data_2AGQ
# 
_entry.id   2AGQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AGQ         
NDB   PD0699       
RCSB  RCSB033873   
WWPDB D_1000033873 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JX4 . unspecified 
PDB 1JXL . unspecified 
# 
_pdbx_database_status.entry_id                        2AGQ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ling, H.' 1 
'Yang, W.' 2 
# 
_citation.id                        primary 
_citation.title                     'Fidelity of Dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            24 
_citation.page_first                2957 
_citation.page_last                 2967 
_citation.year                      2005 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16107880 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600786 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vaisman, A.'  1 
primary 'Ling, H.'     2 
primary 'Woodgate, R.' 3 
primary 'Yang, W.'     4 
# 
_cell.entry_id           2AGQ 
_cell.length_a           98.101 
_cell.length_b           103.009 
_cell.length_c           52.399 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2AGQ 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*(DOC))-3'"         3960.600  1   ?       ? ? ? 
2 polymer     syn "5'-D(*TP*CP*AP*TP*GP*AP*GP*TP*CP*CP*TP*GP*TP*AP*GP*CP*C)-3'" 5178.359  1   ?       ? ? ? 
3 polymer     man 'DNA polymerase IV'                                           39019.523 1   2.7.7.7 ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                 40.078    2   ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                               24.305    1   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
7 water       nat water                                                         18.015    160 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DG)(DA)(DC)(DT)(DOC)' GGCTACAGGACTC B ? 
2 polydeoxyribonucleotide no no  '(DT)(DC)(DA)(DT)(DG)(DA)(DG)(DT)(DC)(DC)(DT)(DG)(DT)(DA)(DG)(DC)(DC)' TCATGAGTCCTGTAGCC C ? 
3 'polypeptide(L)'        no no  
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DC  n 
1 4   DT  n 
1 5   DA  n 
1 6   DC  n 
1 7   DA  n 
1 8   DG  n 
1 9   DG  n 
1 10  DA  n 
1 11  DC  n 
1 12  DT  n 
1 13  DOC n 
2 1   DT  n 
2 2   DC  n 
2 3   DA  n 
2 4   DT  n 
2 5   DG  n 
2 6   DA  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DT  n 
2 14  DA  n 
2 15  DG  n 
2 16  DC  n 
2 17  DC  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   LEU n 
3 5   PHE n 
3 6   VAL n 
3 7   ASP n 
3 8   PHE n 
3 9   ASP n 
3 10  TYR n 
3 11  PHE n 
3 12  TYR n 
3 13  ALA n 
3 14  GLN n 
3 15  VAL n 
3 16  GLU n 
3 17  GLU n 
3 18  VAL n 
3 19  LEU n 
3 20  ASN n 
3 21  PRO n 
3 22  SER n 
3 23  LEU n 
3 24  LYS n 
3 25  GLY n 
3 26  LYS n 
3 27  PRO n 
3 28  VAL n 
3 29  VAL n 
3 30  VAL n 
3 31  CYS n 
3 32  VAL n 
3 33  PHE n 
3 34  SER n 
3 35  GLY n 
3 36  ARG n 
3 37  PHE n 
3 38  GLU n 
3 39  ASP n 
3 40  SER n 
3 41  GLY n 
3 42  ALA n 
3 43  VAL n 
3 44  ALA n 
3 45  THR n 
3 46  ALA n 
3 47  ASN n 
3 48  TYR n 
3 49  GLU n 
3 50  ALA n 
3 51  ARG n 
3 52  LYS n 
3 53  PHE n 
3 54  GLY n 
3 55  VAL n 
3 56  LYS n 
3 57  ALA n 
3 58  GLY n 
3 59  ILE n 
3 60  PRO n 
3 61  ILE n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  LYS n 
3 66  LYS n 
3 67  ILE n 
3 68  LEU n 
3 69  PRO n 
3 70  ASN n 
3 71  ALA n 
3 72  VAL n 
3 73  TYR n 
3 74  LEU n 
3 75  PRO n 
3 76  MET n 
3 77  ARG n 
3 78  LYS n 
3 79  GLU n 
3 80  VAL n 
3 81  TYR n 
3 82  GLN n 
3 83  GLN n 
3 84  VAL n 
3 85  SER n 
3 86  SER n 
3 87  ARG n 
3 88  ILE n 
3 89  MET n 
3 90  ASN n 
3 91  LEU n 
3 92  LEU n 
3 93  ARG n 
3 94  GLU n 
3 95  TYR n 
3 96  SER n 
3 97  GLU n 
3 98  LYS n 
3 99  ILE n 
3 100 GLU n 
3 101 ILE n 
3 102 ALA n 
3 103 SER n 
3 104 ILE n 
3 105 ASP n 
3 106 GLU n 
3 107 ALA n 
3 108 TYR n 
3 109 LEU n 
3 110 ASP n 
3 111 ILE n 
3 112 SER n 
3 113 ASP n 
3 114 LYS n 
3 115 VAL n 
3 116 ARG n 
3 117 ASP n 
3 118 TYR n 
3 119 ARG n 
3 120 GLU n 
3 121 ALA n 
3 122 TYR n 
3 123 ASN n 
3 124 LEU n 
3 125 GLY n 
3 126 LEU n 
3 127 GLU n 
3 128 ILE n 
3 129 LYS n 
3 130 ASN n 
3 131 LYS n 
3 132 ILE n 
3 133 LEU n 
3 134 GLU n 
3 135 LYS n 
3 136 GLU n 
3 137 LYS n 
3 138 ILE n 
3 139 THR n 
3 140 VAL n 
3 141 THR n 
3 142 VAL n 
3 143 GLY n 
3 144 ILE n 
3 145 SER n 
3 146 LYS n 
3 147 ASN n 
3 148 LYS n 
3 149 VAL n 
3 150 PHE n 
3 151 ALA n 
3 152 LYS n 
3 153 ILE n 
3 154 ALA n 
3 155 ALA n 
3 156 ASP n 
3 157 MET n 
3 158 ALA n 
3 159 LYS n 
3 160 PRO n 
3 161 ASN n 
3 162 GLY n 
3 163 ILE n 
3 164 LYS n 
3 165 VAL n 
3 166 ILE n 
3 167 ASP n 
3 168 ASP n 
3 169 GLU n 
3 170 GLU n 
3 171 VAL n 
3 172 LYS n 
3 173 ARG n 
3 174 LEU n 
3 175 ILE n 
3 176 ARG n 
3 177 GLU n 
3 178 LEU n 
3 179 ASP n 
3 180 ILE n 
3 181 ALA n 
3 182 ASP n 
3 183 VAL n 
3 184 PRO n 
3 185 GLY n 
3 186 ILE n 
3 187 GLY n 
3 188 ASN n 
3 189 ILE n 
3 190 THR n 
3 191 ALA n 
3 192 GLU n 
3 193 LYS n 
3 194 LEU n 
3 195 LYS n 
3 196 LYS n 
3 197 LEU n 
3 198 GLY n 
3 199 ILE n 
3 200 ASN n 
3 201 LYS n 
3 202 LEU n 
3 203 VAL n 
3 204 ASP n 
3 205 THR n 
3 206 LEU n 
3 207 SER n 
3 208 ILE n 
3 209 GLU n 
3 210 PHE n 
3 211 ASP n 
3 212 LYS n 
3 213 LEU n 
3 214 LYS n 
3 215 GLY n 
3 216 MET n 
3 217 ILE n 
3 218 GLY n 
3 219 GLU n 
3 220 ALA n 
3 221 LYS n 
3 222 ALA n 
3 223 LYS n 
3 224 TYR n 
3 225 LEU n 
3 226 ILE n 
3 227 SER n 
3 228 LEU n 
3 229 ALA n 
3 230 ARG n 
3 231 ASP n 
3 232 GLU n 
3 233 TYR n 
3 234 ASN n 
3 235 GLU n 
3 236 PRO n 
3 237 ILE n 
3 238 ARG n 
3 239 THR n 
3 240 ARG n 
3 241 VAL n 
3 242 ARG n 
3 243 LYS n 
3 244 SER n 
3 245 ILE n 
3 246 GLY n 
3 247 ARG n 
3 248 ILE n 
3 249 VAL n 
3 250 THR n 
3 251 MET n 
3 252 LYS n 
3 253 ARG n 
3 254 ASN n 
3 255 SER n 
3 256 ARG n 
3 257 ASN n 
3 258 LEU n 
3 259 GLU n 
3 260 GLU n 
3 261 ILE n 
3 262 LYS n 
3 263 PRO n 
3 264 TYR n 
3 265 LEU n 
3 266 PHE n 
3 267 ARG n 
3 268 ALA n 
3 269 ILE n 
3 270 GLU n 
3 271 GLU n 
3 272 SER n 
3 273 TYR n 
3 274 TYR n 
3 275 LYS n 
3 276 LEU n 
3 277 ASP n 
3 278 LYS n 
3 279 ARG n 
3 280 ILE n 
3 281 PRO n 
3 282 LYS n 
3 283 ALA n 
3 284 ILE n 
3 285 HIS n 
3 286 VAL n 
3 287 VAL n 
3 288 ALA n 
3 289 VAL n 
3 290 THR n 
3 291 GLU n 
3 292 ASP n 
3 293 LEU n 
3 294 ASP n 
3 295 ILE n 
3 296 VAL n 
3 297 SER n 
3 298 ARG n 
3 299 GLY n 
3 300 ARG n 
3 301 THR n 
3 302 PHE n 
3 303 PRO n 
3 304 HIS n 
3 305 GLY n 
3 306 ILE n 
3 307 SER n 
3 308 LYS n 
3 309 GLU n 
3 310 THR n 
3 311 ALA n 
3 312 TYR n 
3 313 SER n 
3 314 GLU n 
3 315 SER n 
3 316 VAL n 
3 317 LYS n 
3 318 LEU n 
3 319 LEU n 
3 320 GLN n 
3 321 LYS n 
3 322 ILE n 
3 323 LEU n 
3 324 GLU n 
3 325 GLU n 
3 326 ASP n 
3 327 GLU n 
3 328 ARG n 
3 329 LYS n 
3 330 ILE n 
3 331 ARG n 
3 332 ARG n 
3 333 ILE n 
3 334 GLY n 
3 335 VAL n 
3 336 ARG n 
3 337 PHE n 
3 338 SER n 
3 339 LYS n 
3 340 PHE n 
3 341 ILE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Sulfolobus 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'Chemically synthesized' 
2 1 sample ? ? ? ? ? 'Chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 3 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
1 ? 
2 PDB 2AGQ        2AGQ   1 ? ? ? 
3 PDB 2AGQ        2AGQ   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AGQ A 1 ? 341 ? Q97W02 1 ? 341 ? 1 341 
2 2 2AGQ B 1 ? 13  ? 2AGQ   1 ? 13  ? 1 13  
3 3 2AGQ C 1 ? 17  ? 2AGQ   1 ? 17  ? 1 17  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                            ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2AGQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2004-12-29 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC FOCUSING MIRROR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2AGQ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   30510 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        29.5 
_reflns.pdbx_redundancy              2.44 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   87.6 
_reflns_shell.Rmerge_I_obs           0.406 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.49 
_reflns_shell.pdbx_redundancy        2.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AGQ 
_refine.ls_number_reflns_obs                     30510 
_refine.ls_number_reflns_all                     33308 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               817311.24 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.79 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    91.6 
_refine.ls_R_factor_obs                          0.227 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1438 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               45.1 
_refine.aniso_B[1][1]                            9.93 
_refine.aniso_B[2][2]                            -4.44 
_refine.aniso_B[3][3]                            -5.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.366055 
_refine.solvent_model_param_bsol                 48.6883 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2AGQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2744 
_refine_hist.pdbx_number_atoms_nucleic_acid   606 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             160 
_refine_hist.number_atoms_total               3543 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        26.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.23  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.20  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             4056 
_refine_ls_shell.R_factor_R_work                  0.324 
_refine_ls_shell.percent_reflns_obs               81.8 
_refine_ls_shell.R_factor_R_free                  0.382 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            4.4 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 datp.param        datp.top    'X-RAY DIFFRACTION' 
5 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2AGQ 
_struct.title                     'Fidelity of Dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AGQ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'base stacking, fidelity, metal ion, mismatch, pyrophosphorolysis, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR C 10  ? ASN C 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO C 21  ? LYS C 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN C 47  ? LYS C 52  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO C 60  ? LEU C 68  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG C 77  ? GLU C 94  ? ARG A 77  GLU A 94  1 ? 18 
HELX_P HELX_P6  6  ASP C 117 ? LYS C 137 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  7  ASN C 147 ? LYS C 159 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP C 167 ? LEU C 178 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  ASP C 179 ? VAL C 183 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 10 GLY C 187 ? LYS C 196 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P11 11 LYS C 201 ? SER C 207 ? LYS A 201 SER A 207 5 ? 7  
HELX_P HELX_P12 12 GLU C 209 ? GLY C 218 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 13 GLY C 218 ? ARG C 230 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN C 257 ? ASP C 277 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 15 SER C 307 ? ASP C 326 ? SER A 307 ASP A 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CA  .  CA    ? ? ? 1_555 C PHE 8   O   ? ? A CA  4001 A PHE 8    1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc2  metalc ? ? D CA  .  CA    ? ? ? 1_555 C ASP 105 OD2 ? ? A CA  4001 A ASP 105  1_555 ? ? ? ? ? ? ?            2.158 ? 
metalc3  metalc ? ? D CA  .  CA    ? ? ? 1_555 G DTP .   O1G ? ? A CA  4001 A DTP 1814 1_555 ? ? ? ? ? ? ?            2.659 ? 
metalc4  metalc ? ? D CA  .  CA    ? ? ? 1_555 G DTP .   O2B ? ? A CA  4001 A DTP 1814 1_555 ? ? ? ? ? ? ?            2.563 ? 
metalc5  metalc ? ? D CA  .  CA    ? ? ? 1_555 G DTP .   O3B ? ? A CA  4001 A DTP 1814 1_555 ? ? ? ? ? ? ?            2.835 ? 
metalc6  metalc ? ? D CA  .  CA    ? ? ? 1_555 G DTP .   O1A ? ? A CA  4001 A DTP 1814 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc7  metalc ? ? D CA  .  CA    ? ? ? 1_555 C ASP 7   OD1 ? ? A CA  4001 A ASP 7    1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc8  metalc ? ? E MG  .  MG    ? ? ? 1_555 J HOH .   O   ? ? A MG  4002 A HOH 4004 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc9  metalc ? ? E MG  .  MG    ? ? ? 1_555 J HOH .   O   ? ? A MG  4002 A HOH 4032 1_555 ? ? ? ? ? ? ?            2.081 ? 
metalc10 metalc ? ? E MG  .  MG    ? ? ? 1_555 C ASP 7   OD2 ? ? A MG  4002 A ASP 7    1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc11 metalc ? ? E MG  .  MG    ? ? ? 1_555 A DOC 13  OP1 ? ? A MG  4002 B DOC 13   1_555 ? ? ? ? ? ? ?            2.642 ? 
metalc12 metalc ? ? E MG  .  MG    ? ? ? 1_555 J HOH .   O   ? ? A MG  4002 A HOH 4100 1_555 ? ? ? ? ? ? ?            2.159 ? 
metalc13 metalc ? ? E MG  .  MG    ? ? ? 1_555 C GLU 106 OE2 ? ? A MG  4002 A GLU 106  1_555 ? ? ? ? ? ? ?            2.100 ? 
metalc14 metalc ? ? F CA  .  CA    ? ? ? 1_555 H HOH .   O   ? ? A CA  4003 B HOH 28   1_555 ? ? ? ? ? ? ?            2.587 ? 
metalc15 metalc ? ? F CA  .  CA    ? ? ? 1_555 C ILE 186 O   ? ? A CA  4003 A ILE 186  1_555 ? ? ? ? ? ? ?            2.510 ? 
metalc16 metalc ? ? F CA  .  CA    ? ? ? 1_555 C ALA 181 O   ? ? A CA  4003 A ALA 181  1_555 ? ? ? ? ? ? ?            2.311 ? 
covale1  covale ? ? A DT  12 "O3'" ? ? ? 1_555 A DOC 13  P   ? ? B DT  12   B DOC 13   1_555 ? ? ? ? ? ? ?            1.608 ? 
hydrog1  hydrog ? ? A DG  1  N1    ? ? ? 1_555 B DC  17  N3  ? ? B DG  1    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1  N2    ? ? ? 1_555 B DC  17  O2  ? ? B DG  1    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1  O6    ? ? ? 1_555 B DC  17  N4  ? ? B DG  1    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  2  N1    ? ? ? 1_555 B DC  16  N3  ? ? B DG  2    C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  2  N2    ? ? ? 1_555 B DC  16  O2  ? ? B DG  2    C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  2  O6    ? ? ? 1_555 B DC  16  N4  ? ? B DG  2    C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  15  N1  ? ? B DC  3    C DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  15  O6  ? ? B DC  3    C DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  15  N2  ? ? B DC  3    C DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  14  N1  ? ? B DT  4    C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  14  N6  ? ? B DT  4    C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA  5  N1    ? ? ? 1_555 B DT  13  N3  ? ? B DA  5    C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  5  N6    ? ? ? 1_555 B DT  13  O4  ? ? B DA  5    C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  6  N3    ? ? ? 1_555 B DG  12  N1  ? ? B DC  6    C DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  6  N4    ? ? ? 1_555 B DG  12  O6  ? ? B DC  6    C DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  6  O2    ? ? ? 1_555 B DG  12  N2  ? ? B DC  6    C DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA  7  N1    ? ? ? 1_555 B DT  11  N3  ? ? B DA  7    C DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA  7  N6    ? ? ? 1_555 B DT  11  O4  ? ? B DA  7    C DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  10  N3  ? ? B DG  8    C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  10  O2  ? ? B DG  8    C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  10  N4  ? ? B DG  8    C DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  9  N1    ? ? ? 1_555 B DC  9   N3  ? ? B DG  9    C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  9  N2    ? ? ? 1_555 B DC  9   O2  ? ? B DG  9    C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG  9  O6    ? ? ? 1_555 B DC  9   N4  ? ? B DG  9    C DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA  10 N1    ? ? ? 1_555 B DT  8   N3  ? ? B DA  10   C DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA  10 N6    ? ? ? 1_555 B DT  8   O4  ? ? B DA  10   C DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC  11 N3    ? ? ? 1_555 B DG  7   N1  ? ? B DC  11   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC  11 N4    ? ? ? 1_555 B DG  7   O6  ? ? B DC  11   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC  11 O2    ? ? ? 1_555 B DG  7   N2  ? ? B DC  11   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT  12 N3    ? ? ? 1_555 B DA  6   N1  ? ? B DT  12   C DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DT  12 O4    ? ? ? 1_555 B DA  6   N6  ? ? B DT  12   C DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DOC 13 N3    ? ? ? 1_555 B DG  5   N1  ? ? B DOC 13   C DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DOC 13 N4    ? ? ? 1_555 B DG  5   O6  ? ? B DOC 13   C DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DOC 13 O2    ? ? ? 1_555 B DG  5   N2  ? ? B DOC 13   C DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 99  ? SER C 103 ? ILE A 99  SER A 103 
A 2 GLU C 106 ? ASP C 110 ? GLU A 106 ASP A 110 
A 3 VAL C 3   ? PHE C 8   ? VAL A 3   PHE A 8   
A 4 VAL C 140 ? SER C 145 ? VAL A 140 SER A 145 
A 5 ILE C 163 ? VAL C 165 ? ILE A 163 VAL A 165 
B 1 GLY C 41  ? ALA C 46  ? GLY A 41  ALA A 46  
B 2 VAL C 28  ? PHE C 33  ? VAL A 28  PHE A 33  
B 3 VAL C 72  ? PRO C 75  ? VAL A 72  PRO A 75  
C 1 SER C 244 ? SER C 255 ? SER A 244 SER A 255 
C 2 ILE C 330 ? PHE C 340 ? ILE A 330 PHE A 340 
C 3 PRO C 281 ? THR C 290 ? PRO A 281 THR A 290 
C 4 ILE C 295 ? THR C 301 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 100 ? N GLU A 100 O TYR C 108 ? O TYR A 108 
A 2 3 O ALA C 107 ? O ALA A 107 N VAL C 6   ? N VAL A 6   
A 3 4 N PHE C 5   ? N PHE A 5   O GLY C 143 ? O GLY A 143 
A 4 5 N ILE C 144 ? N ILE A 144 O LYS C 164 ? O LYS A 164 
B 1 2 O ALA C 42  ? O ALA A 42  N VAL C 32  ? N VAL A 32  
B 2 3 N CYS C 31  ? N CYS A 31  O LEU C 74  ? O LEU A 74  
C 1 2 N ILE C 245 ? N ILE A 245 O PHE C 337 ? O PHE A 337 
C 2 3 O ARG C 331 ? O ARG A 331 N VAL C 289 ? N VAL A 289 
C 3 4 N VAL C 286 ? N VAL A 286 O ARG C 298 ? O ARG A 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 4001'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 4002'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 4003'  
AC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DTP A 1814' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP C 7   ? ASP A 7    . ? 1_555 ? 
2  AC1 4  PHE C 8   ? PHE A 8    . ? 1_555 ? 
3  AC1 4  ASP C 105 ? ASP A 105  . ? 1_555 ? 
4  AC1 4  DTP G .   ? DTP A 1814 . ? 1_555 ? 
5  AC2 6  ASP C 7   ? ASP A 7    . ? 1_555 ? 
6  AC2 6  GLU C 106 ? GLU A 106  . ? 1_555 ? 
7  AC2 6  HOH J .   ? HOH A 4004 . ? 1_555 ? 
8  AC2 6  HOH J .   ? HOH A 4032 . ? 1_555 ? 
9  AC2 6  HOH J .   ? HOH A 4100 . ? 1_555 ? 
10 AC2 6  DOC A 13  ? DOC B 13   . ? 1_555 ? 
11 AC3 3  ALA C 181 ? ALA A 181  . ? 1_555 ? 
12 AC3 3  ILE C 186 ? ILE A 186  . ? 1_555 ? 
13 AC3 3  HOH H .   ? HOH B 28   . ? 1_555 ? 
14 AC4 21 ASP C 7   ? ASP A 7    . ? 1_555 ? 
15 AC4 21 PHE C 8   ? PHE A 8    . ? 1_555 ? 
16 AC4 21 ASP C 9   ? ASP A 9    . ? 1_555 ? 
17 AC4 21 TYR C 10  ? TYR A 10   . ? 1_555 ? 
18 AC4 21 PHE C 11  ? PHE A 11   . ? 1_555 ? 
19 AC4 21 TYR C 12  ? TYR A 12   . ? 1_555 ? 
20 AC4 21 ALA C 44  ? ALA A 44   . ? 1_555 ? 
21 AC4 21 THR C 45  ? THR A 45   . ? 1_555 ? 
22 AC4 21 TYR C 48  ? TYR A 48   . ? 1_555 ? 
23 AC4 21 ARG C 51  ? ARG A 51   . ? 1_555 ? 
24 AC4 21 ASP C 105 ? ASP A 105  . ? 1_555 ? 
25 AC4 21 LYS C 159 ? LYS A 159  . ? 1_555 ? 
26 AC4 21 CA  D .   ? CA  A 4001 . ? 1_555 ? 
27 AC4 21 HOH J .   ? HOH A 4004 . ? 1_555 ? 
28 AC4 21 HOH J .   ? HOH A 4007 . ? 1_555 ? 
29 AC4 21 HOH J .   ? HOH A 4030 . ? 1_555 ? 
30 AC4 21 HOH J .   ? HOH A 4039 . ? 1_555 ? 
31 AC4 21 HOH J .   ? HOH A 4100 . ? 1_555 ? 
32 AC4 21 DOC A 13  ? DOC B 13   . ? 1_555 ? 
33 AC4 21 DT  B 4   ? DT  C 4    . ? 1_555 ? 
34 AC4 21 DG  B 5   ? DG  C 5    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AGQ 
_database_PDB_matrix.origx[1][1]       1.00000 
_database_PDB_matrix.origx[1][2]       0.00000 
_database_PDB_matrix.origx[1][3]       0.00000 
_database_PDB_matrix.origx[2][1]       0.00000 
_database_PDB_matrix.origx[2][2]       1.00000 
_database_PDB_matrix.origx[2][3]       0.00000 
_database_PDB_matrix.origx[3][1]       0.00000 
_database_PDB_matrix.origx[3][2]       0.00000 
_database_PDB_matrix.origx[3][3]       1.00000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AGQ 
_atom_sites.fract_transf_matrix[1][1]   0.010194 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009708 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019084 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 30.013  47.944 32.091  1.00 55.88  ? 1    DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 29.424  47.841 33.392  1.00 52.12  ? 1    DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 29.911  46.581 34.067  1.00 51.74  ? 1    DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 29.166  46.366 35.289  1.00 47.81  ? 1    DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 29.723  45.318 33.226  1.00 51.46  ? 1    DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 30.862  44.465 33.385  1.00 55.00  ? 1    DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 28.464  44.691 33.801  1.00 49.31  ? 1    DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 28.531  45.098 35.265  1.00 47.95  ? 1    DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 27.245  45.235 35.946  1.00 45.84  ? 1    DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 26.173  46.004 35.557  1.00 43.93  ? 1    DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 25.176  45.961 36.400  1.00 43.13  ? 1    DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 25.612  45.108 37.404  1.00 43.01  ? 1    DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 24.970  44.692 38.601  1.00 43.28  ? 1    DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 23.851  45.017 39.035  1.00 40.82  ? 1    DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 25.770  43.815 39.330  1.00 42.89  ? 1    DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 27.023  43.395 38.958  1.00 43.29  ? 1    DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 27.626  42.532 39.787  1.00 43.82  ? 1    DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 27.637  43.787 37.854  1.00 44.42  ? 1    DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 26.881  44.637 37.130  1.00 43.51  ? 1    DG  B C4    1 
ATOM   20   P  P     . DG  A 1 2   ? 30.989  43.134 32.499  1.00 57.73  ? 2    DG  B P     1 
ATOM   21   O  OP1   . DG  A 1 2   ? 32.430  42.815 32.316  1.00 58.08  ? 2    DG  B OP1   1 
ATOM   22   O  OP2   . DG  A 1 2   ? 30.115  43.312 31.306  1.00 58.68  ? 2    DG  B OP2   1 
ATOM   23   O  "O5'" . DG  A 1 2   ? 30.348  42.016 33.430  1.00 55.63  ? 2    DG  B "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1 2   ? 31.012  41.602 34.615  1.00 57.66  ? 2    DG  B "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1 2   ? 30.223  40.507 35.289  1.00 58.89  ? 2    DG  B "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1 2   ? 28.993  41.036 35.841  1.00 59.60  ? 2    DG  B "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1 2   ? 29.801  39.381 34.347  1.00 60.95  ? 2    DG  B "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1 2   ? 29.779  38.172 35.098  1.00 63.84  ? 2    DG  B "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1 2   ? 28.373  39.756 33.999  1.00 59.43  ? 2    DG  B "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1 2   ? 27.913  40.263 35.347  1.00 56.80  ? 2    DG  B "C1'" 1 
ATOM   31   N  N9    . DG  A 1 2   ? 26.706  41.082 35.361  1.00 53.20  ? 2    DG  B N9    1 
ATOM   32   C  C8    . DG  A 1 2   ? 26.245  41.935 34.384  1.00 52.24  ? 2    DG  B C8    1 
ATOM   33   N  N7    . DG  A 1 2   ? 25.110  42.506 34.699  1.00 50.83  ? 2    DG  B N7    1 
ATOM   34   C  C5    . DG  A 1 2   ? 24.810  42.004 35.961  1.00 49.62  ? 2    DG  B C5    1 
ATOM   35   C  C6    . DG  A 1 2   ? 23.698  42.252 36.821  1.00 48.76  ? 2    DG  B C6    1 
ATOM   36   O  O6    . DG  A 1 2   ? 22.725  42.998 36.639  1.00 48.25  ? 2    DG  B O6    1 
ATOM   37   N  N1    . DG  A 1 2   ? 23.793  41.519 37.999  1.00 46.26  ? 2    DG  B N1    1 
ATOM   38   C  C2    . DG  A 1 2   ? 24.818  40.659 38.318  1.00 46.65  ? 2    DG  B C2    1 
ATOM   39   N  N2    . DG  A 1 2   ? 24.719  40.033 39.504  1.00 43.87  ? 2    DG  B N2    1 
ATOM   40   N  N3    . DG  A 1 2   ? 25.857  40.427 37.535  1.00 47.24  ? 2    DG  B N3    1 
ATOM   41   C  C4    . DG  A 1 2   ? 25.788  41.125 36.382  1.00 50.32  ? 2    DG  B C4    1 
ATOM   42   P  P     . DC  A 1 3   ? 30.321  36.809 34.447  1.00 66.62  ? 3    DC  B P     1 
ATOM   43   O  OP1   . DC  A 1 3   ? 31.800  36.796 34.562  1.00 64.22  ? 3    DC  B OP1   1 
ATOM   44   O  OP2   . DC  A 1 3   ? 29.681  36.647 33.107  1.00 64.09  ? 3    DC  B OP2   1 
ATOM   45   O  "O5'" . DC  A 1 3   ? 29.739  35.717 35.448  1.00 64.53  ? 3    DC  B "O5'" 1 
ATOM   46   C  "C5'" . DC  A 1 3   ? 29.914  35.866 36.855  1.00 63.76  ? 3    DC  B "C5'" 1 
ATOM   47   C  "C4'" . DC  A 1 3   ? 28.683  35.394 37.595  1.00 64.03  ? 3    DC  B "C4'" 1 
ATOM   48   O  "O4'" . DC  A 1 3   ? 27.646  36.412 37.600  1.00 62.20  ? 3    DC  B "O4'" 1 
ATOM   49   C  "C3'" . DC  A 1 3   ? 28.045  34.129 37.014  1.00 64.13  ? 3    DC  B "C3'" 1 
ATOM   50   O  "O3'" . DC  A 1 3   ? 27.795  33.157 38.024  1.00 64.84  ? 3    DC  B "O3'" 1 
ATOM   51   C  "C2'" . DC  A 1 3   ? 26.720  34.607 36.444  1.00 62.59  ? 3    DC  B "C2'" 1 
ATOM   52   C  "C1'" . DC  A 1 3   ? 26.395  35.808 37.310  1.00 60.54  ? 3    DC  B "C1'" 1 
ATOM   53   N  N1    . DC  A 1 3   ? 25.540  36.802 36.647  1.00 56.39  ? 3    DC  B N1    1 
ATOM   54   C  C2    . DC  A 1 3   ? 24.341  37.187 37.265  1.00 56.24  ? 3    DC  B C2    1 
ATOM   55   O  O2    . DC  A 1 3   ? 24.040  36.685 38.362  1.00 53.94  ? 3    DC  B O2    1 
ATOM   56   N  N3    . DC  A 1 3   ? 23.541  38.091 36.649  1.00 54.36  ? 3    DC  B N3    1 
ATOM   57   C  C4    . DC  A 1 3   ? 23.899  38.597 35.466  1.00 54.05  ? 3    DC  B C4    1 
ATOM   58   N  N4    . DC  A 1 3   ? 23.081  39.477 34.886  1.00 51.83  ? 3    DC  B N4    1 
ATOM   59   C  C5    . DC  A 1 3   ? 25.115  38.223 34.822  1.00 54.12  ? 3    DC  B C5    1 
ATOM   60   C  C6    . DC  A 1 3   ? 25.898  37.336 35.443  1.00 55.14  ? 3    DC  B C6    1 
ATOM   61   P  P     . DT  A 1 4   ? 27.294  31.697 37.591  1.00 66.74  ? 4    DT  B P     1 
ATOM   62   O  OP1   . DT  A 1 4   ? 27.853  30.715 38.556  1.00 66.09  ? 4    DT  B OP1   1 
ATOM   63   O  OP2   . DT  A 1 4   ? 27.560  31.543 36.137  1.00 63.52  ? 4    DT  B OP2   1 
ATOM   64   O  "O5'" . DT  A 1 4   ? 25.718  31.772 37.779  1.00 63.89  ? 4    DT  B "O5'" 1 
ATOM   65   C  "C5'" . DT  A 1 4   ? 25.152  31.896 39.077  1.00 61.54  ? 4    DT  B "C5'" 1 
ATOM   66   C  "C4'" . DT  A 1 4   ? 23.655  31.741 38.998  1.00 59.26  ? 4    DT  B "C4'" 1 
ATOM   67   O  "O4'" . DT  A 1 4   ? 23.088  32.944 38.416  1.00 57.11  ? 4    DT  B "O4'" 1 
ATOM   68   C  "C3'" . DT  A 1 4   ? 23.236  30.576 38.099  1.00 59.15  ? 4    DT  B "C3'" 1 
ATOM   69   O  "O3'" . DT  A 1 4   ? 22.226  29.765 38.698  1.00 59.34  ? 4    DT  B "O3'" 1 
ATOM   70   C  "C2'" . DT  A 1 4   ? 22.718  31.246 36.841  1.00 57.44  ? 4    DT  B "C2'" 1 
ATOM   71   C  "C1'" . DT  A 1 4   ? 22.247  32.606 37.329  1.00 56.01  ? 4    DT  B "C1'" 1 
ATOM   72   N  N1    . DT  A 1 4   ? 22.383  33.644 36.299  1.00 53.36  ? 4    DT  B N1    1 
ATOM   73   C  C2    . DT  A 1 4   ? 21.389  34.593 36.144  1.00 52.75  ? 4    DT  B C2    1 
ATOM   74   O  O2    . DT  A 1 4   ? 20.398  34.649 36.858  1.00 51.91  ? 4    DT  B O2    1 
ATOM   75   N  N3    . DT  A 1 4   ? 21.602  35.477 35.112  1.00 50.79  ? 4    DT  B N3    1 
ATOM   76   C  C4    . DT  A 1 4   ? 22.683  35.506 34.248  1.00 50.62  ? 4    DT  B C4    1 
ATOM   77   O  O4    . DT  A 1 4   ? 22.730  36.349 33.353  1.00 48.65  ? 4    DT  B O4    1 
ATOM   78   C  C5    . DT  A 1 4   ? 23.694  34.492 34.489  1.00 51.76  ? 4    DT  B C5    1 
ATOM   79   C  C7    . DT  A 1 4   ? 24.910  34.444 33.618  1.00 50.55  ? 4    DT  B C7    1 
ATOM   80   C  C6    . DT  A 1 4   ? 23.494  33.633 35.490  1.00 52.83  ? 4    DT  B C6    1 
ATOM   81   P  P     . DA  A 1 5   ? 21.777  28.400 37.971  1.00 60.50  ? 5    DA  B P     1 
ATOM   82   O  OP1   . DA  A 1 5   ? 21.817  27.294 38.959  1.00 60.06  ? 5    DA  B OP1   1 
ATOM   83   O  OP2   . DA  A 1 5   ? 22.527  28.276 36.690  1.00 58.91  ? 5    DA  B OP2   1 
ATOM   84   O  "O5'" . DA  A 1 5   ? 20.258  28.675 37.601  1.00 57.87  ? 5    DA  B "O5'" 1 
ATOM   85   C  "C5'" . DA  A 1 5   ? 19.362  29.174 38.585  1.00 56.23  ? 5    DA  B "C5'" 1 
ATOM   86   C  "C4'" . DA  A 1 5   ? 18.015  29.444 37.961  1.00 55.51  ? 5    DA  B "C4'" 1 
ATOM   87   O  "O4'" . DA  A 1 5   ? 18.073  30.614 37.113  1.00 54.77  ? 5    DA  B "O4'" 1 
ATOM   88   C  "C3'" . DA  A 1 5   ? 17.527  28.304 37.079  1.00 55.50  ? 5    DA  B "C3'" 1 
ATOM   89   O  "O3'" . DA  A 1 5   ? 16.130  28.150 37.283  1.00 56.08  ? 5    DA  B "O3'" 1 
ATOM   90   C  "C2'" . DA  A 1 5   ? 17.880  28.762 35.672  1.00 54.36  ? 5    DA  B "C2'" 1 
ATOM   91   C  "C1'" . DA  A 1 5   ? 17.811  30.281 35.760  1.00 52.30  ? 5    DA  B "C1'" 1 
ATOM   92   N  N9    . DA  A 1 5   ? 18.789  30.994 34.929  1.00 50.72  ? 5    DA  B N9    1 
ATOM   93   C  C8    . DA  A 1 5   ? 20.088  30.636 34.655  1.00 48.29  ? 5    DA  B C8    1 
ATOM   94   N  N7    . DA  A 1 5   ? 20.714  31.478 33.868  1.00 48.48  ? 5    DA  B N7    1 
ATOM   95   C  C5    . DA  A 1 5   ? 19.765  32.456 33.601  1.00 48.25  ? 5    DA  B C5    1 
ATOM   96   C  C6    . DA  A 1 5   ? 19.802  33.626 32.812  1.00 47.28  ? 5    DA  B C6    1 
ATOM   97   N  N6    . DA  A 1 5   ? 20.872  34.019 32.117  1.00 47.99  ? 5    DA  B N6    1 
ATOM   98   N  N1    . DA  A 1 5   ? 18.686  34.384 32.760  1.00 46.32  ? 5    DA  B N1    1 
ATOM   99   C  C2    . DA  A 1 5   ? 17.613  33.988 33.452  1.00 46.09  ? 5    DA  B C2    1 
ATOM   100  N  N3    . DA  A 1 5   ? 17.454  32.911 34.224  1.00 47.47  ? 5    DA  B N3    1 
ATOM   101  C  C4    . DA  A 1 5   ? 18.579  32.177 34.254  1.00 48.20  ? 5    DA  B C4    1 
ATOM   102  P  P     . DC  A 1 6   ? 15.348  26.953 36.570  1.00 58.51  ? 6    DC  B P     1 
ATOM   103  O  OP1   . DC  A 1 6   ? 14.377  26.415 37.558  1.00 56.73  ? 6    DC  B OP1   1 
ATOM   104  O  OP2   . DC  A 1 6   ? 16.340  26.036 35.939  1.00 58.87  ? 6    DC  B OP2   1 
ATOM   105  O  "O5'" . DC  A 1 6   ? 14.570  27.724 35.415  1.00 56.48  ? 6    DC  B "O5'" 1 
ATOM   106  C  "C5'" . DC  A 1 6   ? 13.884  28.936 35.709  1.00 52.67  ? 6    DC  B "C5'" 1 
ATOM   107  C  "C4'" . DC  A 1 6   ? 13.390  29.573 34.437  1.00 49.81  ? 6    DC  B "C4'" 1 
ATOM   108  O  "O4'" . DC  A 1 6   ? 14.486  30.286 33.826  1.00 47.82  ? 6    DC  B "O4'" 1 
ATOM   109  C  "C3'" . DC  A 1 6   ? 12.863  28.598 33.382  1.00 47.59  ? 6    DC  B "C3'" 1 
ATOM   110  O  "O3'" . DC  A 1 6   ? 11.649  29.107 32.830  1.00 47.11  ? 6    DC  B "O3'" 1 
ATOM   111  C  "C2'" . DC  A 1 6   ? 13.965  28.587 32.334  1.00 47.07  ? 6    DC  B "C2'" 1 
ATOM   112  C  "C1'" . DC  A 1 6   ? 14.519  29.995 32.449  1.00 46.95  ? 6    DC  B "C1'" 1 
ATOM   113  N  N1    . DC  A 1 6   ? 15.901  30.191 31.988  1.00 45.96  ? 6    DC  B N1    1 
ATOM   114  C  C2    . DC  A 1 6   ? 16.197  31.306 31.187  1.00 45.94  ? 6    DC  B C2    1 
ATOM   115  O  O2    . DC  A 1 6   ? 15.279  32.079 30.863  1.00 46.21  ? 6    DC  B O2    1 
ATOM   116  N  N3    . DC  A 1 6   ? 17.469  31.514 30.785  1.00 43.51  ? 6    DC  B N3    1 
ATOM   117  C  C4    . DC  A 1 6   ? 18.428  30.664 31.148  1.00 44.29  ? 6    DC  B C4    1 
ATOM   118  N  N4    . DC  A 1 6   ? 19.677  30.927 30.751  1.00 43.12  ? 6    DC  B N4    1 
ATOM   119  C  C5    . DC  A 1 6   ? 18.153  29.509 31.944  1.00 45.01  ? 6    DC  B C5    1 
ATOM   120  C  C6    . DC  A 1 6   ? 16.889  29.313 32.338  1.00 46.38  ? 6    DC  B C6    1 
ATOM   121  P  P     . DA  A 1 7   ? 10.674  28.136 31.990  1.00 49.18  ? 7    DA  B P     1 
ATOM   122  O  OP1   . DA  A 1 7   ? 9.288   28.299 32.503  1.00 48.33  ? 7    DA  B OP1   1 
ATOM   123  O  OP2   . DA  A 1 7   ? 11.286  26.781 31.941  1.00 48.69  ? 7    DA  B OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7   ? 10.714  28.766 30.529  1.00 46.23  ? 7    DA  B "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7   ? 10.296  30.111 30.325  1.00 46.70  ? 7    DA  B "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7   ? 10.638  30.564 28.928  1.00 45.63  ? 7    DA  B "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7   ? 12.067  30.755 28.793  1.00 46.14  ? 7    DA  B "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7   ? 10.228  29.593 27.823  1.00 46.15  ? 7    DA  B "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7   ? 9.720   30.351 26.730  1.00 47.55  ? 7    DA  B "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7   ? 11.536  28.921 27.440  1.00 44.62  ? 7    DA  B "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7   ? 12.548  30.034 27.672  1.00 45.09  ? 7    DA  B "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7   ? 13.905  29.581 27.987  1.00 44.59  ? 7    DA  B N9    1 
ATOM   133  C  C8    . DA  A 1 7   ? 14.264  28.514 28.767  1.00 42.12  ? 7    DA  B C8    1 
ATOM   134  N  N7    . DA  A 1 7   ? 15.559  28.344 28.865  1.00 42.19  ? 7    DA  B N7    1 
ATOM   135  C  C5    . DA  A 1 7   ? 16.092  29.373 28.100  1.00 42.05  ? 7    DA  B C5    1 
ATOM   136  C  C6    . DA  A 1 7   ? 17.416  29.743 27.804  1.00 40.03  ? 7    DA  B C6    1 
ATOM   137  N  N6    . DA  A 1 7   ? 18.483  29.086 28.261  1.00 39.30  ? 7    DA  B N6    1 
ATOM   138  N  N1    . DA  A 1 7   ? 17.608  30.824 27.014  1.00 40.67  ? 7    DA  B N1    1 
ATOM   139  C  C2    . DA  A 1 7   ? 16.535  31.477 26.559  1.00 39.55  ? 7    DA  B C2    1 
ATOM   140  N  N3    . DA  A 1 7   ? 15.241  31.224 26.767  1.00 42.76  ? 7    DA  B N3    1 
ATOM   141  C  C4    . DA  A 1 7   ? 15.086  30.145 27.554  1.00 42.72  ? 7    DA  B C4    1 
ATOM   142  P  P     . DG  A 1 8   ? 8.850   29.637 25.591  1.00 47.66  ? 8    DG  B P     1 
ATOM   143  O  OP1   . DG  A 1 8   ? 7.497   30.233 25.631  1.00 46.69  ? 8    DG  B OP1   1 
ATOM   144  O  OP2   . DG  A 1 8   ? 9.012   28.166 25.686  1.00 49.02  ? 8    DG  B OP2   1 
ATOM   145  O  "O5'" . DG  A 1 8   ? 9.564   30.147 24.268  1.00 48.66  ? 8    DG  B "O5'" 1 
ATOM   146  C  "C5'" . DG  A 1 8   ? 9.895   31.522 24.148  1.00 49.29  ? 8    DG  B "C5'" 1 
ATOM   147  C  "C4'" . DG  A 1 8   ? 11.108  31.705 23.268  1.00 51.41  ? 8    DG  B "C4'" 1 
ATOM   148  O  "O4'" . DG  A 1 8   ? 12.327  31.257 23.917  1.00 49.76  ? 8    DG  B "O4'" 1 
ATOM   149  C  "C3'" . DG  A 1 8   ? 11.053  30.996 21.915  1.00 52.10  ? 8    DG  B "C3'" 1 
ATOM   150  O  "O3'" . DG  A 1 8   ? 11.438  31.932 20.912  1.00 54.78  ? 8    DG  B "O3'" 1 
ATOM   151  C  "C2'" . DG  A 1 8   ? 12.100  29.899 22.041  1.00 49.82  ? 8    DG  B "C2'" 1 
ATOM   152  C  "C1'" . DG  A 1 8   ? 13.110  30.550 22.967  1.00 47.56  ? 8    DG  B "C1'" 1 
ATOM   153  N  N9    . DG  A 1 8   ? 13.996  29.636 23.685  1.00 44.75  ? 8    DG  B N9    1 
ATOM   154  C  C8    . DG  A 1 8   ? 13.638  28.597 24.513  1.00 43.72  ? 8    DG  B C8    1 
ATOM   155  N  N7    . DG  A 1 8   ? 14.666  27.954 25.003  1.00 41.61  ? 8    DG  B N7    1 
ATOM   156  C  C5    . DG  A 1 8   ? 15.768  28.605 24.463  1.00 40.58  ? 8    DG  B C5    1 
ATOM   157  C  C6    . DG  A 1 8   ? 17.150  28.353 24.623  1.00 38.68  ? 8    DG  B C6    1 
ATOM   158  O  O6    . DG  A 1 8   ? 17.693  27.475 25.292  1.00 36.80  ? 8    DG  B O6    1 
ATOM   159  N  N1    . DG  A 1 8   ? 17.927  29.256 23.902  1.00 38.55  ? 8    DG  B N1    1 
ATOM   160  C  C2    . DG  A 1 8   ? 17.434  30.279 23.130  1.00 39.75  ? 8    DG  B C2    1 
ATOM   161  N  N2    . DG  A 1 8   ? 18.345  31.070 22.528  1.00 36.90  ? 8    DG  B N2    1 
ATOM   162  N  N3    . DG  A 1 8   ? 16.142  30.518 22.964  1.00 40.08  ? 8    DG  B N3    1 
ATOM   163  C  C4    . DG  A 1 8   ? 15.373  29.650 23.654  1.00 41.79  ? 8    DG  B C4    1 
ATOM   164  P  P     . DG  A 1 9   ? 11.382  31.516 19.370  1.00 56.42  ? 9    DG  B P     1 
ATOM   165  O  OP1   . DG  A 1 9   ? 10.732  32.637 18.643  1.00 55.97  ? 9    DG  B OP1   1 
ATOM   166  O  OP2   . DG  A 1 9   ? 10.821  30.141 19.264  1.00 57.24  ? 9    DG  B OP2   1 
ATOM   167  O  "O5'" . DG  A 1 9   ? 12.920  31.458 18.974  1.00 55.92  ? 9    DG  B "O5'" 1 
ATOM   168  C  "C5'" . DG  A 1 9   ? 13.769  32.572 19.238  1.00 57.95  ? 9    DG  B "C5'" 1 
ATOM   169  C  "C4'" . DG  A 1 9   ? 15.115  32.354 18.594  1.00 56.47  ? 9    DG  B "C4'" 1 
ATOM   170  O  "O4'" . DG  A 1 9   ? 15.908  31.448 19.402  1.00 55.42  ? 9    DG  B "O4'" 1 
ATOM   171  C  "C3'" . DG  A 1 9   ? 14.997  31.712 17.214  1.00 57.32  ? 9    DG  B "C3'" 1 
ATOM   172  O  "O3'" . DG  A 1 9   ? 15.931  32.304 16.306  1.00 57.73  ? 9    DG  B "O3'" 1 
ATOM   173  C  "C2'" . DG  A 1 9   ? 15.305  30.246 17.481  1.00 55.50  ? 9    DG  B "C2'" 1 
ATOM   174  C  "C1'" . DG  A 1 9   ? 16.306  30.329 18.623  1.00 53.60  ? 9    DG  B "C1'" 1 
ATOM   175  N  N9    . DG  A 1 9   ? 16.351  29.167 19.505  1.00 50.33  ? 9    DG  B N9    1 
ATOM   176  C  C8    . DG  A 1 9   ? 15.286  28.458 20.000  1.00 48.61  ? 9    DG  B C8    1 
ATOM   177  N  N7    . DG  A 1 9   ? 15.642  27.480 20.786  1.00 47.89  ? 9    DG  B N7    1 
ATOM   178  C  C5    . DG  A 1 9   ? 17.028  27.544 20.808  1.00 46.94  ? 9    DG  B C5    1 
ATOM   179  C  C6    . DG  A 1 9   ? 17.975  26.742 21.499  1.00 44.94  ? 9    DG  B C6    1 
ATOM   180  O  O6    . DG  A 1 9   ? 17.769  25.800 22.264  1.00 42.88  ? 9    DG  B O6    1 
ATOM   181  N  N1    . DG  A 1 9   ? 19.279  27.145 21.236  1.00 44.91  ? 9    DG  B N1    1 
ATOM   182  C  C2    . DG  A 1 9   ? 19.630  28.198 20.425  1.00 46.95  ? 9    DG  B C2    1 
ATOM   183  N  N2    . DG  A 1 9   ? 20.945  28.440 20.303  1.00 45.54  ? 9    DG  B N2    1 
ATOM   184  N  N3    . DG  A 1 9   ? 18.754  28.960 19.781  1.00 46.90  ? 9    DG  B N3    1 
ATOM   185  C  C4    . DG  A 1 9   ? 17.482  28.576 20.017  1.00 47.98  ? 9    DG  B C4    1 
ATOM   186  P  P     . DA  A 1 10  ? 15.899  31.885 14.758  1.00 59.77  ? 10   DA  B P     1 
ATOM   187  O  OP1   . DA  A 1 10  ? 16.210  33.081 13.939  1.00 58.47  ? 10   DA  B OP1   1 
ATOM   188  O  OP2   . DA  A 1 10  ? 14.640  31.119 14.519  1.00 59.62  ? 10   DA  B OP2   1 
ATOM   189  O  "O5'" . DA  A 1 10  ? 17.123  30.878 14.638  1.00 56.13  ? 10   DA  B "O5'" 1 
ATOM   190  C  "C5'" . DA  A 1 10  ? 18.395  31.259 15.132  1.00 49.82  ? 10   DA  B "C5'" 1 
ATOM   191  C  "C4'" . DA  A 1 10  ? 19.378  30.130 14.966  1.00 46.25  ? 10   DA  B "C4'" 1 
ATOM   192  O  "O4'" . DA  A 1 10  ? 19.250  29.185 16.059  1.00 42.60  ? 10   DA  B "O4'" 1 
ATOM   193  C  "C3'" . DA  A 1 10  ? 19.215  29.337 13.669  1.00 44.63  ? 10   DA  B "C3'" 1 
ATOM   194  O  "O3'" . DA  A 1 10  ? 20.438  29.358 12.936  1.00 42.17  ? 10   DA  B "O3'" 1 
ATOM   195  C  "C2'" . DA  A 1 10  ? 18.832  27.936 14.132  1.00 43.13  ? 10   DA  B "C2'" 1 
ATOM   196  C  "C1'" . DA  A 1 10  ? 19.364  27.869 15.560  1.00 43.22  ? 10   DA  B "C1'" 1 
ATOM   197  N  N9    . DA  A 1 10  ? 18.637  26.973 16.471  1.00 42.41  ? 10   DA  B N9    1 
ATOM   198  C  C8    . DA  A 1 10  ? 17.279  26.795 16.565  1.00 41.16  ? 10   DA  B C8    1 
ATOM   199  N  N7    . DA  A 1 10  ? 16.921  25.919 17.473  1.00 40.78  ? 10   DA  B N7    1 
ATOM   200  C  C5    . DA  A 1 10  ? 18.123  25.486 18.017  1.00 38.99  ? 10   DA  B C5    1 
ATOM   201  C  C6    . DA  A 1 10  ? 18.432  24.553 19.041  1.00 38.92  ? 10   DA  B C6    1 
ATOM   202  N  N6    . DA  A 1 10  ? 17.519  23.851 19.723  1.00 32.51  ? 10   DA  B N6    1 
ATOM   203  N  N1    . DA  A 1 10  ? 19.733  24.367 19.344  1.00 37.30  ? 10   DA  B N1    1 
ATOM   204  C  C2    . DA  A 1 10  ? 20.650  25.060 18.669  1.00 37.93  ? 10   DA  B C2    1 
ATOM   205  N  N3    . DA  A 1 10  ? 20.489  25.952 17.694  1.00 40.46  ? 10   DA  B N3    1 
ATOM   206  C  C4    . DA  A 1 10  ? 19.188  26.127 17.412  1.00 39.96  ? 10   DA  B C4    1 
ATOM   207  P  P     . DC  A 1 11  ? 20.572  28.520 11.581  1.00 40.51  ? 11   DC  B P     1 
ATOM   208  O  OP1   . DC  A 1 11  ? 21.519  29.207 10.666  1.00 41.43  ? 11   DC  B OP1   1 
ATOM   209  O  OP2   . DC  A 1 11  ? 19.207  28.199 11.114  1.00 45.50  ? 11   DC  B OP2   1 
ATOM   210  O  "O5'" . DC  A 1 11  ? 21.278  27.205 12.112  1.00 39.84  ? 11   DC  B "O5'" 1 
ATOM   211  C  "C5'" . DC  A 1 11  ? 22.338  27.331 13.045  1.00 38.36  ? 11   DC  B "C5'" 1 
ATOM   212  C  "C4'" . DC  A 1 11  ? 22.942  25.983 13.324  1.00 39.40  ? 11   DC  B "C4'" 1 
ATOM   213  O  "O4'" . DC  A 1 11  ? 22.250  25.352 14.425  1.00 40.74  ? 11   DC  B "O4'" 1 
ATOM   214  C  "C3'" . DC  A 1 11  ? 22.850  25.035 12.132  1.00 41.27  ? 11   DC  B "C3'" 1 
ATOM   215  O  "O3'" . DC  A 1 11  ? 24.132  24.497 11.834  1.00 39.23  ? 11   DC  B "O3'" 1 
ATOM   216  C  "C2'" . DC  A 1 11  ? 21.876  23.960 12.586  1.00 40.89  ? 11   DC  B "C2'" 1 
ATOM   217  C  "C1'" . DC  A 1 11  ? 21.973  24.003 14.105  1.00 39.83  ? 11   DC  B "C1'" 1 
ATOM   218  N  N1    . DC  A 1 11  ? 20.718  23.634 14.779  1.00 37.01  ? 11   DC  B N1    1 
ATOM   219  C  C2    . DC  A 1 11  ? 20.747  22.699 15.838  1.00 35.65  ? 11   DC  B C2    1 
ATOM   220  O  O2    . DC  A 1 11  ? 21.838  22.249 16.223  1.00 32.33  ? 11   DC  B O2    1 
ATOM   221  N  N3    . DC  A 1 11  ? 19.579  22.320 16.416  1.00 34.49  ? 11   DC  B N3    1 
ATOM   222  C  C4    . DC  A 1 11  ? 18.425  22.841 15.991  1.00 34.68  ? 11   DC  B C4    1 
ATOM   223  N  N4    . DC  A 1 11  ? 17.303  22.424 16.571  1.00 34.23  ? 11   DC  B N4    1 
ATOM   224  C  C5    . DC  A 1 11  ? 18.371  23.813 14.944  1.00 35.74  ? 11   DC  B C5    1 
ATOM   225  C  C6    . DC  A 1 11  ? 19.529  24.176 14.373  1.00 37.31  ? 11   DC  B C6    1 
ATOM   226  P  P     . DT  A 1 12  ? 24.304  23.479 10.613  1.00 38.33  ? 12   DT  B P     1 
ATOM   227  O  OP1   . DT  A 1 12  ? 25.603  23.766 9.954   1.00 39.57  ? 12   DT  B OP1   1 
ATOM   228  O  OP2   . DT  A 1 12  ? 23.063  23.431 9.805   1.00 40.09  ? 12   DT  B OP2   1 
ATOM   229  O  "O5'" . DT  A 1 12  ? 24.449  22.091 11.366  1.00 38.30  ? 12   DT  B "O5'" 1 
ATOM   230  C  "C5'" . DT  A 1 12  ? 25.314  21.983 12.494  1.00 41.62  ? 12   DT  B "C5'" 1 
ATOM   231  C  "C4'" . DT  A 1 12  ? 25.307  20.565 12.999  1.00 44.31  ? 12   DT  B "C4'" 1 
ATOM   232  O  "O4'" . DT  A 1 12  ? 24.168  20.359 13.881  1.00 46.09  ? 12   DT  B "O4'" 1 
ATOM   233  C  "C3'" . DT  A 1 12  ? 25.133  19.606 11.821  1.00 45.16  ? 12   DT  B "C3'" 1 
ATOM   234  O  "O3'" . DT  A 1 12  ? 26.032  18.502 11.863  1.00 45.11  ? 12   DT  B "O3'" 1 
ATOM   235  C  "C2'" . DT  A 1 12  ? 23.692  19.147 11.932  1.00 46.72  ? 12   DT  B "C2'" 1 
ATOM   236  C  "C1'" . DT  A 1 12  ? 23.412  19.248 13.423  1.00 46.45  ? 12   DT  B "C1'" 1 
ATOM   237  N  N1    . DT  A 1 12  ? 21.977  19.485 13.709  1.00 43.47  ? 12   DT  B N1    1 
ATOM   238  C  C2    . DT  A 1 12  ? 21.383  18.819 14.768  1.00 42.06  ? 12   DT  B C2    1 
ATOM   239  O  O2    . DT  A 1 12  ? 22.001  18.115 15.550  1.00 39.23  ? 12   DT  B O2    1 
ATOM   240  N  N3    . DT  A 1 12  ? 20.031  19.013 14.875  1.00 40.54  ? 12   DT  B N3    1 
ATOM   241  C  C4    . DT  A 1 12  ? 19.234  19.800 14.064  1.00 41.45  ? 12   DT  B C4    1 
ATOM   242  O  O4    . DT  A 1 12  ? 18.021  19.850 14.256  1.00 42.44  ? 12   DT  B O4    1 
ATOM   243  C  C5    . DT  A 1 12  ? 19.932  20.511 13.015  1.00 43.36  ? 12   DT  B C5    1 
ATOM   244  C  C7    . DT  A 1 12  ? 19.160  21.428 12.119  1.00 41.65  ? 12   DT  B C7    1 
ATOM   245  C  C6    . DT  A 1 12  ? 21.248  20.320 12.894  1.00 42.47  ? 12   DT  B C6    1 
HETATM 246  N  N1    . DOC A 1 13  ? 21.512  15.287 12.826  1.00 44.35  ? 13   DOC B N1    1 
HETATM 247  C  C2    . DOC A 1 13  ? 20.332  15.011 13.517  1.00 43.40  ? 13   DOC B C2    1 
HETATM 248  N  N3    . DOC A 1 13  ? 19.217  15.711 13.235  1.00 41.60  ? 13   DOC B N3    1 
HETATM 249  C  C4    . DOC A 1 13  ? 19.247  16.670 12.312  1.00 41.45  ? 13   DOC B C4    1 
HETATM 250  C  C5    . DOC A 1 13  ? 20.442  16.998 11.605  1.00 39.16  ? 13   DOC B C5    1 
HETATM 251  C  C6    . DOC A 1 13  ? 21.545  16.289 11.893  1.00 42.36  ? 13   DOC B C6    1 
HETATM 252  O  O2    . DOC A 1 13  ? 20.343  14.122 14.385  1.00 45.73  ? 13   DOC B O2    1 
HETATM 253  N  N4    . DOC A 1 13  ? 18.109  17.327 12.060  1.00 39.90  ? 13   DOC B N4    1 
HETATM 254  C  "C1'" . DOC A 1 13  ? 22.695  14.447 13.122  1.00 45.83  ? 13   DOC B "C1'" 1 
HETATM 255  C  "C2'" . DOC A 1 13  ? 23.332  13.766 11.922  1.00 47.33  ? 13   DOC B "C2'" 1 
HETATM 256  C  "C3'" . DOC A 1 13  ? 24.730  13.490 12.444  1.00 44.36  ? 13   DOC B "C3'" 1 
HETATM 257  C  "C4'" . DOC A 1 13  ? 25.011  14.694 13.348  1.00 45.38  ? 13   DOC B "C4'" 1 
HETATM 258  O  "O4'" . DOC A 1 13  ? 23.715  15.258 13.689  1.00 44.99  ? 13   DOC B "O4'" 1 
HETATM 259  C  "C5'" . DOC A 1 13  ? 25.891  15.749 12.717  1.00 42.31  ? 13   DOC B "C5'" 1 
HETATM 260  O  "O5'" . DOC A 1 13  ? 25.382  16.132 11.436  1.00 43.79  ? 13   DOC B "O5'" 1 
HETATM 261  P  P     . DOC A 1 13  ? 25.980  17.407 10.687  1.00 45.02  ? 13   DOC B P     1 
HETATM 262  O  OP1   . DOC A 1 13  ? 27.374  17.093 10.277  1.00 47.59  ? 13   DOC B OP1   1 
HETATM 263  O  OP2   . DOC A 1 13  ? 25.016  17.885 9.671   1.00 42.54  ? 13   DOC B OP2   1 
ATOM   264  O  "O5'" . DT  B 2 1   ? -4.739  17.426 7.370   1.00 96.23  ? 1    DT  C "O5'" 1 
ATOM   265  C  "C5'" . DT  B 2 1   ? -3.322  17.570 7.235   1.00 96.97  ? 1    DT  C "C5'" 1 
ATOM   266  C  "C4'" . DT  B 2 1   ? -2.777  16.693 6.130   1.00 97.39  ? 1    DT  C "C4'" 1 
ATOM   267  O  "O4'" . DT  B 2 1   ? -2.965  15.296 6.465   1.00 98.16  ? 1    DT  C "O4'" 1 
ATOM   268  C  "C3'" . DT  B 2 1   ? -3.457  16.892 4.772   1.00 97.27  ? 1    DT  C "C3'" 1 
ATOM   269  O  "O3'" . DT  B 2 1   ? -2.506  16.686 3.719   1.00 95.44  ? 1    DT  C "O3'" 1 
ATOM   270  C  "C2'" . DT  B 2 1   ? -4.469  15.761 4.736   1.00 97.92  ? 1    DT  C "C2'" 1 
ATOM   271  C  "C1'" . DT  B 2 1   ? -3.676  14.658 5.411   1.00 98.66  ? 1    DT  C "C1'" 1 
ATOM   272  N  N1    . DT  B 2 1   ? -4.468  13.551 5.985   1.00 99.64  ? 1    DT  C N1    1 
ATOM   273  C  C2    . DT  B 2 1   ? -4.307  12.303 5.434   1.00 99.97  ? 1    DT  C C2    1 
ATOM   274  O  O2    . DT  B 2 1   ? -3.565  12.085 4.489   1.00 99.93  ? 1    DT  C O2    1 
ATOM   275  N  N3    . DT  B 2 1   ? -5.054  11.312 6.030   1.00 100.64 ? 1    DT  C N3    1 
ATOM   276  C  C4    . DT  B 2 1   ? -5.928  11.448 7.095   1.00 100.57 ? 1    DT  C C4    1 
ATOM   277  O  O4    . DT  B 2 1   ? -6.524  10.464 7.532   1.00 100.77 ? 1    DT  C O4    1 
ATOM   278  C  C5    . DT  B 2 1   ? -6.060  12.790 7.612   1.00 100.30 ? 1    DT  C C5    1 
ATOM   279  C  C7    . DT  B 2 1   ? -6.994  13.038 8.754   1.00 100.06 ? 1    DT  C C7    1 
ATOM   280  C  C6    . DT  B 2 1   ? -5.331  13.758 7.038   1.00 100.01 ? 1    DT  C C6    1 
ATOM   281  P  P     . DC  B 2 2   ? -1.738  17.943 3.072   1.00 94.07  ? 2    DC  C P     1 
ATOM   282  O  OP1   . DC  B 2 2   ? -2.153  19.162 3.823   1.00 94.02  ? 2    DC  C OP1   1 
ATOM   283  O  OP2   . DC  B 2 2   ? -1.888  17.897 1.595   1.00 93.51  ? 2    DC  C OP2   1 
ATOM   284  O  "O5'" . DC  B 2 2   ? -0.215  17.654 3.423   1.00 91.51  ? 2    DC  C "O5'" 1 
ATOM   285  C  "C5'" . DC  B 2 2   ? 0.165   17.373 4.762   1.00 87.27  ? 2    DC  C "C5'" 1 
ATOM   286  C  "C4'" . DC  B 2 2   ? 1.435   16.559 4.788   1.00 83.72  ? 2    DC  C "C4'" 1 
ATOM   287  O  "O4'" . DC  B 2 2   ? 2.457   17.274 4.056   1.00 82.49  ? 2    DC  C "O4'" 1 
ATOM   288  C  "C3'" . DC  B 2 2   ? 1.972   16.388 6.204   1.00 81.23  ? 2    DC  C "C3'" 1 
ATOM   289  O  "O3'" . DC  B 2 2   ? 2.598   15.118 6.387   1.00 75.76  ? 2    DC  C "O3'" 1 
ATOM   290  C  "C2'" . DC  B 2 2   ? 2.955   17.532 6.351   1.00 81.58  ? 2    DC  C "C2'" 1 
ATOM   291  C  "C1'" . DC  B 2 2   ? 3.458   17.765 4.937   1.00 82.19  ? 2    DC  C "C1'" 1 
ATOM   292  N  N1    . DC  B 2 2   ? 3.647   19.192 4.637   1.00 82.14  ? 2    DC  C N1    1 
ATOM   293  C  C2    . DC  B 2 2   ? 4.945   19.697 4.548   1.00 82.60  ? 2    DC  C C2    1 
ATOM   294  O  O2    . DC  B 2 2   ? 5.903   18.927 4.713   1.00 82.69  ? 2    DC  C O2    1 
ATOM   295  N  N3    . DC  B 2 2   ? 5.124   21.012 4.284   1.00 83.70  ? 2    DC  C N3    1 
ATOM   296  C  C4    . DC  B 2 2   ? 4.066   21.809 4.110   1.00 83.72  ? 2    DC  C C4    1 
ATOM   297  N  N4    . DC  B 2 2   ? 4.290   23.102 3.860   1.00 84.16  ? 2    DC  C N4    1 
ATOM   298  C  C5    . DC  B 2 2   ? 2.731   21.317 4.189   1.00 82.86  ? 2    DC  C C5    1 
ATOM   299  C  C6    . DC  B 2 2   ? 2.570   20.014 4.452   1.00 82.16  ? 2    DC  C C6    1 
ATOM   300  P  P     . DA  B 2 3   ? 2.911   14.610 7.875   1.00 71.91  ? 3    DA  C P     1 
ATOM   301  O  OP1   . DA  B 2 3   ? 3.466   13.233 7.790   1.00 72.83  ? 3    DA  C OP1   1 
ATOM   302  O  OP2   . DA  B 2 3   ? 1.709   14.867 8.709   1.00 72.76  ? 3    DA  C OP2   1 
ATOM   303  O  "O5'" . DA  B 2 3   ? 4.059   15.599 8.361   1.00 68.64  ? 3    DA  C "O5'" 1 
ATOM   304  C  "C5'" . DA  B 2 3   ? 5.328   15.637 7.706   1.00 64.54  ? 3    DA  C "C5'" 1 
ATOM   305  C  "C4'" . DA  B 2 3   ? 6.237   16.612 8.414   1.00 62.37  ? 3    DA  C "C4'" 1 
ATOM   306  O  "O4'" . DA  B 2 3   ? 5.989   17.964 7.945   1.00 63.39  ? 3    DA  C "O4'" 1 
ATOM   307  C  "C3'" . DA  B 2 3   ? 5.964   16.617 9.917   1.00 59.91  ? 3    DA  C "C3'" 1 
ATOM   308  O  "O3'" . DA  B 2 3   ? 7.145   16.625 10.699  1.00 54.36  ? 3    DA  C "O3'" 1 
ATOM   309  C  "C2'" . DA  B 2 3   ? 5.178   17.891 10.151  1.00 62.07  ? 3    DA  C "C2'" 1 
ATOM   310  C  "C1'" . DA  B 2 3   ? 5.654   18.810 9.040   1.00 64.05  ? 3    DA  C "C1'" 1 
ATOM   311  N  N9    . DA  B 2 3   ? 4.605   19.734 8.607   1.00 66.21  ? 3    DA  C N9    1 
ATOM   312  C  C8    . DA  B 2 3   ? 3.247   19.540 8.687   1.00 66.40  ? 3    DA  C C8    1 
ATOM   313  N  N7    . DA  B 2 3   ? 2.541   20.551 8.249   1.00 68.64  ? 3    DA  C N7    1 
ATOM   314  C  C5    . DA  B 2 3   ? 3.496   21.476 7.848   1.00 69.13  ? 3    DA  C C5    1 
ATOM   315  C  C6    . DA  B 2 3   ? 3.387   22.766 7.296   1.00 70.08  ? 3    DA  C C6    1 
ATOM   316  N  N6    . DA  B 2 3   ? 2.222   23.361 7.032   1.00 70.97  ? 3    DA  C N6    1 
ATOM   317  N  N1    . DA  B 2 3   ? 4.533   23.431 7.021   1.00 71.17  ? 3    DA  C N1    1 
ATOM   318  C  C2    . DA  B 2 3   ? 5.702   22.826 7.285   1.00 70.37  ? 3    DA  C C2    1 
ATOM   319  N  N3    . DA  B 2 3   ? 5.931   21.616 7.797   1.00 69.06  ? 3    DA  C N3    1 
ATOM   320  C  C4    . DA  B 2 3   ? 4.773   20.985 8.060   1.00 68.09  ? 3    DA  C C4    1 
ATOM   321  P  P     . DT  B 2 4   ? 7.038   16.293 12.265  1.00 48.54  ? 4    DT  C P     1 
ATOM   322  O  OP1   . DT  B 2 4   ? 5.610   16.094 12.587  1.00 49.76  ? 4    DT  C OP1   1 
ATOM   323  O  OP2   . DT  B 2 4   ? 7.809   17.333 12.980  1.00 50.98  ? 4    DT  C OP2   1 
ATOM   324  O  "O5'" . DT  B 2 4   ? 7.782   14.896 12.414  1.00 46.15  ? 4    DT  C "O5'" 1 
ATOM   325  C  "C5'" . DT  B 2 4   ? 7.153   13.683 12.013  1.00 40.16  ? 4    DT  C "C5'" 1 
ATOM   326  C  "C4'" . DT  B 2 4   ? 7.841   12.516 12.677  1.00 37.21  ? 4    DT  C "C4'" 1 
ATOM   327  O  "O4'" . DT  B 2 4   ? 9.167   12.363 12.128  1.00 33.64  ? 4    DT  C "O4'" 1 
ATOM   328  C  "C3'" . DT  B 2 4   ? 8.038   12.715 14.176  1.00 36.64  ? 4    DT  C "C3'" 1 
ATOM   329  O  "O3'" . DT  B 2 4   ? 7.978   11.446 14.805  1.00 36.71  ? 4    DT  C "O3'" 1 
ATOM   330  C  "C2'" . DT  B 2 4   ? 9.432   13.315 14.277  1.00 34.51  ? 4    DT  C "C2'" 1 
ATOM   331  C  "C1'" . DT  B 2 4   ? 10.161  12.675 13.101  1.00 34.41  ? 4    DT  C "C1'" 1 
ATOM   332  N  N1    . DT  B 2 4   ? 11.147  13.544 12.435  1.00 31.00  ? 4    DT  C N1    1 
ATOM   333  C  C2    . DT  B 2 4   ? 12.473  13.152 12.379  1.00 32.69  ? 4    DT  C C2    1 
ATOM   334  O  O2    . DT  B 2 4   ? 12.910  12.144 12.925  1.00 33.65  ? 4    DT  C O2    1 
ATOM   335  N  N3    . DT  B 2 4   ? 13.280  13.990 11.651  1.00 31.95  ? 4    DT  C N3    1 
ATOM   336  C  C4    . DT  B 2 4   ? 12.909  15.151 10.998  1.00 32.54  ? 4    DT  C C4    1 
ATOM   337  O  O4    . DT  B 2 4   ? 13.744  15.779 10.350  1.00 35.41  ? 4    DT  C O4    1 
ATOM   338  C  C5    . DT  B 2 4   ? 11.518  15.523 11.138  1.00 32.28  ? 4    DT  C C5    1 
ATOM   339  C  C7    . DT  B 2 4   ? 11.029  16.784 10.492  1.00 30.59  ? 4    DT  C C7    1 
ATOM   340  C  C6    . DT  B 2 4   ? 10.721  14.712 11.845  1.00 31.73  ? 4    DT  C C6    1 
ATOM   341  P  P     . DG  B 2 5   ? 7.702   11.352 16.375  1.00 36.96  ? 5    DG  C P     1 
ATOM   342  O  OP1   . DG  B 2 5   ? 7.221   9.963  16.604  1.00 35.43  ? 5    DG  C OP1   1 
ATOM   343  O  OP2   . DG  B 2 5   ? 6.876   12.508 16.810  1.00 35.39  ? 5    DG  C OP2   1 
ATOM   344  O  "O5'" . DG  B 2 5   ? 9.159   11.462 16.984  1.00 34.00  ? 5    DG  C "O5'" 1 
ATOM   345  C  "C5'" . DG  B 2 5   ? 10.059  10.406 16.743  1.00 36.55  ? 5    DG  C "C5'" 1 
ATOM   346  C  "C4'" . DG  B 2 5   ? 11.459  10.803 17.119  1.00 36.47  ? 5    DG  C "C4'" 1 
ATOM   347  O  "O4'" . DG  B 2 5   ? 12.070  11.679 16.141  1.00 35.80  ? 5    DG  C "O4'" 1 
ATOM   348  C  "C3'" . DG  B 2 5   ? 11.626  11.478 18.480  1.00 37.41  ? 5    DG  C "C3'" 1 
ATOM   349  O  "O3'" . DG  B 2 5   ? 12.599  10.695 19.155  1.00 39.99  ? 5    DG  C "O3'" 1 
ATOM   350  C  "C2'" . DG  B 2 5   ? 12.183  12.855 18.133  1.00 37.30  ? 5    DG  C "C2'" 1 
ATOM   351  C  "C1'" . DG  B 2 5   ? 12.932  12.541 16.848  1.00 37.28  ? 5    DG  C "C1'" 1 
ATOM   352  N  N9    . DG  B 2 5   ? 13.338  13.632 15.961  1.00 37.91  ? 5    DG  C N9    1 
ATOM   353  C  C8    . DG  B 2 5   ? 12.572  14.654 15.447  1.00 37.39  ? 5    DG  C C8    1 
ATOM   354  N  N7    . DG  B 2 5   ? 13.255  15.462 14.673  1.00 36.97  ? 5    DG  C N7    1 
ATOM   355  C  C5    . DG  B 2 5   ? 14.541  14.941 14.677  1.00 36.81  ? 5    DG  C C5    1 
ATOM   356  C  C6    . DG  B 2 5   ? 15.719  15.381 14.013  1.00 38.72  ? 5    DG  C C6    1 
ATOM   357  O  O6    . DG  B 2 5   ? 15.860  16.339 13.253  1.00 37.78  ? 5    DG  C O6    1 
ATOM   358  N  N1    . DG  B 2 5   ? 16.810  14.564 14.305  1.00 36.00  ? 5    DG  C N1    1 
ATOM   359  C  C2    . DG  B 2 5   ? 16.773  13.464 15.112  1.00 35.67  ? 5    DG  C C2    1 
ATOM   360  N  N2    . DG  B 2 5   ? 17.934  12.814 15.268  1.00 34.63  ? 5    DG  C N2    1 
ATOM   361  N  N3    . DG  B 2 5   ? 15.681  13.033 15.724  1.00 37.24  ? 5    DG  C N3    1 
ATOM   362  C  C4    . DG  B 2 5   ? 14.612  13.817 15.467  1.00 35.50  ? 5    DG  C C4    1 
ATOM   363  P  P     . DA  B 2 6   ? 12.904  10.940 20.700  1.00 39.33  ? 6    DA  C P     1 
ATOM   364  O  OP1   . DA  B 2 6   ? 12.887  9.603  21.330  1.00 40.21  ? 6    DA  C OP1   1 
ATOM   365  O  OP2   . DA  B 2 6   ? 12.033  12.028 21.220  1.00 41.57  ? 6    DA  C OP2   1 
ATOM   366  O  "O5'" . DA  B 2 6   ? 14.402  11.459 20.669  1.00 38.02  ? 6    DA  C "O5'" 1 
ATOM   367  C  "C5'" . DA  B 2 6   ? 15.407  10.658 20.078  1.00 36.74  ? 6    DA  C "C5'" 1 
ATOM   368  C  "C4'" . DA  B 2 6   ? 16.746  11.325 20.229  1.00 36.30  ? 6    DA  C "C4'" 1 
ATOM   369  O  "O4'" . DA  B 2 6   ? 16.961  12.299 19.188  1.00 35.02  ? 6    DA  C "O4'" 1 
ATOM   370  C  "C3'" . DA  B 2 6   ? 16.917  12.055 21.556  1.00 37.20  ? 6    DA  C "C3'" 1 
ATOM   371  O  "O3'" . DA  B 2 6   ? 18.169  11.677 22.089  1.00 36.88  ? 6    DA  C "O3'" 1 
ATOM   372  C  "C2'" . DA  B 2 6   ? 16.878  13.527 21.177  1.00 35.02  ? 6    DA  C "C2'" 1 
ATOM   373  C  "C1'" . DA  B 2 6   ? 17.397  13.520 19.749  1.00 35.74  ? 6    DA  C "C1'" 1 
ATOM   374  N  N9    . DA  B 2 6   ? 16.880  14.594 18.903  1.00 34.99  ? 6    DA  C N9    1 
ATOM   375  C  C8    . DA  B 2 6   ? 15.579  15.006 18.768  1.00 34.34  ? 6    DA  C C8    1 
ATOM   376  N  N7    . DA  B 2 6   ? 15.428  16.014 17.944  1.00 37.41  ? 6    DA  C N7    1 
ATOM   377  C  C5    . DA  B 2 6   ? 16.718  16.284 17.502  1.00 36.18  ? 6    DA  C C5    1 
ATOM   378  C  C6    . DA  B 2 6   ? 17.238  17.258 16.626  1.00 35.62  ? 6    DA  C C6    1 
ATOM   379  N  N6    . DA  B 2 6   ? 16.496  18.181 16.009  1.00 35.99  ? 6    DA  C N6    1 
ATOM   380  N  N1    . DA  B 2 6   ? 18.568  17.254 16.406  1.00 37.83  ? 6    DA  C N1    1 
ATOM   381  C  C2    . DA  B 2 6   ? 19.319  16.333 17.025  1.00 37.03  ? 6    DA  C C2    1 
ATOM   382  N  N3    . DA  B 2 6   ? 18.950  15.372 17.872  1.00 36.61  ? 6    DA  C N3    1 
ATOM   383  C  C4    . DA  B 2 6   ? 17.620  15.407 18.074  1.00 35.90  ? 6    DA  C C4    1 
ATOM   384  P  P     . DG  B 2 7   ? 18.526  12.016 23.603  1.00 36.64  ? 7    DG  C P     1 
ATOM   385  O  OP1   . DG  B 2 7   ? 19.317  10.871 24.113  1.00 38.23  ? 7    DG  C OP1   1 
ATOM   386  O  OP2   . DG  B 2 7   ? 17.325  12.482 24.344  1.00 38.63  ? 7    DG  C OP2   1 
ATOM   387  O  "O5'" . DG  B 2 7   ? 19.525  13.227 23.421  1.00 40.90  ? 7    DG  C "O5'" 1 
ATOM   388  C  "C5'" . DG  B 2 7   ? 20.637  13.055 22.561  1.00 41.14  ? 7    DG  C "C5'" 1 
ATOM   389  C  "C4'" . DG  B 2 7   ? 21.333  14.367 22.321  1.00 38.47  ? 7    DG  C "C4'" 1 
ATOM   390  O  "O4'" . DG  B 2 7   ? 20.635  15.142 21.321  1.00 37.01  ? 7    DG  C "O4'" 1 
ATOM   391  C  "C3'" . DG  B 2 7   ? 21.494  15.264 23.551  1.00 39.88  ? 7    DG  C "C3'" 1 
ATOM   392  O  "O3'" . DG  B 2 7   ? 22.872  15.593 23.680  1.00 39.59  ? 7    DG  C "O3'" 1 
ATOM   393  C  "C2'" . DG  B 2 7   ? 20.667  16.497 23.213  1.00 36.67  ? 7    DG  C "C2'" 1 
ATOM   394  C  "C1'" . DG  B 2 7   ? 20.710  16.499 21.692  1.00 38.23  ? 7    DG  C "C1'" 1 
ATOM   395  N  N9    . DG  B 2 7   ? 19.641  17.222 21.010  1.00 35.96  ? 7    DG  C N9    1 
ATOM   396  C  C8    . DG  B 2 7   ? 18.281  17.107 21.192  1.00 36.10  ? 7    DG  C C8    1 
ATOM   397  N  N7    . DG  B 2 7   ? 17.595  17.950 20.465  1.00 36.37  ? 7    DG  C N7    1 
ATOM   398  C  C5    . DG  B 2 7   ? 18.561  18.650 19.751  1.00 36.82  ? 7    DG  C C5    1 
ATOM   399  C  C6    . DG  B 2 7   ? 18.429  19.708 18.818  1.00 36.51  ? 7    DG  C C6    1 
ATOM   400  O  O6    . DG  B 2 7   ? 17.401  20.260 18.427  1.00 37.94  ? 7    DG  C O6    1 
ATOM   401  N  N1    . DG  B 2 7   ? 19.667  20.124 18.335  1.00 37.28  ? 7    DG  C N1    1 
ATOM   402  C  C2    . DG  B 2 7   ? 20.881  19.591 18.706  1.00 36.36  ? 7    DG  C C2    1 
ATOM   403  N  N2    . DG  B 2 7   ? 21.972  20.113 18.123  1.00 35.49  ? 7    DG  C N2    1 
ATOM   404  N  N3    . DG  B 2 7   ? 21.015  18.613 19.584  1.00 37.41  ? 7    DG  C N3    1 
ATOM   405  C  C4    . DG  B 2 7   ? 19.825  18.196 20.063  1.00 36.90  ? 7    DG  C C4    1 
ATOM   406  P  P     . DT  B 2 8   ? 23.357  16.544 24.870  1.00 43.97  ? 8    DT  C P     1 
ATOM   407  O  OP1   . DT  B 2 8   ? 24.488  15.848 25.531  1.00 41.88  ? 8    DT  C OP1   1 
ATOM   408  O  OP2   . DT  B 2 8   ? 22.195  17.013 25.676  1.00 41.95  ? 8    DT  C OP2   1 
ATOM   409  O  "O5'" . DT  B 2 8   ? 23.913  17.808 24.084  1.00 42.29  ? 8    DT  C "O5'" 1 
ATOM   410  C  "C5'" . DT  B 2 8   ? 24.672  17.641 22.893  1.00 39.98  ? 8    DT  C "C5'" 1 
ATOM   411  C  "C4'" . DT  B 2 8   ? 25.106  18.988 22.375  1.00 40.41  ? 8    DT  C "C4'" 1 
ATOM   412  O  "O4'" . DT  B 2 8   ? 24.044  19.595 21.595  1.00 39.00  ? 8    DT  C "O4'" 1 
ATOM   413  C  "C3'" . DT  B 2 8   ? 25.433  19.963 23.505  1.00 41.18  ? 8    DT  C "C3'" 1 
ATOM   414  O  "O3'" . DT  B 2 8   ? 26.653  20.641 23.255  1.00 43.87  ? 8    DT  C "O3'" 1 
ATOM   415  C  "C2'" . DT  B 2 8   ? 24.266  20.934 23.505  1.00 40.42  ? 8    DT  C "C2'" 1 
ATOM   416  C  "C1'" . DT  B 2 8   ? 23.796  20.912 22.060  1.00 38.84  ? 8    DT  C "C1'" 1 
ATOM   417  N  N1    . DT  B 2 8   ? 22.356  21.164 21.923  1.00 39.06  ? 8    DT  C N1    1 
ATOM   418  C  C2    . DT  B 2 8   ? 21.941  22.144 21.051  1.00 37.26  ? 8    DT  C C2    1 
ATOM   419  O  O2    . DT  B 2 8   ? 22.716  22.799 20.370  1.00 37.98  ? 8    DT  C O2    1 
ATOM   420  N  N3    . DT  B 2 8   ? 20.579  22.327 21.002  1.00 35.23  ? 8    DT  C N3    1 
ATOM   421  C  C4    . DT  B 2 8   ? 19.614  21.636 21.721  1.00 35.81  ? 8    DT  C C4    1 
ATOM   422  O  O4    . DT  B 2 8   ? 18.422  21.910 21.580  1.00 33.73  ? 8    DT  C O4    1 
ATOM   423  C  C5    . DT  B 2 8   ? 20.126  20.614 22.610  1.00 37.43  ? 8    DT  C C5    1 
ATOM   424  C  C7    . DT  B 2 8   ? 19.163  19.811 23.424  1.00 37.92  ? 8    DT  C C7    1 
ATOM   425  C  C6    . DT  B 2 8   ? 21.451  20.431 22.664  1.00 36.85  ? 8    DT  C C6    1 
ATOM   426  P  P     . DC  B 2 9   ? 27.331  21.500 24.432  1.00 45.84  ? 9    DC  C P     1 
ATOM   427  O  OP1   . DC  B 2 9   ? 28.750  21.100 24.554  1.00 46.73  ? 9    DC  C OP1   1 
ATOM   428  O  OP2   . DC  B 2 9   ? 26.449  21.448 25.621  1.00 45.90  ? 9    DC  C OP2   1 
ATOM   429  O  "O5'" . DC  B 2 9   ? 27.286  22.975 23.845  1.00 46.40  ? 9    DC  C "O5'" 1 
ATOM   430  C  "C5'" . DC  B 2 9   ? 27.681  23.217 22.506  1.00 42.84  ? 9    DC  C "C5'" 1 
ATOM   431  C  "C4'" . DC  B 2 9   ? 27.176  24.562 22.053  1.00 42.77  ? 9    DC  C "C4'" 1 
ATOM   432  O  "O4'" . DC  B 2 9   ? 25.748  24.502 21.818  1.00 41.22  ? 9    DC  C "O4'" 1 
ATOM   433  C  "C3'" . DC  B 2 9   ? 27.408  25.687 23.064  1.00 42.08  ? 9    DC  C "C3'" 1 
ATOM   434  O  "O3'" . DC  B 2 9   ? 27.990  26.808 22.402  1.00 41.85  ? 9    DC  C "O3'" 1 
ATOM   435  C  "C2'" . DC  B 2 9   ? 26.012  26.010 23.577  1.00 40.93  ? 9    DC  C "C2'" 1 
ATOM   436  C  "C1'" . DC  B 2 9   ? 25.131  25.633 22.394  1.00 40.13  ? 9    DC  C "C1'" 1 
ATOM   437  N  N1    . DC  B 2 9   ? 23.753  25.262 22.743  1.00 38.65  ? 9    DC  C N1    1 
ATOM   438  C  C2    . DC  B 2 9   ? 22.701  25.846 22.042  1.00 37.48  ? 9    DC  C C2    1 
ATOM   439  O  O2    . DC  B 2 9   ? 22.964  26.620 21.110  1.00 38.74  ? 9    DC  C O2    1 
ATOM   440  N  N3    . DC  B 2 9   ? 21.427  25.546 22.386  1.00 37.06  ? 9    DC  C N3    1 
ATOM   441  C  C4    . DC  B 2 9   ? 21.193  24.677 23.375  1.00 38.27  ? 9    DC  C C4    1 
ATOM   442  N  N4    . DC  B 2 9   ? 19.918  24.400 23.688  1.00 36.60  ? 9    DC  C N4    1 
ATOM   443  C  C5    . DC  B 2 9   ? 22.253  24.050 24.090  1.00 37.12  ? 9    DC  C C5    1 
ATOM   444  C  C6    . DC  B 2 9   ? 23.504  24.369 23.745  1.00 38.35  ? 9    DC  C C6    1 
ATOM   445  P  P     . DC  B 2 10  ? 28.374  28.115 23.242  1.00 42.43  ? 10   DC  C P     1 
ATOM   446  O  OP1   . DC  B 2 10  ? 29.645  28.625 22.661  1.00 45.27  ? 10   DC  C OP1   1 
ATOM   447  O  OP2   . DC  B 2 10  ? 28.287  27.839 24.691  1.00 42.64  ? 10   DC  C OP2   1 
ATOM   448  O  "O5'" . DC  B 2 10  ? 27.212  29.125 22.844  1.00 41.42  ? 10   DC  C "O5'" 1 
ATOM   449  C  "C5'" . DC  B 2 10  ? 26.971  29.412 21.470  1.00 39.62  ? 10   DC  C "C5'" 1 
ATOM   450  C  "C4'" . DC  B 2 10  ? 25.834  30.394 21.329  1.00 38.16  ? 10   DC  C "C4'" 1 
ATOM   451  O  "O4'" . DC  B 2 10  ? 24.573  29.763 21.658  1.00 36.81  ? 10   DC  C "O4'" 1 
ATOM   452  C  "C3'" . DC  B 2 10  ? 25.941  31.639 22.208  1.00 38.80  ? 10   DC  C "C3'" 1 
ATOM   453  O  "O3'" . DC  B 2 10  ? 25.606  32.776 21.408  1.00 41.77  ? 10   DC  C "O3'" 1 
ATOM   454  C  "C2'" . DC  B 2 10  ? 24.915  31.391 23.302  1.00 35.56  ? 10   DC  C "C2'" 1 
ATOM   455  C  "C1'" . DC  B 2 10  ? 23.858  30.575 22.572  1.00 36.69  ? 10   DC  C "C1'" 1 
ATOM   456  N  N1    . DC  B 2 10  ? 23.038  29.689 23.421  1.00 35.92  ? 10   DC  C N1    1 
ATOM   457  C  C2    . DC  B 2 10  ? 21.642  29.822 23.387  1.00 36.71  ? 10   DC  C C2    1 
ATOM   458  O  O2    . DC  B 2 10  ? 21.134  30.679 22.646  1.00 37.07  ? 10   DC  C O2    1 
ATOM   459  N  N3    . DC  B 2 10  ? 20.880  29.014 24.161  1.00 35.53  ? 10   DC  C N3    1 
ATOM   460  C  C4    . DC  B 2 10  ? 21.457  28.107 24.949  1.00 36.12  ? 10   DC  C C4    1 
ATOM   461  N  N4    . DC  B 2 10  ? 20.662  27.336 25.703  1.00 35.18  ? 10   DC  C N4    1 
ATOM   462  C  C5    . DC  B 2 10  ? 22.876  27.949 25.005  1.00 36.79  ? 10   DC  C C5    1 
ATOM   463  C  C6    . DC  B 2 10  ? 23.620  28.754 24.231  1.00 37.62  ? 10   DC  C C6    1 
ATOM   464  P  P     . DT  B 2 11  ? 25.771  34.259 22.001  1.00 40.24  ? 11   DT  C P     1 
ATOM   465  O  OP1   . DT  B 2 11  ? 26.274  35.091 20.868  1.00 41.33  ? 11   DT  C OP1   1 
ATOM   466  O  OP2   . DT  B 2 11  ? 26.524  34.204 23.277  1.00 40.97  ? 11   DT  C OP2   1 
ATOM   467  O  "O5'" . DT  B 2 11  ? 24.272  34.692 22.294  1.00 40.82  ? 11   DT  C "O5'" 1 
ATOM   468  C  "C5'" . DT  B 2 11  ? 23.310  34.675 21.245  1.00 43.12  ? 11   DT  C "C5'" 1 
ATOM   469  C  "C4'" . DT  B 2 11  ? 21.977  35.158 21.759  1.00 46.41  ? 11   DT  C "C4'" 1 
ATOM   470  O  "O4'" . DT  B 2 11  ? 21.333  34.136 22.557  1.00 44.71  ? 11   DT  C "O4'" 1 
ATOM   471  C  "C3'" . DT  B 2 11  ? 22.069  36.399 22.649  1.00 48.21  ? 11   DT  C "C3'" 1 
ATOM   472  O  "O3'" . DT  B 2 11  ? 20.969  37.258 22.354  1.00 54.05  ? 11   DT  C "O3'" 1 
ATOM   473  C  "C2'" . DT  B 2 11  ? 21.916  35.837 24.051  1.00 46.38  ? 11   DT  C "C2'" 1 
ATOM   474  C  "C1'" . DT  B 2 11  ? 20.944  34.697 23.802  1.00 45.02  ? 11   DT  C "C1'" 1 
ATOM   475  N  N1    . DT  B 2 11  ? 20.951  33.619 24.808  1.00 43.47  ? 11   DT  C N1    1 
ATOM   476  C  C2    . DT  B 2 11  ? 19.738  33.093 25.203  1.00 42.20  ? 11   DT  C C2    1 
ATOM   477  O  O2    . DT  B 2 11  ? 18.667  33.504 24.787  1.00 42.31  ? 11   DT  C O2    1 
ATOM   478  N  N3    . DT  B 2 11  ? 19.828  32.066 26.110  1.00 41.03  ? 11   DT  C N3    1 
ATOM   479  C  C4    . DT  B 2 11  ? 20.984  31.532 26.649  1.00 41.51  ? 11   DT  C C4    1 
ATOM   480  O  O4    . DT  B 2 11  ? 20.916  30.595 27.443  1.00 42.29  ? 11   DT  C O4    1 
ATOM   481  C  C5    . DT  B 2 11  ? 22.218  32.148 26.204  1.00 41.24  ? 11   DT  C C5    1 
ATOM   482  C  C7    . DT  B 2 11  ? 23.518  31.642 26.744  1.00 38.01  ? 11   DT  C C7    1 
ATOM   483  C  C6    . DT  B 2 11  ? 22.139  33.147 25.321  1.00 41.34  ? 11   DT  C C6    1 
ATOM   484  P  P     . DG  B 2 12  ? 21.057  38.822 22.710  1.00 55.60  ? 12   DG  C P     1 
ATOM   485  O  OP1   . DG  B 2 12  ? 21.143  39.546 21.415  1.00 53.63  ? 12   DG  C OP1   1 
ATOM   486  O  OP2   . DG  B 2 12  ? 22.089  39.040 23.759  1.00 51.43  ? 12   DG  C OP2   1 
ATOM   487  O  "O5'" . DG  B 2 12  ? 19.635  39.112 23.356  1.00 55.14  ? 12   DG  C "O5'" 1 
ATOM   488  C  "C5'" . DG  B 2 12  ? 18.451  38.693 22.693  1.00 53.95  ? 12   DG  C "C5'" 1 
ATOM   489  C  "C4'" . DG  B 2 12  ? 17.302  38.682 23.669  1.00 54.82  ? 12   DG  C "C4'" 1 
ATOM   490  O  "O4'" . DG  B 2 12  ? 17.378  37.524 24.536  1.00 52.98  ? 12   DG  C "O4'" 1 
ATOM   491  C  "C3'" . DG  B 2 12  ? 17.283  39.900 24.587  1.00 55.18  ? 12   DG  C "C3'" 1 
ATOM   492  O  "O3'" . DG  B 2 12  ? 15.935  40.334 24.751  1.00 57.83  ? 12   DG  C "O3'" 1 
ATOM   493  C  "C2'" . DG  B 2 12  ? 17.868  39.376 25.891  1.00 53.66  ? 12   DG  C "C2'" 1 
ATOM   494  C  "C1'" . DG  B 2 12  ? 17.426  37.922 25.899  1.00 51.29  ? 12   DG  C "C1'" 1 
ATOM   495  N  N9    . DG  B 2 12  ? 18.344  37.012 26.573  1.00 50.05  ? 12   DG  C N9    1 
ATOM   496  C  C8    . DG  B 2 12  ? 19.714  36.993 26.469  1.00 48.36  ? 12   DG  C C8    1 
ATOM   497  N  N7    . DG  B 2 12  ? 20.266  36.020 27.141  1.00 48.29  ? 12   DG  C N7    1 
ATOM   498  C  C5    . DG  B 2 12  ? 19.197  35.361 27.737  1.00 47.90  ? 12   DG  C C5    1 
ATOM   499  C  C6    . DG  B 2 12  ? 19.173  34.211 28.582  1.00 46.01  ? 12   DG  C C6    1 
ATOM   500  O  O6    . DG  B 2 12  ? 20.118  33.516 28.968  1.00 44.89  ? 12   DG  C O6    1 
ATOM   501  N  N1    . DG  B 2 12  ? 17.879  33.891 28.973  1.00 45.81  ? 12   DG  C N1    1 
ATOM   502  C  C2    . DG  B 2 12  ? 16.747  34.577 28.598  1.00 47.68  ? 12   DG  C C2    1 
ATOM   503  N  N2    . DG  B 2 12  ? 15.587  34.114 29.093  1.00 46.03  ? 12   DG  C N2    1 
ATOM   504  N  N3    . DG  B 2 12  ? 16.752  35.639 27.800  1.00 47.83  ? 12   DG  C N3    1 
ATOM   505  C  C4    . DG  B 2 12  ? 18.004  35.972 27.411  1.00 49.70  ? 12   DG  C C4    1 
ATOM   506  P  P     . DT  B 2 13  ? 15.614  41.622 25.649  1.00 57.37  ? 13   DT  C P     1 
ATOM   507  O  OP1   . DT  B 2 13  ? 14.430  42.284 25.035  1.00 58.70  ? 13   DT  C OP1   1 
ATOM   508  O  OP2   . DT  B 2 13  ? 16.868  42.392 25.872  1.00 56.59  ? 13   DT  C OP2   1 
ATOM   509  O  "O5'" . DT  B 2 13  ? 15.180  40.981 27.030  1.00 55.27  ? 13   DT  C "O5'" 1 
ATOM   510  C  "C5'" . DT  B 2 13  ? 14.110  40.059 27.065  1.00 54.07  ? 13   DT  C "C5'" 1 
ATOM   511  C  "C4'" . DT  B 2 13  ? 13.842  39.650 28.488  1.00 53.80  ? 13   DT  C "C4'" 1 
ATOM   512  O  "O4'" . DT  B 2 13  ? 14.828  38.685 28.924  1.00 52.54  ? 13   DT  C "O4'" 1 
ATOM   513  C  "C3'" . DT  B 2 13  ? 13.907  40.812 29.474  1.00 53.55  ? 13   DT  C "C3'" 1 
ATOM   514  O  "O3'" . DT  B 2 13  ? 12.771  40.749 30.329  1.00 54.71  ? 13   DT  C "O3'" 1 
ATOM   515  C  "C2'" . DT  B 2 13  ? 15.207  40.572 30.232  1.00 52.52  ? 13   DT  C "C2'" 1 
ATOM   516  C  "C1'" . DT  B 2 13  ? 15.325  39.058 30.192  1.00 51.88  ? 13   DT  C "C1'" 1 
ATOM   517  N  N1    . DT  B 2 13  ? 16.679  38.477 30.326  1.00 50.70  ? 13   DT  C N1    1 
ATOM   518  C  C2    . DT  B 2 13  ? 16.794  37.319 31.063  1.00 50.19  ? 13   DT  C C2    1 
ATOM   519  O  O2    . DT  B 2 13  ? 15.849  36.799 31.629  1.00 50.99  ? 13   DT  C O2    1 
ATOM   520  N  N3    . DT  B 2 13  ? 18.062  36.792 31.117  1.00 49.77  ? 13   DT  C N3    1 
ATOM   521  C  C4    . DT  B 2 13  ? 19.202  37.303 30.525  1.00 49.36  ? 13   DT  C C4    1 
ATOM   522  O  O4    . DT  B 2 13  ? 20.268  36.708 30.642  1.00 47.02  ? 13   DT  C O4    1 
ATOM   523  C  C5    . DT  B 2 13  ? 19.013  38.536 29.787  1.00 49.33  ? 13   DT  C C5    1 
ATOM   524  C  C7    . DT  B 2 13  ? 20.194  39.175 29.129  1.00 48.34  ? 13   DT  C C7    1 
ATOM   525  C  C6    . DT  B 2 13  ? 17.777  39.053 29.724  1.00 49.75  ? 13   DT  C C6    1 
ATOM   526  P  P     . DA  B 2 14  ? 12.495  41.933 31.370  1.00 55.75  ? 14   DA  C P     1 
ATOM   527  O  OP1   . DA  B 2 14  ? 11.042  42.242 31.338  1.00 55.14  ? 14   DA  C OP1   1 
ATOM   528  O  OP2   . DA  B 2 14  ? 13.488  43.011 31.142  1.00 55.22  ? 14   DA  C OP2   1 
ATOM   529  O  "O5'" . DA  B 2 14  ? 12.811  41.235 32.755  1.00 53.87  ? 14   DA  C "O5'" 1 
ATOM   530  C  "C5'" . DA  B 2 14  ? 12.144  40.035 33.111  1.00 52.74  ? 14   DA  C "C5'" 1 
ATOM   531  C  "C4'" . DA  B 2 14  ? 12.685  39.537 34.424  1.00 52.67  ? 14   DA  C "C4'" 1 
ATOM   532  O  "O4'" . DA  B 2 14  ? 14.011  38.993 34.222  1.00 51.00  ? 14   DA  C "O4'" 1 
ATOM   533  C  "C3'" . DA  B 2 14  ? 12.848  40.662 35.443  1.00 53.25  ? 14   DA  C "C3'" 1 
ATOM   534  O  "O3'" . DA  B 2 14  ? 12.593  40.145 36.741  1.00 54.95  ? 14   DA  C "O3'" 1 
ATOM   535  C  "C2'" . DA  B 2 14  ? 14.314  41.030 35.316  1.00 51.66  ? 14   DA  C "C2'" 1 
ATOM   536  C  "C1'" . DA  B 2 14  ? 14.913  39.660 35.090  1.00 50.35  ? 14   DA  C "C1'" 1 
ATOM   537  N  N9    . DA  B 2 14  ? 16.235  39.622 34.478  1.00 47.83  ? 14   DA  C N9    1 
ATOM   538  C  C8    . DA  B 2 14  ? 16.795  40.449 33.537  1.00 46.87  ? 14   DA  C C8    1 
ATOM   539  N  N7    . DA  B 2 14  ? 18.006  40.093 33.180  1.00 47.27  ? 14   DA  C N7    1 
ATOM   540  C  C5    . DA  B 2 14  ? 18.261  38.963 33.948  1.00 44.26  ? 14   DA  C C5    1 
ATOM   541  C  C6    . DA  B 2 14  ? 19.367  38.107 34.032  1.00 42.98  ? 14   DA  C C6    1 
ATOM   542  N  N6    . DA  B 2 14  ? 20.472  38.254 33.303  1.00 42.25  ? 14   DA  C N6    1 
ATOM   543  N  N1    . DA  B 2 14  ? 19.300  37.074 34.901  1.00 44.68  ? 14   DA  C N1    1 
ATOM   544  C  C2    . DA  B 2 14  ? 18.185  36.922 35.631  1.00 44.24  ? 14   DA  C C2    1 
ATOM   545  N  N3    . DA  B 2 14  ? 17.079  37.657 35.636  1.00 44.89  ? 14   DA  C N3    1 
ATOM   546  C  C4    . DA  B 2 14  ? 17.184  38.672 34.759  1.00 45.70  ? 14   DA  C C4    1 
ATOM   547  P  P     . DG  B 2 15  ? 12.571  41.135 37.999  1.00 58.38  ? 15   DG  C P     1 
ATOM   548  O  OP1   . DG  B 2 15  ? 11.175  41.201 38.503  1.00 57.63  ? 15   DG  C OP1   1 
ATOM   549  O  OP2   . DG  B 2 15  ? 13.282  42.384 37.623  1.00 58.14  ? 15   DG  C OP2   1 
ATOM   550  O  "O5'" . DG  B 2 15  ? 13.442  40.347 39.068  1.00 56.87  ? 15   DG  C "O5'" 1 
ATOM   551  C  "C5'" . DG  B 2 15  ? 13.222  38.958 39.263  1.00 53.93  ? 15   DG  C "C5'" 1 
ATOM   552  C  "C4'" . DG  B 2 15  ? 14.337  38.360 40.085  1.00 53.64  ? 15   DG  C "C4'" 1 
ATOM   553  O  "O4'" . DG  B 2 15  ? 15.543  38.204 39.296  1.00 51.03  ? 15   DG  C "O4'" 1 
ATOM   554  C  "C3'" . DG  B 2 15  ? 14.718  39.188 41.308  1.00 53.32  ? 15   DG  C "C3'" 1 
ATOM   555  O  "O3'" . DG  B 2 15  ? 14.869  38.316 42.425  1.00 57.40  ? 15   DG  C "O3'" 1 
ATOM   556  C  "C2'" . DG  B 2 15  ? 16.035  39.834 40.910  1.00 52.07  ? 15   DG  C "C2'" 1 
ATOM   557  C  "C1'" . DG  B 2 15  ? 16.642  38.813 39.957  1.00 50.94  ? 15   DG  C "C1'" 1 
ATOM   558  N  N9    . DG  B 2 15  ? 17.499  39.393 38.930  1.00 48.28  ? 15   DG  C N9    1 
ATOM   559  C  C8    . DG  B 2 15  ? 17.183  40.439 38.101  1.00 47.62  ? 15   DG  C C8    1 
ATOM   560  N  N7    . DG  B 2 15  ? 18.128  40.721 37.249  1.00 46.91  ? 15   DG  C N7    1 
ATOM   561  C  C5    . DG  B 2 15  ? 19.134  39.813 37.536  1.00 46.10  ? 15   DG  C C5    1 
ATOM   562  C  C6    . DG  B 2 15  ? 20.401  39.629 36.927  1.00 46.18  ? 15   DG  C C6    1 
ATOM   563  O  O6    . DG  B 2 15  ? 20.902  40.258 35.986  1.00 45.67  ? 15   DG  C O6    1 
ATOM   564  N  N1    . DG  B 2 15  ? 21.108  38.588 37.520  1.00 46.03  ? 15   DG  C N1    1 
ATOM   565  C  C2    . DG  B 2 15  ? 20.655  37.825 38.567  1.00 46.37  ? 15   DG  C C2    1 
ATOM   566  N  N2    . DG  B 2 15  ? 21.488  36.864 38.997  1.00 47.44  ? 15   DG  C N2    1 
ATOM   567  N  N3    . DG  B 2 15  ? 19.473  37.990 39.148  1.00 46.83  ? 15   DG  C N3    1 
ATOM   568  C  C4    . DG  B 2 15  ? 18.769  38.992 38.581  1.00 46.97  ? 15   DG  C C4    1 
ATOM   569  P  P     . DC  B 2 16  ? 15.206  38.921 43.869  1.00 59.30  ? 16   DC  C P     1 
ATOM   570  O  OP1   . DC  B 2 16  ? 14.705  37.973 44.896  1.00 59.94  ? 16   DC  C OP1   1 
ATOM   571  O  OP2   . DC  B 2 16  ? 14.748  40.336 43.884  1.00 61.09  ? 16   DC  C OP2   1 
ATOM   572  O  "O5'" . DC  B 2 16  ? 16.798  38.904 43.892  1.00 59.00  ? 16   DC  C "O5'" 1 
ATOM   573  C  "C5'" . DC  B 2 16  ? 17.507  37.720 43.544  1.00 58.34  ? 16   DC  C "C5'" 1 
ATOM   574  C  "C4'" . DC  B 2 16  ? 18.993  37.958 43.642  1.00 59.71  ? 16   DC  C "C4'" 1 
ATOM   575  O  "O4'" . DC  B 2 16  ? 19.515  38.524 42.413  1.00 59.24  ? 16   DC  C "O4'" 1 
ATOM   576  C  "C3'" . DC  B 2 16  ? 19.397  38.911 44.767  1.00 60.82  ? 16   DC  C "C3'" 1 
ATOM   577  O  "O3'" . DC  B 2 16  ? 20.484  38.356 45.505  1.00 63.51  ? 16   DC  C "O3'" 1 
ATOM   578  C  "C2'" . DC  B 2 16  ? 19.837  40.167 44.029  1.00 59.69  ? 16   DC  C "C2'" 1 
ATOM   579  C  "C1'" . DC  B 2 16  ? 20.381  39.597 42.731  1.00 58.39  ? 16   DC  C "C1'" 1 
ATOM   580  N  N1    . DC  B 2 16  ? 20.400  40.527 41.587  1.00 56.92  ? 16   DC  C N1    1 
ATOM   581  C  C2    . DC  B 2 16  ? 21.501  40.506 40.721  1.00 56.24  ? 16   DC  C C2    1 
ATOM   582  O  O2    . DC  B 2 16  ? 22.422  39.708 40.945  1.00 56.75  ? 16   DC  C O2    1 
ATOM   583  N  N3    . DC  B 2 16  ? 21.534  41.359 39.668  1.00 54.10  ? 16   DC  C N3    1 
ATOM   584  C  C4    . DC  B 2 16  ? 20.527  42.211 39.470  1.00 54.01  ? 16   DC  C C4    1 
ATOM   585  N  N4    . DC  B 2 16  ? 20.604  43.044 38.428  1.00 54.35  ? 16   DC  C N4    1 
ATOM   586  C  C5    . DC  B 2 16  ? 19.394  42.251 40.334  1.00 55.17  ? 16   DC  C C5    1 
ATOM   587  C  C6    . DC  B 2 16  ? 19.371  41.399 41.369  1.00 55.76  ? 16   DC  C C6    1 
ATOM   588  P  P     . DC  B 2 17  ? 20.763  38.852 47.009  1.00 64.14  ? 17   DC  C P     1 
ATOM   589  O  OP1   . DC  B 2 17  ? 20.598  37.683 47.915  1.00 65.28  ? 17   DC  C OP1   1 
ATOM   590  O  OP2   . DC  B 2 17  ? 19.969  40.082 47.248  1.00 63.36  ? 17   DC  C OP2   1 
ATOM   591  O  "O5'" . DC  B 2 17  ? 22.310  39.221 46.956  1.00 60.10  ? 17   DC  C "O5'" 1 
ATOM   592  C  "C5'" . DC  B 2 17  ? 23.247  38.239 46.543  1.00 58.37  ? 17   DC  C "C5'" 1 
ATOM   593  C  "C4'" . DC  B 2 17  ? 24.522  38.889 46.066  1.00 57.13  ? 17   DC  C "C4'" 1 
ATOM   594  O  "O4'" . DC  B 2 17  ? 24.308  39.546 44.792  1.00 56.47  ? 17   DC  C "O4'" 1 
ATOM   595  C  "C3'" . DC  B 2 17  ? 25.098  39.939 47.017  1.00 56.67  ? 17   DC  C "C3'" 1 
ATOM   596  O  "O3'" . DC  B 2 17  ? 26.379  39.541 47.543  1.00 56.77  ? 17   DC  C "O3'" 1 
ATOM   597  C  "C2'" . DC  B 2 17  ? 25.049  41.234 46.220  1.00 55.85  ? 17   DC  C "C2'" 1 
ATOM   598  C  "C1'" . DC  B 2 17  ? 25.018  40.768 44.769  1.00 54.53  ? 17   DC  C "C1'" 1 
ATOM   599  N  N1    . DC  B 2 17  ? 24.309  41.688 43.861  1.00 50.77  ? 17   DC  C N1    1 
ATOM   600  C  C2    . DC  B 2 17  ? 24.870  41.984 42.610  1.00 49.55  ? 17   DC  C C2    1 
ATOM   601  O  O2    . DC  B 2 17  ? 25.939  41.450 42.288  1.00 49.17  ? 17   DC  C O2    1 
ATOM   602  N  N3    . DC  B 2 17  ? 24.229  42.847 41.783  1.00 48.51  ? 17   DC  C N3    1 
ATOM   603  C  C4    . DC  B 2 17  ? 23.075  43.400 42.163  1.00 47.78  ? 17   DC  C C4    1 
ATOM   604  N  N4    . DC  B 2 17  ? 22.478  44.250 41.317  1.00 46.13  ? 17   DC  C N4    1 
ATOM   605  C  C5    . DC  B 2 17  ? 22.478  43.110 43.428  1.00 49.33  ? 17   DC  C C5    1 
ATOM   606  C  C6    . DC  B 2 17  ? 23.123  42.256 44.235  1.00 50.52  ? 17   DC  C C6    1 
ATOM   607  N  N     . MET C 3 1   ? 48.597  20.916 14.968  1.00 42.23  ? 1    MET A N     1 
ATOM   608  C  CA    . MET C 3 1   ? 47.663  19.794 15.269  1.00 42.42  ? 1    MET A CA    1 
ATOM   609  C  C     . MET C 3 1   ? 47.072  19.189 14.000  1.00 40.67  ? 1    MET A C     1 
ATOM   610  O  O     . MET C 3 1   ? 46.731  19.900 13.052  1.00 38.29  ? 1    MET A O     1 
ATOM   611  C  CB    . MET C 3 1   ? 46.526  20.272 16.187  1.00 45.09  ? 1    MET A CB    1 
ATOM   612  C  CG    . MET C 3 1   ? 45.394  19.273 16.350  1.00 48.56  ? 1    MET A CG    1 
ATOM   613  S  SD    . MET C 3 1   ? 44.118  19.811 17.463  1.00 56.43  ? 1    MET A SD    1 
ATOM   614  C  CE    . MET C 3 1   ? 43.374  21.193 16.611  1.00 54.76  ? 1    MET A CE    1 
ATOM   615  N  N     . ILE C 3 2   ? 46.967  17.864 14.001  1.00 39.24  ? 2    ILE A N     1 
ATOM   616  C  CA    . ILE C 3 2   ? 46.400  17.123 12.880  1.00 40.06  ? 2    ILE A CA    1 
ATOM   617  C  C     . ILE C 3 2   ? 45.155  16.390 13.369  1.00 39.31  ? 2    ILE A C     1 
ATOM   618  O  O     . ILE C 3 2   ? 45.223  15.545 14.257  1.00 40.49  ? 2    ILE A O     1 
ATOM   619  C  CB    . ILE C 3 2   ? 47.425  16.115 12.304  1.00 39.17  ? 2    ILE A CB    1 
ATOM   620  C  CG1   . ILE C 3 2   ? 48.535  16.894 11.587  1.00 39.71  ? 2    ILE A CG1   1 
ATOM   621  C  CG2   . ILE C 3 2   ? 46.739  15.126 11.362  1.00 36.71  ? 2    ILE A CG2   1 
ATOM   622  C  CD1   . ILE C 3 2   ? 49.671  16.037 11.078  1.00 42.22  ? 2    ILE A CD1   1 
ATOM   623  N  N     . VAL C 3 3   ? 44.013  16.730 12.790  1.00 38.05  ? 3    VAL A N     1 
ATOM   624  C  CA    . VAL C 3 3   ? 42.759  16.110 13.193  1.00 37.87  ? 3    VAL A CA    1 
ATOM   625  C  C     . VAL C 3 3   ? 42.226  15.206 12.098  1.00 36.66  ? 3    VAL A C     1 
ATOM   626  O  O     . VAL C 3 3   ? 42.209  15.585 10.927  1.00 35.23  ? 3    VAL A O     1 
ATOM   627  C  CB    . VAL C 3 3   ? 41.680  17.176 13.518  1.00 36.70  ? 3    VAL A CB    1 
ATOM   628  C  CG1   . VAL C 3 3   ? 40.370  16.500 13.894  1.00 36.21  ? 3    VAL A CG1   1 
ATOM   629  C  CG2   . VAL C 3 3   ? 42.145  18.059 14.666  1.00 38.17  ? 3    VAL A CG2   1 
ATOM   630  N  N     . LEU C 3 4   ? 41.809  14.002 12.486  1.00 36.67  ? 4    LEU A N     1 
ATOM   631  C  CA    . LEU C 3 4   ? 41.243  13.048 11.537  1.00 35.43  ? 4    LEU A CA    1 
ATOM   632  C  C     . LEU C 3 4   ? 39.791  12.850 11.953  1.00 35.08  ? 4    LEU A C     1 
ATOM   633  O  O     . LEU C 3 4   ? 39.499  12.405 13.067  1.00 35.38  ? 4    LEU A O     1 
ATOM   634  C  CB    . LEU C 3 4   ? 42.007  11.719 11.567  1.00 35.80  ? 4    LEU A CB    1 
ATOM   635  C  CG    . LEU C 3 4   ? 41.523  10.650 10.571  1.00 33.52  ? 4    LEU A CG    1 
ATOM   636  C  CD1   . LEU C 3 4   ? 42.688  9.779  10.161  1.00 31.47  ? 4    LEU A CD1   1 
ATOM   637  C  CD2   . LEU C 3 4   ? 40.417  9.818  11.184  1.00 31.60  ? 4    LEU A CD2   1 
ATOM   638  N  N     . PHE C 3 5   ? 38.890  13.196 11.043  1.00 32.23  ? 5    PHE A N     1 
ATOM   639  C  CA    . PHE C 3 5   ? 37.460  13.121 11.283  1.00 30.94  ? 5    PHE A CA    1 
ATOM   640  C  C     . PHE C 3 5   ? 36.837  11.985 10.481  1.00 33.28  ? 5    PHE A C     1 
ATOM   641  O  O     . PHE C 3 5   ? 37.120  11.829 9.282   1.00 35.19  ? 5    PHE A O     1 
ATOM   642  C  CB    . PHE C 3 5   ? 36.847  14.467 10.898  1.00 29.44  ? 5    PHE A CB    1 
ATOM   643  C  CG    . PHE C 3 5   ? 35.356  14.487 10.891  1.00 29.60  ? 5    PHE A CG    1 
ATOM   644  C  CD1   . PHE C 3 5   ? 34.643  14.362 12.073  1.00 27.70  ? 5    PHE A CD1   1 
ATOM   645  C  CD2   . PHE C 3 5   ? 34.661  14.669 9.696   1.00 29.20  ? 5    PHE A CD2   1 
ATOM   646  C  CE1   . PHE C 3 5   ? 33.265  14.423 12.069  1.00 28.32  ? 5    PHE A CE1   1 
ATOM   647  C  CE2   . PHE C 3 5   ? 33.279  14.733 9.679   1.00 28.26  ? 5    PHE A CE2   1 
ATOM   648  C  CZ    . PHE C 3 5   ? 32.577  14.610 10.868  1.00 30.16  ? 5    PHE A CZ    1 
ATOM   649  N  N     . VAL C 3 6   ? 36.016  11.175 11.147  1.00 31.80  ? 6    VAL A N     1 
ATOM   650  C  CA    . VAL C 3 6   ? 35.351  10.061 10.485  1.00 32.14  ? 6    VAL A CA    1 
ATOM   651  C  C     . VAL C 3 6   ? 33.845  10.319 10.504  1.00 32.31  ? 6    VAL A C     1 
ATOM   652  O  O     . VAL C 3 6   ? 33.295  10.712 11.534  1.00 31.80  ? 6    VAL A O     1 
ATOM   653  C  CB    . VAL C 3 6   ? 35.636  8.706  11.198  1.00 32.70  ? 6    VAL A CB    1 
ATOM   654  C  CG1   . VAL C 3 6   ? 35.011  7.571  10.410  1.00 34.47  ? 6    VAL A CG1   1 
ATOM   655  C  CG2   . VAL C 3 6   ? 37.133  8.463  11.321  1.00 30.36  ? 6    VAL A CG2   1 
ATOM   656  N  N     . ASP C 3 7   ? 33.198  10.113 9.356   1.00 31.06  ? 7    ASP A N     1 
ATOM   657  C  CA    . ASP C 3 7   ? 31.755  10.295 9.198   1.00 31.57  ? 7    ASP A CA    1 
ATOM   658  C  C     . ASP C 3 7   ? 31.222  9.104  8.382   1.00 32.18  ? 7    ASP A C     1 
ATOM   659  O  O     . ASP C 3 7   ? 31.588  8.943  7.210   1.00 32.01  ? 7    ASP A O     1 
ATOM   660  C  CB    . ASP C 3 7   ? 31.468  11.603 8.449   1.00 30.63  ? 7    ASP A CB    1 
ATOM   661  C  CG    . ASP C 3 7   ? 29.984  11.947 8.416   1.00 32.84  ? 7    ASP A CG    1 
ATOM   662  O  OD1   . ASP C 3 7   ? 29.143  11.024 8.410   1.00 35.22  ? 7    ASP A OD1   1 
ATOM   663  O  OD2   . ASP C 3 7   ? 29.650  13.143 8.382   1.00 34.30  ? 7    ASP A OD2   1 
ATOM   664  N  N     . PHE C 3 8   ? 30.374  8.275  8.992   1.00 31.52  ? 8    PHE A N     1 
ATOM   665  C  CA    . PHE C 3 8   ? 29.826  7.096  8.307   1.00 31.11  ? 8    PHE A CA    1 
ATOM   666  C  C     . PHE C 3 8   ? 28.904  7.492  7.153   1.00 31.09  ? 8    PHE A C     1 
ATOM   667  O  O     . PHE C 3 8   ? 28.114  8.424  7.273   1.00 30.36  ? 8    PHE A O     1 
ATOM   668  C  CB    . PHE C 3 8   ? 29.062  6.192  9.297   1.00 30.72  ? 8    PHE A CB    1 
ATOM   669  C  CG    . PHE C 3 8   ? 29.804  5.921  10.591  1.00 29.52  ? 8    PHE A CG    1 
ATOM   670  C  CD1   . PHE C 3 8   ? 31.183  6.103  10.688  1.00 28.68  ? 8    PHE A CD1   1 
ATOM   671  C  CD2   . PHE C 3 8   ? 29.110  5.497  11.720  1.00 30.29  ? 8    PHE A CD2   1 
ATOM   672  C  CE1   . PHE C 3 8   ? 31.857  5.869  11.892  1.00 29.64  ? 8    PHE A CE1   1 
ATOM   673  C  CE2   . PHE C 3 8   ? 29.764  5.259  12.923  1.00 29.53  ? 8    PHE A CE2   1 
ATOM   674  C  CZ    . PHE C 3 8   ? 31.144  5.448  13.014  1.00 31.21  ? 8    PHE A CZ    1 
ATOM   675  N  N     . ASP C 3 9   ? 29.000  6.786  6.030   1.00 31.58  ? 9    ASP A N     1 
ATOM   676  C  CA    . ASP C 3 9   ? 28.156  7.104  4.872   1.00 32.57  ? 9    ASP A CA    1 
ATOM   677  C  C     . ASP C 3 9   ? 26.694  6.674  5.026   1.00 31.46  ? 9    ASP A C     1 
ATOM   678  O  O     . ASP C 3 9   ? 26.441  5.580  5.520   1.00 29.95  ? 9    ASP A O     1 
ATOM   679  C  CB    . ASP C 3 9   ? 28.748  6.464  3.604   1.00 33.27  ? 9    ASP A CB    1 
ATOM   680  C  CG    . ASP C 3 9   ? 30.178  6.872  3.362   1.00 38.05  ? 9    ASP A CG    1 
ATOM   681  O  OD1   . ASP C 3 9   ? 30.471  8.084  3.437   1.00 39.78  ? 9    ASP A OD1   1 
ATOM   682  O  OD2   . ASP C 3 9   ? 31.005  5.976  3.091   1.00 40.29  ? 9    ASP A OD2   1 
ATOM   683  N  N     . TYR C 3 10  ? 25.753  7.535  4.615   1.00 31.79  ? 10   TYR A N     1 
ATOM   684  C  CA    . TYR C 3 10  ? 24.316  7.268  4.667   1.00 31.69  ? 10   TYR A CA    1 
ATOM   685  C  C     . TYR C 3 10  ? 24.010  6.169  5.695   1.00 31.13  ? 10   TYR A C     1 
ATOM   686  O  O     . TYR C 3 10  ? 23.335  5.182  5.444   1.00 30.76  ? 10   TYR A O     1 
ATOM   687  C  CB    . TYR C 3 10  ? 23.813  6.888  3.265   1.00 33.84  ? 10   TYR A CB    1 
ATOM   688  C  CG    . TYR C 3 10  ? 24.405  5.642  2.639   1.00 37.03  ? 10   TYR A CG    1 
ATOM   689  C  CD1   . TYR C 3 10  ? 23.641  4.474  2.540   1.00 38.88  ? 10   TYR A CD1   1 
ATOM   690  C  CD2   . TYR C 3 10  ? 25.723  5.612  2.155   1.00 39.13  ? 10   TYR A CD2   1 
ATOM   691  C  CE1   . TYR C 3 10  ? 24.162  3.301  1.980   1.00 37.68  ? 10   TYR A CE1   1 
ATOM   692  C  CE2   . TYR C 3 10  ? 26.258  4.432  1.593   1.00 41.15  ? 10   TYR A CE2   1 
ATOM   693  C  CZ    . TYR C 3 10  ? 25.466  3.286  1.513   1.00 40.51  ? 10   TYR A CZ    1 
ATOM   694  O  OH    . TYR C 3 10  ? 25.981  2.131  0.970   1.00 42.94  ? 10   TYR A OH    1 
ATOM   695  N  N     . PHE C 3 11  ? 24.509  6.425  6.892   1.00 29.21  ? 11   PHE A N     1 
ATOM   696  C  CA    . PHE C 3 11  ? 24.452  5.482  8.001   1.00 30.95  ? 11   PHE A CA    1 
ATOM   697  C  C     . PHE C 3 11  ? 23.272  4.531  8.239   1.00 29.28  ? 11   PHE A C     1 
ATOM   698  O  O     . PHE C 3 11  ? 23.444  3.323  8.107   1.00 29.91  ? 11   PHE A O     1 
ATOM   699  C  CB    . PHE C 3 11  ? 24.786  6.170  9.336   1.00 31.39  ? 11   PHE A CB    1 
ATOM   700  C  CG    . PHE C 3 11  ? 25.252  5.185  10.398  1.00 32.22  ? 11   PHE A CG    1 
ATOM   701  C  CD1   . PHE C 3 11  ? 26.178  4.183  10.072  1.00 32.09  ? 11   PHE A CD1   1 
ATOM   702  C  CD2   . PHE C 3 11  ? 24.751  5.223  11.693  1.00 32.06  ? 11   PHE A CD2   1 
ATOM   703  C  CE1   . PHE C 3 11  ? 26.586  3.237  11.027  1.00 34.43  ? 11   PHE A CE1   1 
ATOM   704  C  CE2   . PHE C 3 11  ? 25.153  4.284  12.657  1.00 36.27  ? 11   PHE A CE2   1 
ATOM   705  C  CZ    . PHE C 3 11  ? 26.070  3.289  12.324  1.00 34.15  ? 11   PHE A CZ    1 
ATOM   706  N  N     . TYR C 3 12  ? 22.104  5.036  8.633   1.00 28.91  ? 12   TYR A N     1 
ATOM   707  C  CA    . TYR C 3 12  ? 20.945  4.165  8.910   1.00 29.14  ? 12   TYR A CA    1 
ATOM   708  C  C     . TYR C 3 12  ? 20.615  3.274  7.720   1.00 30.65  ? 12   TYR A C     1 
ATOM   709  O  O     . TYR C 3 12  ? 20.284  2.097  7.884   1.00 29.64  ? 12   TYR A O     1 
ATOM   710  C  CB    . TYR C 3 12  ? 19.717  5.004  9.267   1.00 30.29  ? 12   TYR A CB    1 
ATOM   711  C  CG    . TYR C 3 12  ? 19.802  5.741  10.592  1.00 30.14  ? 12   TYR A CG    1 
ATOM   712  C  CD1   . TYR C 3 12  ? 21.013  5.857  11.289  1.00 30.67  ? 12   TYR A CD1   1 
ATOM   713  C  CD2   . TYR C 3 12  ? 18.669  6.346  11.137  1.00 27.42  ? 12   TYR A CD2   1 
ATOM   714  C  CE1   . TYR C 3 12  ? 21.083  6.560  12.496  1.00 30.68  ? 12   TYR A CE1   1 
ATOM   715  C  CE2   . TYR C 3 12  ? 18.733  7.043  12.325  1.00 27.41  ? 12   TYR A CE2   1 
ATOM   716  C  CZ    . TYR C 3 12  ? 19.927  7.152  13.000  1.00 31.37  ? 12   TYR A CZ    1 
ATOM   717  O  OH    . TYR C 3 12  ? 19.930  7.879  14.171  1.00 34.04  ? 12   TYR A OH    1 
ATOM   718  N  N     . ALA C 3 13  ? 20.720  3.843  6.523   1.00 31.05  ? 13   ALA A N     1 
ATOM   719  C  CA    . ALA C 3 13  ? 20.441  3.114  5.294   1.00 30.72  ? 13   ALA A CA    1 
ATOM   720  C  C     . ALA C 3 13  ? 21.508  2.052  5.047   1.00 30.70  ? 13   ALA A C     1 
ATOM   721  O  O     . ALA C 3 13  ? 21.179  0.903  4.763   1.00 31.56  ? 13   ALA A O     1 
ATOM   722  C  CB    . ALA C 3 13  ? 20.372  4.081  4.121   1.00 28.93  ? 13   ALA A CB    1 
ATOM   723  N  N     . GLN C 3 14  ? 22.779  2.423  5.178   1.00 31.86  ? 14   GLN A N     1 
ATOM   724  C  CA    . GLN C 3 14  ? 23.872  1.474  4.958   1.00 33.32  ? 14   GLN A CA    1 
ATOM   725  C  C     . GLN C 3 14  ? 23.851  0.296  5.939   1.00 34.72  ? 14   GLN A C     1 
ATOM   726  O  O     . GLN C 3 14  ? 24.222  -0.826 5.575   1.00 36.18  ? 14   GLN A O     1 
ATOM   727  C  CB    . GLN C 3 14  ? 25.239  2.178  5.008   1.00 31.90  ? 14   GLN A CB    1 
ATOM   728  C  CG    . GLN C 3 14  ? 26.423  1.217  4.809   1.00 33.98  ? 14   GLN A CG    1 
ATOM   729  C  CD    . GLN C 3 14  ? 27.769  1.908  4.614   1.00 35.00  ? 14   GLN A CD    1 
ATOM   730  O  OE1   . GLN C 3 14  ? 27.972  3.071  5.010   1.00 36.12  ? 14   GLN A OE1   1 
ATOM   731  N  NE2   . GLN C 3 14  ? 28.705  1.185  4.019   1.00 32.42  ? 14   GLN A NE2   1 
ATOM   732  N  N     . VAL C 3 15  ? 23.429  0.530  7.175   1.00 33.81  ? 15   VAL A N     1 
ATOM   733  C  CA    . VAL C 3 15  ? 23.356  -0.568 8.138   1.00 35.26  ? 15   VAL A CA    1 
ATOM   734  C  C     . VAL C 3 15  ? 22.306  -1.578 7.654   1.00 36.96  ? 15   VAL A C     1 
ATOM   735  O  O     . VAL C 3 15  ? 22.543  -2.787 7.670   1.00 37.69  ? 15   VAL A O     1 
ATOM   736  C  CB    . VAL C 3 15  ? 22.974  -0.064 9.544   1.00 34.04  ? 15   VAL A CB    1 
ATOM   737  C  CG1   . VAL C 3 15  ? 22.691  -1.240 10.466  1.00 33.18  ? 15   VAL A CG1   1 
ATOM   738  C  CG2   . VAL C 3 15  ? 24.117  0.801  10.111  1.00 30.30  ? 15   VAL A CG2   1 
ATOM   739  N  N     . GLU C 3 16  ? 21.157  -1.075 7.213   1.00 36.97  ? 16   GLU A N     1 
ATOM   740  C  CA    . GLU C 3 16  ? 20.095  -1.943 6.714   1.00 39.14  ? 16   GLU A CA    1 
ATOM   741  C  C     . GLU C 3 16  ? 20.615  -2.763 5.533   1.00 39.89  ? 16   GLU A C     1 
ATOM   742  O  O     . GLU C 3 16  ? 20.275  -3.937 5.383   1.00 40.64  ? 16   GLU A O     1 
ATOM   743  C  CB    . GLU C 3 16  ? 18.879  -1.117 6.282   1.00 37.29  ? 16   GLU A CB    1 
ATOM   744  C  CG    . GLU C 3 16  ? 18.160  -0.405 7.421   1.00 36.20  ? 16   GLU A CG    1 
ATOM   745  C  CD    . GLU C 3 16  ? 17.499  -1.364 8.409   1.00 36.93  ? 16   GLU A CD    1 
ATOM   746  O  OE1   . GLU C 3 16  ? 17.627  -2.588 8.232   1.00 37.50  ? 16   GLU A OE1   1 
ATOM   747  O  OE2   . GLU C 3 16  ? 16.847  -0.898 9.370   1.00 35.84  ? 16   GLU A OE2   1 
ATOM   748  N  N     . GLU C 3 17  ? 21.448  -2.150 4.699   1.00 40.76  ? 17   GLU A N     1 
ATOM   749  C  CA    . GLU C 3 17  ? 22.010  -2.860 3.557   1.00 43.97  ? 17   GLU A CA    1 
ATOM   750  C  C     . GLU C 3 17  ? 22.962  -3.949 4.022   1.00 45.35  ? 17   GLU A C     1 
ATOM   751  O  O     . GLU C 3 17  ? 23.007  -5.030 3.435   1.00 47.19  ? 17   GLU A O     1 
ATOM   752  C  CB    . GLU C 3 17  ? 22.760  -1.907 2.633   1.00 43.42  ? 17   GLU A CB    1 
ATOM   753  C  CG    . GLU C 3 17  ? 21.867  -0.952 1.880   1.00 46.62  ? 17   GLU A CG    1 
ATOM   754  C  CD    . GLU C 3 17  ? 22.652  -0.070 0.931   1.00 48.34  ? 17   GLU A CD    1 
ATOM   755  O  OE1   . GLU C 3 17  ? 23.886  -0.254 0.833   1.00 49.24  ? 17   GLU A OE1   1 
ATOM   756  O  OE2   . GLU C 3 17  ? 22.037  0.806  0.286   1.00 49.48  ? 17   GLU A OE2   1 
ATOM   757  N  N     . VAL C 3 18  ? 23.729  -3.669 5.072   1.00 45.39  ? 18   VAL A N     1 
ATOM   758  C  CA    . VAL C 3 18  ? 24.665  -4.663 5.580   1.00 45.39  ? 18   VAL A CA    1 
ATOM   759  C  C     . VAL C 3 18  ? 23.875  -5.834 6.125   1.00 45.32  ? 18   VAL A C     1 
ATOM   760  O  O     . VAL C 3 18  ? 24.252  -6.992 5.933   1.00 47.03  ? 18   VAL A O     1 
ATOM   761  C  CB    . VAL C 3 18  ? 25.575  -4.104 6.709   1.00 44.82  ? 18   VAL A CB    1 
ATOM   762  C  CG1   . VAL C 3 18  ? 26.379  -5.239 7.332   1.00 44.20  ? 18   VAL A CG1   1 
ATOM   763  C  CG2   . VAL C 3 18  ? 26.533  -3.064 6.145   1.00 42.82  ? 18   VAL A CG2   1 
ATOM   764  N  N     . LEU C 3 19  ? 22.769  -5.536 6.795   1.00 43.15  ? 19   LEU A N     1 
ATOM   765  C  CA    . LEU C 3 19  ? 21.948  -6.594 7.362   1.00 43.64  ? 19   LEU A CA    1 
ATOM   766  C  C     . LEU C 3 19  ? 21.140  -7.364 6.314   1.00 44.14  ? 19   LEU A C     1 
ATOM   767  O  O     . LEU C 3 19  ? 20.788  -8.522 6.529   1.00 46.23  ? 19   LEU A O     1 
ATOM   768  C  CB    . LEU C 3 19  ? 21.014  -6.023 8.434   1.00 42.34  ? 19   LEU A CB    1 
ATOM   769  C  CG    . LEU C 3 19  ? 21.521  -6.054 9.884   1.00 44.02  ? 19   LEU A CG    1 
ATOM   770  C  CD1   . LEU C 3 19  ? 22.904  -5.415 9.973   1.00 43.89  ? 19   LEU A CD1   1 
ATOM   771  C  CD2   . LEU C 3 19  ? 20.529  -5.318 10.796  1.00 44.05  ? 19   LEU A CD2   1 
ATOM   772  N  N     . ASN C 3 20  ? 20.850  -6.727 5.186   1.00 43.88  ? 20   ASN A N     1 
ATOM   773  C  CA    . ASN C 3 20  ? 20.082  -7.360 4.112   1.00 44.01  ? 20   ASN A CA    1 
ATOM   774  C  C     . ASN C 3 20  ? 20.708  -6.941 2.787   1.00 43.25  ? 20   ASN A C     1 
ATOM   775  O  O     . ASN C 3 20  ? 20.259  -5.989 2.159   1.00 42.77  ? 20   ASN A O     1 
ATOM   776  C  CB    . ASN C 3 20  ? 18.622  -6.897 4.165   1.00 43.92  ? 20   ASN A CB    1 
ATOM   777  C  CG    . ASN C 3 20  ? 17.787  -7.474 3.037   1.00 46.11  ? 20   ASN A CG    1 
ATOM   778  O  OD1   . ASN C 3 20  ? 18.323  -7.927 2.028   1.00 47.07  ? 20   ASN A OD1   1 
ATOM   779  N  ND2   . ASN C 3 20  ? 16.469  -7.442 3.193   1.00 43.36  ? 20   ASN A ND2   1 
ATOM   780  N  N     . PRO C 3 21  ? 21.746  -7.664 2.339   1.00 43.97  ? 21   PRO A N     1 
ATOM   781  C  CA    . PRO C 3 21  ? 22.460  -7.375 1.091   1.00 43.43  ? 21   PRO A CA    1 
ATOM   782  C  C     . PRO C 3 21  ? 21.614  -7.224 -0.165  1.00 44.28  ? 21   PRO A C     1 
ATOM   783  O  O     . PRO C 3 21  ? 22.014  -6.530 -1.106  1.00 44.76  ? 21   PRO A O     1 
ATOM   784  C  CB    . PRO C 3 21  ? 23.450  -8.531 0.985   1.00 44.34  ? 21   PRO A CB    1 
ATOM   785  C  CG    . PRO C 3 21  ? 23.722  -8.870 2.432   1.00 44.39  ? 21   PRO A CG    1 
ATOM   786  C  CD    . PRO C 3 21  ? 22.326  -8.843 3.009   1.00 43.64  ? 21   PRO A CD    1 
ATOM   787  N  N     . SER C 3 22  ? 20.448  -7.856 -0.194  1.00 43.93  ? 22   SER A N     1 
ATOM   788  C  CA    . SER C 3 22  ? 19.608  -7.754 -1.386  1.00 45.89  ? 22   SER A CA    1 
ATOM   789  C  C     . SER C 3 22  ? 19.169  -6.316 -1.638  1.00 45.99  ? 22   SER A C     1 
ATOM   790  O  O     . SER C 3 22  ? 18.672  -5.992 -2.718  1.00 46.21  ? 22   SER A O     1 
ATOM   791  C  CB    . SER C 3 22  ? 18.373  -8.650 -1.258  1.00 45.79  ? 22   SER A CB    1 
ATOM   792  O  OG    . SER C 3 22  ? 17.431  -8.092 -0.361  1.00 50.07  ? 22   SER A OG    1 
ATOM   793  N  N     . LEU C 3 23  ? 19.366  -5.456 -0.639  1.00 45.34  ? 23   LEU A N     1 
ATOM   794  C  CA    . LEU C 3 23  ? 18.982  -4.050 -0.734  1.00 44.82  ? 23   LEU A CA    1 
ATOM   795  C  C     . LEU C 3 23  ? 19.969  -3.195 -1.520  1.00 45.53  ? 23   LEU A C     1 
ATOM   796  O  O     . LEU C 3 23  ? 19.587  -2.177 -2.086  1.00 43.07  ? 23   LEU A O     1 
ATOM   797  C  CB    . LEU C 3 23  ? 18.819  -3.449 0.669   1.00 43.74  ? 23   LEU A CB    1 
ATOM   798  C  CG    . LEU C 3 23  ? 17.652  -3.905 1.544   1.00 42.90  ? 23   LEU A CG    1 
ATOM   799  C  CD1   . LEU C 3 23  ? 17.836  -3.343 2.940   1.00 42.94  ? 23   LEU A CD1   1 
ATOM   800  C  CD2   . LEU C 3 23  ? 16.330  -3.437 0.949   1.00 41.82  ? 23   LEU A CD2   1 
ATOM   801  N  N     . LYS C 3 24  ? 21.238  -3.592 -1.546  1.00 48.68  ? 24   LYS A N     1 
ATOM   802  C  CA    . LYS C 3 24  ? 22.237  -2.809 -2.264  1.00 52.24  ? 24   LYS A CA    1 
ATOM   803  C  C     . LYS C 3 24  ? 21.841  -2.620 -3.720  1.00 52.56  ? 24   LYS A C     1 
ATOM   804  O  O     . LYS C 3 24  ? 21.524  -3.581 -4.416  1.00 53.44  ? 24   LYS A O     1 
ATOM   805  C  CB    . LYS C 3 24  ? 23.617  -3.473 -2.178  1.00 56.12  ? 24   LYS A CB    1 
ATOM   806  C  CG    . LYS C 3 24  ? 24.357  -3.195 -0.870  1.00 60.90  ? 24   LYS A CG    1 
ATOM   807  C  CD    . LYS C 3 24  ? 25.794  -3.732 -0.891  1.00 65.54  ? 24   LYS A CD    1 
ATOM   808  C  CE    . LYS C 3 24  ? 25.843  -5.264 -0.910  1.00 67.64  ? 24   LYS A CE    1 
ATOM   809  N  NZ    . LYS C 3 24  ? 27.239  -5.788 -0.749  1.00 67.55  ? 24   LYS A NZ    1 
ATOM   810  N  N     . GLY C 3 25  ? 21.845  -1.375 -4.176  1.00 52.49  ? 25   GLY A N     1 
ATOM   811  C  CA    . GLY C 3 25  ? 21.486  -1.110 -5.555  1.00 53.15  ? 25   GLY A CA    1 
ATOM   812  C  C     . GLY C 3 25  ? 20.137  -0.440 -5.692  1.00 52.90  ? 25   GLY A C     1 
ATOM   813  O  O     . GLY C 3 25  ? 19.938  0.377  -6.589  1.00 54.18  ? 25   GLY A O     1 
ATOM   814  N  N     . LYS C 3 26  ? 19.204  -0.780 -4.810  1.00 51.70  ? 26   LYS A N     1 
ATOM   815  C  CA    . LYS C 3 26  ? 17.879  -0.176 -4.863  1.00 51.51  ? 26   LYS A CA    1 
ATOM   816  C  C     . LYS C 3 26  ? 17.862  1.059  -3.975  1.00 49.96  ? 26   LYS A C     1 
ATOM   817  O  O     . LYS C 3 26  ? 18.727  1.221  -3.114  1.00 48.77  ? 26   LYS A O     1 
ATOM   818  C  CB    . LYS C 3 26  ? 16.815  -1.124 -4.319  1.00 52.88  ? 26   LYS A CB    1 
ATOM   819  C  CG    . LYS C 3 26  ? 16.879  -2.570 -4.749  1.00 53.96  ? 26   LYS A CG    1 
ATOM   820  C  CD    . LYS C 3 26  ? 15.840  -3.317 -3.925  1.00 55.17  ? 26   LYS A CD    1 
ATOM   821  C  CE    . LYS C 3 26  ? 15.779  -4.795 -4.215  1.00 58.32  ? 26   LYS A CE    1 
ATOM   822  N  NZ    . LYS C 3 26  ? 14.738  -5.420 -3.352  1.00 59.91  ? 26   LYS A NZ    1 
ATOM   823  N  N     . PRO C 3 27  ? 16.882  1.955  -4.181  1.00 48.37  ? 27   PRO A N     1 
ATOM   824  C  CA    . PRO C 3 27  ? 16.807  3.154  -3.341  1.00 47.02  ? 27   PRO A CA    1 
ATOM   825  C  C     . PRO C 3 27  ? 16.181  2.734  -2.012  1.00 45.72  ? 27   PRO A C     1 
ATOM   826  O  O     . PRO C 3 27  ? 15.120  2.103  -1.991  1.00 45.56  ? 27   PRO A O     1 
ATOM   827  C  CB    . PRO C 3 27  ? 15.905  4.085  -4.146  1.00 47.52  ? 27   PRO A CB    1 
ATOM   828  C  CG    . PRO C 3 27  ? 14.994  3.136  -4.849  1.00 49.32  ? 27   PRO A CG    1 
ATOM   829  C  CD    . PRO C 3 27  ? 15.937  2.043  -5.308  1.00 48.50  ? 27   PRO A CD    1 
ATOM   830  N  N     . VAL C 3 28  ? 16.850  3.059  -0.909  1.00 43.05  ? 28   VAL A N     1 
ATOM   831  C  CA    . VAL C 3 28  ? 16.364  2.697  0.423   1.00 39.76  ? 28   VAL A CA    1 
ATOM   832  C  C     . VAL C 3 28  ? 16.056  3.956  1.217   1.00 37.15  ? 28   VAL A C     1 
ATOM   833  O  O     . VAL C 3 28  ? 16.853  4.895  1.233   1.00 36.48  ? 28   VAL A O     1 
ATOM   834  C  CB    . VAL C 3 28  ? 17.420  1.861  1.195   1.00 39.55  ? 28   VAL A CB    1 
ATOM   835  C  CG1   . VAL C 3 28  ? 16.899  1.497  2.574   1.00 37.50  ? 28   VAL A CG1   1 
ATOM   836  C  CG2   . VAL C 3 28  ? 17.748  0.603  0.420   1.00 39.93  ? 28   VAL A CG2   1 
ATOM   837  N  N     . VAL C 3 29  ? 14.897  3.964  1.873   1.00 34.88  ? 29   VAL A N     1 
ATOM   838  C  CA    . VAL C 3 29  ? 14.452  5.106  2.657   1.00 32.46  ? 29   VAL A CA    1 
ATOM   839  C  C     . VAL C 3 29  ? 14.063  4.687  4.087   1.00 33.43  ? 29   VAL A C     1 
ATOM   840  O  O     . VAL C 3 29  ? 13.090  3.955  4.298   1.00 34.29  ? 29   VAL A O     1 
ATOM   841  C  CB    . VAL C 3 29  ? 13.237  5.791  1.964   1.00 32.25  ? 29   VAL A CB    1 
ATOM   842  C  CG1   . VAL C 3 29  ? 12.871  7.066  2.683   1.00 29.04  ? 29   VAL A CG1   1 
ATOM   843  C  CG2   . VAL C 3 29  ? 13.563  6.093  0.488   1.00 30.00  ? 29   VAL A CG2   1 
ATOM   844  N  N     . VAL C 3 30  ? 14.840  5.148  5.063   1.00 31.12  ? 30   VAL A N     1 
ATOM   845  C  CA    . VAL C 3 30  ? 14.587  4.849  6.464   1.00 29.38  ? 30   VAL A CA    1 
ATOM   846  C  C     . VAL C 3 30  ? 13.607  5.905  6.976   1.00 30.24  ? 30   VAL A C     1 
ATOM   847  O  O     . VAL C 3 30  ? 13.883  7.108  6.936   1.00 29.28  ? 30   VAL A O     1 
ATOM   848  C  CB    . VAL C 3 30  ? 15.895  4.897  7.275   1.00 29.23  ? 30   VAL A CB    1 
ATOM   849  C  CG1   . VAL C 3 30  ? 15.603  4.718  8.760   1.00 25.71  ? 30   VAL A CG1   1 
ATOM   850  C  CG2   . VAL C 3 30  ? 16.835  3.813  6.780   1.00 25.76  ? 30   VAL A CG2   1 
ATOM   851  N  N     . CYS C 3 31  ? 12.472  5.448  7.479   1.00 30.88  ? 31   CYS A N     1 
ATOM   852  C  CA    . CYS C 3 31  ? 11.427  6.353  7.922   1.00 32.85  ? 31   CYS A CA    1 
ATOM   853  C  C     . CYS C 3 31  ? 11.118  6.406  9.407   1.00 32.94  ? 31   CYS A C     1 
ATOM   854  O  O     . CYS C 3 31  ? 11.247  5.422  10.131  1.00 33.48  ? 31   CYS A O     1 
ATOM   855  C  CB    . CYS C 3 31  ? 10.135  5.990  7.180   1.00 32.70  ? 31   CYS A CB    1 
ATOM   856  S  SG    . CYS C 3 31  ? 10.340  5.877  5.385   1.00 35.81  ? 31   CYS A SG    1 
ATOM   857  N  N     . VAL C 3 32  ? 10.677  7.582  9.832   1.00 32.05  ? 32   VAL A N     1 
ATOM   858  C  CA    . VAL C 3 32  ? 10.267  7.800  11.202  1.00 31.79  ? 32   VAL A CA    1 
ATOM   859  C  C     . VAL C 3 32  ? 8.770   8.043  11.143  1.00 32.05  ? 32   VAL A C     1 
ATOM   860  O  O     . VAL C 3 32  ? 8.313   9.152  10.859  1.00 28.32  ? 32   VAL A O     1 
ATOM   861  C  CB    . VAL C 3 32  ? 10.970  9.024  11.827  1.00 31.03  ? 32   VAL A CB    1 
ATOM   862  C  CG1   . VAL C 3 32  ? 10.610  9.114  13.297  1.00 33.72  ? 32   VAL A CG1   1 
ATOM   863  C  CG2   . VAL C 3 32  ? 12.474  8.926  11.687  1.00 31.22  ? 32   VAL A CG2   1 
ATOM   864  N  N     . PHE C 3 33  ? 8.022   6.965  11.348  1.00 33.55  ? 33   PHE A N     1 
ATOM   865  C  CA    . PHE C 3 33  ? 6.564   7.000  11.301  1.00 35.70  ? 33   PHE A CA    1 
ATOM   866  C  C     . PHE C 3 33  ? 5.985   7.604  12.583  1.00 37.18  ? 33   PHE A C     1 
ATOM   867  O  O     . PHE C 3 33  ? 6.280   7.132  13.675  1.00 35.83  ? 33   PHE A O     1 
ATOM   868  C  CB    . PHE C 3 33  ? 6.043   5.578  11.104  1.00 34.79  ? 33   PHE A CB    1 
ATOM   869  C  CG    . PHE C 3 33  ? 6.392   4.990  9.779   1.00 34.44  ? 33   PHE A CG    1 
ATOM   870  C  CD1   . PHE C 3 33  ? 5.666   5.342  8.637   1.00 34.38  ? 33   PHE A CD1   1 
ATOM   871  C  CD2   . PHE C 3 33  ? 7.457   4.100  9.659   1.00 32.82  ? 33   PHE A CD2   1 
ATOM   872  C  CE1   . PHE C 3 33  ? 5.995   4.818  7.386   1.00 33.71  ? 33   PHE A CE1   1 
ATOM   873  C  CE2   . PHE C 3 33  ? 7.802   3.563  8.413   1.00 36.17  ? 33   PHE A CE2   1 
ATOM   874  C  CZ    . PHE C 3 33  ? 7.068   3.923  7.268   1.00 34.09  ? 33   PHE A CZ    1 
ATOM   875  N  N     . SER C 3 34  ? 5.160   8.642  12.454  1.00 40.75  ? 34   SER A N     1 
ATOM   876  C  CA    . SER C 3 34  ? 4.593   9.291  13.636  1.00 44.11  ? 34   SER A CA    1 
ATOM   877  C  C     . SER C 3 34  ? 3.323   8.639  14.165  1.00 45.51  ? 34   SER A C     1 
ATOM   878  O  O     . SER C 3 34  ? 3.000   8.775  15.346  1.00 46.77  ? 34   SER A O     1 
ATOM   879  C  CB    . SER C 3 34  ? 4.342   10.779 13.366  1.00 43.55  ? 34   SER A CB    1 
ATOM   880  O  OG    . SER C 3 34  ? 3.405   10.971 12.322  1.00 47.14  ? 34   SER A OG    1 
ATOM   881  N  N     . GLY C 3 35  ? 2.587   7.951  13.301  1.00 46.60  ? 35   GLY A N     1 
ATOM   882  C  CA    . GLY C 3 35  ? 1.389   7.280  13.768  1.00 48.35  ? 35   GLY A CA    1 
ATOM   883  C  C     . GLY C 3 35  ? 0.055   8.003  13.681  1.00 49.77  ? 35   GLY A C     1 
ATOM   884  O  O     . GLY C 3 35  ? -0.968  7.437  14.068  1.00 48.69  ? 35   GLY A O     1 
ATOM   885  N  N     . ARG C 3 36  ? 0.035   9.236  13.193  1.00 49.96  ? 36   ARG A N     1 
ATOM   886  C  CA    . ARG C 3 36  ? -1.240  9.934  13.088  1.00 52.42  ? 36   ARG A CA    1 
ATOM   887  C  C     . ARG C 3 36  ? -2.106  9.230  12.060  1.00 54.21  ? 36   ARG A C     1 
ATOM   888  O  O     . ARG C 3 36  ? -3.265  8.916  12.321  1.00 55.14  ? 36   ARG A O     1 
ATOM   889  C  CB    . ARG C 3 36  ? -1.049  11.370 12.642  1.00 53.66  ? 36   ARG A CB    1 
ATOM   890  C  CG    . ARG C 3 36  ? -0.105  12.152 13.487  1.00 56.07  ? 36   ARG A CG    1 
ATOM   891  C  CD    . ARG C 3 36  ? -0.495  13.600 13.443  1.00 55.85  ? 36   ARG A CD    1 
ATOM   892  N  NE    . ARG C 3 36  ? -0.981  14.024 14.746  1.00 57.78  ? 36   ARG A NE    1 
ATOM   893  C  CZ    . ARG C 3 36  ? -1.569  15.189 14.976  1.00 58.38  ? 36   ARG A CZ    1 
ATOM   894  N  NH1   . ARG C 3 36  ? -1.748  16.048 13.980  1.00 56.38  ? 36   ARG A NH1   1 
ATOM   895  N  NH2   . ARG C 3 36  ? -1.965  15.498 16.204  1.00 59.23  ? 36   ARG A NH2   1 
ATOM   896  N  N     . PHE C 3 37  ? -1.538  8.992  10.881  1.00 54.81  ? 37   PHE A N     1 
ATOM   897  C  CA    . PHE C 3 37  ? -2.261  8.324  9.811   1.00 55.52  ? 37   PHE A CA    1 
ATOM   898  C  C     . PHE C 3 37  ? -1.332  7.465  8.954   1.00 56.14  ? 37   PHE A C     1 
ATOM   899  O  O     . PHE C 3 37  ? -0.158  7.278  9.282   1.00 56.02  ? 37   PHE A O     1 
ATOM   900  C  CB    . PHE C 3 37  ? -2.997  9.360  8.947   1.00 54.99  ? 37   PHE A CB    1 
ATOM   901  C  CG    . PHE C 3 37  ? -2.099  10.415 8.350   1.00 57.14  ? 37   PHE A CG    1 
ATOM   902  C  CD1   . PHE C 3 37  ? -1.395  10.169 7.172   1.00 57.73  ? 37   PHE A CD1   1 
ATOM   903  C  CD2   . PHE C 3 37  ? -1.954  11.655 8.970   1.00 56.94  ? 37   PHE A CD2   1 
ATOM   904  C  CE1   . PHE C 3 37  ? -0.558  11.145 6.616   1.00 57.63  ? 37   PHE A CE1   1 
ATOM   905  C  CE2   . PHE C 3 37  ? -1.121  12.637 8.426   1.00 57.87  ? 37   PHE A CE2   1 
ATOM   906  C  CZ    . PHE C 3 37  ? -0.420  12.381 7.245   1.00 57.40  ? 37   PHE A CZ    1 
ATOM   907  N  N     . GLU C 3 38  ? -1.877  6.933  7.865   1.00 56.65  ? 38   GLU A N     1 
ATOM   908  C  CA    . GLU C 3 38  ? -1.122  6.093  6.941   1.00 57.48  ? 38   GLU A CA    1 
ATOM   909  C  C     . GLU C 3 38  ? 0.046   6.865  6.324   1.00 55.22  ? 38   GLU A C     1 
ATOM   910  O  O     . GLU C 3 38  ? -0.155  7.818  5.559   1.00 54.53  ? 38   GLU A O     1 
ATOM   911  C  CB    . GLU C 3 38  ? -2.048  5.584  5.825   1.00 61.24  ? 38   GLU A CB    1 
ATOM   912  C  CG    . GLU C 3 38  ? -1.377  4.711  4.766   1.00 65.04  ? 38   GLU A CG    1 
ATOM   913  C  CD    . GLU C 3 38  ? -1.017  3.325  5.275   1.00 67.52  ? 38   GLU A CD    1 
ATOM   914  O  OE1   . GLU C 3 38  ? -0.287  3.227  6.286   1.00 68.51  ? 38   GLU A OE1   1 
ATOM   915  O  OE2   . GLU C 3 38  ? -1.465  2.333  4.654   1.00 68.98  ? 38   GLU A OE2   1 
ATOM   916  N  N     . ASP C 3 39  ? 1.259   6.442  6.671   1.00 51.53  ? 39   ASP A N     1 
ATOM   917  C  CA    . ASP C 3 39  ? 2.486   7.049  6.162   1.00 49.05  ? 39   ASP A CA    1 
ATOM   918  C  C     . ASP C 3 39  ? 2.825   8.418  6.741   1.00 45.75  ? 39   ASP A C     1 
ATOM   919  O  O     . ASP C 3 39  ? 3.669   9.123  6.192   1.00 44.50  ? 39   ASP A O     1 
ATOM   920  C  CB    . ASP C 3 39  ? 2.452   7.153  4.626   1.00 50.26  ? 39   ASP A CB    1 
ATOM   921  C  CG    . ASP C 3 39  ? 2.620   5.810  3.942   1.00 50.31  ? 39   ASP A CG    1 
ATOM   922  O  OD1   . ASP C 3 39  ? 3.526   5.050  4.333   1.00 52.50  ? 39   ASP A OD1   1 
ATOM   923  O  OD2   . ASP C 3 39  ? 1.856   5.521  3.000   1.00 52.52  ? 39   ASP A OD2   1 
ATOM   924  N  N     . SER C 3 40  ? 2.182   8.811  7.838   1.00 42.92  ? 40   SER A N     1 
ATOM   925  C  CA    . SER C 3 40  ? 2.504   10.105 8.425   1.00 37.69  ? 40   SER A CA    1 
ATOM   926  C  C     . SER C 3 40  ? 3.901   9.944  9.000   1.00 36.83  ? 40   SER A C     1 
ATOM   927  O  O     . SER C 3 40  ? 4.265   8.862  9.462   1.00 35.45  ? 40   SER A O     1 
ATOM   928  C  CB    . SER C 3 40  ? 1.527   10.467 9.543   1.00 39.26  ? 40   SER A CB    1 
ATOM   929  O  OG    . SER C 3 40  ? 1.729   9.650  10.685  1.00 41.03  ? 40   SER A OG    1 
ATOM   930  N  N     . GLY C 3 41  ? 4.696   11.006 8.955   1.00 35.86  ? 41   GLY A N     1 
ATOM   931  C  CA    . GLY C 3 41  ? 6.045   10.921 9.487   1.00 36.48  ? 41   GLY A CA    1 
ATOM   932  C  C     . GLY C 3 41  ? 7.056   11.530 8.539   1.00 35.75  ? 41   GLY A C     1 
ATOM   933  O  O     . GLY C 3 41  ? 6.682   12.084 7.505   1.00 35.72  ? 41   GLY A O     1 
ATOM   934  N  N     . ALA C 3 42  ? 8.337   11.424 8.882   1.00 33.13  ? 42   ALA A N     1 
ATOM   935  C  CA    . ALA C 3 42  ? 9.375   11.993 8.040   1.00 32.33  ? 42   ALA A CA    1 
ATOM   936  C  C     . ALA C 3 42  ? 10.507  11.019 7.768   1.00 31.42  ? 42   ALA A C     1 
ATOM   937  O  O     . ALA C 3 42  ? 10.611  9.960  8.403   1.00 31.24  ? 42   ALA A O     1 
ATOM   938  C  CB    . ALA C 3 42  ? 9.918   13.254 8.681   1.00 32.63  ? 42   ALA A CB    1 
ATOM   939  N  N     . VAL C 3 43  ? 11.361  11.390 6.821   1.00 29.88  ? 43   VAL A N     1 
ATOM   940  C  CA    . VAL C 3 43  ? 12.507  10.569 6.442   1.00 29.20  ? 43   VAL A CA    1 
ATOM   941  C  C     . VAL C 3 43  ? 13.707  10.844 7.346   1.00 29.07  ? 43   VAL A C     1 
ATOM   942  O  O     . VAL C 3 43  ? 14.082  11.993 7.548   1.00 30.52  ? 43   VAL A O     1 
ATOM   943  C  CB    . VAL C 3 43  ? 12.897  10.839 4.958   1.00 27.83  ? 43   VAL A CB    1 
ATOM   944  C  CG1   . VAL C 3 43  ? 14.165  10.090 4.584   1.00 23.38  ? 43   VAL A CG1   1 
ATOM   945  C  CG2   . VAL C 3 43  ? 11.753  10.404 4.057   1.00 26.13  ? 43   VAL A CG2   1 
ATOM   946  N  N     . ALA C 3 44  ? 14.289  9.787  7.911   1.00 29.25  ? 44   ALA A N     1 
ATOM   947  C  CA    . ALA C 3 44  ? 15.470  9.931  8.771   1.00 29.27  ? 44   ALA A CA    1 
ATOM   948  C  C     . ALA C 3 44  ? 16.675  10.087 7.861   1.00 29.95  ? 44   ALA A C     1 
ATOM   949  O  O     . ALA C 3 44  ? 17.544  10.916 8.102   1.00 31.78  ? 44   ALA A O     1 
ATOM   950  C  CB    . ALA C 3 44  ? 15.647  8.712  9.629   1.00 27.47  ? 44   ALA A CB    1 
ATOM   951  N  N     . THR C 3 45  ? 16.726  9.251  6.831   1.00 29.08  ? 45   THR A N     1 
ATOM   952  C  CA    . THR C 3 45  ? 17.789  9.297  5.837   1.00 31.39  ? 45   THR A CA    1 
ATOM   953  C  C     . THR C 3 45  ? 17.455  8.306  4.725   1.00 31.14  ? 45   THR A C     1 
ATOM   954  O  O     . THR C 3 45  ? 16.518  7.517  4.841   1.00 31.80  ? 45   THR A O     1 
ATOM   955  C  CB    . THR C 3 45  ? 19.155  8.910  6.419   1.00 31.46  ? 45   THR A CB    1 
ATOM   956  O  OG1   . THR C 3 45  ? 20.186  9.388  5.543   1.00 31.33  ? 45   THR A OG1   1 
ATOM   957  C  CG2   . THR C 3 45  ? 19.276  7.393  6.541   1.00 28.60  ? 45   THR A CG2   1 
ATOM   958  N  N     . ALA C 3 46  ? 18.224  8.350  3.648   1.00 29.91  ? 46   ALA A N     1 
ATOM   959  C  CA    . ALA C 3 46  ? 18.016  7.435  2.536   1.00 30.36  ? 46   ALA A CA    1 
ATOM   960  C  C     . ALA C 3 46  ? 19.372  7.239  1.895   1.00 29.98  ? 46   ALA A C     1 
ATOM   961  O  O     . ALA C 3 46  ? 20.233  8.114  2.001   1.00 27.90  ? 46   ALA A O     1 
ATOM   962  C  CB    . ALA C 3 46  ? 17.036  8.027  1.537   1.00 30.11  ? 46   ALA A CB    1 
ATOM   963  N  N     . ASN C 3 47  ? 19.581  6.093  1.254   1.00 30.82  ? 47   ASN A N     1 
ATOM   964  C  CA    . ASN C 3 47  ? 20.865  5.861  0.614   1.00 33.90  ? 47   ASN A CA    1 
ATOM   965  C  C     . ASN C 3 47  ? 20.973  6.770  -0.602  1.00 35.79  ? 47   ASN A C     1 
ATOM   966  O  O     . ASN C 3 47  ? 20.001  7.435  -0.978  1.00 33.50  ? 47   ASN A O     1 
ATOM   967  C  CB    . ASN C 3 47  ? 21.044  4.389  0.214   1.00 34.66  ? 47   ASN A CB    1 
ATOM   968  C  CG    . ASN C 3 47  ? 20.020  3.913  -0.807  1.00 34.73  ? 47   ASN A CG    1 
ATOM   969  O  OD1   . ASN C 3 47  ? 19.284  4.706  -1.401  1.00 34.08  ? 47   ASN A OD1   1 
ATOM   970  N  ND2   . ASN C 3 47  ? 19.986  2.602  -1.027  1.00 34.29  ? 47   ASN A ND2   1 
ATOM   971  N  N     . TYR C 3 48  ? 22.153  6.809  -1.210  1.00 38.46  ? 48   TYR A N     1 
ATOM   972  C  CA    . TYR C 3 48  ? 22.371  7.675  -2.358  1.00 41.55  ? 48   TYR A CA    1 
ATOM   973  C  C     . TYR C 3 48  ? 21.520  7.370  -3.598  1.00 41.99  ? 48   TYR A C     1 
ATOM   974  O  O     . TYR C 3 48  ? 21.206  8.284  -4.359  1.00 42.33  ? 48   TYR A O     1 
ATOM   975  C  CB    . TYR C 3 48  ? 23.867  7.721  -2.702  1.00 43.22  ? 48   TYR A CB    1 
ATOM   976  C  CG    . TYR C 3 48  ? 24.664  8.540  -1.694  1.00 46.32  ? 48   TYR A CG    1 
ATOM   977  C  CD1   . TYR C 3 48  ? 24.984  8.025  -0.434  1.00 45.24  ? 48   TYR A CD1   1 
ATOM   978  C  CD2   . TYR C 3 48  ? 25.027  9.860  -1.976  1.00 46.72  ? 48   TYR A CD2   1 
ATOM   979  C  CE1   . TYR C 3 48  ? 25.638  8.805  0.515   1.00 46.40  ? 48   TYR A CE1   1 
ATOM   980  C  CE2   . TYR C 3 48  ? 25.680  10.652 -1.031  1.00 47.77  ? 48   TYR A CE2   1 
ATOM   981  C  CZ    . TYR C 3 48  ? 25.980  10.119 0.211   1.00 48.69  ? 48   TYR A CZ    1 
ATOM   982  O  OH    . TYR C 3 48  ? 26.601  10.913 1.149   1.00 49.29  ? 48   TYR A OH    1 
ATOM   983  N  N     . GLU C 3 49  ? 21.136  6.114  -3.808  1.00 42.13  ? 49   GLU A N     1 
ATOM   984  C  CA    . GLU C 3 49  ? 20.293  5.810  -4.960  1.00 44.31  ? 49   GLU A CA    1 
ATOM   985  C  C     . GLU C 3 49  ? 19.049  6.687  -4.832  1.00 43.80  ? 49   GLU A C     1 
ATOM   986  O  O     . GLU C 3 49  ? 18.616  7.322  -5.795  1.00 43.11  ? 49   GLU A O     1 
ATOM   987  C  CB    . GLU C 3 49  ? 19.865  4.333  -4.987  1.00 46.56  ? 49   GLU A CB    1 
ATOM   988  C  CG    . GLU C 3 49  ? 20.798  3.409  -5.766  1.00 54.38  ? 49   GLU A CG    1 
ATOM   989  C  CD    . GLU C 3 49  ? 21.938  2.847  -4.919  1.00 58.18  ? 49   GLU A CD    1 
ATOM   990  O  OE1   . GLU C 3 49  ? 21.691  1.875  -4.163  1.00 60.83  ? 49   GLU A OE1   1 
ATOM   991  O  OE2   . GLU C 3 49  ? 23.074  3.384  -4.996  1.00 59.33  ? 49   GLU A OE2   1 
ATOM   992  N  N     . ALA C 3 50  ? 18.494  6.732  -3.622  1.00 42.49  ? 50   ALA A N     1 
ATOM   993  C  CA    . ALA C 3 50  ? 17.291  7.518  -3.350  1.00 39.68  ? 50   ALA A CA    1 
ATOM   994  C  C     . ALA C 3 50  ? 17.539  9.021  -3.368  1.00 38.62  ? 50   ALA A C     1 
ATOM   995  O  O     . ALA C 3 50  ? 16.691  9.777  -3.851  1.00 37.97  ? 50   ALA A O     1 
ATOM   996  C  CB    . ALA C 3 50  ? 16.676  7.096  -2.006  1.00 38.76  ? 50   ALA A CB    1 
ATOM   997  N  N     . ARG C 3 51  ? 18.692  9.460  -2.858  1.00 38.12  ? 51   ARG A N     1 
ATOM   998  C  CA    . ARG C 3 51  ? 19.011  10.889 -2.844  1.00 39.66  ? 51   ARG A CA    1 
ATOM   999  C  C     . ARG C 3 51  ? 19.157  11.516 -4.218  1.00 40.20  ? 51   ARG A C     1 
ATOM   1000 O  O     . ARG C 3 51  ? 18.890  12.708 -4.387  1.00 40.68  ? 51   ARG A O     1 
ATOM   1001 C  CB    . ARG C 3 51  ? 20.291  11.167 -2.063  1.00 40.16  ? 51   ARG A CB    1 
ATOM   1002 C  CG    . ARG C 3 51  ? 20.143  10.991 -0.588  1.00 41.06  ? 51   ARG A CG    1 
ATOM   1003 C  CD    . ARG C 3 51  ? 21.389  11.428 0.130   1.00 40.15  ? 51   ARG A CD    1 
ATOM   1004 N  NE    . ARG C 3 51  ? 21.475  10.722 1.391   1.00 40.15  ? 51   ARG A NE    1 
ATOM   1005 C  CZ    . ARG C 3 51  ? 22.469  10.849 2.254   1.00 40.65  ? 51   ARG A CZ    1 
ATOM   1006 N  NH1   . ARG C 3 51  ? 23.477  11.671 1.992   1.00 39.52  ? 51   ARG A NH1   1 
ATOM   1007 N  NH2   . ARG C 3 51  ? 22.452  10.141 3.375   1.00 40.13  ? 51   ARG A NH2   1 
ATOM   1008 N  N     . LYS C 3 52  ? 19.599  10.734 -5.196  1.00 40.48  ? 52   LYS A N     1 
ATOM   1009 C  CA    . LYS C 3 52  ? 19.754  11.266 -6.545  1.00 42.47  ? 52   LYS A CA    1 
ATOM   1010 C  C     . LYS C 3 52  ? 18.442  11.885 -7.011  1.00 41.93  ? 52   LYS A C     1 
ATOM   1011 O  O     . LYS C 3 52  ? 18.433  12.802 -7.834  1.00 42.78  ? 52   LYS A O     1 
ATOM   1012 C  CB    . LYS C 3 52  ? 20.135  10.159 -7.532  1.00 43.95  ? 52   LYS A CB    1 
ATOM   1013 C  CG    . LYS C 3 52  ? 21.528  9.601  -7.357  1.00 47.48  ? 52   LYS A CG    1 
ATOM   1014 C  CD    . LYS C 3 52  ? 21.809  8.512  -8.390  1.00 52.79  ? 52   LYS A CD    1 
ATOM   1015 C  CE    . LYS C 3 52  ? 20.812  7.357  -8.290  1.00 53.89  ? 52   LYS A CE    1 
ATOM   1016 N  NZ    . LYS C 3 52  ? 21.198  6.201  -9.161  1.00 56.27  ? 52   LYS A NZ    1 
ATOM   1017 N  N     . PHE C 3 53  ? 17.336  11.386 -6.466  1.00 40.28  ? 53   PHE A N     1 
ATOM   1018 C  CA    . PHE C 3 53  ? 16.012  11.851 -6.864  1.00 38.29  ? 53   PHE A CA    1 
ATOM   1019 C  C     . PHE C 3 53  ? 15.329  12.831 -5.935  1.00 37.14  ? 53   PHE A C     1 
ATOM   1020 O  O     . PHE C 3 53  ? 14.178  13.192 -6.172  1.00 36.91  ? 53   PHE A O     1 
ATOM   1021 C  CB    . PHE C 3 53  ? 15.109  10.641 -7.087  1.00 37.33  ? 53   PHE A CB    1 
ATOM   1022 C  CG    . PHE C 3 53  ? 15.573  9.750  -8.195  1.00 39.71  ? 53   PHE A CG    1 
ATOM   1023 C  CD1   . PHE C 3 53  ? 15.441  10.150 -9.519  1.00 41.09  ? 53   PHE A CD1   1 
ATOM   1024 C  CD2   . PHE C 3 53  ? 16.174  8.523  -7.923  1.00 40.64  ? 53   PHE A CD2   1 
ATOM   1025 C  CE1   . PHE C 3 53  ? 15.898  9.348  -10.555 1.00 40.39  ? 53   PHE A CE1   1 
ATOM   1026 C  CE2   . PHE C 3 53  ? 16.638  7.710  -8.960  1.00 41.13  ? 53   PHE A CE2   1 
ATOM   1027 C  CZ    . PHE C 3 53  ? 16.497  8.128  -10.280 1.00 40.01  ? 53   PHE A CZ    1 
ATOM   1028 N  N     . GLY C 3 54  ? 16.020  13.255 -4.880  1.00 36.57  ? 54   GLY A N     1 
ATOM   1029 C  CA    . GLY C 3 54  ? 15.429  14.214 -3.961  1.00 36.90  ? 54   GLY A CA    1 
ATOM   1030 C  C     . GLY C 3 54  ? 14.851  13.675 -2.661  1.00 36.40  ? 54   GLY A C     1 
ATOM   1031 O  O     . GLY C 3 54  ? 14.249  14.424 -1.893  1.00 37.54  ? 54   GLY A O     1 
ATOM   1032 N  N     . VAL C 3 55  ? 15.009  12.383 -2.410  1.00 35.89  ? 55   VAL A N     1 
ATOM   1033 C  CA    . VAL C 3 55  ? 14.500  11.788 -1.177  1.00 35.79  ? 55   VAL A CA    1 
ATOM   1034 C  C     . VAL C 3 55  ? 15.657  11.830 -0.190  1.00 36.99  ? 55   VAL A C     1 
ATOM   1035 O  O     . VAL C 3 55  ? 16.646  11.115 -0.361  1.00 38.26  ? 55   VAL A O     1 
ATOM   1036 C  CB    . VAL C 3 55  ? 14.064  10.319 -1.385  1.00 34.62  ? 55   VAL A CB    1 
ATOM   1037 C  CG1   . VAL C 3 55  ? 13.586  9.710  -0.055  1.00 31.76  ? 55   VAL A CG1   1 
ATOM   1038 C  CG2   . VAL C 3 55  ? 12.951  10.250 -2.432  1.00 31.65  ? 55   VAL A CG2   1 
ATOM   1039 N  N     . LYS C 3 56  ? 15.530  12.671 0.832   1.00 36.64  ? 56   LYS A N     1 
ATOM   1040 C  CA    . LYS C 3 56  ? 16.580  12.838 1.839   1.00 37.68  ? 56   LYS A CA    1 
ATOM   1041 C  C     . LYS C 3 56  ? 15.983  13.119 3.215   1.00 37.44  ? 56   LYS A C     1 
ATOM   1042 O  O     . LYS C 3 56  ? 14.778  13.344 3.355   1.00 35.43  ? 56   LYS A O     1 
ATOM   1043 C  CB    . LYS C 3 56  ? 17.486  14.008 1.443   1.00 39.14  ? 56   LYS A CB    1 
ATOM   1044 C  CG    . LYS C 3 56  ? 16.723  15.325 1.345   1.00 41.55  ? 56   LYS A CG    1 
ATOM   1045 C  CD    . LYS C 3 56  ? 17.614  16.501 0.967   1.00 45.66  ? 56   LYS A CD    1 
ATOM   1046 C  CE    . LYS C 3 56  ? 16.797  17.793 0.911   1.00 47.57  ? 56   LYS A CE    1 
ATOM   1047 N  NZ    . LYS C 3 56  ? 17.596  18.975 0.472   1.00 51.13  ? 56   LYS A NZ    1 
ATOM   1048 N  N     . ALA C 3 57  ? 16.843  13.128 4.226   1.00 37.78  ? 57   ALA A N     1 
ATOM   1049 C  CA    . ALA C 3 57  ? 16.410  13.376 5.593   1.00 38.63  ? 57   ALA A CA    1 
ATOM   1050 C  C     . ALA C 3 57  ? 15.512  14.599 5.691   1.00 39.12  ? 57   ALA A C     1 
ATOM   1051 O  O     . ALA C 3 57  ? 15.734  15.610 5.015   1.00 39.80  ? 57   ALA A O     1 
ATOM   1052 C  CB    . ALA C 3 57  ? 17.633  13.548 6.518   1.00 35.26  ? 57   ALA A CB    1 
ATOM   1053 N  N     . GLY C 3 58  ? 14.478  14.492 6.516   1.00 38.14  ? 58   GLY A N     1 
ATOM   1054 C  CA    . GLY C 3 58  ? 13.592  15.618 6.724   1.00 38.16  ? 58   GLY A CA    1 
ATOM   1055 C  C     . GLY C 3 58  ? 12.300  15.755 5.943   1.00 39.16  ? 58   GLY A C     1 
ATOM   1056 O  O     . GLY C 3 58  ? 11.344  16.348 6.462   1.00 37.97  ? 58   GLY A O     1 
ATOM   1057 N  N     . ILE C 3 59  ? 12.241  15.241 4.716   1.00 37.24  ? 59   ILE A N     1 
ATOM   1058 C  CA    . ILE C 3 59  ? 11.009  15.390 3.949   1.00 36.89  ? 59   ILE A CA    1 
ATOM   1059 C  C     . ILE C 3 59  ? 9.914   14.431 4.425   1.00 35.69  ? 59   ILE A C     1 
ATOM   1060 O  O     . ILE C 3 59  ? 10.202  13.402 5.029   1.00 35.66  ? 59   ILE A O     1 
ATOM   1061 C  CB    . ILE C 3 59  ? 11.247  15.185 2.423   1.00 37.57  ? 59   ILE A CB    1 
ATOM   1062 C  CG1   . ILE C 3 59  ? 11.214  13.702 2.057   1.00 38.27  ? 59   ILE A CG1   1 
ATOM   1063 C  CG2   . ILE C 3 59  ? 12.598  15.776 2.029   1.00 38.69  ? 59   ILE A CG2   1 
ATOM   1064 C  CD1   . ILE C 3 59  ? 11.058  13.464 0.548   1.00 39.56  ? 59   ILE A CD1   1 
ATOM   1065 N  N     . PRO C 3 60  ? 8.642   14.775 4.172   1.00 34.49  ? 60   PRO A N     1 
ATOM   1066 C  CA    . PRO C 3 60  ? 7.508   13.937 4.572   1.00 34.21  ? 60   PRO A CA    1 
ATOM   1067 C  C     . PRO C 3 60  ? 7.619   12.581 3.871   1.00 34.51  ? 60   PRO A C     1 
ATOM   1068 O  O     . PRO C 3 60  ? 8.034   12.513 2.714   1.00 35.48  ? 60   PRO A O     1 
ATOM   1069 C  CB    . PRO C 3 60  ? 6.297   14.740 4.083   1.00 33.60  ? 60   PRO A CB    1 
ATOM   1070 C  CG    . PRO C 3 60  ? 6.781   16.160 4.126   1.00 32.23  ? 60   PRO A CG    1 
ATOM   1071 C  CD    . PRO C 3 60  ? 8.173   16.028 3.550   1.00 34.17  ? 60   PRO A CD    1 
ATOM   1072 N  N     . ILE C 3 61  ? 7.262   11.503 4.559   1.00 32.75  ? 61   ILE A N     1 
ATOM   1073 C  CA    . ILE C 3 61  ? 7.347   10.187 3.939   1.00 33.76  ? 61   ILE A CA    1 
ATOM   1074 C  C     . ILE C 3 61  ? 6.443   10.143 2.708   1.00 35.26  ? 61   ILE A C     1 
ATOM   1075 O  O     . ILE C 3 61  ? 6.783   9.545  1.684   1.00 33.89  ? 61   ILE A O     1 
ATOM   1076 C  CB    . ILE C 3 61  ? 6.903   9.083  4.907   1.00 33.30  ? 61   ILE A CB    1 
ATOM   1077 C  CG1   . ILE C 3 61  ? 7.797   9.085  6.145   1.00 32.30  ? 61   ILE A CG1   1 
ATOM   1078 C  CG2   . ILE C 3 61  ? 7.008   7.719  4.230   1.00 35.06  ? 61   ILE A CG2   1 
ATOM   1079 C  CD1   . ILE C 3 61  ? 7.293   8.160  7.246   1.00 31.37  ? 61   ILE A CD1   1 
ATOM   1080 N  N     . VAL C 3 62  ? 5.290   10.793 2.825   1.00 37.58  ? 62   VAL A N     1 
ATOM   1081 C  CA    . VAL C 3 62  ? 4.304   10.853 1.748   1.00 38.19  ? 62   VAL A CA    1 
ATOM   1082 C  C     . VAL C 3 62  ? 4.869   11.514 0.481   1.00 38.87  ? 62   VAL A C     1 
ATOM   1083 O  O     . VAL C 3 62  ? 4.471   11.175 -0.643  1.00 38.67  ? 62   VAL A O     1 
ATOM   1084 C  CB    . VAL C 3 62  ? 3.045   11.608 2.236   1.00 38.93  ? 62   VAL A CB    1 
ATOM   1085 C  CG1   . VAL C 3 62  ? 2.126   11.933 1.070   1.00 41.71  ? 62   VAL A CG1   1 
ATOM   1086 C  CG2   . VAL C 3 62  ? 2.306   10.745 3.255   1.00 37.73  ? 62   VAL A CG2   1 
ATOM   1087 N  N     . GLU C 3 63  ? 5.794   12.454 0.655   1.00 38.92  ? 63   GLU A N     1 
ATOM   1088 C  CA    . GLU C 3 63  ? 6.387   13.106 -0.500  1.00 40.10  ? 63   GLU A CA    1 
ATOM   1089 C  C     . GLU C 3 63  ? 7.403   12.167 -1.115  1.00 38.70  ? 63   GLU A C     1 
ATOM   1090 O  O     . GLU C 3 63  ? 7.454   12.010 -2.333  1.00 39.06  ? 63   GLU A O     1 
ATOM   1091 C  CB    . GLU C 3 63  ? 7.045   14.433 -0.111  1.00 43.46  ? 63   GLU A CB    1 
ATOM   1092 C  CG    . GLU C 3 63  ? 6.030   15.517 0.276   1.00 50.71  ? 63   GLU A CG    1 
ATOM   1093 C  CD    . GLU C 3 63  ? 4.883   15.650 -0.742  1.00 54.69  ? 63   GLU A CD    1 
ATOM   1094 O  OE1   . GLU C 3 63  ? 5.154   15.978 -1.923  1.00 55.20  ? 63   GLU A OE1   1 
ATOM   1095 O  OE2   . GLU C 3 63  ? 3.710   15.418 -0.363  1.00 55.78  ? 63   GLU A OE2   1 
ATOM   1096 N  N     . ALA C 3 64  ? 8.202   11.520 -0.274  1.00 39.12  ? 64   ALA A N     1 
ATOM   1097 C  CA    . ALA C 3 64  ? 9.201   10.581 -0.781  1.00 38.92  ? 64   ALA A CA    1 
ATOM   1098 C  C     . ALA C 3 64  ? 8.486   9.531  -1.634  1.00 38.46  ? 64   ALA A C     1 
ATOM   1099 O  O     . ALA C 3 64  ? 8.963   9.166  -2.709  1.00 36.36  ? 64   ALA A O     1 
ATOM   1100 C  CB    . ALA C 3 64  ? 9.967   9.900  0.388   1.00 36.93  ? 64   ALA A CB    1 
ATOM   1101 N  N     . LYS C 3 65  ? 7.340   9.049  -1.159  1.00 37.47  ? 65   LYS A N     1 
ATOM   1102 C  CA    . LYS C 3 65  ? 6.602   8.040  -1.903  1.00 39.01  ? 65   LYS A CA    1 
ATOM   1103 C  C     . LYS C 3 65  ? 6.081   8.544  -3.247  1.00 39.31  ? 65   LYS A C     1 
ATOM   1104 O  O     . LYS C 3 65  ? 5.968   7.770  -4.192  1.00 41.21  ? 65   LYS A O     1 
ATOM   1105 C  CB    . LYS C 3 65  ? 5.456   7.483  -1.051  1.00 38.55  ? 65   LYS A CB    1 
ATOM   1106 C  CG    . LYS C 3 65  ? 5.970   6.717  0.154   1.00 41.02  ? 65   LYS A CG    1 
ATOM   1107 C  CD    . LYS C 3 65  ? 4.993   5.682  0.665   1.00 40.50  ? 65   LYS A CD    1 
ATOM   1108 C  CE    . LYS C 3 65  ? 5.691   4.779  1.674   1.00 42.10  ? 65   LYS A CE    1 
ATOM   1109 N  NZ    . LYS C 3 65  ? 4.815   3.691  2.193   1.00 43.96  ? 65   LYS A NZ    1 
ATOM   1110 N  N     . LYS C 3 66  ? 5.765   9.830  -3.339  1.00 39.35  ? 66   LYS A N     1 
ATOM   1111 C  CA    . LYS C 3 66  ? 5.289   10.393 -4.595  1.00 41.24  ? 66   LYS A CA    1 
ATOM   1112 C  C     . LYS C 3 66  ? 6.425   10.328 -5.621  1.00 40.98  ? 66   LYS A C     1 
ATOM   1113 O  O     . LYS C 3 66  ? 6.211   10.018 -6.788  1.00 40.29  ? 66   LYS A O     1 
ATOM   1114 C  CB    . LYS C 3 66  ? 4.867   11.849 -4.402  1.00 43.32  ? 66   LYS A CB    1 
ATOM   1115 C  CG    . LYS C 3 66  ? 3.581   12.045 -3.624  1.00 47.56  ? 66   LYS A CG    1 
ATOM   1116 C  CD    . LYS C 3 66  ? 3.259   13.537 -3.464  1.00 52.80  ? 66   LYS A CD    1 
ATOM   1117 C  CE    . LYS C 3 66  ? 1.975   13.750 -2.643  1.00 55.85  ? 66   LYS A CE    1 
ATOM   1118 N  NZ    . LYS C 3 66  ? 1.735   15.181 -2.260  1.00 57.08  ? 66   LYS A NZ    1 
ATOM   1119 N  N     . ILE C 3 67  ? 7.639   10.613 -5.157  1.00 39.38  ? 67   ILE A N     1 
ATOM   1120 C  CA    . ILE C 3 67  ? 8.823   10.609 -6.000  1.00 36.34  ? 67   ILE A CA    1 
ATOM   1121 C  C     . ILE C 3 67  ? 9.311   9.200  -6.327  1.00 38.10  ? 67   ILE A C     1 
ATOM   1122 O  O     . ILE C 3 67  ? 9.616   8.900  -7.488  1.00 36.69  ? 67   ILE A O     1 
ATOM   1123 C  CB    . ILE C 3 67  ? 9.958   11.374 -5.315  1.00 34.97  ? 67   ILE A CB    1 
ATOM   1124 C  CG1   . ILE C 3 67  ? 9.510   12.805 -5.015  1.00 35.20  ? 67   ILE A CG1   1 
ATOM   1125 C  CG2   . ILE C 3 67  ? 11.197  11.374 -6.193  1.00 35.74  ? 67   ILE A CG2   1 
ATOM   1126 C  CD1   . ILE C 3 67  ? 10.493  13.574 -4.115  1.00 33.91  ? 67   ILE A CD1   1 
ATOM   1127 N  N     . LEU C 3 68  ? 9.396   8.339  -5.312  1.00 35.42  ? 68   LEU A N     1 
ATOM   1128 C  CA    . LEU C 3 68  ? 9.857   6.969  -5.511  1.00 36.45  ? 68   LEU A CA    1 
ATOM   1129 C  C     . LEU C 3 68  ? 8.880   5.966  -4.920  1.00 39.19  ? 68   LEU A C     1 
ATOM   1130 O  O     . LEU C 3 68  ? 9.154   5.351  -3.885  1.00 38.06  ? 68   LEU A O     1 
ATOM   1131 C  CB    . LEU C 3 68  ? 11.228  6.757  -4.865  1.00 36.96  ? 68   LEU A CB    1 
ATOM   1132 C  CG    . LEU C 3 68  ? 12.427  7.568  -5.369  1.00 38.95  ? 68   LEU A CG    1 
ATOM   1133 C  CD1   . LEU C 3 68  ? 13.689  7.055  -4.688  1.00 37.65  ? 68   LEU A CD1   1 
ATOM   1134 C  CD2   . LEU C 3 68  ? 12.567  7.425  -6.884  1.00 38.21  ? 68   LEU A CD2   1 
ATOM   1135 N  N     . PRO C 3 69  ? 7.731   5.767  -5.584  1.00 39.58  ? 69   PRO A N     1 
ATOM   1136 C  CA    . PRO C 3 69  ? 6.723   4.825  -5.091  1.00 39.66  ? 69   PRO A CA    1 
ATOM   1137 C  C     . PRO C 3 69  ? 7.190   3.382  -4.897  1.00 39.37  ? 69   PRO A C     1 
ATOM   1138 O  O     . PRO C 3 69  ? 6.631   2.653  -4.076  1.00 39.30  ? 69   PRO A O     1 
ATOM   1139 C  CB    . PRO C 3 69  ? 5.593   4.956  -6.119  1.00 39.44  ? 69   PRO A CB    1 
ATOM   1140 C  CG    . PRO C 3 69  ? 6.304   5.401  -7.366  1.00 40.20  ? 69   PRO A CG    1 
ATOM   1141 C  CD    . PRO C 3 69  ? 7.288   6.410  -6.833  1.00 39.53  ? 69   PRO A CD    1 
ATOM   1142 N  N     . ASN C 3 70  ? 8.215   2.969  -5.634  1.00 39.11  ? 70   ASN A N     1 
ATOM   1143 C  CA    . ASN C 3 70  ? 8.707   1.603  -5.516  1.00 39.88  ? 70   ASN A CA    1 
ATOM   1144 C  C     . ASN C 3 70  ? 9.996   1.438  -4.720  1.00 39.65  ? 70   ASN A C     1 
ATOM   1145 O  O     . ASN C 3 70  ? 10.585  0.357  -4.701  1.00 40.19  ? 70   ASN A O     1 
ATOM   1146 C  CB    . ASN C 3 70  ? 8.872   1.004  -6.907  1.00 41.70  ? 70   ASN A CB    1 
ATOM   1147 C  CG    . ASN C 3 70  ? 7.586   1.047  -7.690  1.00 42.73  ? 70   ASN A CG    1 
ATOM   1148 O  OD1   . ASN C 3 70  ? 6.553   0.584  -7.212  1.00 41.75  ? 70   ASN A OD1   1 
ATOM   1149 N  ND2   . ASN C 3 70  ? 7.632   1.618  -8.890  1.00 42.97  ? 70   ASN A ND2   1 
ATOM   1150 N  N     . ALA C 3 71  ? 10.440  2.504  -4.064  1.00 38.14  ? 71   ALA A N     1 
ATOM   1151 C  CA    . ALA C 3 71  ? 11.649  2.413  -3.264  1.00 37.36  ? 71   ALA A CA    1 
ATOM   1152 C  C     . ALA C 3 71  ? 11.339  1.515  -2.071  1.00 35.86  ? 71   ALA A C     1 
ATOM   1153 O  O     . ALA C 3 71  ? 10.177  1.209  -1.801  1.00 35.76  ? 71   ALA A O     1 
ATOM   1154 C  CB    . ALA C 3 71  ? 12.076  3.811  -2.778  1.00 36.75  ? 71   ALA A CB    1 
ATOM   1155 N  N     . VAL C 3 72  ? 12.368  1.069  -1.364  1.00 35.72  ? 72   VAL A N     1 
ATOM   1156 C  CA    . VAL C 3 72  ? 12.118  0.256  -0.186  1.00 34.10  ? 72   VAL A CA    1 
ATOM   1157 C  C     . VAL C 3 72  ? 12.023  1.202  1.010   1.00 33.75  ? 72   VAL A C     1 
ATOM   1158 O  O     . VAL C 3 72  ? 12.943  1.975  1.281   1.00 33.08  ? 72   VAL A O     1 
ATOM   1159 C  CB    . VAL C 3 72  ? 13.237  -0.758 0.059   1.00 35.52  ? 72   VAL A CB    1 
ATOM   1160 C  CG1   . VAL C 3 72  ? 12.993  -1.475 1.383   1.00 36.64  ? 72   VAL A CG1   1 
ATOM   1161 C  CG2   . VAL C 3 72  ? 13.280  -1.778 -1.085  1.00 36.13  ? 72   VAL A CG2   1 
ATOM   1162 N  N     . TYR C 3 73  ? 10.897  1.150  1.711   1.00 33.92  ? 73   TYR A N     1 
ATOM   1163 C  CA    . TYR C 3 73  ? 10.678  1.999  2.871   1.00 32.47  ? 73   TYR A CA    1 
ATOM   1164 C  C     . TYR C 3 73  ? 10.799  1.157  4.114   1.00 33.07  ? 73   TYR A C     1 
ATOM   1165 O  O     . TYR C 3 73  ? 10.079  0.180  4.290   1.00 33.32  ? 73   TYR A O     1 
ATOM   1166 C  CB    . TYR C 3 73  ? 9.299   2.652  2.792   1.00 32.25  ? 73   TYR A CB    1 
ATOM   1167 C  CG    . TYR C 3 73  ? 9.232   3.669  1.683   1.00 33.08  ? 73   TYR A CG    1 
ATOM   1168 C  CD1   . TYR C 3 73  ? 9.599   4.997  1.899   1.00 34.00  ? 73   TYR A CD1   1 
ATOM   1169 C  CD2   . TYR C 3 73  ? 8.894   3.284  0.390   1.00 34.07  ? 73   TYR A CD2   1 
ATOM   1170 C  CE1   . TYR C 3 73  ? 9.636   5.916  0.840   1.00 34.03  ? 73   TYR A CE1   1 
ATOM   1171 C  CE2   . TYR C 3 73  ? 8.932   4.187  -0.667  1.00 34.02  ? 73   TYR A CE2   1 
ATOM   1172 C  CZ    . TYR C 3 73  ? 9.304   5.493  -0.438  1.00 33.11  ? 73   TYR A CZ    1 
ATOM   1173 O  OH    . TYR C 3 73  ? 9.363   6.362  -1.496  1.00 37.32  ? 73   TYR A OH    1 
ATOM   1174 N  N     . LEU C 3 74  ? 11.729  1.539  4.974   1.00 31.49  ? 74   LEU A N     1 
ATOM   1175 C  CA    . LEU C 3 74  ? 11.965  0.803  6.193   1.00 32.25  ? 74   LEU A CA    1 
ATOM   1176 C  C     . LEU C 3 74  ? 11.788  1.690  7.415   1.00 33.10  ? 74   LEU A C     1 
ATOM   1177 O  O     . LEU C 3 74  ? 12.148  2.878  7.405   1.00 32.56  ? 74   LEU A O     1 
ATOM   1178 C  CB    . LEU C 3 74  ? 13.388  0.235  6.188   1.00 32.75  ? 74   LEU A CB    1 
ATOM   1179 C  CG    . LEU C 3 74  ? 13.824  -0.634 5.003   1.00 33.47  ? 74   LEU A CG    1 
ATOM   1180 C  CD1   . LEU C 3 74  ? 15.325  -0.880 5.086   1.00 33.70  ? 74   LEU A CD1   1 
ATOM   1181 C  CD2   . LEU C 3 74  ? 13.064  -1.966 5.021   1.00 32.22  ? 74   LEU A CD2   1 
ATOM   1182 N  N     . PRO C 3 75  ? 11.202  1.129  8.482   1.00 32.20  ? 75   PRO A N     1 
ATOM   1183 C  CA    . PRO C 3 75  ? 10.995  1.883  9.718   1.00 33.18  ? 75   PRO A CA    1 
ATOM   1184 C  C     . PRO C 3 75  ? 12.362  1.977  10.376  1.00 33.81  ? 75   PRO A C     1 
ATOM   1185 O  O     . PRO C 3 75  ? 13.110  1.003  10.392  1.00 31.80  ? 75   PRO A O     1 
ATOM   1186 C  CB    . PRO C 3 75  ? 10.056  0.990  10.505  1.00 34.06  ? 75   PRO A CB    1 
ATOM   1187 C  CG    . PRO C 3 75  ? 10.542  -0.383 10.112  1.00 34.61  ? 75   PRO A CG    1 
ATOM   1188 C  CD    . PRO C 3 75  ? 10.679  -0.241 8.611   1.00 31.79  ? 75   PRO A CD    1 
ATOM   1189 N  N     . MET C 3 76  ? 12.696  3.151  10.893  1.00 36.04  ? 76   MET A N     1 
ATOM   1190 C  CA    . MET C 3 76  ? 13.979  3.369  11.552  1.00 37.40  ? 76   MET A CA    1 
ATOM   1191 C  C     . MET C 3 76  ? 14.155  2.377  12.717  1.00 38.31  ? 76   MET A C     1 
ATOM   1192 O  O     . MET C 3 76  ? 13.211  2.132  13.479  1.00 36.42  ? 76   MET A O     1 
ATOM   1193 C  CB    . MET C 3 76  ? 14.039  4.819  12.072  1.00 39.50  ? 76   MET A CB    1 
ATOM   1194 C  CG    . MET C 3 76  ? 15.318  5.203  12.806  1.00 44.59  ? 76   MET A CG    1 
ATOM   1195 S  SD    . MET C 3 76  ? 15.137  6.729  13.693  1.00 46.42  ? 76   MET A SD    1 
ATOM   1196 C  CE    . MET C 3 76  ? 15.831  7.924  12.616  1.00 51.45  ? 76   MET A CE    1 
ATOM   1197 N  N     . ARG C 3 77  ? 15.351  1.796  12.838  1.00 36.01  ? 77   ARG A N     1 
ATOM   1198 C  CA    . ARG C 3 77  ? 15.658  0.877  13.936  1.00 37.52  ? 77   ARG A CA    1 
ATOM   1199 C  C     . ARG C 3 77  ? 16.889  1.414  14.674  1.00 37.11  ? 77   ARG A C     1 
ATOM   1200 O  O     . ARG C 3 77  ? 17.966  0.825  14.641  1.00 35.17  ? 77   ARG A O     1 
ATOM   1201 C  CB    . ARG C 3 77  ? 15.923  -0.540 13.412  1.00 37.89  ? 77   ARG A CB    1 
ATOM   1202 C  CG    . ARG C 3 77  ? 14.687  -1.197 12.809  1.00 40.03  ? 77   ARG A CG    1 
ATOM   1203 C  CD    . ARG C 3 77  ? 14.892  -2.682 12.564  1.00 39.15  ? 77   ARG A CD    1 
ATOM   1204 N  NE    . ARG C 3 77  ? 15.849  -2.947 11.497  1.00 40.84  ? 77   ARG A NE    1 
ATOM   1205 C  CZ    . ARG C 3 77  ? 16.366  -4.147 11.251  1.00 42.03  ? 77   ARG A CZ    1 
ATOM   1206 N  NH1   . ARG C 3 77  ? 16.013  -5.181 12.006  1.00 41.26  ? 77   ARG A NH1   1 
ATOM   1207 N  NH2   . ARG C 3 77  ? 17.225  -4.320 10.254  1.00 38.32  ? 77   ARG A NH2   1 
ATOM   1208 N  N     . LYS C 3 78  ? 16.694  2.550  15.334  1.00 38.30  ? 78   LYS A N     1 
ATOM   1209 C  CA    . LYS C 3 78  ? 17.732  3.262  16.072  1.00 39.82  ? 78   LYS A CA    1 
ATOM   1210 C  C     . LYS C 3 78  ? 18.657  2.363  16.892  1.00 40.49  ? 78   LYS A C     1 
ATOM   1211 O  O     . LYS C 3 78  ? 19.874  2.401  16.722  1.00 40.44  ? 78   LYS A O     1 
ATOM   1212 C  CB    . LYS C 3 78  ? 17.065  4.297  16.983  1.00 42.27  ? 78   LYS A CB    1 
ATOM   1213 C  CG    . LYS C 3 78  ? 17.998  5.324  17.622  1.00 46.36  ? 78   LYS A CG    1 
ATOM   1214 C  CD    . LYS C 3 78  ? 18.272  6.492  16.695  1.00 48.83  ? 78   LYS A CD    1 
ATOM   1215 C  CE    . LYS C 3 78  ? 18.825  7.695  17.454  1.00 50.80  ? 78   LYS A CE    1 
ATOM   1216 N  NZ    . LYS C 3 78  ? 17.795  8.310  18.337  1.00 54.05  ? 78   LYS A NZ    1 
ATOM   1217 N  N     . GLU C 3 79  ? 18.076  1.558  17.777  1.00 40.25  ? 79   GLU A N     1 
ATOM   1218 C  CA    . GLU C 3 79  ? 18.843  0.661  18.639  1.00 40.46  ? 79   GLU A CA    1 
ATOM   1219 C  C     . GLU C 3 79  ? 19.865  -0.161 17.863  1.00 38.89  ? 79   GLU A C     1 
ATOM   1220 O  O     . GLU C 3 79  ? 21.002  -0.341 18.309  1.00 38.42  ? 79   GLU A O     1 
ATOM   1221 C  CB    . GLU C 3 79  ? 17.904  -0.292 19.392  1.00 43.92  ? 79   GLU A CB    1 
ATOM   1222 C  CG    . GLU C 3 79  ? 16.450  0.181  19.497  1.00 49.58  ? 79   GLU A CG    1 
ATOM   1223 C  CD    . GLU C 3 79  ? 15.696  0.131  18.158  1.00 52.04  ? 79   GLU A CD    1 
ATOM   1224 O  OE1   . GLU C 3 79  ? 15.662  -0.938 17.501  1.00 52.28  ? 79   GLU A OE1   1 
ATOM   1225 O  OE2   . GLU C 3 79  ? 15.124  1.169  17.764  1.00 56.37  ? 79   GLU A OE2   1 
ATOM   1226 N  N     . VAL C 3 80  ? 19.464  -0.667 16.702  1.00 35.61  ? 80   VAL A N     1 
ATOM   1227 C  CA    . VAL C 3 80  ? 20.364  -1.464 15.878  1.00 32.60  ? 80   VAL A CA    1 
ATOM   1228 C  C     . VAL C 3 80  ? 21.546  -0.623 15.378  1.00 32.27  ? 80   VAL A C     1 
ATOM   1229 O  O     . VAL C 3 80  ? 22.704  -1.029 15.513  1.00 32.78  ? 80   VAL A O     1 
ATOM   1230 C  CB    . VAL C 3 80  ? 19.615  -2.063 14.656  1.00 31.72  ? 80   VAL A CB    1 
ATOM   1231 C  CG1   . VAL C 3 80  ? 20.594  -2.755 13.720  1.00 30.01  ? 80   VAL A CG1   1 
ATOM   1232 C  CG2   . VAL C 3 80  ? 18.553  -3.061 15.130  1.00 32.65  ? 80   VAL A CG2   1 
ATOM   1233 N  N     . TYR C 3 81  ? 21.256  0.548  14.808  1.00 31.28  ? 81   TYR A N     1 
ATOM   1234 C  CA    . TYR C 3 81  ? 22.306  1.421  14.276  1.00 30.82  ? 81   TYR A CA    1 
ATOM   1235 C  C     . TYR C 3 81  ? 23.257  1.858  15.385  1.00 29.77  ? 81   TYR A C     1 
ATOM   1236 O  O     . TYR C 3 81  ? 24.449  2.051  15.152  1.00 29.82  ? 81   TYR A O     1 
ATOM   1237 C  CB    . TYR C 3 81  ? 21.697  2.662  13.617  1.00 28.95  ? 81   TYR A CB    1 
ATOM   1238 C  CG    . TYR C 3 81  ? 20.471  2.376  12.785  1.00 29.44  ? 81   TYR A CG    1 
ATOM   1239 C  CD1   . TYR C 3 81  ? 20.403  1.236  11.989  1.00 31.15  ? 81   TYR A CD1   1 
ATOM   1240 C  CD2   . TYR C 3 81  ? 19.370  3.238  12.806  1.00 29.73  ? 81   TYR A CD2   1 
ATOM   1241 C  CE1   . TYR C 3 81  ? 19.264  0.949  11.232  1.00 31.74  ? 81   TYR A CE1   1 
ATOM   1242 C  CE2   . TYR C 3 81  ? 18.228  2.965  12.053  1.00 31.54  ? 81   TYR A CE2   1 
ATOM   1243 C  CZ    . TYR C 3 81  ? 18.179  1.813  11.269  1.00 30.74  ? 81   TYR A CZ    1 
ATOM   1244 O  OH    . TYR C 3 81  ? 17.041  1.519  10.543  1.00 27.53  ? 81   TYR A OH    1 
ATOM   1245 N  N     . GLN C 3 82  ? 22.716  2.004  16.589  1.00 31.12  ? 82   GLN A N     1 
ATOM   1246 C  CA    . GLN C 3 82  ? 23.499  2.412  17.750  1.00 34.48  ? 82   GLN A CA    1 
ATOM   1247 C  C     . GLN C 3 82  ? 24.501  1.328  18.153  1.00 36.45  ? 82   GLN A C     1 
ATOM   1248 O  O     . GLN C 3 82  ? 25.661  1.623  18.478  1.00 37.24  ? 82   GLN A O     1 
ATOM   1249 C  CB    . GLN C 3 82  ? 22.565  2.724  18.929  1.00 36.29  ? 82   GLN A CB    1 
ATOM   1250 C  CG    . GLN C 3 82  ? 23.301  3.187  20.184  1.00 38.76  ? 82   GLN A CG    1 
ATOM   1251 C  CD    . GLN C 3 82  ? 24.174  4.403  19.914  1.00 39.15  ? 82   GLN A CD    1 
ATOM   1252 O  OE1   . GLN C 3 82  ? 23.670  5.507  19.707  1.00 39.91  ? 82   GLN A OE1   1 
ATOM   1253 N  NE2   . GLN C 3 82  ? 25.491  4.199  19.890  1.00 38.51  ? 82   GLN A NE2   1 
ATOM   1254 N  N     . GLN C 3 83  ? 24.059  0.071  18.135  1.00 37.90  ? 83   GLN A N     1 
ATOM   1255 C  CA    . GLN C 3 83  ? 24.945  -1.030 18.492  1.00 39.18  ? 83   GLN A CA    1 
ATOM   1256 C  C     . GLN C 3 83  ? 26.051  -1.105 17.447  1.00 37.77  ? 83   GLN A C     1 
ATOM   1257 O  O     . GLN C 3 83  ? 27.229  -1.281 17.775  1.00 37.31  ? 83   GLN A O     1 
ATOM   1258 C  CB    . GLN C 3 83  ? 24.181  -2.360 18.538  1.00 43.43  ? 83   GLN A CB    1 
ATOM   1259 C  CG    . GLN C 3 83  ? 22.916  -2.314 19.381  1.00 50.63  ? 83   GLN A CG    1 
ATOM   1260 C  CD    . GLN C 3 83  ? 22.579  -3.653 20.033  1.00 54.96  ? 83   GLN A CD    1 
ATOM   1261 O  OE1   . GLN C 3 83  ? 22.705  -4.710 19.416  1.00 56.01  ? 83   GLN A OE1   1 
ATOM   1262 N  NE2   . GLN C 3 83  ? 22.132  -3.603 21.285  1.00 56.61  ? 83   GLN A NE2   1 
ATOM   1263 N  N     . VAL C 3 84  ? 25.674  -0.974 16.180  1.00 35.01  ? 84   VAL A N     1 
ATOM   1264 C  CA    . VAL C 3 84  ? 26.671  -1.021 15.128  1.00 33.17  ? 84   VAL A CA    1 
ATOM   1265 C  C     . VAL C 3 84  ? 27.631  0.155  15.323  1.00 33.84  ? 84   VAL A C     1 
ATOM   1266 O  O     . VAL C 3 84  ? 28.860  0.004  15.264  1.00 31.05  ? 84   VAL A O     1 
ATOM   1267 C  CB    . VAL C 3 84  ? 26.016  -0.946 13.728  1.00 32.96  ? 84   VAL A CB    1 
ATOM   1268 C  CG1   . VAL C 3 84  ? 27.097  -0.920 12.644  1.00 30.63  ? 84   VAL A CG1   1 
ATOM   1269 C  CG2   . VAL C 3 84  ? 25.104  -2.156 13.522  1.00 33.66  ? 84   VAL A CG2   1 
ATOM   1270 N  N     . SER C 3 85  ? 27.061  1.329  15.567  1.00 34.57  ? 85   SER A N     1 
ATOM   1271 C  CA    . SER C 3 85  ? 27.868  2.522  15.778  1.00 34.37  ? 85   SER A CA    1 
ATOM   1272 C  C     . SER C 3 85  ? 28.865  2.303  16.916  1.00 35.24  ? 85   SER A C     1 
ATOM   1273 O  O     . SER C 3 85  ? 30.062  2.558  16.761  1.00 34.86  ? 85   SER A O     1 
ATOM   1274 C  CB    . SER C 3 85  ? 26.973  3.713  16.115  1.00 32.86  ? 85   SER A CB    1 
ATOM   1275 O  OG    . SER C 3 85  ? 27.756  4.821  16.529  1.00 32.49  ? 85   SER A OG    1 
ATOM   1276 N  N     . SER C 3 86  ? 28.374  1.826  18.057  1.00 35.90  ? 86   SER A N     1 
ATOM   1277 C  CA    . SER C 3 86  ? 29.249  1.601  19.207  1.00 37.91  ? 86   SER A CA    1 
ATOM   1278 C  C     . SER C 3 86  ? 30.445  0.725  18.882  1.00 38.21  ? 86   SER A C     1 
ATOM   1279 O  O     . SER C 3 86  ? 31.537  0.943  19.403  1.00 37.31  ? 86   SER A O     1 
ATOM   1280 C  CB    . SER C 3 86  ? 28.468  0.983  20.365  1.00 37.98  ? 86   SER A CB    1 
ATOM   1281 O  OG    . SER C 3 86  ? 27.534  1.915  20.881  1.00 41.51  ? 86   SER A OG    1 
ATOM   1282 N  N     . ARG C 3 87  ? 30.248  -0.262 18.014  1.00 38.40  ? 87   ARG A N     1 
ATOM   1283 C  CA    . ARG C 3 87  ? 31.345  -1.149 17.654  1.00 38.19  ? 87   ARG A CA    1 
ATOM   1284 C  C     . ARG C 3 87  ? 32.376  -0.447 16.778  1.00 38.47  ? 87   ARG A C     1 
ATOM   1285 O  O     . ARG C 3 87  ? 33.584  -0.673 16.918  1.00 37.93  ? 87   ARG A O     1 
ATOM   1286 C  CB    . ARG C 3 87  ? 30.809  -2.397 16.949  1.00 39.12  ? 87   ARG A CB    1 
ATOM   1287 C  CG    . ARG C 3 87  ? 29.803  -3.196 17.785  1.00 38.49  ? 87   ARG A CG    1 
ATOM   1288 C  CD    . ARG C 3 87  ? 29.740  -4.646 17.319  1.00 39.30  ? 87   ARG A CD    1 
ATOM   1289 N  NE    . ARG C 3 87  ? 29.308  -4.762 15.927  1.00 36.27  ? 87   ARG A NE    1 
ATOM   1290 C  CZ    . ARG C 3 87  ? 28.047  -4.950 15.556  1.00 36.54  ? 87   ARG A CZ    1 
ATOM   1291 N  NH1   . ARG C 3 87  ? 27.092  -5.049 16.473  1.00 34.75  ? 87   ARG A NH1   1 
ATOM   1292 N  NH2   . ARG C 3 87  ? 27.742  -5.030 14.271  1.00 36.16  ? 87   ARG A NH2   1 
ATOM   1293 N  N     . ILE C 3 88  ? 31.908  0.406  15.874  1.00 37.17  ? 88   ILE A N     1 
ATOM   1294 C  CA    . ILE C 3 88  ? 32.832  1.129  15.004  1.00 36.63  ? 88   ILE A CA    1 
ATOM   1295 C  C     . ILE C 3 88  ? 33.664  2.111  15.832  1.00 36.82  ? 88   ILE A C     1 
ATOM   1296 O  O     . ILE C 3 88  ? 34.871  2.278  15.604  1.00 35.99  ? 88   ILE A O     1 
ATOM   1297 C  CB    . ILE C 3 88  ? 32.078  1.900  13.891  1.00 33.98  ? 88   ILE A CB    1 
ATOM   1298 C  CG1   . ILE C 3 88  ? 31.300  0.907  13.015  1.00 33.86  ? 88   ILE A CG1   1 
ATOM   1299 C  CG2   . ILE C 3 88  ? 33.076  2.704  13.050  1.00 30.58  ? 88   ILE A CG2   1 
ATOM   1300 C  CD1   . ILE C 3 88  ? 30.547  1.546  11.842  1.00 33.63  ? 88   ILE A CD1   1 
ATOM   1301 N  N     . MET C 3 89  ? 33.012  2.751  16.799  1.00 36.93  ? 89   MET A N     1 
ATOM   1302 C  CA    . MET C 3 89  ? 33.689  3.706  17.658  1.00 38.33  ? 89   MET A CA    1 
ATOM   1303 C  C     . MET C 3 89  ? 34.854  3.017  18.382  1.00 39.84  ? 89   MET A C     1 
ATOM   1304 O  O     . MET C 3 89  ? 35.957  3.567  18.458  1.00 40.23  ? 89   MET A O     1 
ATOM   1305 C  CB    . MET C 3 89  ? 32.690  4.337  18.640  1.00 35.46  ? 89   MET A CB    1 
ATOM   1306 C  CG    . MET C 3 89  ? 31.581  5.172  17.979  1.00 36.33  ? 89   MET A CG    1 
ATOM   1307 S  SD    . MET C 3 89  ? 32.127  6.413  16.801  1.00 35.70  ? 89   MET A SD    1 
ATOM   1308 C  CE    . MET C 3 89  ? 30.569  7.072  16.186  1.00 36.25  ? 89   MET A CE    1 
ATOM   1309 N  N     . ASN C 3 90  ? 34.628  1.801  18.872  1.00 41.28  ? 90   ASN A N     1 
ATOM   1310 C  CA    . ASN C 3 90  ? 35.690  1.064  19.546  1.00 42.03  ? 90   ASN A CA    1 
ATOM   1311 C  C     . ASN C 3 90  ? 36.835  0.752  18.597  1.00 41.87  ? 90   ASN A C     1 
ATOM   1312 O  O     . ASN C 3 90  ? 37.973  0.603  19.031  1.00 42.49  ? 90   ASN A O     1 
ATOM   1313 C  CB    . ASN C 3 90  ? 35.162  -0.230 20.147  1.00 43.02  ? 90   ASN A CB    1 
ATOM   1314 C  CG    . ASN C 3 90  ? 34.258  0.016  21.324  1.00 45.13  ? 90   ASN A CG    1 
ATOM   1315 O  OD1   . ASN C 3 90  ? 34.365  1.041  21.994  1.00 46.81  ? 90   ASN A OD1   1 
ATOM   1316 N  ND2   . ASN C 3 90  ? 33.370  -0.928 21.597  1.00 46.27  ? 90   ASN A ND2   1 
ATOM   1317 N  N     . LEU C 3 91  ? 36.544  0.647  17.304  1.00 40.46  ? 91   LEU A N     1 
ATOM   1318 C  CA    . LEU C 3 91  ? 37.604  0.375  16.347  1.00 42.17  ? 91   LEU A CA    1 
ATOM   1319 C  C     . LEU C 3 91  ? 38.472  1.627  16.217  1.00 42.90  ? 91   LEU A C     1 
ATOM   1320 O  O     . LEU C 3 91  ? 39.699  1.535  16.108  1.00 44.33  ? 91   LEU A O     1 
ATOM   1321 C  CB    . LEU C 3 91  ? 37.030  -0.001 14.971  1.00 41.96  ? 91   LEU A CB    1 
ATOM   1322 C  CG    . LEU C 3 91  ? 36.289  -1.335 14.803  1.00 44.38  ? 91   LEU A CG    1 
ATOM   1323 C  CD1   . LEU C 3 91  ? 35.801  -1.474 13.372  1.00 43.72  ? 91   LEU A CD1   1 
ATOM   1324 C  CD2   . LEU C 3 91  ? 37.219  -2.493 15.147  1.00 45.19  ? 91   LEU A CD2   1 
ATOM   1325 N  N     . LEU C 3 92  ? 37.839  2.796  16.242  1.00 41.85  ? 92   LEU A N     1 
ATOM   1326 C  CA    . LEU C 3 92  ? 38.577  4.042  16.110  1.00 43.06  ? 92   LEU A CA    1 
ATOM   1327 C  C     . LEU C 3 92  ? 39.467  4.342  17.320  1.00 45.54  ? 92   LEU A C     1 
ATOM   1328 O  O     . LEU C 3 92  ? 40.526  4.947  17.172  1.00 45.34  ? 92   LEU A O     1 
ATOM   1329 C  CB    . LEU C 3 92  ? 37.614  5.201  15.868  1.00 41.02  ? 92   LEU A CB    1 
ATOM   1330 C  CG    . LEU C 3 92  ? 36.816  5.109  14.569  1.00 40.91  ? 92   LEU A CG    1 
ATOM   1331 C  CD1   . LEU C 3 92  ? 35.851  6.283  14.486  1.00 40.30  ? 92   LEU A CD1   1 
ATOM   1332 C  CD2   . LEU C 3 92  ? 37.757  5.102  13.379  1.00 39.61  ? 92   LEU A CD2   1 
ATOM   1333 N  N     . ARG C 3 93  ? 39.048  3.914  18.508  1.00 48.68  ? 93   ARG A N     1 
ATOM   1334 C  CA    . ARG C 3 93  ? 39.830  4.150  19.726  1.00 52.64  ? 93   ARG A CA    1 
ATOM   1335 C  C     . ARG C 3 93  ? 41.244  3.576  19.642  1.00 54.83  ? 93   ARG A C     1 
ATOM   1336 O  O     . ARG C 3 93  ? 42.157  4.056  20.314  1.00 56.30  ? 93   ARG A O     1 
ATOM   1337 C  CB    . ARG C 3 93  ? 39.125  3.549  20.941  1.00 52.07  ? 93   ARG A CB    1 
ATOM   1338 C  CG    . ARG C 3 93  ? 37.742  4.102  21.194  1.00 53.17  ? 93   ARG A CG    1 
ATOM   1339 C  CD    . ARG C 3 93  ? 37.032  3.260  22.232  1.00 54.96  ? 93   ARG A CD    1 
ATOM   1340 N  NE    . ARG C 3 93  ? 35.600  3.536  22.275  1.00 57.21  ? 93   ARG A NE    1 
ATOM   1341 C  CZ    . ARG C 3 93  ? 35.077  4.687  22.683  1.00 59.03  ? 93   ARG A CZ    1 
ATOM   1342 N  NH1   . ARG C 3 93  ? 35.873  5.671  23.085  1.00 58.94  ? 93   ARG A NH1   1 
ATOM   1343 N  NH2   . ARG C 3 93  ? 33.760  4.856  22.688  1.00 58.28  ? 93   ARG A NH2   1 
ATOM   1344 N  N     . GLU C 3 94  ? 41.422  2.548  18.823  1.00 56.62  ? 94   GLU A N     1 
ATOM   1345 C  CA    . GLU C 3 94  ? 42.729  1.920  18.658  1.00 59.08  ? 94   GLU A CA    1 
ATOM   1346 C  C     . GLU C 3 94  ? 43.698  2.819  17.900  1.00 59.14  ? 94   GLU A C     1 
ATOM   1347 O  O     . GLU C 3 94  ? 44.894  2.534  17.822  1.00 59.44  ? 94   GLU A O     1 
ATOM   1348 C  CB    . GLU C 3 94  ? 42.589  0.593  17.903  1.00 61.33  ? 94   GLU A CB    1 
ATOM   1349 C  CG    . GLU C 3 94  ? 41.673  -0.411 18.580  1.00 65.31  ? 94   GLU A CG    1 
ATOM   1350 C  CD    . GLU C 3 94  ? 42.072  -0.675 20.024  1.00 68.69  ? 94   GLU A CD    1 
ATOM   1351 O  OE1   . GLU C 3 94  ? 43.179  -1.214 20.255  1.00 70.02  ? 94   GLU A OE1   1 
ATOM   1352 O  OE2   . GLU C 3 94  ? 41.278  -0.332 20.930  1.00 70.55  ? 94   GLU A OE2   1 
ATOM   1353 N  N     . TYR C 3 95  ? 43.178  3.908  17.345  1.00 58.78  ? 95   TYR A N     1 
ATOM   1354 C  CA    . TYR C 3 95  ? 43.992  4.828  16.568  1.00 58.30  ? 95   TYR A CA    1 
ATOM   1355 C  C     . TYR C 3 95  ? 44.351  6.112  17.303  1.00 58.26  ? 95   TYR A C     1 
ATOM   1356 O  O     . TYR C 3 95  ? 45.136  6.913  16.802  1.00 59.34  ? 95   TYR A O     1 
ATOM   1357 C  CB    . TYR C 3 95  ? 43.276  5.138  15.253  1.00 57.16  ? 95   TYR A CB    1 
ATOM   1358 C  CG    . TYR C 3 95  ? 43.135  3.914  14.372  1.00 57.32  ? 95   TYR A CG    1 
ATOM   1359 C  CD1   . TYR C 3 95  ? 44.137  3.562  13.473  1.00 57.27  ? 95   TYR A CD1   1 
ATOM   1360 C  CD2   . TYR C 3 95  ? 42.024  3.076  14.477  1.00 56.08  ? 95   TYR A CD2   1 
ATOM   1361 C  CE1   . TYR C 3 95  ? 44.038  2.407  12.703  1.00 57.38  ? 95   TYR A CE1   1 
ATOM   1362 C  CE2   . TYR C 3 95  ? 41.919  1.920  13.713  1.00 55.16  ? 95   TYR A CE2   1 
ATOM   1363 C  CZ    . TYR C 3 95  ? 42.929  1.594  12.831  1.00 55.82  ? 95   TYR A CZ    1 
ATOM   1364 O  OH    . TYR C 3 95  ? 42.836  0.451  12.079  1.00 57.41  ? 95   TYR A OH    1 
ATOM   1365 N  N     . SER C 3 96  ? 43.784  6.308  18.488  1.00 57.60  ? 96   SER A N     1 
ATOM   1366 C  CA    . SER C 3 96  ? 44.085  7.497  19.274  1.00 58.39  ? 96   SER A CA    1 
ATOM   1367 C  C     . SER C 3 96  ? 43.351  7.546  20.610  1.00 59.09  ? 96   SER A C     1 
ATOM   1368 O  O     . SER C 3 96  ? 42.180  7.183  20.695  1.00 58.74  ? 96   SER A O     1 
ATOM   1369 C  CB    . SER C 3 96  ? 43.759  8.758  18.474  1.00 57.61  ? 96   SER A CB    1 
ATOM   1370 O  OG    . SER C 3 96  ? 44.002  9.914  19.255  1.00 58.72  ? 96   SER A OG    1 
ATOM   1371 N  N     . GLU C 3 97  ? 44.053  7.997  21.650  1.00 60.74  ? 97   GLU A N     1 
ATOM   1372 C  CA    . GLU C 3 97  ? 43.477  8.124  22.993  1.00 61.80  ? 97   GLU A CA    1 
ATOM   1373 C  C     . GLU C 3 97  ? 42.638  9.393  22.997  1.00 60.64  ? 97   GLU A C     1 
ATOM   1374 O  O     . GLU C 3 97  ? 41.642  9.505  23.713  1.00 60.32  ? 97   GLU A O     1 
ATOM   1375 C  CB    . GLU C 3 97  ? 44.575  8.267  24.053  1.00 64.50  ? 97   GLU A CB    1 
ATOM   1376 C  CG    . GLU C 3 97  ? 45.629  7.172  24.047  1.00 69.33  ? 97   GLU A CG    1 
ATOM   1377 C  CD    . GLU C 3 97  ? 46.413  7.121  22.746  1.00 72.97  ? 97   GLU A CD    1 
ATOM   1378 O  OE1   . GLU C 3 97  ? 46.867  8.190  22.276  1.00 74.12  ? 97   GLU A OE1   1 
ATOM   1379 O  OE2   . GLU C 3 97  ? 46.580  6.009  22.195  1.00 74.97  ? 97   GLU A OE2   1 
ATOM   1380 N  N     . LYS C 3 98  ? 43.069  10.350 22.184  1.00 58.70  ? 98   LYS A N     1 
ATOM   1381 C  CA    . LYS C 3 98  ? 42.394  11.629 22.053  1.00 56.23  ? 98   LYS A CA    1 
ATOM   1382 C  C     . LYS C 3 98  ? 41.362  11.523 20.945  1.00 54.06  ? 98   LYS A C     1 
ATOM   1383 O  O     . LYS C 3 98  ? 41.637  11.850 19.792  1.00 52.80  ? 98   LYS A O     1 
ATOM   1384 C  CB    . LYS C 3 98  ? 43.418  12.710 21.720  1.00 57.64  ? 98   LYS A CB    1 
ATOM   1385 C  CG    . LYS C 3 98  ? 44.559  12.758 22.715  1.00 58.58  ? 98   LYS A CG    1 
ATOM   1386 C  CD    . LYS C 3 98  ? 45.622  13.762 22.320  1.00 60.30  ? 98   LYS A CD    1 
ATOM   1387 C  CE    . LYS C 3 98  ? 46.677  13.878 23.405  1.00 60.11  ? 98   LYS A CE    1 
ATOM   1388 N  NZ    . LYS C 3 98  ? 47.697  14.909 23.084  1.00 62.40  ? 98   LYS A NZ    1 
ATOM   1389 N  N     . ILE C 3 99  ? 40.173  11.057 21.306  1.00 52.15  ? 99   ILE A N     1 
ATOM   1390 C  CA    . ILE C 3 99  ? 39.100  10.888 20.344  1.00 51.49  ? 99   ILE A CA    1 
ATOM   1391 C  C     . ILE C 3 99  ? 37.792  11.470 20.882  1.00 49.88  ? 99   ILE A C     1 
ATOM   1392 O  O     . ILE C 3 99  ? 37.471  11.320 22.060  1.00 49.14  ? 99   ILE A O     1 
ATOM   1393 C  CB    . ILE C 3 99  ? 38.920  9.389  20.001  1.00 52.06  ? 99   ILE A CB    1 
ATOM   1394 C  CG1   . ILE C 3 99  ? 37.802  9.205  18.972  1.00 52.86  ? 99   ILE A CG1   1 
ATOM   1395 C  CG2   . ILE C 3 99  ? 38.631  8.607  21.271  1.00 52.76  ? 99   ILE A CG2   1 
ATOM   1396 C  CD1   . ILE C 3 99  ? 37.705  7.788  18.421  1.00 53.18  ? 99   ILE A CD1   1 
ATOM   1397 N  N     . GLU C 3 100 ? 37.050  12.144 20.009  1.00 47.73  ? 100  GLU A N     1 
ATOM   1398 C  CA    . GLU C 3 100 ? 35.785  12.753 20.381  1.00 46.06  ? 100  GLU A CA    1 
ATOM   1399 C  C     . GLU C 3 100 ? 34.658  12.191 19.537  1.00 46.49  ? 100  GLU A C     1 
ATOM   1400 O  O     . GLU C 3 100 ? 34.656  12.351 18.317  1.00 46.37  ? 100  GLU A O     1 
ATOM   1401 C  CB    . GLU C 3 100 ? 35.841  14.267 20.173  1.00 45.03  ? 100  GLU A CB    1 
ATOM   1402 C  CG    . GLU C 3 100 ? 34.539  14.977 20.487  1.00 42.98  ? 100  GLU A CG    1 
ATOM   1403 C  CD    . GLU C 3 100 ? 34.618  16.472 20.255  1.00 43.32  ? 100  GLU A CD    1 
ATOM   1404 O  OE1   . GLU C 3 100 ? 35.603  17.098 20.690  1.00 44.30  ? 100  GLU A OE1   1 
ATOM   1405 O  OE2   . GLU C 3 100 ? 33.685  17.028 19.647  1.00 44.94  ? 100  GLU A OE2   1 
ATOM   1406 N  N     . ILE C 3 101 ? 33.697  11.536 20.183  1.00 45.83  ? 101  ILE A N     1 
ATOM   1407 C  CA    . ILE C 3 101 ? 32.555  10.984 19.469  1.00 43.66  ? 101  ILE A CA    1 
ATOM   1408 C  C     . ILE C 3 101 ? 31.524  12.095 19.443  1.00 42.86  ? 101  ILE A C     1 
ATOM   1409 O  O     . ILE C 3 101 ? 30.910  12.403 20.462  1.00 43.54  ? 101  ILE A O     1 
ATOM   1410 C  CB    . ILE C 3 101 ? 31.990  9.736  20.188  1.00 45.55  ? 101  ILE A CB    1 
ATOM   1411 C  CG1   . ILE C 3 101 ? 33.089  8.672  20.293  1.00 44.26  ? 101  ILE A CG1   1 
ATOM   1412 C  CG2   . ILE C 3 101 ? 30.781  9.171  19.413  1.00 44.07  ? 101  ILE A CG2   1 
ATOM   1413 C  CD1   . ILE C 3 101 ? 32.630  7.362  20.899  1.00 47.30  ? 101  ILE A CD1   1 
ATOM   1414 N  N     . ALA C 3 102 ? 31.348  12.702 18.274  1.00 40.45  ? 102  ALA A N     1 
ATOM   1415 C  CA    . ALA C 3 102 ? 30.430  13.820 18.122  1.00 39.04  ? 102  ALA A CA    1 
ATOM   1416 C  C     . ALA C 3 102 ? 28.972  13.449 17.943  1.00 37.27  ? 102  ALA A C     1 
ATOM   1417 O  O     . ALA C 3 102 ? 28.093  14.267 18.189  1.00 37.45  ? 102  ALA A O     1 
ATOM   1418 C  CB    . ALA C 3 102 ? 30.882  14.700 16.955  1.00 37.90  ? 102  ALA A CB    1 
ATOM   1419 N  N     . SER C 3 103 ? 28.706  12.228 17.496  1.00 35.84  ? 103  SER A N     1 
ATOM   1420 C  CA    . SER C 3 103 ? 27.329  11.801 17.293  1.00 34.11  ? 103  SER A CA    1 
ATOM   1421 C  C     . SER C 3 103 ? 27.272  10.316 16.990  1.00 32.93  ? 103  SER A C     1 
ATOM   1422 O  O     . SER C 3 103 ? 28.271  9.612  17.105  1.00 32.45  ? 103  SER A O     1 
ATOM   1423 C  CB    . SER C 3 103 ? 26.700  12.581 16.139  1.00 34.86  ? 103  SER A CB    1 
ATOM   1424 O  OG    . SER C 3 103 ? 27.275  12.203 14.902  1.00 38.15  ? 103  SER A OG    1 
ATOM   1425 N  N     . ILE C 3 104 ? 26.103  9.840  16.581  1.00 32.22  ? 104  ILE A N     1 
ATOM   1426 C  CA    . ILE C 3 104 ? 25.954  8.432  16.278  1.00 30.80  ? 104  ILE A CA    1 
ATOM   1427 C  C     . ILE C 3 104 ? 26.877  7.969  15.145  1.00 32.10  ? 104  ILE A C     1 
ATOM   1428 O  O     . ILE C 3 104 ? 27.254  6.796  15.101  1.00 31.88  ? 104  ILE A O     1 
ATOM   1429 C  CB    . ILE C 3 104 ? 24.490  8.094  15.920  1.00 32.14  ? 104  ILE A CB    1 
ATOM   1430 C  CG1   . ILE C 3 104 ? 24.266  6.583  16.083  1.00 31.56  ? 104  ILE A CG1   1 
ATOM   1431 C  CG2   . ILE C 3 104 ? 24.165  8.564  14.492  1.00 29.11  ? 104  ILE A CG2   1 
ATOM   1432 C  CD1   . ILE C 3 104 ? 22.818  6.154  16.006  1.00 33.60  ? 104  ILE A CD1   1 
ATOM   1433 N  N     . ASP C 3 105 ? 27.270  8.871  14.246  1.00 30.92  ? 105  ASP A N     1 
ATOM   1434 C  CA    . ASP C 3 105 ? 28.134  8.454  13.139  1.00 33.08  ? 105  ASP A CA    1 
ATOM   1435 C  C     . ASP C 3 105 ? 29.366  9.314  12.860  1.00 33.53  ? 105  ASP A C     1 
ATOM   1436 O  O     . ASP C 3 105 ? 29.887  9.299  11.738  1.00 33.52  ? 105  ASP A O     1 
ATOM   1437 C  CB    . ASP C 3 105 ? 27.303  8.327  11.855  1.00 32.43  ? 105  ASP A CB    1 
ATOM   1438 C  CG    . ASP C 3 105 ? 27.086  9.665  11.150  1.00 36.06  ? 105  ASP A CG    1 
ATOM   1439 O  OD1   . ASP C 3 105 ? 27.070  10.709 11.842  1.00 32.35  ? 105  ASP A OD1   1 
ATOM   1440 O  OD2   . ASP C 3 105 ? 26.922  9.662  9.903   1.00 33.09  ? 105  ASP A OD2   1 
ATOM   1441 N  N     . GLU C 3 106 ? 29.850  10.035 13.872  1.00 33.29  ? 106  GLU A N     1 
ATOM   1442 C  CA    . GLU C 3 106 ? 31.023  10.896 13.696  1.00 34.63  ? 106  GLU A CA    1 
ATOM   1443 C  C     . GLU C 3 106 ? 31.991  10.842 14.855  1.00 34.39  ? 106  GLU A C     1 
ATOM   1444 O  O     . GLU C 3 106 ? 31.587  10.768 16.006  1.00 35.26  ? 106  GLU A O     1 
ATOM   1445 C  CB    . GLU C 3 106 ? 30.609  12.355 13.535  1.00 35.28  ? 106  GLU A CB    1 
ATOM   1446 C  CG    . GLU C 3 106 ? 29.726  12.665 12.362  1.00 39.51  ? 106  GLU A CG    1 
ATOM   1447 C  CD    . GLU C 3 106 ? 29.241  14.102 12.403  1.00 39.44  ? 106  GLU A CD    1 
ATOM   1448 O  OE1   . GLU C 3 106 ? 28.669  14.500 13.434  1.00 41.33  ? 106  GLU A OE1   1 
ATOM   1449 O  OE2   . GLU C 3 106 ? 29.430  14.835 11.418  1.00 42.16  ? 106  GLU A OE2   1 
ATOM   1450 N  N     . ALA C 3 107 ? 33.277  10.915 14.538  1.00 35.56  ? 107  ALA A N     1 
ATOM   1451 C  CA    . ALA C 3 107 ? 34.321  10.911 15.551  1.00 33.19  ? 107  ALA A CA    1 
ATOM   1452 C  C     . ALA C 3 107 ? 35.492  11.746 15.055  1.00 33.39  ? 107  ALA A C     1 
ATOM   1453 O  O     . ALA C 3 107 ? 35.841  11.707 13.869  1.00 31.37  ? 107  ALA A O     1 
ATOM   1454 C  CB    . ALA C 3 107 ? 34.787  9.478  15.840  1.00 32.43  ? 107  ALA A CB    1 
ATOM   1455 N  N     . TYR C 3 108 ? 36.080  12.518 15.963  1.00 32.85  ? 108  TYR A N     1 
ATOM   1456 C  CA    . TYR C 3 108 ? 37.241  13.344 15.651  1.00 33.76  ? 108  TYR A CA    1 
ATOM   1457 C  C     . TYR C 3 108 ? 38.393  12.682 16.383  1.00 35.45  ? 108  TYR A C     1 
ATOM   1458 O  O     . TYR C 3 108 ? 38.258  12.326 17.553  1.00 36.11  ? 108  TYR A O     1 
ATOM   1459 C  CB    . TYR C 3 108 ? 37.082  14.764 16.200  1.00 30.97  ? 108  TYR A CB    1 
ATOM   1460 C  CG    . TYR C 3 108 ? 36.041  15.607 15.511  1.00 28.87  ? 108  TYR A CG    1 
ATOM   1461 C  CD1   . TYR C 3 108 ? 36.374  16.410 14.411  1.00 27.36  ? 108  TYR A CD1   1 
ATOM   1462 C  CD2   . TYR C 3 108 ? 34.728  15.601 15.946  1.00 26.37  ? 108  TYR A CD2   1 
ATOM   1463 C  CE1   . TYR C 3 108 ? 35.415  17.184 13.768  1.00 28.27  ? 108  TYR A CE1   1 
ATOM   1464 C  CE2   . TYR C 3 108 ? 33.761  16.372 15.313  1.00 30.62  ? 108  TYR A CE2   1 
ATOM   1465 C  CZ    . TYR C 3 108 ? 34.112  17.159 14.225  1.00 28.59  ? 108  TYR A CZ    1 
ATOM   1466 O  OH    . TYR C 3 108 ? 33.157  17.912 13.591  1.00 32.97  ? 108  TYR A OH    1 
ATOM   1467 N  N     . LEU C 3 109 ? 39.522  12.506 15.709  1.00 36.75  ? 109  LEU A N     1 
ATOM   1468 C  CA    . LEU C 3 109 ? 40.677  11.914 16.367  1.00 37.50  ? 109  LEU A CA    1 
ATOM   1469 C  C     . LEU C 3 109 ? 41.876  12.842 16.247  1.00 39.51  ? 109  LEU A C     1 
ATOM   1470 O  O     . LEU C 3 109 ? 42.195  13.320 15.158  1.00 39.74  ? 109  LEU A O     1 
ATOM   1471 C  CB    . LEU C 3 109 ? 41.022  10.552 15.755  1.00 37.25  ? 109  LEU A CB    1 
ATOM   1472 C  CG    . LEU C 3 109 ? 40.102  9.363  16.067  1.00 37.24  ? 109  LEU A CG    1 
ATOM   1473 C  CD1   . LEU C 3 109 ? 38.760  9.543  15.416  1.00 34.97  ? 109  LEU A CD1   1 
ATOM   1474 C  CD2   . LEU C 3 109 ? 40.744  8.095  15.541  1.00 38.62  ? 109  LEU A CD2   1 
ATOM   1475 N  N     . ASP C 3 110 ? 42.524  13.107 17.374  1.00 40.48  ? 110  ASP A N     1 
ATOM   1476 C  CA    . ASP C 3 110 ? 43.707  13.955 17.394  1.00 43.95  ? 110  ASP A CA    1 
ATOM   1477 C  C     . ASP C 3 110 ? 44.871  13.008 17.173  1.00 44.38  ? 110  ASP A C     1 
ATOM   1478 O  O     . ASP C 3 110 ? 45.318  12.337 18.098  1.00 44.66  ? 110  ASP A O     1 
ATOM   1479 C  CB    . ASP C 3 110 ? 43.857  14.638 18.756  1.00 45.41  ? 110  ASP A CB    1 
ATOM   1480 C  CG    . ASP C 3 110 ? 45.071  15.546 18.822  1.00 47.59  ? 110  ASP A CG    1 
ATOM   1481 O  OD1   . ASP C 3 110 ? 46.011  15.354 18.024  1.00 46.43  ? 110  ASP A OD1   1 
ATOM   1482 O  OD2   . ASP C 3 110 ? 45.090  16.452 19.682  1.00 52.08  ? 110  ASP A OD2   1 
ATOM   1483 N  N     . ILE C 3 111 ? 45.361  12.940 15.945  1.00 46.26  ? 111  ILE A N     1 
ATOM   1484 C  CA    . ILE C 3 111 ? 46.456  12.039 15.650  1.00 48.33  ? 111  ILE A CA    1 
ATOM   1485 C  C     . ILE C 3 111 ? 47.777  12.780 15.563  1.00 50.53  ? 111  ILE A C     1 
ATOM   1486 O  O     . ILE C 3 111 ? 48.710  12.329 14.895  1.00 50.54  ? 111  ILE A O     1 
ATOM   1487 C  CB    . ILE C 3 111 ? 46.206  11.280 14.332  1.00 48.20  ? 111  ILE A CB    1 
ATOM   1488 C  CG1   . ILE C 3 111 ? 46.080  12.271 13.177  1.00 47.55  ? 111  ILE A CG1   1 
ATOM   1489 C  CG2   . ILE C 3 111 ? 44.942  10.427 14.453  1.00 47.81  ? 111  ILE A CG2   1 
ATOM   1490 C  CD1   . ILE C 3 111 ? 45.879  11.607 11.829  1.00 49.29  ? 111  ILE A CD1   1 
ATOM   1491 N  N     . SER C 3 112 ? 47.849  13.917 16.247  1.00 51.63  ? 112  SER A N     1 
ATOM   1492 C  CA    . SER C 3 112 ? 49.059  14.726 16.259  1.00 53.39  ? 112  SER A CA    1 
ATOM   1493 C  C     . SER C 3 112 ? 50.269  13.905 16.714  1.00 54.78  ? 112  SER A C     1 
ATOM   1494 O  O     . SER C 3 112 ? 51.345  14.006 16.125  1.00 54.94  ? 112  SER A O     1 
ATOM   1495 C  CB    . SER C 3 112 ? 48.875  15.938 17.179  1.00 52.30  ? 112  SER A CB    1 
ATOM   1496 O  OG    . SER C 3 112 ? 47.813  16.763 16.733  1.00 50.21  ? 112  SER A OG    1 
ATOM   1497 N  N     . ASP C 3 113 ? 50.087  13.083 17.747  1.00 56.31  ? 113  ASP A N     1 
ATOM   1498 C  CA    . ASP C 3 113 ? 51.173  12.255 18.269  1.00 58.27  ? 113  ASP A CA    1 
ATOM   1499 C  C     . ASP C 3 113 ? 51.321  10.895 17.589  1.00 58.97  ? 113  ASP A C     1 
ATOM   1500 O  O     . ASP C 3 113 ? 52.198  10.112 17.953  1.00 59.23  ? 113  ASP A O     1 
ATOM   1501 C  CB    . ASP C 3 113 ? 50.995  12.032 19.770  1.00 59.77  ? 113  ASP A CB    1 
ATOM   1502 C  CG    . ASP C 3 113 ? 50.861  13.323 20.533  1.00 62.77  ? 113  ASP A CG    1 
ATOM   1503 O  OD1   . ASP C 3 113 ? 51.671  14.239 20.281  1.00 63.54  ? 113  ASP A OD1   1 
ATOM   1504 O  OD2   . ASP C 3 113 ? 49.953  13.418 21.388  1.00 64.87  ? 113  ASP A OD2   1 
ATOM   1505 N  N     . LYS C 3 114 ? 50.477  10.607 16.607  1.00 59.49  ? 114  LYS A N     1 
ATOM   1506 C  CA    . LYS C 3 114 ? 50.560  9.326  15.919  1.00 60.92  ? 114  LYS A CA    1 
ATOM   1507 C  C     . LYS C 3 114 ? 51.250  9.437  14.565  1.00 61.48  ? 114  LYS A C     1 
ATOM   1508 O  O     . LYS C 3 114 ? 52.013  8.554  14.181  1.00 62.94  ? 114  LYS A O     1 
ATOM   1509 C  CB    . LYS C 3 114 ? 49.162  8.730  15.748  1.00 60.42  ? 114  LYS A CB    1 
ATOM   1510 C  CG    . LYS C 3 114 ? 48.372  8.672  17.043  1.00 62.01  ? 114  LYS A CG    1 
ATOM   1511 C  CD    . LYS C 3 114 ? 49.089  7.842  18.102  1.00 65.05  ? 114  LYS A CD    1 
ATOM   1512 C  CE    . LYS C 3 114 ? 48.326  7.851  19.429  1.00 66.90  ? 114  LYS A CE    1 
ATOM   1513 N  NZ    . LYS C 3 114 ? 48.871  6.872  20.417  1.00 67.14  ? 114  LYS A NZ    1 
ATOM   1514 N  N     . VAL C 3 115 ? 50.987  10.514 13.837  1.00 61.84  ? 115  VAL A N     1 
ATOM   1515 C  CA    . VAL C 3 115 ? 51.610  10.697 12.532  1.00 62.89  ? 115  VAL A CA    1 
ATOM   1516 C  C     . VAL C 3 115 ? 52.500  11.937 12.530  1.00 63.64  ? 115  VAL A C     1 
ATOM   1517 O  O     . VAL C 3 115 ? 52.371  12.804 13.393  1.00 64.07  ? 115  VAL A O     1 
ATOM   1518 C  CB    . VAL C 3 115 ? 50.547  10.817 11.417  1.00 63.65  ? 115  VAL A CB    1 
ATOM   1519 C  CG1   . VAL C 3 115 ? 49.658  9.587  11.425  1.00 63.76  ? 115  VAL A CG1   1 
ATOM   1520 C  CG2   . VAL C 3 115 ? 49.715  12.073 11.611  1.00 63.41  ? 115  VAL A CG2   1 
ATOM   1521 N  N     . ARG C 3 116 ? 53.402  12.021 11.559  1.00 64.02  ? 116  ARG A N     1 
ATOM   1522 C  CA    . ARG C 3 116 ? 54.316  13.153 11.477  1.00 64.77  ? 116  ARG A CA    1 
ATOM   1523 C  C     . ARG C 3 116 ? 53.905  14.218 10.481  1.00 62.78  ? 116  ARG A C     1 
ATOM   1524 O  O     . ARG C 3 116 ? 54.388  15.343 10.544  1.00 63.78  ? 116  ARG A O     1 
ATOM   1525 C  CB    . ARG C 3 116 ? 55.734  12.667 11.142  1.00 67.86  ? 116  ARG A CB    1 
ATOM   1526 C  CG    . ARG C 3 116 ? 56.491  12.109 12.343  1.00 72.91  ? 116  ARG A CG    1 
ATOM   1527 C  CD    . ARG C 3 116 ? 57.874  11.597 11.967  1.00 76.39  ? 116  ARG A CD    1 
ATOM   1528 N  NE    . ARG C 3 116 ? 57.831  10.265 11.361  1.00 80.27  ? 116  ARG A NE    1 
ATOM   1529 C  CZ    . ARG C 3 116 ? 58.907  9.594  10.956  1.00 82.08  ? 116  ARG A CZ    1 
ATOM   1530 N  NH1   . ARG C 3 116 ? 60.116  10.129 11.090  1.00 82.45  ? 116  ARG A NH1   1 
ATOM   1531 N  NH2   . ARG C 3 116 ? 58.776  8.384  10.420  1.00 83.30  ? 116  ARG A NH2   1 
ATOM   1532 N  N     . ASP C 3 117 ? 53.016  13.873 9.561   1.00 60.58  ? 117  ASP A N     1 
ATOM   1533 C  CA    . ASP C 3 117 ? 52.575  14.827 8.551   1.00 58.37  ? 117  ASP A CA    1 
ATOM   1534 C  C     . ASP C 3 117 ? 51.257  14.382 7.930   1.00 55.69  ? 117  ASP A C     1 
ATOM   1535 O  O     . ASP C 3 117 ? 50.679  13.382 8.345   1.00 53.99  ? 117  ASP A O     1 
ATOM   1536 C  CB    . ASP C 3 117 ? 53.648  14.965 7.466   1.00 60.24  ? 117  ASP A CB    1 
ATOM   1537 C  CG    . ASP C 3 117 ? 54.199  13.618 7.012   1.00 61.64  ? 117  ASP A CG    1 
ATOM   1538 O  OD1   . ASP C 3 117 ? 53.397  12.714 6.693   1.00 62.56  ? 117  ASP A OD1   1 
ATOM   1539 O  OD2   . ASP C 3 117 ? 55.437  13.463 6.972   1.00 63.40  ? 117  ASP A OD2   1 
ATOM   1540 N  N     . TYR C 3 118 ? 50.782  15.122 6.936   1.00 53.47  ? 118  TYR A N     1 
ATOM   1541 C  CA    . TYR C 3 118 ? 49.525  14.761 6.299   1.00 53.40  ? 118  TYR A CA    1 
ATOM   1542 C  C     . TYR C 3 118 ? 49.638  13.503 5.444   1.00 54.11  ? 118  TYR A C     1 
ATOM   1543 O  O     . TYR C 3 118 ? 48.660  12.765 5.288   1.00 52.49  ? 118  TYR A O     1 
ATOM   1544 C  CB    . TYR C 3 118 ? 48.988  15.931 5.463   1.00 52.07  ? 118  TYR A CB    1 
ATOM   1545 C  CG    . TYR C 3 118 ? 48.339  17.022 6.294   1.00 49.19  ? 118  TYR A CG    1 
ATOM   1546 C  CD1   . TYR C 3 118 ? 47.461  16.702 7.331   1.00 48.36  ? 118  TYR A CD1   1 
ATOM   1547 C  CD2   . TYR C 3 118 ? 48.583  18.369 6.033   1.00 47.59  ? 118  TYR A CD2   1 
ATOM   1548 C  CE1   . TYR C 3 118 ? 46.844  17.689 8.086   1.00 46.08  ? 118  TYR A CE1   1 
ATOM   1549 C  CE2   . TYR C 3 118 ? 47.966  19.369 6.787   1.00 46.45  ? 118  TYR A CE2   1 
ATOM   1550 C  CZ    . TYR C 3 118 ? 47.098  19.016 7.810   1.00 46.40  ? 118  TYR A CZ    1 
ATOM   1551 O  OH    . TYR C 3 118 ? 46.478  19.983 8.560   1.00 44.87  ? 118  TYR A OH    1 
ATOM   1552 N  N     . ARG C 3 119 ? 50.827  13.252 4.893   1.00 54.79  ? 119  ARG A N     1 
ATOM   1553 C  CA    . ARG C 3 119 ? 51.021  12.059 4.075   1.00 55.61  ? 119  ARG A CA    1 
ATOM   1554 C  C     . ARG C 3 119 ? 50.736  10.866 4.966   1.00 54.36  ? 119  ARG A C     1 
ATOM   1555 O  O     . ARG C 3 119 ? 49.938  9.996  4.629   1.00 54.93  ? 119  ARG A O     1 
ATOM   1556 C  CB    . ARG C 3 119 ? 52.460  11.970 3.550   1.00 57.77  ? 119  ARG A CB    1 
ATOM   1557 C  CG    . ARG C 3 119 ? 52.707  10.770 2.631   1.00 59.76  ? 119  ARG A CG    1 
ATOM   1558 C  CD    . ARG C 3 119 ? 54.175  10.644 2.225   1.00 63.00  ? 119  ARG A CD    1 
ATOM   1559 N  NE    . ARG C 3 119 ? 55.034  10.273 3.350   1.00 64.57  ? 119  ARG A NE    1 
ATOM   1560 C  CZ    . ARG C 3 119 ? 55.146  9.039  3.839   1.00 66.37  ? 119  ARG A CZ    1 
ATOM   1561 N  NH1   . ARG C 3 119 ? 54.457  8.040  3.300   1.00 66.28  ? 119  ARG A NH1   1 
ATOM   1562 N  NH2   . ARG C 3 119 ? 55.941  8.805  4.879   1.00 66.66  ? 119  ARG A NH2   1 
ATOM   1563 N  N     . GLU C 3 120 ? 51.395  10.840 6.116   1.00 53.76  ? 120  GLU A N     1 
ATOM   1564 C  CA    . GLU C 3 120 ? 51.215  9.761  7.070   1.00 53.40  ? 120  GLU A CA    1 
ATOM   1565 C  C     . GLU C 3 120 ? 49.778  9.715  7.563   1.00 52.16  ? 120  GLU A C     1 
ATOM   1566 O  O     . GLU C 3 120 ? 49.219  8.637  7.757   1.00 51.28  ? 120  GLU A O     1 
ATOM   1567 C  CB    . GLU C 3 120 ? 52.153  9.949  8.260   1.00 55.77  ? 120  GLU A CB    1 
ATOM   1568 C  CG    . GLU C 3 120 ? 53.579  9.500  8.007   1.00 59.21  ? 120  GLU A CG    1 
ATOM   1569 C  CD    . GLU C 3 120 ? 54.470  9.714  9.215   1.00 61.68  ? 120  GLU A CD    1 
ATOM   1570 O  OE1   . GLU C 3 120 ? 54.055  9.350  10.340  1.00 63.36  ? 120  GLU A OE1   1 
ATOM   1571 O  OE2   . GLU C 3 120 ? 55.589  10.241 9.039   1.00 63.80  ? 120  GLU A OE2   1 
ATOM   1572 N  N     . ALA C 3 121 ? 49.192  10.893 7.773   1.00 49.98  ? 121  ALA A N     1 
ATOM   1573 C  CA    . ALA C 3 121 ? 47.815  10.992 8.242   1.00 49.37  ? 121  ALA A CA    1 
ATOM   1574 C  C     . ALA C 3 121 ? 46.872  10.384 7.204   1.00 47.70  ? 121  ALA A C     1 
ATOM   1575 O  O     . ALA C 3 121 ? 46.010  9.580  7.541   1.00 45.62  ? 121  ALA A O     1 
ATOM   1576 C  CB    . ALA C 3 121 ? 47.444  12.460 8.497   1.00 49.55  ? 121  ALA A CB    1 
ATOM   1577 N  N     . TYR C 3 122 ? 47.044  10.786 5.946   1.00 47.65  ? 122  TYR A N     1 
ATOM   1578 C  CA    . TYR C 3 122 ? 46.228  10.274 4.849   1.00 48.34  ? 122  TYR A CA    1 
ATOM   1579 C  C     . TYR C 3 122 ? 46.303  8.752  4.850   1.00 48.26  ? 122  TYR A C     1 
ATOM   1580 O  O     . TYR C 3 122 ? 45.283  8.069  4.780   1.00 46.48  ? 122  TYR A O     1 
ATOM   1581 C  CB    . TYR C 3 122 ? 46.754  10.807 3.520   1.00 49.47  ? 122  TYR A CB    1 
ATOM   1582 C  CG    . TYR C 3 122 ? 46.033  10.277 2.300   1.00 50.17  ? 122  TYR A CG    1 
ATOM   1583 C  CD1   . TYR C 3 122 ? 44.881  10.894 1.823   1.00 50.83  ? 122  TYR A CD1   1 
ATOM   1584 C  CD2   . TYR C 3 122 ? 46.514  9.161  1.613   1.00 51.65  ? 122  TYR A CD2   1 
ATOM   1585 C  CE1   . TYR C 3 122 ? 44.227  10.420 0.691   1.00 51.66  ? 122  TYR A CE1   1 
ATOM   1586 C  CE2   . TYR C 3 122 ? 45.866  8.676  0.481   1.00 50.08  ? 122  TYR A CE2   1 
ATOM   1587 C  CZ    . TYR C 3 122 ? 44.724  9.309  0.026   1.00 51.83  ? 122  TYR A CZ    1 
ATOM   1588 O  OH    . TYR C 3 122 ? 44.065  8.835  -1.086  1.00 51.86  ? 122  TYR A OH    1 
ATOM   1589 N  N     . ASN C 3 123 ? 47.525  8.227  4.934   1.00 48.94  ? 123  ASN A N     1 
ATOM   1590 C  CA    . ASN C 3 123 ? 47.735  6.781  4.956   1.00 49.82  ? 123  ASN A CA    1 
ATOM   1591 C  C     . ASN C 3 123 ? 47.044  6.158  6.157   1.00 48.82  ? 123  ASN A C     1 
ATOM   1592 O  O     . ASN C 3 123 ? 46.488  5.060  6.064   1.00 48.77  ? 123  ASN A O     1 
ATOM   1593 C  CB    . ASN C 3 123 ? 49.228  6.440  5.005   1.00 50.60  ? 123  ASN A CB    1 
ATOM   1594 C  CG    . ASN C 3 123 ? 49.954  6.806  3.727   1.00 52.99  ? 123  ASN A CG    1 
ATOM   1595 O  OD1   . ASN C 3 123 ? 49.336  7.015  2.677   1.00 52.21  ? 123  ASN A OD1   1 
ATOM   1596 N  ND2   . ASN C 3 123 ? 51.282  6.869  3.804   1.00 54.09  ? 123  ASN A ND2   1 
ATOM   1597 N  N     . LEU C 3 124 ? 47.097  6.846  7.291   1.00 46.37  ? 124  LEU A N     1 
ATOM   1598 C  CA    . LEU C 3 124 ? 46.440  6.345  8.485   1.00 46.43  ? 124  LEU A CA    1 
ATOM   1599 C  C     . LEU C 3 124 ? 44.932  6.321  8.221   1.00 45.64  ? 124  LEU A C     1 
ATOM   1600 O  O     . LEU C 3 124 ? 44.221  5.422  8.677   1.00 44.76  ? 124  LEU A O     1 
ATOM   1601 C  CB    . LEU C 3 124 ? 46.749  7.243  9.690   1.00 47.37  ? 124  LEU A CB    1 
ATOM   1602 C  CG    . LEU C 3 124 ? 46.118  6.764  10.998  1.00 46.77  ? 124  LEU A CG    1 
ATOM   1603 C  CD1   . LEU C 3 124 ? 46.567  5.343  11.275  1.00 46.68  ? 124  LEU A CD1   1 
ATOM   1604 C  CD2   . LEU C 3 124 ? 46.501  7.690  12.141  1.00 46.77  ? 124  LEU A CD2   1 
ATOM   1605 N  N     . GLY C 3 125 ? 44.457  7.311  7.470   1.00 44.14  ? 125  GLY A N     1 
ATOM   1606 C  CA    . GLY C 3 125 ? 43.047  7.378  7.152   1.00 45.89  ? 125  GLY A CA    1 
ATOM   1607 C  C     . GLY C 3 125 ? 42.620  6.145  6.384   1.00 47.21  ? 125  GLY A C     1 
ATOM   1608 O  O     . GLY C 3 125 ? 41.597  5.536  6.700   1.00 47.57  ? 125  GLY A O     1 
ATOM   1609 N  N     . LEU C 3 126 ? 43.398  5.781  5.365   1.00 47.87  ? 126  LEU A N     1 
ATOM   1610 C  CA    . LEU C 3 126 ? 43.099  4.612  4.543   1.00 48.23  ? 126  LEU A CA    1 
ATOM   1611 C  C     . LEU C 3 126 ? 43.061  3.383  5.435   1.00 49.50  ? 126  LEU A C     1 
ATOM   1612 O  O     . LEU C 3 126 ? 42.136  2.574  5.361   1.00 50.86  ? 126  LEU A O     1 
ATOM   1613 C  CB    . LEU C 3 126 ? 44.166  4.439  3.465   1.00 47.98  ? 126  LEU A CB    1 
ATOM   1614 C  CG    . LEU C 3 126 ? 44.318  5.587  2.464   1.00 49.73  ? 126  LEU A CG    1 
ATOM   1615 C  CD1   . LEU C 3 126 ? 45.550  5.361  1.615   1.00 49.17  ? 126  LEU A CD1   1 
ATOM   1616 C  CD2   . LEU C 3 126 ? 43.078  5.690  1.587   1.00 48.85  ? 126  LEU A CD2   1 
ATOM   1617 N  N     . GLU C 3 127 ? 44.069  3.257  6.291   1.00 50.31  ? 127  GLU A N     1 
ATOM   1618 C  CA    . GLU C 3 127 ? 44.147  2.133  7.215   1.00 51.58  ? 127  GLU A CA    1 
ATOM   1619 C  C     . GLU C 3 127 ? 42.881  2.052  8.065   1.00 51.22  ? 127  GLU A C     1 
ATOM   1620 O  O     . GLU C 3 127 ? 42.406  0.962  8.380   1.00 52.94  ? 127  GLU A O     1 
ATOM   1621 C  CB    . GLU C 3 127 ? 45.363  2.281  8.131   1.00 53.31  ? 127  GLU A CB    1 
ATOM   1622 C  CG    . GLU C 3 127 ? 45.682  1.021  8.920   1.00 57.85  ? 127  GLU A CG    1 
ATOM   1623 C  CD    . GLU C 3 127 ? 46.769  1.229  9.955   1.00 59.89  ? 127  GLU A CD    1 
ATOM   1624 O  OE1   . GLU C 3 127 ? 47.782  1.896  9.638   1.00 61.18  ? 127  GLU A OE1   1 
ATOM   1625 O  OE2   . GLU C 3 127 ? 46.609  0.713  11.084  1.00 60.80  ? 127  GLU A OE2   1 
ATOM   1626 N  N     . ILE C 3 128 ? 42.341  3.208  8.445   1.00 49.62  ? 128  ILE A N     1 
ATOM   1627 C  CA    . ILE C 3 128 ? 41.125  3.247  9.252   1.00 48.41  ? 128  ILE A CA    1 
ATOM   1628 C  C     . ILE C 3 128 ? 39.922  2.838  8.409   1.00 47.59  ? 128  ILE A C     1 
ATOM   1629 O  O     . ILE C 3 128 ? 39.093  2.037  8.838   1.00 46.34  ? 128  ILE A O     1 
ATOM   1630 C  CB    . ILE C 3 128 ? 40.862  4.666  9.838   1.00 48.08  ? 128  ILE A CB    1 
ATOM   1631 C  CG1   . ILE C 3 128 ? 41.912  4.994  10.903  1.00 46.41  ? 128  ILE A CG1   1 
ATOM   1632 C  CG2   . ILE C 3 128 ? 39.453  4.733  10.440  1.00 45.93  ? 128  ILE A CG2   1 
ATOM   1633 C  CD1   . ILE C 3 128 ? 41.719  6.348  11.541  1.00 49.21  ? 128  ILE A CD1   1 
ATOM   1634 N  N     . LYS C 3 129 ? 39.826  3.401  7.210   1.00 46.99  ? 129  LYS A N     1 
ATOM   1635 C  CA    . LYS C 3 129 ? 38.727  3.082  6.315   1.00 47.24  ? 129  LYS A CA    1 
ATOM   1636 C  C     . LYS C 3 129 ? 38.689  1.587  6.016   1.00 48.54  ? 129  LYS A C     1 
ATOM   1637 O  O     . LYS C 3 129 ? 37.614  0.979  5.977   1.00 47.76  ? 129  LYS A O     1 
ATOM   1638 C  CB    . LYS C 3 129 ? 38.859  3.875  5.014   1.00 45.49  ? 129  LYS A CB    1 
ATOM   1639 C  CG    . LYS C 3 129 ? 38.465  5.335  5.146   1.00 44.11  ? 129  LYS A CG    1 
ATOM   1640 C  CD    . LYS C 3 129 ? 38.679  6.094  3.852   1.00 43.22  ? 129  LYS A CD    1 
ATOM   1641 C  CE    . LYS C 3 129 ? 37.939  5.463  2.687   1.00 42.57  ? 129  LYS A CE    1 
ATOM   1642 N  NZ    . LYS C 3 129 ? 36.470  5.588  2.822   1.00 44.06  ? 129  LYS A NZ    1 
ATOM   1643 N  N     . ASN C 3 130 ? 39.861  0.989  5.818   1.00 49.58  ? 130  ASN A N     1 
ATOM   1644 C  CA    . ASN C 3 130 ? 39.919  -0.435 5.517   1.00 50.78  ? 130  ASN A CA    1 
ATOM   1645 C  C     . ASN C 3 130 ? 39.538  -1.280 6.709   1.00 49.29  ? 130  ASN A C     1 
ATOM   1646 O  O     . ASN C 3 130 ? 38.783  -2.242 6.575   1.00 48.95  ? 130  ASN A O     1 
ATOM   1647 C  CB    . ASN C 3 130 ? 41.309  -0.834 5.018   1.00 54.46  ? 130  ASN A CB    1 
ATOM   1648 C  CG    . ASN C 3 130 ? 41.585  -0.322 3.613   1.00 60.79  ? 130  ASN A CG    1 
ATOM   1649 O  OD1   . ASN C 3 130 ? 40.703  -0.350 2.746   1.00 63.02  ? 130  ASN A OD1   1 
ATOM   1650 N  ND2   . ASN C 3 130 ? 42.814  0.138  3.373   1.00 63.34  ? 130  ASN A ND2   1 
ATOM   1651 N  N     . LYS C 3 131 ? 40.056  -0.917 7.877   1.00 47.43  ? 131  LYS A N     1 
ATOM   1652 C  CA    . LYS C 3 131 ? 39.756  -1.656 9.096   1.00 45.96  ? 131  LYS A CA    1 
ATOM   1653 C  C     . LYS C 3 131 ? 38.256  -1.750 9.318   1.00 45.41  ? 131  LYS A C     1 
ATOM   1654 O  O     . LYS C 3 131 ? 37.717  -2.841 9.534   1.00 45.46  ? 131  LYS A O     1 
ATOM   1655 C  CB    . LYS C 3 131 ? 40.404  -0.977 10.301  1.00 45.61  ? 131  LYS A CB    1 
ATOM   1656 C  CG    . LYS C 3 131 ? 39.943  -1.522 11.650  1.00 45.90  ? 131  LYS A CG    1 
ATOM   1657 C  CD    . LYS C 3 131 ? 40.428  -2.941 11.898  1.00 47.83  ? 131  LYS A CD    1 
ATOM   1658 C  CE    . LYS C 3 131 ? 41.939  -2.999 12.088  1.00 47.96  ? 131  LYS A CE    1 
ATOM   1659 N  NZ    . LYS C 3 131 ? 42.399  -4.370 12.446  1.00 48.68  ? 131  LYS A NZ    1 
ATOM   1660 N  N     . ILE C 3 132 ? 37.587  -0.601 9.271   1.00 44.43  ? 132  ILE A N     1 
ATOM   1661 C  CA    . ILE C 3 132 ? 36.141  -0.541 9.473   1.00 43.42  ? 132  ILE A CA    1 
ATOM   1662 C  C     . ILE C 3 132 ? 35.397  -1.365 8.423   1.00 44.68  ? 132  ILE A C     1 
ATOM   1663 O  O     . ILE C 3 132 ? 34.412  -2.040 8.726   1.00 43.09  ? 132  ILE A O     1 
ATOM   1664 C  CB    . ILE C 3 132 ? 35.631  0.908  9.406   1.00 41.49  ? 132  ILE A CB    1 
ATOM   1665 C  CG1   . ILE C 3 132 ? 36.273  1.732  10.532  1.00 40.36  ? 132  ILE A CG1   1 
ATOM   1666 C  CG2   . ILE C 3 132 ? 34.101  0.923  9.498   1.00 39.00  ? 132  ILE A CG2   1 
ATOM   1667 C  CD1   . ILE C 3 132 ? 35.863  3.197  10.545  1.00 37.96  ? 132  ILE A CD1   1 
ATOM   1668 N  N     . LEU C 3 133 ? 35.874  -1.303 7.186   1.00 45.25  ? 133  LEU A N     1 
ATOM   1669 C  CA    . LEU C 3 133 ? 35.252  -2.042 6.100   1.00 47.31  ? 133  LEU A CA    1 
ATOM   1670 C  C     . LEU C 3 133 ? 35.424  -3.551 6.263   1.00 49.22  ? 133  LEU A C     1 
ATOM   1671 O  O     . LEU C 3 133 ? 34.503  -4.311 5.976   1.00 49.31  ? 133  LEU A O     1 
ATOM   1672 C  CB    . LEU C 3 133 ? 35.841  -1.600 4.766   1.00 45.32  ? 133  LEU A CB    1 
ATOM   1673 C  CG    . LEU C 3 133 ? 35.213  -2.282 3.554   1.00 45.92  ? 133  LEU A CG    1 
ATOM   1674 C  CD1   . LEU C 3 133 ? 33.771  -1.840 3.402   1.00 44.57  ? 133  LEU A CD1   1 
ATOM   1675 C  CD2   . LEU C 3 133 ? 36.011  -1.929 2.310   1.00 45.17  ? 133  LEU A CD2   1 
ATOM   1676 N  N     . GLU C 3 134 ? 36.600  -3.974 6.725   1.00 50.91  ? 134  GLU A N     1 
ATOM   1677 C  CA    . GLU C 3 134 ? 36.886  -5.393 6.932   1.00 53.54  ? 134  GLU A CA    1 
ATOM   1678 C  C     . GLU C 3 134 ? 36.083  -5.930 8.105   1.00 53.35  ? 134  GLU A C     1 
ATOM   1679 O  O     . GLU C 3 134 ? 35.451  -6.979 8.020   1.00 53.12  ? 134  GLU A O     1 
ATOM   1680 C  CB    . GLU C 3 134 ? 38.369  -5.619 7.249   1.00 56.79  ? 134  GLU A CB    1 
ATOM   1681 C  CG    . GLU C 3 134 ? 39.354  -5.003 6.276   1.00 62.24  ? 134  GLU A CG    1 
ATOM   1682 C  CD    . GLU C 3 134 ? 40.799  -5.170 6.741   1.00 66.26  ? 134  GLU A CD    1 
ATOM   1683 O  OE1   . GLU C 3 134 ? 41.057  -5.032 7.962   1.00 67.80  ? 134  GLU A OE1   1 
ATOM   1684 O  OE2   . GLU C 3 134 ? 41.674  -5.426 5.884   1.00 67.70  ? 134  GLU A OE2   1 
ATOM   1685 N  N     . LYS C 3 135 ? 36.131  -5.201 9.211   1.00 53.63  ? 135  LYS A N     1 
ATOM   1686 C  CA    . LYS C 3 135 ? 35.440  -5.602 10.422  1.00 52.70  ? 135  LYS A CA    1 
ATOM   1687 C  C     . LYS C 3 135 ? 33.924  -5.475 10.365  1.00 51.68  ? 135  LYS A C     1 
ATOM   1688 O  O     . LYS C 3 135 ? 33.208  -6.328 10.891  1.00 51.88  ? 135  LYS A O     1 
ATOM   1689 C  CB    . LYS C 3 135 ? 35.964  -4.787 11.607  1.00 54.55  ? 135  LYS A CB    1 
ATOM   1690 C  CG    . LYS C 3 135 ? 37.388  -5.119 12.037  1.00 55.18  ? 135  LYS A CG    1 
ATOM   1691 C  CD    . LYS C 3 135 ? 37.438  -6.419 12.842  1.00 57.85  ? 135  LYS A CD    1 
ATOM   1692 C  CE    . LYS C 3 135 ? 38.751  -6.540 13.613  1.00 58.25  ? 135  LYS A CE    1 
ATOM   1693 N  NZ    . LYS C 3 135 ? 38.815  -7.734 14.501  1.00 58.88  ? 135  LYS A NZ    1 
ATOM   1694 N  N     . GLU C 3 136 ? 33.431  -4.420 9.728   1.00 48.76  ? 136  GLU A N     1 
ATOM   1695 C  CA    . GLU C 3 136 ? 31.992  -4.204 9.684   1.00 46.72  ? 136  GLU A CA    1 
ATOM   1696 C  C     . GLU C 3 136 ? 31.364  -4.003 8.303   1.00 45.71  ? 136  GLU A C     1 
ATOM   1697 O  O     . GLU C 3 136 ? 30.144  -3.887 8.195   1.00 45.27  ? 136  GLU A O     1 
ATOM   1698 C  CB    . GLU C 3 136 ? 31.644  -3.012 10.581  1.00 45.71  ? 136  GLU A CB    1 
ATOM   1699 C  CG    . GLU C 3 136 ? 32.037  -3.184 12.041  1.00 43.96  ? 136  GLU A CG    1 
ATOM   1700 C  CD    . GLU C 3 136 ? 31.081  -4.087 12.811  1.00 44.69  ? 136  GLU A CD    1 
ATOM   1701 O  OE1   . GLU C 3 136 ? 30.006  -4.437 12.280  1.00 46.77  ? 136  GLU A OE1   1 
ATOM   1702 O  OE2   . GLU C 3 136 ? 31.391  -4.440 13.963  1.00 41.50  ? 136  GLU A OE2   1 
ATOM   1703 N  N     . LYS C 3 137 ? 32.180  -3.965 7.253   1.00 45.18  ? 137  LYS A N     1 
ATOM   1704 C  CA    . LYS C 3 137 ? 31.648  -3.768 5.907   1.00 45.28  ? 137  LYS A CA    1 
ATOM   1705 C  C     . LYS C 3 137 ? 30.801  -2.499 5.832   1.00 43.56  ? 137  LYS A C     1 
ATOM   1706 O  O     . LYS C 3 137 ? 29.730  -2.488 5.226   1.00 44.73  ? 137  LYS A O     1 
ATOM   1707 C  CB    . LYS C 3 137 ? 30.804  -4.976 5.484   1.00 47.74  ? 137  LYS A CB    1 
ATOM   1708 C  CG    . LYS C 3 137 ? 31.603  -6.267 5.384   1.00 51.15  ? 137  LYS A CG    1 
ATOM   1709 C  CD    . LYS C 3 137 ? 32.603  -6.210 4.235   1.00 54.11  ? 137  LYS A CD    1 
ATOM   1710 C  CE    . LYS C 3 137 ? 33.871  -6.981 4.577   1.00 57.76  ? 137  LYS A CE    1 
ATOM   1711 N  NZ    . LYS C 3 137 ? 33.590  -8.358 5.079   1.00 58.64  ? 137  LYS A NZ    1 
ATOM   1712 N  N     . ILE C 3 138 ? 31.285  -1.441 6.472   1.00 41.40  ? 138  ILE A N     1 
ATOM   1713 C  CA    . ILE C 3 138 ? 30.622  -0.140 6.477   1.00 37.31  ? 138  ILE A CA    1 
ATOM   1714 C  C     . ILE C 3 138 ? 31.621  0.832  5.874   1.00 37.60  ? 138  ILE A C     1 
ATOM   1715 O  O     . ILE C 3 138 ? 32.793  0.863  6.281   1.00 36.53  ? 138  ILE A O     1 
ATOM   1716 C  CB    . ILE C 3 138 ? 30.312  0.348  7.912   1.00 37.11  ? 138  ILE A CB    1 
ATOM   1717 C  CG1   . ILE C 3 138 ? 29.175  -0.475 8.517   1.00 35.23  ? 138  ILE A CG1   1 
ATOM   1718 C  CG2   . ILE C 3 138 ? 29.947  1.824  7.891   1.00 30.88  ? 138  ILE A CG2   1 
ATOM   1719 C  CD1   . ILE C 3 138 ? 27.820  -0.233 7.837   1.00 34.33  ? 138  ILE A CD1   1 
ATOM   1720 N  N     . THR C 3 139 ? 31.174  1.609  4.897   1.00 34.69  ? 139  THR A N     1 
ATOM   1721 C  CA    . THR C 3 139 ? 32.051  2.584  4.280   1.00 35.40  ? 139  THR A CA    1 
ATOM   1722 C  C     . THR C 3 139 ? 31.828  3.892  5.024   1.00 35.22  ? 139  THR A C     1 
ATOM   1723 O  O     . THR C 3 139 ? 30.710  4.203  5.433   1.00 35.72  ? 139  THR A O     1 
ATOM   1724 C  CB    . THR C 3 139 ? 31.721  2.803  2.798   1.00 35.59  ? 139  THR A CB    1 
ATOM   1725 O  OG1   . THR C 3 139 ? 30.410  3.372  2.688   1.00 34.81  ? 139  THR A OG1   1 
ATOM   1726 C  CG2   . THR C 3 139 ? 31.786  1.471  2.028   1.00 38.24  ? 139  THR A CG2   1 
ATOM   1727 N  N     . VAL C 3 140 ? 32.900  4.650  5.191   1.00 34.40  ? 140  VAL A N     1 
ATOM   1728 C  CA    . VAL C 3 140 ? 32.847  5.921  5.893   1.00 34.83  ? 140  VAL A CA    1 
ATOM   1729 C  C     . VAL C 3 140 ? 33.697  6.887  5.096   1.00 35.59  ? 140  VAL A C     1 
ATOM   1730 O  O     . VAL C 3 140 ? 34.447  6.465  4.221   1.00 36.45  ? 140  VAL A O     1 
ATOM   1731 C  CB    . VAL C 3 140 ? 33.447  5.795  7.323   1.00 32.38  ? 140  VAL A CB    1 
ATOM   1732 C  CG1   . VAL C 3 140 ? 32.766  4.674  8.076   1.00 31.87  ? 140  VAL A CG1   1 
ATOM   1733 C  CG2   . VAL C 3 140 ? 34.940  5.533  7.249   1.00 32.35  ? 140  VAL A CG2   1 
ATOM   1734 N  N     . THR C 3 141 ? 33.573  8.178  5.380   1.00 35.48  ? 141  THR A N     1 
ATOM   1735 C  CA    . THR C 3 141 ? 34.388  9.172  4.696   1.00 34.78  ? 141  THR A CA    1 
ATOM   1736 C  C     . THR C 3 141 ? 35.323  9.816  5.724   1.00 35.73  ? 141  THR A C     1 
ATOM   1737 O  O     . THR C 3 141 ? 34.916  10.117 6.850   1.00 34.76  ? 141  THR A O     1 
ATOM   1738 C  CB    . THR C 3 141 ? 33.535  10.270 4.035   1.00 35.19  ? 141  THR A CB    1 
ATOM   1739 O  OG1   . THR C 3 141 ? 32.740  9.696  2.992   1.00 35.43  ? 141  THR A OG1   1 
ATOM   1740 C  CG2   . THR C 3 141 ? 34.441  11.358 3.440   1.00 31.76  ? 141  THR A CG2   1 
ATOM   1741 N  N     . VAL C 3 142 ? 36.576  10.023 5.335   1.00 35.38  ? 142  VAL A N     1 
ATOM   1742 C  CA    . VAL C 3 142 ? 37.558  10.613 6.233   1.00 34.78  ? 142  VAL A CA    1 
ATOM   1743 C  C     . VAL C 3 142 ? 37.945  12.045 5.838   1.00 36.47  ? 142  VAL A C     1 
ATOM   1744 O  O     . VAL C 3 142 ? 38.111  12.358 4.658   1.00 36.48  ? 142  VAL A O     1 
ATOM   1745 C  CB    . VAL C 3 142 ? 38.834  9.713  6.312   1.00 34.31  ? 142  VAL A CB    1 
ATOM   1746 C  CG1   . VAL C 3 142 ? 39.972  10.446 7.018   1.00 32.71  ? 142  VAL A CG1   1 
ATOM   1747 C  CG2   . VAL C 3 142 ? 38.511  8.415  7.060   1.00 30.08  ? 142  VAL A CG2   1 
ATOM   1748 N  N     . GLY C 3 143 ? 38.051  12.912 6.842   1.00 35.54  ? 143  GLY A N     1 
ATOM   1749 C  CA    . GLY C 3 143 ? 38.438  14.292 6.623   1.00 35.69  ? 143  GLY A CA    1 
ATOM   1750 C  C     . GLY C 3 143 ? 39.653  14.574 7.486   1.00 36.75  ? 143  GLY A C     1 
ATOM   1751 O  O     . GLY C 3 143 ? 39.674  14.216 8.662   1.00 38.10  ? 143  GLY A O     1 
ATOM   1752 N  N     . ILE C 3 144 ? 40.679  15.199 6.916   1.00 38.24  ? 144  ILE A N     1 
ATOM   1753 C  CA    . ILE C 3 144 ? 41.891  15.492 7.671   1.00 36.80  ? 144  ILE A CA    1 
ATOM   1754 C  C     . ILE C 3 144 ? 42.356  16.930 7.467   1.00 38.46  ? 144  ILE A C     1 
ATOM   1755 O  O     . ILE C 3 144 ? 42.500  17.389 6.335   1.00 39.12  ? 144  ILE A O     1 
ATOM   1756 C  CB    . ILE C 3 144 ? 43.026  14.527 7.261   1.00 36.24  ? 144  ILE A CB    1 
ATOM   1757 C  CG1   . ILE C 3 144 ? 42.597  13.088 7.556   1.00 35.30  ? 144  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE C 3 144 ? 44.321  14.880 8.011   1.00 34.98  ? 144  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE C 3 144 ? 43.598  12.029 7.122   1.00 33.00  ? 144  ILE A CD1   1 
ATOM   1760 N  N     . SER C 3 145 ? 42.587  17.644 8.564   1.00 38.21  ? 145  SER A N     1 
ATOM   1761 C  CA    . SER C 3 145 ? 43.046  19.023 8.470   1.00 38.14  ? 145  SER A CA    1 
ATOM   1762 C  C     . SER C 3 145 ? 43.629  19.499 9.794   1.00 38.19  ? 145  SER A C     1 
ATOM   1763 O  O     . SER C 3 145 ? 43.821  18.697 10.703  1.00 39.40  ? 145  SER A O     1 
ATOM   1764 C  CB    . SER C 3 145 ? 41.915  19.946 8.031   1.00 36.09  ? 145  SER A CB    1 
ATOM   1765 O  OG    . SER C 3 145 ? 42.414  21.261 7.829   1.00 38.50  ? 145  SER A OG    1 
ATOM   1766 N  N     . LYS C 3 146 ? 43.896  20.801 9.901   1.00 38.62  ? 146  LYS A N     1 
ATOM   1767 C  CA    . LYS C 3 146 ? 44.509  21.370 11.100  1.00 37.78  ? 146  LYS A CA    1 
ATOM   1768 C  C     . LYS C 3 146 ? 43.592  21.509 12.301  1.00 37.49  ? 146  LYS A C     1 
ATOM   1769 O  O     . LYS C 3 146 ? 44.071  21.644 13.427  1.00 37.41  ? 146  LYS A O     1 
ATOM   1770 C  CB    . LYS C 3 146 ? 45.141  22.729 10.773  1.00 37.91  ? 146  LYS A CB    1 
ATOM   1771 C  CG    . LYS C 3 146 ? 44.143  23.778 10.309  1.00 41.28  ? 146  LYS A CG    1 
ATOM   1772 C  CD    . LYS C 3 146 ? 44.820  24.919 9.550   1.00 41.44  ? 146  LYS A CD    1 
ATOM   1773 C  CE    . LYS C 3 146 ? 45.838  25.644 10.403  1.00 43.31  ? 146  LYS A CE    1 
ATOM   1774 N  NZ    . LYS C 3 146 ? 46.371  26.839 9.688   1.00 44.11  ? 146  LYS A NZ    1 
ATOM   1775 N  N     . ASN C 3 147 ? 42.282  21.502 12.078  1.00 36.41  ? 147  ASN A N     1 
ATOM   1776 C  CA    . ASN C 3 147 ? 41.337  21.591 13.190  1.00 36.26  ? 147  ASN A CA    1 
ATOM   1777 C  C     . ASN C 3 147 ? 40.018  20.862 12.898  1.00 34.85  ? 147  ASN A C     1 
ATOM   1778 O  O     . ASN C 3 147 ? 39.811  20.331 11.804  1.00 32.67  ? 147  ASN A O     1 
ATOM   1779 C  CB    . ASN C 3 147 ? 41.078  23.059 13.593  1.00 37.38  ? 147  ASN A CB    1 
ATOM   1780 C  CG    . ASN C 3 147 ? 40.397  23.865 12.499  1.00 39.48  ? 147  ASN A CG    1 
ATOM   1781 O  OD1   . ASN C 3 147 ? 39.366  23.457 11.966  1.00 40.80  ? 147  ASN A OD1   1 
ATOM   1782 N  ND2   . ASN C 3 147 ? 40.967  25.027 12.168  1.00 36.80  ? 147  ASN A ND2   1 
ATOM   1783 N  N     . LYS C 3 148 ? 39.133  20.833 13.889  1.00 32.68  ? 148  LYS A N     1 
ATOM   1784 C  CA    . LYS C 3 148 ? 37.867  20.136 13.747  1.00 32.29  ? 148  LYS A CA    1 
ATOM   1785 C  C     . LYS C 3 148 ? 36.965  20.640 12.646  1.00 31.52  ? 148  LYS A C     1 
ATOM   1786 O  O     . LYS C 3 148 ? 36.368  19.849 11.917  1.00 29.88  ? 148  LYS A O     1 
ATOM   1787 C  CB    . LYS C 3 148 ? 37.098  20.149 15.071  1.00 34.23  ? 148  LYS A CB    1 
ATOM   1788 C  CG    . LYS C 3 148 ? 37.784  19.345 16.161  1.00 35.78  ? 148  LYS A CG    1 
ATOM   1789 C  CD    . LYS C 3 148 ? 36.787  18.775 17.161  1.00 38.25  ? 148  LYS A CD    1 
ATOM   1790 C  CE    . LYS C 3 148 ? 36.113  19.858 17.953  1.00 38.79  ? 148  LYS A CE    1 
ATOM   1791 N  NZ    . LYS C 3 148 ? 35.251  19.264 19.010  1.00 40.43  ? 148  LYS A NZ    1 
ATOM   1792 N  N     . VAL C 3 149 ? 36.852  21.951 12.513  1.00 30.22  ? 149  VAL A N     1 
ATOM   1793 C  CA    . VAL C 3 149 ? 35.980  22.473 11.485  1.00 30.50  ? 149  VAL A CA    1 
ATOM   1794 C  C     . VAL C 3 149 ? 36.399  22.079 10.074  1.00 32.48  ? 149  VAL A C     1 
ATOM   1795 O  O     . VAL C 3 149 ? 35.574  21.589 9.287   1.00 31.73  ? 149  VAL A O     1 
ATOM   1796 C  CB    . VAL C 3 149 ? 35.876  23.994 11.584  1.00 30.18  ? 149  VAL A CB    1 
ATOM   1797 C  CG1   . VAL C 3 149 ? 35.033  24.534 10.435  1.00 28.02  ? 149  VAL A CG1   1 
ATOM   1798 C  CG2   . VAL C 3 149 ? 35.268  24.370 12.927  1.00 28.96  ? 149  VAL A CG2   1 
ATOM   1799 N  N     . PHE C 3 150 ? 37.673  22.270 9.746   1.00 32.36  ? 150  PHE A N     1 
ATOM   1800 C  CA    . PHE C 3 150 ? 38.125  21.945 8.400   1.00 34.35  ? 150  PHE A CA    1 
ATOM   1801 C  C     . PHE C 3 150 ? 38.319  20.468 8.144   1.00 33.73  ? 150  PHE A C     1 
ATOM   1802 O  O     . PHE C 3 150 ? 38.401  20.038 6.994   1.00 34.71  ? 150  PHE A O     1 
ATOM   1803 C  CB    . PHE C 3 150 ? 39.387  22.736 8.068   1.00 37.11  ? 150  PHE A CB    1 
ATOM   1804 C  CG    . PHE C 3 150 ? 39.111  24.181 7.747   1.00 40.09  ? 150  PHE A CG    1 
ATOM   1805 C  CD1   . PHE C 3 150 ? 38.580  24.545 6.506   1.00 39.71  ? 150  PHE A CD1   1 
ATOM   1806 C  CD2   . PHE C 3 150 ? 39.342  25.174 8.699   1.00 40.01  ? 150  PHE A CD2   1 
ATOM   1807 C  CE1   . PHE C 3 150 ? 38.283  25.881 6.223   1.00 40.92  ? 150  PHE A CE1   1 
ATOM   1808 C  CE2   . PHE C 3 150 ? 39.047  26.513 8.429   1.00 39.12  ? 150  PHE A CE2   1 
ATOM   1809 C  CZ    . PHE C 3 150 ? 38.519  26.867 7.193   1.00 40.58  ? 150  PHE A CZ    1 
ATOM   1810 N  N     . ALA C 3 151 ? 38.400  19.670 9.199   1.00 34.32  ? 151  ALA A N     1 
ATOM   1811 C  CA    . ALA C 3 151 ? 38.525  18.236 8.961   1.00 34.34  ? 151  ALA A CA    1 
ATOM   1812 C  C     . ALA C 3 151 ? 37.116  17.797 8.534   1.00 33.04  ? 151  ALA A C     1 
ATOM   1813 O  O     . ALA C 3 151 ? 36.944  16.966 7.637   1.00 33.37  ? 151  ALA A O     1 
ATOM   1814 C  CB    . ALA C 3 151 ? 38.971  17.511 10.231  1.00 33.90  ? 151  ALA A CB    1 
ATOM   1815 N  N     . LYS C 3 152 ? 36.109  18.392 9.170   1.00 31.93  ? 152  LYS A N     1 
ATOM   1816 C  CA    . LYS C 3 152 ? 34.712  18.093 8.869   1.00 31.37  ? 152  LYS A CA    1 
ATOM   1817 C  C     . LYS C 3 152 ? 34.371  18.559 7.464   1.00 31.09  ? 152  LYS A C     1 
ATOM   1818 O  O     . LYS C 3 152 ? 33.753  17.830 6.691   1.00 31.01  ? 152  LYS A O     1 
ATOM   1819 C  CB    . LYS C 3 152 ? 33.798  18.805 9.859   1.00 31.17  ? 152  LYS A CB    1 
ATOM   1820 C  CG    . LYS C 3 152 ? 32.326  18.556 9.613   1.00 33.69  ? 152  LYS A CG    1 
ATOM   1821 C  CD    . LYS C 3 152 ? 31.523  19.122 10.760  1.00 38.72  ? 152  LYS A CD    1 
ATOM   1822 C  CE    . LYS C 3 152 ? 30.194  18.432 10.899  1.00 39.39  ? 152  LYS A CE    1 
ATOM   1823 N  NZ    . LYS C 3 152 ? 30.192  17.616 12.142  1.00 45.88  ? 152  LYS A NZ    1 
ATOM   1824 N  N     . ILE C 3 153 ? 34.751  19.793 7.147   1.00 32.09  ? 153  ILE A N     1 
ATOM   1825 C  CA    . ILE C 3 153 ? 34.501  20.338 5.817   1.00 32.51  ? 153  ILE A CA    1 
ATOM   1826 C  C     . ILE C 3 153 ? 35.167  19.416 4.796   1.00 33.19  ? 153  ILE A C     1 
ATOM   1827 O  O     . ILE C 3 153 ? 34.580  19.111 3.760   1.00 34.42  ? 153  ILE A O     1 
ATOM   1828 C  CB    . ILE C 3 153 ? 35.059  21.781 5.687   1.00 31.74  ? 153  ILE A CB    1 
ATOM   1829 C  CG1   . ILE C 3 153 ? 34.171  22.739 6.476   1.00 31.08  ? 153  ILE A CG1   1 
ATOM   1830 C  CG2   . ILE C 3 153 ? 35.124  22.211 4.217   1.00 31.57  ? 153  ILE A CG2   1 
ATOM   1831 C  CD1   . ILE C 3 153 ? 34.690  24.166 6.519   1.00 30.91  ? 153  ILE A CD1   1 
ATOM   1832 N  N     . ALA C 3 154 ? 36.382  18.963 5.104   1.00 33.29  ? 154  ALA A N     1 
ATOM   1833 C  CA    . ALA C 3 154 ? 37.115  18.059 4.217   1.00 35.78  ? 154  ALA A CA    1 
ATOM   1834 C  C     . ALA C 3 154 ? 36.270  16.816 3.910   1.00 37.05  ? 154  ALA A C     1 
ATOM   1835 O  O     . ALA C 3 154 ? 36.180  16.375 2.765   1.00 36.28  ? 154  ALA A O     1 
ATOM   1836 C  CB    . ALA C 3 154 ? 38.433  17.637 4.861   1.00 35.57  ? 154  ALA A CB    1 
ATOM   1837 N  N     . ALA C 3 155 ? 35.659  16.249 4.941   1.00 37.31  ? 155  ALA A N     1 
ATOM   1838 C  CA    . ALA C 3 155 ? 34.827  15.066 4.763   1.00 36.45  ? 155  ALA A CA    1 
ATOM   1839 C  C     . ALA C 3 155 ? 33.559  15.399 3.957   1.00 36.54  ? 155  ALA A C     1 
ATOM   1840 O  O     . ALA C 3 155 ? 33.141  14.623 3.091   1.00 35.67  ? 155  ALA A O     1 
ATOM   1841 C  CB    . ALA C 3 155 ? 34.452  14.490 6.122   1.00 36.09  ? 155  ALA A CB    1 
ATOM   1842 N  N     . ASP C 3 156 ? 32.948  16.549 4.232   1.00 35.89  ? 156  ASP A N     1 
ATOM   1843 C  CA    . ASP C 3 156 ? 31.738  16.925 3.502   1.00 37.64  ? 156  ASP A CA    1 
ATOM   1844 C  C     . ASP C 3 156 ? 32.007  16.979 2.012   1.00 39.54  ? 156  ASP A C     1 
ATOM   1845 O  O     . ASP C 3 156 ? 31.123  16.695 1.206   1.00 41.51  ? 156  ASP A O     1 
ATOM   1846 C  CB    . ASP C 3 156 ? 31.209  18.293 3.943   1.00 37.35  ? 156  ASP A CB    1 
ATOM   1847 C  CG    . ASP C 3 156 ? 30.650  18.284 5.354   1.00 39.53  ? 156  ASP A CG    1 
ATOM   1848 O  OD1   . ASP C 3 156 ? 30.215  17.213 5.825   1.00 40.58  ? 156  ASP A OD1   1 
ATOM   1849 O  OD2   . ASP C 3 156 ? 30.628  19.359 5.992   1.00 41.32  ? 156  ASP A OD2   1 
ATOM   1850 N  N     . MET C 3 157 ? 33.232  17.344 1.649   1.00 39.47  ? 157  MET A N     1 
ATOM   1851 C  CA    . MET C 3 157 ? 33.605  17.458 0.242   1.00 41.33  ? 157  MET A CA    1 
ATOM   1852 C  C     . MET C 3 157 ? 33.937  16.115 -0.401  1.00 41.16  ? 157  MET A C     1 
ATOM   1853 O  O     . MET C 3 157 ? 33.814  15.956 -1.612  1.00 42.45  ? 157  MET A O     1 
ATOM   1854 C  CB    . MET C 3 157 ? 34.824  18.378 0.078   1.00 41.36  ? 157  MET A CB    1 
ATOM   1855 C  CG    . MET C 3 157 ? 34.638  19.796 0.553   1.00 44.19  ? 157  MET A CG    1 
ATOM   1856 S  SD    . MET C 3 157 ? 36.153  20.684 0.436   1.00 48.78  ? 157  MET A SD    1 
ATOM   1857 C  CE    . MET C 3 157 ? 37.200  19.718 1.431   1.00 52.50  ? 157  MET A CE    1 
ATOM   1858 N  N     . ALA C 3 158 ? 34.355  15.149 0.407   1.00 40.98  ? 158  ALA A N     1 
ATOM   1859 C  CA    . ALA C 3 158 ? 34.758  13.852 -0.123  1.00 41.21  ? 158  ALA A CA    1 
ATOM   1860 C  C     . ALA C 3 158 ? 33.758  12.703 -0.073  1.00 40.52  ? 158  ALA A C     1 
ATOM   1861 O  O     . ALA C 3 158 ? 34.020  11.642 -0.639  1.00 39.04  ? 158  ALA A O     1 
ATOM   1862 C  CB    . ALA C 3 158 ? 36.064  13.417 0.550   1.00 39.15  ? 158  ALA A CB    1 
ATOM   1863 N  N     . LYS C 3 159 ? 32.619  12.886 0.585   1.00 41.09  ? 159  LYS A N     1 
ATOM   1864 C  CA    . LYS C 3 159 ? 31.677  11.780 0.661   1.00 42.59  ? 159  LYS A CA    1 
ATOM   1865 C  C     . LYS C 3 159 ? 30.872  11.558 -0.613  1.00 41.78  ? 159  LYS A C     1 
ATOM   1866 O  O     . LYS C 3 159 ? 30.697  12.467 -1.417  1.00 41.07  ? 159  LYS A O     1 
ATOM   1867 C  CB    . LYS C 3 159 ? 30.743  11.933 1.870   1.00 44.54  ? 159  LYS A CB    1 
ATOM   1868 C  CG    . LYS C 3 159 ? 29.818  13.121 1.854   1.00 43.67  ? 159  LYS A CG    1 
ATOM   1869 C  CD    . LYS C 3 159 ? 28.943  13.123 3.118   1.00 44.52  ? 159  LYS A CD    1 
ATOM   1870 C  CE    . LYS C 3 159 ? 29.763  13.150 4.401   1.00 44.31  ? 159  LYS A CE    1 
ATOM   1871 N  NZ    . LYS C 3 159 ? 28.919  13.487 5.596   1.00 41.96  ? 159  LYS A NZ    1 
ATOM   1872 N  N     . PRO C 3 160 ? 30.367  10.330 -0.808  1.00 41.59  ? 160  PRO A N     1 
ATOM   1873 C  CA    . PRO C 3 160 ? 30.529  9.200  0.108   1.00 41.23  ? 160  PRO A CA    1 
ATOM   1874 C  C     . PRO C 3 160 ? 31.793  8.370  -0.102  1.00 41.76  ? 160  PRO A C     1 
ATOM   1875 O  O     . PRO C 3 160 ? 32.496  8.524  -1.094  1.00 41.49  ? 160  PRO A O     1 
ATOM   1876 C  CB    . PRO C 3 160 ? 29.278  8.379  -0.161  1.00 40.97  ? 160  PRO A CB    1 
ATOM   1877 C  CG    . PRO C 3 160 ? 29.142  8.518  -1.637  1.00 40.03  ? 160  PRO A CG    1 
ATOM   1878 C  CD    . PRO C 3 160 ? 29.379  10.004 -1.854  1.00 42.26  ? 160  PRO A CD    1 
ATOM   1879 N  N     . ASN C 3 161 ? 32.064  7.487  0.853   1.00 43.05  ? 161  ASN A N     1 
ATOM   1880 C  CA    . ASN C 3 161 ? 33.204  6.586  0.786   1.00 44.37  ? 161  ASN A CA    1 
ATOM   1881 C  C     . ASN C 3 161 ? 34.457  7.274  0.254   1.00 45.47  ? 161  ASN A C     1 
ATOM   1882 O  O     . ASN C 3 161 ? 35.078  6.809  -0.697  1.00 47.07  ? 161  ASN A O     1 
ATOM   1883 C  CB    . ASN C 3 161 ? 32.827  5.388  -0.091  1.00 45.19  ? 161  ASN A CB    1 
ATOM   1884 C  CG    . ASN C 3 161 ? 33.925  4.355  -0.182  1.00 46.91  ? 161  ASN A CG    1 
ATOM   1885 O  OD1   . ASN C 3 161 ? 34.702  4.170  0.756   1.00 49.61  ? 161  ASN A OD1   1 
ATOM   1886 N  ND2   . ASN C 3 161 ? 33.984  3.656  -1.309  1.00 48.23  ? 161  ASN A ND2   1 
ATOM   1887 N  N     . GLY C 3 162 ? 34.823  8.392  0.870   1.00 45.19  ? 162  GLY A N     1 
ATOM   1888 C  CA    . GLY C 3 162 ? 36.001  9.109  0.432   1.00 44.06  ? 162  GLY A CA    1 
ATOM   1889 C  C     . GLY C 3 162 ? 37.005  9.386  1.538   1.00 43.64  ? 162  GLY A C     1 
ATOM   1890 O  O     . GLY C 3 162 ? 36.896  8.879  2.659   1.00 42.83  ? 162  GLY A O     1 
ATOM   1891 N  N     . ILE C 3 163 ? 38.006  10.187 1.200   1.00 43.15  ? 163  ILE A N     1 
ATOM   1892 C  CA    . ILE C 3 163 ? 39.046  10.590 2.134   1.00 43.03  ? 163  ILE A CA    1 
ATOM   1893 C  C     . ILE C 3 163 ? 39.735  11.818 1.550   1.00 44.19  ? 163  ILE A C     1 
ATOM   1894 O  O     . ILE C 3 163 ? 40.229  11.790 0.422   1.00 44.60  ? 163  ILE A O     1 
ATOM   1895 C  CB    . ILE C 3 163 ? 40.099  9.475  2.371   1.00 42.60  ? 163  ILE A CB    1 
ATOM   1896 C  CG1   . ILE C 3 163 ? 41.248  10.046 3.213   1.00 42.20  ? 163  ILE A CG1   1 
ATOM   1897 C  CG2   . ILE C 3 163 ? 40.608  8.925  1.038   1.00 41.33  ? 163  ILE A CG2   1 
ATOM   1898 C  CD1   . ILE C 3 163 ? 42.271  9.032  3.672   1.00 42.98  ? 163  ILE A CD1   1 
ATOM   1899 N  N     . LYS C 3 164 ? 39.745  12.906 2.313   1.00 45.19  ? 164  LYS A N     1 
ATOM   1900 C  CA    . LYS C 3 164 ? 40.369  14.138 1.854   1.00 44.94  ? 164  LYS A CA    1 
ATOM   1901 C  C     . LYS C 3 164 ? 41.180  14.874 2.906   1.00 45.02  ? 164  LYS A C     1 
ATOM   1902 O  O     . LYS C 3 164 ? 40.838  14.909 4.091   1.00 45.52  ? 164  LYS A O     1 
ATOM   1903 C  CB    . LYS C 3 164 ? 39.331  15.105 1.288   1.00 43.82  ? 164  LYS A CB    1 
ATOM   1904 C  CG    . LYS C 3 164 ? 39.942  16.467 1.008   1.00 46.50  ? 164  LYS A CG    1 
ATOM   1905 C  CD    . LYS C 3 164 ? 39.108  17.304 0.076   1.00 48.60  ? 164  LYS A CD    1 
ATOM   1906 C  CE    . LYS C 3 164 ? 39.810  18.629 -0.208  1.00 50.49  ? 164  LYS A CE    1 
ATOM   1907 N  NZ    . LYS C 3 164 ? 41.169  18.431 -0.792  1.00 50.43  ? 164  LYS A NZ    1 
ATOM   1908 N  N     . VAL C 3 165 ? 42.264  15.474 2.445   1.00 44.10  ? 165  VAL A N     1 
ATOM   1909 C  CA    . VAL C 3 165 ? 43.131  16.233 3.317   1.00 44.64  ? 165  VAL A CA    1 
ATOM   1910 C  C     . VAL C 3 165 ? 43.106  17.684 2.873   1.00 43.39  ? 165  VAL A C     1 
ATOM   1911 O  O     . VAL C 3 165 ? 43.176  17.977 1.680   1.00 42.11  ? 165  VAL A O     1 
ATOM   1912 C  CB    . VAL C 3 165 ? 44.589  15.729 3.258   1.00 44.46  ? 165  VAL A CB    1 
ATOM   1913 C  CG1   . VAL C 3 165 ? 45.470  16.613 4.123   1.00 44.77  ? 165  VAL A CG1   1 
ATOM   1914 C  CG2   . VAL C 3 165 ? 44.665  14.284 3.728   1.00 46.57  ? 165  VAL A CG2   1 
ATOM   1915 N  N     . ILE C 3 166 ? 42.967  18.583 3.840   1.00 42.23  ? 166  ILE A N     1 
ATOM   1916 C  CA    . ILE C 3 166 ? 42.971  20.011 3.566   1.00 43.22  ? 166  ILE A CA    1 
ATOM   1917 C  C     . ILE C 3 166 ? 44.208  20.571 4.268   1.00 45.16  ? 166  ILE A C     1 
ATOM   1918 O  O     . ILE C 3 166 ? 44.203  20.786 5.487   1.00 43.41  ? 166  ILE A O     1 
ATOM   1919 C  CB    . ILE C 3 166 ? 41.687  20.706 4.103   1.00 42.91  ? 166  ILE A CB    1 
ATOM   1920 C  CG1   . ILE C 3 166 ? 40.482  20.284 3.259   1.00 41.25  ? 166  ILE A CG1   1 
ATOM   1921 C  CG2   . ILE C 3 166 ? 41.840  22.224 4.058   1.00 39.83  ? 166  ILE A CG2   1 
ATOM   1922 C  CD1   . ILE C 3 166 ? 39.206  21.022 3.591   1.00 37.59  ? 166  ILE A CD1   1 
ATOM   1923 N  N     . ASP C 3 167 ? 45.274  20.772 3.494   1.00 47.77  ? 167  ASP A N     1 
ATOM   1924 C  CA    . ASP C 3 167 ? 46.523  21.293 4.033   1.00 50.13  ? 167  ASP A CA    1 
ATOM   1925 C  C     . ASP C 3 167 ? 46.426  22.785 4.298   1.00 50.11  ? 167  ASP A C     1 
ATOM   1926 O  O     . ASP C 3 167 ? 45.430  23.426 3.958   1.00 50.10  ? 167  ASP A O     1 
ATOM   1927 C  CB    . ASP C 3 167 ? 47.708  21.001 3.089   1.00 51.09  ? 167  ASP A CB    1 
ATOM   1928 C  CG    . ASP C 3 167 ? 47.575  21.676 1.727   1.00 52.02  ? 167  ASP A CG    1 
ATOM   1929 O  OD1   . ASP C 3 167 ? 47.188  22.867 1.656   1.00 52.50  ? 167  ASP A OD1   1 
ATOM   1930 O  OD2   . ASP C 3 167 ? 47.886  21.009 0.718   1.00 54.21  ? 167  ASP A OD2   1 
ATOM   1931 N  N     . ASP C 3 168 ? 47.474  23.327 4.904   1.00 51.39  ? 168  ASP A N     1 
ATOM   1932 C  CA    . ASP C 3 168 ? 47.523  24.737 5.247   1.00 53.40  ? 168  ASP A CA    1 
ATOM   1933 C  C     . ASP C 3 168 ? 47.259  25.660 4.065   1.00 54.51  ? 168  ASP A C     1 
ATOM   1934 O  O     . ASP C 3 168 ? 46.520  26.638 4.198   1.00 55.33  ? 168  ASP A O     1 
ATOM   1935 C  CB    . ASP C 3 168 ? 48.876  25.063 5.883   1.00 54.48  ? 168  ASP A CB    1 
ATOM   1936 C  CG    . ASP C 3 168 ? 49.091  24.335 7.205   1.00 55.87  ? 168  ASP A CG    1 
ATOM   1937 O  OD1   . ASP C 3 168 ? 48.253  23.484 7.574   1.00 56.37  ? 168  ASP A OD1   1 
ATOM   1938 O  OD2   . ASP C 3 168 ? 50.107  24.613 7.876   1.00 57.86  ? 168  ASP A OD2   1 
ATOM   1939 N  N     . GLU C 3 169 ? 47.848  25.366 2.910   1.00 55.02  ? 169  GLU A N     1 
ATOM   1940 C  CA    . GLU C 3 169 ? 47.618  26.229 1.761   1.00 56.85  ? 169  GLU A CA    1 
ATOM   1941 C  C     . GLU C 3 169 ? 46.141  26.201 1.373   1.00 55.17  ? 169  GLU A C     1 
ATOM   1942 O  O     . GLU C 3 169 ? 45.527  27.249 1.157   1.00 55.12  ? 169  GLU A O     1 
ATOM   1943 C  CB    . GLU C 3 169 ? 48.483  25.814 0.563   1.00 60.59  ? 169  GLU A CB    1 
ATOM   1944 C  CG    . GLU C 3 169 ? 48.217  26.668 -0.691  1.00 67.29  ? 169  GLU A CG    1 
ATOM   1945 C  CD    . GLU C 3 169 ? 49.152  26.359 -1.871  1.00 71.38  ? 169  GLU A CD    1 
ATOM   1946 O  OE1   . GLU C 3 169 ? 49.773  25.268 -1.884  1.00 72.92  ? 169  GLU A OE1   1 
ATOM   1947 O  OE2   . GLU C 3 169 ? 49.252  27.205 -2.797  1.00 71.64  ? 169  GLU A OE2   1 
ATOM   1948 N  N     . GLU C 3 170 ? 45.564  25.006 1.300   1.00 52.28  ? 170  GLU A N     1 
ATOM   1949 C  CA    . GLU C 3 170 ? 44.159  24.893 0.934   1.00 50.55  ? 170  GLU A CA    1 
ATOM   1950 C  C     . GLU C 3 170 ? 43.248  25.541 1.972   1.00 48.44  ? 170  GLU A C     1 
ATOM   1951 O  O     . GLU C 3 170 ? 42.156  25.999 1.645   1.00 47.86  ? 170  GLU A O     1 
ATOM   1952 C  CB    . GLU C 3 170 ? 43.771  23.430 0.715   1.00 51.02  ? 170  GLU A CB    1 
ATOM   1953 C  CG    . GLU C 3 170 ? 42.319  23.256 0.343   1.00 55.31  ? 170  GLU A CG    1 
ATOM   1954 C  CD    . GLU C 3 170 ? 42.033  21.973 -0.400  1.00 58.01  ? 170  GLU A CD    1 
ATOM   1955 O  OE1   . GLU C 3 170 ? 42.747  20.975 -0.165  1.00 60.73  ? 170  GLU A OE1   1 
ATOM   1956 O  OE2   . GLU C 3 170 ? 41.080  21.956 -1.210  1.00 58.76  ? 170  GLU A OE2   1 
ATOM   1957 N  N     . VAL C 3 171 ? 43.688  25.592 3.224   1.00 46.48  ? 171  VAL A N     1 
ATOM   1958 C  CA    . VAL C 3 171 ? 42.875  26.236 4.249   1.00 44.42  ? 171  VAL A CA    1 
ATOM   1959 C  C     . VAL C 3 171 ? 42.774  27.714 3.898   1.00 44.46  ? 171  VAL A C     1 
ATOM   1960 O  O     . VAL C 3 171 ? 41.711  28.328 4.011   1.00 42.21  ? 171  VAL A O     1 
ATOM   1961 C  CB    . VAL C 3 171 ? 43.503  26.088 5.659   1.00 43.80  ? 171  VAL A CB    1 
ATOM   1962 C  CG1   . VAL C 3 171 ? 42.861  27.078 6.627   1.00 41.03  ? 171  VAL A CG1   1 
ATOM   1963 C  CG2   . VAL C 3 171 ? 43.300  24.668 6.161   1.00 40.19  ? 171  VAL A CG2   1 
ATOM   1964 N  N     . LYS C 3 172 ? 43.892  28.281 3.460   1.00 45.37  ? 172  LYS A N     1 
ATOM   1965 C  CA    . LYS C 3 172 ? 43.916  29.687 3.089   1.00 46.20  ? 172  LYS A CA    1 
ATOM   1966 C  C     . LYS C 3 172 ? 43.040  29.938 1.858   1.00 45.04  ? 172  LYS A C     1 
ATOM   1967 O  O     . LYS C 3 172 ? 42.371  30.961 1.761   1.00 43.94  ? 172  LYS A O     1 
ATOM   1968 C  CB    . LYS C 3 172 ? 45.363  30.139 2.830   1.00 48.13  ? 172  LYS A CB    1 
ATOM   1969 C  CG    . LYS C 3 172 ? 46.268  30.085 4.068   1.00 51.12  ? 172  LYS A CG    1 
ATOM   1970 C  CD    . LYS C 3 172 ? 47.695  30.582 3.781   1.00 54.68  ? 172  LYS A CD    1 
ATOM   1971 C  CE    . LYS C 3 172 ? 47.718  32.075 3.438   1.00 58.59  ? 172  LYS A CE    1 
ATOM   1972 N  NZ    . LYS C 3 172 ? 49.101  32.606 3.202   1.00 59.32  ? 172  LYS A NZ    1 
ATOM   1973 N  N     . ARG C 3 173 ? 43.037  28.999 0.919   1.00 44.98  ? 173  ARG A N     1 
ATOM   1974 C  CA    . ARG C 3 173 ? 42.223  29.159 -0.276  1.00 45.37  ? 173  ARG A CA    1 
ATOM   1975 C  C     . ARG C 3 173 ? 40.741  29.106 0.090   1.00 44.13  ? 173  ARG A C     1 
ATOM   1976 O  O     . ARG C 3 173 ? 39.952  29.935 -0.369  1.00 43.47  ? 173  ARG A O     1 
ATOM   1977 C  CB    . ARG C 3 173 ? 42.545  28.061 -1.295  1.00 47.06  ? 173  ARG A CB    1 
ATOM   1978 C  CG    . ARG C 3 173 ? 41.746  28.163 -2.586  1.00 51.71  ? 173  ARG A CG    1 
ATOM   1979 C  CD    . ARG C 3 173 ? 42.059  27.013 -3.543  1.00 55.25  ? 173  ARG A CD    1 
ATOM   1980 N  NE    . ARG C 3 173 ? 41.598  25.707 -3.064  1.00 58.41  ? 173  ARG A NE    1 
ATOM   1981 C  CZ    . ARG C 3 173 ? 40.324  25.318 -3.013  1.00 59.08  ? 173  ARG A CZ    1 
ATOM   1982 N  NH1   . ARG C 3 173 ? 39.357  26.135 -3.414  1.00 58.41  ? 173  ARG A NH1   1 
ATOM   1983 N  NH2   . ARG C 3 173 ? 40.015  24.104 -2.561  1.00 58.03  ? 173  ARG A NH2   1 
ATOM   1984 N  N     . LEU C 3 174 ? 40.369  28.137 0.925   1.00 43.39  ? 174  LEU A N     1 
ATOM   1985 C  CA    . LEU C 3 174 ? 38.975  27.980 1.333   1.00 43.83  ? 174  LEU A CA    1 
ATOM   1986 C  C     . LEU C 3 174 ? 38.405  29.168 2.097   1.00 42.60  ? 174  LEU A C     1 
ATOM   1987 O  O     . LEU C 3 174 ? 37.220  29.468 1.951   1.00 40.24  ? 174  LEU A O     1 
ATOM   1988 C  CB    . LEU C 3 174 ? 38.802  26.713 2.165   1.00 43.64  ? 174  LEU A CB    1 
ATOM   1989 C  CG    . LEU C 3 174 ? 39.061  25.449 1.361   1.00 46.30  ? 174  LEU A CG    1 
ATOM   1990 C  CD1   . LEU C 3 174 ? 38.976  24.235 2.267   1.00 48.07  ? 174  LEU A CD1   1 
ATOM   1991 C  CD2   . LEU C 3 174 ? 38.060  25.356 0.218   1.00 46.93  ? 174  LEU A CD2   1 
ATOM   1992 N  N     . ILE C 3 175 ? 39.235  29.829 2.907   1.00 42.80  ? 175  ILE A N     1 
ATOM   1993 C  CA    . ILE C 3 175 ? 38.789  30.988 3.671   1.00 43.87  ? 175  ILE A CA    1 
ATOM   1994 C  C     . ILE C 3 175 ? 38.384  32.058 2.668   1.00 44.63  ? 175  ILE A C     1 
ATOM   1995 O  O     . ILE C 3 175 ? 37.428  32.817 2.890   1.00 43.19  ? 175  ILE A O     1 
ATOM   1996 C  CB    . ILE C 3 175 ? 39.920  31.516 4.568   1.00 44.05  ? 175  ILE A CB    1 
ATOM   1997 C  CG1   . ILE C 3 175 ? 40.212  30.474 5.651   1.00 42.90  ? 175  ILE A CG1   1 
ATOM   1998 C  CG2   . ILE C 3 175 ? 39.527  32.865 5.164   1.00 43.18  ? 175  ILE A CG2   1 
ATOM   1999 C  CD1   . ILE C 3 175 ? 41.240  30.926 6.656   1.00 41.09  ? 175  ILE A CD1   1 
ATOM   2000 N  N     . ARG C 3 176 ? 39.085  32.070 1.539   1.00 47.17  ? 176  ARG A N     1 
ATOM   2001 C  CA    . ARG C 3 176 ? 38.853  33.061 0.495   1.00 49.54  ? 176  ARG A CA    1 
ATOM   2002 C  C     . ARG C 3 176 ? 37.692  32.619 -0.433  1.00 49.64  ? 176  ARG A C     1 
ATOM   2003 O  O     . ARG C 3 176 ? 36.806  33.419 -0.783  1.00 49.46  ? 176  ARG A O     1 
ATOM   2004 C  CB    . ARG C 3 176 ? 40.136  33.235 -0.341  1.00 51.08  ? 176  ARG A CB    1 
ATOM   2005 C  CG    . ARG C 3 176 ? 41.145  34.322 0.161   1.00 53.63  ? 176  ARG A CG    1 
ATOM   2006 C  CD    . ARG C 3 176 ? 42.307  34.580 -0.842  1.00 54.71  ? 176  ARG A CD    1 
ATOM   2007 N  NE    . ARG C 3 176 ? 43.347  33.552 -0.792  1.00 57.15  ? 176  ARG A NE    1 
ATOM   2008 C  CZ    . ARG C 3 176 ? 43.488  32.564 -1.675  1.00 59.33  ? 176  ARG A CZ    1 
ATOM   2009 N  NH1   . ARG C 3 176 ? 42.650  32.458 -2.702  1.00 59.31  ? 176  ARG A NH1   1 
ATOM   2010 N  NH2   . ARG C 3 176 ? 44.468  31.676 -1.529  1.00 58.96  ? 176  ARG A NH2   1 
ATOM   2011 N  N     . GLU C 3 177 ? 37.693  31.346 -0.801  1.00 49.74  ? 177  GLU A N     1 
ATOM   2012 C  CA    . GLU C 3 177 ? 36.690  30.833 -1.730  1.00 51.24  ? 177  GLU A CA    1 
ATOM   2013 C  C     . GLU C 3 177 ? 35.469  30.012 -1.278  1.00 52.18  ? 177  GLU A C     1 
ATOM   2014 O  O     . GLU C 3 177 ? 34.459  29.980 -1.993  1.00 53.61  ? 177  GLU A O     1 
ATOM   2015 C  CB    . GLU C 3 177 ? 37.410  30.012 -2.797  1.00 51.93  ? 177  GLU A CB    1 
ATOM   2016 C  CG    . GLU C 3 177 ? 38.669  30.651 -3.348  1.00 54.40  ? 177  GLU A CG    1 
ATOM   2017 C  CD    . GLU C 3 177 ? 39.347  29.839 -4.448  1.00 56.45  ? 177  GLU A CD    1 
ATOM   2018 O  OE1   . GLU C 3 177 ? 39.447  28.596 -4.335  1.00 58.60  ? 177  GLU A OE1   1 
ATOM   2019 O  OE2   . GLU C 3 177 ? 39.813  30.464 -5.426  1.00 59.08  ? 177  GLU A OE2   1 
ATOM   2020 N  N     . LEU C 3 178 ? 35.564  29.304 -0.154  1.00 50.30  ? 178  LEU A N     1 
ATOM   2021 C  CA    . LEU C 3 178 ? 34.457  28.459 0.314   1.00 48.47  ? 178  LEU A CA    1 
ATOM   2022 C  C     . LEU C 3 178 ? 33.171  29.207 0.654   1.00 46.61  ? 178  LEU A C     1 
ATOM   2023 O  O     . LEU C 3 178 ? 33.183  30.170 1.412   1.00 46.16  ? 178  LEU A O     1 
ATOM   2024 C  CB    . LEU C 3 178 ? 34.899  27.640 1.535   1.00 48.77  ? 178  LEU A CB    1 
ATOM   2025 C  CG    . LEU C 3 178 ? 33.814  26.749 2.140   1.00 47.82  ? 178  LEU A CG    1 
ATOM   2026 C  CD1   . LEU C 3 178 ? 33.320  25.773 1.082   1.00 49.48  ? 178  LEU A CD1   1 
ATOM   2027 C  CD2   . LEU C 3 178 ? 34.359  26.000 3.338   1.00 48.35  ? 178  LEU A CD2   1 
ATOM   2028 N  N     . ASP C 3 179 ? 32.057  28.751 0.093   1.00 45.92  ? 179  ASP A N     1 
ATOM   2029 C  CA    . ASP C 3 179 ? 30.760  29.371 0.361   1.00 46.34  ? 179  ASP A CA    1 
ATOM   2030 C  C     . ASP C 3 179 ? 30.531  29.309 1.881   1.00 43.88  ? 179  ASP A C     1 
ATOM   2031 O  O     . ASP C 3 179 ? 30.396  28.226 2.438   1.00 40.69  ? 179  ASP A O     1 
ATOM   2032 C  CB    . ASP C 3 179 ? 29.663  28.586 -0.361  1.00 49.44  ? 179  ASP A CB    1 
ATOM   2033 C  CG    . ASP C 3 179 ? 28.324  29.308 -0.362  1.00 53.72  ? 179  ASP A CG    1 
ATOM   2034 O  OD1   . ASP C 3 179 ? 28.006  30.009 0.628   1.00 53.17  ? 179  ASP A OD1   1 
ATOM   2035 O  OD2   . ASP C 3 179 ? 27.580  29.158 -1.357  1.00 56.94  ? 179  ASP A OD2   1 
ATOM   2036 N  N     . ILE C 3 180 ? 30.476  30.462 2.539   1.00 42.86  ? 180  ILE A N     1 
ATOM   2037 C  CA    . ILE C 3 180 ? 30.297  30.501 3.985   1.00 42.09  ? 180  ILE A CA    1 
ATOM   2038 C  C     . ILE C 3 180 ? 29.111  29.669 4.468   1.00 43.39  ? 180  ILE A C     1 
ATOM   2039 O  O     . ILE C 3 180 ? 29.060  29.263 5.625   1.00 43.60  ? 180  ILE A O     1 
ATOM   2040 C  CB    . ILE C 3 180 ? 30.149  31.955 4.496   1.00 41.21  ? 180  ILE A CB    1 
ATOM   2041 C  CG1   . ILE C 3 180 ? 30.430  32.002 5.998   1.00 40.72  ? 180  ILE A CG1   1 
ATOM   2042 C  CG2   . ILE C 3 180 ? 28.741  32.482 4.221   1.00 38.77  ? 180  ILE A CG2   1 
ATOM   2043 C  CD1   . ILE C 3 180 ? 30.565  33.409 6.557   1.00 38.59  ? 180  ILE A CD1   1 
ATOM   2044 N  N     . ALA C 3 181 ? 28.161  29.417 3.575   1.00 43.59  ? 181  ALA A N     1 
ATOM   2045 C  CA    . ALA C 3 181 ? 26.991  28.625 3.918   1.00 42.80  ? 181  ALA A CA    1 
ATOM   2046 C  C     . ALA C 3 181 ? 27.415  27.183 4.177   1.00 41.22  ? 181  ALA A C     1 
ATOM   2047 O  O     . ALA C 3 181 ? 26.748  26.452 4.901   1.00 41.35  ? 181  ALA A O     1 
ATOM   2048 C  CB    . ALA C 3 181 ? 25.970  28.681 2.786   1.00 41.08  ? 181  ALA A CB    1 
ATOM   2049 N  N     . ASP C 3 182 ? 28.530  26.772 3.588   1.00 40.02  ? 182  ASP A N     1 
ATOM   2050 C  CA    . ASP C 3 182 ? 29.004  25.408 3.795   1.00 39.38  ? 182  ASP A CA    1 
ATOM   2051 C  C     . ASP C 3 182 ? 29.835  25.262 5.064   1.00 36.96  ? 182  ASP A C     1 
ATOM   2052 O  O     . ASP C 3 182 ? 30.363  24.185 5.342   1.00 35.94  ? 182  ASP A O     1 
ATOM   2053 C  CB    . ASP C 3 182 ? 29.815  24.915 2.590   1.00 42.89  ? 182  ASP A CB    1 
ATOM   2054 C  CG    . ASP C 3 182 ? 28.976  24.815 1.318   1.00 46.87  ? 182  ASP A CG    1 
ATOM   2055 O  OD1   . ASP C 3 182 ? 27.744  24.622 1.421   1.00 49.68  ? 182  ASP A OD1   1 
ATOM   2056 O  OD2   . ASP C 3 182 ? 29.553  24.917 0.217   1.00 48.62  ? 182  ASP A OD2   1 
ATOM   2057 N  N     . VAL C 3 183 ? 29.952  26.341 5.833   1.00 33.38  ? 183  VAL A N     1 
ATOM   2058 C  CA    . VAL C 3 183 ? 30.709  26.292 7.083   1.00 32.00  ? 183  VAL A CA    1 
ATOM   2059 C  C     . VAL C 3 183 ? 29.849  25.675 8.205   1.00 31.24  ? 183  VAL A C     1 
ATOM   2060 O  O     . VAL C 3 183 ? 28.727  26.125 8.471   1.00 31.45  ? 183  VAL A O     1 
ATOM   2061 C  CB    . VAL C 3 183 ? 31.169  27.711 7.535   1.00 30.32  ? 183  VAL A CB    1 
ATOM   2062 C  CG1   . VAL C 3 183 ? 31.878  27.623 8.869   1.00 27.01  ? 183  VAL A CG1   1 
ATOM   2063 C  CG2   . VAL C 3 183 ? 32.117  28.313 6.511   1.00 32.16  ? 183  VAL A CG2   1 
ATOM   2064 N  N     . PRO C 3 184 ? 30.356  24.628 8.870   1.00 30.72  ? 184  PRO A N     1 
ATOM   2065 C  CA    . PRO C 3 184 ? 29.561  24.027 9.946   1.00 30.37  ? 184  PRO A CA    1 
ATOM   2066 C  C     . PRO C 3 184 ? 29.026  25.083 10.917  1.00 30.96  ? 184  PRO A C     1 
ATOM   2067 O  O     . PRO C 3 184 ? 29.753  26.016 11.305  1.00 30.28  ? 184  PRO A O     1 
ATOM   2068 C  CB    . PRO C 3 184 ? 30.555  23.073 10.603  1.00 30.22  ? 184  PRO A CB    1 
ATOM   2069 C  CG    . PRO C 3 184 ? 31.348  22.590 9.396   1.00 29.56  ? 184  PRO A CG    1 
ATOM   2070 C  CD    . PRO C 3 184 ? 31.610  23.880 8.654   1.00 29.27  ? 184  PRO A CD    1 
ATOM   2071 N  N     . GLY C 3 185 ? 27.755  24.940 11.297  1.00 31.40  ? 185  GLY A N     1 
ATOM   2072 C  CA    . GLY C 3 185 ? 27.136  25.881 12.218  1.00 30.51  ? 185  GLY A CA    1 
ATOM   2073 C  C     . GLY C 3 185 ? 26.402  27.028 11.546  1.00 32.58  ? 185  GLY A C     1 
ATOM   2074 O  O     . GLY C 3 185 ? 25.757  27.840 12.217  1.00 33.31  ? 185  GLY A O     1 
ATOM   2075 N  N     . ILE C 3 186 ? 26.508  27.122 10.224  1.00 32.31  ? 186  ILE A N     1 
ATOM   2076 C  CA    . ILE C 3 186 ? 25.811  28.188 9.497   1.00 33.83  ? 186  ILE A CA    1 
ATOM   2077 C  C     . ILE C 3 186 ? 24.635  27.526 8.788   1.00 35.34  ? 186  ILE A C     1 
ATOM   2078 O  O     . ILE C 3 186 ? 24.831  26.778 7.829   1.00 34.68  ? 186  ILE A O     1 
ATOM   2079 C  CB    . ILE C 3 186 ? 26.709  28.859 8.410   1.00 32.53  ? 186  ILE A CB    1 
ATOM   2080 C  CG1   . ILE C 3 186 ? 28.027  29.329 9.028   1.00 32.81  ? 186  ILE A CG1   1 
ATOM   2081 C  CG2   . ILE C 3 186 ? 25.980  30.051 7.790   1.00 31.56  ? 186  ILE A CG2   1 
ATOM   2082 C  CD1   . ILE C 3 186 ? 27.864  30.304 10.188  1.00 29.81  ? 186  ILE A CD1   1 
ATOM   2083 N  N     . GLY C 3 187 ? 23.423  27.769 9.284   1.00 38.24  ? 187  GLY A N     1 
ATOM   2084 C  CA    . GLY C 3 187 ? 22.241  27.188 8.668   1.00 39.82  ? 187  GLY A CA    1 
ATOM   2085 C  C     . GLY C 3 187 ? 21.593  28.235 7.781   1.00 42.42  ? 187  GLY A C     1 
ATOM   2086 O  O     . GLY C 3 187 ? 22.113  29.348 7.663   1.00 43.23  ? 187  GLY A O     1 
ATOM   2087 N  N     . ASN C 3 188 ? 20.463  27.900 7.165   1.00 43.59  ? 188  ASN A N     1 
ATOM   2088 C  CA    . ASN C 3 188 ? 19.773  28.844 6.287   1.00 45.57  ? 188  ASN A CA    1 
ATOM   2089 C  C     . ASN C 3 188 ? 19.588  30.207 6.917   1.00 44.39  ? 188  ASN A C     1 
ATOM   2090 O  O     . ASN C 3 188 ? 20.002  31.210 6.351   1.00 44.58  ? 188  ASN A O     1 
ATOM   2091 C  CB    . ASN C 3 188 ? 18.400  28.313 5.880   1.00 49.83  ? 188  ASN A CB    1 
ATOM   2092 C  CG    . ASN C 3 188 ? 18.487  27.138 4.932   1.00 55.55  ? 188  ASN A CG    1 
ATOM   2093 O  OD1   . ASN C 3 188 ? 17.462  26.638 4.461   1.00 60.57  ? 188  ASN A OD1   1 
ATOM   2094 N  ND2   . ASN C 3 188 ? 19.709  26.686 4.643   1.00 56.26  ? 188  ASN A ND2   1 
ATOM   2095 N  N     . ILE C 3 189 ? 18.971  30.250 8.091   1.00 43.61  ? 189  ILE A N     1 
ATOM   2096 C  CA    . ILE C 3 189 ? 18.734  31.522 8.752   1.00 43.48  ? 189  ILE A CA    1 
ATOM   2097 C  C     . ILE C 3 189 ? 19.984  32.375 8.895   1.00 44.80  ? 189  ILE A C     1 
ATOM   2098 O  O     . ILE C 3 189 ? 19.960  33.566 8.582   1.00 45.52  ? 189  ILE A O     1 
ATOM   2099 C  CB    . ILE C 3 189 ? 18.106  31.327 10.135  1.00 44.96  ? 189  ILE A CB    1 
ATOM   2100 C  CG1   . ILE C 3 189 ? 16.670  30.819 9.962   1.00 47.01  ? 189  ILE A CG1   1 
ATOM   2101 C  CG2   . ILE C 3 189 ? 18.154  32.639 10.929  1.00 41.05  ? 189  ILE A CG2   1 
ATOM   2102 C  CD1   . ILE C 3 189 ? 15.886  30.717 11.257  1.00 51.53  ? 189  ILE A CD1   1 
ATOM   2103 N  N     . THR C 3 190 ? 21.080  31.787 9.367   1.00 42.91  ? 190  THR A N     1 
ATOM   2104 C  CA    . THR C 3 190 ? 22.299  32.572 9.523   1.00 41.82  ? 190  THR A CA    1 
ATOM   2105 C  C     . THR C 3 190 ? 22.883  32.905 8.152   1.00 41.37  ? 190  THR A C     1 
ATOM   2106 O  O     . THR C 3 190 ? 23.326  34.018 7.920   1.00 40.23  ? 190  THR A O     1 
ATOM   2107 C  CB    . THR C 3 190 ? 23.359  31.832 10.358  1.00 39.05  ? 190  THR A CB    1 
ATOM   2108 O  OG1   . THR C 3 190 ? 22.768  31.377 11.581  1.00 39.26  ? 190  THR A OG1   1 
ATOM   2109 C  CG2   . THR C 3 190 ? 24.512  32.766 10.688  1.00 37.57  ? 190  THR A CG2   1 
ATOM   2110 N  N     . ALA C 3 191 ? 22.878  31.930 7.250   1.00 42.93  ? 191  ALA A N     1 
ATOM   2111 C  CA    . ALA C 3 191 ? 23.399  32.133 5.905   1.00 44.09  ? 191  ALA A CA    1 
ATOM   2112 C  C     . ALA C 3 191 ? 22.693  33.313 5.259   1.00 46.60  ? 191  ALA A C     1 
ATOM   2113 O  O     . ALA C 3 191 ? 23.319  34.152 4.619   1.00 47.93  ? 191  ALA A O     1 
ATOM   2114 C  CB    . ALA C 3 191 ? 23.186  30.884 5.070   1.00 43.36  ? 191  ALA A CB    1 
ATOM   2115 N  N     . GLU C 3 192 ? 21.384  33.388 5.439   1.00 48.98  ? 192  GLU A N     1 
ATOM   2116 C  CA    . GLU C 3 192 ? 20.621  34.478 4.856   1.00 52.37  ? 192  GLU A CA    1 
ATOM   2117 C  C     . GLU C 3 192 ? 21.085  35.820 5.414   1.00 52.73  ? 192  GLU A C     1 
ATOM   2118 O  O     . GLU C 3 192 ? 21.341  36.764 4.662   1.00 53.05  ? 192  GLU A O     1 
ATOM   2119 C  CB    . GLU C 3 192 ? 19.131  34.267 5.125   1.00 55.29  ? 192  GLU A CB    1 
ATOM   2120 C  CG    . GLU C 3 192 ? 18.232  35.205 4.356   1.00 61.50  ? 192  GLU A CG    1 
ATOM   2121 C  CD    . GLU C 3 192 ? 18.632  35.340 2.887   1.00 64.39  ? 192  GLU A CD    1 
ATOM   2122 O  OE1   . GLU C 3 192 ? 18.770  34.290 2.221   1.00 65.54  ? 192  GLU A OE1   1 
ATOM   2123 O  OE2   . GLU C 3 192 ? 18.806  36.485 2.400   1.00 65.51  ? 192  GLU A OE2   1 
ATOM   2124 N  N     . LYS C 3 193 ? 21.198  35.903 6.735   1.00 53.02  ? 193  LYS A N     1 
ATOM   2125 C  CA    . LYS C 3 193 ? 21.640  37.135 7.375   1.00 53.80  ? 193  LYS A CA    1 
ATOM   2126 C  C     . LYS C 3 193 ? 23.004  37.561 6.844   1.00 54.22  ? 193  LYS A C     1 
ATOM   2127 O  O     . LYS C 3 193 ? 23.256  38.746 6.639   1.00 55.11  ? 193  LYS A O     1 
ATOM   2128 C  CB    . LYS C 3 193 ? 21.735  36.946 8.882   1.00 54.41  ? 193  LYS A CB    1 
ATOM   2129 C  CG    . LYS C 3 193 ? 20.423  36.643 9.569   1.00 56.50  ? 193  LYS A CG    1 
ATOM   2130 C  CD    . LYS C 3 193 ? 20.641  36.643 11.064  1.00 57.24  ? 193  LYS A CD    1 
ATOM   2131 C  CE    . LYS C 3 193 ? 19.344  36.722 11.821  1.00 59.14  ? 193  LYS A CE    1 
ATOM   2132 N  NZ    . LYS C 3 193 ? 19.611  37.218 13.198  1.00 62.19  ? 193  LYS A NZ    1 
ATOM   2133 N  N     . LEU C 3 194 ? 23.880  36.588 6.623   1.00 53.98  ? 194  LEU A N     1 
ATOM   2134 C  CA    . LEU C 3 194 ? 25.223  36.867 6.122   1.00 54.74  ? 194  LEU A CA    1 
ATOM   2135 C  C     . LEU C 3 194 ? 25.224  37.302 4.655   1.00 56.76  ? 194  LEU A C     1 
ATOM   2136 O  O     . LEU C 3 194 ? 26.029  38.143 4.247   1.00 57.66  ? 194  LEU A O     1 
ATOM   2137 C  CB    . LEU C 3 194 ? 26.113  35.636 6.300   1.00 51.71  ? 194  LEU A CB    1 
ATOM   2138 C  CG    . LEU C 3 194 ? 26.372  35.216 7.750   1.00 48.92  ? 194  LEU A CG    1 
ATOM   2139 C  CD1   . LEU C 3 194 ? 26.995  33.835 7.780   1.00 46.61  ? 194  LEU A CD1   1 
ATOM   2140 C  CD2   . LEU C 3 194 ? 27.274  36.234 8.427   1.00 44.32  ? 194  LEU A CD2   1 
ATOM   2141 N  N     . LYS C 3 195 ? 24.332  36.720 3.859   1.00 58.20  ? 195  LYS A N     1 
ATOM   2142 C  CA    . LYS C 3 195 ? 24.238  37.076 2.450   1.00 58.23  ? 195  LYS A CA    1 
ATOM   2143 C  C     . LYS C 3 195 ? 23.796  38.530 2.353   1.00 58.26  ? 195  LYS A C     1 
ATOM   2144 O  O     . LYS C 3 195 ? 24.248  39.271 1.478   1.00 57.16  ? 195  LYS A O     1 
ATOM   2145 C  CB    . LYS C 3 195 ? 23.225  36.179 1.738   1.00 59.08  ? 195  LYS A CB    1 
ATOM   2146 C  CG    . LYS C 3 195 ? 23.079  36.466 0.257   1.00 61.81  ? 195  LYS A CG    1 
ATOM   2147 C  CD    . LYS C 3 195 ? 22.156  35.460 -0.415  1.00 64.59  ? 195  LYS A CD    1 
ATOM   2148 C  CE    . LYS C 3 195 ? 21.976  35.772 -1.900  1.00 66.86  ? 195  LYS A CE    1 
ATOM   2149 N  NZ    . LYS C 3 195 ? 21.129  34.752 -2.598  1.00 68.25  ? 195  LYS A NZ    1 
ATOM   2150 N  N     . LYS C 3 196 ? 22.921  38.930 3.273   1.00 57.89  ? 196  LYS A N     1 
ATOM   2151 C  CA    . LYS C 3 196 ? 22.402  40.289 3.317   1.00 57.83  ? 196  LYS A CA    1 
ATOM   2152 C  C     . LYS C 3 196 ? 23.439  41.334 3.687   1.00 56.17  ? 196  LYS A C     1 
ATOM   2153 O  O     . LYS C 3 196 ? 23.231  42.529 3.475   1.00 56.81  ? 196  LYS A O     1 
ATOM   2154 C  CB    . LYS C 3 196 ? 21.228  40.367 4.287   1.00 60.69  ? 196  LYS A CB    1 
ATOM   2155 C  CG    . LYS C 3 196 ? 19.895  40.500 3.571   1.00 66.52  ? 196  LYS A CG    1 
ATOM   2156 C  CD    . LYS C 3 196 ? 18.722  40.161 4.476   1.00 70.61  ? 196  LYS A CD    1 
ATOM   2157 C  CE    . LYS C 3 196 ? 17.414  40.102 3.678   1.00 73.49  ? 196  LYS A CE    1 
ATOM   2158 N  NZ    . LYS C 3 196 ? 16.314  39.411 4.427   1.00 74.21  ? 196  LYS A NZ    1 
ATOM   2159 N  N     . LEU C 3 197 ? 24.553  40.888 4.245   1.00 54.63  ? 197  LEU A N     1 
ATOM   2160 C  CA    . LEU C 3 197 ? 25.622  41.800 4.628   1.00 52.46  ? 197  LEU A CA    1 
ATOM   2161 C  C     . LEU C 3 197 ? 26.723  41.739 3.578   1.00 51.00  ? 197  LEU A C     1 
ATOM   2162 O  O     . LEU C 3 197 ? 27.805  42.292 3.763   1.00 50.69  ? 197  LEU A O     1 
ATOM   2163 C  CB    . LEU C 3 197 ? 26.184  41.405 5.995   1.00 52.94  ? 197  LEU A CB    1 
ATOM   2164 C  CG    . LEU C 3 197 ? 25.209  41.531 7.168   1.00 52.75  ? 197  LEU A CG    1 
ATOM   2165 C  CD1   . LEU C 3 197 ? 25.838  40.946 8.426   1.00 54.19  ? 197  LEU A CD1   1 
ATOM   2166 C  CD2   . LEU C 3 197 ? 24.848  42.995 7.379   1.00 53.43  ? 197  LEU A CD2   1 
ATOM   2167 N  N     . GLY C 3 198 ? 26.435  41.062 2.472   1.00 49.57  ? 198  GLY A N     1 
ATOM   2168 C  CA    . GLY C 3 198 ? 27.416  40.927 1.415   1.00 48.23  ? 198  GLY A CA    1 
ATOM   2169 C  C     . GLY C 3 198 ? 28.449  39.883 1.782   1.00 48.65  ? 198  GLY A C     1 
ATOM   2170 O  O     . GLY C 3 198 ? 29.402  39.647 1.040   1.00 49.81  ? 198  GLY A O     1 
ATOM   2171 N  N     . ILE C 3 199 ? 28.250  39.240 2.930   1.00 49.25  ? 199  ILE A N     1 
ATOM   2172 C  CA    . ILE C 3 199 ? 29.173  38.215 3.416   1.00 48.59  ? 199  ILE A CA    1 
ATOM   2173 C  C     . ILE C 3 199 ? 28.889  36.858 2.782   1.00 47.92  ? 199  ILE A C     1 
ATOM   2174 O  O     . ILE C 3 199 ? 27.925  36.187 3.142   1.00 49.64  ? 199  ILE A O     1 
ATOM   2175 C  CB    . ILE C 3 199 ? 29.088  38.089 4.960   1.00 49.29  ? 199  ILE A CB    1 
ATOM   2176 C  CG1   . ILE C 3 199 ? 29.358  39.456 5.599   1.00 48.67  ? 199  ILE A CG1   1 
ATOM   2177 C  CG2   . ILE C 3 199 ? 30.069  37.022 5.450   1.00 49.35  ? 199  ILE A CG2   1 
ATOM   2178 C  CD1   . ILE C 3 199 ? 29.295  39.492 7.099   1.00 47.99  ? 199  ILE A CD1   1 
ATOM   2179 N  N     . ASN C 3 200 ? 29.735  36.454 1.840   1.00 46.94  ? 200  ASN A N     1 
ATOM   2180 C  CA    . ASN C 3 200 ? 29.558  35.179 1.150   1.00 47.78  ? 200  ASN A CA    1 
ATOM   2181 C  C     . ASN C 3 200 ? 30.719  34.233 1.385   1.00 46.86  ? 200  ASN A C     1 
ATOM   2182 O  O     . ASN C 3 200 ? 30.656  33.069 0.997   1.00 45.91  ? 200  ASN A O     1 
ATOM   2183 C  CB    . ASN C 3 200 ? 29.450  35.395 -0.361  1.00 49.85  ? 200  ASN A CB    1 
ATOM   2184 C  CG    . ASN C 3 200 ? 28.427  36.432 -0.727  1.00 52.06  ? 200  ASN A CG    1 
ATOM   2185 O  OD1   . ASN C 3 200 ? 27.222  36.213 -0.586  1.00 53.23  ? 200  ASN A OD1   1 
ATOM   2186 N  ND2   . ASN C 3 200 ? 28.899  37.585 -1.195  1.00 54.95  ? 200  ASN A ND2   1 
ATOM   2187 N  N     . LYS C 3 201 ? 31.786  34.749 1.987   1.00 47.34  ? 201  LYS A N     1 
ATOM   2188 C  CA    . LYS C 3 201 ? 32.987  33.960 2.246   1.00 46.94  ? 201  LYS A CA    1 
ATOM   2189 C  C     . LYS C 3 201 ? 33.520  34.263 3.634   1.00 46.28  ? 201  LYS A C     1 
ATOM   2190 O  O     . LYS C 3 201 ? 33.273  35.337 4.191   1.00 47.33  ? 201  LYS A O     1 
ATOM   2191 C  CB    . LYS C 3 201 ? 34.075  34.302 1.219   1.00 49.43  ? 201  LYS A CB    1 
ATOM   2192 C  CG    . LYS C 3 201 ? 33.616  34.310 -0.236  1.00 50.12  ? 201  LYS A CG    1 
ATOM   2193 C  CD    . LYS C 3 201 ? 33.286  32.912 -0.736  1.00 50.83  ? 201  LYS A CD    1 
ATOM   2194 C  CE    . LYS C 3 201 ? 32.903  32.949 -2.209  1.00 52.11  ? 201  LYS A CE    1 
ATOM   2195 N  NZ    . LYS C 3 201 ? 32.672  31.588 -2.764  1.00 52.25  ? 201  LYS A NZ    1 
ATOM   2196 N  N     . LEU C 3 202 ? 34.269  33.324 4.193   1.00 44.49  ? 202  LEU A N     1 
ATOM   2197 C  CA    . LEU C 3 202 ? 34.827  33.537 5.516   1.00 42.12  ? 202  LEU A CA    1 
ATOM   2198 C  C     . LEU C 3 202 ? 35.652  34.819 5.569   1.00 41.87  ? 202  LEU A C     1 
ATOM   2199 O  O     . LEU C 3 202 ? 35.470  35.648 6.459   1.00 39.73  ? 202  LEU A O     1 
ATOM   2200 C  CB    . LEU C 3 202 ? 35.690  32.345 5.921   1.00 40.50  ? 202  LEU A CB    1 
ATOM   2201 C  CG    . LEU C 3 202 ? 34.921  31.144 6.470   1.00 39.79  ? 202  LEU A CG    1 
ATOM   2202 C  CD1   . LEU C 3 202 ? 35.896  30.016 6.767   1.00 37.60  ? 202  LEU A CD1   1 
ATOM   2203 C  CD2   . LEU C 3 202 ? 34.157  31.557 7.732   1.00 36.22  ? 202  LEU A CD2   1 
ATOM   2204 N  N     . VAL C 3 203 ? 36.549  34.990 4.601   1.00 42.85  ? 203  VAL A N     1 
ATOM   2205 C  CA    . VAL C 3 203 ? 37.403  36.173 4.587   1.00 42.71  ? 203  VAL A CA    1 
ATOM   2206 C  C     . VAL C 3 203 ? 36.625  37.482 4.684   1.00 41.97  ? 203  VAL A C     1 
ATOM   2207 O  O     . VAL C 3 203 ? 37.109  38.455 5.255   1.00 42.96  ? 203  VAL A O     1 
ATOM   2208 C  CB    . VAL C 3 203 ? 38.320  36.190 3.329   1.00 44.04  ? 203  VAL A CB    1 
ATOM   2209 C  CG1   . VAL C 3 203 ? 37.483  36.279 2.044   1.00 43.48  ? 203  VAL A CG1   1 
ATOM   2210 C  CG2   . VAL C 3 203 ? 39.313  37.343 3.434   1.00 42.94  ? 203  VAL A CG2   1 
ATOM   2211 N  N     . ASP C 3 204 ? 35.404  37.500 4.166   1.00 42.22  ? 204  ASP A N     1 
ATOM   2212 C  CA    . ASP C 3 204 ? 34.601  38.717 4.208   1.00 41.97  ? 204  ASP A CA    1 
ATOM   2213 C  C     . ASP C 3 204 ? 34.260  39.203 5.624   1.00 42.49  ? 204  ASP A C     1 
ATOM   2214 O  O     . ASP C 3 204 ? 34.016  40.398 5.826   1.00 39.46  ? 204  ASP A O     1 
ATOM   2215 C  CB    . ASP C 3 204 ? 33.307  38.529 3.404   1.00 44.64  ? 204  ASP A CB    1 
ATOM   2216 C  CG    . ASP C 3 204 ? 33.561  38.152 1.956   1.00 47.72  ? 204  ASP A CG    1 
ATOM   2217 O  OD1   . ASP C 3 204 ? 34.402  38.802 1.305   1.00 50.70  ? 204  ASP A OD1   1 
ATOM   2218 O  OD2   . ASP C 3 204 ? 32.910  37.210 1.458   1.00 50.39  ? 204  ASP A OD2   1 
ATOM   2219 N  N     . THR C 3 205 ? 34.243  38.299 6.606   1.00 40.56  ? 205  THR A N     1 
ATOM   2220 C  CA    . THR C 3 205 ? 33.909  38.699 7.975   1.00 39.40  ? 205  THR A CA    1 
ATOM   2221 C  C     . THR C 3 205 ? 35.013  39.554 8.567   1.00 40.55  ? 205  THR A C     1 
ATOM   2222 O  O     . THR C 3 205 ? 34.848  40.155 9.627   1.00 40.98  ? 205  THR A O     1 
ATOM   2223 C  CB    . THR C 3 205 ? 33.716  37.483 8.893   1.00 39.12  ? 205  THR A CB    1 
ATOM   2224 O  OG1   . THR C 3 205 ? 34.942  36.750 8.963   1.00 37.34  ? 205  THR A OG1   1 
ATOM   2225 C  CG2   . THR C 3 205 ? 32.629  36.568 8.348   1.00 39.22  ? 205  THR A CG2   1 
ATOM   2226 N  N     . LEU C 3 206 ? 36.143  39.616 7.877   1.00 41.74  ? 206  LEU A N     1 
ATOM   2227 C  CA    . LEU C 3 206 ? 37.270  40.398 8.366   1.00 44.05  ? 206  LEU A CA    1 
ATOM   2228 C  C     . LEU C 3 206 ? 37.145  41.887 8.055   1.00 46.32  ? 206  LEU A C     1 
ATOM   2229 O  O     . LEU C 3 206 ? 37.596  42.733 8.832   1.00 45.33  ? 206  LEU A O     1 
ATOM   2230 C  CB    . LEU C 3 206 ? 38.574  39.845 7.783   1.00 42.52  ? 206  LEU A CB    1 
ATOM   2231 C  CG    . LEU C 3 206 ? 38.911  38.430 8.273   1.00 42.81  ? 206  LEU A CG    1 
ATOM   2232 C  CD1   . LEU C 3 206 ? 40.097  37.863 7.495   1.00 41.27  ? 206  LEU A CD1   1 
ATOM   2233 C  CD2   . LEU C 3 206 ? 39.197  38.483 9.774   1.00 41.34  ? 206  LEU A CD2   1 
ATOM   2234 N  N     . SER C 3 207 ? 36.514  42.210 6.932   1.00 48.16  ? 207  SER A N     1 
ATOM   2235 C  CA    . SER C 3 207 ? 36.372  43.603 6.540   1.00 51.57  ? 207  SER A CA    1 
ATOM   2236 C  C     . SER C 3 207 ? 35.146  44.304 7.111   1.00 52.51  ? 207  SER A C     1 
ATOM   2237 O  O     . SER C 3 207 ? 35.084  45.530 7.110   1.00 54.05  ? 207  SER A O     1 
ATOM   2238 C  CB    . SER C 3 207 ? 36.389  43.722 5.012   1.00 51.31  ? 207  SER A CB    1 
ATOM   2239 O  OG    . SER C 3 207 ? 35.418  42.880 4.415   1.00 55.26  ? 207  SER A OG    1 
ATOM   2240 N  N     . ILE C 3 208 ? 34.179  43.539 7.612   1.00 53.17  ? 208  ILE A N     1 
ATOM   2241 C  CA    . ILE C 3 208 ? 32.971  44.135 8.186   1.00 53.07  ? 208  ILE A CA    1 
ATOM   2242 C  C     . ILE C 3 208 ? 33.204  44.530 9.640   1.00 53.15  ? 208  ILE A C     1 
ATOM   2243 O  O     . ILE C 3 208 ? 33.913  43.836 10.366  1.00 52.73  ? 208  ILE A O     1 
ATOM   2244 C  CB    . ILE C 3 208 ? 31.764  43.153 8.132   1.00 54.57  ? 208  ILE A CB    1 
ATOM   2245 C  CG1   . ILE C 3 208 ? 30.510  43.829 8.696   1.00 54.01  ? 208  ILE A CG1   1 
ATOM   2246 C  CG2   . ILE C 3 208 ? 32.061  41.900 8.949   1.00 53.34  ? 208  ILE A CG2   1 
ATOM   2247 C  CD1   . ILE C 3 208 ? 29.259  42.977 8.598   1.00 54.68  ? 208  ILE A CD1   1 
ATOM   2248 N  N     . GLU C 3 209 ? 32.619  45.649 10.062  1.00 53.89  ? 209  GLU A N     1 
ATOM   2249 C  CA    . GLU C 3 209 ? 32.762  46.097 11.442  1.00 54.95  ? 209  GLU A CA    1 
ATOM   2250 C  C     . GLU C 3 209 ? 32.204  45.011 12.351  1.00 54.30  ? 209  GLU A C     1 
ATOM   2251 O  O     . GLU C 3 209 ? 31.099  44.512 12.122  1.00 52.97  ? 209  GLU A O     1 
ATOM   2252 C  CB    . GLU C 3 209 ? 31.987  47.394 11.680  1.00 58.00  ? 209  GLU A CB    1 
ATOM   2253 C  CG    . GLU C 3 209 ? 31.744  47.684 13.158  1.00 63.78  ? 209  GLU A CG    1 
ATOM   2254 C  CD    . GLU C 3 209 ? 30.956  48.961 13.391  1.00 68.96  ? 209  GLU A CD    1 
ATOM   2255 O  OE1   . GLU C 3 209 ? 29.922  49.157 12.711  1.00 72.23  ? 209  GLU A OE1   1 
ATOM   2256 O  OE2   . GLU C 3 209 ? 31.365  49.764 14.262  1.00 71.51  ? 209  GLU A OE2   1 
ATOM   2257 N  N     . PHE C 3 210 ? 32.959  44.657 13.386  1.00 53.48  ? 210  PHE A N     1 
ATOM   2258 C  CA    . PHE C 3 210 ? 32.529  43.615 14.308  1.00 52.59  ? 210  PHE A CA    1 
ATOM   2259 C  C     . PHE C 3 210 ? 31.159  43.863 14.932  1.00 52.83  ? 210  PHE A C     1 
ATOM   2260 O  O     . PHE C 3 210 ? 30.317  42.963 14.958  1.00 51.55  ? 210  PHE A O     1 
ATOM   2261 C  CB    . PHE C 3 210 ? 33.548  43.425 15.427  1.00 50.35  ? 210  PHE A CB    1 
ATOM   2262 C  CG    . PHE C 3 210 ? 33.186  42.320 16.371  1.00 49.68  ? 210  PHE A CG    1 
ATOM   2263 C  CD1   . PHE C 3 210 ? 33.315  40.990 15.982  1.00 47.40  ? 210  PHE A CD1   1 
ATOM   2264 C  CD2   . PHE C 3 210 ? 32.682  42.605 17.636  1.00 49.40  ? 210  PHE A CD2   1 
ATOM   2265 C  CE1   . PHE C 3 210 ? 32.948  39.962 16.835  1.00 47.74  ? 210  PHE A CE1   1 
ATOM   2266 C  CE2   . PHE C 3 210 ? 32.309  41.579 18.502  1.00 49.79  ? 210  PHE A CE2   1 
ATOM   2267 C  CZ    . PHE C 3 210 ? 32.443  40.252 18.098  1.00 48.21  ? 210  PHE A CZ    1 
ATOM   2268 N  N     . ASP C 3 211 ? 30.934  45.070 15.444  1.00 53.07  ? 211  ASP A N     1 
ATOM   2269 C  CA    . ASP C 3 211 ? 29.653  45.382 16.068  1.00 53.15  ? 211  ASP A CA    1 
ATOM   2270 C  C     . ASP C 3 211 ? 28.484  45.084 15.151  1.00 51.97  ? 211  ASP A C     1 
ATOM   2271 O  O     . ASP C 3 211 ? 27.429  44.638 15.599  1.00 51.21  ? 211  ASP A O     1 
ATOM   2272 C  CB    . ASP C 3 211 ? 29.597  46.847 16.497  1.00 56.78  ? 211  ASP A CB    1 
ATOM   2273 C  CG    . ASP C 3 211 ? 30.404  47.114 17.753  1.00 60.05  ? 211  ASP A CG    1 
ATOM   2274 O  OD1   . ASP C 3 211 ? 30.785  46.137 18.437  1.00 60.84  ? 211  ASP A OD1   1 
ATOM   2275 O  OD2   . ASP C 3 211 ? 30.647  48.300 18.064  1.00 63.09  ? 211  ASP A OD2   1 
ATOM   2276 N  N     . LYS C 3 212 ? 28.673  45.322 13.860  1.00 50.91  ? 212  LYS A N     1 
ATOM   2277 C  CA    . LYS C 3 212 ? 27.602  45.074 12.913  1.00 49.86  ? 212  LYS A CA    1 
ATOM   2278 C  C     . LYS C 3 212 ? 27.386  43.579 12.723  1.00 49.16  ? 212  LYS A C     1 
ATOM   2279 O  O     . LYS C 3 212 ? 26.247  43.111 12.703  1.00 49.69  ? 212  LYS A O     1 
ATOM   2280 C  CB    . LYS C 3 212 ? 27.911  45.731 11.573  1.00 50.76  ? 212  LYS A CB    1 
ATOM   2281 C  CG    . LYS C 3 212 ? 26.724  45.757 10.636  1.00 52.09  ? 212  LYS A CG    1 
ATOM   2282 C  CD    . LYS C 3 212 ? 27.083  46.352 9.293   1.00 54.75  ? 212  LYS A CD    1 
ATOM   2283 C  CE    . LYS C 3 212 ? 25.885  46.335 8.362   1.00 56.06  ? 212  LYS A CE    1 
ATOM   2284 N  NZ    . LYS C 3 212 ? 26.284  46.633 6.960   1.00 58.09  ? 212  LYS A NZ    1 
ATOM   2285 N  N     . LEU C 3 213 ? 28.475  42.830 12.582  1.00 47.55  ? 213  LEU A N     1 
ATOM   2286 C  CA    . LEU C 3 213 ? 28.372  41.386 12.402  1.00 46.86  ? 213  LEU A CA    1 
ATOM   2287 C  C     . LEU C 3 213 ? 27.772  40.790 13.661  1.00 46.06  ? 213  LEU A C     1 
ATOM   2288 O  O     . LEU C 3 213 ? 26.885  39.943 13.600  1.00 46.57  ? 213  LEU A O     1 
ATOM   2289 C  CB    . LEU C 3 213 ? 29.748  40.775 12.155  1.00 46.25  ? 213  LEU A CB    1 
ATOM   2290 C  CG    . LEU C 3 213 ? 29.760  39.268 11.912  1.00 44.94  ? 213  LEU A CG    1 
ATOM   2291 C  CD1   . LEU C 3 213 ? 28.877  38.928 10.716  1.00 45.11  ? 213  LEU A CD1   1 
ATOM   2292 C  CD2   . LEU C 3 213 ? 31.191  38.814 11.672  1.00 44.36  ? 213  LEU A CD2   1 
ATOM   2293 N  N     . LYS C 3 214 ? 28.262  41.243 14.805  1.00 45.50  ? 214  LYS A N     1 
ATOM   2294 C  CA    . LYS C 3 214 ? 27.766  40.764 16.082  1.00 46.58  ? 214  LYS A CA    1 
ATOM   2295 C  C     . LYS C 3 214 ? 26.275  41.034 16.206  1.00 47.07  ? 214  LYS A C     1 
ATOM   2296 O  O     . LYS C 3 214 ? 25.497  40.127 16.476  1.00 47.68  ? 214  LYS A O     1 
ATOM   2297 C  CB    . LYS C 3 214 ? 28.488  41.459 17.232  1.00 46.94  ? 214  LYS A CB    1 
ATOM   2298 C  CG    . LYS C 3 214 ? 27.913  41.114 18.585  1.00 49.37  ? 214  LYS A CG    1 
ATOM   2299 C  CD    . LYS C 3 214 ? 28.577  41.894 19.704  1.00 51.49  ? 214  LYS A CD    1 
ATOM   2300 C  CE    . LYS C 3 214 ? 27.940  41.528 21.035  1.00 53.17  ? 214  LYS A CE    1 
ATOM   2301 N  NZ    . LYS C 3 214 ? 28.448  42.332 22.184  1.00 55.80  ? 214  LYS A NZ    1 
ATOM   2302 N  N     . GLY C 3 215 ? 25.883  42.290 16.016  1.00 47.98  ? 215  GLY A N     1 
ATOM   2303 C  CA    . GLY C 3 215 ? 24.480  42.649 16.128  1.00 46.88  ? 215  GLY A CA    1 
ATOM   2304 C  C     . GLY C 3 215 ? 23.574  41.824 15.239  1.00 47.37  ? 215  GLY A C     1 
ATOM   2305 O  O     . GLY C 3 215 ? 22.387  41.660 15.534  1.00 49.12  ? 215  GLY A O     1 
ATOM   2306 N  N     . MET C 3 216 ? 24.133  41.292 14.156  1.00 46.08  ? 216  MET A N     1 
ATOM   2307 C  CA    . MET C 3 216 ? 23.364  40.489 13.207  1.00 46.41  ? 216  MET A CA    1 
ATOM   2308 C  C     . MET C 3 216 ? 23.283  38.990 13.519  1.00 45.92  ? 216  MET A C     1 
ATOM   2309 O  O     . MET C 3 216 ? 22.193  38.407 13.484  1.00 44.89  ? 216  MET A O     1 
ATOM   2310 C  CB    . MET C 3 216 ? 23.925  40.680 11.790  1.00 49.38  ? 216  MET A CB    1 
ATOM   2311 C  CG    . MET C 3 216 ? 23.177  39.965 10.705  1.00 52.60  ? 216  MET A CG    1 
ATOM   2312 S  SD    . MET C 3 216 ? 21.539  40.550 10.409  1.00 61.92  ? 216  MET A SD    1 
ATOM   2313 C  CE    . MET C 3 216 ? 21.408  42.063 11.399  1.00 57.43  ? 216  MET A CE    1 
ATOM   2314 N  N     . ILE C 3 217 ? 24.421  38.363 13.816  1.00 42.72  ? 217  ILE A N     1 
ATOM   2315 C  CA    . ILE C 3 217 ? 24.420  36.934 14.092  1.00 39.90  ? 217  ILE A CA    1 
ATOM   2316 C  C     . ILE C 3 217 ? 24.754  36.543 15.517  1.00 39.70  ? 217  ILE A C     1 
ATOM   2317 O  O     . ILE C 3 217 ? 24.804  35.358 15.834  1.00 42.08  ? 217  ILE A O     1 
ATOM   2318 C  CB    . ILE C 3 217 ? 25.378  36.186 13.159  1.00 38.25  ? 217  ILE A CB    1 
ATOM   2319 C  CG1   . ILE C 3 217 ? 26.821  36.601 13.444  1.00 36.37  ? 217  ILE A CG1   1 
ATOM   2320 C  CG2   . ILE C 3 217 ? 25.010  36.468 11.719  1.00 36.96  ? 217  ILE A CG2   1 
ATOM   2321 C  CD1   . ILE C 3 217 ? 27.833  35.842 12.622  1.00 34.10  ? 217  ILE A CD1   1 
ATOM   2322 N  N     . GLY C 3 218 ? 24.974  37.526 16.380  1.00 38.88  ? 218  GLY A N     1 
ATOM   2323 C  CA    . GLY C 3 218 ? 25.287  37.224 17.765  1.00 37.92  ? 218  GLY A CA    1 
ATOM   2324 C  C     . GLY C 3 218 ? 26.781  37.165 18.007  1.00 38.86  ? 218  GLY A C     1 
ATOM   2325 O  O     . GLY C 3 218 ? 27.549  36.809 17.113  1.00 39.17  ? 218  GLY A O     1 
ATOM   2326 N  N     . GLU C 3 219 ? 27.190  37.500 19.224  1.00 38.44  ? 219  GLU A N     1 
ATOM   2327 C  CA    . GLU C 3 219 ? 28.597  37.510 19.601  1.00 39.87  ? 219  GLU A CA    1 
ATOM   2328 C  C     . GLU C 3 219 ? 29.341  36.190 19.390  1.00 38.20  ? 219  GLU A C     1 
ATOM   2329 O  O     . GLU C 3 219 ? 30.445  36.182 18.846  1.00 39.39  ? 219  GLU A O     1 
ATOM   2330 C  CB    . GLU C 3 219 ? 28.736  37.948 21.064  1.00 43.07  ? 219  GLU A CB    1 
ATOM   2331 C  CG    . GLU C 3 219 ? 30.124  37.778 21.635  1.00 49.77  ? 219  GLU A CG    1 
ATOM   2332 C  CD    . GLU C 3 219 ? 30.280  38.426 23.000  1.00 54.62  ? 219  GLU A CD    1 
ATOM   2333 O  OE1   . GLU C 3 219 ? 29.441  38.171 23.894  1.00 56.93  ? 219  GLU A OE1   1 
ATOM   2334 O  OE2   . GLU C 3 219 ? 31.251  39.193 23.178  1.00 57.24  ? 219  GLU A OE2   1 
ATOM   2335 N  N     . ALA C 3 220 ? 28.754  35.077 19.815  1.00 35.06  ? 220  ALA A N     1 
ATOM   2336 C  CA    . ALA C 3 220 ? 29.420  33.788 19.653  1.00 34.19  ? 220  ALA A CA    1 
ATOM   2337 C  C     . ALA C 3 220 ? 29.674  33.410 18.196  1.00 32.39  ? 220  ALA A C     1 
ATOM   2338 O  O     . ALA C 3 220 ? 30.802  33.086 17.834  1.00 31.82  ? 220  ALA A O     1 
ATOM   2339 C  CB    . ALA C 3 220 ? 28.617  32.672 20.354  1.00 33.78  ? 220  ALA A CB    1 
ATOM   2340 N  N     . LYS C 3 221 ? 28.647  33.441 17.352  1.00 31.89  ? 221  LYS A N     1 
ATOM   2341 C  CA    . LYS C 3 221 ? 28.852  33.065 15.951  1.00 34.05  ? 221  LYS A CA    1 
ATOM   2342 C  C     . LYS C 3 221 ? 29.815  34.010 15.224  1.00 33.74  ? 221  LYS A C     1 
ATOM   2343 O  O     . LYS C 3 221 ? 30.565  33.589 14.342  1.00 35.70  ? 221  LYS A O     1 
ATOM   2344 C  CB    . LYS C 3 221 ? 27.513  32.997 15.200  1.00 33.56  ? 221  LYS A CB    1 
ATOM   2345 C  CG    . LYS C 3 221 ? 27.311  31.684 14.450  1.00 38.42  ? 221  LYS A CG    1 
ATOM   2346 C  CD    . LYS C 3 221 ? 25.922  31.102 14.733  1.00 40.34  ? 221  LYS A CD    1 
ATOM   2347 C  CE    . LYS C 3 221 ? 25.879  29.607 14.500  1.00 41.71  ? 221  LYS A CE    1 
ATOM   2348 N  NZ    . LYS C 3 221 ? 24.618  29.024 15.036  1.00 48.53  ? 221  LYS A NZ    1 
ATOM   2349 N  N     . ALA C 3 222 ? 29.800  35.280 15.602  1.00 33.38  ? 222  ALA A N     1 
ATOM   2350 C  CA    . ALA C 3 222 ? 30.683  36.266 14.991  1.00 33.40  ? 222  ALA A CA    1 
ATOM   2351 C  C     . ALA C 3 222 ? 32.142  35.934 15.296  1.00 33.03  ? 222  ALA A C     1 
ATOM   2352 O  O     . ALA C 3 222 ? 32.987  35.893 14.396  1.00 33.43  ? 222  ALA A O     1 
ATOM   2353 C  CB    . ALA C 3 222 ? 30.352  37.658 15.523  1.00 34.05  ? 222  ALA A CB    1 
ATOM   2354 N  N     . LYS C 3 223 ? 32.444  35.707 16.569  1.00 32.91  ? 223  LYS A N     1 
ATOM   2355 C  CA    . LYS C 3 223 ? 33.813  35.390 16.953  1.00 32.92  ? 223  LYS A CA    1 
ATOM   2356 C  C     . LYS C 3 223 ? 34.269  34.094 16.301  1.00 33.25  ? 223  LYS A C     1 
ATOM   2357 O  O     . LYS C 3 223 ? 35.418  33.965 15.879  1.00 33.78  ? 223  LYS A O     1 
ATOM   2358 C  CB    . LYS C 3 223 ? 33.918  35.292 18.472  1.00 35.34  ? 223  LYS A CB    1 
ATOM   2359 C  CG    . LYS C 3 223 ? 33.880  36.652 19.142  1.00 37.36  ? 223  LYS A CG    1 
ATOM   2360 C  CD    . LYS C 3 223 ? 34.032  36.557 20.637  1.00 37.78  ? 223  LYS A CD    1 
ATOM   2361 C  CE    . LYS C 3 223 ? 34.035  37.953 21.256  1.00 40.77  ? 223  LYS A CE    1 
ATOM   2362 N  NZ    . LYS C 3 223 ? 34.097  37.908 22.747  1.00 43.11  ? 223  LYS A NZ    1 
ATOM   2363 N  N     . TYR C 3 224 ? 33.345  33.144 16.215  1.00 33.01  ? 224  TYR A N     1 
ATOM   2364 C  CA    . TYR C 3 224 ? 33.590  31.843 15.614  1.00 30.86  ? 224  TYR A CA    1 
ATOM   2365 C  C     . TYR C 3 224 ? 34.002  32.013 14.163  1.00 30.95  ? 224  TYR A C     1 
ATOM   2366 O  O     . TYR C 3 224 ? 35.076  31.546 13.745  1.00 30.42  ? 224  TYR A O     1 
ATOM   2367 C  CB    . TYR C 3 224 ? 32.307  31.011 15.701  1.00 31.61  ? 224  TYR A CB    1 
ATOM   2368 C  CG    . TYR C 3 224 ? 32.287  29.738 14.893  1.00 30.95  ? 224  TYR A CG    1 
ATOM   2369 C  CD1   . TYR C 3 224 ? 33.065  28.639 15.256  1.00 33.26  ? 224  TYR A CD1   1 
ATOM   2370 C  CD2   . TYR C 3 224 ? 31.455  29.615 13.781  1.00 30.29  ? 224  TYR A CD2   1 
ATOM   2371 C  CE1   . TYR C 3 224 ? 33.008  27.432 14.522  1.00 30.41  ? 224  TYR A CE1   1 
ATOM   2372 C  CE2   . TYR C 3 224 ? 31.390  28.424 13.043  1.00 30.42  ? 224  TYR A CE2   1 
ATOM   2373 C  CZ    . TYR C 3 224 ? 32.167  27.334 13.419  1.00 31.42  ? 224  TYR A CZ    1 
ATOM   2374 O  OH    . TYR C 3 224 ? 32.089  26.157 12.687  1.00 29.67  ? 224  TYR A OH    1 
ATOM   2375 N  N     . LEU C 3 225 ? 33.157  32.686 13.390  1.00 29.89  ? 225  LEU A N     1 
ATOM   2376 C  CA    . LEU C 3 225 ? 33.452  32.885 11.979  1.00 31.02  ? 225  LEU A CA    1 
ATOM   2377 C  C     . LEU C 3 225 ? 34.763  33.639 11.787  1.00 31.54  ? 225  LEU A C     1 
ATOM   2378 O  O     . LEU C 3 225 ? 35.578  33.265 10.949  1.00 32.72  ? 225  LEU A O     1 
ATOM   2379 C  CB    . LEU C 3 225 ? 32.308  33.635 11.293  1.00 31.18  ? 225  LEU A CB    1 
ATOM   2380 C  CG    . LEU C 3 225 ? 31.001  32.854 11.165  1.00 32.02  ? 225  LEU A CG    1 
ATOM   2381 C  CD1   . LEU C 3 225 ? 29.923  33.723 10.501  1.00 32.23  ? 225  LEU A CD1   1 
ATOM   2382 C  CD2   . LEU C 3 225 ? 31.268  31.583 10.350  1.00 32.89  ? 225  LEU A CD2   1 
ATOM   2383 N  N     . ILE C 3 226 ? 34.966  34.692 12.574  1.00 33.06  ? 226  ILE A N     1 
ATOM   2384 C  CA    . ILE C 3 226 ? 36.183  35.490 12.482  1.00 34.55  ? 226  ILE A CA    1 
ATOM   2385 C  C     . ILE C 3 226 ? 37.432  34.666 12.805  1.00 35.98  ? 226  ILE A C     1 
ATOM   2386 O  O     . ILE C 3 226 ? 38.421  34.705 12.058  1.00 36.16  ? 226  ILE A O     1 
ATOM   2387 C  CB    . ILE C 3 226 ? 36.104  36.704 13.420  1.00 33.56  ? 226  ILE A CB    1 
ATOM   2388 C  CG1   . ILE C 3 226 ? 35.054  37.682 12.882  1.00 34.85  ? 226  ILE A CG1   1 
ATOM   2389 C  CG2   . ILE C 3 226 ? 37.469  37.367 13.534  1.00 32.93  ? 226  ILE A CG2   1 
ATOM   2390 C  CD1   . ILE C 3 226 ? 34.648  38.751 13.852  1.00 33.91  ? 226  ILE A CD1   1 
ATOM   2391 N  N     . SER C 3 227 ? 37.385  33.911 13.905  1.00 34.37  ? 227  SER A N     1 
ATOM   2392 C  CA    . SER C 3 227 ? 38.527  33.091 14.299  1.00 31.81  ? 227  SER A CA    1 
ATOM   2393 C  C     . SER C 3 227 ? 38.895  32.154 13.149  1.00 31.30  ? 227  SER A C     1 
ATOM   2394 O  O     . SER C 3 227 ? 40.072  31.900 12.887  1.00 30.57  ? 227  SER A O     1 
ATOM   2395 C  CB    . SER C 3 227 ? 38.194  32.271 15.547  1.00 30.85  ? 227  SER A CB    1 
ATOM   2396 O  OG    . SER C 3 227 ? 37.470  31.100 15.195  1.00 34.69  ? 227  SER A OG    1 
ATOM   2397 N  N     . LEU C 3 228 ? 37.884  31.631 12.461  1.00 31.32  ? 228  LEU A N     1 
ATOM   2398 C  CA    . LEU C 3 228 ? 38.134  30.738 11.339  1.00 30.89  ? 228  LEU A CA    1 
ATOM   2399 C  C     . LEU C 3 228 ? 38.761  31.533 10.196  1.00 32.29  ? 228  LEU A C     1 
ATOM   2400 O  O     . LEU C 3 228 ? 39.720  31.081 9.578   1.00 30.17  ? 228  LEU A O     1 
ATOM   2401 C  CB    . LEU C 3 228 ? 36.833  30.082 10.862  1.00 30.14  ? 228  LEU A CB    1 
ATOM   2402 C  CG    . LEU C 3 228 ? 36.246  28.920 11.684  1.00 29.75  ? 228  LEU A CG    1 
ATOM   2403 C  CD1   . LEU C 3 228 ? 34.851  28.600 11.198  1.00 25.22  ? 228  LEU A CD1   1 
ATOM   2404 C  CD2   . LEU C 3 228 ? 37.149  27.688 11.561  1.00 28.04  ? 228  LEU A CD2   1 
ATOM   2405 N  N     . ALA C 3 229 ? 38.220  32.720 9.924   1.00 32.05  ? 229  ALA A N     1 
ATOM   2406 C  CA    . ALA C 3 229 ? 38.739  33.564 8.850   1.00 35.45  ? 229  ALA A CA    1 
ATOM   2407 C  C     . ALA C 3 229 ? 40.214  33.911 9.066   1.00 36.08  ? 229  ALA A C     1 
ATOM   2408 O  O     . ALA C 3 229 ? 40.992  33.936 8.115   1.00 36.87  ? 229  ALA A O     1 
ATOM   2409 C  CB    . ALA C 3 229 ? 37.913  34.839 8.738   1.00 33.74  ? 229  ALA A CB    1 
ATOM   2410 N  N     . ARG C 3 230 ? 40.591  34.180 10.311  1.00 37.38  ? 230  ARG A N     1 
ATOM   2411 C  CA    . ARG C 3 230 ? 41.980  34.516 10.636  1.00 39.34  ? 230  ARG A CA    1 
ATOM   2412 C  C     . ARG C 3 230 ? 42.843  33.260 10.691  1.00 38.88  ? 230  ARG A C     1 
ATOM   2413 O  O     . ARG C 3 230 ? 44.048  33.334 10.924  1.00 39.55  ? 230  ARG A O     1 
ATOM   2414 C  CB    . ARG C 3 230 ? 42.058  35.212 11.995  1.00 40.59  ? 230  ARG A CB    1 
ATOM   2415 C  CG    . ARG C 3 230 ? 41.378  36.566 12.057  1.00 44.74  ? 230  ARG A CG    1 
ATOM   2416 C  CD    . ARG C 3 230 ? 41.506  37.185 13.448  1.00 47.15  ? 230  ARG A CD    1 
ATOM   2417 N  NE    . ARG C 3 230 ? 40.870  38.496 13.491  1.00 51.57  ? 230  ARG A NE    1 
ATOM   2418 C  CZ    . ARG C 3 230 ? 40.459  39.096 14.603  1.00 54.40  ? 230  ARG A CZ    1 
ATOM   2419 N  NH1   . ARG C 3 230 ? 40.619  38.503 15.778  1.00 55.01  ? 230  ARG A NH1   1 
ATOM   2420 N  NH2   . ARG C 3 230 ? 39.870  40.288 14.536  1.00 57.06  ? 230  ARG A NH2   1 
ATOM   2421 N  N     . ASP C 3 231 ? 42.220  32.106 10.488  1.00 38.01  ? 231  ASP A N     1 
ATOM   2422 C  CA    . ASP C 3 231 ? 42.941  30.844 10.550  1.00 37.18  ? 231  ASP A CA    1 
ATOM   2423 C  C     . ASP C 3 231 ? 43.536  30.721 11.955  1.00 37.74  ? 231  ASP A C     1 
ATOM   2424 O  O     . ASP C 3 231 ? 44.663  30.264 12.129  1.00 37.72  ? 231  ASP A O     1 
ATOM   2425 C  CB    . ASP C 3 231 ? 44.057  30.823 9.511   1.00 38.13  ? 231  ASP A CB    1 
ATOM   2426 C  CG    . ASP C 3 231 ? 44.647  29.446 9.315   1.00 40.90  ? 231  ASP A CG    1 
ATOM   2427 O  OD1   . ASP C 3 231 ? 44.258  28.508 10.047  1.00 40.29  ? 231  ASP A OD1   1 
ATOM   2428 O  OD2   . ASP C 3 231 ? 45.506  29.305 8.417   1.00 44.03  ? 231  ASP A OD2   1 
ATOM   2429 N  N     . GLU C 3 232 ? 42.765  31.143 12.954  1.00 37.48  ? 232  GLU A N     1 
ATOM   2430 C  CA    . GLU C 3 232 ? 43.193  31.092 14.346  1.00 39.41  ? 232  GLU A CA    1 
ATOM   2431 C  C     . GLU C 3 232 ? 42.193  30.332 15.200  1.00 39.70  ? 232  GLU A C     1 
ATOM   2432 O  O     . GLU C 3 232 ? 42.058  30.595 16.384  1.00 41.06  ? 232  GLU A O     1 
ATOM   2433 C  CB    . GLU C 3 232 ? 43.360  32.513 14.894  1.00 38.78  ? 232  GLU A CB    1 
ATOM   2434 C  CG    . GLU C 3 232 ? 44.730  33.097 14.614  1.00 40.58  ? 232  GLU A CG    1 
ATOM   2435 C  CD    . GLU C 3 232 ? 44.798  34.602 14.816  1.00 43.90  ? 232  GLU A CD    1 
ATOM   2436 O  OE1   . GLU C 3 232 ? 43.989  35.142 15.607  1.00 42.43  ? 232  GLU A OE1   1 
ATOM   2437 O  OE2   . GLU C 3 232 ? 45.675  35.238 14.185  1.00 43.09  ? 232  GLU A OE2   1 
ATOM   2438 N  N     . TYR C 3 233 ? 41.488  29.391 14.587  1.00 41.60  ? 233  TYR A N     1 
ATOM   2439 C  CA    . TYR C 3 233 ? 40.485  28.602 15.289  1.00 42.20  ? 233  TYR A CA    1 
ATOM   2440 C  C     . TYR C 3 233 ? 41.095  27.405 15.975  1.00 44.78  ? 233  TYR A C     1 
ATOM   2441 O  O     . TYR C 3 233 ? 41.827  26.621 15.364  1.00 45.69  ? 233  TYR A O     1 
ATOM   2442 C  CB    . TYR C 3 233 ? 39.418  28.110 14.312  1.00 40.46  ? 233  TYR A CB    1 
ATOM   2443 C  CG    . TYR C 3 233 ? 38.412  27.152 14.918  1.00 38.46  ? 233  TYR A CG    1 
ATOM   2444 C  CD1   . TYR C 3 233 ? 37.224  27.615 15.485  1.00 39.20  ? 233  TYR A CD1   1 
ATOM   2445 C  CD2   . TYR C 3 233 ? 38.643  25.777 14.911  1.00 38.48  ? 233  TYR A CD2   1 
ATOM   2446 C  CE1   . TYR C 3 233 ? 36.285  26.720 16.026  1.00 40.04  ? 233  TYR A CE1   1 
ATOM   2447 C  CE2   . TYR C 3 233 ? 37.719  24.880 15.447  1.00 39.14  ? 233  TYR A CE2   1 
ATOM   2448 C  CZ    . TYR C 3 233 ? 36.540  25.356 16.001  1.00 40.87  ? 233  TYR A CZ    1 
ATOM   2449 O  OH    . TYR C 3 233 ? 35.621  24.461 16.520  1.00 43.85  ? 233  TYR A OH    1 
ATOM   2450 N  N     . ASN C 3 234 ? 40.792  27.261 17.249  1.00 47.09  ? 234  ASN A N     1 
ATOM   2451 C  CA    . ASN C 3 234 ? 41.297  26.133 17.962  1.00 50.98  ? 234  ASN A CA    1 
ATOM   2452 C  C     . ASN C 3 234 ? 40.202  25.670 18.912  1.00 49.96  ? 234  ASN A C     1 
ATOM   2453 O  O     . ASN C 3 234 ? 39.635  26.395 19.694  1.00 51.22  ? 234  ASN A O     1 
ATOM   2454 C  CB    . ASN C 3 234 ? 42.588  26.471 18.735  1.00 54.17  ? 234  ASN A CB    1 
ATOM   2455 C  CG    . ASN C 3 234 ? 42.407  26.439 20.240  1.00 59.78  ? 234  ASN A CG    1 
ATOM   2456 O  OD1   . ASN C 3 234 ? 41.763  27.314 20.818  1.00 62.61  ? 234  ASN A OD1   1 
ATOM   2457 N  ND2   . ASN C 3 234 ? 43.007  25.440 20.889  1.00 62.10  ? 234  ASN A ND2   1 
ATOM   2458 N  N     . GLU C 3 235 ? 39.845  24.423 18.723  1.00 49.07  ? 235  GLU A N     1 
ATOM   2459 C  CA    . GLU C 3 235 ? 38.909  23.745 19.593  1.00 47.71  ? 235  GLU A CA    1 
ATOM   2460 C  C     . GLU C 3 235 ? 39.470  22.362 19.833  1.00 44.75  ? 235  GLU A C     1 
ATOM   2461 O  O     . GLU C 3 235 ? 39.715  21.665 18.918  1.00 43.27  ? 235  GLU A O     1 
ATOM   2462 C  CB    . GLU C 3 235 ? 37.517  23.701 18.943  1.00 50.77  ? 235  GLU A CB    1 
ATOM   2463 C  CG    . GLU C 3 235 ? 36.588  24.787 19.450  1.00 57.25  ? 235  GLU A CG    1 
ATOM   2464 C  CD    . GLU C 3 235 ? 36.633  24.930 20.975  1.00 60.74  ? 235  GLU A CD    1 
ATOM   2465 O  OE1   . GLU C 3 235 ? 36.412  23.923 21.689  1.00 64.54  ? 235  GLU A OE1   1 
ATOM   2466 O  OE2   . GLU C 3 235 ? 36.882  26.058 21.460  1.00 62.09  ? 235  GLU A OE2   1 
ATOM   2467 N  N     . PRO C 3 236 ? 39.645  21.947 21.068  1.00 43.40  ? 236  PRO A N     1 
ATOM   2468 C  CA    . PRO C 3 236 ? 40.185  20.656 21.468  1.00 42.80  ? 236  PRO A CA    1 
ATOM   2469 C  C     . PRO C 3 236 ? 39.203  19.533 21.282  1.00 42.20  ? 236  PRO A C     1 
ATOM   2470 O  O     . PRO C 3 236 ? 38.005  19.705 21.321  1.00 41.50  ? 236  PRO A O     1 
ATOM   2471 C  CB    . PRO C 3 236 ? 40.545  20.902 22.912  1.00 43.33  ? 236  PRO A CB    1 
ATOM   2472 C  CG    . PRO C 3 236 ? 39.367  21.746 23.324  1.00 46.01  ? 236  PRO A CG    1 
ATOM   2473 C  CD    . PRO C 3 236 ? 39.204  22.736 22.220  1.00 44.54  ? 236  PRO A CD    1 
ATOM   2474 N  N     . ILE C 3 237 ? 39.773  18.380 21.002  1.00 42.94  ? 237  ILE A N     1 
ATOM   2475 C  CA    . ILE C 3 237 ? 39.014  17.175 20.847  1.00 44.50  ? 237  ILE A CA    1 
ATOM   2476 C  C     . ILE C 3 237 ? 38.808  16.680 22.253  1.00 46.30  ? 237  ILE A C     1 
ATOM   2477 O  O     . ILE C 3 237 ? 39.776  16.353 22.932  1.00 46.30  ? 237  ILE A O     1 
ATOM   2478 C  CB    . ILE C 3 237 ? 39.824  16.170 19.995  1.00 43.82  ? 237  ILE A CB    1 
ATOM   2479 C  CG1   . ILE C 3 237 ? 39.950  16.676 18.553  1.00 45.29  ? 237  ILE A CG1   1 
ATOM   2480 C  CG2   . ILE C 3 237 ? 39.155  14.810 20.016  1.00 44.86  ? 237  ILE A CG2   1 
ATOM   2481 C  CD1   . ILE C 3 237 ? 40.528  18.083 18.439  1.00 48.27  ? 237  ILE A CD1   1 
ATOM   2482 N  N     . ARG C 3 238 ? 37.559  16.699 22.709  1.00 48.00  ? 238  ARG A N     1 
ATOM   2483 C  CA    . ARG C 3 238 ? 37.274  16.302 24.079  1.00 50.13  ? 238  ARG A CA    1 
ATOM   2484 C  C     . ARG C 3 238 ? 36.168  15.257 24.165  1.00 49.64  ? 238  ARG A C     1 
ATOM   2485 O  O     . ARG C 3 238 ? 35.223  15.260 23.369  1.00 47.93  ? 238  ARG A O     1 
ATOM   2486 C  CB    . ARG C 3 238 ? 36.832  17.524 24.894  1.00 54.12  ? 238  ARG A CB    1 
ATOM   2487 C  CG    . ARG C 3 238 ? 35.611  18.234 24.274  1.00 61.59  ? 238  ARG A CG    1 
ATOM   2488 C  CD    . ARG C 3 238 ? 35.104  19.422 25.115  1.00 66.31  ? 238  ARG A CD    1 
ATOM   2489 N  NE    . ARG C 3 238 ? 36.088  20.497 25.256  1.00 70.47  ? 238  ARG A NE    1 
ATOM   2490 C  CZ    . ARG C 3 238 ? 36.864  20.675 26.325  1.00 71.83  ? 238  ARG A CZ    1 
ATOM   2491 N  NH1   . ARG C 3 238 ? 37.733  21.679 26.361  1.00 72.03  ? 238  ARG A NH1   1 
ATOM   2492 N  NH2   . ARG C 3 238 ? 36.764  19.856 27.365  1.00 72.64  ? 238  ARG A NH2   1 
ATOM   2493 N  N     . THR C 3 239 ? 36.278  14.375 25.154  1.00 50.01  ? 239  THR A N     1 
ATOM   2494 C  CA    . THR C 3 239 ? 35.277  13.343 25.377  1.00 50.39  ? 239  THR A CA    1 
ATOM   2495 C  C     . THR C 3 239 ? 33.991  14.079 25.712  1.00 49.51  ? 239  THR A C     1 
ATOM   2496 O  O     . THR C 3 239 ? 33.983  14.964 26.558  1.00 49.74  ? 239  THR A O     1 
ATOM   2497 C  CB    . THR C 3 239 ? 35.653  12.450 26.574  1.00 51.50  ? 239  THR A CB    1 
ATOM   2498 O  OG1   . THR C 3 239 ? 36.884  11.766 26.300  1.00 52.03  ? 239  THR A OG1   1 
ATOM   2499 C  CG2   . THR C 3 239 ? 34.550  11.439 26.842  1.00 51.73  ? 239  THR A CG2   1 
ATOM   2500 N  N     . ARG C 3 240 ? 32.913  13.734 25.029  1.00 49.53  ? 240  ARG A N     1 
ATOM   2501 C  CA    . ARG C 3 240 ? 31.638  14.375 25.290  1.00 51.18  ? 240  ARG A CA    1 
ATOM   2502 C  C     . ARG C 3 240 ? 30.808  13.556 26.261  1.00 49.50  ? 240  ARG A C     1 
ATOM   2503 O  O     . ARG C 3 240 ? 30.697  12.340 26.126  1.00 49.70  ? 240  ARG A O     1 
ATOM   2504 C  CB    . ARG C 3 240 ? 30.838  14.552 24.001  1.00 54.08  ? 240  ARG A CB    1 
ATOM   2505 C  CG    . ARG C 3 240 ? 31.395  15.575 23.040  1.00 58.56  ? 240  ARG A CG    1 
ATOM   2506 C  CD    . ARG C 3 240 ? 30.313  15.989 22.061  1.00 62.73  ? 240  ARG A CD    1 
ATOM   2507 N  NE    . ARG C 3 240 ? 30.848  16.708 20.910  1.00 66.29  ? 240  ARG A NE    1 
ATOM   2508 C  CZ    . ARG C 3 240 ? 30.100  17.194 19.924  1.00 68.44  ? 240  ARG A CZ    1 
ATOM   2509 N  NH1   . ARG C 3 240 ? 28.779  17.042 19.952  1.00 69.12  ? 240  ARG A NH1   1 
ATOM   2510 N  NH2   . ARG C 3 240 ? 30.672  17.819 18.902  1.00 69.15  ? 240  ARG A NH2   1 
ATOM   2511 N  N     . VAL C 3 241 ? 30.232  14.232 27.245  1.00 48.39  ? 241  VAL A N     1 
ATOM   2512 C  CA    . VAL C 3 241 ? 29.381  13.577 28.225  1.00 47.19  ? 241  VAL A CA    1 
ATOM   2513 C  C     . VAL C 3 241 ? 27.974  14.076 27.945  1.00 45.53  ? 241  VAL A C     1 
ATOM   2514 O  O     . VAL C 3 241 ? 27.751  15.281 27.875  1.00 43.99  ? 241  VAL A O     1 
ATOM   2515 C  CB    . VAL C 3 241 ? 29.783  13.958 29.668  1.00 48.17  ? 241  VAL A CB    1 
ATOM   2516 C  CG1   . VAL C 3 241 ? 28.745  13.446 30.652  1.00 48.03  ? 241  VAL A CG1   1 
ATOM   2517 C  CG2   . VAL C 3 241 ? 31.150  13.369 29.997  1.00 49.51  ? 241  VAL A CG2   1 
ATOM   2518 N  N     . ARG C 3 242 ? 27.037  13.152 27.771  1.00 44.60  ? 242  ARG A N     1 
ATOM   2519 C  CA    . ARG C 3 242 ? 25.658  13.515 27.490  1.00 46.18  ? 242  ARG A CA    1 
ATOM   2520 C  C     . ARG C 3 242 ? 25.080  14.397 28.595  1.00 45.15  ? 242  ARG A C     1 
ATOM   2521 O  O     . ARG C 3 242 ? 25.158  14.050 29.771  1.00 45.14  ? 242  ARG A O     1 
ATOM   2522 C  CB    . ARG C 3 242 ? 24.812  12.253 27.317  1.00 49.09  ? 242  ARG A CB    1 
ATOM   2523 C  CG    . ARG C 3 242 ? 23.404  12.559 26.837  1.00 54.63  ? 242  ARG A CG    1 
ATOM   2524 C  CD    . ARG C 3 242 ? 22.766  11.420 26.066  1.00 58.41  ? 242  ARG A CD    1 
ATOM   2525 N  NE    . ARG C 3 242 ? 23.573  11.039 24.909  1.00 61.80  ? 242  ARG A NE    1 
ATOM   2526 C  CZ    . ARG C 3 242 ? 24.186  11.900 24.096  1.00 63.01  ? 242  ARG A CZ    1 
ATOM   2527 N  NH1   . ARG C 3 242 ? 24.095  13.209 24.302  1.00 63.66  ? 242  ARG A NH1   1 
ATOM   2528 N  NH2   . ARG C 3 242 ? 24.895  11.450 23.067  1.00 64.59  ? 242  ARG A NH2   1 
ATOM   2529 N  N     . LYS C 3 243 ? 24.504  15.536 28.216  1.00 43.91  ? 243  LYS A N     1 
ATOM   2530 C  CA    . LYS C 3 243 ? 23.935  16.474 29.188  1.00 42.48  ? 243  LYS A CA    1 
ATOM   2531 C  C     . LYS C 3 243 ? 22.426  16.362 29.396  1.00 40.55  ? 243  LYS A C     1 
ATOM   2532 O  O     . LYS C 3 243 ? 21.899  16.896 30.372  1.00 40.58  ? 243  LYS A O     1 
ATOM   2533 C  CB    . LYS C 3 243 ? 24.253  17.916 28.786  1.00 46.11  ? 243  LYS A CB    1 
ATOM   2534 C  CG    . LYS C 3 243 ? 25.721  18.311 28.869  1.00 50.88  ? 243  LYS A CG    1 
ATOM   2535 C  CD    . LYS C 3 243 ? 25.873  19.808 28.616  1.00 53.23  ? 243  LYS A CD    1 
ATOM   2536 C  CE    . LYS C 3 243 ? 27.291  20.291 28.880  1.00 54.68  ? 243  LYS A CE    1 
ATOM   2537 N  NZ    . LYS C 3 243 ? 28.268  19.682 27.940  1.00 57.13  ? 243  LYS A NZ    1 
ATOM   2538 N  N     . SER C 3 244 ? 21.721  15.693 28.487  1.00 37.54  ? 244  SER A N     1 
ATOM   2539 C  CA    . SER C 3 244 ? 20.275  15.559 28.634  1.00 34.07  ? 244  SER A CA    1 
ATOM   2540 C  C     . SER C 3 244 ? 19.699  14.345 27.905  1.00 33.59  ? 244  SER A C     1 
ATOM   2541 O  O     . SER C 3 244 ? 20.234  13.897 26.882  1.00 32.53  ? 244  SER A O     1 
ATOM   2542 C  CB    . SER C 3 244 ? 19.572  16.821 28.129  1.00 34.00  ? 244  SER A CB    1 
ATOM   2543 O  OG    . SER C 3 244 ? 19.705  16.935 26.723  1.00 31.71  ? 244  SER A OG    1 
ATOM   2544 N  N     . ILE C 3 245 ? 18.622  13.802 28.473  1.00 29.46  ? 245  ILE A N     1 
ATOM   2545 C  CA    . ILE C 3 245 ? 17.919  12.663 27.906  1.00 28.84  ? 245  ILE A CA    1 
ATOM   2546 C  C     . ILE C 3 245 ? 16.422  12.973 27.898  1.00 29.11  ? 245  ILE A C     1 
ATOM   2547 O  O     . ILE C 3 245 ? 15.860  13.450 28.894  1.00 28.77  ? 245  ILE A O     1 
ATOM   2548 C  CB    . ILE C 3 245 ? 18.190  11.386 28.702  1.00 29.71  ? 245  ILE A CB    1 
ATOM   2549 C  CG1   . ILE C 3 245 ? 19.642  10.959 28.479  1.00 33.01  ? 245  ILE A CG1   1 
ATOM   2550 C  CG2   . ILE C 3 245 ? 17.246  10.280 28.250  1.00 25.94  ? 245  ILE A CG2   1 
ATOM   2551 C  CD1   . ILE C 3 245 ? 20.081  9.809  29.360  1.00 39.48  ? 245  ILE A CD1   1 
ATOM   2552 N  N     . GLY C 3 246 ? 15.776  12.718 26.767  1.00 27.97  ? 246  GLY A N     1 
ATOM   2553 C  CA    . GLY C 3 246 ? 14.364  13.023 26.669  1.00 28.36  ? 246  GLY A CA    1 
ATOM   2554 C  C     . GLY C 3 246 ? 13.631  12.212 25.623  1.00 29.50  ? 246  GLY A C     1 
ATOM   2555 O  O     . GLY C 3 246 ? 14.217  11.416 24.885  1.00 28.98  ? 246  GLY A O     1 
ATOM   2556 N  N     . ARG C 3 247 ? 12.326  12.421 25.568  1.00 27.32  ? 247  ARG A N     1 
ATOM   2557 C  CA    . ARG C 3 247 ? 11.494  11.718 24.626  1.00 31.23  ? 247  ARG A CA    1 
ATOM   2558 C  C     . ARG C 3 247 ? 10.312  12.603 24.336  1.00 28.52  ? 247  ARG A C     1 
ATOM   2559 O  O     . ARG C 3 247 ? 9.734   13.209 25.236  1.00 29.37  ? 247  ARG A O     1 
ATOM   2560 C  CB    . ARG C 3 247 ? 11.045  10.384 25.229  1.00 32.28  ? 247  ARG A CB    1 
ATOM   2561 C  CG    . ARG C 3 247 ? 9.964   9.663  24.455  1.00 39.73  ? 247  ARG A CG    1 
ATOM   2562 C  CD    . ARG C 3 247 ? 10.490  9.025  23.178  1.00 44.40  ? 247  ARG A CD    1 
ATOM   2563 N  NE    . ARG C 3 247 ? 9.418   8.315  22.489  1.00 48.36  ? 247  ARG A NE    1 
ATOM   2564 C  CZ    . ARG C 3 247 ? 9.495   7.865  21.241  1.00 52.48  ? 247  ARG A CZ    1 
ATOM   2565 N  NH1   . ARG C 3 247 ? 10.609  8.046  20.537  1.00 52.95  ? 247  ARG A NH1   1 
ATOM   2566 N  NH2   . ARG C 3 247 ? 8.446   7.260  20.689  1.00 52.25  ? 247  ARG A NH2   1 
ATOM   2567 N  N     . ILE C 3 248 ? 9.962   12.690 23.066  1.00 28.79  ? 248  ILE A N     1 
ATOM   2568 C  CA    . ILE C 3 248 ? 8.851   13.513 22.655  1.00 32.19  ? 248  ILE A CA    1 
ATOM   2569 C  C     . ILE C 3 248 ? 8.083   12.671 21.631  1.00 34.23  ? 248  ILE A C     1 
ATOM   2570 O  O     . ILE C 3 248 ? 8.675   12.066 20.727  1.00 33.07  ? 248  ILE A O     1 
ATOM   2571 C  CB    . ILE C 3 248 ? 9.390   14.851 22.072  1.00 34.26  ? 248  ILE A CB    1 
ATOM   2572 C  CG1   . ILE C 3 248 ? 8.268   15.884 21.965  1.00 36.07  ? 248  ILE A CG1   1 
ATOM   2573 C  CG2   . ILE C 3 248 ? 10.057  14.606 20.728  1.00 34.61  ? 248  ILE A CG2   1 
ATOM   2574 C  CD1   . ILE C 3 248 ? 7.217   15.527 20.978  1.00 40.26  ? 248  ILE A CD1   1 
ATOM   2575 N  N     . VAL C 3 249 ? 6.766   12.605 21.793  1.00 34.38  ? 249  VAL A N     1 
ATOM   2576 C  CA    . VAL C 3 249 ? 5.941   11.802 20.900  1.00 35.29  ? 249  VAL A CA    1 
ATOM   2577 C  C     . VAL C 3 249 ? 4.820   12.591 20.241  1.00 35.66  ? 249  VAL A C     1 
ATOM   2578 O  O     . VAL C 3 249 ? 4.395   13.633 20.737  1.00 34.73  ? 249  VAL A O     1 
ATOM   2579 C  CB    . VAL C 3 249 ? 5.310   10.595 21.651  1.00 36.48  ? 249  VAL A CB    1 
ATOM   2580 C  CG1   . VAL C 3 249 ? 6.403   9.775  22.339  1.00 36.04  ? 249  VAL A CG1   1 
ATOM   2581 C  CG2   . VAL C 3 249 ? 4.274   11.091 22.675  1.00 34.41  ? 249  VAL A CG2   1 
ATOM   2582 N  N     . THR C 3 250 ? 4.352   12.086 19.108  1.00 35.41  ? 250  THR A N     1 
ATOM   2583 C  CA    . THR C 3 250 ? 3.272   12.735 18.390  1.00 37.59  ? 250  THR A CA    1 
ATOM   2584 C  C     . THR C 3 250 ? 1.944   12.144 18.831  1.00 38.59  ? 250  THR A C     1 
ATOM   2585 O  O     . THR C 3 250 ? 1.806   10.926 18.963  1.00 38.79  ? 250  THR A O     1 
ATOM   2586 C  CB    . THR C 3 250 ? 3.440   12.573 16.866  1.00 38.35  ? 250  THR A CB    1 
ATOM   2587 O  OG1   . THR C 3 250 ? 4.566   13.349 16.440  1.00 38.84  ? 250  THR A OG1   1 
ATOM   2588 C  CG2   . THR C 3 250 ? 2.195   13.069 16.118  1.00 37.01  ? 250  THR A CG2   1 
ATOM   2589 N  N     . MET C 3 251 ? 0.966   13.010 19.074  1.00 40.22  ? 251  MET A N     1 
ATOM   2590 C  CA    . MET C 3 251 ? -0.346  12.540 19.507  1.00 43.35  ? 251  MET A CA    1 
ATOM   2591 C  C     . MET C 3 251 ? -1.225  12.198 18.310  1.00 44.10  ? 251  MET A C     1 
ATOM   2592 O  O     . MET C 3 251 ? -1.110  12.806 17.241  1.00 44.04  ? 251  MET A O     1 
ATOM   2593 C  CB    . MET C 3 251 ? -1.047  13.586 20.388  1.00 41.90  ? 251  MET A CB    1 
ATOM   2594 C  CG    . MET C 3 251 ? -0.252  13.994 21.618  1.00 42.27  ? 251  MET A CG    1 
ATOM   2595 S  SD    . MET C 3 251 ? -1.174  15.011 22.732  1.00 43.46  ? 251  MET A SD    1 
ATOM   2596 C  CE    . MET C 3 251 ? -1.405  16.472 21.803  1.00 40.55  ? 251  MET A CE    1 
ATOM   2597 N  N     . LYS C 3 252 ? -2.095  11.211 18.501  1.00 47.33  ? 252  LYS A N     1 
ATOM   2598 C  CA    . LYS C 3 252 ? -3.004  10.761 17.453  1.00 50.02  ? 252  LYS A CA    1 
ATOM   2599 C  C     . LYS C 3 252 ? -3.715  11.963 16.847  1.00 50.02  ? 252  LYS A C     1 
ATOM   2600 O  O     . LYS C 3 252 ? -3.871  12.051 15.631  1.00 49.76  ? 252  LYS A O     1 
ATOM   2601 C  CB    . LYS C 3 252 ? -4.026  9.785  18.034  1.00 52.46  ? 252  LYS A CB    1 
ATOM   2602 C  CG    . LYS C 3 252 ? -4.921  9.129  17.002  1.00 57.65  ? 252  LYS A CG    1 
ATOM   2603 C  CD    . LYS C 3 252 ? -4.149  8.148  16.122  1.00 61.30  ? 252  LYS A CD    1 
ATOM   2604 C  CE    . LYS C 3 252 ? -5.082  7.480  15.109  1.00 63.66  ? 252  LYS A CE    1 
ATOM   2605 N  NZ    . LYS C 3 252 ? -4.408  6.393  14.334  1.00 65.19  ? 252  LYS A NZ    1 
ATOM   2606 N  N     . ARG C 3 253 ? -4.140  12.890 17.702  1.00 50.26  ? 253  ARG A N     1 
ATOM   2607 C  CA    . ARG C 3 253 ? -4.817  14.091 17.239  1.00 51.23  ? 253  ARG A CA    1 
ATOM   2608 C  C     . ARG C 3 253 ? -4.459  15.233 18.172  1.00 50.49  ? 253  ARG A C     1 
ATOM   2609 O  O     . ARG C 3 253 ? -4.196  15.007 19.351  1.00 50.48  ? 253  ARG A O     1 
ATOM   2610 C  CB    . ARG C 3 253 ? -6.336  13.887 17.223  1.00 53.70  ? 253  ARG A CB    1 
ATOM   2611 C  CG    . ARG C 3 253 ? -7.029  14.143 18.553  1.00 58.07  ? 253  ARG A CG    1 
ATOM   2612 C  CD    . ARG C 3 253 ? -8.544  14.038 18.409  1.00 61.88  ? 253  ARG A CD    1 
ATOM   2613 N  NE    . ARG C 3 253 ? -9.241  14.625 19.551  1.00 64.79  ? 253  ARG A NE    1 
ATOM   2614 C  CZ    . ARG C 3 253 ? -10.168 13.996 20.268  1.00 67.02  ? 253  ARG A CZ    1 
ATOM   2615 N  NH1   . ARG C 3 253 ? -10.522 12.751 19.968  1.00 67.53  ? 253  ARG A NH1   1 
ATOM   2616 N  NH2   . ARG C 3 253 ? -10.740 14.613 21.293  1.00 69.56  ? 253  ARG A NH2   1 
ATOM   2617 N  N     . ASN C 3 254 ? -4.448  16.455 17.648  1.00 50.17  ? 254  ASN A N     1 
ATOM   2618 C  CA    . ASN C 3 254 ? -4.112  17.619 18.457  1.00 50.21  ? 254  ASN A CA    1 
ATOM   2619 C  C     . ASN C 3 254 ? -5.091  17.802 19.608  1.00 51.03  ? 254  ASN A C     1 
ATOM   2620 O  O     . ASN C 3 254 ? -6.228  17.331 19.547  1.00 50.58  ? 254  ASN A O     1 
ATOM   2621 C  CB    . ASN C 3 254 ? -4.077  18.885 17.599  1.00 49.50  ? 254  ASN A CB    1 
ATOM   2622 C  CG    . ASN C 3 254 ? -2.989  18.841 16.547  1.00 49.03  ? 254  ASN A CG    1 
ATOM   2623 O  OD1   . ASN C 3 254 ? -2.004  18.124 16.692  1.00 47.55  ? 254  ASN A OD1   1 
ATOM   2624 N  ND2   . ASN C 3 254 ? -3.153  19.621 15.490  1.00 49.64  ? 254  ASN A ND2   1 
ATOM   2625 N  N     . SER C 3 255 ? -4.642  18.489 20.657  1.00 50.80  ? 255  SER A N     1 
ATOM   2626 C  CA    . SER C 3 255 ? -5.478  18.725 21.824  1.00 50.07  ? 255  SER A CA    1 
ATOM   2627 C  C     . SER C 3 255 ? -4.846  19.663 22.839  1.00 50.82  ? 255  SER A C     1 
ATOM   2628 O  O     . SER C 3 255 ? -3.661  19.985 22.760  1.00 51.71  ? 255  SER A O     1 
ATOM   2629 C  CB    . SER C 3 255 ? -5.788  17.395 22.515  1.00 49.24  ? 255  SER A CB    1 
ATOM   2630 O  OG    . SER C 3 255 ? -6.357  17.595 23.797  1.00 46.72  ? 255  SER A OG    1 
ATOM   2631 N  N     . ARG C 3 256 ? -5.663  20.113 23.785  1.00 51.38  ? 256  ARG A N     1 
ATOM   2632 C  CA    . ARG C 3 256 ? -5.204  20.964 24.873  1.00 50.54  ? 256  ARG A CA    1 
ATOM   2633 C  C     . ARG C 3 256 ? -6.047  20.579 26.071  1.00 49.40  ? 256  ARG A C     1 
ATOM   2634 O  O     . ARG C 3 256 ? -6.337  21.386 26.953  1.00 48.88  ? 256  ARG A O     1 
ATOM   2635 C  CB    . ARG C 3 256 ? -5.329  22.458 24.542  1.00 51.22  ? 256  ARG A CB    1 
ATOM   2636 C  CG    . ARG C 3 256 ? -6.669  22.933 24.046  1.00 53.88  ? 256  ARG A CG    1 
ATOM   2637 C  CD    . ARG C 3 256 ? -6.623  24.441 23.775  1.00 55.30  ? 256  ARG A CD    1 
ATOM   2638 N  NE    . ARG C 3 256 ? -6.383  25.216 24.995  1.00 57.55  ? 256  ARG A NE    1 
ATOM   2639 C  CZ    . ARG C 3 256 ? -5.184  25.566 25.459  1.00 57.09  ? 256  ARG A CZ    1 
ATOM   2640 N  NH1   . ARG C 3 256 ? -4.080  25.222 24.811  1.00 56.22  ? 256  ARG A NH1   1 
ATOM   2641 N  NH2   . ARG C 3 256 ? -5.089  26.262 26.582  1.00 56.75  ? 256  ARG A NH2   1 
ATOM   2642 N  N     . ASN C 3 257 ? -6.426  19.304 26.068  1.00 48.74  ? 257  ASN A N     1 
ATOM   2643 C  CA    . ASN C 3 257 ? -7.222  18.685 27.119  1.00 48.44  ? 257  ASN A CA    1 
ATOM   2644 C  C     . ASN C 3 257 ? -6.261  17.871 27.992  1.00 47.14  ? 257  ASN A C     1 
ATOM   2645 O  O     . ASN C 3 257 ? -5.811  16.800 27.598  1.00 46.97  ? 257  ASN A O     1 
ATOM   2646 C  CB    . ASN C 3 257 ? -8.270  17.766 26.484  1.00 49.89  ? 257  ASN A CB    1 
ATOM   2647 C  CG    . ASN C 3 257 ? -9.049  16.965 27.510  1.00 52.25  ? 257  ASN A CG    1 
ATOM   2648 O  OD1   . ASN C 3 257 ? -8.482  16.177 28.272  1.00 53.31  ? 257  ASN A OD1   1 
ATOM   2649 N  ND2   . ASN C 3 257 ? -10.360 17.161 27.531  1.00 54.59  ? 257  ASN A ND2   1 
ATOM   2650 N  N     . LEU C 3 258 ? -5.960  18.378 29.180  1.00 46.65  ? 258  LEU A N     1 
ATOM   2651 C  CA    . LEU C 3 258 ? -5.025  17.723 30.088  1.00 47.23  ? 258  LEU A CA    1 
ATOM   2652 C  C     . LEU C 3 258 ? -5.122  16.200 30.208  1.00 46.90  ? 258  LEU A C     1 
ATOM   2653 O  O     . LEU C 3 258 ? -4.108  15.497 30.121  1.00 45.75  ? 258  LEU A O     1 
ATOM   2654 C  CB    . LEU C 3 258 ? -5.133  18.337 31.484  1.00 48.29  ? 258  LEU A CB    1 
ATOM   2655 C  CG    . LEU C 3 258 ? -4.024  17.859 32.428  1.00 50.81  ? 258  LEU A CG    1 
ATOM   2656 C  CD1   . LEU C 3 258 ? -2.698  18.492 32.013  1.00 48.38  ? 258  LEU A CD1   1 
ATOM   2657 C  CD2   . LEU C 3 258 ? -4.363  18.226 33.867  1.00 51.46  ? 258  LEU A CD2   1 
ATOM   2658 N  N     . GLU C 3 259 ? -6.327  15.681 30.414  1.00 46.04  ? 259  GLU A N     1 
ATOM   2659 C  CA    . GLU C 3 259 ? -6.479  14.235 30.561  1.00 47.00  ? 259  GLU A CA    1 
ATOM   2660 C  C     . GLU C 3 259 ? -6.191  13.450 29.285  1.00 45.70  ? 259  GLU A C     1 
ATOM   2661 O  O     . GLU C 3 259 ? -5.740  12.309 29.339  1.00 44.51  ? 259  GLU A O     1 
ATOM   2662 C  CB    . GLU C 3 259 ? -7.880  13.898 31.083  1.00 48.40  ? 259  GLU A CB    1 
ATOM   2663 C  CG    . GLU C 3 259 ? -8.089  14.307 32.538  1.00 51.05  ? 259  GLU A CG    1 
ATOM   2664 C  CD    . GLU C 3 259 ? -7.044  13.703 33.471  1.00 53.06  ? 259  GLU A CD    1 
ATOM   2665 O  OE1   . GLU C 3 259 ? -6.992  12.460 33.601  1.00 51.76  ? 259  GLU A OE1   1 
ATOM   2666 O  OE2   . GLU C 3 259 ? -6.271  14.475 34.075  1.00 55.29  ? 259  GLU A OE2   1 
ATOM   2667 N  N     . GLU C 3 260 ? -6.448  14.067 28.139  1.00 44.82  ? 260  GLU A N     1 
ATOM   2668 C  CA    . GLU C 3 260 ? -6.207  13.419 26.858  1.00 44.87  ? 260  GLU A CA    1 
ATOM   2669 C  C     . GLU C 3 260 ? -4.706  13.418 26.534  1.00 43.40  ? 260  GLU A C     1 
ATOM   2670 O  O     . GLU C 3 260 ? -4.199  12.494 25.902  1.00 42.38  ? 260  GLU A O     1 
ATOM   2671 C  CB    . GLU C 3 260 ? -7.002  14.141 25.769  1.00 47.13  ? 260  GLU A CB    1 
ATOM   2672 C  CG    . GLU C 3 260 ? -6.783  13.609 24.368  1.00 50.96  ? 260  GLU A CG    1 
ATOM   2673 C  CD    . GLU C 3 260 ? -7.680  14.289 23.345  1.00 53.73  ? 260  GLU A CD    1 
ATOM   2674 O  OE1   . GLU C 3 260 ? -7.935  15.504 23.488  1.00 56.01  ? 260  GLU A OE1   1 
ATOM   2675 O  OE2   . GLU C 3 260 ? -8.120  13.616 22.387  1.00 56.43  ? 260  GLU A OE2   1 
ATOM   2676 N  N     . ILE C 3 261 ? -3.999  14.445 26.997  1.00 40.91  ? 261  ILE A N     1 
ATOM   2677 C  CA    . ILE C 3 261 ? -2.561  14.566 26.761  1.00 40.80  ? 261  ILE A CA    1 
ATOM   2678 C  C     . ILE C 3 261 ? -1.726  13.734 27.740  1.00 40.74  ? 261  ILE A C     1 
ATOM   2679 O  O     . ILE C 3 261 ? -0.673  13.212 27.376  1.00 39.78  ? 261  ILE A O     1 
ATOM   2680 C  CB    . ILE C 3 261 ? -2.110  16.043 26.858  1.00 40.50  ? 261  ILE A CB    1 
ATOM   2681 C  CG1   . ILE C 3 261 ? -2.811  16.865 25.773  1.00 39.21  ? 261  ILE A CG1   1 
ATOM   2682 C  CG2   . ILE C 3 261 ? -0.588  16.142 26.725  1.00 38.60  ? 261  ILE A CG2   1 
ATOM   2683 C  CD1   . ILE C 3 261 ? -2.454  18.324 25.778  1.00 39.24  ? 261  ILE A CD1   1 
ATOM   2684 N  N     . LYS C 3 262 ? -2.211  13.606 28.972  1.00 39.91  ? 262  LYS A N     1 
ATOM   2685 C  CA    . LYS C 3 262 ? -1.521  12.860 30.023  1.00 40.01  ? 262  LYS A CA    1 
ATOM   2686 C  C     . LYS C 3 262 ? -0.878  11.528 29.655  1.00 39.78  ? 262  LYS A C     1 
ATOM   2687 O  O     . LYS C 3 262 ? 0.296   11.303 29.958  1.00 40.28  ? 262  LYS A O     1 
ATOM   2688 C  CB    . LYS C 3 262 ? -2.459  12.617 31.206  1.00 40.48  ? 262  LYS A CB    1 
ATOM   2689 C  CG    . LYS C 3 262 ? -2.547  13.759 32.191  1.00 41.90  ? 262  LYS A CG    1 
ATOM   2690 C  CD    . LYS C 3 262 ? -3.368  13.321 33.391  1.00 43.98  ? 262  LYS A CD    1 
ATOM   2691 C  CE    . LYS C 3 262 ? -3.324  14.342 34.513  1.00 43.62  ? 262  LYS A CE    1 
ATOM   2692 N  NZ    . LYS C 3 262 ? -4.027  13.825 35.724  1.00 43.96  ? 262  LYS A NZ    1 
ATOM   2693 N  N     . PRO C 3 263 ? -1.637  10.615 29.024  1.00 39.53  ? 263  PRO A N     1 
ATOM   2694 C  CA    . PRO C 3 263 ? -1.066  9.313  28.653  1.00 38.36  ? 263  PRO A CA    1 
ATOM   2695 C  C     . PRO C 3 263 ? 0.186   9.412  27.779  1.00 35.73  ? 263  PRO A C     1 
ATOM   2696 O  O     . PRO C 3 263 ? 1.112   8.624  27.939  1.00 34.82  ? 263  PRO A O     1 
ATOM   2697 C  CB    . PRO C 3 263 ? -2.227  8.610  27.946  1.00 38.82  ? 263  PRO A CB    1 
ATOM   2698 C  CG    . PRO C 3 263 ? -3.442  9.250  28.560  1.00 39.88  ? 263  PRO A CG    1 
ATOM   2699 C  CD    . PRO C 3 263 ? -3.047  10.701 28.605  1.00 39.85  ? 263  PRO A CD    1 
ATOM   2700 N  N     . TYR C 3 264 ? 0.219   10.375 26.862  1.00 34.60  ? 264  TYR A N     1 
ATOM   2701 C  CA    . TYR C 3 264 ? 1.392   10.552 26.006  1.00 35.55  ? 264  TYR A CA    1 
ATOM   2702 C  C     . TYR C 3 264 ? 2.563   11.041 26.863  1.00 36.01  ? 264  TYR A C     1 
ATOM   2703 O  O     . TYR C 3 264 ? 3.670   10.496 26.807  1.00 35.88  ? 264  TYR A O     1 
ATOM   2704 C  CB    . TYR C 3 264 ? 1.105   11.571 24.909  1.00 36.08  ? 264  TYR A CB    1 
ATOM   2705 C  CG    . TYR C 3 264 ? 0.093   11.117 23.884  1.00 37.57  ? 264  TYR A CG    1 
ATOM   2706 C  CD1   . TYR C 3 264 ? 0.432   10.181 22.901  1.00 37.86  ? 264  TYR A CD1   1 
ATOM   2707 C  CD2   . TYR C 3 264 ? -1.199  11.648 23.874  1.00 38.12  ? 264  TYR A CD2   1 
ATOM   2708 C  CE1   . TYR C 3 264 ? -0.499  9.789  21.927  1.00 38.77  ? 264  TYR A CE1   1 
ATOM   2709 C  CE2   . TYR C 3 264 ? -2.132  11.269 22.913  1.00 37.24  ? 264  TYR A CE2   1 
ATOM   2710 C  CZ    . TYR C 3 264 ? -1.777  10.341 21.940  1.00 40.19  ? 264  TYR A CZ    1 
ATOM   2711 O  OH    . TYR C 3 264 ? -2.690  9.982  20.971  1.00 40.09  ? 264  TYR A OH    1 
ATOM   2712 N  N     . LEU C 3 265 ? 2.311   12.062 27.673  1.00 34.89  ? 265  LEU A N     1 
ATOM   2713 C  CA    . LEU C 3 265 ? 3.348   12.605 28.537  1.00 35.16  ? 265  LEU A CA    1 
ATOM   2714 C  C     . LEU C 3 265 ? 3.939   11.508 29.415  1.00 34.98  ? 265  LEU A C     1 
ATOM   2715 O  O     . LEU C 3 265 ? 5.161   11.386 29.541  1.00 33.35  ? 265  LEU A O     1 
ATOM   2716 C  CB    . LEU C 3 265 ? 2.775   13.728 29.413  1.00 36.69  ? 265  LEU A CB    1 
ATOM   2717 C  CG    . LEU C 3 265 ? 3.770   14.529 30.274  1.00 38.66  ? 265  LEU A CG    1 
ATOM   2718 C  CD1   . LEU C 3 265 ? 4.889   15.097 29.408  1.00 38.61  ? 265  LEU A CD1   1 
ATOM   2719 C  CD2   . LEU C 3 265 ? 3.042   15.662 30.975  1.00 39.32  ? 265  LEU A CD2   1 
ATOM   2720 N  N     . PHE C 3 266 ? 3.071   10.691 30.005  1.00 34.16  ? 266  PHE A N     1 
ATOM   2721 C  CA    . PHE C 3 266 ? 3.533   9.626  30.880  1.00 33.87  ? 266  PHE A CA    1 
ATOM   2722 C  C     . PHE C 3 266 ? 4.346   8.581  30.135  1.00 34.38  ? 266  PHE A C     1 
ATOM   2723 O  O     . PHE C 3 266 ? 5.349   8.084  30.652  1.00 33.02  ? 266  PHE A O     1 
ATOM   2724 C  CB    . PHE C 3 266 ? 2.345   8.992  31.607  1.00 36.72  ? 266  PHE A CB    1 
ATOM   2725 C  CG    . PHE C 3 266 ? 1.634   9.941  32.535  1.00 38.73  ? 266  PHE A CG    1 
ATOM   2726 C  CD1   . PHE C 3 266 ? 2.282   11.078 33.018  1.00 40.06  ? 266  PHE A CD1   1 
ATOM   2727 C  CD2   . PHE C 3 266 ? 0.327   9.692  32.942  1.00 39.38  ? 266  PHE A CD2   1 
ATOM   2728 C  CE1   . PHE C 3 266 ? 1.642   11.956 33.890  1.00 42.40  ? 266  PHE A CE1   1 
ATOM   2729 C  CE2   . PHE C 3 266 ? -0.326  10.563 33.816  1.00 41.72  ? 266  PHE A CE2   1 
ATOM   2730 C  CZ    . PHE C 3 266 ? 0.335   11.701 34.292  1.00 42.28  ? 266  PHE A CZ    1 
ATOM   2731 N  N     . ARG C 3 267 ? 3.915   8.242  28.925  1.00 33.48  ? 267  ARG A N     1 
ATOM   2732 C  CA    . ARG C 3 267 ? 4.662   7.300  28.112  1.00 35.30  ? 267  ARG A CA    1 
ATOM   2733 C  C     . ARG C 3 267 ? 6.059   7.901  27.873  1.00 34.75  ? 267  ARG A C     1 
ATOM   2734 O  O     . ARG C 3 267 ? 7.074   7.220  28.022  1.00 36.74  ? 267  ARG A O     1 
ATOM   2735 C  CB    . ARG C 3 267 ? 3.946   7.071  26.772  1.00 39.48  ? 267  ARG A CB    1 
ATOM   2736 C  CG    . ARG C 3 267 ? 2.773   6.086  26.836  1.00 46.73  ? 267  ARG A CG    1 
ATOM   2737 C  CD    . ARG C 3 267 ? 2.011   5.990  25.493  1.00 49.84  ? 267  ARG A CD    1 
ATOM   2738 N  NE    . ARG C 3 267 ? 0.679   6.594  25.527  1.00 52.99  ? 267  ARG A NE    1 
ATOM   2739 C  CZ    . ARG C 3 267 ? -0.015  6.961  24.449  1.00 53.93  ? 267  ARG A CZ    1 
ATOM   2740 N  NH1   . ARG C 3 267 ? 0.493   6.795  23.229  1.00 55.28  ? 267  ARG A NH1   1 
ATOM   2741 N  NH2   . ARG C 3 267 ? -1.230  7.484  24.593  1.00 52.36  ? 267  ARG A NH2   1 
ATOM   2742 N  N     . ALA C 3 268 ? 6.119   9.184  27.526  1.00 32.35  ? 268  ALA A N     1 
ATOM   2743 C  CA    . ALA C 3 268 ? 7.409   9.821  27.269  1.00 33.86  ? 268  ALA A CA    1 
ATOM   2744 C  C     . ALA C 3 268 ? 8.326   9.775  28.496  1.00 34.17  ? 268  ALA A C     1 
ATOM   2745 O  O     . ALA C 3 268 ? 9.544   9.599  28.372  1.00 33.61  ? 268  ALA A O     1 
ATOM   2746 C  CB    . ALA C 3 268 ? 7.203   11.268 26.808  1.00 31.77  ? 268  ALA A CB    1 
ATOM   2747 N  N     . ILE C 3 269 ? 7.739   9.930  29.681  1.00 35.90  ? 269  ILE A N     1 
ATOM   2748 C  CA    . ILE C 3 269 ? 8.511   9.892  30.927  1.00 35.52  ? 269  ILE A CA    1 
ATOM   2749 C  C     . ILE C 3 269 ? 9.033   8.479  31.172  1.00 37.70  ? 269  ILE A C     1 
ATOM   2750 O  O     . ILE C 3 269 ? 10.203  8.281  31.527  1.00 36.93  ? 269  ILE A O     1 
ATOM   2751 C  CB    . ILE C 3 269 ? 7.651   10.329 32.134  1.00 35.81  ? 269  ILE A CB    1 
ATOM   2752 C  CG1   . ILE C 3 269 ? 7.428   11.845 32.093  1.00 35.42  ? 269  ILE A CG1   1 
ATOM   2753 C  CG2   . ILE C 3 269 ? 8.317   9.891  33.442  1.00 34.02  ? 269  ILE A CG2   1 
ATOM   2754 C  CD1   . ILE C 3 269 ? 6.599   12.369 33.263  1.00 34.36  ? 269  ILE A CD1   1 
ATOM   2755 N  N     . GLU C 3 270 ? 8.163   7.491  30.980  1.00 39.32  ? 270  GLU A N     1 
ATOM   2756 C  CA    . GLU C 3 270 ? 8.559   6.104  31.170  1.00 41.36  ? 270  GLU A CA    1 
ATOM   2757 C  C     . GLU C 3 270 ? 9.785   5.795  30.314  1.00 41.32  ? 270  GLU A C     1 
ATOM   2758 O  O     . GLU C 3 270 ? 10.818  5.345  30.815  1.00 41.49  ? 270  GLU A O     1 
ATOM   2759 C  CB    . GLU C 3 270 ? 7.411   5.169  30.777  1.00 45.46  ? 270  GLU A CB    1 
ATOM   2760 C  CG    . GLU C 3 270 ? 6.307   5.043  31.819  1.00 49.33  ? 270  GLU A CG    1 
ATOM   2761 C  CD    . GLU C 3 270 ? 6.830   4.486  33.129  1.00 52.16  ? 270  GLU A CD    1 
ATOM   2762 O  OE1   . GLU C 3 270 ? 7.534   3.456  33.096  1.00 54.68  ? 270  GLU A OE1   1 
ATOM   2763 O  OE2   . GLU C 3 270 ? 6.539   5.072  34.193  1.00 54.55  ? 270  GLU A OE2   1 
ATOM   2764 N  N     . GLU C 3 271 ? 9.668   6.048  29.016  1.00 40.37  ? 271  GLU A N     1 
ATOM   2765 C  CA    . GLU C 3 271 ? 10.762  5.783  28.098  1.00 41.30  ? 271  GLU A CA    1 
ATOM   2766 C  C     . GLU C 3 271 ? 12.028  6.577  28.448  1.00 40.03  ? 271  GLU A C     1 
ATOM   2767 O  O     . GLU C 3 271 ? 13.145  6.051  28.373  1.00 39.34  ? 271  GLU A O     1 
ATOM   2768 C  CB    . GLU C 3 271 ? 10.293  6.064  26.672  1.00 45.43  ? 271  GLU A CB    1 
ATOM   2769 C  CG    . GLU C 3 271 ? 9.268   5.040  26.190  1.00 54.36  ? 271  GLU A CG    1 
ATOM   2770 C  CD    . GLU C 3 271 ? 8.566   5.458  24.912  1.00 59.00  ? 271  GLU A CD    1 
ATOM   2771 O  OE1   . GLU C 3 271 ? 9.240   6.024  24.023  1.00 61.47  ? 271  GLU A OE1   1 
ATOM   2772 O  OE2   . GLU C 3 271 ? 7.345   5.209  24.787  1.00 62.43  ? 271  GLU A OE2   1 
ATOM   2773 N  N     . SER C 3 272 ? 11.856  7.833  28.847  1.00 37.48  ? 272  SER A N     1 
ATOM   2774 C  CA    . SER C 3 272 ? 12.996  8.664  29.226  1.00 36.63  ? 272  SER A CA    1 
ATOM   2775 C  C     . SER C 3 272 ? 13.759  8.049  30.402  1.00 37.13  ? 272  SER A C     1 
ATOM   2776 O  O     . SER C 3 272 ? 14.990  7.961  30.382  1.00 36.37  ? 272  SER A O     1 
ATOM   2777 C  CB    . SER C 3 272 ? 12.527  10.061 29.626  1.00 33.63  ? 272  SER A CB    1 
ATOM   2778 O  OG    . SER C 3 272 ? 12.011  10.772 28.529  1.00 32.69  ? 272  SER A OG    1 
ATOM   2779 N  N     . TYR C 3 273 ? 13.022  7.639  31.433  1.00 38.01  ? 273  TYR A N     1 
ATOM   2780 C  CA    . TYR C 3 273 ? 13.635  7.041  32.610  1.00 40.15  ? 273  TYR A CA    1 
ATOM   2781 C  C     . TYR C 3 273 ? 14.365  5.760  32.308  1.00 41.68  ? 273  TYR A C     1 
ATOM   2782 O  O     . TYR C 3 273 ? 15.343  5.422  32.974  1.00 41.68  ? 273  TYR A O     1 
ATOM   2783 C  CB    . TYR C 3 273 ? 12.588  6.811  33.686  1.00 41.30  ? 273  TYR A CB    1 
ATOM   2784 C  CG    . TYR C 3 273 ? 12.632  7.918  34.683  1.00 42.89  ? 273  TYR A CG    1 
ATOM   2785 C  CD1   . TYR C 3 273 ? 13.346  7.783  35.878  1.00 42.90  ? 273  TYR A CD1   1 
ATOM   2786 C  CD2   . TYR C 3 273 ? 12.065  9.149  34.384  1.00 41.51  ? 273  TYR A CD2   1 
ATOM   2787 C  CE1   . TYR C 3 273 ? 13.493  8.866  36.747  1.00 42.95  ? 273  TYR A CE1   1 
ATOM   2788 C  CE2   . TYR C 3 273 ? 12.209  10.226 35.234  1.00 43.64  ? 273  TYR A CE2   1 
ATOM   2789 C  CZ    . TYR C 3 273 ? 12.921  10.085 36.409  1.00 42.85  ? 273  TYR A CZ    1 
ATOM   2790 O  OH    . TYR C 3 273 ? 13.053  11.192 37.214  1.00 45.49  ? 273  TYR A OH    1 
ATOM   2791 N  N     . TYR C 3 274 ? 13.883  5.038  31.307  1.00 43.82  ? 274  TYR A N     1 
ATOM   2792 C  CA    . TYR C 3 274 ? 14.535  3.809  30.896  1.00 46.10  ? 274  TYR A CA    1 
ATOM   2793 C  C     . TYR C 3 274 ? 15.893  4.222  30.317  1.00 46.33  ? 274  TYR A C     1 
ATOM   2794 O  O     . TYR C 3 274 ? 16.931  3.643  30.653  1.00 47.09  ? 274  TYR A O     1 
ATOM   2795 C  CB    . TYR C 3 274 ? 13.695  3.111  29.829  1.00 49.95  ? 274  TYR A CB    1 
ATOM   2796 C  CG    . TYR C 3 274 ? 14.409  1.986  29.117  1.00 54.17  ? 274  TYR A CG    1 
ATOM   2797 C  CD1   . TYR C 3 274 ? 14.651  0.771  29.756  1.00 56.36  ? 274  TYR A CD1   1 
ATOM   2798 C  CD2   . TYR C 3 274 ? 14.837  2.135  27.796  1.00 57.25  ? 274  TYR A CD2   1 
ATOM   2799 C  CE1   . TYR C 3 274 ? 15.301  -0.277 29.096  1.00 59.07  ? 274  TYR A CE1   1 
ATOM   2800 C  CE2   . TYR C 3 274 ? 15.490  1.097  27.125  1.00 59.91  ? 274  TYR A CE2   1 
ATOM   2801 C  CZ    . TYR C 3 274 ? 15.715  -0.104 27.782  1.00 60.67  ? 274  TYR A CZ    1 
ATOM   2802 O  OH    . TYR C 3 274 ? 16.342  -1.132 27.117  1.00 63.73  ? 274  TYR A OH    1 
ATOM   2803 N  N     . LYS C 3 275 ? 15.875  5.240  29.458  1.00 44.47  ? 275  LYS A N     1 
ATOM   2804 C  CA    . LYS C 3 275 ? 17.098  5.746  28.842  1.00 44.54  ? 275  LYS A CA    1 
ATOM   2805 C  C     . LYS C 3 275 ? 18.075  6.313  29.879  1.00 43.95  ? 275  LYS A C     1 
ATOM   2806 O  O     . LYS C 3 275 ? 19.287  6.134  29.761  1.00 42.91  ? 275  LYS A O     1 
ATOM   2807 C  CB    . LYS C 3 275 ? 16.777  6.851  27.832  1.00 44.24  ? 275  LYS A CB    1 
ATOM   2808 C  CG    . LYS C 3 275 ? 16.027  6.439  26.572  1.00 45.52  ? 275  LYS A CG    1 
ATOM   2809 C  CD    . LYS C 3 275 ? 15.882  7.682  25.683  1.00 46.97  ? 275  LYS A CD    1 
ATOM   2810 C  CE    . LYS C 3 275 ? 15.100  7.447  24.403  1.00 45.94  ? 275  LYS A CE    1 
ATOM   2811 N  NZ    . LYS C 3 275 ? 14.862  8.758  23.731  1.00 42.05  ? 275  LYS A NZ    1 
ATOM   2812 N  N     . LEU C 3 276 ? 17.551  7.011  30.882  1.00 44.03  ? 276  LEU A N     1 
ATOM   2813 C  CA    . LEU C 3 276 ? 18.402  7.599  31.915  1.00 45.58  ? 276  LEU A CA    1 
ATOM   2814 C  C     . LEU C 3 276 ? 19.373  6.572  32.478  1.00 47.64  ? 276  LEU A C     1 
ATOM   2815 O  O     . LEU C 3 276 ? 20.528  6.889  32.765  1.00 47.81  ? 276  LEU A O     1 
ATOM   2816 C  CB    . LEU C 3 276 ? 17.550  8.188  33.045  1.00 43.73  ? 276  LEU A CB    1 
ATOM   2817 C  CG    . LEU C 3 276 ? 16.786  9.476  32.708  1.00 43.21  ? 276  LEU A CG    1 
ATOM   2818 C  CD1   . LEU C 3 276 ? 15.881  9.873  33.871  1.00 44.74  ? 276  LEU A CD1   1 
ATOM   2819 C  CD2   . LEU C 3 276 ? 17.772  10.589 32.407  1.00 40.96  ? 276  LEU A CD2   1 
ATOM   2820 N  N     . ASP C 3 277 ? 18.890  5.345  32.641  1.00 49.94  ? 277  ASP A N     1 
ATOM   2821 C  CA    . ASP C 3 277 ? 19.699  4.236  33.140  1.00 53.14  ? 277  ASP A CA    1 
ATOM   2822 C  C     . ASP C 3 277 ? 20.805  4.621  34.140  1.00 53.59  ? 277  ASP A C     1 
ATOM   2823 O  O     . ASP C 3 277 ? 21.975  4.787  33.767  1.00 54.61  ? 277  ASP A O     1 
ATOM   2824 C  CB    . ASP C 3 277 ? 20.300  3.493  31.938  1.00 56.32  ? 277  ASP A CB    1 
ATOM   2825 C  CG    . ASP C 3 277 ? 21.207  2.349  32.343  1.00 59.92  ? 277  ASP A CG    1 
ATOM   2826 O  OD1   . ASP C 3 277 ? 20.793  1.539  33.206  1.00 61.44  ? 277  ASP A OD1   1 
ATOM   2827 O  OD2   . ASP C 3 277 ? 22.328  2.262  31.784  1.00 61.03  ? 277  ASP A OD2   1 
ATOM   2828 N  N     . LYS C 3 278 ? 20.418  4.760  35.406  1.00 51.51  ? 278  LYS A N     1 
ATOM   2829 C  CA    . LYS C 3 278 ? 21.338  5.100  36.492  1.00 52.14  ? 278  LYS A CA    1 
ATOM   2830 C  C     . LYS C 3 278 ? 21.636  6.582  36.687  1.00 50.20  ? 278  LYS A C     1 
ATOM   2831 O  O     . LYS C 3 278 ? 22.032  6.993  37.777  1.00 51.27  ? 278  LYS A O     1 
ATOM   2832 C  CB    . LYS C 3 278 ? 22.658  4.333  36.345  1.00 55.59  ? 278  LYS A CB    1 
ATOM   2833 C  CG    . LYS C 3 278 ? 22.472  2.823  36.256  1.00 59.78  ? 278  LYS A CG    1 
ATOM   2834 C  CD    . LYS C 3 278 ? 21.542  2.313  37.359  1.00 62.76  ? 278  LYS A CD    1 
ATOM   2835 C  CE    . LYS C 3 278 ? 21.151  0.857  37.135  1.00 64.62  ? 278  LYS A CE    1 
ATOM   2836 N  NZ    . LYS C 3 278 ? 20.174  0.401  38.166  1.00 65.11  ? 278  LYS A NZ    1 
ATOM   2837 N  N     . ARG C 3 279 ? 21.463  7.387  35.644  1.00 48.05  ? 279  ARG A N     1 
ATOM   2838 C  CA    . ARG C 3 279 ? 21.702  8.822  35.772  1.00 44.26  ? 279  ARG A CA    1 
ATOM   2839 C  C     . ARG C 3 279 ? 20.487  9.444  36.434  1.00 41.85  ? 279  ARG A C     1 
ATOM   2840 O  O     . ARG C 3 279 ? 19.356  9.139  36.070  1.00 42.25  ? 279  ARG A O     1 
ATOM   2841 C  CB    . ARG C 3 279 ? 21.947  9.448  34.401  1.00 42.68  ? 279  ARG A CB    1 
ATOM   2842 C  CG    . ARG C 3 279 ? 23.341  9.169  33.879  1.00 43.57  ? 279  ARG A CG    1 
ATOM   2843 C  CD    . ARG C 3 279 ? 23.460  9.485  32.411  1.00 42.56  ? 279  ARG A CD    1 
ATOM   2844 N  NE    . ARG C 3 279 ? 22.581  8.621  31.634  1.00 47.84  ? 279  ARG A NE    1 
ATOM   2845 C  CZ    . ARG C 3 279 ? 22.720  8.393  30.333  1.00 49.50  ? 279  ARG A CZ    1 
ATOM   2846 N  NH1   . ARG C 3 279 ? 23.709  8.966  29.656  1.00 50.60  ? 279  ARG A NH1   1 
ATOM   2847 N  NH2   . ARG C 3 279 ? 21.872  7.586  29.707  1.00 50.80  ? 279  ARG A NH2   1 
ATOM   2848 N  N     . ILE C 3 280 ? 20.721  10.304 37.416  1.00 39.52  ? 280  ILE A N     1 
ATOM   2849 C  CA    . ILE C 3 280 ? 19.627  10.944 38.123  1.00 37.73  ? 280  ILE A CA    1 
ATOM   2850 C  C     . ILE C 3 280 ? 19.606  12.421 37.760  1.00 36.76  ? 280  ILE A C     1 
ATOM   2851 O  O     . ILE C 3 280 ? 20.538  13.155 38.071  1.00 36.57  ? 280  ILE A O     1 
ATOM   2852 C  CB    . ILE C 3 280 ? 19.795  10.804 39.656  1.00 38.99  ? 280  ILE A CB    1 
ATOM   2853 C  CG1   . ILE C 3 280 ? 20.230  9.377  40.014  1.00 39.79  ? 280  ILE A CG1   1 
ATOM   2854 C  CG2   . ILE C 3 280 ? 18.481  11.137 40.358  1.00 38.83  ? 280  ILE A CG2   1 
ATOM   2855 C  CD1   . ILE C 3 280 ? 19.228  8.305  39.624  1.00 39.92  ? 280  ILE A CD1   1 
ATOM   2856 N  N     . PRO C 3 281 ? 18.535  12.877 37.093  1.00 34.61  ? 281  PRO A N     1 
ATOM   2857 C  CA    . PRO C 3 281 ? 18.444  14.282 36.705  1.00 33.78  ? 281  PRO A CA    1 
ATOM   2858 C  C     . PRO C 3 281 ? 17.913  15.165 37.823  1.00 34.57  ? 281  PRO A C     1 
ATOM   2859 O  O     . PRO C 3 281 ? 17.094  14.720 38.635  1.00 33.46  ? 281  PRO A O     1 
ATOM   2860 C  CB    . PRO C 3 281 ? 17.484  14.236 35.531  1.00 31.38  ? 281  PRO A CB    1 
ATOM   2861 C  CG    . PRO C 3 281 ? 16.512  13.228 35.982  1.00 31.58  ? 281  PRO A CG    1 
ATOM   2862 C  CD    . PRO C 3 281 ? 17.401  12.119 36.540  1.00 32.89  ? 281  PRO A CD    1 
ATOM   2863 N  N     . LYS C 3 282 ? 18.383  16.411 37.861  1.00 34.32  ? 282  LYS A N     1 
ATOM   2864 C  CA    . LYS C 3 282 ? 17.923  17.373 38.857  1.00 34.82  ? 282  LYS A CA    1 
ATOM   2865 C  C     . LYS C 3 282 ? 16.971  18.358 38.190  1.00 33.80  ? 282  LYS A C     1 
ATOM   2866 O  O     . LYS C 3 282 ? 16.271  19.103 38.868  1.00 33.13  ? 282  LYS A O     1 
ATOM   2867 C  CB    . LYS C 3 282 ? 19.092  18.138 39.485  1.00 37.13  ? 282  LYS A CB    1 
ATOM   2868 C  CG    . LYS C 3 282 ? 19.954  17.301 40.421  1.00 41.51  ? 282  LYS A CG    1 
ATOM   2869 C  CD    . LYS C 3 282 ? 20.848  18.188 41.282  1.00 44.00  ? 282  LYS A CD    1 
ATOM   2870 C  CE    . LYS C 3 282 ? 21.777  19.040 40.420  1.00 48.16  ? 282  LYS A CE    1 
ATOM   2871 N  NZ    . LYS C 3 282 ? 22.603  18.193 39.506  1.00 49.37  ? 282  LYS A NZ    1 
ATOM   2872 N  N     . ALA C 3 283 ? 16.942  18.348 36.857  1.00 31.77  ? 283  ALA A N     1 
ATOM   2873 C  CA    . ALA C 3 283 ? 16.056  19.239 36.104  1.00 31.19  ? 283  ALA A CA    1 
ATOM   2874 C  C     . ALA C 3 283 ? 15.141  18.497 35.129  1.00 31.53  ? 283  ALA A C     1 
ATOM   2875 O  O     . ALA C 3 283 ? 15.519  17.472 34.553  1.00 30.61  ? 283  ALA A O     1 
ATOM   2876 C  CB    . ALA C 3 283 ? 16.872  20.272 35.341  1.00 29.98  ? 283  ALA A CB    1 
ATOM   2877 N  N     . ILE C 3 284 ? 13.935  19.030 34.943  1.00 31.14  ? 284  ILE A N     1 
ATOM   2878 C  CA    . ILE C 3 284 ? 12.959  18.437 34.032  1.00 30.68  ? 284  ILE A CA    1 
ATOM   2879 C  C     . ILE C 3 284 ? 12.283  19.538 33.214  1.00 31.38  ? 284  ILE A C     1 
ATOM   2880 O  O     . ILE C 3 284 ? 11.975  20.606 33.747  1.00 32.03  ? 284  ILE A O     1 
ATOM   2881 C  CB    . ILE C 3 284 ? 11.873  17.634 34.808  1.00 31.39  ? 284  ILE A CB    1 
ATOM   2882 C  CG1   . ILE C 3 284 ? 10.792  17.148 33.835  1.00 33.30  ? 284  ILE A CG1   1 
ATOM   2883 C  CG2   . ILE C 3 284 ? 11.236  18.504 35.876  1.00 28.29  ? 284  ILE A CG2   1 
ATOM   2884 C  CD1   . ILE C 3 284 ? 9.752   16.213 34.446  1.00 32.09  ? 284  ILE A CD1   1 
ATOM   2885 N  N     . HIS C 3 285 ? 12.075  19.280 31.924  1.00 30.00  ? 285  HIS A N     1 
ATOM   2886 C  CA    . HIS C 3 285 ? 11.437  20.233 31.031  1.00 31.81  ? 285  HIS A CA    1 
ATOM   2887 C  C     . HIS C 3 285 ? 10.364  19.515 30.252  1.00 32.23  ? 285  HIS A C     1 
ATOM   2888 O  O     . HIS C 3 285 ? 10.585  18.415 29.726  1.00 31.48  ? 285  HIS A O     1 
ATOM   2889 C  CB    . HIS C 3 285 ? 12.449  20.835 30.035  1.00 32.61  ? 285  HIS A CB    1 
ATOM   2890 C  CG    . HIS C 3 285 ? 13.380  21.830 30.650  1.00 36.80  ? 285  HIS A CG    1 
ATOM   2891 N  ND1   . HIS C 3 285 ? 13.206  23.192 30.517  1.00 36.51  ? 285  HIS A ND1   1 
ATOM   2892 C  CD2   . HIS C 3 285 ? 14.483  21.666 31.421  1.00 35.52  ? 285  HIS A CD2   1 
ATOM   2893 C  CE1   . HIS C 3 285 ? 14.162  23.824 31.175  1.00 36.33  ? 285  HIS A CE1   1 
ATOM   2894 N  NE2   . HIS C 3 285 ? 14.950  22.920 31.731  1.00 38.75  ? 285  HIS A NE2   1 
ATOM   2895 N  N     . VAL C 3 286 ? 9.187   20.113 30.198  1.00 31.46  ? 286  VAL A N     1 
ATOM   2896 C  CA    . VAL C 3 286 ? 8.130   19.521 29.395  1.00 30.95  ? 286  VAL A CA    1 
ATOM   2897 C  C     . VAL C 3 286 ? 8.127   20.299 28.108  1.00 31.11  ? 286  VAL A C     1 
ATOM   2898 O  O     . VAL C 3 286 ? 8.055   21.526 28.134  1.00 30.63  ? 286  VAL A O     1 
ATOM   2899 C  CB    . VAL C 3 286 ? 6.719   19.633 30.069  1.00 29.33  ? 286  VAL A CB    1 
ATOM   2900 C  CG1   . VAL C 3 286 ? 5.620   19.227 29.064  1.00 26.10  ? 286  VAL A CG1   1 
ATOM   2901 C  CG2   . VAL C 3 286 ? 6.598   18.719 31.264  1.00 27.34  ? 286  VAL A CG2   1 
ATOM   2902 N  N     . VAL C 3 287 ? 8.193   19.580 26.987  1.00 31.83  ? 287  VAL A N     1 
ATOM   2903 C  CA    . VAL C 3 287 ? 8.247   20.214 25.691  1.00 31.50  ? 287  VAL A CA    1 
ATOM   2904 C  C     . VAL C 3 287 ? 7.022   19.879 24.880  1.00 33.30  ? 287  VAL A C     1 
ATOM   2905 O  O     . VAL C 3 287 ? 6.617   18.701 24.774  1.00 32.25  ? 287  VAL A O     1 
ATOM   2906 C  CB    . VAL C 3 287 ? 9.501   19.774 24.948  1.00 31.17  ? 287  VAL A CB    1 
ATOM   2907 C  CG1   . VAL C 3 287 ? 9.541   20.361 23.556  1.00 32.46  ? 287  VAL A CG1   1 
ATOM   2908 C  CG2   . VAL C 3 287 ? 10.717  20.202 25.742  1.00 32.31  ? 287  VAL A CG2   1 
ATOM   2909 N  N     . ALA C 3 288 ? 6.407   20.922 24.346  1.00 33.45  ? 288  ALA A N     1 
ATOM   2910 C  CA    . ALA C 3 288 ? 5.219   20.755 23.567  1.00 36.42  ? 288  ALA A CA    1 
ATOM   2911 C  C     . ALA C 3 288 ? 5.423   21.472 22.249  1.00 37.86  ? 288  ALA A C     1 
ATOM   2912 O  O     . ALA C 3 288 ? 6.076   22.496 22.157  1.00 37.17  ? 288  ALA A O     1 
ATOM   2913 C  CB    . ALA C 3 288 ? 4.035   21.354 24.311  1.00 36.55  ? 288  ALA A CB    1 
ATOM   2914 N  N     . VAL C 3 289 ? 4.891   20.860 21.207  1.00 39.15  ? 289  VAL A N     1 
ATOM   2915 C  CA    . VAL C 3 289 ? 4.899   21.440 19.891  1.00 40.34  ? 289  VAL A CA    1 
ATOM   2916 C  C     . VAL C 3 289 ? 3.461   21.725 19.586  1.00 43.09  ? 289  VAL A C     1 
ATOM   2917 O  O     . VAL C 3 289 ? 2.635   20.838 19.699  1.00 41.70  ? 289  VAL A O     1 
ATOM   2918 C  CB    . VAL C 3 289 ? 5.457   20.475 18.852  1.00 41.50  ? 289  VAL A CB    1 
ATOM   2919 C  CG1   . VAL C 3 289 ? 5.226   21.063 17.463  1.00 40.52  ? 289  VAL A CG1   1 
ATOM   2920 C  CG2   . VAL C 3 289 ? 6.930   20.265 19.065  1.00 40.56  ? 289  VAL A CG2   1 
ATOM   2921 N  N     . THR C 3 290 ? 3.162   22.981 19.256  1.00 45.52  ? 290  THR A N     1 
ATOM   2922 C  CA    . THR C 3 290 ? 1.807   23.391 18.971  1.00 48.13  ? 290  THR A CA    1 
ATOM   2923 C  C     . THR C 3 290 ? 1.393   23.021 17.561  1.00 49.70  ? 290  THR A C     1 
ATOM   2924 O  O     . THR C 3 290 ? 2.230   22.700 16.711  1.00 50.53  ? 290  THR A O     1 
ATOM   2925 C  CB    . THR C 3 290 ? 1.674   24.899 19.181  1.00 49.01  ? 290  THR A CB    1 
ATOM   2926 O  OG1   . THR C 3 290 ? 2.638   25.584 18.357  1.00 50.42  ? 290  THR A OG1   1 
ATOM   2927 C  CG2   . THR C 3 290 ? 1.961   25.220 20.635  1.00 47.42  ? 290  THR A CG2   1 
ATOM   2928 N  N     . GLU C 3 291 ? 0.086   23.045 17.340  1.00 52.51  ? 291  GLU A N     1 
ATOM   2929 C  CA    . GLU C 3 291 ? -0.504  22.729 16.063  1.00 54.71  ? 291  GLU A CA    1 
ATOM   2930 C  C     . GLU C 3 291 ? 0.196   23.464 14.922  1.00 54.85  ? 291  GLU A C     1 
ATOM   2931 O  O     . GLU C 3 291 ? 0.349   22.917 13.835  1.00 55.19  ? 291  GLU A O     1 
ATOM   2932 C  CB    . GLU C 3 291 ? -1.994  23.072 16.124  1.00 56.87  ? 291  GLU A CB    1 
ATOM   2933 C  CG    . GLU C 3 291 ? -2.302  24.371 16.882  1.00 61.55  ? 291  GLU A CG    1 
ATOM   2934 C  CD    . GLU C 3 291 ? -3.796  24.646 17.014  1.00 63.44  ? 291  GLU A CD    1 
ATOM   2935 O  OE1   . GLU C 3 291 ? -4.172  25.580 17.764  1.00 62.84  ? 291  GLU A OE1   1 
ATOM   2936 O  OE2   . GLU C 3 291 ? -4.591  23.930 16.364  1.00 65.89  ? 291  GLU A OE2   1 
ATOM   2937 N  N     . ASP C 3 292 ? 0.639   24.694 15.170  1.00 54.92  ? 292  ASP A N     1 
ATOM   2938 C  CA    . ASP C 3 292 ? 1.311   25.474 14.126  1.00 55.07  ? 292  ASP A CA    1 
ATOM   2939 C  C     . ASP C 3 292 ? 2.816   25.177 14.087  1.00 54.13  ? 292  ASP A C     1 
ATOM   2940 O  O     . ASP C 3 292 ? 3.609   25.893 13.485  1.00 53.79  ? 292  ASP A O     1 
ATOM   2941 C  CB    . ASP C 3 292 ? 1.053   26.967 14.325  1.00 56.99  ? 292  ASP A CB    1 
ATOM   2942 C  CG    . ASP C 3 292 ? 1.478   27.458 15.683  1.00 57.92  ? 292  ASP A CG    1 
ATOM   2943 O  OD1   . ASP C 3 292 ? 1.215   26.758 16.682  1.00 59.32  ? 292  ASP A OD1   1 
ATOM   2944 O  OD2   . ASP C 3 292 ? 2.057   28.560 15.743  1.00 59.34  ? 292  ASP A OD2   1 
ATOM   2945 N  N     . LEU C 3 293 ? 3.176   24.069 14.723  1.00 52.40  ? 293  LEU A N     1 
ATOM   2946 C  CA    . LEU C 3 293 ? 4.563   23.584 14.804  1.00 51.97  ? 293  LEU A CA    1 
ATOM   2947 C  C     . LEU C 3 293 ? 5.608   24.444 15.596  1.00 52.07  ? 293  LEU A C     1 
ATOM   2948 O  O     . LEU C 3 293 ? 6.838   24.291 15.393  1.00 51.96  ? 293  LEU A O     1 
ATOM   2949 C  CB    . LEU C 3 293 ? 5.068   23.334 13.399  1.00 51.25  ? 293  LEU A CB    1 
ATOM   2950 C  CG    . LEU C 3 293 ? 4.132   22.412 12.623  1.00 51.74  ? 293  LEU A CG    1 
ATOM   2951 C  CD1   . LEU C 3 293 ? 4.686   22.241 11.221  1.00 52.76  ? 293  LEU A CD1   1 
ATOM   2952 C  CD2   . LEU C 3 293 ? 3.984   21.055 13.301  1.00 50.98  ? 293  LEU A CD2   1 
ATOM   2953 N  N     . ASP C 3 294 ? 5.146   25.285 16.519  1.00 52.06  ? 294  ASP A N     1 
ATOM   2954 C  CA    . ASP C 3 294 ? 6.022   26.088 17.347  1.00 53.43  ? 294  ASP A CA    1 
ATOM   2955 C  C     . ASP C 3 294 ? 6.357   25.211 18.560  1.00 51.62  ? 294  ASP A C     1 
ATOM   2956 O  O     . ASP C 3 294 ? 5.541   24.382 18.976  1.00 51.36  ? 294  ASP A O     1 
ATOM   2957 C  CB    . ASP C 3 294 ? 5.241   27.318 17.773  1.00 56.47  ? 294  ASP A CB    1 
ATOM   2958 C  CG    . ASP C 3 294 ? 5.759   28.600 17.139  1.00 60.80  ? 294  ASP A CG    1 
ATOM   2959 O  OD1   . ASP C 3 294 ? 6.495   28.498 16.139  1.00 63.20  ? 294  ASP A OD1   1 
ATOM   2960 O  OD2   . ASP C 3 294 ? 5.428   29.711 17.637  1.00 63.27  ? 294  ASP A OD2   1 
ATOM   2961 N  N     . ILE C 3 295 ? 7.540   25.422 19.125  1.00 50.07  ? 295  ILE A N     1 
ATOM   2962 C  CA    . ILE C 3 295 ? 7.993   24.676 20.286  1.00 47.32  ? 295  ILE A CA    1 
ATOM   2963 C  C     . ILE C 3 295 ? 7.917   25.546 21.534  1.00 47.01  ? 295  ILE A C     1 
ATOM   2964 O  O     . ILE C 3 295 ? 8.529   26.610 21.588  1.00 48.53  ? 295  ILE A O     1 
ATOM   2965 C  CB    . ILE C 3 295 ? 9.445   24.223 20.101  1.00 46.91  ? 295  ILE A CB    1 
ATOM   2966 C  CG1   . ILE C 3 295 ? 9.569   23.368 18.837  1.00 46.09  ? 295  ILE A CG1   1 
ATOM   2967 C  CG2   . ILE C 3 295 ? 9.909   23.461 21.325  1.00 44.52  ? 295  ILE A CG2   1 
ATOM   2968 C  CD1   . ILE C 3 295 ? 10.989  22.960 18.529  1.00 47.67  ? 295  ILE A CD1   1 
ATOM   2969 N  N     . VAL C 3 296 ? 7.162   25.093 22.530  1.00 44.35  ? 296  VAL A N     1 
ATOM   2970 C  CA    . VAL C 3 296 ? 7.020   25.822 23.786  1.00 42.23  ? 296  VAL A CA    1 
ATOM   2971 C  C     . VAL C 3 296 ? 7.435   24.880 24.917  1.00 41.30  ? 296  VAL A C     1 
ATOM   2972 O  O     . VAL C 3 296 ? 7.262   23.667 24.814  1.00 40.64  ? 296  VAL A O     1 
ATOM   2973 C  CB    . VAL C 3 296 ? 5.557   26.276 24.016  1.00 41.94  ? 296  VAL A CB    1 
ATOM   2974 C  CG1   . VAL C 3 296 ? 5.438   27.032 25.331  1.00 43.05  ? 296  VAL A CG1   1 
ATOM   2975 C  CG2   . VAL C 3 296 ? 5.116   27.171 22.884  1.00 42.43  ? 296  VAL A CG2   1 
ATOM   2976 N  N     . SER C 3 297 ? 7.991   25.420 25.994  1.00 37.80  ? 297  SER A N     1 
ATOM   2977 C  CA    . SER C 3 297 ? 8.393   24.550 27.079  1.00 36.67  ? 297  SER A CA    1 
ATOM   2978 C  C     . SER C 3 297 ? 8.463   25.222 28.444  1.00 35.56  ? 297  SER A C     1 
ATOM   2979 O  O     . SER C 3 297 ? 8.593   26.439 28.562  1.00 34.17  ? 297  SER A O     1 
ATOM   2980 C  CB    . SER C 3 297 ? 9.739   23.904 26.755  1.00 37.49  ? 297  SER A CB    1 
ATOM   2981 O  OG    . SER C 3 297 ? 10.772  24.860 26.817  1.00 37.48  ? 297  SER A OG    1 
ATOM   2982 N  N     . ARG C 3 298 ? 8.383   24.396 29.477  1.00 34.39  ? 298  ARG A N     1 
ATOM   2983 C  CA    . ARG C 3 298 ? 8.426   24.866 30.847  1.00 35.59  ? 298  ARG A CA    1 
ATOM   2984 C  C     . ARG C 3 298 ? 9.216   23.844 31.625  1.00 35.27  ? 298  ARG A C     1 
ATOM   2985 O  O     . ARG C 3 298 ? 9.000   22.642 31.479  1.00 34.21  ? 298  ARG A O     1 
ATOM   2986 C  CB    . ARG C 3 298 ? 7.005   24.987 31.411  1.00 36.39  ? 298  ARG A CB    1 
ATOM   2987 C  CG    . ARG C 3 298 ? 6.192   26.105 30.786  1.00 35.88  ? 298  ARG A CG    1 
ATOM   2988 C  CD    . ARG C 3 298 ? 6.872   27.456 31.008  1.00 38.92  ? 298  ARG A CD    1 
ATOM   2989 N  NE    . ARG C 3 298 ? 6.074   28.555 30.473  1.00 41.53  ? 298  ARG A NE    1 
ATOM   2990 C  CZ    . ARG C 3 298 ? 5.927   28.835 29.181  1.00 41.77  ? 298  ARG A CZ    1 
ATOM   2991 N  NH1   . ARG C 3 298 ? 6.533   28.104 28.263  1.00 41.42  ? 298  ARG A NH1   1 
ATOM   2992 N  NH2   . ARG C 3 298 ? 5.152   29.841 28.804  1.00 43.44  ? 298  ARG A NH2   1 
ATOM   2993 N  N     . GLY C 3 299 ? 10.140  24.315 32.451  1.00 34.42  ? 299  GLY A N     1 
ATOM   2994 C  CA    . GLY C 3 299 ? 10.943  23.380 33.198  1.00 35.00  ? 299  GLY A CA    1 
ATOM   2995 C  C     . GLY C 3 299 ? 11.209  23.796 34.615  1.00 36.39  ? 299  GLY A C     1 
ATOM   2996 O  O     . GLY C 3 299 ? 10.860  24.898 35.035  1.00 37.52  ? 299  GLY A O     1 
ATOM   2997 N  N     . ARG C 3 300 ? 11.851  22.908 35.356  1.00 37.43  ? 300  ARG A N     1 
ATOM   2998 C  CA    . ARG C 3 300 ? 12.159  23.196 36.735  1.00 39.11  ? 300  ARG A CA    1 
ATOM   2999 C  C     . ARG C 3 300 ? 13.382  22.426 37.203  1.00 38.04  ? 300  ARG A C     1 
ATOM   3000 O  O     . ARG C 3 300 ? 13.572  21.262 36.842  1.00 35.58  ? 300  ARG A O     1 
ATOM   3001 C  CB    . ARG C 3 300 ? 10.958  22.843 37.617  1.00 42.62  ? 300  ARG A CB    1 
ATOM   3002 C  CG    . ARG C 3 300 ? 11.150  23.239 39.076  1.00 49.63  ? 300  ARG A CG    1 
ATOM   3003 C  CD    . ARG C 3 300 ? 10.018  22.753 39.961  1.00 54.24  ? 300  ARG A CD    1 
ATOM   3004 N  NE    . ARG C 3 300 ? 10.268  23.087 41.360  1.00 58.05  ? 300  ARG A NE    1 
ATOM   3005 C  CZ    . ARG C 3 300 ? 9.576   22.591 42.380  1.00 60.76  ? 300  ARG A CZ    1 
ATOM   3006 N  NH1   . ARG C 3 300 ? 8.588   21.734 42.162  1.00 62.08  ? 300  ARG A NH1   1 
ATOM   3007 N  NH2   . ARG C 3 300 ? 9.870   22.951 43.622  1.00 62.16  ? 300  ARG A NH2   1 
ATOM   3008 N  N     . THR C 3 301 ? 14.216  23.093 37.995  1.00 38.07  ? 301  THR A N     1 
ATOM   3009 C  CA    . THR C 3 301 ? 15.402  22.470 38.562  1.00 39.48  ? 301  THR A CA    1 
ATOM   3010 C  C     . THR C 3 301 ? 15.151  22.283 40.059  1.00 40.97  ? 301  THR A C     1 
ATOM   3011 O  O     . THR C 3 301 ? 14.636  23.184 40.725  1.00 41.16  ? 301  THR A O     1 
ATOM   3012 C  CB    . THR C 3 301 ? 16.652  23.342 38.347  1.00 40.12  ? 301  THR A CB    1 
ATOM   3013 O  OG1   . THR C 3 301 ? 16.962  23.378 36.950  1.00 41.81  ? 301  THR A OG1   1 
ATOM   3014 C  CG2   . THR C 3 301 ? 17.860  22.769 39.109  1.00 39.88  ? 301  THR A CG2   1 
ATOM   3015 N  N     . PHE C 3 302 ? 15.487  21.105 40.574  1.00 40.59  ? 302  PHE A N     1 
ATOM   3016 C  CA    . PHE C 3 302 ? 15.304  20.798 41.989  1.00 42.65  ? 302  PHE A CA    1 
ATOM   3017 C  C     . PHE C 3 302 ? 16.660  20.726 42.663  1.00 42.86  ? 302  PHE A C     1 
ATOM   3018 O  O     . PHE C 3 302 ? 17.667  20.470 42.011  1.00 41.84  ? 302  PHE A O     1 
ATOM   3019 C  CB    . PHE C 3 302 ? 14.619  19.436 42.183  1.00 43.75  ? 302  PHE A CB    1 
ATOM   3020 C  CG    . PHE C 3 302 ? 13.204  19.381 41.681  1.00 47.30  ? 302  PHE A CG    1 
ATOM   3021 C  CD1   . PHE C 3 302 ? 12.926  19.424 40.318  1.00 45.78  ? 302  PHE A CD1   1 
ATOM   3022 C  CD2   . PHE C 3 302 ? 12.142  19.284 42.579  1.00 47.71  ? 302  PHE A CD2   1 
ATOM   3023 C  CE1   . PHE C 3 302 ? 11.611  19.369 39.857  1.00 47.12  ? 302  PHE A CE1   1 
ATOM   3024 C  CE2   . PHE C 3 302 ? 10.824  19.230 42.124  1.00 49.02  ? 302  PHE A CE2   1 
ATOM   3025 C  CZ    . PHE C 3 302 ? 10.561  19.272 40.761  1.00 47.19  ? 302  PHE A CZ    1 
ATOM   3026 N  N     . PRO C 3 303 ? 16.702  20.947 43.984  1.00 43.79  ? 303  PRO A N     1 
ATOM   3027 C  CA    . PRO C 3 303 ? 17.968  20.885 44.713  1.00 43.97  ? 303  PRO A CA    1 
ATOM   3028 C  C     . PRO C 3 303 ? 18.375  19.425 44.952  1.00 44.78  ? 303  PRO A C     1 
ATOM   3029 O  O     . PRO C 3 303 ? 19.374  19.145 45.615  1.00 45.64  ? 303  PRO A O     1 
ATOM   3030 C  CB    . PRO C 3 303 ? 17.646  21.626 46.002  1.00 43.54  ? 303  PRO A CB    1 
ATOM   3031 C  CG    . PRO C 3 303 ? 16.227  21.232 46.239  1.00 45.64  ? 303  PRO A CG    1 
ATOM   3032 C  CD    . PRO C 3 303 ? 15.627  21.439 44.862  1.00 44.26  ? 303  PRO A CD    1 
ATOM   3033 N  N     . HIS C 3 304 ? 17.594  18.497 44.406  1.00 42.15  ? 304  HIS A N     1 
ATOM   3034 C  CA    . HIS C 3 304 ? 17.882  17.078 44.560  1.00 41.78  ? 304  HIS A CA    1 
ATOM   3035 C  C     . HIS C 3 304 ? 17.450  16.326 43.304  1.00 40.63  ? 304  HIS A C     1 
ATOM   3036 O  O     . HIS C 3 304 ? 16.728  16.869 42.467  1.00 40.38  ? 304  HIS A O     1 
ATOM   3037 C  CB    . HIS C 3 304 ? 17.134  16.517 45.777  1.00 42.99  ? 304  HIS A CB    1 
ATOM   3038 C  CG    . HIS C 3 304 ? 15.652  16.724 45.719  1.00 43.77  ? 304  HIS A CG    1 
ATOM   3039 N  ND1   . HIS C 3 304 ? 15.004  17.690 46.460  1.00 44.36  ? 304  HIS A ND1   1 
ATOM   3040 C  CD2   . HIS C 3 304 ? 14.699  16.132 44.960  1.00 43.08  ? 304  HIS A CD2   1 
ATOM   3041 C  CE1   . HIS C 3 304 ? 13.717  17.688 46.157  1.00 45.07  ? 304  HIS A CE1   1 
ATOM   3042 N  NE2   . HIS C 3 304 ? 13.506  16.753 45.248  1.00 44.46  ? 304  HIS A NE2   1 
ATOM   3043 N  N     . GLY C 3 305 ? 17.878  15.073 43.182  1.00 39.31  ? 305  GLY A N     1 
ATOM   3044 C  CA    . GLY C 3 305 ? 17.510  14.282 42.020  1.00 37.77  ? 305  GLY A CA    1 
ATOM   3045 C  C     . GLY C 3 305 ? 16.012  14.082 41.945  1.00 37.09  ? 305  GLY A C     1 
ATOM   3046 O  O     . GLY C 3 305 ? 15.334  14.105 42.972  1.00 37.56  ? 305  GLY A O     1 
ATOM   3047 N  N     . ILE C 3 306 ? 15.496  13.866 40.737  1.00 36.01  ? 306  ILE A N     1 
ATOM   3048 C  CA    . ILE C 3 306 ? 14.064  13.680 40.523  1.00 33.66  ? 306  ILE A CA    1 
ATOM   3049 C  C     . ILE C 3 306 ? 13.690  12.216 40.368  1.00 33.84  ? 306  ILE A C     1 
ATOM   3050 O  O     . ILE C 3 306 ? 14.155  11.559 39.448  1.00 34.27  ? 306  ILE A O     1 
ATOM   3051 C  CB    . ILE C 3 306 ? 13.609  14.414 39.250  1.00 33.48  ? 306  ILE A CB    1 
ATOM   3052 C  CG1   . ILE C 3 306 ? 13.880  15.912 39.379  1.00 31.94  ? 306  ILE A CG1   1 
ATOM   3053 C  CG2   . ILE C 3 306 ? 12.137  14.140 38.987  1.00 31.79  ? 306  ILE A CG2   1 
ATOM   3054 C  CD1   . ILE C 3 306 ? 13.699  16.679 38.058  1.00 32.49  ? 306  ILE A CD1   1 
ATOM   3055 N  N     . SER C 3 307 ? 12.848  11.697 41.259  1.00 35.10  ? 307  SER A N     1 
ATOM   3056 C  CA    . SER C 3 307 ? 12.428  10.297 41.166  1.00 34.79  ? 307  SER A CA    1 
ATOM   3057 C  C     . SER C 3 307 ? 11.384  10.196 40.065  1.00 34.42  ? 307  SER A C     1 
ATOM   3058 O  O     . SER C 3 307 ? 10.794  11.204 39.671  1.00 35.88  ? 307  SER A O     1 
ATOM   3059 C  CB    . SER C 3 307 ? 11.821  9.815  42.488  1.00 33.68  ? 307  SER A CB    1 
ATOM   3060 O  OG    . SER C 3 307 ? 10.635  10.535 42.772  1.00 33.14  ? 307  SER A OG    1 
ATOM   3061 N  N     . LYS C 3 308 ? 11.141  8.990  39.565  1.00 36.98  ? 308  LYS A N     1 
ATOM   3062 C  CA    . LYS C 3 308 ? 10.154  8.848  38.501  1.00 37.90  ? 308  LYS A CA    1 
ATOM   3063 C  C     . LYS C 3 308 ? 8.818   9.416  38.963  1.00 36.86  ? 308  LYS A C     1 
ATOM   3064 O  O     . LYS C 3 308 ? 8.146   10.129 38.218  1.00 37.37  ? 308  LYS A O     1 
ATOM   3065 C  CB    . LYS C 3 308 ? 9.980   7.380  38.090  1.00 39.21  ? 308  LYS A CB    1 
ATOM   3066 C  CG    . LYS C 3 308 ? 9.214   7.231  36.764  1.00 43.19  ? 308  LYS A CG    1 
ATOM   3067 C  CD    . LYS C 3 308 ? 8.630   5.836  36.545  1.00 46.04  ? 308  LYS A CD    1 
ATOM   3068 C  CE    . LYS C 3 308 ? 9.697   4.765  36.452  1.00 47.32  ? 308  LYS A CE    1 
ATOM   3069 N  NZ    . LYS C 3 308 ? 9.089   3.477  36.013  1.00 50.46  ? 308  LYS A NZ    1 
ATOM   3070 N  N     . GLU C 3 309 ? 8.436   9.103  40.199  1.00 37.17  ? 309  GLU A N     1 
ATOM   3071 C  CA    . GLU C 3 309 ? 7.175   9.594  40.752  1.00 36.89  ? 309  GLU A CA    1 
ATOM   3072 C  C     . GLU C 3 309 ? 7.162   11.116 40.757  1.00 36.00  ? 309  GLU A C     1 
ATOM   3073 O  O     . GLU C 3 309 ? 6.156   11.738 40.405  1.00 35.53  ? 309  GLU A O     1 
ATOM   3074 C  CB    . GLU C 3 309 ? 6.958   9.089  42.188  1.00 39.50  ? 309  GLU A CB    1 
ATOM   3075 C  CG    . GLU C 3 309 ? 6.780   7.574  42.351  1.00 44.40  ? 309  GLU A CG    1 
ATOM   3076 C  CD    . GLU C 3 309 ? 8.038   6.758  42.027  1.00 50.02  ? 309  GLU A CD    1 
ATOM   3077 O  OE1   . GLU C 3 309 ? 9.172   7.197  42.350  1.00 49.47  ? 309  GLU A OE1   1 
ATOM   3078 O  OE2   . GLU C 3 309 ? 7.885   5.654  41.461  1.00 52.63  ? 309  GLU A OE2   1 
ATOM   3079 N  N     . THR C 3 310 ? 8.267   11.733 41.172  1.00 34.89  ? 310  THR A N     1 
ATOM   3080 C  CA    . THR C 3 310 ? 8.304   13.192 41.177  1.00 35.56  ? 310  THR A CA    1 
ATOM   3081 C  C     . THR C 3 310 ? 8.211   13.707 39.734  1.00 33.76  ? 310  THR A C     1 
ATOM   3082 O  O     . THR C 3 310 ? 7.605   14.753 39.465  1.00 32.50  ? 310  THR A O     1 
ATOM   3083 C  CB    . THR C 3 310 ? 9.589   13.730 41.830  1.00 35.93  ? 310  THR A CB    1 
ATOM   3084 O  OG1   . THR C 3 310 ? 9.674   13.261 43.183  1.00 36.19  ? 310  THR A OG1   1 
ATOM   3085 C  CG2   . THR C 3 310 ? 9.572   15.246 41.832  1.00 33.97  ? 310  THR A CG2   1 
ATOM   3086 N  N     . ALA C 3 311 ? 8.805   12.963 38.805  1.00 33.54  ? 311  ALA A N     1 
ATOM   3087 C  CA    . ALA C 3 311 ? 8.759   13.356 37.397  1.00 34.50  ? 311  ALA A CA    1 
ATOM   3088 C  C     . ALA C 3 311 ? 7.313   13.406 36.888  1.00 34.78  ? 311  ALA A C     1 
ATOM   3089 O  O     . ALA C 3 311 ? 6.935   14.320 36.154  1.00 33.82  ? 311  ALA A O     1 
ATOM   3090 C  CB    . ALA C 3 311 ? 9.586   12.383 36.550  1.00 33.79  ? 311  ALA A CB    1 
ATOM   3091 N  N     . TYR C 3 312 ? 6.509   12.417 37.275  1.00 35.11  ? 312  TYR A N     1 
ATOM   3092 C  CA    . TYR C 3 312 ? 5.108   12.367 36.863  1.00 36.49  ? 312  TYR A CA    1 
ATOM   3093 C  C     . TYR C 3 312 ? 4.355   13.583 37.366  1.00 37.29  ? 312  TYR A C     1 
ATOM   3094 O  O     . TYR C 3 312 ? 3.834   14.374 36.580  1.00 39.38  ? 312  TYR A O     1 
ATOM   3095 C  CB    . TYR C 3 312 ? 4.430   11.118 37.423  1.00 38.58  ? 312  TYR A CB    1 
ATOM   3096 C  CG    . TYR C 3 312 ? 4.478   9.912  36.517  1.00 40.53  ? 312  TYR A CG    1 
ATOM   3097 C  CD1   . TYR C 3 312 ? 3.394   9.589  35.706  1.00 44.67  ? 312  TYR A CD1   1 
ATOM   3098 C  CD2   . TYR C 3 312 ? 5.591   9.086  36.486  1.00 42.23  ? 312  TYR A CD2   1 
ATOM   3099 C  CE1   . TYR C 3 312 ? 3.420   8.461  34.887  1.00 47.68  ? 312  TYR A CE1   1 
ATOM   3100 C  CE2   . TYR C 3 312 ? 5.634   7.958  35.671  1.00 44.96  ? 312  TYR A CE2   1 
ATOM   3101 C  CZ    . TYR C 3 312 ? 4.545   7.647  34.875  1.00 47.23  ? 312  TYR A CZ    1 
ATOM   3102 O  OH    . TYR C 3 312 ? 4.566   6.521  34.077  1.00 46.46  ? 312  TYR A OH    1 
ATOM   3103 N  N     . SER C 3 313 ? 4.300   13.735 38.684  1.00 37.20  ? 313  SER A N     1 
ATOM   3104 C  CA    . SER C 3 313 ? 3.583   14.850 39.280  1.00 37.96  ? 313  SER A CA    1 
ATOM   3105 C  C     . SER C 3 313 ? 4.056   16.206 38.778  1.00 37.32  ? 313  SER A C     1 
ATOM   3106 O  O     . SER C 3 313 ? 3.246   17.059 38.419  1.00 35.81  ? 313  SER A O     1 
ATOM   3107 C  CB    . SER C 3 313 ? 3.682   14.783 40.808  1.00 40.05  ? 313  SER A CB    1 
ATOM   3108 O  OG    . SER C 3 313 ? 5.012   14.534 41.227  1.00 44.38  ? 313  SER A OG    1 
ATOM   3109 N  N     . GLU C 3 314 ? 5.367   16.406 38.731  1.00 37.67  ? 314  GLU A N     1 
ATOM   3110 C  CA    . GLU C 3 314 ? 5.891   17.691 38.287  1.00 37.21  ? 314  GLU A CA    1 
ATOM   3111 C  C     . GLU C 3 314 ? 5.630   17.970 36.802  1.00 36.12  ? 314  GLU A C     1 
ATOM   3112 O  O     . GLU C 3 314 ? 5.346   19.116 36.419  1.00 33.39  ? 314  GLU A O     1 
ATOM   3113 C  CB    . GLU C 3 314 ? 7.388   17.779 38.591  1.00 40.11  ? 314  GLU A CB    1 
ATOM   3114 C  CG    . GLU C 3 314 ? 7.959   19.168 38.361  1.00 43.98  ? 314  GLU A CG    1 
ATOM   3115 C  CD    . GLU C 3 314 ? 7.299   20.223 39.240  1.00 47.75  ? 314  GLU A CD    1 
ATOM   3116 O  OE1   . GLU C 3 314 ? 7.283   21.402 38.827  1.00 49.36  ? 314  GLU A OE1   1 
ATOM   3117 O  OE2   . GLU C 3 314 ? 6.806   19.873 40.342  1.00 48.02  ? 314  GLU A OE2   1 
ATOM   3118 N  N     . SER C 3 315 ? 5.712   16.936 35.964  1.00 35.31  ? 315  SER A N     1 
ATOM   3119 C  CA    . SER C 3 315 ? 5.472   17.131 34.529  1.00 35.72  ? 315  SER A CA    1 
ATOM   3120 C  C     . SER C 3 315 ? 4.061   17.673 34.290  1.00 35.09  ? 315  SER A C     1 
ATOM   3121 O  O     . SER C 3 315 ? 3.854   18.523 33.420  1.00 34.88  ? 315  SER A O     1 
ATOM   3122 C  CB    . SER C 3 315 ? 5.681   15.821 33.752  1.00 34.96  ? 315  SER A CB    1 
ATOM   3123 O  OG    . SER C 3 315 ? 4.758   14.817 34.145  1.00 36.28  ? 315  SER A OG    1 
ATOM   3124 N  N     . VAL C 3 316 ? 3.095   17.198 35.076  1.00 35.12  ? 316  VAL A N     1 
ATOM   3125 C  CA    . VAL C 3 316 ? 1.709   17.657 34.950  1.00 33.86  ? 316  VAL A CA    1 
ATOM   3126 C  C     . VAL C 3 316 ? 1.619   19.155 35.257  1.00 34.41  ? 316  VAL A C     1 
ATOM   3127 O  O     . VAL C 3 316 ? 1.011   19.918 34.505  1.00 35.95  ? 316  VAL A O     1 
ATOM   3128 C  CB    . VAL C 3 316 ? 0.764   16.867 35.908  1.00 34.00  ? 316  VAL A CB    1 
ATOM   3129 C  CG1   . VAL C 3 316 ? -0.652  17.412 35.828  1.00 31.95  ? 316  VAL A CG1   1 
ATOM   3130 C  CG2   . VAL C 3 316 ? 0.763   15.397 35.534  1.00 32.19  ? 316  VAL A CG2   1 
ATOM   3131 N  N     . LYS C 3 317 ? 2.227   19.584 36.360  1.00 35.98  ? 317  LYS A N     1 
ATOM   3132 C  CA    . LYS C 3 317 ? 2.213   21.006 36.712  1.00 36.18  ? 317  LYS A CA    1 
ATOM   3133 C  C     . LYS C 3 317 ? 2.818   21.832 35.578  1.00 36.18  ? 317  LYS A C     1 
ATOM   3134 O  O     . LYS C 3 317 ? 2.293   22.887 35.210  1.00 37.67  ? 317  LYS A O     1 
ATOM   3135 C  CB    . LYS C 3 317 ? 3.026   21.252 37.977  1.00 37.31  ? 317  LYS A CB    1 
ATOM   3136 C  CG    . LYS C 3 317 ? 2.540   20.499 39.187  1.00 42.44  ? 317  LYS A CG    1 
ATOM   3137 C  CD    . LYS C 3 317 ? 3.357   20.895 40.394  1.00 45.61  ? 317  LYS A CD    1 
ATOM   3138 C  CE    . LYS C 3 317 ? 3.094   19.955 41.542  1.00 49.20  ? 317  LYS A CE    1 
ATOM   3139 N  NZ    . LYS C 3 317 ? 3.855   20.343 42.763  1.00 51.67  ? 317  LYS A NZ    1 
ATOM   3140 N  N     . LEU C 3 318 ? 3.929   21.348 35.025  1.00 34.32  ? 318  LEU A N     1 
ATOM   3141 C  CA    . LEU C 3 318 ? 4.593   22.050 33.935  1.00 32.91  ? 318  LEU A CA    1 
ATOM   3142 C  C     . LEU C 3 318 ? 3.721   22.092 32.670  1.00 33.04  ? 318  LEU A C     1 
ATOM   3143 O  O     . LEU C 3 318 ? 3.657   23.116 31.996  1.00 31.84  ? 318  LEU A O     1 
ATOM   3144 C  CB    . LEU C 3 318 ? 5.967   21.414 33.663  1.00 29.72  ? 318  LEU A CB    1 
ATOM   3145 C  CG    . LEU C 3 318 ? 7.010   21.681 34.767  1.00 32.09  ? 318  LEU A CG    1 
ATOM   3146 C  CD1   . LEU C 3 318 ? 8.278   20.859 34.520  1.00 29.93  ? 318  LEU A CD1   1 
ATOM   3147 C  CD2   . LEU C 3 318 ? 7.350   23.175 34.813  1.00 29.55  ? 318  LEU A CD2   1 
ATOM   3148 N  N     . LEU C 3 319 ? 3.045   20.994 32.344  1.00 33.60  ? 319  LEU A N     1 
ATOM   3149 C  CA    . LEU C 3 319 ? 2.162   20.993 31.176  1.00 34.76  ? 319  LEU A CA    1 
ATOM   3150 C  C     . LEU C 3 319 ? 1.040   22.003 31.419  1.00 36.22  ? 319  LEU A C     1 
ATOM   3151 O  O     . LEU C 3 319 ? 0.648   22.762 30.524  1.00 36.45  ? 319  LEU A O     1 
ATOM   3152 C  CB    . LEU C 3 319 ? 1.548   19.604 30.961  1.00 35.36  ? 319  LEU A CB    1 
ATOM   3153 C  CG    . LEU C 3 319 ? 0.466   19.497 29.873  1.00 36.01  ? 319  LEU A CG    1 
ATOM   3154 C  CD1   . LEU C 3 319 ? 0.996   20.014 28.545  1.00 32.72  ? 319  LEU A CD1   1 
ATOM   3155 C  CD2   . LEU C 3 319 ? 0.027   18.038 29.741  1.00 36.03  ? 319  LEU A CD2   1 
ATOM   3156 N  N     . GLN C 3 320 ? 0.516   21.993 32.642  1.00 38.64  ? 320  GLN A N     1 
ATOM   3157 C  CA    . GLN C 3 320 ? -0.549  22.905 33.018  1.00 40.69  ? 320  GLN A CA    1 
ATOM   3158 C  C     . GLN C 3 320 ? -0.106  24.330 32.794  1.00 41.36  ? 320  GLN A C     1 
ATOM   3159 O  O     . GLN C 3 320 ? -0.867  25.149 32.275  1.00 41.84  ? 320  GLN A O     1 
ATOM   3160 C  CB    . GLN C 3 320 ? -0.937  22.696 34.480  1.00 44.94  ? 320  GLN A CB    1 
ATOM   3161 C  CG    . GLN C 3 320 ? -1.845  21.506 34.678  1.00 49.08  ? 320  GLN A CG    1 
ATOM   3162 C  CD    . GLN C 3 320 ? -2.631  21.590 35.961  1.00 53.54  ? 320  GLN A CD    1 
ATOM   3163 O  OE1   . GLN C 3 320 ? -2.096  21.382 37.055  1.00 54.92  ? 320  GLN A OE1   1 
ATOM   3164 N  NE2   . GLN C 3 320 ? -3.917  21.916 35.837  1.00 55.60  ? 320  GLN A NE2   1 
ATOM   3165 N  N     . LYS C 3 321 ? 1.133   24.625 33.170  1.00 40.67  ? 321  LYS A N     1 
ATOM   3166 C  CA    . LYS C 3 321 ? 1.667   25.959 32.974  1.00 42.43  ? 321  LYS A CA    1 
ATOM   3167 C  C     . LYS C 3 321 ? 1.563   26.281 31.481  1.00 42.57  ? 321  LYS A C     1 
ATOM   3168 O  O     . LYS C 3 321 ? 1.045   27.332 31.106  1.00 42.56  ? 321  LYS A O     1 
ATOM   3169 C  CB    . LYS C 3 321 ? 3.123   26.019 33.450  1.00 44.69  ? 321  LYS A CB    1 
ATOM   3170 C  CG    . LYS C 3 321 ? 3.627   27.429 33.710  1.00 46.58  ? 321  LYS A CG    1 
ATOM   3171 C  CD    . LYS C 3 321 ? 5.015   27.439 34.358  1.00 49.35  ? 321  LYS A CD    1 
ATOM   3172 C  CE    . LYS C 3 321 ? 5.013   26.783 35.738  1.00 49.84  ? 321  LYS A CE    1 
ATOM   3173 N  NZ    . LYS C 3 321 ? 6.356   26.867 36.409  1.00 49.99  ? 321  LYS A NZ    1 
ATOM   3174 N  N     . ILE C 3 322 ? 2.035   25.366 30.632  1.00 42.89  ? 322  ILE A N     1 
ATOM   3175 C  CA    . ILE C 3 322 ? 1.975   25.555 29.179  1.00 41.75  ? 322  ILE A CA    1 
ATOM   3176 C  C     . ILE C 3 322 ? 0.549   25.852 28.727  1.00 43.93  ? 322  ILE A C     1 
ATOM   3177 O  O     . ILE C 3 322 ? 0.309   26.800 27.980  1.00 43.85  ? 322  ILE A O     1 
ATOM   3178 C  CB    . ILE C 3 322 ? 2.450   24.293 28.409  1.00 40.53  ? 322  ILE A CB    1 
ATOM   3179 C  CG1   . ILE C 3 322 ? 3.956   24.104 28.577  1.00 39.34  ? 322  ILE A CG1   1 
ATOM   3180 C  CG2   . ILE C 3 322 ? 2.094   24.414 26.925  1.00 39.02  ? 322  ILE A CG2   1 
ATOM   3181 C  CD1   . ILE C 3 322 ? 4.508   22.922 27.813  1.00 39.06  ? 322  ILE A CD1   1 
ATOM   3182 N  N     . LEU C 3 323 ? -0.393  25.026 29.171  1.00 46.17  ? 323  LEU A N     1 
ATOM   3183 C  CA    . LEU C 3 323 ? -1.794  25.200 28.809  1.00 49.08  ? 323  LEU A CA    1 
ATOM   3184 C  C     . LEU C 3 323 ? -2.339  26.550 29.265  1.00 50.53  ? 323  LEU A C     1 
ATOM   3185 O  O     . LEU C 3 323 ? -2.984  27.256 28.497  1.00 51.61  ? 323  LEU A O     1 
ATOM   3186 C  CB    . LEU C 3 323 ? -2.632  24.066 29.409  1.00 47.34  ? 323  LEU A CB    1 
ATOM   3187 C  CG    . LEU C 3 323 ? -3.035  22.880 28.519  1.00 48.31  ? 323  LEU A CG    1 
ATOM   3188 C  CD1   . LEU C 3 323 ? -2.320  22.911 27.183  1.00 46.27  ? 323  LEU A CD1   1 
ATOM   3189 C  CD2   . LEU C 3 323 ? -2.743  21.584 29.265  1.00 46.35  ? 323  LEU A CD2   1 
ATOM   3190 N  N     . GLU C 3 324 ? -2.073  26.909 30.515  1.00 52.59  ? 324  GLU A N     1 
ATOM   3191 C  CA    . GLU C 3 324 ? -2.542  28.176 31.061  1.00 55.57  ? 324  GLU A CA    1 
ATOM   3192 C  C     . GLU C 3 324 ? -1.912  29.396 30.384  1.00 57.93  ? 324  GLU A C     1 
ATOM   3193 O  O     . GLU C 3 324 ? -2.502  30.477 30.364  1.00 58.55  ? 324  GLU A O     1 
ATOM   3194 C  CB    . GLU C 3 324 ? -2.237  28.244 32.557  1.00 56.60  ? 324  GLU A CB    1 
ATOM   3195 C  CG    . GLU C 3 324 ? -2.909  27.182 33.408  1.00 59.54  ? 324  GLU A CG    1 
ATOM   3196 C  CD    . GLU C 3 324 ? -2.374  27.179 34.835  1.00 61.99  ? 324  GLU A CD    1 
ATOM   3197 O  OE1   . GLU C 3 324 ? -2.911  26.434 35.683  1.00 63.26  ? 324  GLU A OE1   1 
ATOM   3198 O  OE2   . GLU C 3 324 ? -1.406  27.926 35.106  1.00 63.36  ? 324  GLU A OE2   1 
ATOM   3199 N  N     . GLU C 3 325 ? -0.717  29.233 29.828  1.00 59.28  ? 325  GLU A N     1 
ATOM   3200 C  CA    . GLU C 3 325 ? -0.037  30.362 29.207  1.00 61.00  ? 325  GLU A CA    1 
ATOM   3201 C  C     . GLU C 3 325 ? -0.087  30.413 27.688  1.00 61.69  ? 325  GLU A C     1 
ATOM   3202 O  O     . GLU C 3 325 ? 0.183   31.455 27.095  1.00 62.60  ? 325  GLU A O     1 
ATOM   3203 C  CB    . GLU C 3 325 ? 1.412   30.414 29.701  1.00 61.50  ? 325  GLU A CB    1 
ATOM   3204 C  CG    . GLU C 3 325 ? 1.522   30.899 31.141  1.00 62.89  ? 325  GLU A CG    1 
ATOM   3205 C  CD    . GLU C 3 325 ? 2.821   30.500 31.816  1.00 64.15  ? 325  GLU A CD    1 
ATOM   3206 O  OE1   . GLU C 3 325 ? 3.906   30.692 31.220  1.00 64.21  ? 325  GLU A OE1   1 
ATOM   3207 O  OE2   . GLU C 3 325 ? 2.753   30.000 32.959  1.00 64.55  ? 325  GLU A OE2   1 
ATOM   3208 N  N     . ASP C 3 326 ? -0.431  29.299 27.055  1.00 62.47  ? 326  ASP A N     1 
ATOM   3209 C  CA    . ASP C 3 326 ? -0.526  29.262 25.600  1.00 63.63  ? 326  ASP A CA    1 
ATOM   3210 C  C     . ASP C 3 326 ? -1.909  28.709 25.247  1.00 65.20  ? 326  ASP A C     1 
ATOM   3211 O  O     . ASP C 3 326 ? -2.341  27.691 25.799  1.00 65.02  ? 326  ASP A O     1 
ATOM   3212 C  CB    . ASP C 3 326 ? 0.583   28.383 25.016  1.00 62.98  ? 326  ASP A CB    1 
ATOM   3213 C  CG    . ASP C 3 326 ? 0.763   28.586 23.527  1.00 63.38  ? 326  ASP A CG    1 
ATOM   3214 O  OD1   . ASP C 3 326 ? -0.188  28.297 22.773  1.00 64.23  ? 326  ASP A OD1   1 
ATOM   3215 O  OD2   . ASP C 3 326 ? 1.852   29.039 23.111  1.00 61.94  ? 326  ASP A OD2   1 
ATOM   3216 N  N     . GLU C 3 327 ? -2.609  29.384 24.340  1.00 64.94  ? 327  GLU A N     1 
ATOM   3217 C  CA    . GLU C 3 327 ? -3.951  28.961 23.969  1.00 65.68  ? 327  GLU A CA    1 
ATOM   3218 C  C     . GLU C 3 327 ? -4.017  27.923 22.847  1.00 63.77  ? 327  GLU A C     1 
ATOM   3219 O  O     . GLU C 3 327 ? -5.014  27.212 22.713  1.00 63.38  ? 327  GLU A O     1 
ATOM   3220 C  CB    . GLU C 3 327 ? -4.786  30.190 23.600  1.00 68.71  ? 327  GLU A CB    1 
ATOM   3221 C  CG    . GLU C 3 327 ? -4.309  30.919 22.356  1.00 73.27  ? 327  GLU A CG    1 
ATOM   3222 C  CD    . GLU C 3 327 ? -5.015  32.250 22.147  1.00 76.31  ? 327  GLU A CD    1 
ATOM   3223 O  OE1   . GLU C 3 327 ? -6.257  32.299 22.288  1.00 77.90  ? 327  GLU A OE1   1 
ATOM   3224 O  OE2   . GLU C 3 327 ? -4.328  33.249 21.834  1.00 78.10  ? 327  GLU A OE2   1 
ATOM   3225 N  N     . ARG C 3 328 ? -2.957  27.826 22.052  1.00 61.73  ? 328  ARG A N     1 
ATOM   3226 C  CA    . ARG C 3 328 ? -2.919  26.873 20.942  1.00 59.71  ? 328  ARG A CA    1 
ATOM   3227 C  C     . ARG C 3 328 ? -3.104  25.422 21.370  1.00 58.79  ? 328  ARG A C     1 
ATOM   3228 O  O     . ARG C 3 328 ? -3.025  25.095 22.550  1.00 59.69  ? 328  ARG A O     1 
ATOM   3229 C  CB    . ARG C 3 328 ? -1.593  27.004 20.186  1.00 59.37  ? 328  ARG A CB    1 
ATOM   3230 C  CG    . ARG C 3 328 ? -1.469  28.271 19.373  1.00 58.39  ? 328  ARG A CG    1 
ATOM   3231 C  CD    . ARG C 3 328 ? -0.073  28.426 18.798  1.00 59.16  ? 328  ARG A CD    1 
ATOM   3232 N  NE    . ARG C 3 328 ? 0.921   28.681 19.835  1.00 58.67  ? 328  ARG A NE    1 
ATOM   3233 C  CZ    . ARG C 3 328 ? 2.201   28.933 19.593  1.00 58.50  ? 328  ARG A CZ    1 
ATOM   3234 N  NH1   . ARG C 3 328 ? 2.646   28.961 18.346  1.00 59.27  ? 328  ARG A NH1   1 
ATOM   3235 N  NH2   . ARG C 3 328 ? 3.036   29.171 20.594  1.00 58.74  ? 328  ARG A NH2   1 
ATOM   3236 N  N     . LYS C 3 329 ? -3.361  24.552 20.398  1.00 57.82  ? 329  LYS A N     1 
ATOM   3237 C  CA    . LYS C 3 329 ? -3.524  23.125 20.669  1.00 55.42  ? 329  LYS A CA    1 
ATOM   3238 C  C     . LYS C 3 329 ? -2.158  22.455 20.555  1.00 52.61  ? 329  LYS A C     1 
ATOM   3239 O  O     . LYS C 3 329 ? -1.313  22.890 19.774  1.00 52.55  ? 329  LYS A O     1 
ATOM   3240 C  CB    . LYS C 3 329 ? -4.475  22.479 19.659  1.00 57.34  ? 329  LYS A CB    1 
ATOM   3241 C  CG    . LYS C 3 329 ? -5.930  22.851 19.832  1.00 59.11  ? 329  LYS A CG    1 
ATOM   3242 C  CD    . LYS C 3 329 ? -6.786  22.050 18.865  1.00 60.68  ? 329  LYS A CD    1 
ATOM   3243 C  CE    . LYS C 3 329 ? -8.259  22.396 18.996  1.00 60.25  ? 329  LYS A CE    1 
ATOM   3244 N  NZ    . LYS C 3 329 ? -9.058  21.573 18.056  1.00 60.32  ? 329  LYS A NZ    1 
ATOM   3245 N  N     . ILE C 3 330 ? -1.941  21.396 21.327  1.00 49.51  ? 330  ILE A N     1 
ATOM   3246 C  CA    . ILE C 3 330 ? -0.667  20.692 21.287  1.00 46.62  ? 330  ILE A CA    1 
ATOM   3247 C  C     . ILE C 3 330 ? -0.702  19.550 20.266  1.00 44.95  ? 330  ILE A C     1 
ATOM   3248 O  O     . ILE C 3 330 ? -1.707  18.849 20.143  1.00 44.10  ? 330  ILE A O     1 
ATOM   3249 C  CB    . ILE C 3 330 ? -0.296  20.167 22.694  1.00 46.23  ? 330  ILE A CB    1 
ATOM   3250 C  CG1   . ILE C 3 330 ? -0.182  21.358 23.653  1.00 46.48  ? 330  ILE A CG1   1 
ATOM   3251 C  CG2   . ILE C 3 330 ? 1.040   19.410 22.652  1.00 45.28  ? 330  ILE A CG2   1 
ATOM   3252 C  CD1   . ILE C 3 330 ? 0.148   20.991 25.086  1.00 46.97  ? 330  ILE A CD1   1 
ATOM   3253 N  N     . ARG C 3 331 ? 0.398   19.386 19.530  1.00 42.51  ? 331  ARG A N     1 
ATOM   3254 C  CA    . ARG C 3 331 ? 0.518   18.352 18.495  1.00 42.14  ? 331  ARG A CA    1 
ATOM   3255 C  C     . ARG C 3 331 ? 1.444   17.227 18.930  1.00 41.25  ? 331  ARG A C     1 
ATOM   3256 O  O     . ARG C 3 331 ? 1.193   16.051 18.657  1.00 42.29  ? 331  ARG A O     1 
ATOM   3257 C  CB    . ARG C 3 331 ? 1.048   18.980 17.201  1.00 43.87  ? 331  ARG A CB    1 
ATOM   3258 C  CG    . ARG C 3 331 ? 1.399   18.013 16.070  1.00 45.78  ? 331  ARG A CG    1 
ATOM   3259 C  CD    . ARG C 3 331 ? 2.087   18.795 14.949  1.00 49.31  ? 331  ARG A CD    1 
ATOM   3260 N  NE    . ARG C 3 331 ? 2.707   17.964 13.916  1.00 50.33  ? 331  ARG A NE    1 
ATOM   3261 C  CZ    . ARG C 3 331 ? 2.062   17.450 12.873  1.00 50.73  ? 331  ARG A CZ    1 
ATOM   3262 N  NH1   . ARG C 3 331 ? 0.767   17.675 12.715  1.00 51.11  ? 331  ARG A NH1   1 
ATOM   3263 N  NH2   . ARG C 3 331 ? 2.718   16.724 11.977  1.00 50.69  ? 331  ARG A NH2   1 
ATOM   3264 N  N     . ARG C 3 332 ? 2.522   17.600 19.607  1.00 39.40  ? 332  ARG A N     1 
ATOM   3265 C  CA    . ARG C 3 332 ? 3.500   16.638 20.090  1.00 38.42  ? 332  ARG A CA    1 
ATOM   3266 C  C     . ARG C 3 332 ? 3.812   17.032 21.522  1.00 36.76  ? 332  ARG A C     1 
ATOM   3267 O  O     . ARG C 3 332 ? 3.909   18.218 21.831  1.00 38.17  ? 332  ARG A O     1 
ATOM   3268 C  CB    . ARG C 3 332 ? 4.768   16.709 19.235  1.00 39.07  ? 332  ARG A CB    1 
ATOM   3269 C  CG    . ARG C 3 332 ? 4.536   16.428 17.752  1.00 42.78  ? 332  ARG A CG    1 
ATOM   3270 C  CD    . ARG C 3 332 ? 5.796   16.654 16.931  1.00 45.23  ? 332  ARG A CD    1 
ATOM   3271 N  NE    . ARG C 3 332 ? 6.941   16.148 17.656  1.00 52.08  ? 332  ARG A NE    1 
ATOM   3272 C  CZ    . ARG C 3 332 ? 8.199   16.395 17.334  1.00 53.90  ? 332  ARG A CZ    1 
ATOM   3273 N  NH1   . ARG C 3 332 ? 8.487   17.149 16.275  1.00 56.53  ? 332  ARG A NH1   1 
ATOM   3274 N  NH2   . ARG C 3 332 ? 9.159   15.904 18.098  1.00 56.41  ? 332  ARG A NH2   1 
ATOM   3275 N  N     . ILE C 3 333 ? 3.956   16.053 22.403  1.00 34.41  ? 333  ILE A N     1 
ATOM   3276 C  CA    . ILE C 3 333 ? 4.249   16.356 23.795  1.00 32.58  ? 333  ILE A CA    1 
ATOM   3277 C  C     . ILE C 3 333 ? 5.414   15.494 24.239  1.00 31.03  ? 333  ILE A C     1 
ATOM   3278 O  O     . ILE C 3 333 ? 5.566   14.357 23.792  1.00 32.64  ? 333  ILE A O     1 
ATOM   3279 C  CB    . ILE C 3 333 ? 3.028   16.074 24.698  1.00 31.49  ? 333  ILE A CB    1 
ATOM   3280 C  CG1   . ILE C 3 333 ? 3.303   16.553 26.125  1.00 31.80  ? 333  ILE A CG1   1 
ATOM   3281 C  CG2   . ILE C 3 333 ? 2.715   14.590 24.692  1.00 32.78  ? 333  ILE A CG2   1 
ATOM   3282 C  CD1   . ILE C 3 333 ? 3.464   18.051 26.245  1.00 30.91  ? 333  ILE A CD1   1 
ATOM   3283 N  N     . GLY C 3 334 ? 6.245   16.025 25.119  1.00 28.58  ? 334  GLY A N     1 
ATOM   3284 C  CA    . GLY C 3 334 ? 7.374   15.242 25.563  1.00 29.22  ? 334  GLY A CA    1 
ATOM   3285 C  C     . GLY C 3 334 ? 8.049   15.819 26.781  1.00 30.63  ? 334  GLY A C     1 
ATOM   3286 O  O     . GLY C 3 334 ? 7.614   16.828 27.344  1.00 27.97  ? 334  GLY A O     1 
ATOM   3287 N  N     . VAL C 3 335 ? 9.145   15.190 27.173  1.00 31.49  ? 335  VAL A N     1 
ATOM   3288 C  CA    . VAL C 3 335 ? 9.871   15.629 28.349  1.00 33.13  ? 335  VAL A CA    1 
ATOM   3289 C  C     . VAL C 3 335 ? 11.384  15.533 28.103  1.00 33.28  ? 335  VAL A C     1 
ATOM   3290 O  O     . VAL C 3 335 ? 11.842  14.791 27.225  1.00 32.51  ? 335  VAL A O     1 
ATOM   3291 C  CB    . VAL C 3 335 ? 9.424   14.748 29.567  1.00 33.92  ? 335  VAL A CB    1 
ATOM   3292 C  CG1   . VAL C 3 335 ? 9.712   13.267 29.275  1.00 34.75  ? 335  VAL A CG1   1 
ATOM   3293 C  CG2   . VAL C 3 335 ? 10.105  15.199 30.843  1.00 36.30  ? 335  VAL A CG2   1 
ATOM   3294 N  N     . ARG C 3 336 ? 12.164  16.299 28.856  1.00 31.39  ? 336  ARG A N     1 
ATOM   3295 C  CA    . ARG C 3 336 ? 13.613  16.241 28.721  1.00 32.01  ? 336  ARG A CA    1 
ATOM   3296 C  C     . ARG C 3 336 ? 14.258  16.417 30.090  1.00 32.18  ? 336  ARG A C     1 
ATOM   3297 O  O     . ARG C 3 336 ? 13.913  17.327 30.843  1.00 31.72  ? 336  ARG A O     1 
ATOM   3298 C  CB    . ARG C 3 336 ? 14.106  17.312 27.747  1.00 36.22  ? 336  ARG A CB    1 
ATOM   3299 C  CG    . ARG C 3 336 ? 15.614  17.344 27.602  1.00 40.36  ? 336  ARG A CG    1 
ATOM   3300 C  CD    . ARG C 3 336 ? 16.039  17.722 26.187  1.00 45.90  ? 336  ARG A CD    1 
ATOM   3301 N  NE    . ARG C 3 336 ? 17.070  16.796 25.723  1.00 51.84  ? 336  ARG A NE    1 
ATOM   3302 C  CZ    . ARG C 3 336 ? 16.845  15.677 25.037  1.00 51.88  ? 336  ARG A CZ    1 
ATOM   3303 N  NH1   . ARG C 3 336 ? 15.613  15.318 24.695  1.00 51.36  ? 336  ARG A NH1   1 
ATOM   3304 N  NH2   . ARG C 3 336 ? 17.865  14.888 24.728  1.00 53.05  ? 336  ARG A NH2   1 
ATOM   3305 N  N     . PHE C 3 337 ? 15.192  15.533 30.414  1.00 31.87  ? 337  PHE A N     1 
ATOM   3306 C  CA    . PHE C 3 337 ? 15.855  15.578 31.702  1.00 31.43  ? 337  PHE A CA    1 
ATOM   3307 C  C     . PHE C 3 337 ? 17.303  16.028 31.589  1.00 32.66  ? 337  PHE A C     1 
ATOM   3308 O  O     . PHE C 3 337 ? 17.997  15.674 30.629  1.00 30.99  ? 337  PHE A O     1 
ATOM   3309 C  CB    . PHE C 3 337 ? 15.773  14.198 32.348  1.00 31.88  ? 337  PHE A CB    1 
ATOM   3310 C  CG    . PHE C 3 337 ? 14.380  13.796 32.720  1.00 33.83  ? 337  PHE A CG    1 
ATOM   3311 C  CD1   . PHE C 3 337 ? 13.782  14.303 33.871  1.00 33.54  ? 337  PHE A CD1   1 
ATOM   3312 C  CD2   . PHE C 3 337 ? 13.649  12.930 31.908  1.00 34.74  ? 337  PHE A CD2   1 
ATOM   3313 C  CE1   . PHE C 3 337 ? 12.474  13.955 34.211  1.00 36.91  ? 337  PHE A CE1   1 
ATOM   3314 C  CE2   . PHE C 3 337 ? 12.333  12.572 32.241  1.00 36.68  ? 337  PHE A CE2   1 
ATOM   3315 C  CZ    . PHE C 3 337 ? 11.746  13.086 33.392  1.00 35.09  ? 337  PHE A CZ    1 
ATOM   3316 N  N     . SER C 3 338 ? 17.764  16.795 32.575  1.00 30.45  ? 338  SER A N     1 
ATOM   3317 C  CA    . SER C 3 338 ? 19.130  17.287 32.547  1.00 31.03  ? 338  SER A CA    1 
ATOM   3318 C  C     . SER C 3 338 ? 19.695  17.566 33.937  1.00 32.80  ? 338  SER A C     1 
ATOM   3319 O  O     . SER C 3 338 ? 19.048  17.271 34.951  1.00 30.11  ? 338  SER A O     1 
ATOM   3320 C  CB    . SER C 3 338 ? 19.210  18.553 31.696  1.00 29.14  ? 338  SER A CB    1 
ATOM   3321 O  OG    . SER C 3 338 ? 18.373  19.546 32.234  1.00 32.37  ? 338  SER A OG    1 
ATOM   3322 N  N     . LYS C 3 339 ? 20.904  18.133 33.958  1.00 31.47  ? 339  LYS A N     1 
ATOM   3323 C  CA    . LYS C 3 339 ? 21.626  18.446 35.186  1.00 34.20  ? 339  LYS A CA    1 
ATOM   3324 C  C     . LYS C 3 339 ? 21.735  17.181 36.028  1.00 36.46  ? 339  LYS A C     1 
ATOM   3325 O  O     . LYS C 3 339 ? 21.256  17.109 37.163  1.00 34.32  ? 339  LYS A O     1 
ATOM   3326 C  CB    . LYS C 3 339 ? 20.918  19.565 35.954  1.00 34.60  ? 339  LYS A CB    1 
ATOM   3327 C  CG    . LYS C 3 339 ? 20.801  20.848 35.142  1.00 37.78  ? 339  LYS A CG    1 
ATOM   3328 C  CD    . LYS C 3 339 ? 20.055  21.941 35.896  1.00 41.76  ? 339  LYS A CD    1 
ATOM   3329 C  CE    . LYS C 3 339 ? 19.876  23.192 35.036  1.00 42.28  ? 339  LYS A CE    1 
ATOM   3330 N  NZ    . LYS C 3 339 ? 19.176  24.275 35.776  1.00 44.28  ? 339  LYS A NZ    1 
ATOM   3331 N  N     . PHE C 3 340 ? 22.377  16.178 35.444  1.00 37.12  ? 340  PHE A N     1 
ATOM   3332 C  CA    . PHE C 3 340 ? 22.557  14.898 36.100  1.00 39.76  ? 340  PHE A CA    1 
ATOM   3333 C  C     . PHE C 3 340 ? 23.466  14.986 37.317  1.00 41.07  ? 340  PHE A C     1 
ATOM   3334 O  O     . PHE C 3 340 ? 24.353  15.837 37.399  1.00 41.65  ? 340  PHE A O     1 
ATOM   3335 C  CB    . PHE C 3 340 ? 23.123  13.869 35.111  1.00 38.47  ? 340  PHE A CB    1 
ATOM   3336 C  CG    . PHE C 3 340 ? 22.313  13.730 33.855  1.00 40.33  ? 340  PHE A CG    1 
ATOM   3337 C  CD1   . PHE C 3 340 ? 20.920  13.711 33.905  1.00 40.05  ? 340  PHE A CD1   1 
ATOM   3338 C  CD2   . PHE C 3 340 ? 22.940  13.608 32.617  1.00 41.16  ? 340  PHE A CD2   1 
ATOM   3339 C  CE1   . PHE C 3 340 ? 20.161  13.573 32.742  1.00 39.38  ? 340  PHE A CE1   1 
ATOM   3340 C  CE2   . PHE C 3 340 ? 22.193  13.469 31.451  1.00 40.48  ? 340  PHE A CE2   1 
ATOM   3341 C  CZ    . PHE C 3 340 ? 20.799  13.451 31.513  1.00 40.54  ? 340  PHE A CZ    1 
ATOM   3342 N  N     . ILE C 3 341 ? 23.226  14.101 38.271  1.00 42.42  ? 341  ILE A N     1 
ATOM   3343 C  CA    . ILE C 3 341 ? 24.026  14.065 39.477  1.00 46.57  ? 341  ILE A CA    1 
ATOM   3344 C  C     . ILE C 3 341 ? 25.355  13.387 39.164  1.00 48.85  ? 341  ILE A C     1 
ATOM   3345 O  O     . ILE C 3 341 ? 25.359  12.456 38.325  1.00 50.32  ? 341  ILE A O     1 
ATOM   3346 C  CB    . ILE C 3 341 ? 23.299  13.284 40.586  1.00 46.54  ? 341  ILE A CB    1 
ATOM   3347 C  CG1   . ILE C 3 341 ? 22.149  14.129 41.130  1.00 45.80  ? 341  ILE A CG1   1 
ATOM   3348 C  CG2   . ILE C 3 341 ? 24.279  12.899 41.692  1.00 48.25  ? 341  ILE A CG2   1 
ATOM   3349 C  CD1   . ILE C 3 341 ? 21.269  13.392 42.091  1.00 47.31  ? 341  ILE A CD1   1 
ATOM   3350 O  OXT   . ILE C 3 341 ? 26.372  13.789 39.774  1.00 51.94  ? 341  ILE A OXT   1 
HETATM 3351 CA CA    . CA  D 4 .   ? 27.071  10.390 7.877   1.00 34.28  ? 4001 CA  A CA    1 
HETATM 3352 MG MG    . MG  E 5 .   ? 28.271  14.682 9.673   1.00 32.69  ? 4002 MG  A MG    1 
HETATM 3353 CA CA    . CA  F 4 .   ? 24.977  25.284 5.817   1.00 49.67  ? 4003 CA  A CA    1 
HETATM 3354 P  PG    . DTP G 6 .   ? 25.900  11.031 4.563   1.00 34.98  ? 1814 DTP A PG    1 
HETATM 3355 O  O1G   . DTP G 6 .   ? 27.085  11.483 5.453   1.00 35.99  ? 1814 DTP A O1G   1 
HETATM 3356 O  O2G   . DTP G 6 .   ? 25.409  12.255 3.743   1.00 39.15  ? 1814 DTP A O2G   1 
HETATM 3357 O  O3G   . DTP G 6 .   ? 26.352  9.777  3.749   1.00 36.11  ? 1814 DTP A O3G   1 
HETATM 3358 P  PB    . DTP G 6 .   ? 23.907  10.158 6.579   1.00 34.36  ? 1814 DTP A PB    1 
HETATM 3359 O  O1B   . DTP G 6 .   ? 22.757  9.295  5.995   1.00 38.46  ? 1814 DTP A O1B   1 
HETATM 3360 O  O2B   . DTP G 6 .   ? 24.800  9.263  7.501   1.00 33.69  ? 1814 DTP A O2B   1 
HETATM 3361 O  O3B   . DTP G 6 .   ? 25.114  10.797 5.867   1.00 40.50  ? 1814 DTP A O3B   1 
HETATM 3362 P  PA    . DTP G 6 .   ? 24.195  12.306 8.456   1.00 36.12  ? 1814 DTP A PA    1 
HETATM 3363 O  O1A   . DTP G 6 .   ? 25.580  12.051 8.405   1.00 35.46  ? 1814 DTP A O1A   1 
HETATM 3364 O  O2A   . DTP G 6 .   ? 24.027  13.788 8.243   1.00 35.26  ? 1814 DTP A O2A   1 
HETATM 3365 O  O3A   . DTP G 6 .   ? 23.262  11.401 7.354   1.00 35.79  ? 1814 DTP A O3A   1 
HETATM 3366 O  "O5'" . DTP G 6 .   ? 23.506  11.887 9.496   1.00 33.98  ? 1814 DTP A "O5'" 1 
HETATM 3367 C  "C5'" . DTP G 6 .   ? 23.746  10.626 10.285  1.00 29.22  ? 1814 DTP A "C5'" 1 
HETATM 3368 C  "C4'" . DTP G 6 .   ? 22.508  9.809  10.663  1.00 32.44  ? 1814 DTP A "C4'" 1 
HETATM 3369 O  "O4'" . DTP G 6 .   ? 21.590  10.426 11.597  1.00 29.94  ? 1814 DTP A "O4'" 1 
HETATM 3370 C  "C3'" . DTP G 6 .   ? 21.658  9.359  9.422   1.00 30.54  ? 1814 DTP A "C3'" 1 
HETATM 3371 O  "O3'" . DTP G 6 .   ? 21.848  8.012  9.088   1.00 35.76  ? 1814 DTP A "O3'" 1 
HETATM 3372 C  "C2'" . DTP G 6 .   ? 20.250  9.734  9.745   1.00 31.11  ? 1814 DTP A "C2'" 1 
HETATM 3373 C  "C1'" . DTP G 6 .   ? 20.284  10.425 11.119  1.00 31.36  ? 1814 DTP A "C1'" 1 
HETATM 3374 N  N9    . DTP G 6 .   ? 19.618  11.754 10.805  1.00 31.02  ? 1814 DTP A N9    1 
HETATM 3375 C  C8    . DTP G 6 .   ? 20.196  12.858 10.152  1.00 31.26  ? 1814 DTP A C8    1 
HETATM 3376 N  N7    . DTP G 6 .   ? 19.371  13.850 9.988   1.00 32.85  ? 1814 DTP A N7    1 
HETATM 3377 C  C5    . DTP G 6 .   ? 18.196  13.418 10.573  1.00 32.80  ? 1814 DTP A C5    1 
HETATM 3378 C  C6    . DTP G 6 .   ? 16.886  14.012 10.691  1.00 33.92  ? 1814 DTP A C6    1 
HETATM 3379 N  N6    . DTP G 6 .   ? 16.611  15.247 10.247  1.00 35.41  ? 1814 DTP A N6    1 
HETATM 3380 N  N1    . DTP G 6 .   ? 15.905  13.266 11.347  1.00 31.97  ? 1814 DTP A N1    1 
HETATM 3381 C  C2    . DTP G 6 .   ? 16.157  11.996 11.812  1.00 32.51  ? 1814 DTP A C2    1 
HETATM 3382 N  N3    . DTP G 6 .   ? 17.330  11.337 11.736  1.00 30.31  ? 1814 DTP A N3    1 
HETATM 3383 C  C4    . DTP G 6 .   ? 18.303  12.113 11.068  1.00 31.38  ? 1814 DTP A C4    1 
HETATM 3384 O  O     . HOH H 7 .   ? 22.801  26.767 17.134  1.00 40.02  ? 14   HOH B O     1 
HETATM 3385 O  O     . HOH H 7 .   ? 8.482   26.642 34.204  1.00 38.75  ? 15   HOH B O     1 
HETATM 3386 O  O     . HOH H 7 .   ? 30.078  43.643 38.383  1.00 55.56  ? 16   HOH B O     1 
HETATM 3387 O  O     . HOH H 7 .   ? 24.524  22.657 16.788  1.00 43.87  ? 17   HOH B O     1 
HETATM 3388 O  O     . HOH H 7 .   ? 15.653  24.386 23.938  1.00 47.78  ? 18   HOH B O     1 
HETATM 3389 O  O     . HOH H 7 .   ? 20.007  31.603 37.415  1.00 79.95  ? 19   HOH B O     1 
HETATM 3390 O  O     . HOH H 7 .   ? 27.817  35.382 34.185  1.00 75.19  ? 20   HOH B O     1 
HETATM 3391 O  O     . HOH H 7 .   ? 27.845  31.784 33.824  1.00 46.56  ? 21   HOH B O     1 
HETATM 3392 O  O     . HOH H 7 .   ? 26.180  35.997 39.813  1.00 67.55  ? 22   HOH B O     1 
HETATM 3393 O  O     . HOH H 7 .   ? 18.438  33.986 39.156  1.00 56.16  ? 23   HOH B O     1 
HETATM 3394 O  O     . HOH H 7 .   ? 6.543   30.916 22.783  1.00 60.26  ? 24   HOH B O     1 
HETATM 3395 O  O     . HOH H 7 .   ? 20.459  25.058 38.465  1.00 55.57  ? 25   HOH B O     1 
HETATM 3396 O  O     . HOH H 7 .   ? 12.427  26.961 36.133  1.00 76.97  ? 26   HOH B O     1 
HETATM 3397 O  O     . HOH H 7 .   ? 16.240  21.092 12.876  1.00 50.56  ? 27   HOH B O     1 
HETATM 3398 O  O     . HOH H 7 .   ? 23.140  24.086 7.189   1.00 43.91  ? 28   HOH B O     1 
HETATM 3399 O  O     . HOH I 7 .   ? 26.546  29.079 26.032  1.00 47.16  ? 18   HOH C O     1 
HETATM 3400 O  O     . HOH I 7 .   ? 13.442  14.256 22.505  1.00 39.98  ? 19   HOH C O     1 
HETATM 3401 O  O     . HOH I 7 .   ? 22.424  28.539 28.862  1.00 38.99  ? 20   HOH C O     1 
HETATM 3402 O  O     . HOH I 7 .   ? 15.655  10.005 16.363  1.00 40.25  ? 21   HOH C O     1 
HETATM 3403 O  O     . HOH I 7 .   ? 4.939   9.712  17.729  1.00 41.22  ? 22   HOH C O     1 
HETATM 3404 O  O     . HOH I 7 .   ? 1.094   21.282 6.386   1.00 80.72  ? 23   HOH C O     1 
HETATM 3405 O  O     . HOH I 7 .   ? 12.403  17.791 13.736  1.00 47.10  ? 24   HOH C O     1 
HETATM 3406 O  O     . HOH I 7 .   ? 16.058  21.634 22.397  1.00 53.19  ? 25   HOH C O     1 
HETATM 3407 O  O     . HOH I 7 .   ? 22.682  33.721 29.568  1.00 52.12  ? 26   HOH C O     1 
HETATM 3408 O  O     . HOH I 7 .   ? 20.607  42.640 46.290  1.00 60.92  ? 27   HOH C O     1 
HETATM 3409 O  O     . HOH I 7 .   ? 13.849  17.705 17.186  1.00 45.85  ? 28   HOH C O     1 
HETATM 3410 O  O     . HOH I 7 .   ? 18.143  42.950 35.990  1.00 48.20  ? 29   HOH C O     1 
HETATM 3411 O  O     . HOH I 7 .   ? -0.349  24.912 7.169   1.00 63.53  ? 30   HOH C O     1 
HETATM 3412 O  O     . HOH I 7 .   ? -3.627  15.843 9.447   1.00 68.11  ? 31   HOH C O     1 
HETATM 3413 O  O     . HOH I 7 .   ? 3.971   15.219 14.208  1.00 47.95  ? 32   HOH C O     1 
HETATM 3414 O  O     . HOH I 7 .   ? 14.490  18.329 12.601  1.00 52.99  ? 33   HOH C O     1 
HETATM 3415 O  O     . HOH I 7 .   ? 20.341  42.844 34.846  1.00 47.52  ? 34   HOH C O     1 
HETATM 3416 O  O     . HOH I 7 .   ? 29.289  26.392 26.445  1.00 54.66  ? 35   HOH C O     1 
HETATM 3417 O  O     . HOH I 7 .   ? 23.982  17.328 19.488  1.00 47.64  ? 36   HOH C O     1 
HETATM 3418 O  O     . HOH I 7 .   ? 21.076  13.550 18.704  1.00 49.85  ? 37   HOH C O     1 
HETATM 3419 O  O     . HOH I 7 .   ? 24.978  28.255 28.187  1.00 58.08  ? 38   HOH C O     1 
HETATM 3420 O  O     . HOH I 7 .   ? 14.405  18.195 9.598   1.00 50.17  ? 39   HOH C O     1 
HETATM 3421 O  O     . HOH I 7 .   ? 24.918  22.929 19.048  1.00 50.73  ? 40   HOH C O     1 
HETATM 3422 O  O     . HOH I 7 .   ? 22.660  35.846 28.295  1.00 57.05  ? 41   HOH C O     1 
HETATM 3423 O  O     . HOH I 7 .   ? -5.908  15.662 8.499   1.00 77.19  ? 42   HOH C O     1 
HETATM 3424 O  O     . HOH I 7 .   ? 30.614  31.080 23.863  1.00 50.60  ? 43   HOH C O     1 
HETATM 3425 O  O     . HOH J 7 .   ? 27.237  12.740 10.359  1.00 33.64  ? 4004 HOH A O     1 
HETATM 3426 O  O     . HOH J 7 .   ? 18.159  -4.390 6.263   1.00 37.69  ? 4005 HOH A O     1 
HETATM 3427 O  O     . HOH J 7 .   ? 26.078  34.134 18.199  1.00 34.96  ? 4006 HOH A O     1 
HETATM 3428 O  O     . HOH J 7 .   ? 17.815  9.642  14.169  1.00 31.70  ? 4007 HOH A O     1 
HETATM 3429 O  O     . HOH J 7 .   ? 12.500  13.427 43.661  1.00 33.36  ? 4008 HOH A O     1 
HETATM 3430 O  O     . HOH J 7 .   ? 28.013  5.502  19.133  1.00 38.41  ? 4009 HOH A O     1 
HETATM 3431 O  O     . HOH J 7 .   ? 24.132  4.551  -1.021  1.00 42.73  ? 4010 HOH A O     1 
HETATM 3432 O  O     . HOH J 7 .   ? 7.479   0.941  -2.233  1.00 41.91  ? 4011 HOH A O     1 
HETATM 3433 O  O     . HOH J 7 .   ? 3.159   6.948  10.755  1.00 42.88  ? 4012 HOH A O     1 
HETATM 3434 O  O     . HOH J 7 .   ? 15.554  19.176 31.457  1.00 39.10  ? 4013 HOH A O     1 
HETATM 3435 O  O     . HOH J 7 .   ? 22.066  4.061  -2.811  1.00 49.78  ? 4014 HOH A O     1 
HETATM 3436 O  O     . HOH J 7 .   ? 35.469  3.539  3.750   1.00 38.69  ? 4015 HOH A O     1 
HETATM 3437 O  O     . HOH J 7 .   ? 9.060   4.865  12.846  1.00 40.44  ? 4016 HOH A O     1 
HETATM 3438 O  O     . HOH J 7 .   ? 7.755   7.654  15.609  1.00 40.58  ? 4017 HOH A O     1 
HETATM 3439 O  O     . HOH J 7 .   ? 33.308  20.908 13.312  1.00 39.62  ? 4018 HOH A O     1 
HETATM 3440 O  O     . HOH J 7 .   ? 46.473  27.698 6.792   1.00 43.99  ? 4019 HOH A O     1 
HETATM 3441 O  O     . HOH J 7 .   ? 48.106  12.831 19.309  1.00 48.16  ? 4020 HOH A O     1 
HETATM 3442 O  O     . HOH J 7 .   ? 24.086  8.490  19.767  1.00 49.90  ? 4021 HOH A O     1 
HETATM 3443 O  O     . HOH J 7 .   ? 32.374  31.643 19.239  1.00 46.98  ? 4022 HOH A O     1 
HETATM 3444 O  O     . HOH J 7 .   ? 0.631   9.422  16.712  1.00 44.24  ? 4023 HOH A O     1 
HETATM 3445 O  O     . HOH J 7 .   ? 48.838  20.620 10.851  1.00 48.07  ? 4024 HOH A O     1 
HETATM 3446 O  O     . HOH J 7 .   ? 14.080  -1.278 9.226   1.00 42.98  ? 4025 HOH A O     1 
HETATM 3447 O  O     . HOH J 7 .   ? 10.949  3.405  33.203  1.00 48.31  ? 4026 HOH A O     1 
HETATM 3448 O  O     . HOH J 7 .   ? 46.025  21.995 7.544   1.00 47.05  ? 4027 HOH A O     1 
HETATM 3449 O  O     . HOH J 7 .   ? 36.617  30.565 17.717  1.00 45.14  ? 4028 HOH A O     1 
HETATM 3450 O  O     . HOH J 7 .   ? 39.642  35.793 15.916  1.00 45.72  ? 4029 HOH A O     1 
HETATM 3451 O  O     . HOH J 7 .   ? 26.660  13.335 1.754   1.00 65.71  ? 4030 HOH A O     1 
HETATM 3452 O  O     . HOH J 7 .   ? 17.376  34.984 8.124   1.00 42.14  ? 4031 HOH A O     1 
HETATM 3453 O  O     . HOH J 7 .   ? 29.643  16.011 8.847   1.00 56.42  ? 4032 HOH A O     1 
HETATM 3454 O  O     . HOH J 7 .   ? 39.843  21.883 16.489  1.00 41.75  ? 4033 HOH A O     1 
HETATM 3455 O  O     . HOH J 7 .   ? 8.576   -0.628 1.241   1.00 45.98  ? 4034 HOH A O     1 
HETATM 3456 O  O     . HOH J 7 .   ? 40.773  24.946 -0.515  1.00 58.32  ? 4035 HOH A O     1 
HETATM 3457 O  O     . HOH J 7 .   ? -6.857  16.489 34.960  1.00 46.55  ? 4036 HOH A O     1 
HETATM 3458 O  O     . HOH J 7 .   ? 1.532   4.730  8.458   1.00 51.75  ? 4037 HOH A O     1 
HETATM 3459 O  O     . HOH J 7 .   ? 10.651  26.805 37.515  1.00 48.57  ? 4038 HOH A O     1 
HETATM 3460 O  O     . HOH J 7 .   ? 29.857  10.554 5.376   1.00 45.15  ? 4039 HOH A O     1 
HETATM 3461 O  O     . HOH J 7 .   ? 33.337  11.916 23.659  1.00 55.80  ? 4040 HOH A O     1 
HETATM 3462 O  O     . HOH J 7 .   ? 14.858  -6.133 -0.834  1.00 47.55  ? 4041 HOH A O     1 
HETATM 3463 O  O     . HOH J 7 .   ? 19.798  11.659 4.066   1.00 48.30  ? 4042 HOH A O     1 
HETATM 3464 O  O     . HOH J 7 .   ? 24.086  11.319 16.722  1.00 43.61  ? 4043 HOH A O     1 
HETATM 3465 O  O     . HOH J 7 .   ? -3.333  24.352 14.215  1.00 68.61  ? 4044 HOH A O     1 
HETATM 3466 O  O     . HOH J 7 .   ? 1.504   24.301 37.673  1.00 52.92  ? 4045 HOH A O     1 
HETATM 3467 O  O     . HOH J 7 .   ? 28.155  -1.289 2.835   1.00 46.86  ? 4046 HOH A O     1 
HETATM 3468 O  O     . HOH J 7 .   ? 42.806  18.402 20.955  1.00 38.39  ? 4047 HOH A O     1 
HETATM 3469 O  O     . HOH J 7 .   ? 33.889  -4.762 15.068  1.00 38.26  ? 4048 HOH A O     1 
HETATM 3470 O  O     . HOH J 7 .   ? 14.089  3.241  16.485  1.00 43.62  ? 4049 HOH A O     1 
HETATM 3471 O  O     . HOH J 7 .   ? -0.324  20.507 13.368  1.00 49.50  ? 4050 HOH A O     1 
HETATM 3472 O  O     . HOH J 7 .   ? 41.598  40.156 11.549  1.00 54.22  ? 4051 HOH A O     1 
HETATM 3473 O  O     . HOH J 7 .   ? 50.236  21.844 5.529   1.00 47.07  ? 4052 HOH A O     1 
HETATM 3474 O  O     . HOH J 7 .   ? 19.981  21.790 41.933  1.00 46.71  ? 4053 HOH A O     1 
HETATM 3475 O  O     . HOH J 7 .   ? 27.901  11.993 40.169  1.00 58.92  ? 4054 HOH A O     1 
HETATM 3476 O  O     . HOH J 7 .   ? 5.464   1.855  4.005   1.00 50.88  ? 4055 HOH A O     1 
HETATM 3477 O  O     . HOH J 7 .   ? 26.099  26.731 -1.104  1.00 57.30  ? 4056 HOH A O     1 
HETATM 3478 O  O     . HOH J 7 .   ? 24.379  17.402 33.343  1.00 42.87  ? 4057 HOH A O     1 
HETATM 3479 O  O     . HOH J 7 .   ? 43.531  25.885 13.605  1.00 50.13  ? 4058 HOH A O     1 
HETATM 3480 O  O     . HOH J 7 .   ? 35.146  1.844  6.021   1.00 48.52  ? 4059 HOH A O     1 
HETATM 3481 O  O     . HOH J 7 .   ? 25.689  38.271 21.212  1.00 46.17  ? 4060 HOH A O     1 
HETATM 3482 O  O     . HOH J 7 .   ? 22.484  19.107 31.810  1.00 40.99  ? 4061 HOH A O     1 
HETATM 3483 O  O     . HOH J 7 .   ? 41.182  6.817  4.526   1.00 90.14  ? 4062 HOH A O     1 
HETATM 3484 O  O     . HOH J 7 .   ? 37.465  35.490 17.285  1.00 38.14  ? 4063 HOH A O     1 
HETATM 3485 O  O     . HOH J 7 .   ? 11.217  16.783 18.019  1.00 62.67  ? 4064 HOH A O     1 
HETATM 3486 O  O     . HOH J 7 .   ? 2.871   7.535  22.310  1.00 49.57  ? 4065 HOH A O     1 
HETATM 3487 O  O     . HOH J 7 .   ? 15.229  -5.527 5.222   1.00 49.17  ? 4066 HOH A O     1 
HETATM 3488 O  O     . HOH J 7 .   ? 44.880  20.014 0.574   1.00 47.61  ? 4067 HOH A O     1 
HETATM 3489 O  O     . HOH J 7 .   ? 35.107  30.576 3.007   1.00 44.58  ? 4068 HOH A O     1 
HETATM 3490 O  O     . HOH J 7 .   ? 31.278  -7.355 14.294  1.00 46.56  ? 4069 HOH A O     1 
HETATM 3491 O  O     . HOH J 7 .   ? 32.830  42.357 4.202   1.00 45.80  ? 4070 HOH A O     1 
HETATM 3492 O  O     . HOH J 7 .   ? 52.869  7.849  1.186   1.00 55.77  ? 4071 HOH A O     1 
HETATM 3493 O  O     . HOH J 7 .   ? 28.660  40.426 -2.224  1.00 50.21  ? 4072 HOH A O     1 
HETATM 3494 O  O     . HOH J 7 .   ? 4.647   3.836  -2.091  1.00 51.98  ? 4073 HOH A O     1 
HETATM 3495 O  O     . HOH J 7 .   ? 30.772  21.800 4.411   1.00 46.02  ? 4074 HOH A O     1 
HETATM 3496 O  O     . HOH J 7 .   ? 51.853  16.264 19.215  1.00 63.21  ? 4075 HOH A O     1 
HETATM 3497 O  O     . HOH J 7 .   ? 42.177  23.679 18.371  1.00 75.82  ? 4076 HOH A O     1 
HETATM 3498 O  O     . HOH J 7 .   ? 9.766   4.258  -7.246  1.00 46.17  ? 4077 HOH A O     1 
HETATM 3499 O  O     . HOH J 7 .   ? 9.639   4.205  41.880  1.00 62.57  ? 4078 HOH A O     1 
HETATM 3500 O  O     . HOH J 7 .   ? 47.639  2.765  4.662   1.00 50.35  ? 4079 HOH A O     1 
HETATM 3501 O  O     . HOH J 7 .   ? 4.413   11.750 5.306   1.00 45.18  ? 4080 HOH A O     1 
HETATM 3502 O  O     . HOH J 7 .   ? 21.897  33.483 13.256  1.00 48.22  ? 4081 HOH A O     1 
HETATM 3503 O  O     . HOH J 7 .   ? -2.976  24.119 35.272  1.00 78.69  ? 4082 HOH A O     1 
HETATM 3504 O  O     . HOH J 7 .   ? 38.904  29.302 18.569  1.00 48.72  ? 4083 HOH A O     1 
HETATM 3505 O  O     . HOH J 7 .   ? 31.330  24.146 14.782  1.00 40.15  ? 4084 HOH A O     1 
HETATM 3506 O  O     . HOH J 7 .   ? 49.268  21.201 17.727  1.00 58.38  ? 4085 HOH A O     1 
HETATM 3507 O  O     . HOH J 7 .   ? -8.828  17.096 30.837  1.00 53.54  ? 4086 HOH A O     1 
HETATM 3508 O  O     . HOH J 7 .   ? 6.478   23.444 38.353  1.00 49.85  ? 4087 HOH A O     1 
HETATM 3509 O  O     . HOH J 7 .   ? 5.821   5.407  26.401  1.00 86.44  ? 4088 HOH A O     1 
HETATM 3510 O  O     . HOH J 7 .   ? -3.917  11.608 36.540  1.00 60.90  ? 4089 HOH A O     1 
HETATM 3511 O  O     . HOH J 7 .   ? 12.774  23.555 42.342  1.00 50.79  ? 4090 HOH A O     1 
HETATM 3512 O  O     . HOH J 7 .   ? 34.774  -3.063 17.272  1.00 57.60  ? 4091 HOH A O     1 
HETATM 3513 O  O     . HOH J 7 .   ? 18.791  22.071 32.014  1.00 49.87  ? 4092 HOH A O     1 
HETATM 3514 O  O     . HOH J 7 .   ? 21.406  28.663 3.451   1.00 53.54  ? 4093 HOH A O     1 
HETATM 3515 O  O     . HOH J 7 .   ? 28.549  20.228 7.859   1.00 51.25  ? 4094 HOH A O     1 
HETATM 3516 O  O     . HOH J 7 .   ? 2.270   18.139 43.239  1.00 68.87  ? 4095 HOH A O     1 
HETATM 3517 O  O     . HOH J 7 .   ? 52.538  15.848 14.184  1.00 58.43  ? 4096 HOH A O     1 
HETATM 3518 O  O     . HOH J 7 .   ? -2.039  16.240 11.068  1.00 57.91  ? 4097 HOH A O     1 
HETATM 3519 O  O     . HOH J 7 .   ? 43.386  15.059 -0.413  1.00 54.56  ? 4098 HOH A O     1 
HETATM 3520 O  O     . HOH J 7 .   ? 37.715  10.798 -1.579  1.00 47.18  ? 4099 HOH A O     1 
HETATM 3521 O  O     . HOH J 7 .   ? 26.592  14.529 8.325   1.00 39.55  ? 4100 HOH A O     1 
HETATM 3522 O  O     . HOH J 7 .   ? 26.953  8.024  19.552  1.00 54.76  ? 4101 HOH A O     1 
HETATM 3523 O  O     . HOH J 7 .   ? 31.695  21.669 1.402   1.00 44.33  ? 4102 HOH A O     1 
HETATM 3524 O  O     . HOH J 7 .   ? 30.899  17.949 14.642  1.00 49.63  ? 4103 HOH A O     1 
HETATM 3525 O  O     . HOH J 7 .   ? 26.885  4.816  -2.348  1.00 53.24  ? 4104 HOH A O     1 
HETATM 3526 O  O     . HOH J 7 .   ? 10.449  4.952  14.967  1.00 58.66  ? 4105 HOH A O     1 
HETATM 3527 O  O     . HOH J 7 .   ? 29.809  4.496  21.348  1.00 56.01  ? 4106 HOH A O     1 
HETATM 3528 O  O     . HOH J 7 .   ? 13.206  2.791  34.385  1.00 54.98  ? 4107 HOH A O     1 
HETATM 3529 O  O     . HOH J 7 .   ? 18.152  37.665 4.416   1.00 71.45  ? 4108 HOH A O     1 
HETATM 3530 O  O     . HOH J 7 .   ? 31.718  39.824 5.035   1.00 80.09  ? 4109 HOH A O     1 
HETATM 3531 O  O     . HOH J 7 .   ? 19.349  25.820 7.678   1.00 57.17  ? 4110 HOH A O     1 
HETATM 3532 O  O     . HOH J 7 .   ? 30.354  20.506 13.221  1.00 49.67  ? 4111 HOH A O     1 
HETATM 3533 O  O     . HOH J 7 .   ? 22.931  33.311 15.543  1.00 46.48  ? 4112 HOH A O     1 
HETATM 3534 O  O     . HOH J 7 .   ? 3.908   5.941  23.830  1.00 60.97  ? 4113 HOH A O     1 
HETATM 3535 O  O     . HOH J 7 .   ? 13.100  -3.483 9.204   1.00 56.28  ? 4114 HOH A O     1 
HETATM 3536 O  O     . HOH J 7 .   ? 48.032  28.282 11.944  1.00 53.23  ? 4115 HOH A O     1 
HETATM 3537 O  O     . HOH J 7 .   ? 2.720   8.610  20.000  1.00 46.62  ? 4116 HOH A O     1 
HETATM 3538 O  O     . HOH J 7 .   ? 1.035   16.731 39.945  1.00 43.35  ? 4117 HOH A O     1 
HETATM 3539 O  O     . HOH J 7 .   ? 9.435   17.792 7.210   1.00 50.56  ? 4118 HOH A O     1 
HETATM 3540 O  O     . HOH J 7 .   ? 9.050   -2.182 4.900   1.00 48.98  ? 4119 HOH A O     1 
HETATM 3541 O  O     . HOH J 7 .   ? 21.569  -0.323 21.149  1.00 49.92  ? 4120 HOH A O     1 
HETATM 3542 O  O     . HOH J 7 .   ? 21.789  13.234 28.625  1.00 92.35  ? 4121 HOH A O     1 
HETATM 3543 O  O     . HOH J 7 .   ? 31.585  38.058 -1.377  1.00 50.11  ? 4122 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  G   B . n 
A 1 2   DG  2   2   2   DG  G   B . n 
A 1 3   DC  3   3   3   DC  C   B . n 
A 1 4   DT  4   4   4   DT  T   B . n 
A 1 5   DA  5   5   5   DA  A   B . n 
A 1 6   DC  6   6   6   DC  C   B . n 
A 1 7   DA  7   7   7   DA  A   B . n 
A 1 8   DG  8   8   8   DG  G   B . n 
A 1 9   DG  9   9   9   DG  G   B . n 
A 1 10  DA  10  10  10  DA  A   B . n 
A 1 11  DC  11  11  11  DC  C   B . n 
A 1 12  DT  12  12  12  DT  T   B . n 
A 1 13  DOC 13  13  13  DOC DOC B . n 
B 2 1   DT  1   1   1   DT  T   C . n 
B 2 2   DC  2   2   2   DC  C   C . n 
B 2 3   DA  3   3   3   DA  A   C . n 
B 2 4   DT  4   4   4   DT  T   C . n 
B 2 5   DG  5   5   5   DG  G   C . n 
B 2 6   DA  6   6   6   DA  A   C . n 
B 2 7   DG  7   7   7   DG  G   C . n 
B 2 8   DT  8   8   8   DT  T   C . n 
B 2 9   DC  9   9   9   DC  C   C . n 
B 2 10  DC  10  10  10  DC  C   C . n 
B 2 11  DT  11  11  11  DT  T   C . n 
B 2 12  DG  12  12  12  DG  G   C . n 
B 2 13  DT  13  13  13  DT  T   C . n 
B 2 14  DA  14  14  14  DA  A   C . n 
B 2 15  DG  15  15  15  DG  G   C . n 
B 2 16  DC  16  16  16  DC  C   C . n 
B 2 17  DC  17  17  17  DC  C   C . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   PHE 5   5   5   PHE PHE A . n 
C 3 6   VAL 6   6   6   VAL VAL A . n 
C 3 7   ASP 7   7   7   ASP ASP A . n 
C 3 8   PHE 8   8   8   PHE PHE A . n 
C 3 9   ASP 9   9   9   ASP ASP A . n 
C 3 10  TYR 10  10  10  TYR TYR A . n 
C 3 11  PHE 11  11  11  PHE PHE A . n 
C 3 12  TYR 12  12  12  TYR TYR A . n 
C 3 13  ALA 13  13  13  ALA ALA A . n 
C 3 14  GLN 14  14  14  GLN GLN A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  GLU 16  16  16  GLU GLU A . n 
C 3 17  GLU 17  17  17  GLU GLU A . n 
C 3 18  VAL 18  18  18  VAL VAL A . n 
C 3 19  LEU 19  19  19  LEU LEU A . n 
C 3 20  ASN 20  20  20  ASN ASN A . n 
C 3 21  PRO 21  21  21  PRO PRO A . n 
C 3 22  SER 22  22  22  SER SER A . n 
C 3 23  LEU 23  23  23  LEU LEU A . n 
C 3 24  LYS 24  24  24  LYS LYS A . n 
C 3 25  GLY 25  25  25  GLY GLY A . n 
C 3 26  LYS 26  26  26  LYS LYS A . n 
C 3 27  PRO 27  27  27  PRO PRO A . n 
C 3 28  VAL 28  28  28  VAL VAL A . n 
C 3 29  VAL 29  29  29  VAL VAL A . n 
C 3 30  VAL 30  30  30  VAL VAL A . n 
C 3 31  CYS 31  31  31  CYS CYS A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  PHE 33  33  33  PHE PHE A . n 
C 3 34  SER 34  34  34  SER SER A . n 
C 3 35  GLY 35  35  35  GLY GLY A . n 
C 3 36  ARG 36  36  36  ARG ARG A . n 
C 3 37  PHE 37  37  37  PHE PHE A . n 
C 3 38  GLU 38  38  38  GLU GLU A . n 
C 3 39  ASP 39  39  39  ASP ASP A . n 
C 3 40  SER 40  40  40  SER SER A . n 
C 3 41  GLY 41  41  41  GLY GLY A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  VAL 43  43  43  VAL VAL A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  THR 45  45  45  THR THR A . n 
C 3 46  ALA 46  46  46  ALA ALA A . n 
C 3 47  ASN 47  47  47  ASN ASN A . n 
C 3 48  TYR 48  48  48  TYR TYR A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  ALA 50  50  50  ALA ALA A . n 
C 3 51  ARG 51  51  51  ARG ARG A . n 
C 3 52  LYS 52  52  52  LYS LYS A . n 
C 3 53  PHE 53  53  53  PHE PHE A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  VAL 55  55  55  VAL VAL A . n 
C 3 56  LYS 56  56  56  LYS LYS A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLY 58  58  58  GLY GLY A . n 
C 3 59  ILE 59  59  59  ILE ILE A . n 
C 3 60  PRO 60  60  60  PRO PRO A . n 
C 3 61  ILE 61  61  61  ILE ILE A . n 
C 3 62  VAL 62  62  62  VAL VAL A . n 
C 3 63  GLU 63  63  63  GLU GLU A . n 
C 3 64  ALA 64  64  64  ALA ALA A . n 
C 3 65  LYS 65  65  65  LYS LYS A . n 
C 3 66  LYS 66  66  66  LYS LYS A . n 
C 3 67  ILE 67  67  67  ILE ILE A . n 
C 3 68  LEU 68  68  68  LEU LEU A . n 
C 3 69  PRO 69  69  69  PRO PRO A . n 
C 3 70  ASN 70  70  70  ASN ASN A . n 
C 3 71  ALA 71  71  71  ALA ALA A . n 
C 3 72  VAL 72  72  72  VAL VAL A . n 
C 3 73  TYR 73  73  73  TYR TYR A . n 
C 3 74  LEU 74  74  74  LEU LEU A . n 
C 3 75  PRO 75  75  75  PRO PRO A . n 
C 3 76  MET 76  76  76  MET MET A . n 
C 3 77  ARG 77  77  77  ARG ARG A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  GLU 79  79  79  GLU GLU A . n 
C 3 80  VAL 80  80  80  VAL VAL A . n 
C 3 81  TYR 81  81  81  TYR TYR A . n 
C 3 82  GLN 82  82  82  GLN GLN A . n 
C 3 83  GLN 83  83  83  GLN GLN A . n 
C 3 84  VAL 84  84  84  VAL VAL A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  SER 86  86  86  SER SER A . n 
C 3 87  ARG 87  87  87  ARG ARG A . n 
C 3 88  ILE 88  88  88  ILE ILE A . n 
C 3 89  MET 89  89  89  MET MET A . n 
C 3 90  ASN 90  90  90  ASN ASN A . n 
C 3 91  LEU 91  91  91  LEU LEU A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  ARG 93  93  93  ARG ARG A . n 
C 3 94  GLU 94  94  94  GLU GLU A . n 
C 3 95  TYR 95  95  95  TYR TYR A . n 
C 3 96  SER 96  96  96  SER SER A . n 
C 3 97  GLU 97  97  97  GLU GLU A . n 
C 3 98  LYS 98  98  98  LYS LYS A . n 
C 3 99  ILE 99  99  99  ILE ILE A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ILE 101 101 101 ILE ILE A . n 
C 3 102 ALA 102 102 102 ALA ALA A . n 
C 3 103 SER 103 103 103 SER SER A . n 
C 3 104 ILE 104 104 104 ILE ILE A . n 
C 3 105 ASP 105 105 105 ASP ASP A . n 
C 3 106 GLU 106 106 106 GLU GLU A . n 
C 3 107 ALA 107 107 107 ALA ALA A . n 
C 3 108 TYR 108 108 108 TYR TYR A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 ASP 110 110 110 ASP ASP A . n 
C 3 111 ILE 111 111 111 ILE ILE A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 ASP 113 113 113 ASP ASP A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 VAL 115 115 115 VAL VAL A . n 
C 3 116 ARG 116 116 116 ARG ARG A . n 
C 3 117 ASP 117 117 117 ASP ASP A . n 
C 3 118 TYR 118 118 118 TYR TYR A . n 
C 3 119 ARG 119 119 119 ARG ARG A . n 
C 3 120 GLU 120 120 120 GLU GLU A . n 
C 3 121 ALA 121 121 121 ALA ALA A . n 
C 3 122 TYR 122 122 122 TYR TYR A . n 
C 3 123 ASN 123 123 123 ASN ASN A . n 
C 3 124 LEU 124 124 124 LEU LEU A . n 
C 3 125 GLY 125 125 125 GLY GLY A . n 
C 3 126 LEU 126 126 126 LEU LEU A . n 
C 3 127 GLU 127 127 127 GLU GLU A . n 
C 3 128 ILE 128 128 128 ILE ILE A . n 
C 3 129 LYS 129 129 129 LYS LYS A . n 
C 3 130 ASN 130 130 130 ASN ASN A . n 
C 3 131 LYS 131 131 131 LYS LYS A . n 
C 3 132 ILE 132 132 132 ILE ILE A . n 
C 3 133 LEU 133 133 133 LEU LEU A . n 
C 3 134 GLU 134 134 134 GLU GLU A . n 
C 3 135 LYS 135 135 135 LYS LYS A . n 
C 3 136 GLU 136 136 136 GLU GLU A . n 
C 3 137 LYS 137 137 137 LYS LYS A . n 
C 3 138 ILE 138 138 138 ILE ILE A . n 
C 3 139 THR 139 139 139 THR THR A . n 
C 3 140 VAL 140 140 140 VAL VAL A . n 
C 3 141 THR 141 141 141 THR THR A . n 
C 3 142 VAL 142 142 142 VAL VAL A . n 
C 3 143 GLY 143 143 143 GLY GLY A . n 
C 3 144 ILE 144 144 144 ILE ILE A . n 
C 3 145 SER 145 145 145 SER SER A . n 
C 3 146 LYS 146 146 146 LYS LYS A . n 
C 3 147 ASN 147 147 147 ASN ASN A . n 
C 3 148 LYS 148 148 148 LYS LYS A . n 
C 3 149 VAL 149 149 149 VAL VAL A . n 
C 3 150 PHE 150 150 150 PHE PHE A . n 
C 3 151 ALA 151 151 151 ALA ALA A . n 
C 3 152 LYS 152 152 152 LYS LYS A . n 
C 3 153 ILE 153 153 153 ILE ILE A . n 
C 3 154 ALA 154 154 154 ALA ALA A . n 
C 3 155 ALA 155 155 155 ALA ALA A . n 
C 3 156 ASP 156 156 156 ASP ASP A . n 
C 3 157 MET 157 157 157 MET MET A . n 
C 3 158 ALA 158 158 158 ALA ALA A . n 
C 3 159 LYS 159 159 159 LYS LYS A . n 
C 3 160 PRO 160 160 160 PRO PRO A . n 
C 3 161 ASN 161 161 161 ASN ASN A . n 
C 3 162 GLY 162 162 162 GLY GLY A . n 
C 3 163 ILE 163 163 163 ILE ILE A . n 
C 3 164 LYS 164 164 164 LYS LYS A . n 
C 3 165 VAL 165 165 165 VAL VAL A . n 
C 3 166 ILE 166 166 166 ILE ILE A . n 
C 3 167 ASP 167 167 167 ASP ASP A . n 
C 3 168 ASP 168 168 168 ASP ASP A . n 
C 3 169 GLU 169 169 169 GLU GLU A . n 
C 3 170 GLU 170 170 170 GLU GLU A . n 
C 3 171 VAL 171 171 171 VAL VAL A . n 
C 3 172 LYS 172 172 172 LYS LYS A . n 
C 3 173 ARG 173 173 173 ARG ARG A . n 
C 3 174 LEU 174 174 174 LEU LEU A . n 
C 3 175 ILE 175 175 175 ILE ILE A . n 
C 3 176 ARG 176 176 176 ARG ARG A . n 
C 3 177 GLU 177 177 177 GLU GLU A . n 
C 3 178 LEU 178 178 178 LEU LEU A . n 
C 3 179 ASP 179 179 179 ASP ASP A . n 
C 3 180 ILE 180 180 180 ILE ILE A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 ASP 182 182 182 ASP ASP A . n 
C 3 183 VAL 183 183 183 VAL VAL A . n 
C 3 184 PRO 184 184 184 PRO PRO A . n 
C 3 185 GLY 185 185 185 GLY GLY A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 GLY 187 187 187 GLY GLY A . n 
C 3 188 ASN 188 188 188 ASN ASN A . n 
C 3 189 ILE 189 189 189 ILE ILE A . n 
C 3 190 THR 190 190 190 THR THR A . n 
C 3 191 ALA 191 191 191 ALA ALA A . n 
C 3 192 GLU 192 192 192 GLU GLU A . n 
C 3 193 LYS 193 193 193 LYS LYS A . n 
C 3 194 LEU 194 194 194 LEU LEU A . n 
C 3 195 LYS 195 195 195 LYS LYS A . n 
C 3 196 LYS 196 196 196 LYS LYS A . n 
C 3 197 LEU 197 197 197 LEU LEU A . n 
C 3 198 GLY 198 198 198 GLY GLY A . n 
C 3 199 ILE 199 199 199 ILE ILE A . n 
C 3 200 ASN 200 200 200 ASN ASN A . n 
C 3 201 LYS 201 201 201 LYS LYS A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 VAL 203 203 203 VAL VAL A . n 
C 3 204 ASP 204 204 204 ASP ASP A . n 
C 3 205 THR 205 205 205 THR THR A . n 
C 3 206 LEU 206 206 206 LEU LEU A . n 
C 3 207 SER 207 207 207 SER SER A . n 
C 3 208 ILE 208 208 208 ILE ILE A . n 
C 3 209 GLU 209 209 209 GLU GLU A . n 
C 3 210 PHE 210 210 210 PHE PHE A . n 
C 3 211 ASP 211 211 211 ASP ASP A . n 
C 3 212 LYS 212 212 212 LYS LYS A . n 
C 3 213 LEU 213 213 213 LEU LEU A . n 
C 3 214 LYS 214 214 214 LYS LYS A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 MET 216 216 216 MET MET A . n 
C 3 217 ILE 217 217 217 ILE ILE A . n 
C 3 218 GLY 218 218 218 GLY GLY A . n 
C 3 219 GLU 219 219 219 GLU GLU A . n 
C 3 220 ALA 220 220 220 ALA ALA A . n 
C 3 221 LYS 221 221 221 LYS LYS A . n 
C 3 222 ALA 222 222 222 ALA ALA A . n 
C 3 223 LYS 223 223 223 LYS LYS A . n 
C 3 224 TYR 224 224 224 TYR TYR A . n 
C 3 225 LEU 225 225 225 LEU LEU A . n 
C 3 226 ILE 226 226 226 ILE ILE A . n 
C 3 227 SER 227 227 227 SER SER A . n 
C 3 228 LEU 228 228 228 LEU LEU A . n 
C 3 229 ALA 229 229 229 ALA ALA A . n 
C 3 230 ARG 230 230 230 ARG ARG A . n 
C 3 231 ASP 231 231 231 ASP ASP A . n 
C 3 232 GLU 232 232 232 GLU GLU A . n 
C 3 233 TYR 233 233 233 TYR TYR A . n 
C 3 234 ASN 234 234 234 ASN ASN A . n 
C 3 235 GLU 235 235 235 GLU GLU A . n 
C 3 236 PRO 236 236 236 PRO PRO A . n 
C 3 237 ILE 237 237 237 ILE ILE A . n 
C 3 238 ARG 238 238 238 ARG ARG A . n 
C 3 239 THR 239 239 239 THR THR A . n 
C 3 240 ARG 240 240 240 ARG ARG A . n 
C 3 241 VAL 241 241 241 VAL VAL A . n 
C 3 242 ARG 242 242 242 ARG ARG A . n 
C 3 243 LYS 243 243 243 LYS LYS A . n 
C 3 244 SER 244 244 244 SER SER A . n 
C 3 245 ILE 245 245 245 ILE ILE A . n 
C 3 246 GLY 246 246 246 GLY GLY A . n 
C 3 247 ARG 247 247 247 ARG ARG A . n 
C 3 248 ILE 248 248 248 ILE ILE A . n 
C 3 249 VAL 249 249 249 VAL VAL A . n 
C 3 250 THR 250 250 250 THR THR A . n 
C 3 251 MET 251 251 251 MET MET A . n 
C 3 252 LYS 252 252 252 LYS LYS A . n 
C 3 253 ARG 253 253 253 ARG ARG A . n 
C 3 254 ASN 254 254 254 ASN ASN A . n 
C 3 255 SER 255 255 255 SER SER A . n 
C 3 256 ARG 256 256 256 ARG ARG A . n 
C 3 257 ASN 257 257 257 ASN ASN A . n 
C 3 258 LEU 258 258 258 LEU LEU A . n 
C 3 259 GLU 259 259 259 GLU GLU A . n 
C 3 260 GLU 260 260 260 GLU GLU A . n 
C 3 261 ILE 261 261 261 ILE ILE A . n 
C 3 262 LYS 262 262 262 LYS LYS A . n 
C 3 263 PRO 263 263 263 PRO PRO A . n 
C 3 264 TYR 264 264 264 TYR TYR A . n 
C 3 265 LEU 265 265 265 LEU LEU A . n 
C 3 266 PHE 266 266 266 PHE PHE A . n 
C 3 267 ARG 267 267 267 ARG ARG A . n 
C 3 268 ALA 268 268 268 ALA ALA A . n 
C 3 269 ILE 269 269 269 ILE ILE A . n 
C 3 270 GLU 270 270 270 GLU GLU A . n 
C 3 271 GLU 271 271 271 GLU GLU A . n 
C 3 272 SER 272 272 272 SER SER A . n 
C 3 273 TYR 273 273 273 TYR TYR A . n 
C 3 274 TYR 274 274 274 TYR TYR A . n 
C 3 275 LYS 275 275 275 LYS LYS A . n 
C 3 276 LEU 276 276 276 LEU LEU A . n 
C 3 277 ASP 277 277 277 ASP ASP A . n 
C 3 278 LYS 278 278 278 LYS LYS A . n 
C 3 279 ARG 279 279 279 ARG ARG A . n 
C 3 280 ILE 280 280 280 ILE ILE A . n 
C 3 281 PRO 281 281 281 PRO PRO A . n 
C 3 282 LYS 282 282 282 LYS LYS A . n 
C 3 283 ALA 283 283 283 ALA ALA A . n 
C 3 284 ILE 284 284 284 ILE ILE A . n 
C 3 285 HIS 285 285 285 HIS HIS A . n 
C 3 286 VAL 286 286 286 VAL VAL A . n 
C 3 287 VAL 287 287 287 VAL VAL A . n 
C 3 288 ALA 288 288 288 ALA ALA A . n 
C 3 289 VAL 289 289 289 VAL VAL A . n 
C 3 290 THR 290 290 290 THR THR A . n 
C 3 291 GLU 291 291 291 GLU GLU A . n 
C 3 292 ASP 292 292 292 ASP ASP A . n 
C 3 293 LEU 293 293 293 LEU LEU A . n 
C 3 294 ASP 294 294 294 ASP ASP A . n 
C 3 295 ILE 295 295 295 ILE ILE A . n 
C 3 296 VAL 296 296 296 VAL VAL A . n 
C 3 297 SER 297 297 297 SER SER A . n 
C 3 298 ARG 298 298 298 ARG ARG A . n 
C 3 299 GLY 299 299 299 GLY GLY A . n 
C 3 300 ARG 300 300 300 ARG ARG A . n 
C 3 301 THR 301 301 301 THR THR A . n 
C 3 302 PHE 302 302 302 PHE PHE A . n 
C 3 303 PRO 303 303 303 PRO PRO A . n 
C 3 304 HIS 304 304 304 HIS HIS A . n 
C 3 305 GLY 305 305 305 GLY GLY A . n 
C 3 306 ILE 306 306 306 ILE ILE A . n 
C 3 307 SER 307 307 307 SER SER A . n 
C 3 308 LYS 308 308 308 LYS LYS A . n 
C 3 309 GLU 309 309 309 GLU GLU A . n 
C 3 310 THR 310 310 310 THR THR A . n 
C 3 311 ALA 311 311 311 ALA ALA A . n 
C 3 312 TYR 312 312 312 TYR TYR A . n 
C 3 313 SER 313 313 313 SER SER A . n 
C 3 314 GLU 314 314 314 GLU GLU A . n 
C 3 315 SER 315 315 315 SER SER A . n 
C 3 316 VAL 316 316 316 VAL VAL A . n 
C 3 317 LYS 317 317 317 LYS LYS A . n 
C 3 318 LEU 318 318 318 LEU LEU A . n 
C 3 319 LEU 319 319 319 LEU LEU A . n 
C 3 320 GLN 320 320 320 GLN GLN A . n 
C 3 321 LYS 321 321 321 LYS LYS A . n 
C 3 322 ILE 322 322 322 ILE ILE A . n 
C 3 323 LEU 323 323 323 LEU LEU A . n 
C 3 324 GLU 324 324 324 GLU GLU A . n 
C 3 325 GLU 325 325 325 GLU GLU A . n 
C 3 326 ASP 326 326 326 ASP ASP A . n 
C 3 327 GLU 327 327 327 GLU GLU A . n 
C 3 328 ARG 328 328 328 ARG ARG A . n 
C 3 329 LYS 329 329 329 LYS LYS A . n 
C 3 330 ILE 330 330 330 ILE ILE A . n 
C 3 331 ARG 331 331 331 ARG ARG A . n 
C 3 332 ARG 332 332 332 ARG ARG A . n 
C 3 333 ILE 333 333 333 ILE ILE A . n 
C 3 334 GLY 334 334 334 GLY GLY A . n 
C 3 335 VAL 335 335 335 VAL VAL A . n 
C 3 336 ARG 336 336 336 ARG ARG A . n 
C 3 337 PHE 337 337 337 PHE PHE A . n 
C 3 338 SER 338 338 338 SER SER A . n 
C 3 339 LYS 339 339 339 LYS LYS A . n 
C 3 340 PHE 340 340 340 PHE PHE A . n 
C 3 341 ILE 341 341 341 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   4001 4001 CA  CA  A . 
E 5 MG  1   4002 4002 MG  MG  A . 
F 4 CA  1   4003 4003 CA  CA  A . 
G 6 DTP 1   1814 1814 DTP DTP A . 
H 7 HOH 1   14   12   HOH TIP B . 
H 7 HOH 2   15   18   HOH TIP B . 
H 7 HOH 3   16   21   HOH TIP B . 
H 7 HOH 4   17   38   HOH TIP B . 
H 7 HOH 5   18   45   HOH TIP B . 
H 7 HOH 6   19   48   HOH TIP B . 
H 7 HOH 7   20   56   HOH TIP B . 
H 7 HOH 8   21   58   HOH TIP B . 
H 7 HOH 9   22   62   HOH TIP B . 
H 7 HOH 10  23   102  HOH TIP B . 
H 7 HOH 11  24   122  HOH TIP B . 
H 7 HOH 12  25   4016 HOH TIP B . 
H 7 HOH 13  26   4023 HOH TIP B . 
H 7 HOH 14  27   4028 HOH TIP B . 
H 7 HOH 15  28   4033 HOH TIP B . 
I 7 HOH 1   18   15   HOH TIP C . 
I 7 HOH 2   19   25   HOH TIP C . 
I 7 HOH 3   20   29   HOH TIP C . 
I 7 HOH 4   21   33   HOH TIP C . 
I 7 HOH 5   22   46   HOH TIP C . 
I 7 HOH 6   23   57   HOH TIP C . 
I 7 HOH 7   24   67   HOH TIP C . 
I 7 HOH 8   25   75   HOH TIP C . 
I 7 HOH 9   26   80   HOH TIP C . 
I 7 HOH 10  27   81   HOH TIP C . 
I 7 HOH 11  28   82   HOH TIP C . 
I 7 HOH 12  29   86   HOH TIP C . 
I 7 HOH 13  30   91   HOH TIP C . 
I 7 HOH 14  31   103  HOH TIP C . 
I 7 HOH 15  32   118  HOH TIP C . 
I 7 HOH 16  33   119  HOH TIP C . 
I 7 HOH 17  34   121  HOH TIP C . 
I 7 HOH 18  35   125  HOH TIP C . 
I 7 HOH 19  36   4008 HOH TIP C . 
I 7 HOH 20  37   4009 HOH TIP C . 
I 7 HOH 21  38   4014 HOH TIP C . 
I 7 HOH 22  39   4015 HOH TIP C . 
I 7 HOH 23  40   4019 HOH TIP C . 
I 7 HOH 24  41   4026 HOH TIP C . 
I 7 HOH 25  42   4032 HOH TIP C . 
I 7 HOH 26  43   4038 HOH TIP C . 
J 7 HOH 1   4004 2    HOH TIP A . 
J 7 HOH 2   4005 3    HOH TIP A . 
J 7 HOH 3   4006 4    HOH TIP A . 
J 7 HOH 4   4007 5    HOH TIP A . 
J 7 HOH 5   4008 6    HOH TIP A . 
J 7 HOH 6   4009 7    HOH TIP A . 
J 7 HOH 7   4010 8    HOH TIP A . 
J 7 HOH 8   4011 9    HOH TIP A . 
J 7 HOH 9   4012 10   HOH TIP A . 
J 7 HOH 10  4013 11   HOH TIP A . 
J 7 HOH 11  4014 13   HOH TIP A . 
J 7 HOH 12  4015 14   HOH TIP A . 
J 7 HOH 13  4016 16   HOH TIP A . 
J 7 HOH 14  4017 17   HOH TIP A . 
J 7 HOH 15  4018 19   HOH TIP A . 
J 7 HOH 16  4019 20   HOH TIP A . 
J 7 HOH 17  4020 22   HOH TIP A . 
J 7 HOH 18  4021 23   HOH TIP A . 
J 7 HOH 19  4022 24   HOH TIP A . 
J 7 HOH 20  4023 26   HOH TIP A . 
J 7 HOH 21  4024 27   HOH TIP A . 
J 7 HOH 22  4025 28   HOH TIP A . 
J 7 HOH 23  4026 30   HOH TIP A . 
J 7 HOH 24  4027 31   HOH TIP A . 
J 7 HOH 25  4028 32   HOH TIP A . 
J 7 HOH 26  4029 34   HOH TIP A . 
J 7 HOH 27  4030 35   HOH TIP A . 
J 7 HOH 28  4031 36   HOH TIP A . 
J 7 HOH 29  4032 37   HOH TIP A . 
J 7 HOH 30  4033 39   HOH TIP A . 
J 7 HOH 31  4034 40   HOH TIP A . 
J 7 HOH 32  4035 41   HOH TIP A . 
J 7 HOH 33  4036 42   HOH TIP A . 
J 7 HOH 34  4037 43   HOH TIP A . 
J 7 HOH 35  4038 47   HOH TIP A . 
J 7 HOH 36  4039 49   HOH TIP A . 
J 7 HOH 37  4040 50   HOH TIP A . 
J 7 HOH 38  4041 51   HOH TIP A . 
J 7 HOH 39  4042 52   HOH TIP A . 
J 7 HOH 40  4043 53   HOH TIP A . 
J 7 HOH 41  4044 54   HOH TIP A . 
J 7 HOH 42  4045 55   HOH TIP A . 
J 7 HOH 43  4046 59   HOH TIP A . 
J 7 HOH 44  4047 60   HOH TIP A . 
J 7 HOH 45  4048 61   HOH TIP A . 
J 7 HOH 46  4049 63   HOH TIP A . 
J 7 HOH 47  4050 64   HOH TIP A . 
J 7 HOH 48  4051 65   HOH TIP A . 
J 7 HOH 49  4052 66   HOH TIP A . 
J 7 HOH 50  4053 68   HOH TIP A . 
J 7 HOH 51  4054 69   HOH TIP A . 
J 7 HOH 52  4055 70   HOH TIP A . 
J 7 HOH 53  4056 71   HOH TIP A . 
J 7 HOH 54  4057 72   HOH TIP A . 
J 7 HOH 55  4058 73   HOH TIP A . 
J 7 HOH 56  4059 74   HOH TIP A . 
J 7 HOH 57  4060 76   HOH TIP A . 
J 7 HOH 58  4061 77   HOH TIP A . 
J 7 HOH 59  4062 78   HOH TIP A . 
J 7 HOH 60  4063 79   HOH TIP A . 
J 7 HOH 61  4064 83   HOH TIP A . 
J 7 HOH 62  4065 84   HOH TIP A . 
J 7 HOH 63  4066 85   HOH TIP A . 
J 7 HOH 64  4067 87   HOH TIP A . 
J 7 HOH 65  4068 88   HOH TIP A . 
J 7 HOH 66  4069 89   HOH TIP A . 
J 7 HOH 67  4070 90   HOH TIP A . 
J 7 HOH 68  4071 92   HOH TIP A . 
J 7 HOH 69  4072 93   HOH TIP A . 
J 7 HOH 70  4073 94   HOH TIP A . 
J 7 HOH 71  4074 95   HOH TIP A . 
J 7 HOH 72  4075 96   HOH TIP A . 
J 7 HOH 73  4076 97   HOH TIP A . 
J 7 HOH 74  4077 98   HOH TIP A . 
J 7 HOH 75  4078 99   HOH TIP A . 
J 7 HOH 76  4079 100  HOH TIP A . 
J 7 HOH 77  4080 104  HOH TIP A . 
J 7 HOH 78  4081 105  HOH TIP A . 
J 7 HOH 79  4082 106  HOH TIP A . 
J 7 HOH 80  4083 107  HOH TIP A . 
J 7 HOH 81  4084 108  HOH TIP A . 
J 7 HOH 82  4085 109  HOH TIP A . 
J 7 HOH 83  4086 110  HOH TIP A . 
J 7 HOH 84  4087 111  HOH TIP A . 
J 7 HOH 85  4088 113  HOH TIP A . 
J 7 HOH 86  4089 114  HOH TIP A . 
J 7 HOH 87  4090 115  HOH TIP A . 
J 7 HOH 88  4091 116  HOH TIP A . 
J 7 HOH 89  4092 117  HOH TIP A . 
J 7 HOH 90  4093 120  HOH TIP A . 
J 7 HOH 91  4094 123  HOH TIP A . 
J 7 HOH 92  4095 124  HOH TIP A . 
J 7 HOH 93  4096 126  HOH TIP A . 
J 7 HOH 94  4097 127  HOH TIP A . 
J 7 HOH 95  4098 128  HOH TIP A . 
J 7 HOH 96  4099 129  HOH TIP A . 
J 7 HOH 97  4100 4004 HOH TIP A . 
J 7 HOH 98  4101 4005 HOH TIP A . 
J 7 HOH 99  4102 4006 HOH TIP A . 
J 7 HOH 100 4103 4007 HOH TIP A . 
J 7 HOH 101 4104 4010 HOH TIP A . 
J 7 HOH 102 4105 4011 HOH TIP A . 
J 7 HOH 103 4106 4012 HOH TIP A . 
J 7 HOH 104 4107 4013 HOH TIP A . 
J 7 HOH 105 4108 4017 HOH TIP A . 
J 7 HOH 106 4109 4018 HOH TIP A . 
J 7 HOH 107 4110 4020 HOH TIP A . 
J 7 HOH 108 4111 4021 HOH TIP A . 
J 7 HOH 109 4112 4022 HOH TIP A . 
J 7 HOH 110 4113 4024 HOH TIP A . 
J 7 HOH 111 4114 4025 HOH TIP A . 
J 7 HOH 112 4115 4027 HOH TIP A . 
J 7 HOH 113 4116 4029 HOH TIP A . 
J 7 HOH 114 4117 4030 HOH TIP A . 
J 7 HOH 115 4118 4034 HOH TIP A . 
J 7 HOH 116 4119 4035 HOH TIP A . 
J 7 HOH 117 4120 4037 HOH TIP A . 
J 7 HOH 118 4121 4039 HOH TIP A . 
J 7 HOH 119 4122 4040 HOH TIP A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    DOC 
_pdbx_struct_mod_residue.label_seq_id     13 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     DOC 
_pdbx_struct_mod_residue.auth_seq_id      13 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DC 
_pdbx_struct_mod_residue.details          "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD2 ? C ASP 105 ? A ASP 105  ? 1_555 89.4  ? 
2  O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1G ? G DTP .   ? A DTP 1814 ? 1_555 96.3  ? 
3  OD2 ? C ASP 105 ? A ASP 105  ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1G ? G DTP .   ? A DTP 1814 ? 1_555 174.2 ? 
4  O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O2B ? G DTP .   ? A DTP 1814 ? 1_555 89.3  ? 
5  OD2 ? C ASP 105 ? A ASP 105  ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O2B ? G DTP .   ? A DTP 1814 ? 1_555 85.9  ? 
6  O1G ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O2B ? G DTP .   ? A DTP 1814 ? 1_555 93.0  ? 
7  O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O3B ? G DTP .   ? A DTP 1814 ? 1_555 104.4 ? 
8  OD2 ? C ASP 105 ? A ASP 105  ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O3B ? G DTP .   ? A DTP 1814 ? 1_555 131.8 ? 
9  O1G ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O3B ? G DTP .   ? A DTP 1814 ? 1_555 45.4  ? 
10 O2B ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O3B ? G DTP .   ? A DTP 1814 ? 1_555 49.3  ? 
11 O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1A ? G DTP .   ? A DTP 1814 ? 1_555 166.3 ? 
12 OD2 ? C ASP 105 ? A ASP 105  ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1A ? G DTP .   ? A DTP 1814 ? 1_555 89.0  ? 
13 O1G ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1A ? G DTP .   ? A DTP 1814 ? 1_555 85.2  ? 
14 O2B ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1A ? G DTP .   ? A DTP 1814 ? 1_555 77.1  ? 
15 O3B ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 O1A ? G DTP .   ? A DTP 1814 ? 1_555 67.1  ? 
16 O   ? C PHE 8   ? A PHE 8    ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 83.4  ? 
17 OD2 ? C ASP 105 ? A ASP 105  ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 86.3  ? 
18 O1G ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 95.5  ? 
19 O2B ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 169.3 ? 
20 O3B ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 140.3 ? 
21 O1A ? G DTP .   ? A DTP 1814 ? 1_555 CA ? D CA . ? A CA 4001 ? 1_555 OD1 ? C ASP 7   ? A ASP 7    ? 1_555 110.1 ? 
22 O   ? J HOH .   ? A HOH 4004 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 O   ? J HOH .   ? A HOH 4032 ? 1_555 162.2 ? 
23 O   ? J HOH .   ? A HOH 4004 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 7   ? A ASP 7    ? 1_555 83.1  ? 
24 O   ? J HOH .   ? A HOH 4032 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OD2 ? C ASP 7   ? A ASP 7    ? 1_555 79.6  ? 
25 O   ? J HOH .   ? A HOH 4004 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OP1 ? A DOC 13  ? B DOC 13   ? 1_555 123.3 ? 
26 O   ? J HOH .   ? A HOH 4032 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OP1 ? A DOC 13  ? B DOC 13   ? 1_555 74.4  ? 
27 OD2 ? C ASP 7   ? A ASP 7    ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OP1 ? A DOC 13  ? B DOC 13   ? 1_555 152.8 ? 
28 O   ? J HOH .   ? A HOH 4004 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 O   ? J HOH .   ? A HOH 4100 ? 1_555 77.1  ? 
29 O   ? J HOH .   ? A HOH 4032 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 O   ? J HOH .   ? A HOH 4100 ? 1_555 108.1 ? 
30 OD2 ? C ASP 7   ? A ASP 7    ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 O   ? J HOH .   ? A HOH 4100 ? 1_555 93.7  ? 
31 OP1 ? A DOC 13  ? B DOC 13   ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 O   ? J HOH .   ? A HOH 4100 ? 1_555 86.8  ? 
32 O   ? J HOH .   ? A HOH 4004 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OE2 ? C GLU 106 ? A GLU 106  ? 1_555 93.5  ? 
33 O   ? J HOH .   ? A HOH 4032 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OE2 ? C GLU 106 ? A GLU 106  ? 1_555 85.4  ? 
34 OD2 ? C ASP 7   ? A ASP 7    ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OE2 ? C GLU 106 ? A GLU 106  ? 1_555 100.0 ? 
35 OP1 ? A DOC 13  ? B DOC 13   ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OE2 ? C GLU 106 ? A GLU 106  ? 1_555 86.0  ? 
36 O   ? J HOH .   ? A HOH 4100 ? 1_555 MG ? E MG . ? A MG 4002 ? 1_555 OE2 ? C GLU 106 ? A GLU 106  ? 1_555 162.4 ? 
37 O   ? H HOH .   ? B HOH 28   ? 1_555 CA ? F CA . ? A CA 4003 ? 1_555 O   ? C ILE 186 ? A ILE 186  ? 1_555 79.0  ? 
38 O   ? H HOH .   ? B HOH 28   ? 1_555 CA ? F CA . ? A CA 4003 ? 1_555 O   ? C ALA 181 ? A ALA 181  ? 1_555 171.3 ? 
39 O   ? C ILE 186 ? A ILE 186  ? 1_555 CA ? F CA . ? A CA 4003 ? 1_555 O   ? C ALA 181 ? A ALA 181  ? 1_555 93.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         1.1   ?               package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 1.700 'May. 30, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CNS         .     ?               ?       ?                    ?                        phasing           ? ?          ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   "O4'" 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   DA 
_pdbx_validate_close_contact.auth_seq_id_1    5 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    19 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 10  ? ? 21.30   53.58   
2 1 SER A 96  ? ? -179.53 139.92  
3 1 SER A 103 ? ? -171.20 -169.87 
4 1 ARG A 256 ? ? -146.24 30.74   
5 1 ASP A 277 ? ? 31.78   82.77   
6 1 LYS A 278 ? ? 84.14   -23.36  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2AGQ 'double helix'        
2AGQ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG  1  1_555 B DC 17 1_555 -0.289 -0.078 -0.363 -5.752 -5.181  -6.605 1  B_DG1:DC17_C  B 1  ? C 17 ? 19 1 
1 A DG  2  1_555 B DC 16 1_555 0.020  -0.202 -0.201 7.639  -5.768  -0.002 2  B_DG2:DC16_C  B 2  ? C 16 ? 19 1 
1 A DC  3  1_555 B DG 15 1_555 -0.018 -0.393 -0.199 5.243  -11.559 -1.987 3  B_DC3:DG15_C  B 3  ? C 15 ? 19 1 
1 A DT  4  1_555 B DA 14 1_555 0.352  -0.205 -0.118 0.811  -7.688  1.619  4  B_DT4:DA14_C  B 4  ? C 14 ? 20 1 
1 A DA  5  1_555 B DT 13 1_555 0.349  0.057  -0.140 1.181  -7.764  1.704  5  B_DA5:DT13_C  B 5  ? C 13 ? 20 1 
1 A DC  6  1_555 B DG 12 1_555 0.259  0.038  -0.040 1.979  -5.922  4.207  6  B_DC6:DG12_C  B 6  ? C 12 ? 19 1 
1 A DA  7  1_555 B DT 11 1_555 0.334  -0.194 0.085  -0.288 -6.455  4.067  7  B_DA7:DT11_C  B 7  ? C 11 ? 20 1 
1 A DG  8  1_555 B DC 10 1_555 -0.169 -0.048 0.196  1.802  -4.103  0.235  8  B_DG8:DC10_C  B 8  ? C 10 ? 19 1 
1 A DG  9  1_555 B DC 9  1_555 -0.158 -0.111 -0.290 -4.242 -9.787  0.754  9  B_DG9:DC9_C   B 9  ? C 9  ? 19 1 
1 A DA  10 1_555 B DT 8  1_555 0.033  -0.192 -0.104 6.731  -3.990  0.447  10 B_DA10:DT8_C  B 10 ? C 8  ? 20 1 
1 A DC  11 1_555 B DG 7  1_555 0.157  -0.127 -0.300 5.675  1.336   -1.951 11 B_DC11:DG7_C  B 11 ? C 7  ? 19 1 
1 A DT  12 1_555 B DA 6  1_555 -0.225 -0.189 -0.547 11.108 -4.944  1.333  12 B_DT12:DA6_C  B 12 ? C 6  ? 20 1 
1 A DOC 13 1_555 B DG 5  1_555 0.344  -0.259 -0.467 3.425  -6.458  -2.399 13 B_DOC13:DG5_C B 13 ? C 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 17 1_555 A DG  2  1_555 B DC 16 1_555 0.593  0.134  3.076 -1.889 3.924  32.522 -0.395 -1.355 3.032 6.967  
3.354  32.805 1  BB_DG1DG2:DC16DC17_CC  B 1  ? C 17 ? B 2  ? C 16 ? 
1 A DG 2  1_555 B DC 16 1_555 A DC  3  1_555 B DG 15 1_555 -0.899 -0.208 3.261 -3.614 2.563  34.614 -0.739 0.947  3.311 4.286  
6.044  34.887 2  BB_DG2DC3:DG15DC16_CC  B 2  ? C 16 ? B 3  ? C 15 ? 
1 A DC 3  1_555 B DG 15 1_555 A DT  4  1_555 B DA 14 1_555 0.518  -0.140 3.409 2.500  8.349  39.812 -1.165 -0.456 3.339 12.086 
-3.618 40.717 3  BB_DC3DT4:DA14DG15_CC  B 3  ? C 15 ? B 4  ? C 14 ? 
1 A DT 4  1_555 B DA 14 1_555 A DA  5  1_555 B DT 13 1_555 -0.217 0.477  3.367 1.644  13.624 33.002 -1.315 0.607  3.290 22.794 
-2.750 35.668 4  BB_DT4DA5:DT13DA14_CC  B 4  ? C 14 ? B 5  ? C 13 ? 
1 A DA 5  1_555 B DT 13 1_555 A DC  6  1_555 B DG 12 1_555 0.083  -0.218 3.268 -1.503 7.063  29.284 -1.846 -0.462 3.123 13.709 
2.916  30.142 5  BB_DA5DC6:DG12DT13_CC  B 5  ? C 13 ? B 6  ? C 12 ? 
1 A DC 6  1_555 B DG 12 1_555 A DA  7  1_555 B DT 11 1_555 0.312  0.550  3.356 2.054  9.142  38.632 -0.307 -0.209 3.406 13.576 
-3.050 39.710 6  BB_DC6DA7:DT11DG12_CC  B 6  ? C 12 ? B 7  ? C 11 ? 
1 A DA 7  1_555 B DT 11 1_555 A DG  8  1_555 B DC 10 1_555 -0.084 -0.412 3.333 -3.086 0.351  31.515 -0.820 -0.427 3.321 0.644  
5.664  31.664 7  BB_DA7DG8:DC10DT11_CC  B 7  ? C 11 ? B 8  ? C 10 ? 
1 A DG 8  1_555 B DC 10 1_555 A DG  9  1_555 B DC 9  1_555 -0.195 -0.747 3.633 3.933  2.487  35.916 -1.587 0.921  3.535 4.012  
-6.345 36.207 8  BB_DG8DG9:DC9DC10_CC   B 8  ? C 10 ? B 9  ? C 9  ? 
1 A DG 9  1_555 B DC 9  1_555 A DA  10 1_555 B DT 8  1_555 0.282  -0.254 3.095 -0.179 2.112  31.592 -0.834 -0.548 3.070 3.873  
0.328  31.661 9  BB_DG9DA10:DT8DC9_CC   B 9  ? C 9  ? B 10 ? C 8  ? 
1 A DA 10 1_555 B DT 8  1_555 A DC  11 1_555 B DG 7  1_555 0.307  -0.900 3.458 -0.182 4.143  32.770 -2.314 -0.573 3.321 7.307  
0.321  33.025 10 BB_DA10DC11:DG7DT8_CC  B 10 ? C 8  ? B 11 ? C 7  ? 
1 A DC 11 1_555 B DG 7  1_555 A DT  12 1_555 B DA 6  1_555 -0.018 -0.705 3.296 1.887  3.679  26.039 -2.523 0.541  3.158 8.099  
-4.155 26.360 11 BB_DC11DT12:DA6DG7_CC  B 11 ? C 7  ? B 12 ? C 6  ? 
1 A DT 12 1_555 B DA 6  1_555 A DOC 13 1_555 B DG 5  1_555 0.177  -0.661 3.610 0.278  7.803  35.612 -2.232 -0.242 3.395 12.573 
-0.448 36.430 12 BB_DT12DOC13:DG5DA6_CC B 12 ? C 6  ? B 13 ? C 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                       CA  
5 'MAGNESIUM ION'                     MG  
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 water                               HOH 
#