data_2AIN
# 
_entry.id   2AIN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2AIN         pdb_00002ain 10.2210/pdb2ain/pdb 
RCSB  RCSB033938   ?            ?                   
WWPDB D_1000033938 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1T2M 
_pdbx_database_related.details        'Solution structure of the AF-6 PDZ domain' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AIN 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, Q.' 1 
'Wu, J.'   2 
'Shi, Y.'  3 
# 
_citation.id                        primary 
_citation.title                     'Solution structure and backbone dynamics of the AF-6 PDZ domain/Bcr peptide complex.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            16 
_citation.page_first                1053 
_citation.page_last                 1062 
_citation.year                      2007 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17473018 
_citation.pdbx_database_id_DOI      10.1110/ps.062440607 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chen, Q.' 1 ? 
primary 'Niu, X.'  2 ? 
primary 'Xu, Y.'   3 ? 
primary 'Wu, J.'   4 ? 
primary 'Shi, Y.'  5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Afadin                                                 9566.045 1 ?       ? 'AF-6 PDZ domain'    ? 
2 polymer syn '6-mer peptide from Breakpoint cluster region protein' 694.773  1 2.7.1.- ? 'C-terminal peptide' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AF-6 protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRT
SSVVTLEVAKQGA
;
;MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRT
SSVVTLEVAKQGA
;
A ? 
2 'polypeptide(L)' no no LFSTEV                                                                                           LFSTEV B 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LYS n 
1 3  GLU n 
1 4  PRO n 
1 5  GLU n 
1 6  ILE n 
1 7  ILE n 
1 8  THR n 
1 9  VAL n 
1 10 THR n 
1 11 LEU n 
1 12 LYS n 
1 13 LYS n 
1 14 GLN n 
1 15 ASN n 
1 16 GLY n 
1 17 MET n 
1 18 GLY n 
1 19 LEU n 
1 20 SER n 
1 21 ILE n 
1 22 VAL n 
1 23 ALA n 
1 24 ALA n 
1 25 LYS n 
1 26 GLY n 
1 27 ALA n 
1 28 GLY n 
1 29 GLN n 
1 30 ASP n 
1 31 LYS n 
1 32 LEU n 
1 33 GLY n 
1 34 ILE n 
1 35 TYR n 
1 36 VAL n 
1 37 LYS n 
1 38 SER n 
1 39 VAL n 
1 40 VAL n 
1 41 LYS n 
1 42 GLY n 
1 43 GLY n 
1 44 ALA n 
1 45 ALA n 
1 46 ASP n 
1 47 VAL n 
1 48 ASP n 
1 49 GLY n 
1 50 ARG n 
1 51 LEU n 
1 52 ALA n 
1 53 ALA n 
1 54 GLY n 
1 55 ASP n 
1 56 GLN n 
1 57 LEU n 
1 58 LEU n 
1 59 SER n 
1 60 VAL n 
1 61 ASP n 
1 62 GLY n 
1 63 ARG n 
1 64 SER n 
1 65 LEU n 
1 66 VAL n 
1 67 GLY n 
1 68 LEU n 
1 69 SER n 
1 70 GLN n 
1 71 GLU n 
1 72 ARG n 
1 73 ALA n 
1 74 ALA n 
1 75 GLU n 
1 76 LEU n 
1 77 MET n 
1 78 THR n 
1 79 ARG n 
1 80 THR n 
1 81 SER n 
1 82 SER n 
1 83 VAL n 
1 84 VAL n 
1 85 THR n 
1 86 LEU n 
1 87 GLU n 
1 88 VAL n 
1 89 ALA n 
1 90 LYS n 
1 91 GLN n 
1 92 GLY n 
1 93 ALA n 
2 1  LEU n 
2 2  PHE n 
2 3  SER n 
2 4  THR n 
2 5  GLU n 
2 6  VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET22b (+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP AFAD_HUMAN P55196 1 987  ? ? 
2 UNP BCR_HUMAN  P11274 2 1266 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AIN A 2 ? 93 ? P55196 987  ? 1077 ? 2  93  
2 2 2AIN B 1 ? 6  ? P11274 1266 ? 1271 ? 99 104 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2AIN 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P55196 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'initiating methionine' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
3 1 DQF-COSY               1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  5.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'2.0mM 15N, 13C-labeled AF-6 PDZ domain, 50mM phosphate buffer (pH 5.9), 1mM EDTA, 10%(v/v) D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 500 ? 
2 DMX Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           2AIN 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' 
_pdbx_nmr_refine.details            
;The complex structure is solved using a total of 1606 experimental restraints that includes 1471 intramolecular NOEs, 61 intermolecular NOEs and 74 dihedral angles restraints
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2AIN 
_pdbx_nmr_details.text       
'Intermolecular interactions were identified in a 13C/15N-filtered (F1), 13C-edited(F3) 3D NOESY spectrum' 
# 
_pdbx_nmr_ensemble.entry_id                                      2AIN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2AIN 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPipe 2.2  F.Delaglio                    1 
'data analysis'      Sparky  3    'T.D.Goddard and D.G.Kneller' 2 
'structure solution' CNS     1.1  A.T.Brunger                   3 
'data analysis'      CSI     1.0  'David S. Wishart'            4 
'data analysis'      MOLMOL  2K.2 Koradi                        5 
refinement           CNS     1.1  ?                             6 
# 
_exptl.entry_id          2AIN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2AIN 
_struct.title                     
'Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the Bcr protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AIN 
_struct_keywords.pdbx_keywords   'CELL ADHESION/Transferase' 
_struct_keywords.text            'AF-6 PDZ domain-Bcr complex, CELL ADHESION-Transferase COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 43 ? GLY A 49 ? GLY A 43 GLY A 49 1 ? 7  
HELX_P HELX_P2 2 SER A 69 ? ARG A 79 ? SER A 69 ARG A 79 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 5  ? LYS A 12 ? GLU A 5   LYS A 12  
A 2 VAL A 83 ? LYS A 90 ? VAL A 83  LYS A 90  
A 3 GLN A 56 ? VAL A 60 ? GLN A 56  VAL A 60  
A 4 ARG A 63 ? SER A 64 ? ARG A 63  SER A 64  
B 1 GLY A 33 ? VAL A 39 ? GLY A 33  VAL A 39  
B 2 LEU A 19 ? ALA A 24 ? LEU A 19  ALA A 24  
B 3 SER B 3  ? VAL B 6  ? SER B 101 VAL B 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 7  ? N ILE A 7  O VAL A 88 ? O VAL A 88  
A 2 3 O GLU A 87 ? O GLU A 87 N SER A 59 ? N SER A 59  
A 3 4 N VAL A 60 ? N VAL A 60 O ARG A 63 ? O ARG A 63  
B 1 2 O SER A 38 ? O SER A 38 N SER A 20 ? N SER A 20  
B 2 3 N ILE A 21 ? N ILE A 21 O THR B 4  ? O THR B 102 
# 
_database_PDB_matrix.entry_id          2AIN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AIN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -3.436  3.143   -20.697 1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? -3.749  4.294   -19.805 1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? -5.129  4.872   -20.113 1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1  ? -5.397  5.303   -21.236 1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? -2.664  5.372   -19.972 1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? -2.370  5.746   -21.419 1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? -1.375  7.243   -21.562 1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? -0.438  6.889   -23.048 1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? -2.431  2.907   -20.575 1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? -3.640  3.432   -21.676 1.00 0.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? -4.042  2.348   -20.409 1.00 0.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? -3.741  3.942   -18.785 1.00 0.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? -2.979  6.265   -19.453 1.00 0.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? -1.748  5.013   -19.524 1.00 0.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? -1.834  4.932   -21.885 1.00 0.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? -3.305  5.902   -21.935 1.00 0.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? -0.764  5.947   -23.463 1.00 0.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? 0.613   6.831   -22.806 1.00 0.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? -0.598  7.675   -23.770 1.00 0.00 ? 1   MET A HE3  1  
ATOM 20    N N    . LYS A 1 2  ? -6.004  4.869   -19.107 1.00 0.00 ? 2   LYS A N    1  
ATOM 21    C CA   . LYS A 1 2  ? -7.362  5.388   -19.262 1.00 0.00 ? 2   LYS A CA   1  
ATOM 22    C C    . LYS A 1 2  ? -7.975  5.738   -17.904 1.00 0.00 ? 2   LYS A C    1  
ATOM 23    O O    . LYS A 1 2  ? -9.152  5.465   -17.658 1.00 0.00 ? 2   LYS A O    1  
ATOM 24    C CB   . LYS A 1 2  ? -8.241  4.362   -19.987 1.00 0.00 ? 2   LYS A CB   1  
ATOM 25    C CG   . LYS A 1 2  ? -9.286  4.990   -20.899 1.00 0.00 ? 2   LYS A CG   1  
ATOM 26    C CD   . LYS A 1 2  ? -10.644 4.318   -20.740 1.00 0.00 ? 2   LYS A CD   1  
ATOM 27    C CE   . LYS A 1 2  ? -11.675 5.262   -20.133 1.00 0.00 ? 2   LYS A CE   1  
ATOM 28    N NZ   . LYS A 1 2  ? -11.685 5.200   -18.644 1.00 0.00 ? 2   LYS A NZ   1  
ATOM 29    H H    . LYS A 1 2  ? -5.730  4.506   -18.237 1.00 0.00 ? 2   LYS A H    1  
ATOM 30    H HA   . LYS A 1 2  ? -7.306  6.287   -19.860 1.00 0.00 ? 2   LYS A HA   1  
ATOM 31    H HB2  . LYS A 1 2  ? -7.609  3.722   -20.584 1.00 0.00 ? 2   LYS A HB2  1  
ATOM 32    H HB3  . LYS A 1 2  ? -8.752  3.762   -19.250 1.00 0.00 ? 2   LYS A HB3  1  
ATOM 33    H HG2  . LYS A 1 2  ? -9.381  6.037   -20.655 1.00 0.00 ? 2   LYS A HG2  1  
ATOM 34    H HG3  . LYS A 1 2  ? -8.961  4.887   -21.925 1.00 0.00 ? 2   LYS A HG3  1  
ATOM 35    H HD2  . LYS A 1 2  ? -10.993 4.002   -21.712 1.00 0.00 ? 2   LYS A HD2  1  
ATOM 36    H HD3  . LYS A 1 2  ? -10.536 3.456   -20.098 1.00 0.00 ? 2   LYS A HD3  1  
ATOM 37    H HE2  . LYS A 1 2  ? -11.446 6.271   -20.440 1.00 0.00 ? 2   LYS A HE2  1  
ATOM 38    H HE3  . LYS A 1 2  ? -12.653 4.989   -20.503 1.00 0.00 ? 2   LYS A HE3  1  
ATOM 39    H HZ1  . LYS A 1 2  ? -11.430 4.244   -18.322 1.00 0.00 ? 2   LYS A HZ1  1  
ATOM 40    H HZ2  . LYS A 1 2  ? -12.632 5.432   -18.282 1.00 0.00 ? 2   LYS A HZ2  1  
ATOM 41    H HZ3  . LYS A 1 2  ? -11.000 5.879   -18.252 1.00 0.00 ? 2   LYS A HZ3  1  
ATOM 42    N N    . GLU A 1 3  ? -7.169  6.347   -17.029 1.00 0.00 ? 3   GLU A N    1  
ATOM 43    C CA   . GLU A 1 3  ? -7.619  6.745   -15.694 1.00 0.00 ? 3   GLU A CA   1  
ATOM 44    C C    . GLU A 1 3  ? -8.042  5.534   -14.858 1.00 0.00 ? 3   GLU A C    1  
ATOM 45    O O    . GLU A 1 3  ? -9.160  5.030   -14.997 1.00 0.00 ? 3   GLU A O    1  
ATOM 46    C CB   . GLU A 1 3  ? -8.772  7.745   -15.791 1.00 0.00 ? 3   GLU A CB   1  
ATOM 47    C CG   . GLU A 1 3  ? -8.505  8.892   -16.754 1.00 0.00 ? 3   GLU A CG   1  
ATOM 48    C CD   . GLU A 1 3  ? -9.294  10.142  -16.413 1.00 0.00 ? 3   GLU A CD   1  
ATOM 49    O OE1  . GLU A 1 3  ? -9.340  10.512  -15.219 1.00 0.00 ? 3   GLU A OE1  1  
ATOM 50    O OE2  . GLU A 1 3  ? -9.864  10.753  -17.341 1.00 0.00 ? 3   GLU A OE2  1  
ATOM 51    H H    . GLU A 1 3  ? -6.246  6.541   -17.290 1.00 0.00 ? 3   GLU A H    1  
ATOM 52    H HA   . GLU A 1 3  ? -6.788  7.226   -15.202 1.00 0.00 ? 3   GLU A HA   1  
ATOM 53    H HB2  . GLU A 1 3  ? -9.661  7.225   -16.121 1.00 0.00 ? 3   GLU A HB2  1  
ATOM 54    H HB3  . GLU A 1 3  ? -8.952  8.160   -14.811 1.00 0.00 ? 3   GLU A HB3  1  
ATOM 55    H HG2  . GLU A 1 3  ? -7.452  9.132   -16.725 1.00 0.00 ? 3   GLU A HG2  1  
ATOM 56    H HG3  . GLU A 1 3  ? -8.773  8.575   -17.751 1.00 0.00 ? 3   GLU A HG3  1  
ATOM 57    N N    . PRO A 1 4  ? -7.148  5.050   -13.972 1.00 0.00 ? 4   PRO A N    1  
ATOM 58    C CA   . PRO A 1 4  ? -7.430  3.894   -13.108 1.00 0.00 ? 4   PRO A CA   1  
ATOM 59    C C    . PRO A 1 4  ? -8.514  4.179   -12.063 1.00 0.00 ? 4   PRO A C    1  
ATOM 60    O O    . PRO A 1 4  ? -9.139  5.242   -12.076 1.00 0.00 ? 4   PRO A O    1  
ATOM 61    C CB   . PRO A 1 4  ? -6.086  3.623   -12.425 1.00 0.00 ? 4   PRO A CB   1  
ATOM 62    C CG   . PRO A 1 4  ? -5.362  4.924   -12.473 1.00 0.00 ? 4   PRO A CG   1  
ATOM 63    C CD   . PRO A 1 4  ? -5.793  5.590   -13.748 1.00 0.00 ? 4   PRO A CD   1  
ATOM 64    H HA   . PRO A 1 4  ? -7.719  3.031   -13.692 1.00 0.00 ? 4   PRO A HA   1  
ATOM 65    H HB2  . PRO A 1 4  ? -6.255  3.302   -11.408 1.00 0.00 ? 4   PRO A HB2  1  
ATOM 66    H HB3  . PRO A 1 4  ? -5.553  2.856   -12.967 1.00 0.00 ? 4   PRO A HB3  1  
ATOM 67    H HG2  . PRO A 1 4  ? -5.639  5.530   -11.622 1.00 0.00 ? 4   PRO A HG2  1  
ATOM 68    H HG3  . PRO A 1 4  ? -4.296  4.752   -12.481 1.00 0.00 ? 4   PRO A HG3  1  
ATOM 69    H HD2  . PRO A 1 4  ? -5.819  6.663   -13.623 1.00 0.00 ? 4   PRO A HD2  1  
ATOM 70    H HD3  . PRO A 1 4  ? -5.132  5.318   -14.558 1.00 0.00 ? 4   PRO A HD3  1  
ATOM 71    N N    . GLU A 1 5  ? -8.731  3.219   -11.162 1.00 0.00 ? 5   GLU A N    1  
ATOM 72    C CA   . GLU A 1 5  ? -9.738  3.355   -10.113 1.00 0.00 ? 5   GLU A CA   1  
ATOM 73    C C    . GLU A 1 5  ? -9.092  3.354   -8.733  1.00 0.00 ? 5   GLU A C    1  
ATOM 74    O O    . GLU A 1 5  ? -8.864  2.300   -8.136  1.00 0.00 ? 5   GLU A O    1  
ATOM 75    C CB   . GLU A 1 5  ? -10.763 2.225   -10.217 1.00 0.00 ? 5   GLU A CB   1  
ATOM 76    C CG   . GLU A 1 5  ? -11.957 2.391   -9.289  1.00 0.00 ? 5   GLU A CG   1  
ATOM 77    C CD   . GLU A 1 5  ? -12.668 1.081   -9.015  1.00 0.00 ? 5   GLU A CD   1  
ATOM 78    O OE1  . GLU A 1 5  ? -12.151 0.281   -8.204  1.00 0.00 ? 5   GLU A OE1  1  
ATOM 79    O OE2  . GLU A 1 5  ? -13.741 0.852   -9.611  1.00 0.00 ? 5   GLU A OE2  1  
ATOM 80    H H    . GLU A 1 5  ? -8.201  2.397   -11.203 1.00 0.00 ? 5   GLU A H    1  
ATOM 81    H HA   . GLU A 1 5  ? -10.242 4.299   -10.259 1.00 0.00 ? 5   GLU A HA   1  
ATOM 82    H HB2  . GLU A 1 5  ? -11.126 2.182   -11.231 1.00 0.00 ? 5   GLU A HB2  1  
ATOM 83    H HB3  . GLU A 1 5  ? -10.277 1.290   -9.979  1.00 0.00 ? 5   GLU A HB3  1  
ATOM 84    H HG2  . GLU A 1 5  ? -11.614 2.800   -8.350  1.00 0.00 ? 5   GLU A HG2  1  
ATOM 85    H HG3  . GLU A 1 5  ? -12.656 3.077   -9.745  1.00 0.00 ? 5   GLU A HG3  1  
ATOM 86    N N    . ILE A 1 6  ? -8.803  4.548   -8.235  1.00 0.00 ? 6   ILE A N    1  
ATOM 87    C CA   . ILE A 1 6  ? -8.184  4.709   -6.925  1.00 0.00 ? 6   ILE A CA   1  
ATOM 88    C C    . ILE A 1 6  ? -9.251  4.852   -5.838  1.00 0.00 ? 6   ILE A C    1  
ATOM 89    O O    . ILE A 1 6  ? -10.208 5.613   -5.997  1.00 0.00 ? 6   ILE A O    1  
ATOM 90    C CB   . ILE A 1 6  ? -7.260  5.944   -6.904  1.00 0.00 ? 6   ILE A CB   1  
ATOM 91    C CG1  . ILE A 1 6  ? -6.202  5.843   -8.007  1.00 0.00 ? 6   ILE A CG1  1  
ATOM 92    C CG2  . ILE A 1 6  ? -6.596  6.103   -5.543  1.00 0.00 ? 6   ILE A CG2  1  
ATOM 93    C CD1  . ILE A 1 6  ? -5.889  7.170   -8.664  1.00 0.00 ? 6   ILE A CD1  1  
ATOM 94    H H    . ILE A 1 6  ? -9.013  5.345   -8.764  1.00 0.00 ? 6   ILE A H    1  
ATOM 95    H HA   . ILE A 1 6  ? -7.588  3.831   -6.723  1.00 0.00 ? 6   ILE A HA   1  
ATOM 96    H HB   . ILE A 1 6  ? -7.868  6.816   -7.084  1.00 0.00 ? 6   ILE A HB   1  
ATOM 97    H HG12 . ILE A 1 6  ? -5.286  5.458   -7.585  1.00 0.00 ? 6   ILE A HG12 1  
ATOM 98    H HG13 . ILE A 1 6  ? -6.552  5.167   -8.774  1.00 0.00 ? 6   ILE A HG13 1  
ATOM 99    H HG21 . ILE A 1 6  ? -7.203  6.741   -4.918  1.00 0.00 ? 6   ILE A HG21 1  
ATOM 100   H HG22 . ILE A 1 6  ? -5.620  6.549   -5.669  1.00 0.00 ? 6   ILE A HG22 1  
ATOM 101   H HG23 . ILE A 1 6  ? -6.492  5.135   -5.076  1.00 0.00 ? 6   ILE A HG23 1  
ATOM 102   H HD11 . ILE A 1 6  ? -6.442  7.955   -8.169  1.00 0.00 ? 6   ILE A HD11 1  
ATOM 103   H HD12 . ILE A 1 6  ? -6.172  7.132   -9.705  1.00 0.00 ? 6   ILE A HD12 1  
ATOM 104   H HD13 . ILE A 1 6  ? -4.831  7.371   -8.584  1.00 0.00 ? 6   ILE A HD13 1  
ATOM 105   N N    . ILE A 1 7  ? -9.078  4.117   -4.737  1.00 0.00 ? 7   ILE A N    1  
ATOM 106   C CA   . ILE A 1 7  ? -10.027 4.163   -3.624  1.00 0.00 ? 7   ILE A CA   1  
ATOM 107   C C    . ILE A 1 7  ? -9.322  3.935   -2.288  1.00 0.00 ? 7   ILE A C    1  
ATOM 108   O O    . ILE A 1 7  ? -8.340  3.192   -2.212  1.00 0.00 ? 7   ILE A O    1  
ATOM 109   C CB   . ILE A 1 7  ? -11.153 3.112   -3.778  1.00 0.00 ? 7   ILE A CB   1  
ATOM 110   C CG1  . ILE A 1 7  ? -10.566 1.701   -3.889  1.00 0.00 ? 7   ILE A CG1  1  
ATOM 111   C CG2  . ILE A 1 7  ? -12.022 3.426   -4.989  1.00 0.00 ? 7   ILE A CG2  1  
ATOM 112   C CD1  . ILE A 1 7  ? -11.302 0.676   -3.055  1.00 0.00 ? 7   ILE A CD1  1  
ATOM 113   H H    . ILE A 1 7  ? -8.291  3.533   -4.669  1.00 0.00 ? 7   ILE A H    1  
ATOM 114   H HA   . ILE A 1 7  ? -10.479 5.144   -3.614  1.00 0.00 ? 7   ILE A HA   1  
ATOM 115   H HB   . ILE A 1 7  ? -11.779 3.163   -2.899  1.00 0.00 ? 7   ILE A HB   1  
ATOM 116   H HG12 . ILE A 1 7  ? -10.606 1.381   -4.920  1.00 0.00 ? 7   ILE A HG12 1  
ATOM 117   H HG13 . ILE A 1 7  ? -9.537  1.718   -3.562  1.00 0.00 ? 7   ILE A HG13 1  
ATOM 118   H HG21 . ILE A 1 7  ? -12.149 4.495   -5.074  1.00 0.00 ? 7   ILE A HG21 1  
ATOM 119   H HG22 . ILE A 1 7  ? -12.988 2.958   -4.869  1.00 0.00 ? 7   ILE A HG22 1  
ATOM 120   H HG23 . ILE A 1 7  ? -11.548 3.048   -5.883  1.00 0.00 ? 7   ILE A HG23 1  
ATOM 121   H HD11 . ILE A 1 7  ? -10.793 -0.274  -3.120  1.00 0.00 ? 7   ILE A HD11 1  
ATOM 122   H HD12 . ILE A 1 7  ? -12.311 0.569   -3.424  1.00 0.00 ? 7   ILE A HD12 1  
ATOM 123   H HD13 . ILE A 1 7  ? -11.328 1.001   -2.024  1.00 0.00 ? 7   ILE A HD13 1  
ATOM 124   N N    . THR A 1 8  ? -9.831  4.576   -1.237  1.00 0.00 ? 8   THR A N    1  
ATOM 125   C CA   . THR A 1 8  ? -9.254  4.443   0.098   1.00 0.00 ? 8   THR A CA   1  
ATOM 126   C C    . THR A 1 8  ? -10.204 3.696   1.031   1.00 0.00 ? 8   THR A C    1  
ATOM 127   O O    . THR A 1 8  ? -11.362 4.087   1.195   1.00 0.00 ? 8   THR A O    1  
ATOM 128   C CB   . THR A 1 8  ? -8.926  5.823   0.681   1.00 0.00 ? 8   THR A CB   1  
ATOM 129   O OG1  . THR A 1 8  ? -8.452  6.696   -0.330  1.00 0.00 ? 8   THR A OG1  1  
ATOM 130   C CG2  . THR A 1 8  ? -7.880  5.780   1.775   1.00 0.00 ? 8   THR A CG2  1  
ATOM 131   H H    . THR A 1 8  ? -10.616 5.150   -1.362  1.00 0.00 ? 8   THR A H    1  
ATOM 132   H HA   . THR A 1 8  ? -8.340  3.875   0.008   1.00 0.00 ? 8   THR A HA   1  
ATOM 133   H HB   . THR A 1 8  ? -9.827  6.247   1.102   1.00 0.00 ? 8   THR A HB   1  
ATOM 134   H HG1  . THR A 1 8  ? -8.617  7.606   -0.072  1.00 0.00 ? 8   THR A HG1  1  
ATOM 135   H HG21 . THR A 1 8  ? -6.987  5.302   1.401   1.00 0.00 ? 8   THR A HG21 1  
ATOM 136   H HG22 . THR A 1 8  ? -8.262  5.221   2.618   1.00 0.00 ? 8   THR A HG22 1  
ATOM 137   H HG23 . THR A 1 8  ? -7.647  6.786   2.088   1.00 0.00 ? 8   THR A HG23 1  
ATOM 138   N N    . VAL A 1 9  ? -9.708  2.619   1.637   1.00 0.00 ? 9   VAL A N    1  
ATOM 139   C CA   . VAL A 1 9  ? -10.512 1.814   2.553   1.00 0.00 ? 9   VAL A CA   1  
ATOM 140   C C    . VAL A 1 9  ? -10.184 2.132   4.010   1.00 0.00 ? 9   VAL A C    1  
ATOM 141   O O    . VAL A 1 9  ? -9.015  2.251   4.382   1.00 0.00 ? 9   VAL A O    1  
ATOM 142   C CB   . VAL A 1 9  ? -10.312 0.302   2.312   1.00 0.00 ? 9   VAL A CB   1  
ATOM 143   C CG1  . VAL A 1 9  ? -11.023 -0.130  1.038   1.00 0.00 ? 9   VAL A CG1  1  
ATOM 144   C CG2  . VAL A 1 9  ? -8.831  -0.052  2.254   1.00 0.00 ? 9   VAL A CG2  1  
ATOM 145   H H    . VAL A 1 9  ? -8.778  2.360   1.463   1.00 0.00 ? 9   VAL A H    1  
ATOM 146   H HA   . VAL A 1 9  ? -11.552 2.049   2.373   1.00 0.00 ? 9   VAL A HA   1  
ATOM 147   H HB   . VAL A 1 9  ? -10.755 -0.234  3.140   1.00 0.00 ? 9   VAL A HB   1  
ATOM 148   H HG11 . VAL A 1 9  ? -12.042 0.225   1.058   1.00 0.00 ? 9   VAL A HG11 1  
ATOM 149   H HG12 . VAL A 1 9  ? -11.018 -1.208  0.971   1.00 0.00 ? 9   VAL A HG12 1  
ATOM 150   H HG13 . VAL A 1 9  ? -10.513 0.287   0.183   1.00 0.00 ? 9   VAL A HG13 1  
ATOM 151   H HG21 . VAL A 1 9  ? -8.701  -1.098  2.487   1.00 0.00 ? 9   VAL A HG21 1  
ATOM 152   H HG22 . VAL A 1 9  ? -8.289  0.546   2.973   1.00 0.00 ? 9   VAL A HG22 1  
ATOM 153   H HG23 . VAL A 1 9  ? -8.452  0.147   1.263   1.00 0.00 ? 9   VAL A HG23 1  
ATOM 154   N N    . THR A 1 10 ? -11.225 2.265   4.828   1.00 0.00 ? 10  THR A N    1  
ATOM 155   C CA   . THR A 1 10 ? -11.058 2.565   6.247   1.00 0.00 ? 10  THR A CA   1  
ATOM 156   C C    . THR A 1 10 ? -11.272 1.309   7.090   1.00 0.00 ? 10  THR A C    1  
ATOM 157   O O    . THR A 1 10 ? -12.409 0.938   7.390   1.00 0.00 ? 10  THR A O    1  
ATOM 158   C CB   . THR A 1 10 ? -12.035 3.664   6.679   1.00 0.00 ? 10  THR A CB   1  
ATOM 159   O OG1  . THR A 1 10 ? -12.180 4.644   5.662   1.00 0.00 ? 10  THR A OG1  1  
ATOM 160   C CG2  . THR A 1 10 ? -11.611 4.376   7.945   1.00 0.00 ? 10  THR A CG2  1  
ATOM 161   H H    . THR A 1 10 ? -12.131 2.157   4.469   1.00 0.00 ? 10  THR A H    1  
ATOM 162   H HA   . THR A 1 10 ? -10.047 2.916   6.395   1.00 0.00 ? 10  THR A HA   1  
ATOM 163   H HB   . THR A 1 10 ? -13.003 3.219   6.859   1.00 0.00 ? 10  THR A HB   1  
ATOM 164   H HG1  . THR A 1 10 ? -11.316 4.984   5.414   1.00 0.00 ? 10  THR A HG1  1  
ATOM 165   H HG21 . THR A 1 10 ? -10.541 4.289   8.067   1.00 0.00 ? 10  THR A HG21 1  
ATOM 166   H HG22 . THR A 1 10 ? -12.107 3.928   8.793   1.00 0.00 ? 10  THR A HG22 1  
ATOM 167   H HG23 . THR A 1 10 ? -11.882 5.419   7.879   1.00 0.00 ? 10  THR A HG23 1  
ATOM 168   N N    . LEU A 1 11 ? -10.174 0.655   7.463   1.00 0.00 ? 11  LEU A N    1  
ATOM 169   C CA   . LEU A 1 11 ? -10.238 -0.565  8.267   1.00 0.00 ? 11  LEU A CA   1  
ATOM 170   C C    . LEU A 1 11 ? -9.451  -0.403  9.567   1.00 0.00 ? 11  LEU A C    1  
ATOM 171   O O    . LEU A 1 11 ? -8.627  0.505   9.694   1.00 0.00 ? 11  LEU A O    1  
ATOM 172   C CB   . LEU A 1 11 ? -9.694  -1.757  7.471   1.00 0.00 ? 11  LEU A CB   1  
ATOM 173   C CG   . LEU A 1 11 ? -10.312 -1.950  6.083   1.00 0.00 ? 11  LEU A CG   1  
ATOM 174   C CD1  . LEU A 1 11 ? -9.344  -2.680  5.163   1.00 0.00 ? 11  LEU A CD1  1  
ATOM 175   C CD2  . LEU A 1 11 ? -11.628 -2.707  6.184   1.00 0.00 ? 11  LEU A CD2  1  
ATOM 176   H H    . LEU A 1 11 ? -9.296  0.997   7.188   1.00 0.00 ? 11  LEU A H    1  
ATOM 177   H HA   . LEU A 1 11 ? -11.274 -0.748  8.509   1.00 0.00 ? 11  LEU A HA   1  
ATOM 178   H HB2  . LEU A 1 11 ? -8.628  -1.627  7.354   1.00 0.00 ? 11  LEU A HB2  1  
ATOM 179   H HB3  . LEU A 1 11 ? -9.868  -2.654  8.046   1.00 0.00 ? 11  LEU A HB3  1  
ATOM 180   H HG   . LEU A 1 11 ? -10.515 -0.981  5.650   1.00 0.00 ? 11  LEU A HG   1  
ATOM 181   H HD11 . LEU A 1 11 ? -9.901  -3.277  4.455   1.00 0.00 ? 11  LEU A HD11 1  
ATOM 182   H HD12 . LEU A 1 11 ? -8.703  -3.321  5.749   1.00 0.00 ? 11  LEU A HD12 1  
ATOM 183   H HD13 . LEU A 1 11 ? -8.743  -1.959  4.629   1.00 0.00 ? 11  LEU A HD13 1  
ATOM 184   H HD21 . LEU A 1 11 ? -11.445 -3.696  6.579   1.00 0.00 ? 11  LEU A HD21 1  
ATOM 185   H HD22 . LEU A 1 11 ? -12.073 -2.788  5.203   1.00 0.00 ? 11  LEU A HD22 1  
ATOM 186   H HD23 . LEU A 1 11 ? -12.300 -2.175  6.841   1.00 0.00 ? 11  LEU A HD23 1  
ATOM 187   N N    . LYS A 1 12 ? -9.707  -1.291  10.527  1.00 0.00 ? 12  LYS A N    1  
ATOM 188   C CA   . LYS A 1 12 ? -9.020  -1.247  11.816  1.00 0.00 ? 12  LYS A CA   1  
ATOM 189   C C    . LYS A 1 12 ? -8.032  -2.405  11.946  1.00 0.00 ? 12  LYS A C    1  
ATOM 190   O O    . LYS A 1 12 ? -8.312  -3.524  11.514  1.00 0.00 ? 12  LYS A O    1  
ATOM 191   C CB   . LYS A 1 12 ? -10.028 -1.290  12.967  1.00 0.00 ? 12  LYS A CB   1  
ATOM 192   C CG   . LYS A 1 12 ? -10.837 -0.011  13.119  1.00 0.00 ? 12  LYS A CG   1  
ATOM 193   C CD   . LYS A 1 12 ? -11.829 -0.110  14.270  1.00 0.00 ? 12  LYS A CD   1  
ATOM 194   C CE   . LYS A 1 12 ? -12.654 1.162   14.409  1.00 0.00 ? 12  LYS A CE   1  
ATOM 195   N NZ   . LYS A 1 12 ? -13.524 1.138   15.620  1.00 0.00 ? 12  LYS A NZ   1  
ATOM 196   H H    . LYS A 1 12 ? -10.372 -1.993  10.366  1.00 0.00 ? 12  LYS A H    1  
ATOM 197   H HA   . LYS A 1 12 ? -8.472  -0.318  11.866  1.00 0.00 ? 12  LYS A HA   1  
ATOM 198   H HB2  . LYS A 1 12 ? -10.715 -2.107  12.797  1.00 0.00 ? 12  LYS A HB2  1  
ATOM 199   H HB3  . LYS A 1 12 ? -9.496  -1.466  13.889  1.00 0.00 ? 12  LYS A HB3  1  
ATOM 200   H HG2  . LYS A 1 12 ? -10.162 0.810   13.309  1.00 0.00 ? 12  LYS A HG2  1  
ATOM 201   H HG3  . LYS A 1 12 ? -11.378 0.172   12.203  1.00 0.00 ? 12  LYS A HG3  1  
ATOM 202   H HD2  . LYS A 1 12 ? -12.495 -0.940  14.087  1.00 0.00 ? 12  LYS A HD2  1  
ATOM 203   H HD3  . LYS A 1 12 ? -11.285 -0.277  15.187  1.00 0.00 ? 12  LYS A HD3  1  
ATOM 204   H HE2  . LYS A 1 12 ? -11.983 2.005   14.478  1.00 0.00 ? 12  LYS A HE2  1  
ATOM 205   H HE3  . LYS A 1 12 ? -13.276 1.270   13.532  1.00 0.00 ? 12  LYS A HE3  1  
ATOM 206   H HZ1  . LYS A 1 12 ? -13.038 1.591   16.420  1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 207   H HZ2  . LYS A 1 12 ? -13.753 0.157   15.879  1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 208   H HZ3  . LYS A 1 12 ? -14.411 1.649   15.433  1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 209   N N    . LYS A 1 13 ? -6.876  -2.125  12.546  1.00 0.00 ? 13  LYS A N    1  
ATOM 210   C CA   . LYS A 1 13 ? -5.843  -3.141  12.737  1.00 0.00 ? 13  LYS A CA   1  
ATOM 211   C C    . LYS A 1 13 ? -6.189  -4.060  13.906  1.00 0.00 ? 13  LYS A C    1  
ATOM 212   O O    . LYS A 1 13 ? -6.167  -3.640  15.065  1.00 0.00 ? 13  LYS A O    1  
ATOM 213   C CB   . LYS A 1 13 ? -4.484  -2.480  12.982  1.00 0.00 ? 13  LYS A CB   1  
ATOM 214   C CG   . LYS A 1 13 ? -3.819  -1.957  11.719  1.00 0.00 ? 13  LYS A CG   1  
ATOM 215   C CD   . LYS A 1 13 ? -3.033  -0.680  11.983  1.00 0.00 ? 13  LYS A CD   1  
ATOM 216   C CE   . LYS A 1 13 ? -1.882  -0.915  12.954  1.00 0.00 ? 13  LYS A CE   1  
ATOM 217   N NZ   . LYS A 1 13 ? -2.176  -0.385  14.317  1.00 0.00 ? 13  LYS A NZ   1  
ATOM 218   H H    . LYS A 1 13 ? -6.715  -1.215  12.872  1.00 0.00 ? 13  LYS A H    1  
ATOM 219   H HA   . LYS A 1 13 ? -5.789  -3.732  11.833  1.00 0.00 ? 13  LYS A HA   1  
ATOM 220   H HB2  . LYS A 1 13 ? -4.619  -1.652  13.661  1.00 0.00 ? 13  LYS A HB2  1  
ATOM 221   H HB3  . LYS A 1 13 ? -3.824  -3.204  13.437  1.00 0.00 ? 13  LYS A HB3  1  
ATOM 222   H HG2  . LYS A 1 13 ? -3.145  -2.711  11.341  1.00 0.00 ? 13  LYS A HG2  1  
ATOM 223   H HG3  . LYS A 1 13 ? -4.582  -1.753  10.982  1.00 0.00 ? 13  LYS A HG3  1  
ATOM 224   H HD2  . LYS A 1 13 ? -2.631  -0.319  11.049  1.00 0.00 ? 13  LYS A HD2  1  
ATOM 225   H HD3  . LYS A 1 13 ? -3.700  0.061   12.400  1.00 0.00 ? 13  LYS A HD3  1  
ATOM 226   H HE2  . LYS A 1 13 ? -1.696  -1.976  13.024  1.00 0.00 ? 13  LYS A HE2  1  
ATOM 227   H HE3  . LYS A 1 13 ? -1.000  -0.423  12.569  1.00 0.00 ? 13  LYS A HE3  1  
ATOM 228   H HZ1  . LYS A 1 13 ? -1.805  -1.033  15.040  1.00 0.00 ? 13  LYS A HZ1  1  
ATOM 229   H HZ2  . LYS A 1 13 ? -3.202  -0.283  14.451  1.00 0.00 ? 13  LYS A HZ2  1  
ATOM 230   H HZ3  . LYS A 1 13 ? -1.728  0.548   14.441  1.00 0.00 ? 13  LYS A HZ3  1  
ATOM 231   N N    . GLN A 1 14 ? -6.503  -5.317  13.594  1.00 0.00 ? 14  GLN A N    1  
ATOM 232   C CA   . GLN A 1 14 ? -6.848  -6.299  14.623  1.00 0.00 ? 14  GLN A CA   1  
ATOM 233   C C    . GLN A 1 14 ? -5.587  -6.913  15.235  1.00 0.00 ? 14  GLN A C    1  
ATOM 234   O O    . GLN A 1 14 ? -5.496  -7.086  16.452  1.00 0.00 ? 14  GLN A O    1  
ATOM 235   C CB   . GLN A 1 14 ? -7.759  -7.402  14.055  1.00 0.00 ? 14  GLN A CB   1  
ATOM 236   C CG   . GLN A 1 14 ? -7.305  -7.981  12.719  1.00 0.00 ? 14  GLN A CG   1  
ATOM 237   C CD   . GLN A 1 14 ? -8.262  -7.673  11.577  1.00 0.00 ? 14  GLN A CD   1  
ATOM 238   O OE1  . GLN A 1 14 ? -8.540  -8.535  10.742  1.00 0.00 ? 14  GLN A OE1  1  
ATOM 239   N NE2  . GLN A 1 14 ? -8.772  -6.446  11.531  1.00 0.00 ? 14  GLN A NE2  1  
ATOM 240   H H    . GLN A 1 14 ? -6.496  -5.590  12.654  1.00 0.00 ? 14  GLN A H    1  
ATOM 241   H HA   . GLN A 1 14 ? -7.385  -5.776  15.399  1.00 0.00 ? 14  GLN A HA   1  
ATOM 242   H HB2  . GLN A 1 14 ? -7.803  -8.211  14.769  1.00 0.00 ? 14  GLN A HB2  1  
ATOM 243   H HB3  . GLN A 1 14 ? -8.753  -6.997  13.928  1.00 0.00 ? 14  GLN A HB3  1  
ATOM 244   H HG2  . GLN A 1 14 ? -6.337  -7.574  12.473  1.00 0.00 ? 14  GLN A HG2  1  
ATOM 245   H HG3  . GLN A 1 14 ? -7.225  -9.054  12.819  1.00 0.00 ? 14  GLN A HG3  1  
ATOM 246   H HE21 . GLN A 1 14 ? -8.511  -5.808  12.226  1.00 0.00 ? 14  GLN A HE21 1  
ATOM 247   H HE22 . GLN A 1 14 ? -9.390  -6.231  10.805  1.00 0.00 ? 14  GLN A HE22 1  
ATOM 248   N N    . ASN A 1 15 ? -4.616  -7.235  14.379  1.00 0.00 ? 15  ASN A N    1  
ATOM 249   C CA   . ASN A 1 15 ? -3.351  -7.824  14.816  1.00 0.00 ? 15  ASN A CA   1  
ATOM 250   C C    . ASN A 1 15 ? -2.328  -7.822  13.674  1.00 0.00 ? 15  ASN A C    1  
ATOM 251   O O    . ASN A 1 15 ? -1.552  -8.767  13.518  1.00 0.00 ? 15  ASN A O    1  
ATOM 252   C CB   . ASN A 1 15 ? -3.576  -9.254  15.329  1.00 0.00 ? 15  ASN A CB   1  
ATOM 253   C CG   . ASN A 1 15 ? -4.312  -10.131 14.329  1.00 0.00 ? 15  ASN A CG   1  
ATOM 254   O OD1  . ASN A 1 15 ? -5.536  -10.243 14.374  1.00 0.00 ? 15  ASN A OD1  1  
ATOM 255   N ND2  . ASN A 1 15 ? -3.570  -10.760 13.422  1.00 0.00 ? 15  ASN A ND2  1  
ATOM 256   H H    . ASN A 1 15 ? -4.754  -7.068  13.424  1.00 0.00 ? 15  ASN A H    1  
ATOM 257   H HA   . ASN A 1 15 ? -2.968  -7.219  15.626  1.00 0.00 ? 15  ASN A HA   1  
ATOM 258   H HB2  . ASN A 1 15 ? -2.619  -9.709  15.543  1.00 0.00 ? 15  ASN A HB2  1  
ATOM 259   H HB3  . ASN A 1 15 ? -4.158  -9.213  16.238  1.00 0.00 ? 15  ASN A HB3  1  
ATOM 260   H HD21 . ASN A 1 15 ? -2.598  -10.629 13.442  1.00 0.00 ? 15  ASN A HD21 1  
ATOM 261   H HD22 . ASN A 1 15 ? -4.025  -11.334 12.773  1.00 0.00 ? 15  ASN A HD22 1  
ATOM 262   N N    . GLY A 1 16 ? -2.342  -6.752  12.872  1.00 0.00 ? 16  GLY A N    1  
ATOM 263   C CA   . GLY A 1 16 ? -1.425  -6.641  11.749  1.00 0.00 ? 16  GLY A CA   1  
ATOM 264   C C    . GLY A 1 16 ? -2.150  -6.667  10.415  1.00 0.00 ? 16  GLY A C    1  
ATOM 265   O O    . GLY A 1 16 ? -3.367  -6.869  10.370  1.00 0.00 ? 16  GLY A O    1  
ATOM 266   H H    . GLY A 1 16 ? -2.986  -6.033  13.042  1.00 0.00 ? 16  GLY A H    1  
ATOM 267   H HA2  . GLY A 1 16 ? -0.881  -5.711  11.832  1.00 0.00 ? 16  GLY A HA2  1  
ATOM 268   H HA3  . GLY A 1 16 ? -0.725  -7.462  11.784  1.00 0.00 ? 16  GLY A HA3  1  
ATOM 269   N N    . MET A 1 17 ? -1.410  -6.458  9.327   1.00 0.00 ? 17  MET A N    1  
ATOM 270   C CA   . MET A 1 17 ? -2.001  -6.453  7.991   1.00 0.00 ? 17  MET A CA   1  
ATOM 271   C C    . MET A 1 17 ? -1.695  -7.749  7.243   1.00 0.00 ? 17  MET A C    1  
ATOM 272   O O    . MET A 1 17 ? -2.590  -8.355  6.654   1.00 0.00 ? 17  MET A O    1  
ATOM 273   C CB   . MET A 1 17 ? -1.503  -5.245  7.192   1.00 0.00 ? 17  MET A CB   1  
ATOM 274   C CG   . MET A 1 17 ? -2.390  -4.020  7.351   1.00 0.00 ? 17  MET A CG   1  
ATOM 275   S SD   . MET A 1 17 ? -2.139  -2.801  6.047   1.00 0.00 ? 17  MET A SD   1  
ATOM 276   C CE   . MET A 1 17 ? -0.564  -2.099  6.533   1.00 0.00 ? 17  MET A CE   1  
ATOM 277   H H    . MET A 1 17 ? -0.447  -6.298  9.424   1.00 0.00 ? 17  MET A H    1  
ATOM 278   H HA   . MET A 1 17 ? -3.072  -6.374  8.109   1.00 0.00 ? 17  MET A HA   1  
ATOM 279   H HB2  . MET A 1 17 ? -0.507  -4.989  7.527   1.00 0.00 ? 17  MET A HB2  1  
ATOM 280   H HB3  . MET A 1 17 ? -1.463  -5.505  6.142   1.00 0.00 ? 17  MET A HB3  1  
ATOM 281   H HG2  . MET A 1 17 ? -3.423  -4.337  7.330   1.00 0.00 ? 17  MET A HG2  1  
ATOM 282   H HG3  . MET A 1 17 ? -2.176  -3.560  8.305   1.00 0.00 ? 17  MET A HG3  1  
ATOM 283   H HE1  . MET A 1 17 ? 0.147   -2.893  6.705   1.00 0.00 ? 17  MET A HE1  1  
ATOM 284   H HE2  . MET A 1 17 ? -0.689  -1.526  7.440   1.00 0.00 ? 17  MET A HE2  1  
ATOM 285   H HE3  . MET A 1 17 ? -0.200  -1.455  5.746   1.00 0.00 ? 17  MET A HE3  1  
ATOM 286   N N    . GLY A 1 18 ? -0.432  -8.171  7.274   1.00 0.00 ? 18  GLY A N    1  
ATOM 287   C CA   . GLY A 1 18 ? -0.041  -9.395  6.598   1.00 0.00 ? 18  GLY A CA   1  
ATOM 288   C C    . GLY A 1 18 ? -0.188  -9.307  5.090   1.00 0.00 ? 18  GLY A C    1  
ATOM 289   O O    . GLY A 1 18 ? -1.181  -9.772  4.531   1.00 0.00 ? 18  GLY A O    1  
ATOM 290   H H    . GLY A 1 18 ? 0.240   -7.648  7.760   1.00 0.00 ? 18  GLY A H    1  
ATOM 291   H HA2  . GLY A 1 18 ? 0.989   -9.611  6.838   1.00 0.00 ? 18  GLY A HA2  1  
ATOM 292   H HA3  . GLY A 1 18 ? -0.659  -10.202 6.962   1.00 0.00 ? 18  GLY A HA3  1  
ATOM 293   N N    . LEU A 1 19 ? 0.804   -8.709  4.432   1.00 0.00 ? 19  LEU A N    1  
ATOM 294   C CA   . LEU A 1 19 ? 0.792   -8.563  2.974   1.00 0.00 ? 19  LEU A CA   1  
ATOM 295   C C    . LEU A 1 19 ? 2.202   -8.298  2.441   1.00 0.00 ? 19  LEU A C    1  
ATOM 296   O O    . LEU A 1 19 ? 3.161   -8.226  3.209   1.00 0.00 ? 19  LEU A O    1  
ATOM 297   C CB   . LEU A 1 19 ? -0.159  -7.436  2.557   1.00 0.00 ? 19  LEU A CB   1  
ATOM 298   C CG   . LEU A 1 19 ? 0.174   -6.063  3.135   1.00 0.00 ? 19  LEU A CG   1  
ATOM 299   C CD1  . LEU A 1 19 ? 0.935   -5.228  2.114   1.00 0.00 ? 19  LEU A CD1  1  
ATOM 300   C CD2  . LEU A 1 19 ? -1.092  -5.347  3.583   1.00 0.00 ? 19  LEU A CD2  1  
ATOM 301   H H    . LEU A 1 19 ? 1.570   -8.362  4.939   1.00 0.00 ? 19  LEU A H    1  
ATOM 302   H HA   . LEU A 1 19 ? 0.438   -9.491  2.552   1.00 0.00 ? 19  LEU A HA   1  
ATOM 303   H HB2  . LEU A 1 19 ? -0.147  -7.365  1.479   1.00 0.00 ? 19  LEU A HB2  1  
ATOM 304   H HB3  . LEU A 1 19 ? -1.157  -7.702  2.871   1.00 0.00 ? 19  LEU A HB3  1  
ATOM 305   H HG   . LEU A 1 19 ? 0.805   -6.198  3.998   1.00 0.00 ? 19  LEU A HG   1  
ATOM 306   H HD11 . LEU A 1 19 ? 0.737   -4.179  2.283   1.00 0.00 ? 19  LEU A HD11 1  
ATOM 307   H HD12 . LEU A 1 19 ? 0.616   -5.498  1.118   1.00 0.00 ? 19  LEU A HD12 1  
ATOM 308   H HD13 . LEU A 1 19 ? 1.994   -5.413  2.215   1.00 0.00 ? 19  LEU A HD13 1  
ATOM 309   H HD21 . LEU A 1 19 ? -0.847  -4.637  4.359   1.00 0.00 ? 19  LEU A HD21 1  
ATOM 310   H HD22 . LEU A 1 19 ? -1.798  -6.069  3.965   1.00 0.00 ? 19  LEU A HD22 1  
ATOM 311   H HD23 . LEU A 1 19 ? -1.529  -4.826  2.743   1.00 0.00 ? 19  LEU A HD23 1  
ATOM 312   N N    . SER A 1 20 ? 2.323   -8.156  1.123   1.00 0.00 ? 20  SER A N    1  
ATOM 313   C CA   . SER A 1 20 ? 3.618   -7.904  0.493   1.00 0.00 ? 20  SER A CA   1  
ATOM 314   C C    . SER A 1 20 ? 3.532   -6.763  -0.517  1.00 0.00 ? 20  SER A C    1  
ATOM 315   O O    . SER A 1 20 ? 2.505   -6.579  -1.173  1.00 0.00 ? 20  SER A O    1  
ATOM 316   C CB   . SER A 1 20 ? 4.126   -9.173  -0.194  1.00 0.00 ? 20  SER A CB   1  
ATOM 317   O OG   . SER A 1 20 ? 4.490   -10.156 0.759   1.00 0.00 ? 20  SER A OG   1  
ATOM 318   H H    . SER A 1 20 ? 1.522   -8.224  0.560   1.00 0.00 ? 20  SER A H    1  
ATOM 319   H HA   . SER A 1 20 ? 4.314   -7.626  1.270   1.00 0.00 ? 20  SER A HA   1  
ATOM 320   H HB2  . SER A 1 20 ? 3.350   -9.574  -0.827  1.00 0.00 ? 20  SER A HB2  1  
ATOM 321   H HB3  . SER A 1 20 ? 4.992   -8.933  -0.794  1.00 0.00 ? 20  SER A HB3  1  
ATOM 322   H HG   . SER A 1 20 ? 5.168   -9.802  1.344   1.00 0.00 ? 20  SER A HG   1  
ATOM 323   N N    . ILE A 1 21 ? 4.620   -5.997  -0.635  1.00 0.00 ? 21  ILE A N    1  
ATOM 324   C CA   . ILE A 1 21 ? 4.664   -4.867  -1.562  1.00 0.00 ? 21  ILE A CA   1  
ATOM 325   C C    . ILE A 1 21 ? 6.037   -4.728  -2.225  1.00 0.00 ? 21  ILE A C    1  
ATOM 326   O O    . ILE A 1 21 ? 7.054   -5.142  -1.663  1.00 0.00 ? 21  ILE A O    1  
ATOM 327   C CB   . ILE A 1 21 ? 4.307   -3.542  -0.852  1.00 0.00 ? 21  ILE A CB   1  
ATOM 328   C CG1  . ILE A 1 21 ? 5.106   -3.387  0.445   1.00 0.00 ? 21  ILE A CG1  1  
ATOM 329   C CG2  . ILE A 1 21 ? 2.813   -3.480  -0.569  1.00 0.00 ? 21  ILE A CG2  1  
ATOM 330   C CD1  . ILE A 1 21 ? 6.509   -2.874  0.225   1.00 0.00 ? 21  ILE A CD1  1  
ATOM 331   H H    . ILE A 1 21 ? 5.407   -6.193  -0.082  1.00 0.00 ? 21  ILE A H    1  
ATOM 332   H HA   . ILE A 1 21 ? 3.926   -5.046  -2.331  1.00 0.00 ? 21  ILE A HA   1  
ATOM 333   H HB   . ILE A 1 21 ? 4.554   -2.728  -1.517  1.00 0.00 ? 21  ILE A HB   1  
ATOM 334   H HG12 . ILE A 1 21 ? 4.597   -2.691  1.095   1.00 0.00 ? 21  ILE A HG12 1  
ATOM 335   H HG13 . ILE A 1 21 ? 5.175   -4.347  0.937   1.00 0.00 ? 21  ILE A HG13 1  
ATOM 336   H HG21 . ILE A 1 21 ? 2.617   -3.871  0.419   1.00 0.00 ? 21  ILE A HG21 1  
ATOM 337   H HG22 . ILE A 1 21 ? 2.284   -4.070  -1.301  1.00 0.00 ? 21  ILE A HG22 1  
ATOM 338   H HG23 . ILE A 1 21 ? 2.479   -2.454  -0.623  1.00 0.00 ? 21  ILE A HG23 1  
ATOM 339   H HD11 . ILE A 1 21 ? 6.579   -2.442  -0.762  1.00 0.00 ? 21  ILE A HD11 1  
ATOM 340   H HD12 . ILE A 1 21 ? 7.209   -3.692  0.311   1.00 0.00 ? 21  ILE A HD12 1  
ATOM 341   H HD13 . ILE A 1 21 ? 6.740   -2.123  0.965   1.00 0.00 ? 21  ILE A HD13 1  
ATOM 342   N N    . VAL A 1 22 ? 6.055   -4.141  -3.427  1.00 0.00 ? 22  VAL A N    1  
ATOM 343   C CA   . VAL A 1 22 ? 7.299   -3.944  -4.172  1.00 0.00 ? 22  VAL A CA   1  
ATOM 344   C C    . VAL A 1 22 ? 7.370   -2.541  -4.781  1.00 0.00 ? 22  VAL A C    1  
ATOM 345   O O    . VAL A 1 22 ? 6.390   -2.045  -5.340  1.00 0.00 ? 22  VAL A O    1  
ATOM 346   C CB   . VAL A 1 22 ? 7.457   -4.992  -5.297  1.00 0.00 ? 22  VAL A CB   1  
ATOM 347   C CG1  . VAL A 1 22 ? 8.803   -4.845  -5.996  1.00 0.00 ? 22  VAL A CG1  1  
ATOM 348   C CG2  . VAL A 1 22 ? 7.291   -6.401  -4.749  1.00 0.00 ? 22  VAL A CG2  1  
ATOM 349   H H    . VAL A 1 22 ? 5.211   -3.833  -3.820  1.00 0.00 ? 22  VAL A H    1  
ATOM 350   H HA   . VAL A 1 22 ? 8.119   -4.065  -3.481  1.00 0.00 ? 22  VAL A HA   1  
ATOM 351   H HB   . VAL A 1 22 ? 6.681   -4.823  -6.028  1.00 0.00 ? 22  VAL A HB   1  
ATOM 352   H HG11 . VAL A 1 22 ? 9.257   -3.907  -5.712  1.00 0.00 ? 22  VAL A HG11 1  
ATOM 353   H HG12 . VAL A 1 22 ? 8.658   -4.864  -7.066  1.00 0.00 ? 22  VAL A HG12 1  
ATOM 354   H HG13 . VAL A 1 22 ? 9.449   -5.660  -5.706  1.00 0.00 ? 22  VAL A HG13 1  
ATOM 355   H HG21 . VAL A 1 22 ? 7.126   -7.088  -5.565  1.00 0.00 ? 22  VAL A HG21 1  
ATOM 356   H HG22 . VAL A 1 22 ? 6.446   -6.430  -4.077  1.00 0.00 ? 22  VAL A HG22 1  
ATOM 357   H HG23 . VAL A 1 22 ? 8.186   -6.686  -4.215  1.00 0.00 ? 22  VAL A HG23 1  
ATOM 358   N N    . ALA A 1 23 ? 8.542   -1.913  -4.666  1.00 0.00 ? 23  ALA A N    1  
ATOM 359   C CA   . ALA A 1 23 ? 8.761   -0.569  -5.200  1.00 0.00 ? 23  ALA A CA   1  
ATOM 360   C C    . ALA A 1 23 ? 9.164   -0.622  -6.674  1.00 0.00 ? 23  ALA A C    1  
ATOM 361   O O    . ALA A 1 23 ? 10.063  -1.376  -7.050  1.00 0.00 ? 23  ALA A O    1  
ATOM 362   C CB   . ALA A 1 23 ? 9.829   0.153   -4.390  1.00 0.00 ? 23  ALA A CB   1  
ATOM 363   H H    . ALA A 1 23 ? 9.279   -2.368  -4.208  1.00 0.00 ? 23  ALA A H    1  
ATOM 364   H HA   . ALA A 1 23 ? 7.838   -0.016  -5.103  1.00 0.00 ? 23  ALA A HA   1  
ATOM 365   H HB1  . ALA A 1 23 ? 9.916   -0.306  -3.415  1.00 0.00 ? 23  ALA A HB1  1  
ATOM 366   H HB2  . ALA A 1 23 ? 9.553   1.189   -4.275  1.00 0.00 ? 23  ALA A HB2  1  
ATOM 367   H HB3  . ALA A 1 23 ? 10.778  0.088   -4.903  1.00 0.00 ? 23  ALA A HB3  1  
ATOM 368   N N    . ALA A 1 24 ? 8.496   0.182   -7.505  1.00 0.00 ? 24  ALA A N    1  
ATOM 369   C CA   . ALA A 1 24 ? 8.792   0.222   -8.937  1.00 0.00 ? 24  ALA A CA   1  
ATOM 370   C C    . ALA A 1 24 ? 8.856   1.659   -9.454  1.00 0.00 ? 24  ALA A C    1  
ATOM 371   O O    . ALA A 1 24 ? 8.081   2.517   -9.026  1.00 0.00 ? 24  ALA A O    1  
ATOM 372   C CB   . ALA A 1 24 ? 7.755   -0.573  -9.718  1.00 0.00 ? 24  ALA A CB   1  
ATOM 373   H H    . ALA A 1 24 ? 7.790   0.761   -7.147  1.00 0.00 ? 24  ALA A H    1  
ATOM 374   H HA   . ALA A 1 24 ? 9.755   -0.245  -9.090  1.00 0.00 ? 24  ALA A HA   1  
ATOM 375   H HB1  . ALA A 1 24 ? 7.090   0.106   -10.230 1.00 0.00 ? 24  ALA A HB1  1  
ATOM 376   H HB2  . ALA A 1 24 ? 7.185   -1.189  -9.038  1.00 0.00 ? 24  ALA A HB2  1  
ATOM 377   H HB3  . ALA A 1 24 ? 8.254   -1.203  -10.440 1.00 0.00 ? 24  ALA A HB3  1  
ATOM 378   N N    . LYS A 1 25 ? 9.784   1.908   -10.379 1.00 0.00 ? 25  LYS A N    1  
ATOM 379   C CA   . LYS A 1 25 ? 9.959   3.238   -10.967 1.00 0.00 ? 25  LYS A CA   1  
ATOM 380   C C    . LYS A 1 25 ? 9.796   3.189   -12.487 1.00 0.00 ? 25  LYS A C    1  
ATOM 381   O O    . LYS A 1 25 ? 9.547   2.126   -13.062 1.00 0.00 ? 25  LYS A O    1  
ATOM 382   C CB   . LYS A 1 25 ? 11.338  3.803   -10.605 1.00 0.00 ? 25  LYS A CB   1  
ATOM 383   C CG   . LYS A 1 25 ? 11.294  5.220   -10.052 1.00 0.00 ? 25  LYS A CG   1  
ATOM 384   C CD   . LYS A 1 25 ? 12.432  6.069   -10.597 1.00 0.00 ? 25  LYS A CD   1  
ATOM 385   C CE   . LYS A 1 25 ? 12.828  7.166   -9.620  1.00 0.00 ? 25  LYS A CE   1  
ATOM 386   N NZ   . LYS A 1 25 ? 13.890  8.052   -10.174 1.00 0.00 ? 25  LYS A NZ   1  
ATOM 387   H H    . LYS A 1 25 ? 10.367  1.178   -10.677 1.00 0.00 ? 25  LYS A H    1  
ATOM 388   H HA   . LYS A 1 25 ? 9.196   3.883   -10.556 1.00 0.00 ? 25  LYS A HA   1  
ATOM 389   H HB2  . LYS A 1 25 ? 11.793  3.164   -9.863  1.00 0.00 ? 25  LYS A HB2  1  
ATOM 390   H HB3  . LYS A 1 25 ? 11.956  3.805   -11.492 1.00 0.00 ? 25  LYS A HB3  1  
ATOM 391   H HG2  . LYS A 1 25 ? 10.355  5.675   -10.329 1.00 0.00 ? 25  LYS A HG2  1  
ATOM 392   H HG3  . LYS A 1 25 ? 11.372  5.178   -8.975  1.00 0.00 ? 25  LYS A HG3  1  
ATOM 393   H HD2  . LYS A 1 25 ? 13.288  5.435   -10.775 1.00 0.00 ? 25  LYS A HD2  1  
ATOM 394   H HD3  . LYS A 1 25 ? 12.117  6.522   -11.526 1.00 0.00 ? 25  LYS A HD3  1  
ATOM 395   H HE2  . LYS A 1 25 ? 11.956  7.763   -9.396  1.00 0.00 ? 25  LYS A HE2  1  
ATOM 396   H HE3  . LYS A 1 25 ? 13.192  6.708   -8.711  1.00 0.00 ? 25  LYS A HE3  1  
ATOM 397   H HZ1  . LYS A 1 25 ? 14.767  7.513   -10.320 1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 398   H HZ2  . LYS A 1 25 ? 14.083  8.834   -9.516  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 399   H HZ3  . LYS A 1 25 ? 13.585  8.450   -11.085 1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 400   N N    . GLY A 1 26 ? 9.943   4.346   -13.135 1.00 0.00 ? 26  GLY A N    1  
ATOM 401   C CA   . GLY A 1 26 ? 9.815   4.417   -14.578 1.00 0.00 ? 26  GLY A CA   1  
ATOM 402   C C    . GLY A 1 26 ? 10.390  5.703   -15.124 1.00 0.00 ? 26  GLY A C    1  
ATOM 403   O O    . GLY A 1 26 ? 11.418  6.184   -14.637 1.00 0.00 ? 26  GLY A O    1  
ATOM 404   H H    . GLY A 1 26 ? 10.147  5.164   -12.632 1.00 0.00 ? 26  GLY A H    1  
ATOM 405   H HA2  . GLY A 1 26 ? 10.336  3.584   -15.021 1.00 0.00 ? 26  GLY A HA2  1  
ATOM 406   H HA3  . GLY A 1 26 ? 8.770   4.360   -14.842 1.00 0.00 ? 26  GLY A HA3  1  
ATOM 407   N N    . ALA A 1 27 ? 9.727   6.271   -16.122 1.00 0.00 ? 27  ALA A N    1  
ATOM 408   C CA   . ALA A 1 27 ? 10.182  7.520   -16.713 1.00 0.00 ? 27  ALA A CA   1  
ATOM 409   C C    . ALA A 1 27 ? 9.307   8.682   -16.256 1.00 0.00 ? 27  ALA A C    1  
ATOM 410   O O    . ALA A 1 27 ? 8.096   8.526   -16.079 1.00 0.00 ? 27  ALA A O    1  
ATOM 411   C CB   . ALA A 1 27 ? 10.202  7.426   -18.232 1.00 0.00 ? 27  ALA A CB   1  
ATOM 412   H H    . ALA A 1 27 ? 8.911   5.846   -16.457 1.00 0.00 ? 27  ALA A H    1  
ATOM 413   H HA   . ALA A 1 27 ? 11.192  7.687   -16.366 1.00 0.00 ? 27  ALA A HA   1  
ATOM 414   H HB1  . ALA A 1 27 ? 9.470   6.702   -18.559 1.00 0.00 ? 27  ALA A HB1  1  
ATOM 415   H HB2  . ALA A 1 27 ? 11.184  7.119   -18.560 1.00 0.00 ? 27  ALA A HB2  1  
ATOM 416   H HB3  . ALA A 1 27 ? 9.967   8.392   -18.654 1.00 0.00 ? 27  ALA A HB3  1  
ATOM 417   N N    . GLY A 1 28 ? 9.930   9.842   -16.046 1.00 0.00 ? 28  GLY A N    1  
ATOM 418   C CA   . GLY A 1 28 ? 9.193   11.009  -15.588 1.00 0.00 ? 28  GLY A CA   1  
ATOM 419   C C    . GLY A 1 28 ? 8.579   10.783  -14.218 1.00 0.00 ? 28  GLY A C    1  
ATOM 420   O O    . GLY A 1 28 ? 7.488   11.277  -13.927 1.00 0.00 ? 28  GLY A O    1  
ATOM 421   H H    . GLY A 1 28 ? 10.898  9.901   -16.190 1.00 0.00 ? 28  GLY A H    1  
ATOM 422   H HA2  . GLY A 1 28 ? 9.866   11.851  -15.536 1.00 0.00 ? 28  GLY A HA2  1  
ATOM 423   H HA3  . GLY A 1 28 ? 8.407   11.228  -16.294 1.00 0.00 ? 28  GLY A HA3  1  
ATOM 424   N N    . GLN A 1 29 ? 9.281   10.017  -13.381 1.00 0.00 ? 29  GLN A N    1  
ATOM 425   C CA   . GLN A 1 29 ? 8.807   9.703   -12.042 1.00 0.00 ? 29  GLN A CA   1  
ATOM 426   C C    . GLN A 1 29 ? 9.880   10.005  -11.003 1.00 0.00 ? 29  GLN A C    1  
ATOM 427   O O    . GLN A 1 29 ? 10.851  9.258   -10.866 1.00 0.00 ? 29  GLN A O    1  
ATOM 428   C CB   . GLN A 1 29 ? 8.405   8.231   -11.958 1.00 0.00 ? 29  GLN A CB   1  
ATOM 429   C CG   . GLN A 1 29 ? 7.333   7.950   -10.917 1.00 0.00 ? 29  GLN A CG   1  
ATOM 430   C CD   . GLN A 1 29 ? 6.044   7.439   -11.530 1.00 0.00 ? 29  GLN A CD   1  
ATOM 431   O OE1  . GLN A 1 29 ? 4.957   7.922   -11.211 1.00 0.00 ? 29  GLN A OE1  1  
ATOM 432   N NE2  . GLN A 1 29 ? 6.156   6.456   -12.417 1.00 0.00 ? 29  GLN A NE2  1  
ATOM 433   H H    . GLN A 1 29 ? 10.138  9.645   -13.677 1.00 0.00 ? 29  GLN A H    1  
ATOM 434   H HA   . GLN A 1 29 ? 7.939   10.314  -11.843 1.00 0.00 ? 29  GLN A HA   1  
ATOM 435   H HB2  . GLN A 1 29 ? 8.032   7.919   -12.922 1.00 0.00 ? 29  GLN A HB2  1  
ATOM 436   H HB3  . GLN A 1 29 ? 9.277   7.645   -11.711 1.00 0.00 ? 29  GLN A HB3  1  
ATOM 437   H HG2  . GLN A 1 29 ? 7.704   7.206   -10.230 1.00 0.00 ? 29  GLN A HG2  1  
ATOM 438   H HG3  . GLN A 1 29 ? 7.122   8.862   -10.380 1.00 0.00 ? 29  GLN A HG3  1  
ATOM 439   H HE21 . GLN A 1 29 ? 7.051   6.115   -12.624 1.00 0.00 ? 29  GLN A HE21 1  
ATOM 440   H HE22 . GLN A 1 29 ? 5.340   6.114   -12.831 1.00 0.00 ? 29  GLN A HE22 1  
ATOM 441   N N    . ASP A 1 30 ? 9.695   11.100  -10.271 1.00 0.00 ? 30  ASP A N    1  
ATOM 442   C CA   . ASP A 1 30 ? 10.644  11.501  -9.235  1.00 0.00 ? 30  ASP A CA   1  
ATOM 443   C C    . ASP A 1 30 ? 10.251  10.931  -7.867  1.00 0.00 ? 30  ASP A C    1  
ATOM 444   O O    . ASP A 1 30 ? 10.690  11.427  -6.828  1.00 0.00 ? 30  ASP A O    1  
ATOM 445   C CB   . ASP A 1 30 ? 10.733  13.028  -9.166  1.00 0.00 ? 30  ASP A CB   1  
ATOM 446   C CG   . ASP A 1 30 ? 12.123  13.509  -8.802  1.00 0.00 ? 30  ASP A CG   1  
ATOM 447   O OD1  . ASP A 1 30 ? 12.988  13.561  -9.701  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 448   O OD2  . ASP A 1 30 ? 12.346  13.834  -7.617  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 449   H H    . ASP A 1 30 ? 8.899   11.649  -10.429 1.00 0.00 ? 30  ASP A H    1  
ATOM 450   H HA   . ASP A 1 30 ? 11.610  11.104  -9.504  1.00 0.00 ? 30  ASP A HA   1  
ATOM 451   H HB2  . ASP A 1 30 ? 10.471  13.440  -10.129 1.00 0.00 ? 30  ASP A HB2  1  
ATOM 452   H HB3  . ASP A 1 30 ? 10.040  13.392  -8.423  1.00 0.00 ? 30  ASP A HB3  1  
ATOM 453   N N    . LYS A 1 31 ? 9.426   9.883   -7.877  1.00 0.00 ? 31  LYS A N    1  
ATOM 454   C CA   . LYS A 1 31 ? 8.974   9.244   -6.646  1.00 0.00 ? 31  LYS A CA   1  
ATOM 455   C C    . LYS A 1 31 ? 8.977   7.722   -6.793  1.00 0.00 ? 31  LYS A C    1  
ATOM 456   O O    . LYS A 1 31 ? 9.522   7.186   -7.762  1.00 0.00 ? 31  LYS A O    1  
ATOM 457   C CB   . LYS A 1 31 ? 7.567   9.736   -6.280  1.00 0.00 ? 31  LYS A CB   1  
ATOM 458   C CG   . LYS A 1 31 ? 7.353   11.226  -6.515  1.00 0.00 ? 31  LYS A CG   1  
ATOM 459   C CD   . LYS A 1 31 ? 8.046   12.069  -5.453  1.00 0.00 ? 31  LYS A CD   1  
ATOM 460   C CE   . LYS A 1 31 ? 8.550   13.388  -6.023  1.00 0.00 ? 31  LYS A CE   1  
ATOM 461   N NZ   . LYS A 1 31 ? 7.767   14.553  -5.519  1.00 0.00 ? 31  LYS A NZ   1  
ATOM 462   H H    . LYS A 1 31 ? 9.115   9.530   -8.733  1.00 0.00 ? 31  LYS A H    1  
ATOM 463   H HA   . LYS A 1 31 ? 9.659   9.520   -5.859  1.00 0.00 ? 31  LYS A HA   1  
ATOM 464   H HB2  . LYS A 1 31 ? 6.845   9.194   -6.872  1.00 0.00 ? 31  LYS A HB2  1  
ATOM 465   H HB3  . LYS A 1 31 ? 7.388   9.530   -5.235  1.00 0.00 ? 31  LYS A HB3  1  
ATOM 466   H HG2  . LYS A 1 31 ? 7.749   11.488  -7.484  1.00 0.00 ? 31  LYS A HG2  1  
ATOM 467   H HG3  . LYS A 1 31 ? 6.293   11.433  -6.491  1.00 0.00 ? 31  LYS A HG3  1  
ATOM 468   H HD2  . LYS A 1 31 ? 7.346   12.275  -4.659  1.00 0.00 ? 31  LYS A HD2  1  
ATOM 469   H HD3  . LYS A 1 31 ? 8.885   11.514  -5.059  1.00 0.00 ? 31  LYS A HD3  1  
ATOM 470   H HE2  . LYS A 1 31 ? 9.586   13.513  -5.741  1.00 0.00 ? 31  LYS A HE2  1  
ATOM 471   H HE3  . LYS A 1 31 ? 8.474   13.353  -7.101  1.00 0.00 ? 31  LYS A HE3  1  
ATOM 472   H HZ1  . LYS A 1 31 ? 8.177   14.898  -4.626  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM 473   H HZ2  . LYS A 1 31 ? 6.779   14.277  -5.349  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM 474   H HZ3  . LYS A 1 31 ? 7.784   15.325  -6.216  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM 475   N N    . LEU A 1 32 ? 8.369   7.027   -5.827  1.00 0.00 ? 32  LEU A N    1  
ATOM 476   C CA   . LEU A 1 32 ? 8.304   5.568   -5.855  1.00 0.00 ? 32  LEU A CA   1  
ATOM 477   C C    . LEU A 1 32 ? 6.949   5.072   -5.350  1.00 0.00 ? 32  LEU A C    1  
ATOM 478   O O    . LEU A 1 32 ? 6.476   5.498   -4.294  1.00 0.00 ? 32  LEU A O    1  
ATOM 479   C CB   . LEU A 1 32 ? 9.431   4.970   -5.005  1.00 0.00 ? 32  LEU A CB   1  
ATOM 480   C CG   . LEU A 1 32 ? 10.069  3.695   -5.565  1.00 0.00 ? 32  LEU A CG   1  
ATOM 481   C CD1  . LEU A 1 32 ? 10.553  3.915   -6.992  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 482   C CD2  . LEU A 1 32 ? 11.219  3.244   -4.674  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 483   H H    . LEU A 1 32 ? 7.955   7.507   -5.080  1.00 0.00 ? 32  LEU A H    1  
ATOM 484   H HA   . LEU A 1 32 ? 8.430   5.251   -6.879  1.00 0.00 ? 32  LEU A HA   1  
ATOM 485   H HB2  . LEU A 1 32 ? 10.205  5.717   -4.897  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 486   H HB3  . LEU A 1 32 ? 9.034   4.745   -4.026  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 487   H HG   . LEU A 1 32 ? 9.330   2.908   -5.582  1.00 0.00 ? 32  LEU A HG   1  
ATOM 488   H HD11 . LEU A 1 32 ? 9.868   3.444   -7.682  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 489   H HD12 . LEU A 1 32 ? 11.535  3.485   -7.112  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 490   H HD13 . LEU A 1 32 ? 10.597  4.975   -7.199  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 491   H HD21 . LEU A 1 32 ? 11.799  4.104   -4.373  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 492   H HD22 . LEU A 1 32 ? 11.850  2.558   -5.219  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 493   H HD23 . LEU A 1 32 ? 10.823  2.751   -3.798  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 494   N N    . GLY A 1 33 ? 6.330   4.170   -6.114  1.00 0.00 ? 33  GLY A N    1  
ATOM 495   C CA   . GLY A 1 33 ? 5.034   3.629   -5.735  1.00 0.00 ? 33  GLY A CA   1  
ATOM 496   C C    . GLY A 1 33 ? 5.142   2.296   -5.015  1.00 0.00 ? 33  GLY A C    1  
ATOM 497   O O    . GLY A 1 33 ? 5.906   1.422   -5.429  1.00 0.00 ? 33  GLY A O    1  
ATOM 498   H H    . GLY A 1 33 ? 6.756   3.869   -6.945  1.00 0.00 ? 33  GLY A H    1  
ATOM 499   H HA2  . GLY A 1 33 ? 4.537   4.337   -5.089  1.00 0.00 ? 33  GLY A HA2  1  
ATOM 500   H HA3  . GLY A 1 33 ? 4.441   3.494   -6.627  1.00 0.00 ? 33  GLY A HA3  1  
ATOM 501   N N    . ILE A 1 34 ? 4.372   2.140   -3.938  1.00 0.00 ? 34  ILE A N    1  
ATOM 502   C CA   . ILE A 1 34 ? 4.381   0.902   -3.160  1.00 0.00 ? 34  ILE A CA   1  
ATOM 503   C C    . ILE A 1 34 ? 3.329   -0.074  -3.686  1.00 0.00 ? 34  ILE A C    1  
ATOM 504   O O    . ILE A 1 34 ? 2.213   -0.143  -3.169  1.00 0.00 ? 34  ILE A O    1  
ATOM 505   C CB   . ILE A 1 34 ? 4.127   1.174   -1.660  1.00 0.00 ? 34  ILE A CB   1  
ATOM 506   C CG1  . ILE A 1 34 ? 5.006   2.328   -1.167  1.00 0.00 ? 34  ILE A CG1  1  
ATOM 507   C CG2  . ILE A 1 34 ? 4.382   -0.079  -0.832  1.00 0.00 ? 34  ILE A CG2  1  
ATOM 508   C CD1  . ILE A 1 34 ? 6.491   2.079   -1.332  1.00 0.00 ? 34  ILE A CD1  1  
ATOM 509   H H    . ILE A 1 34 ? 3.782   2.873   -3.660  1.00 0.00 ? 34  ILE A H    1  
ATOM 510   H HA   . ILE A 1 34 ? 5.359   0.452   -3.263  1.00 0.00 ? 34  ILE A HA   1  
ATOM 511   H HB   . ILE A 1 34 ? 3.090   1.447   -1.539  1.00 0.00 ? 34  ILE A HB   1  
ATOM 512   H HG12 . ILE A 1 34 ? 4.759   3.221   -1.721  1.00 0.00 ? 34  ILE A HG12 1  
ATOM 513   H HG13 . ILE A 1 34 ? 4.811   2.494   -0.118  1.00 0.00 ? 34  ILE A HG13 1  
ATOM 514   H HG21 . ILE A 1 34 ? 4.265   0.154   0.216   1.00 0.00 ? 34  ILE A HG21 1  
ATOM 515   H HG22 . ILE A 1 34 ? 5.386   -0.432  -1.013  1.00 0.00 ? 34  ILE A HG22 1  
ATOM 516   H HG23 . ILE A 1 34 ? 3.675   -0.845  -1.112  1.00 0.00 ? 34  ILE A HG23 1  
ATOM 517   H HD11 . ILE A 1 34 ? 6.673   1.592   -2.279  1.00 0.00 ? 34  ILE A HD11 1  
ATOM 518   H HD12 . ILE A 1 34 ? 6.842   1.447   -0.530  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 519   H HD13 . ILE A 1 34 ? 7.019   3.021   -1.305  1.00 0.00 ? 34  ILE A HD13 1  
ATOM 520   N N    . TYR A 1 35 ? 3.694   -0.824  -4.724  1.00 0.00 ? 35  TYR A N    1  
ATOM 521   C CA   . TYR A 1 35 ? 2.785   -1.796  -5.332  1.00 0.00 ? 35  TYR A CA   1  
ATOM 522   C C    . TYR A 1 35 ? 2.621   -3.033  -4.449  1.00 0.00 ? 35  TYR A C    1  
ATOM 523   O O    . TYR A 1 35 ? 3.435   -3.281  -3.564  1.00 0.00 ? 35  TYR A O    1  
ATOM 524   C CB   . TYR A 1 35 ? 3.303   -2.206  -6.712  1.00 0.00 ? 35  TYR A CB   1  
ATOM 525   C CG   . TYR A 1 35 ? 3.516   -1.038  -7.648  1.00 0.00 ? 35  TYR A CG   1  
ATOM 526   C CD1  . TYR A 1 35 ? 2.462   -0.518  -8.388  1.00 0.00 ? 35  TYR A CD1  1  
ATOM 527   C CD2  . TYR A 1 35 ? 4.768   -0.451  -7.786  1.00 0.00 ? 35  TYR A CD2  1  
ATOM 528   C CE1  . TYR A 1 35 ? 2.650   0.549   -9.244  1.00 0.00 ? 35  TYR A CE1  1  
ATOM 529   C CE2  . TYR A 1 35 ? 4.964   0.617   -8.641  1.00 0.00 ? 35  TYR A CE2  1  
ATOM 530   C CZ   . TYR A 1 35 ? 3.902   1.115   -9.366  1.00 0.00 ? 35  TYR A CZ   1  
ATOM 531   O OH   . TYR A 1 35 ? 4.093   2.177   -10.220 1.00 0.00 ? 35  TYR A OH   1  
ATOM 532   H H    . TYR A 1 35 ? 4.597   -0.719  -5.093  1.00 0.00 ? 35  TYR A H    1  
ATOM 533   H HA   . TYR A 1 35 ? 1.822   -1.321  -5.447  1.00 0.00 ? 35  TYR A HA   1  
ATOM 534   H HB2  . TYR A 1 35 ? 4.248   -2.715  -6.598  1.00 0.00 ? 35  TYR A HB2  1  
ATOM 535   H HB3  . TYR A 1 35 ? 2.592   -2.875  -7.173  1.00 0.00 ? 35  TYR A HB3  1  
ATOM 536   H HD1  . TYR A 1 35 ? 1.482   -0.961  -8.289  1.00 0.00 ? 35  TYR A HD1  1  
ATOM 537   H HD2  . TYR A 1 35 ? 5.597   -0.841  -7.218  1.00 0.00 ? 35  TYR A HD2  1  
ATOM 538   H HE1  . TYR A 1 35 ? 1.817   0.937   -9.809  1.00 0.00 ? 35  TYR A HE1  1  
ATOM 539   H HE2  . TYR A 1 35 ? 5.944   1.060   -8.735  1.00 0.00 ? 35  TYR A HE2  1  
ATOM 540   H HH   . TYR A 1 35 ? 4.245   1.850   -11.110 1.00 0.00 ? 35  TYR A HH   1  
ATOM 541   N N    . VAL A 1 36 ? 1.563   -3.806  -4.702  1.00 0.00 ? 36  VAL A N    1  
ATOM 542   C CA   . VAL A 1 36 ? 1.293   -5.022  -3.930  1.00 0.00 ? 36  VAL A CA   1  
ATOM 543   C C    . VAL A 1 36 ? 1.809   -6.265  -4.655  1.00 0.00 ? 36  VAL A C    1  
ATOM 544   O O    . VAL A 1 36 ? 1.599   -6.423  -5.859  1.00 0.00 ? 36  VAL A O    1  
ATOM 545   C CB   . VAL A 1 36 ? -0.217  -5.202  -3.649  1.00 0.00 ? 36  VAL A CB   1  
ATOM 546   C CG1  . VAL A 1 36 ? -0.457  -6.361  -2.689  1.00 0.00 ? 36  VAL A CG1  1  
ATOM 547   C CG2  . VAL A 1 36 ? -0.828  -3.921  -3.099  1.00 0.00 ? 36  VAL A CG2  1  
ATOM 548   H H    . VAL A 1 36 ? 0.951   -3.554  -5.427  1.00 0.00 ? 36  VAL A H    1  
ATOM 549   H HA   . VAL A 1 36 ? 1.805   -4.934  -2.983  1.00 0.00 ? 36  VAL A HA   1  
ATOM 550   H HB   . VAL A 1 36 ? -0.709  -5.435  -4.583  1.00 0.00 ? 36  VAL A HB   1  
ATOM 551   H HG11 . VAL A 1 36 ? 0.388   -7.032  -2.715  1.00 0.00 ? 36  VAL A HG11 1  
ATOM 552   H HG12 . VAL A 1 36 ? -1.348  -6.894  -2.984  1.00 0.00 ? 36  VAL A HG12 1  
ATOM 553   H HG13 . VAL A 1 36 ? -0.583  -5.978  -1.687  1.00 0.00 ? 36  VAL A HG13 1  
ATOM 554   H HG21 . VAL A 1 36 ? -0.225  -3.076  -3.396  1.00 0.00 ? 36  VAL A HG21 1  
ATOM 555   H HG22 . VAL A 1 36 ? -0.867  -3.975  -2.021  1.00 0.00 ? 36  VAL A HG22 1  
ATOM 556   H HG23 . VAL A 1 36 ? -1.829  -3.804  -3.488  1.00 0.00 ? 36  VAL A HG23 1  
ATOM 557   N N    . LYS A 1 37 ? 2.477   -7.144  -3.910  1.00 0.00 ? 37  LYS A N    1  
ATOM 558   C CA   . LYS A 1 37 ? 3.022   -8.381  -4.469  1.00 0.00 ? 37  LYS A CA   1  
ATOM 559   C C    . LYS A 1 37 ? 2.188   -9.592  -4.047  1.00 0.00 ? 37  LYS A C    1  
ATOM 560   O O    . LYS A 1 37 ? 1.988   -10.517 -4.835  1.00 0.00 ? 37  LYS A O    1  
ATOM 561   C CB   . LYS A 1 37 ? 4.474   -8.571  -4.026  1.00 0.00 ? 37  LYS A CB   1  
ATOM 562   C CG   . LYS A 1 37 ? 5.371   -9.145  -5.112  1.00 0.00 ? 37  LYS A CG   1  
ATOM 563   C CD   . LYS A 1 37 ? 6.687   -9.648  -4.542  1.00 0.00 ? 37  LYS A CD   1  
ATOM 564   C CE   . LYS A 1 37 ? 6.688   -11.161 -4.377  1.00 0.00 ? 37  LYS A CE   1  
ATOM 565   N NZ   . LYS A 1 37 ? 8.052   -11.694 -4.097  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 566   H H    . LYS A 1 37 ? 2.604   -6.958  -2.955  1.00 0.00 ? 37  LYS A H    1  
ATOM 567   H HA   . LYS A 1 37 ? 2.993   -8.298  -5.546  1.00 0.00 ? 37  LYS A HA   1  
ATOM 568   H HB2  . LYS A 1 37 ? 4.875   -7.616  -3.723  1.00 0.00 ? 37  LYS A HB2  1  
ATOM 569   H HB3  . LYS A 1 37 ? 4.494   -9.244  -3.181  1.00 0.00 ? 37  LYS A HB3  1  
ATOM 570   H HG2  . LYS A 1 37 ? 4.859   -9.966  -5.591  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 571   H HG3  . LYS A 1 37 ? 5.576   -8.373  -5.840  1.00 0.00 ? 37  LYS A HG3  1  
ATOM 572   H HD2  . LYS A 1 37 ? 7.487   -9.368  -5.212  1.00 0.00 ? 37  LYS A HD2  1  
ATOM 573   H HD3  . LYS A 1 37 ? 6.846   -9.189  -3.578  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 574   H HE2  . LYS A 1 37 ? 6.035   -11.421 -3.558  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 575   H HE3  . LYS A 1 37 ? 6.317   -11.609 -5.287  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 576   H HZ1  . LYS A 1 37 ? 8.167   -12.631 -4.536  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 577   H HZ2  . LYS A 1 37 ? 8.197   -11.785 -3.071  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 578   H HZ3  . LYS A 1 37 ? 8.776   -11.053 -4.481  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 579   N N    . SER A 1 38 ? 1.707   -9.584  -2.800  1.00 0.00 ? 38  SER A N    1  
ATOM 580   C CA   . SER A 1 38 ? 0.897   -10.685 -2.280  1.00 0.00 ? 38  SER A CA   1  
ATOM 581   C C    . SER A 1 38 ? 0.197   -10.283 -0.980  1.00 0.00 ? 38  SER A C    1  
ATOM 582   O O    . SER A 1 38 ? 0.463   -9.215  -0.427  1.00 0.00 ? 38  SER A O    1  
ATOM 583   C CB   . SER A 1 38 ? 1.768   -11.925 -2.047  1.00 0.00 ? 38  SER A CB   1  
ATOM 584   O OG   . SER A 1 38 ? 0.972   -13.090 -1.920  1.00 0.00 ? 38  SER A OG   1  
ATOM 585   H H    . SER A 1 38 ? 1.902   -8.821  -2.215  1.00 0.00 ? 38  SER A H    1  
ATOM 586   H HA   . SER A 1 38 ? 0.147   -10.920 -3.020  1.00 0.00 ? 38  SER A HA   1  
ATOM 587   H HB2  . SER A 1 38 ? 2.438   -12.054 -2.884  1.00 0.00 ? 38  SER A HB2  1  
ATOM 588   H HB3  . SER A 1 38 ? 2.344   -11.794 -1.143  1.00 0.00 ? 38  SER A HB3  1  
ATOM 589   H HG   . SER A 1 38 ? 1.091   -13.466 -1.044  1.00 0.00 ? 38  SER A HG   1  
ATOM 590   N N    . VAL A 1 39 ? -0.693  -11.150 -0.494  1.00 0.00 ? 39  VAL A N    1  
ATOM 591   C CA   . VAL A 1 39 ? -1.425  -10.891 0.743   1.00 0.00 ? 39  VAL A CA   1  
ATOM 592   C C    . VAL A 1 39 ? -1.358  -12.098 1.674   1.00 0.00 ? 39  VAL A C    1  
ATOM 593   O O    . VAL A 1 39 ? -1.685  -13.217 1.277   1.00 0.00 ? 39  VAL A O    1  
ATOM 594   C CB   . VAL A 1 39 ? -2.906  -10.544 0.474   1.00 0.00 ? 39  VAL A CB   1  
ATOM 595   C CG1  . VAL A 1 39 ? -3.588  -10.069 1.751   1.00 0.00 ? 39  VAL A CG1  1  
ATOM 596   C CG2  . VAL A 1 39 ? -3.022  -9.491  -0.621  1.00 0.00 ? 39  VAL A CG2  1  
ATOM 597   H H    . VAL A 1 39 ? -0.859  -11.987 -0.979  1.00 0.00 ? 39  VAL A H    1  
ATOM 598   H HA   . VAL A 1 39 ? -0.962  -10.047 1.234   1.00 0.00 ? 39  VAL A HA   1  
ATOM 599   H HB   . VAL A 1 39 ? -3.410  -11.439 0.137   1.00 0.00 ? 39  VAL A HB   1  
ATOM 600   H HG11 . VAL A 1 39 ? -3.117  -10.532 2.605   1.00 0.00 ? 39  VAL A HG11 1  
ATOM 601   H HG12 . VAL A 1 39 ? -4.632  -10.342 1.724   1.00 0.00 ? 39  VAL A HG12 1  
ATOM 602   H HG13 . VAL A 1 39 ? -3.500  -8.995  1.828   1.00 0.00 ? 39  VAL A HG13 1  
ATOM 603   H HG21 . VAL A 1 39 ? -3.890  -8.874  -0.438  1.00 0.00 ? 39  VAL A HG21 1  
ATOM 604   H HG22 . VAL A 1 39 ? -3.123  -9.978  -1.579  1.00 0.00 ? 39  VAL A HG22 1  
ATOM 605   H HG23 . VAL A 1 39 ? -2.135  -8.874  -0.623  1.00 0.00 ? 39  VAL A HG23 1  
ATOM 606   N N    . VAL A 1 40 ? -0.930  -11.863 2.912   1.00 0.00 ? 40  VAL A N    1  
ATOM 607   C CA   . VAL A 1 40 ? -0.816  -12.932 3.902   1.00 0.00 ? 40  VAL A CA   1  
ATOM 608   C C    . VAL A 1 40 ? -2.186  -13.302 4.469   1.00 0.00 ? 40  VAL A C    1  
ATOM 609   O O    . VAL A 1 40 ? -3.057  -12.445 4.631   1.00 0.00 ? 40  VAL A O    1  
ATOM 610   C CB   . VAL A 1 40 ? 0.127   -12.535 5.060   1.00 0.00 ? 40  VAL A CB   1  
ATOM 611   C CG1  . VAL A 1 40 ? 0.376   -13.715 5.987   1.00 0.00 ? 40  VAL A CG1  1  
ATOM 612   C CG2  . VAL A 1 40 ? 1.445   -11.994 4.523   1.00 0.00 ? 40  VAL A CG2  1  
ATOM 613   H H    . VAL A 1 40 ? -0.684  -10.946 3.168   1.00 0.00 ? 40  VAL A H    1  
ATOM 614   H HA   . VAL A 1 40 ? -0.399  -13.796 3.406   1.00 0.00 ? 40  VAL A HA   1  
ATOM 615   H HB   . VAL A 1 40 ? -0.350  -11.754 5.633   1.00 0.00 ? 40  VAL A HB   1  
ATOM 616   H HG11 . VAL A 1 40 ? 0.954   -14.465 5.467   1.00 0.00 ? 40  VAL A HG11 1  
ATOM 617   H HG12 . VAL A 1 40 ? -0.568  -14.138 6.297   1.00 0.00 ? 40  VAL A HG12 1  
ATOM 618   H HG13 . VAL A 1 40 ? 0.923   -13.379 6.857   1.00 0.00 ? 40  VAL A HG13 1  
ATOM 619   H HG21 . VAL A 1 40 ? 1.983   -12.788 4.026   1.00 0.00 ? 40  VAL A HG21 1  
ATOM 620   H HG22 . VAL A 1 40 ? 2.040   -11.616 5.343   1.00 0.00 ? 40  VAL A HG22 1  
ATOM 621   H HG23 . VAL A 1 40 ? 1.250   -11.198 3.821   1.00 0.00 ? 40  VAL A HG23 1  
ATOM 622   N N    . LYS A 1 41 ? -2.366  -14.588 4.764   1.00 0.00 ? 41  LYS A N    1  
ATOM 623   C CA   . LYS A 1 41 ? -3.627  -15.090 5.309   1.00 0.00 ? 41  LYS A CA   1  
ATOM 624   C C    . LYS A 1 41 ? -3.865  -14.572 6.725   1.00 0.00 ? 41  LYS A C    1  
ATOM 625   O O    . LYS A 1 41 ? -2.918  -14.323 7.474   1.00 0.00 ? 41  LYS A O    1  
ATOM 626   C CB   . LYS A 1 41 ? -3.631  -16.620 5.319   1.00 0.00 ? 41  LYS A CB   1  
ATOM 627   C CG   . LYS A 1 41 ? -3.464  -17.240 3.941   1.00 0.00 ? 41  LYS A CG   1  
ATOM 628   C CD   . LYS A 1 41 ? -4.808  -17.573 3.307   1.00 0.00 ? 41  LYS A CD   1  
ATOM 629   C CE   . LYS A 1 41 ? -4.744  -18.863 2.501   1.00 0.00 ? 41  LYS A CE   1  
ATOM 630   N NZ   . LYS A 1 41 ? -4.575  -20.063 3.370   1.00 0.00 ? 41  LYS A NZ   1  
ATOM 631   H H    . LYS A 1 41 ? -1.633  -15.218 4.609   1.00 0.00 ? 41  LYS A H    1  
ATOM 632   H HA   . LYS A 1 41 ? -4.426  -14.742 4.673   1.00 0.00 ? 41  LYS A HA   1  
ATOM 633   H HB2  . LYS A 1 41 ? -2.822  -16.965 5.946   1.00 0.00 ? 41  LYS A HB2  1  
ATOM 634   H HB3  . LYS A 1 41 ? -4.569  -16.962 5.735   1.00 0.00 ? 41  LYS A HB3  1  
ATOM 635   H HG2  . LYS A 1 41 ? -2.942  -16.542 3.305   1.00 0.00 ? 41  LYS A HG2  1  
ATOM 636   H HG3  . LYS A 1 41 ? -2.885  -18.147 4.037   1.00 0.00 ? 41  LYS A HG3  1  
ATOM 637   H HD2  . LYS A 1 41 ? -5.546  -17.684 4.087   1.00 0.00 ? 41  LYS A HD2  1  
ATOM 638   H HD3  . LYS A 1 41 ? -5.094  -16.763 2.651   1.00 0.00 ? 41  LYS A HD3  1  
ATOM 639   H HE2  . LYS A 1 41 ? -5.662  -18.966 1.940   1.00 0.00 ? 41  LYS A HE2  1  
ATOM 640   H HE3  . LYS A 1 41 ? -3.911  -18.804 1.816   1.00 0.00 ? 41  LYS A HE3  1  
ATOM 641   H HZ1  . LYS A 1 41 ? -4.134  -19.793 4.272   1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 642   H HZ2  . LYS A 1 41 ? -3.969  -20.764 2.898   1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 643   H HZ3  . LYS A 1 41 ? -5.500  -20.498 3.565   1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 644   N N    . GLY A 1 42 ? -5.138  -14.421 7.085   1.00 0.00 ? 42  GLY A N    1  
ATOM 645   C CA   . GLY A 1 42 ? -5.490  -13.936 8.410   1.00 0.00 ? 42  GLY A CA   1  
ATOM 646   C C    . GLY A 1 42 ? -5.112  -12.480 8.627   1.00 0.00 ? 42  GLY A C    1  
ATOM 647   O O    . GLY A 1 42 ? -5.000  -12.029 9.769   1.00 0.00 ? 42  GLY A O    1  
ATOM 648   H H    . GLY A 1 42 ? -5.847  -14.641 6.444   1.00 0.00 ? 42  GLY A H    1  
ATOM 649   H HA2  . GLY A 1 42 ? -6.556  -14.042 8.544   1.00 0.00 ? 42  GLY A HA2  1  
ATOM 650   H HA3  . GLY A 1 42 ? -4.984  -14.542 9.148   1.00 0.00 ? 42  GLY A HA3  1  
ATOM 651   N N    . GLY A 1 43 ? -4.921  -11.742 7.532   1.00 0.00 ? 43  GLY A N    1  
ATOM 652   C CA   . GLY A 1 43 ? -4.563  -10.340 7.630   1.00 0.00 ? 43  GLY A CA   1  
ATOM 653   C C    . GLY A 1 43 ? -5.777  -9.429  7.590   1.00 0.00 ? 43  GLY A C    1  
ATOM 654   O O    . GLY A 1 43 ? -6.833  -9.816  7.087   1.00 0.00 ? 43  GLY A O    1  
ATOM 655   H H    . GLY A 1 43 ? -5.030  -12.153 6.649   1.00 0.00 ? 43  GLY A H    1  
ATOM 656   H HA2  . GLY A 1 43 ? -4.035  -10.178 8.557   1.00 0.00 ? 43  GLY A HA2  1  
ATOM 657   H HA3  . GLY A 1 43 ? -3.910  -10.091 6.808   1.00 0.00 ? 43  GLY A HA3  1  
ATOM 658   N N    . ALA A 1 44 ? -5.624  -8.216  8.121   1.00 0.00 ? 44  ALA A N    1  
ATOM 659   C CA   . ALA A 1 44 ? -6.715  -7.236  8.148   1.00 0.00 ? 44  ALA A CA   1  
ATOM 660   C C    . ALA A 1 44 ? -7.303  -7.000  6.755   1.00 0.00 ? 44  ALA A C    1  
ATOM 661   O O    . ALA A 1 44 ? -8.509  -6.794  6.610   1.00 0.00 ? 44  ALA A O    1  
ATOM 662   C CB   . ALA A 1 44 ? -6.225  -5.922  8.739   1.00 0.00 ? 44  ALA A CB   1  
ATOM 663   H H    . ALA A 1 44 ? -4.757  -7.971  8.506   1.00 0.00 ? 44  ALA A H    1  
ATOM 664   H HA   . ALA A 1 44 ? -7.492  -7.623  8.792   1.00 0.00 ? 44  ALA A HA   1  
ATOM 665   H HB1  . ALA A 1 44 ? -6.053  -6.044  9.797   1.00 0.00 ? 44  ALA A HB1  1  
ATOM 666   H HB2  . ALA A 1 44 ? -6.970  -5.155  8.580   1.00 0.00 ? 44  ALA A HB2  1  
ATOM 667   H HB3  . ALA A 1 44 ? -5.304  -5.634  8.256   1.00 0.00 ? 44  ALA A HB3  1  
ATOM 668   N N    . ALA A 1 45 ? -6.446  -7.031  5.733   1.00 0.00 ? 45  ALA A N    1  
ATOM 669   C CA   . ALA A 1 45 ? -6.884  -6.823  4.355   1.00 0.00 ? 45  ALA A CA   1  
ATOM 670   C C    . ALA A 1 45 ? -7.381  -8.123  3.724   1.00 0.00 ? 45  ALA A C    1  
ATOM 671   O O    . ALA A 1 45 ? -8.285  -8.107  2.887   1.00 0.00 ? 45  ALA A O    1  
ATOM 672   C CB   . ALA A 1 45 ? -5.752  -6.237  3.524   1.00 0.00 ? 45  ALA A CB   1  
ATOM 673   H H    . ALA A 1 45 ? -5.496  -7.200  5.910   1.00 0.00 ? 45  ALA A H    1  
ATOM 674   H HA   . ALA A 1 45 ? -7.695  -6.108  4.368   1.00 0.00 ? 45  ALA A HA   1  
ATOM 675   H HB1  . ALA A 1 45 ? -6.006  -6.298  2.477   1.00 0.00 ? 45  ALA A HB1  1  
ATOM 676   H HB2  . ALA A 1 45 ? -4.845  -6.795  3.708   1.00 0.00 ? 45  ALA A HB2  1  
ATOM 677   H HB3  . ALA A 1 45 ? -5.601  -5.204  3.798   1.00 0.00 ? 45  ALA A HB3  1  
ATOM 678   N N    . ASP A 1 46 ? -6.784  -9.247  4.124   1.00 0.00 ? 46  ASP A N    1  
ATOM 679   C CA   . ASP A 1 46 ? -7.170  -10.551 3.589   1.00 0.00 ? 46  ASP A CA   1  
ATOM 680   C C    . ASP A 1 46 ? -8.522  -10.999 4.141   1.00 0.00 ? 46  ASP A C    1  
ATOM 681   O O    . ASP A 1 46 ? -9.374  -11.481 3.394   1.00 0.00 ? 46  ASP A O    1  
ATOM 682   C CB   . ASP A 1 46 ? -6.101  -11.598 3.912   1.00 0.00 ? 46  ASP A CB   1  
ATOM 683   C CG   . ASP A 1 46 ? -6.131  -12.769 2.947   1.00 0.00 ? 46  ASP A CG   1  
ATOM 684   O OD1  . ASP A 1 46 ? -5.948  -12.543 1.731   1.00 0.00 ? 46  ASP A OD1  1  
ATOM 685   O OD2  . ASP A 1 46 ? -6.337  -13.911 3.408   1.00 0.00 ? 46  ASP A OD2  1  
ATOM 686   H H    . ASP A 1 46 ? -6.068  -9.197  4.790   1.00 0.00 ? 46  ASP A H    1  
ATOM 687   H HA   . ASP A 1 46 ? -7.251  -10.454 2.516   1.00 0.00 ? 46  ASP A HA   1  
ATOM 688   H HB2  . ASP A 1 46 ? -5.125  -11.138 3.860   1.00 0.00 ? 46  ASP A HB2  1  
ATOM 689   H HB3  . ASP A 1 46 ? -6.265  -11.973 4.911   1.00 0.00 ? 46  ASP A HB3  1  
ATOM 690   N N    . VAL A 1 47 ? -8.712  -10.839 5.450   1.00 0.00 ? 47  VAL A N    1  
ATOM 691   C CA   . VAL A 1 47 ? -9.964  -11.231 6.099   1.00 0.00 ? 47  VAL A CA   1  
ATOM 692   C C    . VAL A 1 47 ? -11.127 -10.360 5.624   1.00 0.00 ? 47  VAL A C    1  
ATOM 693   O O    . VAL A 1 47 ? -12.208 -10.869 5.321   1.00 0.00 ? 47  VAL A O    1  
ATOM 694   C CB   . VAL A 1 47 ? -9.862  -11.147 7.638   1.00 0.00 ? 47  VAL A CB   1  
ATOM 695   C CG1  . VAL A 1 47 ? -11.147 -11.643 8.293   1.00 0.00 ? 47  VAL A CG1  1  
ATOM 696   C CG2  . VAL A 1 47 ? -8.664  -11.938 8.143   1.00 0.00 ? 47  VAL A CG2  1  
ATOM 697   H H    . VAL A 1 47 ? -7.993  -10.449 5.994   1.00 0.00 ? 47  VAL A H    1  
ATOM 698   H HA   . VAL A 1 47 ? -10.167 -12.258 5.828   1.00 0.00 ? 47  VAL A HA   1  
ATOM 699   H HB   . VAL A 1 47 ? -9.723  -10.112 7.912   1.00 0.00 ? 47  VAL A HB   1  
ATOM 700   H HG11 . VAL A 1 47 ? -11.995 -11.139 7.854   1.00 0.00 ? 47  VAL A HG11 1  
ATOM 701   H HG12 . VAL A 1 47 ? -11.113 -11.433 9.352   1.00 0.00 ? 47  VAL A HG12 1  
ATOM 702   H HG13 . VAL A 1 47 ? -11.242 -12.708 8.140   1.00 0.00 ? 47  VAL A HG13 1  
ATOM 703   H HG21 . VAL A 1 47 ? -8.227  -11.427 8.988   1.00 0.00 ? 47  VAL A HG21 1  
ATOM 704   H HG22 . VAL A 1 47 ? -7.929  -12.022 7.356   1.00 0.00 ? 47  VAL A HG22 1  
ATOM 705   H HG23 . VAL A 1 47 ? -8.983  -12.924 8.444   1.00 0.00 ? 47  VAL A HG23 1  
ATOM 706   N N    . ASP A 1 48 ? -10.901 -9.048  5.558   1.00 0.00 ? 48  ASP A N    1  
ATOM 707   C CA   . ASP A 1 48 ? -11.934 -8.114  5.115   1.00 0.00 ? 48  ASP A CA   1  
ATOM 708   C C    . ASP A 1 48 ? -12.150 -8.217  3.605   1.00 0.00 ? 48  ASP A C    1  
ATOM 709   O O    . ASP A 1 48 ? -13.281 -8.119  3.125   1.00 0.00 ? 48  ASP A O    1  
ATOM 710   C CB   . ASP A 1 48 ? -11.555 -6.679  5.493   1.00 0.00 ? 48  ASP A CB   1  
ATOM 711   C CG   . ASP A 1 48 ? -12.714 -5.712  5.337   1.00 0.00 ? 48  ASP A CG   1  
ATOM 712   O OD1  . ASP A 1 48 ? -12.879 -5.154  4.231   1.00 0.00 ? 48  ASP A OD1  1  
ATOM 713   O OD2  . ASP A 1 48 ? -13.456 -5.511  6.321   1.00 0.00 ? 48  ASP A OD2  1  
ATOM 714   H H    . ASP A 1 48 ? -10.019 -8.701  5.810   1.00 0.00 ? 48  ASP A H    1  
ATOM 715   H HA   . ASP A 1 48 ? -12.854 -8.379  5.617   1.00 0.00 ? 48  ASP A HA   1  
ATOM 716   H HB2  . ASP A 1 48 ? -11.231 -6.658  6.523   1.00 0.00 ? 48  ASP A HB2  1  
ATOM 717   H HB3  . ASP A 1 48 ? -10.746 -6.349  4.859   1.00 0.00 ? 48  ASP A HB3  1  
ATOM 718   N N    . GLY A 1 49 ? -11.059 -8.416  2.863   1.00 0.00 ? 49  GLY A N    1  
ATOM 719   C CA   . GLY A 1 49 ? -11.148 -8.531  1.419   1.00 0.00 ? 49  GLY A CA   1  
ATOM 720   C C    . GLY A 1 49 ? -11.320 -7.185  0.734   1.00 0.00 ? 49  GLY A C    1  
ATOM 721   O O    . GLY A 1 49 ? -12.440 -6.795  0.401   1.00 0.00 ? 49  GLY A O    1  
ATOM 722   H H    . GLY A 1 49 ? -10.185 -8.486  3.301   1.00 0.00 ? 49  GLY A H    1  
ATOM 723   H HA2  . GLY A 1 49 ? -10.249 -8.999  1.051   1.00 0.00 ? 49  GLY A HA2  1  
ATOM 724   H HA3  . GLY A 1 49 ? -11.992 -9.157  1.171   1.00 0.00 ? 49  GLY A HA3  1  
ATOM 725   N N    . ARG A 1 50 ? -10.210 -6.477  0.520   1.00 0.00 ? 50  ARG A N    1  
ATOM 726   C CA   . ARG A 1 50 ? -10.249 -5.168  -0.134  1.00 0.00 ? 50  ARG A CA   1  
ATOM 727   C C    . ARG A 1 50 ? -9.182  -5.058  -1.223  1.00 0.00 ? 50  ARG A C    1  
ATOM 728   O O    . ARG A 1 50 ? -9.504  -4.873  -2.397  1.00 0.00 ? 50  ARG A O    1  
ATOM 729   C CB   . ARG A 1 50 ? -10.063 -4.045  0.894   1.00 0.00 ? 50  ARG A CB   1  
ATOM 730   C CG   . ARG A 1 50 ? -11.237 -3.887  1.848   1.00 0.00 ? 50  ARG A CG   1  
ATOM 731   C CD   . ARG A 1 50 ? -12.479 -3.375  1.131   1.00 0.00 ? 50  ARG A CD   1  
ATOM 732   N NE   . ARG A 1 50 ? -13.616 -4.285  1.280   1.00 0.00 ? 50  ARG A NE   1  
ATOM 733   C CZ   . ARG A 1 50 ? -14.682 -4.291  0.476   1.00 0.00 ? 50  ARG A CZ   1  
ATOM 734   N NH1  . ARG A 1 50 ? -14.779 -3.422  -0.528  1.00 0.00 ? 50  ARG A NH1  1  
ATOM 735   N NH2  . ARG A 1 50 ? -15.661 -5.165  0.679   1.00 0.00 ? 50  ARG A NH2  1  
ATOM 736   H H    . ARG A 1 50 ? -9.345  -6.843  0.807   1.00 0.00 ? 50  ARG A H    1  
ATOM 737   H HA   . ARG A 1 50 ? -11.219 -5.061  -0.594  1.00 0.00 ? 50  ARG A HA   1  
ATOM 738   H HB2  . ARG A 1 50 ? -9.177  -4.249  1.476   1.00 0.00 ? 50  ARG A HB2  1  
ATOM 739   H HB3  . ARG A 1 50 ? -9.929  -3.111  0.367   1.00 0.00 ? 50  ARG A HB3  1  
ATOM 740   H HG2  . ARG A 1 50 ? -11.458 -4.847  2.291   1.00 0.00 ? 50  ARG A HG2  1  
ATOM 741   H HG3  . ARG A 1 50 ? -10.963 -3.186  2.623   1.00 0.00 ? 50  ARG A HG3  1  
ATOM 742   H HD2  . ARG A 1 50 ? -12.746 -2.412  1.543   1.00 0.00 ? 50  ARG A HD2  1  
ATOM 743   H HD3  . ARG A 1 50 ? -12.252 -3.265  0.080   1.00 0.00 ? 50  ARG A HD3  1  
ATOM 744   H HE   . ARG A 1 50 ? -13.581 -4.931  2.018   1.00 0.00 ? 50  ARG A HE   1  
ATOM 745   H HH11 . ARG A 1 50 ? -14.050 -2.756  -0.688  1.00 0.00 ? 50  ARG A HH11 1  
ATOM 746   H HH12 . ARG A 1 50 ? -15.582 -3.435  -1.125  1.00 0.00 ? 50  ARG A HH12 1  
ATOM 747   H HH21 . ARG A 1 50 ? -15.600 -5.819  1.433   1.00 0.00 ? 50  ARG A HH21 1  
ATOM 748   H HH22 . ARG A 1 50 ? -16.461 -5.172  0.077   1.00 0.00 ? 50  ARG A HH22 1  
ATOM 749   N N    . LEU A 1 51 ? -7.913  -5.166  -0.825  1.00 0.00 ? 51  LEU A N    1  
ATOM 750   C CA   . LEU A 1 51 ? -6.800  -5.070  -1.771  1.00 0.00 ? 51  LEU A CA   1  
ATOM 751   C C    . LEU A 1 51 ? -6.298  -6.455  -2.182  1.00 0.00 ? 51  LEU A C    1  
ATOM 752   O O    . LEU A 1 51 ? -6.478  -7.434  -1.453  1.00 0.00 ? 51  LEU A O    1  
ATOM 753   C CB   . LEU A 1 51 ? -5.651  -4.256  -1.166  1.00 0.00 ? 51  LEU A CB   1  
ATOM 754   C CG   . LEU A 1 51 ? -5.215  -4.680  0.240   1.00 0.00 ? 51  LEU A CG   1  
ATOM 755   C CD1  . LEU A 1 51 ? -3.709  -4.895  0.292   1.00 0.00 ? 51  LEU A CD1  1  
ATOM 756   C CD2  . LEU A 1 51 ? -5.644  -3.641  1.266   1.00 0.00 ? 51  LEU A CD2  1  
ATOM 757   H H    . LEU A 1 51 ? -7.722  -5.309  0.125   1.00 0.00 ? 51  LEU A H    1  
ATOM 758   H HA   . LEU A 1 51 ? -7.161  -4.560  -2.652  1.00 0.00 ? 51  LEU A HA   1  
ATOM 759   H HB2  . LEU A 1 51 ? -4.798  -4.336  -1.824  1.00 0.00 ? 51  LEU A HB2  1  
ATOM 760   H HB3  . LEU A 1 51 ? -5.955  -3.220  -1.126  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 761   H HG   . LEU A 1 51 ? -5.692  -5.616  0.491   1.00 0.00 ? 51  LEU A HG   1  
ATOM 762   H HD11 . LEU A 1 51 ? -3.399  -5.483  -0.559  1.00 0.00 ? 51  LEU A HD11 1  
ATOM 763   H HD12 . LEU A 1 51 ? -3.451  -5.417  1.202   1.00 0.00 ? 51  LEU A HD12 1  
ATOM 764   H HD13 . LEU A 1 51 ? -3.208  -3.938  0.272   1.00 0.00 ? 51  LEU A HD13 1  
ATOM 765   H HD21 . LEU A 1 51 ? -5.283  -3.929  2.243   1.00 0.00 ? 51  LEU A HD21 1  
ATOM 766   H HD22 . LEU A 1 51 ? -6.721  -3.577  1.285   1.00 0.00 ? 51  LEU A HD22 1  
ATOM 767   H HD23 . LEU A 1 51 ? -5.232  -2.679  0.998   1.00 0.00 ? 51  LEU A HD23 1  
ATOM 768   N N    . ALA A 1 52 ? -5.667  -6.526  -3.356  1.00 0.00 ? 52  ALA A N    1  
ATOM 769   C CA   . ALA A 1 52 ? -5.135  -7.786  -3.876  1.00 0.00 ? 52  ALA A CA   1  
ATOM 770   C C    . ALA A 1 52 ? -3.726  -7.608  -4.441  1.00 0.00 ? 52  ALA A C    1  
ATOM 771   O O    . ALA A 1 52 ? -3.221  -6.487  -4.536  1.00 0.00 ? 52  ALA A O    1  
ATOM 772   C CB   . ALA A 1 52 ? -6.062  -8.345  -4.946  1.00 0.00 ? 52  ALA A CB   1  
ATOM 773   H H    . ALA A 1 52 ? -5.556  -5.709  -3.888  1.00 0.00 ? 52  ALA A H    1  
ATOM 774   H HA   . ALA A 1 52 ? -5.098  -8.494  -3.061  1.00 0.00 ? 52  ALA A HA   1  
ATOM 775   H HB1  . ALA A 1 52 ? -5.483  -8.900  -5.670  1.00 0.00 ? 52  ALA A HB1  1  
ATOM 776   H HB2  . ALA A 1 52 ? -6.572  -7.532  -5.442  1.00 0.00 ? 52  ALA A HB2  1  
ATOM 777   H HB3  . ALA A 1 52 ? -6.788  -9.000  -4.488  1.00 0.00 ? 52  ALA A HB3  1  
ATOM 778   N N    . ALA A 1 53 ? -3.099  -8.724  -4.817  1.00 0.00 ? 53  ALA A N    1  
ATOM 779   C CA   . ALA A 1 53 ? -1.749  -8.698  -5.376  1.00 0.00 ? 53  ALA A CA   1  
ATOM 780   C C    . ALA A 1 53 ? -1.738  -8.070  -6.769  1.00 0.00 ? 53  ALA A C    1  
ATOM 781   O O    . ALA A 1 53 ? -2.642  -8.303  -7.574  1.00 0.00 ? 53  ALA A O    1  
ATOM 782   C CB   . ALA A 1 53 ? -1.170  -10.105 -5.425  1.00 0.00 ? 53  ALA A CB   1  
ATOM 783   H H    . ALA A 1 53 ? -3.556  -9.585  -4.718  1.00 0.00 ? 53  ALA A H    1  
ATOM 784   H HA   . ALA A 1 53 ? -1.130  -8.103  -4.720  1.00 0.00 ? 53  ALA A HA   1  
ATOM 785   H HB1  . ALA A 1 53 ? -1.336  -10.596 -4.478  1.00 0.00 ? 53  ALA A HB1  1  
ATOM 786   H HB2  . ALA A 1 53 ? -0.110  -10.049 -5.621  1.00 0.00 ? 53  ALA A HB2  1  
ATOM 787   H HB3  . ALA A 1 53 ? -1.652  -10.667 -6.212  1.00 0.00 ? 53  ALA A HB3  1  
ATOM 788   N N    . GLY A 1 54 ? -0.708  -7.272  -7.046  1.00 0.00 ? 54  GLY A N    1  
ATOM 789   C CA   . GLY A 1 54 ? -0.596  -6.617  -8.339  1.00 0.00 ? 54  GLY A CA   1  
ATOM 790   C C    . GLY A 1 54 ? -1.344  -5.297  -8.388  1.00 0.00 ? 54  GLY A C    1  
ATOM 791   O O    . GLY A 1 54 ? -1.962  -4.966  -9.400  1.00 0.00 ? 54  GLY A O    1  
ATOM 792   H H    . GLY A 1 54 ? -0.018  -7.123  -6.365  1.00 0.00 ? 54  GLY A H    1  
ATOM 793   H HA2  . GLY A 1 54 ? 0.448   -6.433  -8.546  1.00 0.00 ? 54  GLY A HA2  1  
ATOM 794   H HA3  . GLY A 1 54 ? -0.993  -7.273  -9.100  1.00 0.00 ? 54  GLY A HA3  1  
ATOM 795   N N    . ASP A 1 55 ? -1.286  -4.542  -7.290  1.00 0.00 ? 55  ASP A N    1  
ATOM 796   C CA   . ASP A 1 55 ? -1.961  -3.251  -7.207  1.00 0.00 ? 55  ASP A CA   1  
ATOM 797   C C    . ASP A 1 55 ? -0.963  -2.130  -6.914  1.00 0.00 ? 55  ASP A C    1  
ATOM 798   O O    . ASP A 1 55 ? 0.234   -2.382  -6.762  1.00 0.00 ? 55  ASP A O    1  
ATOM 799   C CB   . ASP A 1 55 ? -3.048  -3.294  -6.125  1.00 0.00 ? 55  ASP A CB   1  
ATOM 800   C CG   . ASP A 1 55 ? -4.416  -3.669  -6.671  1.00 0.00 ? 55  ASP A CG   1  
ATOM 801   O OD1  . ASP A 1 55 ? -4.496  -4.144  -7.825  1.00 0.00 ? 55  ASP A OD1  1  
ATOM 802   O OD2  . ASP A 1 55 ? -5.413  -3.486  -5.939  1.00 0.00 ? 55  ASP A OD2  1  
ATOM 803   H H    . ASP A 1 55 ? -0.775  -4.861  -6.517  1.00 0.00 ? 55  ASP A H    1  
ATOM 804   H HA   . ASP A 1 55 ? -2.424  -3.060  -8.163  1.00 0.00 ? 55  ASP A HA   1  
ATOM 805   H HB2  . ASP A 1 55 ? -2.771  -4.021  -5.375  1.00 0.00 ? 55  ASP A HB2  1  
ATOM 806   H HB3  . ASP A 1 55 ? -3.122  -2.321  -5.664  1.00 0.00 ? 55  ASP A HB3  1  
ATOM 807   N N    . GLN A 1 56 ? -1.458  -0.891  -6.843  1.00 0.00 ? 56  GLN A N    1  
ATOM 808   C CA   . GLN A 1 56 ? -0.600  0.265   -6.576  1.00 0.00 ? 56  GLN A CA   1  
ATOM 809   C C    . GLN A 1 56 ? -1.099  1.065   -5.368  1.00 0.00 ? 56  GLN A C    1  
ATOM 810   O O    . GLN A 1 56 ? -2.303  1.258   -5.197  1.00 0.00 ? 56  GLN A O    1  
ATOM 811   C CB   . GLN A 1 56 ? -0.538  1.168   -7.812  1.00 0.00 ? 56  GLN A CB   1  
ATOM 812   C CG   . GLN A 1 56 ? 0.420   2.342   -7.670  1.00 0.00 ? 56  GLN A CG   1  
ATOM 813   C CD   . GLN A 1 56 ? -0.288  3.669   -7.455  1.00 0.00 ? 56  GLN A CD   1  
ATOM 814   O OE1  . GLN A 1 56 ? -1.506  3.775   -7.612  1.00 0.00 ? 56  GLN A OE1  1  
ATOM 815   N NE2  . GLN A 1 56 ? 0.477   4.691   -7.094  1.00 0.00 ? 56  GLN A NE2  1  
ATOM 816   H H    . GLN A 1 56 ? -2.418  -0.749  -6.978  1.00 0.00 ? 56  GLN A H    1  
ATOM 817   H HA   . GLN A 1 56 ? 0.392   -0.104  -6.363  1.00 0.00 ? 56  GLN A HA   1  
ATOM 818   H HB2  . GLN A 1 56 ? -0.220  0.575   -8.657  1.00 0.00 ? 56  GLN A HB2  1  
ATOM 819   H HB3  . GLN A 1 56 ? -1.526  1.557   -8.010  1.00 0.00 ? 56  GLN A HB3  1  
ATOM 820   H HG2  . GLN A 1 56 ? 1.068   2.161   -6.825  1.00 0.00 ? 56  GLN A HG2  1  
ATOM 821   H HG3  . GLN A 1 56 ? 1.017   2.413   -8.568  1.00 0.00 ? 56  GLN A HG3  1  
ATOM 822   H HE21 . GLN A 1 56 ? 1.439   4.536   -6.987  1.00 0.00 ? 56  GLN A HE21 1  
ATOM 823   H HE22 . GLN A 1 56 ? 0.049   5.559   -6.949  1.00 0.00 ? 56  GLN A HE22 1  
ATOM 824   N N    . LEU A 1 57 ? -0.159  1.533   -4.539  1.00 0.00 ? 57  LEU A N    1  
ATOM 825   C CA   . LEU A 1 57 ? -0.494  2.316   -3.348  1.00 0.00 ? 57  LEU A CA   1  
ATOM 826   C C    . LEU A 1 57 ? -0.141  3.792   -3.543  1.00 0.00 ? 57  LEU A C    1  
ATOM 827   O O    . LEU A 1 57 ? 0.820   4.123   -4.241  1.00 0.00 ? 57  LEU A O    1  
ATOM 828   C CB   . LEU A 1 57 ? 0.242   1.761   -2.124  1.00 0.00 ? 57  LEU A CB   1  
ATOM 829   C CG   . LEU A 1 57 ? -0.406  2.081   -0.775  1.00 0.00 ? 57  LEU A CG   1  
ATOM 830   C CD1  . LEU A 1 57 ? -1.611  1.185   -0.532  1.00 0.00 ? 57  LEU A CD1  1  
ATOM 831   C CD2  . LEU A 1 57 ? 0.607   1.933   0.351   1.00 0.00 ? 57  LEU A CD2  1  
ATOM 832   H H    . LEU A 1 57 ? 0.784   1.348   -4.736  1.00 0.00 ? 57  LEU A H    1  
ATOM 833   H HA   . LEU A 1 57 ? -1.558  2.233   -3.184  1.00 0.00 ? 57  LEU A HA   1  
ATOM 834   H HB2  . LEU A 1 57 ? 0.303   0.687   -2.224  1.00 0.00 ? 57  LEU A HB2  1  
ATOM 835   H HB3  . LEU A 1 57 ? 1.245   2.163   -2.121  1.00 0.00 ? 57  LEU A HB3  1  
ATOM 836   H HG   . LEU A 1 57 ? -0.749  3.105   -0.782  1.00 0.00 ? 57  LEU A HG   1  
ATOM 837   H HD11 . LEU A 1 57 ? -2.023  1.393   0.445   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 838   H HD12 . LEU A 1 57 ? -1.306  0.150   -0.581  1.00 0.00 ? 57  LEU A HD12 1  
ATOM 839   H HD13 . LEU A 1 57 ? -2.361  1.376   -1.286  1.00 0.00 ? 57  LEU A HD13 1  
ATOM 840   H HD21 . LEU A 1 57 ? 0.109   1.566   1.236   1.00 0.00 ? 57  LEU A HD21 1  
ATOM 841   H HD22 . LEU A 1 57 ? 1.053   2.893   0.561   1.00 0.00 ? 57  LEU A HD22 1  
ATOM 842   H HD23 . LEU A 1 57 ? 1.376   1.234   0.056   1.00 0.00 ? 57  LEU A HD23 1  
ATOM 843   N N    . LEU A 1 58 ? -0.926  4.675   -2.919  1.00 0.00 ? 58  LEU A N    1  
ATOM 844   C CA   . LEU A 1 58 ? -0.702  6.118   -3.023  1.00 0.00 ? 58  LEU A CA   1  
ATOM 845   C C    . LEU A 1 58 ? -0.600  6.768   -1.641  1.00 0.00 ? 58  LEU A C    1  
ATOM 846   O O    . LEU A 1 58 ? 0.412   7.392   -1.315  1.00 0.00 ? 58  LEU A O    1  
ATOM 847   C CB   . LEU A 1 58 ? -1.838  6.776   -3.814  1.00 0.00 ? 58  LEU A CB   1  
ATOM 848   C CG   . LEU A 1 58 ? -1.414  7.502   -5.095  1.00 0.00 ? 58  LEU A CG   1  
ATOM 849   C CD1  . LEU A 1 58 ? -2.595  7.635   -6.046  1.00 0.00 ? 58  LEU A CD1  1  
ATOM 850   C CD2  . LEU A 1 58 ? -0.837  8.874   -4.769  1.00 0.00 ? 58  LEU A CD2  1  
ATOM 851   H H    . LEU A 1 58 ? -1.674  4.347   -2.377  1.00 0.00 ? 58  LEU A H    1  
ATOM 852   H HA   . LEU A 1 58 ? 0.227   6.273   -3.550  1.00 0.00 ? 58  LEU A HA   1  
ATOM 853   H HB2  . LEU A 1 58 ? -2.553  6.012   -4.078  1.00 0.00 ? 58  LEU A HB2  1  
ATOM 854   H HB3  . LEU A 1 58 ? -2.326  7.492   -3.170  1.00 0.00 ? 58  LEU A HB3  1  
ATOM 855   H HG   . LEU A 1 58 ? -0.648  6.926   -5.593  1.00 0.00 ? 58  LEU A HG   1  
ATOM 856   H HD11 . LEU A 1 58 ? -2.644  6.765   -6.683  1.00 0.00 ? 58  LEU A HD11 1  
ATOM 857   H HD12 . LEU A 1 58 ? -2.471  8.520   -6.653  1.00 0.00 ? 58  LEU A HD12 1  
ATOM 858   H HD13 . LEU A 1 58 ? -3.509  7.716   -5.476  1.00 0.00 ? 58  LEU A HD13 1  
ATOM 859   H HD21 . LEU A 1 58 ? -0.041  9.104   -5.463  1.00 0.00 ? 58  LEU A HD21 1  
ATOM 860   H HD22 . LEU A 1 58 ? -0.447  8.872   -3.762  1.00 0.00 ? 58  LEU A HD22 1  
ATOM 861   H HD23 . LEU A 1 58 ? -1.613  9.621   -4.853  1.00 0.00 ? 58  LEU A HD23 1  
ATOM 862   N N    . SER A 1 59 ? -1.661  6.634   -0.840  1.00 0.00 ? 59  SER A N    1  
ATOM 863   C CA   . SER A 1 59 ? -1.691  7.225   0.496   1.00 0.00 ? 59  SER A CA   1  
ATOM 864   C C    . SER A 1 59 ? -2.008  6.185   1.568   1.00 0.00 ? 59  SER A C    1  
ATOM 865   O O    . SER A 1 59 ? -2.804  5.267   1.347   1.00 0.00 ? 59  SER A O    1  
ATOM 866   C CB   . SER A 1 59 ? -2.723  8.356   0.551   1.00 0.00 ? 59  SER A CB   1  
ATOM 867   O OG   . SER A 1 59 ? -2.164  9.527   1.120   1.00 0.00 ? 59  SER A OG   1  
ATOM 868   H H    . SER A 1 59 ? -2.442  6.137   -1.159  1.00 0.00 ? 59  SER A H    1  
ATOM 869   H HA   . SER A 1 59 ? -0.713  7.637   0.696   1.00 0.00 ? 59  SER A HA   1  
ATOM 870   H HB2  . SER A 1 59 ? -3.062  8.583   -0.448  1.00 0.00 ? 59  SER A HB2  1  
ATOM 871   H HB3  . SER A 1 59 ? -3.563  8.045   1.154   1.00 0.00 ? 59  SER A HB3  1  
ATOM 872   H HG   . SER A 1 59 ? -1.896  9.346   2.026   1.00 0.00 ? 59  SER A HG   1  
ATOM 873   N N    . VAL A 1 60 ? -1.381  6.346   2.732   1.00 0.00 ? 60  VAL A N    1  
ATOM 874   C CA   . VAL A 1 60 ? -1.589  5.440   3.855   1.00 0.00 ? 60  VAL A CA   1  
ATOM 875   C C    . VAL A 1 60 ? -1.800  6.225   5.143   1.00 0.00 ? 60  VAL A C    1  
ATOM 876   O O    . VAL A 1 60 ? -0.960  7.044   5.524   1.00 0.00 ? 60  VAL A O    1  
ATOM 877   C CB   . VAL A 1 60 ? -0.397  4.482   4.051   1.00 0.00 ? 60  VAL A CB   1  
ATOM 878   C CG1  . VAL A 1 60 ? -0.699  3.475   5.153   1.00 0.00 ? 60  VAL A CG1  1  
ATOM 879   C CG2  . VAL A 1 60 ? -0.057  3.774   2.748   1.00 0.00 ? 60  VAL A CG2  1  
ATOM 880   H H    . VAL A 1 60 ? -0.767  7.103   2.842   1.00 0.00 ? 60  VAL A H    1  
ATOM 881   H HA   . VAL A 1 60 ? -2.473  4.852   3.654   1.00 0.00 ? 60  VAL A HA   1  
ATOM 882   H HB   . VAL A 1 60 ? 0.461   5.065   4.354   1.00 0.00 ? 60  VAL A HB   1  
ATOM 883   H HG11 . VAL A 1 60 ? -1.691  3.652   5.543   1.00 0.00 ? 60  VAL A HG11 1  
ATOM 884   H HG12 . VAL A 1 60 ? 0.024   3.584   5.949   1.00 0.00 ? 60  VAL A HG12 1  
ATOM 885   H HG13 . VAL A 1 60 ? -0.644  2.474   4.753   1.00 0.00 ? 60  VAL A HG13 1  
ATOM 886   H HG21 . VAL A 1 60 ? 0.979   3.469   2.764   1.00 0.00 ? 60  VAL A HG21 1  
ATOM 887   H HG22 . VAL A 1 60 ? -0.221  4.445   1.918   1.00 0.00 ? 60  VAL A HG22 1  
ATOM 888   H HG23 . VAL A 1 60 ? -0.686  2.903   2.636   1.00 0.00 ? 60  VAL A HG23 1  
ATOM 889   N N    . ASP A 1 61 ? -2.926  5.972   5.806   1.00 0.00 ? 61  ASP A N    1  
ATOM 890   C CA   . ASP A 1 61 ? -3.256  6.657   7.054   1.00 0.00 ? 61  ASP A CA   1  
ATOM 891   C C    . ASP A 1 61 ? -3.320  8.173   6.842   1.00 0.00 ? 61  ASP A C    1  
ATOM 892   O O    . ASP A 1 61 ? -2.981  8.951   7.736   1.00 0.00 ? 61  ASP A O    1  
ATOM 893   C CB   . ASP A 1 61 ? -2.225  6.311   8.135   1.00 0.00 ? 61  ASP A CB   1  
ATOM 894   C CG   . ASP A 1 61 ? -2.861  6.042   9.485   1.00 0.00 ? 61  ASP A CG   1  
ATOM 895   O OD1  . ASP A 1 61 ? -3.918  5.379   9.522   1.00 0.00 ? 61  ASP A OD1  1  
ATOM 896   O OD2  . ASP A 1 61 ? -2.298  6.488   10.507  1.00 0.00 ? 61  ASP A OD2  1  
ATOM 897   H H    . ASP A 1 61 ? -3.554  5.310   5.446   1.00 0.00 ? 61  ASP A H    1  
ATOM 898   H HA   . ASP A 1 61 ? -4.228  6.311   7.372   1.00 0.00 ? 61  ASP A HA   1  
ATOM 899   H HB2  . ASP A 1 61 ? -1.683  5.427   7.836   1.00 0.00 ? 61  ASP A HB2  1  
ATOM 900   H HB3  . ASP A 1 61 ? -1.531  7.133   8.241   1.00 0.00 ? 61  ASP A HB3  1  
ATOM 901   N N    . GLY A 1 62 ? -3.755  8.584   5.650   1.00 0.00 ? 62  GLY A N    1  
ATOM 902   C CA   . GLY A 1 62 ? -3.855  9.999   5.335   1.00 0.00 ? 62  GLY A CA   1  
ATOM 903   C C    . GLY A 1 62 ? -2.500  10.670  5.169   1.00 0.00 ? 62  GLY A C    1  
ATOM 904   O O    . GLY A 1 62 ? -2.387  11.888  5.319   1.00 0.00 ? 62  GLY A O    1  
ATOM 905   H H    . GLY A 1 62 ? -4.011  7.919   4.975   1.00 0.00 ? 62  GLY A H    1  
ATOM 906   H HA2  . GLY A 1 62 ? -4.412  10.110  4.417   1.00 0.00 ? 62  GLY A HA2  1  
ATOM 907   H HA3  . GLY A 1 62 ? -4.394  10.494  6.130   1.00 0.00 ? 62  GLY A HA3  1  
ATOM 908   N N    . ARG A 1 63 ? -1.469  9.884   4.850   1.00 0.00 ? 63  ARG A N    1  
ATOM 909   C CA   . ARG A 1 63 ? -0.127  10.425  4.658   1.00 0.00 ? 63  ARG A CA   1  
ATOM 910   C C    . ARG A 1 63 ? 0.292   10.291  3.201   1.00 0.00 ? 63  ARG A C    1  
ATOM 911   O O    . ARG A 1 63 ? 0.110   9.235   2.591   1.00 0.00 ? 63  ARG A O    1  
ATOM 912   C CB   . ARG A 1 63 ? 0.890   9.705   5.550   1.00 0.00 ? 63  ARG A CB   1  
ATOM 913   C CG   . ARG A 1 63 ? 0.485   9.626   7.013   1.00 0.00 ? 63  ARG A CG   1  
ATOM 914   C CD   . ARG A 1 63 ? 1.525   8.885   7.844   1.00 0.00 ? 63  ARG A CD   1  
ATOM 915   N NE   . ARG A 1 63 ? 1.299   7.439   7.842   1.00 0.00 ? 63  ARG A NE   1  
ATOM 916   C CZ   . ARG A 1 63 ? 1.830   6.595   6.953   1.00 0.00 ? 63  ARG A CZ   1  
ATOM 917   N NH1  . ARG A 1 63 ? 2.634   7.039   5.989   1.00 0.00 ? 63  ARG A NH1  1  
ATOM 918   N NH2  . ARG A 1 63 ? 1.557   5.298   7.031   1.00 0.00 ? 63  ARG A NH2  1  
ATOM 919   H H    . ARG A 1 63 ? -1.614  8.921   4.735   1.00 0.00 ? 63  ARG A H    1  
ATOM 920   H HA   . ARG A 1 63 ? -0.149  11.471  4.922   1.00 0.00 ? 63  ARG A HA   1  
ATOM 921   H HB2  . ARG A 1 63 ? 1.021   8.699   5.183   1.00 0.00 ? 63  ARG A HB2  1  
ATOM 922   H HB3  . ARG A 1 63 ? 1.834   10.227  5.488   1.00 0.00 ? 63  ARG A HB3  1  
ATOM 923   H HG2  . ARG A 1 63 ? 0.376   10.627  7.403   1.00 0.00 ? 63  ARG A HG2  1  
ATOM 924   H HG3  . ARG A 1 63 ? -0.457  9.104   7.086   1.00 0.00 ? 63  ARG A HG3  1  
ATOM 925   H HD2  . ARG A 1 63 ? 2.506   9.088   7.441   1.00 0.00 ? 63  ARG A HD2  1  
ATOM 926   H HD3  . ARG A 1 63 ? 1.474   9.245   8.861   1.00 0.00 ? 63  ARG A HD3  1  
ATOM 927   H HE   . ARG A 1 63 ? 0.714   7.076   8.542   1.00 0.00 ? 63  ARG A HE   1  
ATOM 928   H HH11 . ARG A 1 63 ? 2.848   8.013   5.922   1.00 0.00 ? 63  ARG A HH11 1  
ATOM 929   H HH12 . ARG A 1 63 ? 3.027   6.397   5.331   1.00 0.00 ? 63  ARG A HH12 1  
ATOM 930   H HH21 . ARG A 1 63 ? 0.956   4.956   7.755   1.00 0.00 ? 63  ARG A HH21 1  
ATOM 931   H HH22 . ARG A 1 63 ? 1.952   4.661   6.369   1.00 0.00 ? 63  ARG A HH22 1  
ATOM 932   N N    . SER A 1 64 ? 0.858   11.362  2.652   1.00 0.00 ? 64  SER A N    1  
ATOM 933   C CA   . SER A 1 64 ? 1.310   11.362  1.266   1.00 0.00 ? 64  SER A CA   1  
ATOM 934   C C    . SER A 1 64 ? 2.697   10.736  1.162   1.00 0.00 ? 64  SER A C    1  
ATOM 935   O O    . SER A 1 64 ? 3.711   11.437  1.199   1.00 0.00 ? 64  SER A O    1  
ATOM 936   C CB   . SER A 1 64 ? 1.331   12.788  0.707   1.00 0.00 ? 64  SER A CB   1  
ATOM 937   O OG   . SER A 1 64 ? 0.103   13.106  0.073   1.00 0.00 ? 64  SER A OG   1  
ATOM 938   H H    . SER A 1 64 ? 0.979   12.170  3.194   1.00 0.00 ? 64  SER A H    1  
ATOM 939   H HA   . SER A 1 64 ? 0.616   10.767  0.691   1.00 0.00 ? 64  SER A HA   1  
ATOM 940   H HB2  . SER A 1 64 ? 1.496   13.486  1.515   1.00 0.00 ? 64  SER A HB2  1  
ATOM 941   H HB3  . SER A 1 64 ? 2.130   12.878  -0.014  1.00 0.00 ? 64  SER A HB3  1  
ATOM 942   H HG   . SER A 1 64 ? -0.622  12.979  0.691   1.00 0.00 ? 64  SER A HG   1  
ATOM 943   N N    . LEU A 1 65 ? 2.737   9.412   1.034   1.00 0.00 ? 65  LEU A N    1  
ATOM 944   C CA   . LEU A 1 65 ? 4.005   8.694   0.926   1.00 0.00 ? 65  LEU A CA   1  
ATOM 945   C C    . LEU A 1 65 ? 4.440   8.574   -0.534  1.00 0.00 ? 65  LEU A C    1  
ATOM 946   O O    . LEU A 1 65 ? 4.696   7.476   -1.035  1.00 0.00 ? 65  LEU A O    1  
ATOM 947   C CB   . LEU A 1 65 ? 3.897   7.306   1.571   1.00 0.00 ? 65  LEU A CB   1  
ATOM 948   C CG   . LEU A 1 65 ? 2.809   6.398   0.992   1.00 0.00 ? 65  LEU A CG   1  
ATOM 949   C CD1  . LEU A 1 65 ? 3.348   4.992   0.774   1.00 0.00 ? 65  LEU A CD1  1  
ATOM 950   C CD2  . LEU A 1 65 ? 1.596   6.374   1.908   1.00 0.00 ? 65  LEU A CD2  1  
ATOM 951   H H    . LEU A 1 65 ? 1.896   8.908   1.011   1.00 0.00 ? 65  LEU A H    1  
ATOM 952   H HA   . LEU A 1 65 ? 4.749   9.267   1.459   1.00 0.00 ? 65  LEU A HA   1  
ATOM 953   H HB2  . LEU A 1 65 ? 4.849   6.808   1.460   1.00 0.00 ? 65  LEU A HB2  1  
ATOM 954   H HB3  . LEU A 1 65 ? 3.701   7.438   2.624   1.00 0.00 ? 65  LEU A HB3  1  
ATOM 955   H HG   . LEU A 1 65 ? 2.498   6.788   0.034   1.00 0.00 ? 65  LEU A HG   1  
ATOM 956   H HD11 . LEU A 1 65 ? 3.738   4.909   -0.230  1.00 0.00 ? 65  LEU A HD11 1  
ATOM 957   H HD12 . LEU A 1 65 ? 2.552   4.275   0.911   1.00 0.00 ? 65  LEU A HD12 1  
ATOM 958   H HD13 . LEU A 1 65 ? 4.137   4.794   1.485   1.00 0.00 ? 65  LEU A HD13 1  
ATOM 959   H HD21 . LEU A 1 65 ? 1.474   7.342   2.369   1.00 0.00 ? 65  LEU A HD21 1  
ATOM 960   H HD22 . LEU A 1 65 ? 1.737   5.625   2.674   1.00 0.00 ? 65  LEU A HD22 1  
ATOM 961   H HD23 . LEU A 1 65 ? 0.715   6.136   1.331   1.00 0.00 ? 65  LEU A HD23 1  
ATOM 962   N N    . VAL A 1 66 ? 4.524   9.718   -1.212  1.00 0.00 ? 66  VAL A N    1  
ATOM 963   C CA   . VAL A 1 66 ? 4.930   9.754   -2.608  1.00 0.00 ? 66  VAL A CA   1  
ATOM 964   C C    . VAL A 1 66 ? 6.382   10.203  -2.734  1.00 0.00 ? 66  VAL A C    1  
ATOM 965   O O    . VAL A 1 66 ? 6.692   11.396  -2.671  1.00 0.00 ? 66  VAL A O    1  
ATOM 966   C CB   . VAL A 1 66 ? 4.010   10.678  -3.429  1.00 0.00 ? 66  VAL A CB   1  
ATOM 967   C CG1  . VAL A 1 66 ? 4.538   10.857  -4.844  1.00 0.00 ? 66  VAL A CG1  1  
ATOM 968   C CG2  . VAL A 1 66 ? 2.598   10.116  -3.445  1.00 0.00 ? 66  VAL A CG2  1  
ATOM 969   H H    . VAL A 1 66 ? 4.311   10.559  -0.758  1.00 0.00 ? 66  VAL A H    1  
ATOM 970   H HA   . VAL A 1 66 ? 4.841   8.752   -3.004  1.00 0.00 ? 66  VAL A HA   1  
ATOM 971   H HB   . VAL A 1 66 ? 3.983   11.647  -2.951  1.00 0.00 ? 66  VAL A HB   1  
ATOM 972   H HG11 . VAL A 1 66 ? 5.101   9.982   -5.133  1.00 0.00 ? 66  VAL A HG11 1  
ATOM 973   H HG12 . VAL A 1 66 ? 5.178   11.726  -4.881  1.00 0.00 ? 66  VAL A HG12 1  
ATOM 974   H HG13 . VAL A 1 66 ? 3.708   10.993  -5.522  1.00 0.00 ? 66  VAL A HG13 1  
ATOM 975   H HG21 . VAL A 1 66 ? 2.034   10.537  -2.627  1.00 0.00 ? 66  VAL A HG21 1  
ATOM 976   H HG22 . VAL A 1 66 ? 2.642   9.041   -3.338  1.00 0.00 ? 66  VAL A HG22 1  
ATOM 977   H HG23 . VAL A 1 66 ? 2.121   10.365  -4.380  1.00 0.00 ? 66  VAL A HG23 1  
ATOM 978   N N    . GLY A 1 67 ? 7.263   9.225   -2.901  1.00 0.00 ? 67  GLY A N    1  
ATOM 979   C CA   . GLY A 1 67 ? 8.686   9.502   -3.027  1.00 0.00 ? 67  GLY A CA   1  
ATOM 980   C C    . GLY A 1 67 ? 9.489   8.984   -1.846  1.00 0.00 ? 67  GLY A C    1  
ATOM 981   O O    . GLY A 1 67 ? 10.494  9.584   -1.461  1.00 0.00 ? 67  GLY A O    1  
ATOM 982   H H    . GLY A 1 67 ? 6.942   8.300   -2.935  1.00 0.00 ? 67  GLY A H    1  
ATOM 983   H HA2  . GLY A 1 67 ? 9.053   9.036   -3.929  1.00 0.00 ? 67  GLY A HA2  1  
ATOM 984   H HA3  . GLY A 1 67 ? 8.830   10.570  -3.104  1.00 0.00 ? 67  GLY A HA3  1  
ATOM 985   N N    . LEU A 1 68 ? 9.046   7.866   -1.269  1.00 0.00 ? 68  LEU A N    1  
ATOM 986   C CA   . LEU A 1 68 ? 9.726   7.264   -0.127  1.00 0.00 ? 68  LEU A CA   1  
ATOM 987   C C    . LEU A 1 68 ? 10.238  5.870   -0.473  1.00 0.00 ? 68  LEU A C    1  
ATOM 988   O O    . LEU A 1 68 ? 9.783   5.252   -1.438  1.00 0.00 ? 68  LEU A O    1  
ATOM 989   C CB   . LEU A 1 68 ? 8.776   7.186   1.072   1.00 0.00 ? 68  LEU A CB   1  
ATOM 990   C CG   . LEU A 1 68 ? 8.642   8.476   1.881   1.00 0.00 ? 68  LEU A CG   1  
ATOM 991   C CD1  . LEU A 1 68 ? 7.591   8.312   2.968   1.00 0.00 ? 68  LEU A CD1  1  
ATOM 992   C CD2  . LEU A 1 68 ? 9.983   8.872   2.486   1.00 0.00 ? 68  LEU A CD2  1  
ATOM 993   H H    . LEU A 1 68 ? 8.242   7.432   -1.622  1.00 0.00 ? 68  LEU A H    1  
ATOM 994   H HA   . LEU A 1 68 ? 10.566  7.890   0.130   1.00 0.00 ? 68  LEU A HA   1  
ATOM 995   H HB2  . LEU A 1 68 ? 7.797   6.911   0.710   1.00 0.00 ? 68  LEU A HB2  1  
ATOM 996   H HB3  . LEU A 1 68 ? 9.128   6.409   1.734   1.00 0.00 ? 68  LEU A HB3  1  
ATOM 997   H HG   . LEU A 1 68 ? 8.322   9.272   1.225   1.00 0.00 ? 68  LEU A HG   1  
ATOM 998   H HD11 . LEU A 1 68 ? 7.830   8.956   3.801   1.00 0.00 ? 68  LEU A HD11 1  
ATOM 999   H HD12 . LEU A 1 68 ? 7.573   7.284   3.300   1.00 0.00 ? 68  LEU A HD12 1  
ATOM 1000  H HD13 . LEU A 1 68 ? 6.622   8.579   2.573   1.00 0.00 ? 68  LEU A HD13 1  
ATOM 1001  H HD21 . LEU A 1 68 ? 10.663  9.162   1.698   1.00 0.00 ? 68  LEU A HD21 1  
ATOM 1002  H HD22 . LEU A 1 68 ? 10.396  8.035   3.029   1.00 0.00 ? 68  LEU A HD22 1  
ATOM 1003  H HD23 . LEU A 1 68 ? 9.841   9.703   3.161   1.00 0.00 ? 68  LEU A HD23 1  
ATOM 1004  N N    . SER A 1 69 ? 11.180  5.376   0.328   1.00 0.00 ? 69  SER A N    1  
ATOM 1005  C CA   . SER A 1 69 ? 11.748  4.048   0.116   1.00 0.00 ? 69  SER A CA   1  
ATOM 1006  C C    . SER A 1 69 ? 10.854  2.985   0.741   1.00 0.00 ? 69  SER A C    1  
ATOM 1007  O O    . SER A 1 69 ? 10.134  3.262   1.702   1.00 0.00 ? 69  SER A O    1  
ATOM 1008  C CB   . SER A 1 69 ? 13.155  3.962   0.718   1.00 0.00 ? 69  SER A CB   1  
ATOM 1009  O OG   . SER A 1 69 ? 13.759  5.243   0.804   1.00 0.00 ? 69  SER A OG   1  
ATOM 1010  H H    . SER A 1 69 ? 11.496  5.914   1.086   1.00 0.00 ? 69  SER A H    1  
ATOM 1011  H HA   . SER A 1 69 ? 11.808  3.876   -0.949  1.00 0.00 ? 69  SER A HA   1  
ATOM 1012  H HB2  . SER A 1 69 ? 13.094  3.541   1.711   1.00 0.00 ? 69  SER A HB2  1  
ATOM 1013  H HB3  . SER A 1 69 ? 13.770  3.329   0.097   1.00 0.00 ? 69  SER A HB3  1  
ATOM 1014  H HG   . SER A 1 69 ? 13.879  5.601   -0.079  1.00 0.00 ? 69  SER A HG   1  
ATOM 1015  N N    . GLN A 1 70 ? 10.900  1.771   0.193   1.00 0.00 ? 70  GLN A N    1  
ATOM 1016  C CA   . GLN A 1 70 ? 10.088  0.667   0.704   1.00 0.00 ? 70  GLN A CA   1  
ATOM 1017  C C    . GLN A 1 70 ? 10.173  0.563   2.225   1.00 0.00 ? 70  GLN A C    1  
ATOM 1018  O O    . GLN A 1 70 ? 9.163   0.342   2.892   1.00 0.00 ? 70  GLN A O    1  
ATOM 1019  C CB   . GLN A 1 70 ? 10.522  -0.658  0.080   1.00 0.00 ? 70  GLN A CB   1  
ATOM 1020  C CG   . GLN A 1 70 ? 9.396   -1.668  -0.013  1.00 0.00 ? 70  GLN A CG   1  
ATOM 1021  C CD   . GLN A 1 70 ? 8.866   -1.806  -1.423  1.00 0.00 ? 70  GLN A CD   1  
ATOM 1022  O OE1  . GLN A 1 70 ? 9.349   -2.626  -2.200  1.00 0.00 ? 70  GLN A OE1  1  
ATOM 1023  N NE2  . GLN A 1 70 ? 7.869   -0.994  -1.761  1.00 0.00 ? 70  GLN A NE2  1  
ATOM 1024  H H    . GLN A 1 70 ? 11.492  1.615   -0.575  1.00 0.00 ? 70  GLN A H    1  
ATOM 1025  H HA   . GLN A 1 70 ? 9.062   0.861   0.429   1.00 0.00 ? 70  GLN A HA   1  
ATOM 1026  H HB2  . GLN A 1 70 ? 10.896  -0.471  -0.916  1.00 0.00 ? 70  GLN A HB2  1  
ATOM 1027  H HB3  . GLN A 1 70 ? 11.313  -1.084  0.679   1.00 0.00 ? 70  GLN A HB3  1  
ATOM 1028  H HG2  . GLN A 1 70 ? 9.758   -2.626  0.322   1.00 0.00 ? 70  GLN A HG2  1  
ATOM 1029  H HG3  . GLN A 1 70 ? 8.589   -1.348  0.629   1.00 0.00 ? 70  GLN A HG3  1  
ATOM 1030  H HE21 . GLN A 1 70 ? 7.539   -0.362  -1.088  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 1031  H HE22 . GLN A 1 70 ? 7.503   -1.062  -2.667  1.00 0.00 ? 70  GLN A HE22 1  
ATOM 1032  N N    . GLU A 1 71 ? 11.380  0.722   2.767   1.00 0.00 ? 71  GLU A N    1  
ATOM 1033  C CA   . GLU A 1 71 ? 11.587  0.646   4.211   1.00 0.00 ? 71  GLU A CA   1  
ATOM 1034  C C    . GLU A 1 71 ? 10.738  1.684   4.942   1.00 0.00 ? 71  GLU A C    1  
ATOM 1035  O O    . GLU A 1 71 ? 10.028  1.353   5.891   1.00 0.00 ? 71  GLU A O    1  
ATOM 1036  C CB   . GLU A 1 71 ? 13.064  0.851   4.550   1.00 0.00 ? 71  GLU A CB   1  
ATOM 1037  C CG   . GLU A 1 71 ? 13.953  -0.314  4.146   1.00 0.00 ? 71  GLU A CG   1  
ATOM 1038  C CD   . GLU A 1 71 ? 14.420  -1.129  5.336   1.00 0.00 ? 71  GLU A CD   1  
ATOM 1039  O OE1  . GLU A 1 71 ? 15.454  -0.766  5.936   1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1040  O OE2  . GLU A 1 71 ? 13.750  -2.129  5.668   1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1041  H H    . GLU A 1 71 ? 12.148  0.894   2.182   1.00 0.00 ? 71  GLU A H    1  
ATOM 1042  H HA   . GLU A 1 71 ? 11.282  -0.339  4.535   1.00 0.00 ? 71  GLU A HA   1  
ATOM 1043  H HB2  . GLU A 1 71 ? 13.417  1.736   4.043   1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1044  H HB3  . GLU A 1 71 ? 13.159  0.996   5.616   1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1045  H HG2  . GLU A 1 71 ? 13.400  -0.959  3.480   1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1046  H HG3  . GLU A 1 71 ? 14.820  0.075   3.631   1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1047  N N    . ARG A 1 72 ? 10.807  2.936   4.492   1.00 0.00 ? 72  ARG A N    1  
ATOM 1048  C CA   . ARG A 1 72 ? 10.032  4.011   5.107   1.00 0.00 ? 72  ARG A CA   1  
ATOM 1049  C C    . ARG A 1 72 ? 8.540   3.844   4.817   1.00 0.00 ? 72  ARG A C    1  
ATOM 1050  O O    . ARG A 1 72 ? 7.699   4.144   5.666   1.00 0.00 ? 72  ARG A O    1  
ATOM 1051  C CB   . ARG A 1 72 ? 10.513  5.375   4.602   1.00 0.00 ? 72  ARG A CB   1  
ATOM 1052  C CG   . ARG A 1 72 ? 11.939  5.710   5.008   1.00 0.00 ? 72  ARG A CG   1  
ATOM 1053  C CD   . ARG A 1 72 ? 12.020  6.115   6.472   1.00 0.00 ? 72  ARG A CD   1  
ATOM 1054  N NE   . ARG A 1 72 ? 12.324  7.538   6.637   1.00 0.00 ? 72  ARG A NE   1  
ATOM 1055  C CZ   . ARG A 1 72 ? 12.733  8.089   7.784   1.00 0.00 ? 72  ARG A CZ   1  
ATOM 1056  N NH1  . ARG A 1 72 ? 12.877  7.345   8.877   1.00 0.00 ? 72  ARG A NH1  1  
ATOM 1057  N NH2  . ARG A 1 72 ? 12.993  9.390   7.839   1.00 0.00 ? 72  ARG A NH2  1  
ATOM 1058  H H    . ARG A 1 72 ? 11.385  3.140   3.725   1.00 0.00 ? 72  ARG A H    1  
ATOM 1059  H HA   . ARG A 1 72 ? 10.184  3.959   6.175   1.00 0.00 ? 72  ARG A HA   1  
ATOM 1060  H HB2  . ARG A 1 72 ? 10.458  5.387   3.524   1.00 0.00 ? 72  ARG A HB2  1  
ATOM 1061  H HB3  . ARG A 1 72 ? 9.860   6.142   4.995   1.00 0.00 ? 72  ARG A HB3  1  
ATOM 1062  H HG2  . ARG A 1 72 ? 12.564  4.842   4.851   1.00 0.00 ? 72  ARG A HG2  1  
ATOM 1063  H HG3  . ARG A 1 72 ? 12.295  6.526   4.397   1.00 0.00 ? 72  ARG A HG3  1  
ATOM 1064  H HD2  . ARG A 1 72 ? 11.072  5.904   6.943   1.00 0.00 ? 72  ARG A HD2  1  
ATOM 1065  H HD3  . ARG A 1 72 ? 12.795  5.533   6.947   1.00 0.00 ? 72  ARG A HD3  1  
ATOM 1066  H HE   . ARG A 1 72 ? 12.219  8.116   5.852   1.00 0.00 ? 72  ARG A HE   1  
ATOM 1067  H HH11 . ARG A 1 72 ? 12.679  6.365   8.847   1.00 0.00 ? 72  ARG A HH11 1  
ATOM 1068  H HH12 . ARG A 1 72 ? 13.187  7.765   9.730   1.00 0.00 ? 72  ARG A HH12 1  
ATOM 1069  H HH21 . ARG A 1 72 ? 12.882  9.958   7.023   1.00 0.00 ? 72  ARG A HH21 1  
ATOM 1070  H HH22 . ARG A 1 72 ? 13.303  9.803   8.695   1.00 0.00 ? 72  ARG A HH22 1  
ATOM 1071  N N    . ALA A 1 73 ? 8.217   3.367   3.614   1.00 0.00 ? 73  ALA A N    1  
ATOM 1072  C CA   . ALA A 1 73 ? 6.828   3.165   3.216   1.00 0.00 ? 73  ALA A CA   1  
ATOM 1073  C C    . ALA A 1 73 ? 6.169   2.043   4.019   1.00 0.00 ? 73  ALA A C    1  
ATOM 1074  O O    . ALA A 1 73 ? 5.159   2.268   4.690   1.00 0.00 ? 73  ALA A O    1  
ATOM 1075  C CB   . ALA A 1 73 ? 6.736   2.876   1.723   1.00 0.00 ? 73  ALA A CB   1  
ATOM 1076  H H    . ALA A 1 73 ? 8.933   3.149   2.979   1.00 0.00 ? 73  ALA A H    1  
ATOM 1077  H HA   . ALA A 1 73 ? 6.296   4.086   3.409   1.00 0.00 ? 73  ALA A HA   1  
ATOM 1078  H HB1  . ALA A 1 73 ? 5.923   3.446   1.297   1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1079  H HB2  . ALA A 1 73 ? 6.556   1.822   1.570   1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1080  H HB3  . ALA A 1 73 ? 7.662   3.156   1.243   1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1081  N N    . ALA A 1 74 ? 6.744   0.837   3.953   1.00 0.00 ? 74  ALA A N    1  
ATOM 1082  C CA   . ALA A 1 74 ? 6.198   -0.309  4.682   1.00 0.00 ? 74  ALA A CA   1  
ATOM 1083  C C    . ALA A 1 74 ? 6.197   -0.058  6.189   1.00 0.00 ? 74  ALA A C    1  
ATOM 1084  O O    . ALA A 1 74 ? 5.199   -0.310  6.866   1.00 0.00 ? 74  ALA A O    1  
ATOM 1085  C CB   . ALA A 1 74 ? 6.978   -1.576  4.354   1.00 0.00 ? 74  ALA A CB   1  
ATOM 1086  H H    . ALA A 1 74 ? 7.554   0.716   3.404   1.00 0.00 ? 74  ALA A H    1  
ATOM 1087  H HA   . ALA A 1 74 ? 5.178   -0.451  4.355   1.00 0.00 ? 74  ALA A HA   1  
ATOM 1088  H HB1  . ALA A 1 74 ? 6.293   -2.404  4.250   1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1089  H HB2  . ALA A 1 74 ? 7.678   -1.787  5.150   1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1090  H HB3  . ALA A 1 74 ? 7.518   -1.439  3.428   1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1091  N N    . GLU A 1 75 ? 7.318   0.447   6.706   1.00 0.00 ? 75  GLU A N    1  
ATOM 1092  C CA   . GLU A 1 75 ? 7.440   0.738   8.132   1.00 0.00 ? 75  GLU A CA   1  
ATOM 1093  C C    . GLU A 1 75 ? 6.324   1.674   8.596   1.00 0.00 ? 75  GLU A C    1  
ATOM 1094  O O    . GLU A 1 75 ? 5.645   1.395   9.580   1.00 0.00 ? 75  GLU A O    1  
ATOM 1095  C CB   . GLU A 1 75 ? 8.807   1.361   8.434   1.00 0.00 ? 75  GLU A CB   1  
ATOM 1096  C CG   . GLU A 1 75 ? 9.053   1.616   9.912   1.00 0.00 ? 75  GLU A CG   1  
ATOM 1097  C CD   . GLU A 1 75 ? 9.706   0.438   10.608  1.00 0.00 ? 75  GLU A CD   1  
ATOM 1098  O OE1  . GLU A 1 75 ? 8.977   -0.497  11.002  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1099  O OE2  . GLU A 1 75 ? 10.946  0.450   10.759  1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1100  H H    . GLU A 1 75 ? 8.078   0.631   6.116   1.00 0.00 ? 75  GLU A H    1  
ATOM 1101  H HA   . GLU A 1 75 ? 7.354   -0.198  8.666   1.00 0.00 ? 75  GLU A HA   1  
ATOM 1102  H HB2  . GLU A 1 75 ? 9.579   0.698   8.073   1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1103  H HB3  . GLU A 1 75 ? 8.883   2.304   7.911   1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1104  H HG2  . GLU A 1 75 ? 9.697   2.476   10.012  1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1105  H HG3  . GLU A 1 75 ? 8.106   1.819   10.391  1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1106  N N    . LEU A 1 76 ? 6.136   2.781   7.877   1.00 0.00 ? 76  LEU A N    1  
ATOM 1107  C CA   . LEU A 1 76 ? 5.094   3.749   8.222   1.00 0.00 ? 76  LEU A CA   1  
ATOM 1108  C C    . LEU A 1 76 ? 3.699   3.122   8.138   1.00 0.00 ? 76  LEU A C    1  
ATOM 1109  O O    . LEU A 1 76 ? 2.845   3.384   8.986   1.00 0.00 ? 76  LEU A O    1  
ATOM 1110  C CB   . LEU A 1 76 ? 5.165   4.965   7.292   1.00 0.00 ? 76  LEU A CB   1  
ATOM 1111  C CG   . LEU A 1 76 ? 6.010   6.142   7.794   1.00 0.00 ? 76  LEU A CG   1  
ATOM 1112  C CD1  . LEU A 1 76 ? 6.112   7.218   6.720   1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1113  C CD2  . LEU A 1 76 ? 5.417   6.719   9.072   1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1114  H H    . LEU A 1 76 ? 6.706   2.947   7.095   1.00 0.00 ? 76  LEU A H    1  
ATOM 1115  H HA   . LEU A 1 76 ? 5.269   4.069   9.242   1.00 0.00 ? 76  LEU A HA   1  
ATOM 1116  H HB2  . LEU A 1 76 ? 5.570   4.640   6.345   1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1117  H HB3  . LEU A 1 76 ? 4.160   5.320   7.128   1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1118  H HG   . LEU A 1 76 ? 7.010   5.794   8.014   1.00 0.00 ? 76  LEU A HG   1  
ATOM 1119  H HD11 . LEU A 1 76 ? 6.083   6.757   5.744   1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1120  H HD12 . LEU A 1 76 ? 7.041   7.755   6.836   1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1121  H HD13 . LEU A 1 76 ? 5.284   7.906   6.819   1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1122  H HD21 . LEU A 1 76 ? 5.499   5.993   9.868   1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1123  H HD22 . LEU A 1 76 ? 4.376   6.959   8.910   1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1124  H HD23 . LEU A 1 76 ? 5.954   7.616   9.346   1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1125  N N    . MET A 1 77 ? 3.473   2.301   7.111   1.00 0.00 ? 77  MET A N    1  
ATOM 1126  C CA   . MET A 1 77 ? 2.177   1.643   6.918   1.00 0.00 ? 77  MET A CA   1  
ATOM 1127  C C    . MET A 1 77 ? 1.806   0.786   8.128   1.00 0.00 ? 77  MET A C    1  
ATOM 1128  O O    . MET A 1 77 ? 0.701   0.902   8.657   1.00 0.00 ? 77  MET A O    1  
ATOM 1129  C CB   . MET A 1 77 ? 2.190   0.786   5.652   1.00 0.00 ? 77  MET A CB   1  
ATOM 1130  C CG   . MET A 1 77 ? 2.159   1.591   4.363   1.00 0.00 ? 77  MET A CG   1  
ATOM 1131  S SD   . MET A 1 77 ? 3.002   0.754   3.005   1.00 0.00 ? 77  MET A SD   1  
ATOM 1132  C CE   . MET A 1 77 ? 1.987   -0.712  2.830   1.00 0.00 ? 77  MET A CE   1  
ATOM 1133  H H    . MET A 1 77 ? 4.191   2.136   6.465   1.00 0.00 ? 77  MET A H    1  
ATOM 1134  H HA   . MET A 1 77 ? 1.431   2.417   6.811   1.00 0.00 ? 77  MET A HA   1  
ATOM 1135  H HB2  . MET A 1 77 ? 3.083   0.181   5.651   1.00 0.00 ? 77  MET A HB2  1  
ATOM 1136  H HB3  . MET A 1 77 ? 1.328   0.137   5.664   1.00 0.00 ? 77  MET A HB3  1  
ATOM 1137  H HG2  . MET A 1 77 ? 1.130   1.756   4.084   1.00 0.00 ? 77  MET A HG2  1  
ATOM 1138  H HG3  . MET A 1 77 ? 2.641   2.544   4.535   1.00 0.00 ? 77  MET A HG3  1  
ATOM 1139  H HE1  . MET A 1 77 ? 1.089   -0.465  2.282   1.00 0.00 ? 77  MET A HE1  1  
ATOM 1140  H HE2  . MET A 1 77 ? 1.721   -1.087  3.809   1.00 0.00 ? 77  MET A HE2  1  
ATOM 1141  H HE3  . MET A 1 77 ? 2.540   -1.469  2.294   1.00 0.00 ? 77  MET A HE3  1  
ATOM 1142  N N    . THR A 1 78 ? 2.735   -0.058  8.577   1.00 0.00 ? 78  THR A N    1  
ATOM 1143  C CA   . THR A 1 78 ? 2.487   -0.901  9.745   1.00 0.00 ? 78  THR A CA   1  
ATOM 1144  C C    . THR A 1 78 ? 2.437   -0.041  11.009  1.00 0.00 ? 78  THR A C    1  
ATOM 1145  O O    . THR A 1 78 ? 1.769   -0.388  11.984  1.00 0.00 ? 78  THR A O    1  
ATOM 1146  C CB   . THR A 1 78 ? 3.565   -1.983  9.882   1.00 0.00 ? 78  THR A CB   1  
ATOM 1147  O OG1  . THR A 1 78 ? 3.281   -2.840  10.975  1.00 0.00 ? 78  THR A OG1  1  
ATOM 1148  C CG2  . THR A 1 78 ? 4.965   -1.435  10.083  1.00 0.00 ? 78  THR A CG2  1  
ATOM 1149  H H    . THR A 1 78 ? 3.607   -0.101  8.126   1.00 0.00 ? 78  THR A H    1  
ATOM 1150  H HA   . THR A 1 78 ? 1.526   -1.377  9.611   1.00 0.00 ? 78  THR A HA   1  
ATOM 1151  H HB   . THR A 1 78 ? 3.571   -2.577  8.984   1.00 0.00 ? 78  THR A HB   1  
ATOM 1152  H HG1  . THR A 1 78 ? 3.525   -3.741  10.749  1.00 0.00 ? 78  THR A HG1  1  
ATOM 1153  H HG21 . THR A 1 78 ? 5.389   -1.172  9.125   1.00 0.00 ? 78  THR A HG21 1  
ATOM 1154  H HG22 . THR A 1 78 ? 5.582   -2.185  10.556  1.00 0.00 ? 78  THR A HG22 1  
ATOM 1155  H HG23 . THR A 1 78 ? 4.922   -0.557  10.711  1.00 0.00 ? 78  THR A HG23 1  
ATOM 1156  N N    . ARG A 1 79 ? 3.151   1.088   10.975  1.00 0.00 ? 79  ARG A N    1  
ATOM 1157  C CA   . ARG A 1 79 ? 3.205   2.014   12.107  1.00 0.00 ? 79  ARG A CA   1  
ATOM 1158  C C    . ARG A 1 79 ? 1.998   2.964   12.125  1.00 0.00 ? 79  ARG A C    1  
ATOM 1159  O O    . ARG A 1 79 ? 2.152   4.166   12.357  1.00 0.00 ? 79  ARG A O    1  
ATOM 1160  C CB   . ARG A 1 79 ? 4.501   2.833   12.054  1.00 0.00 ? 79  ARG A CB   1  
ATOM 1161  C CG   . ARG A 1 79 ? 5.758   2.026   12.338  1.00 0.00 ? 79  ARG A CG   1  
ATOM 1162  C CD   . ARG A 1 79 ? 5.914   1.752   13.822  1.00 0.00 ? 79  ARG A CD   1  
ATOM 1163  N NE   . ARG A 1 79 ? 6.587   2.847   14.523  1.00 0.00 ? 79  ARG A NE   1  
ATOM 1164  C CZ   . ARG A 1 79 ? 6.470   3.078   15.834  1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1165  N NH1  . ARG A 1 79 ? 5.719   2.288   16.596  1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1166  N NH2  . ARG A 1 79 ? 7.112   4.103   16.386  1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1167  H H    . ARG A 1 79 ? 3.659   1.302   10.165  1.00 0.00 ? 79  ARG A H    1  
ATOM 1168  H HA   . ARG A 1 79 ? 3.199   1.427   13.012  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1169  H HB2  . ARG A 1 79 ? 4.597   3.269   11.070  1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1170  H HB3  . ARG A 1 79 ? 4.439   3.627   12.783  1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1171  H HG2  . ARG A 1 79 ? 5.698   1.084   11.813  1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1172  H HG3  . ARG A 1 79 ? 6.617   2.581   11.990  1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1173  H HD2  . ARG A 1 79 ? 4.933   1.614   14.248  1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1174  H HD3  . ARG A 1 79 ? 6.491   0.848   13.947  1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1175  H HE   . ARG A 1 79 ? 7.153   3.444   13.990  1.00 0.00 ? 79  ARG A HE   1  
ATOM 1176  H HH11 . ARG A 1 79 ? 5.235   1.513   16.189  1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1177  H HH12 . ARG A 1 79 ? 5.636   2.469   17.576  1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1178  H HH21 . ARG A 1 79 ? 7.681   4.701   15.822  1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1179  H HH22 . ARG A 1 79 ? 7.024   4.278   17.367  1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1180  N N    . THR A 1 80 ? 0.801   2.428   11.885  1.00 0.00 ? 80  THR A N    1  
ATOM 1181  C CA   . THR A 1 80 ? -0.416  3.241   11.880  1.00 0.00 ? 80  THR A CA   1  
ATOM 1182  C C    . THR A 1 80 ? -1.197  3.080   13.187  1.00 0.00 ? 80  THR A C    1  
ATOM 1183  O O    . THR A 1 80 ? -0.878  2.221   14.013  1.00 0.00 ? 80  THR A O    1  
ATOM 1184  C CB   . THR A 1 80 ? -1.305  2.860   10.693  1.00 0.00 ? 80  THR A CB   1  
ATOM 1185  O OG1  . THR A 1 80 ? -1.304  1.456   10.492  1.00 0.00 ? 80  THR A OG1  1  
ATOM 1186  C CG2  . THR A 1 80 ? -0.879  3.516   9.399   1.00 0.00 ? 80  THR A CG2  1  
ATOM 1187  H H    . THR A 1 80 ? 0.731   1.467   11.706  1.00 0.00 ? 80  THR A H    1  
ATOM 1188  H HA   . THR A 1 80 ? -0.121  4.275   11.778  1.00 0.00 ? 80  THR A HA   1  
ATOM 1189  H HB   . THR A 1 80 ? -2.319  3.171   10.902  1.00 0.00 ? 80  THR A HB   1  
ATOM 1190  H HG1  . THR A 1 80 ? -1.718  1.251   9.648   1.00 0.00 ? 80  THR A HG1  1  
ATOM 1191  H HG21 . THR A 1 80 ? -1.719  3.560   8.722   1.00 0.00 ? 80  THR A HG21 1  
ATOM 1192  H HG22 . THR A 1 80 ? -0.085  2.940   8.950   1.00 0.00 ? 80  THR A HG22 1  
ATOM 1193  H HG23 . THR A 1 80 ? -0.528  4.517   9.603   1.00 0.00 ? 80  THR A HG23 1  
ATOM 1194  N N    . SER A 1 81 ? -2.226  3.910   13.366  1.00 0.00 ? 81  SER A N    1  
ATOM 1195  C CA   . SER A 1 81 ? -3.057  3.860   14.568  1.00 0.00 ? 81  SER A CA   1  
ATOM 1196  C C    . SER A 1 81 ? -4.166  2.814   14.414  1.00 0.00 ? 81  SER A C    1  
ATOM 1197  O O    . SER A 1 81 ? -4.125  1.988   13.500  1.00 0.00 ? 81  SER A O    1  
ATOM 1198  C CB   . SER A 1 81 ? -3.661  5.243   14.851  1.00 0.00 ? 81  SER A CB   1  
ATOM 1199  O OG   . SER A 1 81 ? -2.668  6.254   14.815  1.00 0.00 ? 81  SER A OG   1  
ATOM 1200  H H    . SER A 1 81 ? -2.434  4.571   12.672  1.00 0.00 ? 81  SER A H    1  
ATOM 1201  H HA   . SER A 1 81 ? -2.424  3.577   15.397  1.00 0.00 ? 81  SER A HA   1  
ATOM 1202  H HB2  . SER A 1 81 ? -4.411  5.466   14.107  1.00 0.00 ? 81  SER A HB2  1  
ATOM 1203  H HB3  . SER A 1 81 ? -4.118  5.241   15.830  1.00 0.00 ? 81  SER A HB3  1  
ATOM 1204  H HG   . SER A 1 81 ? -2.574  6.578   13.916  1.00 0.00 ? 81  SER A HG   1  
ATOM 1205  N N    . SER A 1 82 ? -5.157  2.852   15.310  1.00 0.00 ? 82  SER A N    1  
ATOM 1206  C CA   . SER A 1 82 ? -6.273  1.904   15.261  1.00 0.00 ? 82  SER A CA   1  
ATOM 1207  C C    . SER A 1 82 ? -6.957  1.935   13.892  1.00 0.00 ? 82  SER A C    1  
ATOM 1208  O O    . SER A 1 82 ? -7.275  0.888   13.327  1.00 0.00 ? 82  SER A O    1  
ATOM 1209  C CB   . SER A 1 82 ? -7.295  2.216   16.361  1.00 0.00 ? 82  SER A CB   1  
ATOM 1210  O OG   . SER A 1 82 ? -7.860  1.027   16.888  1.00 0.00 ? 82  SER A OG   1  
ATOM 1211  H H    . SER A 1 82 ? -5.138  3.531   16.016  1.00 0.00 ? 82  SER A H    1  
ATOM 1212  H HA   . SER A 1 82 ? -5.873  0.913   15.425  1.00 0.00 ? 82  SER A HA   1  
ATOM 1213  H HB2  . SER A 1 82 ? -6.808  2.752   17.162  1.00 0.00 ? 82  SER A HB2  1  
ATOM 1214  H HB3  . SER A 1 82 ? -8.088  2.825   15.951  1.00 0.00 ? 82  SER A HB3  1  
ATOM 1215  H HG   . SER A 1 82 ? -8.793  1.167   17.066  1.00 0.00 ? 82  SER A HG   1  
ATOM 1216  N N    . VAL A 1 83 ? -7.170  3.140   13.363  1.00 0.00 ? 83  VAL A N    1  
ATOM 1217  C CA   . VAL A 1 83 ? -7.805  3.308   12.058  1.00 0.00 ? 83  VAL A CA   1  
ATOM 1218  C C    . VAL A 1 83 ? -6.752  3.399   10.954  1.00 0.00 ? 83  VAL A C    1  
ATOM 1219  O O    . VAL A 1 83 ? -5.708  4.025   11.136  1.00 0.00 ? 83  VAL A O    1  
ATOM 1220  C CB   . VAL A 1 83 ? -8.694  4.571   12.018  1.00 0.00 ? 83  VAL A CB   1  
ATOM 1221  C CG1  . VAL A 1 83 ? -9.460  4.655   10.704  1.00 0.00 ? 83  VAL A CG1  1  
ATOM 1222  C CG2  . VAL A 1 83 ? -9.652  4.589   13.200  1.00 0.00 ? 83  VAL A CG2  1  
ATOM 1223  H H    . VAL A 1 83 ? -6.888  3.938   13.861  1.00 0.00 ? 83  VAL A H    1  
ATOM 1224  H HA   . VAL A 1 83 ? -8.429  2.445   11.877  1.00 0.00 ? 83  VAL A HA   1  
ATOM 1225  H HB   . VAL A 1 83 ? -8.055  5.439   12.089  1.00 0.00 ? 83  VAL A HB   1  
ATOM 1226  H HG11 . VAL A 1 83 ? -9.493  5.682   10.372  1.00 0.00 ? 83  VAL A HG11 1  
ATOM 1227  H HG12 . VAL A 1 83 ? -10.467 4.292   10.850  1.00 0.00 ? 83  VAL A HG12 1  
ATOM 1228  H HG13 . VAL A 1 83 ? -8.966  4.051   9.958   1.00 0.00 ? 83  VAL A HG13 1  
ATOM 1229  H HG21 . VAL A 1 83 ? -9.092  4.707   14.116  1.00 0.00 ? 83  VAL A HG21 1  
ATOM 1230  H HG22 . VAL A 1 83 ? -10.202 3.660   13.231  1.00 0.00 ? 83  VAL A HG22 1  
ATOM 1231  H HG23 . VAL A 1 83 ? -10.341 5.412   13.091  1.00 0.00 ? 83  VAL A HG23 1  
ATOM 1232  N N    . VAL A 1 84 ? -7.033  2.767   9.814   1.00 0.00 ? 84  VAL A N    1  
ATOM 1233  C CA   . VAL A 1 84 ? -6.109  2.774   8.682   1.00 0.00 ? 84  VAL A CA   1  
ATOM 1234  C C    . VAL A 1 84 ? -6.822  3.158   7.387   1.00 0.00 ? 84  VAL A C    1  
ATOM 1235  O O    . VAL A 1 84 ? -7.907  2.651   7.093   1.00 0.00 ? 84  VAL A O    1  
ATOM 1236  C CB   . VAL A 1 84 ? -5.435  1.399   8.482   1.00 0.00 ? 84  VAL A CB   1  
ATOM 1237  C CG1  . VAL A 1 84 ? -4.371  1.481   7.397   1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1238  C CG2  . VAL A 1 84 ? -4.833  0.889   9.785   1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1239  H H    . VAL A 1 84 ? -7.882  2.281   9.734   1.00 0.00 ? 84  VAL A H    1  
ATOM 1240  H HA   . VAL A 1 84 ? -5.338  3.504   8.886   1.00 0.00 ? 84  VAL A HA   1  
ATOM 1241  H HB   . VAL A 1 84 ? -6.190  0.695   8.160   1.00 0.00 ? 84  VAL A HB   1  
ATOM 1242  H HG11 . VAL A 1 84 ? -3.505  1.998   7.780   1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1243  H HG12 . VAL A 1 84 ? -4.765  2.018   6.547   1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1244  H HG13 . VAL A 1 84 ? -4.091  0.483   7.093   1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1245  H HG21 . VAL A 1 84 ? -5.016  -0.171  9.873   1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1246  H HG22 . VAL A 1 84 ? -5.287  1.402   10.620  1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1247  H HG23 . VAL A 1 84 ? -3.769  1.072   9.786   1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1248  N N    . THR A 1 85 ? -6.200  4.050   6.616   1.00 0.00 ? 85  THR A N    1  
ATOM 1249  C CA   . THR A 1 85 ? -6.767  4.496   5.345   1.00 0.00 ? 85  THR A CA   1  
ATOM 1250  C C    . THR A 1 85 ? -5.799  4.228   4.194   1.00 0.00 ? 85  THR A C    1  
ATOM 1251  O O    . THR A 1 85 ? -4.965  5.072   3.857   1.00 0.00 ? 85  THR A O    1  
ATOM 1252  C CB   . THR A 1 85 ? -7.124  5.987   5.403   1.00 0.00 ? 85  THR A CB   1  
ATOM 1253  O OG1  . THR A 1 85 ? -6.327  6.666   6.362   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1254  C CG2  . THR A 1 85 ? -8.577  6.235   5.750   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1255  H H    . THR A 1 85 ? -5.334  4.411   6.906   1.00 0.00 ? 85  THR A H    1  
ATOM 1256  H HA   . THR A 1 85 ? -7.669  3.929   5.173   1.00 0.00 ? 85  THR A HA   1  
ATOM 1257  H HB   . THR A 1 85 ? -6.936  6.430   4.434   1.00 0.00 ? 85  THR A HB   1  
ATOM 1258  H HG1  . THR A 1 85 ? -6.423  7.615   6.248   1.00 0.00 ? 85  THR A HG1  1  
ATOM 1259  H HG21 . THR A 1 85 ? -8.650  6.588   6.768   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1260  H HG22 . THR A 1 85 ? -9.133  5.315   5.648   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1261  H HG23 . THR A 1 85 ? -8.986  6.978   5.081   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1262  N N    . LEU A 1 86 ? -5.916  3.042   3.597   1.00 0.00 ? 86  LEU A N    1  
ATOM 1263  C CA   . LEU A 1 86 ? -5.056  2.651   2.481   1.00 0.00 ? 86  LEU A CA   1  
ATOM 1264  C C    . LEU A 1 86 ? -5.725  2.959   1.144   1.00 0.00 ? 86  LEU A C    1  
ATOM 1265  O O    . LEU A 1 86 ? -6.804  2.441   0.846   1.00 0.00 ? 86  LEU A O    1  
ATOM 1266  C CB   . LEU A 1 86 ? -4.725  1.157   2.557   1.00 0.00 ? 86  LEU A CB   1  
ATOM 1267  C CG   . LEU A 1 86 ? -4.012  0.703   3.833   1.00 0.00 ? 86  LEU A CG   1  
ATOM 1268  C CD1  . LEU A 1 86 ? -4.212  -0.790  4.046   1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1269  C CD2  . LEU A 1 86 ? -2.529  1.042   3.767   1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1270  H H    . LEU A 1 86 ? -6.598  2.413   3.915   1.00 0.00 ? 86  LEU A H    1  
ATOM 1271  H HA   . LEU A 1 86 ? -4.139  3.219   2.550   1.00 0.00 ? 86  LEU A HA   1  
ATOM 1272  H HB2  . LEU A 1 86 ? -5.649  0.602   2.471   1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1273  H HB3  . LEU A 1 86 ? -4.098  0.908   1.714   1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1274  H HG   . LEU A 1 86 ? -4.438  1.221   4.680   1.00 0.00 ? 86  LEU A HG   1  
ATOM 1275  H HD11 . LEU A 1 86 ? -3.288  -1.234  4.386   1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1276  H HD12 . LEU A 1 86 ? -4.510  -1.250  3.115   1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1277  H HD13 . LEU A 1 86 ? -4.982  -0.948  4.787   1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1278  H HD21 . LEU A 1 86 ? -2.400  2.001   3.289   1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1279  H HD22 . LEU A 1 86 ? -2.010  0.284   3.200   1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1280  H HD23 . LEU A 1 86 ? -2.125  1.081   4.768   1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1281  N N    . GLU A 1 87 ? -5.073  3.796   0.342   1.00 0.00 ? 87  GLU A N    1  
ATOM 1282  C CA   . GLU A 1 87 ? -5.594  4.171   -0.969  1.00 0.00 ? 87  GLU A CA   1  
ATOM 1283  C C    . GLU A 1 87 ? -4.925  3.341   -2.063  1.00 0.00 ? 87  GLU A C    1  
ATOM 1284  O O    . GLU A 1 87 ? -3.783  3.604   -2.447  1.00 0.00 ? 87  GLU A O    1  
ATOM 1285  C CB   . GLU A 1 87 ? -5.372  5.666   -1.212  1.00 0.00 ? 87  GLU A CB   1  
ATOM 1286  C CG   . GLU A 1 87 ? -5.904  6.166   -2.545  1.00 0.00 ? 87  GLU A CG   1  
ATOM 1287  C CD   . GLU A 1 87 ? -5.695  7.659   -2.729  1.00 0.00 ? 87  GLU A CD   1  
ATOM 1288  O OE1  . GLU A 1 87 ? -4.537  8.116   -2.618  1.00 0.00 ? 87  GLU A OE1  1  
ATOM 1289  O OE2  . GLU A 1 87 ? -6.689  8.370   -2.983  1.00 0.00 ? 87  GLU A OE2  1  
ATOM 1290  H H    . GLU A 1 87 ? -4.216  4.169   0.637   1.00 0.00 ? 87  GLU A H    1  
ATOM 1291  H HA   . GLU A 1 87 ? -6.654  3.966   -0.976  1.00 0.00 ? 87  GLU A HA   1  
ATOM 1292  H HB2  . GLU A 1 87 ? -5.865  6.219   -0.427  1.00 0.00 ? 87  GLU A HB2  1  
ATOM 1293  H HB3  . GLU A 1 87 ? -4.315  5.872   -1.173  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 1294  H HG2  . GLU A 1 87 ? -5.393  5.646   -3.341  1.00 0.00 ? 87  GLU A HG2  1  
ATOM 1295  H HG3  . GLU A 1 87 ? -6.963  5.956   -2.597  1.00 0.00 ? 87  GLU A HG3  1  
ATOM 1296  N N    . VAL A 1 88 ? -5.644  2.332   -2.549  1.00 0.00 ? 88  VAL A N    1  
ATOM 1297  C CA   . VAL A 1 88 ? -5.127  1.447   -3.589  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1298  C C    . VAL A 1 88 ? -5.767  1.749   -4.947  1.00 0.00 ? 88  VAL A C    1  
ATOM 1299  O O    . VAL A 1 88 ? -6.912  2.199   -5.017  1.00 0.00 ? 88  VAL A O    1  
ATOM 1300  C CB   . VAL A 1 88 ? -5.361  -0.037  -3.222  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1301  C CG1  . VAL A 1 88 ? -6.848  -0.363  -3.186  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1302  C CG2  . VAL A 1 88 ? -4.631  -0.957  -4.190  1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1303  H H    . VAL A 1 88 ? -6.544  2.173   -2.193  1.00 0.00 ? 88  VAL A H    1  
ATOM 1304  H HA   . VAL A 1 88 ? -4.061  1.614   -3.662  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1305  H HB   . VAL A 1 88 ? -4.959  -0.206  -2.232  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1306  H HG11 . VAL A 1 88 ? -7.327  0.226   -2.417  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1307  H HG12 . VAL A 1 88 ? -6.981  -1.413  -2.970  1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1308  H HG13 . VAL A 1 88 ? -7.290  -0.133  -4.144  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1309  H HG21 . VAL A 1 88 ? -4.663  -1.971  -3.817  1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1310  H HG22 . VAL A 1 88 ? -3.603  -0.640  -4.284  1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1311  H HG23 . VAL A 1 88 ? -5.110  -0.915  -5.158  1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1312  N N    . ALA A 1 89 ? -5.016  1.500   -6.020  1.00 0.00 ? 89  ALA A N    1  
ATOM 1313  C CA   . ALA A 1 89 ? -5.503  1.748   -7.374  1.00 0.00 ? 89  ALA A CA   1  
ATOM 1314  C C    . ALA A 1 89 ? -5.841  0.445   -8.097  1.00 0.00 ? 89  ALA A C    1  
ATOM 1315  O O    . ALA A 1 89 ? -5.208  -0.588  -7.867  1.00 0.00 ? 89  ALA A O    1  
ATOM 1316  C CB   . ALA A 1 89 ? -4.470  2.535   -8.168  1.00 0.00 ? 89  ALA A CB   1  
ATOM 1317  H H    . ALA A 1 89 ? -4.109  1.145   -5.897  1.00 0.00 ? 89  ALA A H    1  
ATOM 1318  H HA   . ALA A 1 89 ? -6.398  2.349   -7.302  1.00 0.00 ? 89  ALA A HA   1  
ATOM 1319  H HB1  . ALA A 1 89 ? -4.747  2.540   -9.211  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1320  H HB2  . ALA A 1 89 ? -3.500  2.074   -8.055  1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1321  H HB3  . ALA A 1 89 ? -4.432  3.550   -7.802  1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1322  N N    . LYS A 1 90 ? -6.842  0.509   -8.978  1.00 0.00 ? 90  LYS A N    1  
ATOM 1323  C CA   . LYS A 1 90 ? -7.273  -0.655  -9.748  1.00 0.00 ? 90  LYS A CA   1  
ATOM 1324  C C    . LYS A 1 90 ? -6.712  -0.598  -11.167 1.00 0.00 ? 90  LYS A C    1  
ATOM 1325  O O    . LYS A 1 90 ? -7.038  0.309   -11.936 1.00 0.00 ? 90  LYS A O    1  
ATOM 1326  C CB   . LYS A 1 90 ? -8.804  -0.728  -9.793  1.00 0.00 ? 90  LYS A CB   1  
ATOM 1327  C CG   . LYS A 1 90 ? -9.364  -2.106  -9.475  1.00 0.00 ? 90  LYS A CG   1  
ATOM 1328  C CD   . LYS A 1 90 ? -9.051  -2.518  -8.046  1.00 0.00 ? 90  LYS A CD   1  
ATOM 1329  C CE   . LYS A 1 90 ? -10.230 -2.261  -7.119  1.00 0.00 ? 90  LYS A CE   1  
ATOM 1330  N NZ   . LYS A 1 90 ? -10.445 -3.383  -6.163  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1331  H H    . LYS A 1 90 ? -7.299  1.365   -9.116  1.00 0.00 ? 90  LYS A H    1  
ATOM 1332  H HA   . LYS A 1 90 ? -6.891  -1.538  -9.257  1.00 0.00 ? 90  LYS A HA   1  
ATOM 1333  H HB2  . LYS A 1 90 ? -9.207  -0.027  -9.076  1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1334  H HB3  . LYS A 1 90 ? -9.138  -0.447  -10.781 1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1335  H HG2  . LYS A 1 90 ? -10.436 -2.086  -9.607  1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1336  H HG3  . LYS A 1 90 ? -8.929  -2.827  -10.153 1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1337  H HD2  . LYS A 1 90 ? -8.813  -3.571  -8.029  1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1338  H HD3  . LYS A 1 90 ? -8.200  -1.950  -7.697  1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1339  H HE2  . LYS A 1 90 ? -10.041 -1.356  -6.560  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1340  H HE3  . LYS A 1 90 ? -11.120 -2.133  -7.717  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1341  H HZ1  . LYS A 1 90 ? -9.932  -3.201  -5.277  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1342  H HZ2  . LYS A 1 90 ? -10.100 -4.276  -6.572  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1343  H HZ3  . LYS A 1 90 ? -11.458 -3.482  -5.951  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1344  N N    . GLN A 1 91 ? -5.863  -1.568  -11.503 1.00 0.00 ? 91  GLN A N    1  
ATOM 1345  C CA   . GLN A 1 91 ? -5.248  -1.635  -12.826 1.00 0.00 ? 91  GLN A CA   1  
ATOM 1346  C C    . GLN A 1 91 ? -4.616  -3.008  -13.067 1.00 0.00 ? 91  GLN A C    1  
ATOM 1347  O O    . GLN A 1 91 ? -4.758  -3.918  -12.246 1.00 0.00 ? 91  GLN A O    1  
ATOM 1348  C CB   . GLN A 1 91 ? -4.191  -0.532  -12.969 1.00 0.00 ? 91  GLN A CB   1  
ATOM 1349  C CG   . GLN A 1 91 ? -2.946  -0.757  -12.122 1.00 0.00 ? 91  GLN A CG   1  
ATOM 1350  C CD   . GLN A 1 91 ? -3.216  -0.623  -10.635 1.00 0.00 ? 91  GLN A CD   1  
ATOM 1351  O OE1  . GLN A 1 91 ? -3.328  0.484   -10.111 1.00 0.00 ? 91  GLN A OE1  1  
ATOM 1352  N NE2  . GLN A 1 91 ? -3.324  -1.755  -9.947  1.00 0.00 ? 91  GLN A NE2  1  
ATOM 1353  H H    . GLN A 1 91 ? -5.642  -2.258  -10.844 1.00 0.00 ? 91  GLN A H    1  
ATOM 1354  H HA   . GLN A 1 91 ? -6.022  -1.475  -13.562 1.00 0.00 ? 91  GLN A HA   1  
ATOM 1355  H HB2  . GLN A 1 91 ? -3.888  -0.473  -14.003 1.00 0.00 ? 91  GLN A HB2  1  
ATOM 1356  H HB3  . GLN A 1 91 ? -4.632  0.412   -12.680 1.00 0.00 ? 91  GLN A HB3  1  
ATOM 1357  H HG2  . GLN A 1 91 ? -2.570  -1.751  -12.315 1.00 0.00 ? 91  GLN A HG2  1  
ATOM 1358  H HG3  . GLN A 1 91 ? -2.197  -0.030  -12.403 1.00 0.00 ? 91  GLN A HG3  1  
ATOM 1359  H HE21 . GLN A 1 91 ? -3.224  -2.603  -10.429 1.00 0.00 ? 91  GLN A HE21 1  
ATOM 1360  H HE22 . GLN A 1 91 ? -3.505  -1.696  -8.986  1.00 0.00 ? 91  GLN A HE22 1  
ATOM 1361  N N    . GLY A 1 92 ? -3.915  -3.151  -14.192 1.00 0.00 ? 92  GLY A N    1  
ATOM 1362  C CA   . GLY A 1 92 ? -3.271  -4.411  -14.514 1.00 0.00 ? 92  GLY A CA   1  
ATOM 1363  C C    . GLY A 1 92 ? -3.033  -4.581  -16.001 1.00 0.00 ? 92  GLY A C    1  
ATOM 1364  O O    . GLY A 1 92 ? -3.884  -4.230  -16.822 1.00 0.00 ? 92  GLY A O    1  
ATOM 1365  H H    . GLY A 1 92 ? -3.830  -2.395  -14.809 1.00 0.00 ? 92  GLY A H    1  
ATOM 1366  H HA2  . GLY A 1 92 ? -2.321  -4.455  -14.001 1.00 0.00 ? 92  GLY A HA2  1  
ATOM 1367  H HA3  . GLY A 1 92 ? -3.892  -5.221  -14.165 1.00 0.00 ? 92  GLY A HA3  1  
ATOM 1368  N N    . ALA A 1 93 ? -1.869  -5.124  -16.341 1.00 0.00 ? 93  ALA A N    1  
ATOM 1369  C CA   . ALA A 1 93 ? -1.497  -5.355  -17.735 1.00 0.00 ? 93  ALA A CA   1  
ATOM 1370  C C    . ALA A 1 93 ? -1.306  -6.844  -18.016 1.00 0.00 ? 93  ALA A C    1  
ATOM 1371  O O    . ALA A 1 93 ? -1.577  -7.267  -19.160 1.00 0.00 ? 93  ALA A O    1  
ATOM 1372  C CB   . ALA A 1 93 ? -0.230  -4.586  -18.082 1.00 0.00 ? 93  ALA A CB   1  
ATOM 1373  O OXT  . ALA A 1 93 ? -0.884  -7.576  -17.094 1.00 0.00 ? 93  ALA A OXT  1  
ATOM 1374  H H    . ALA A 1 93 ? -1.242  -5.379  -15.633 1.00 0.00 ? 93  ALA A H    1  
ATOM 1375  H HA   . ALA A 1 93 ? -2.298  -4.984  -18.359 1.00 0.00 ? 93  ALA A HA   1  
ATOM 1376  H HB1  . ALA A 1 93 ? 0.321   -5.124  -18.840 1.00 0.00 ? 93  ALA A HB1  1  
ATOM 1377  H HB2  . ALA A 1 93 ? 0.383   -4.482  -17.200 1.00 0.00 ? 93  ALA A HB2  1  
ATOM 1378  H HB3  . ALA A 1 93 ? -0.493  -3.607  -18.455 1.00 0.00 ? 93  ALA A HB3  1  
ATOM 1379  N N    . LEU B 2 1  ? 13.172  -2.248  -5.613  1.00 0.00 ? 99  LEU B N    1  
ATOM 1380  C CA   . LEU B 2 1  ? 12.554  -3.400  -6.332  1.00 0.00 ? 99  LEU B CA   1  
ATOM 1381  C C    . LEU B 2 1  ? 12.523  -4.668  -5.466  1.00 0.00 ? 99  LEU B C    1  
ATOM 1382  O O    . LEU B 2 1  ? 12.611  -5.782  -5.985  1.00 0.00 ? 99  LEU B O    1  
ATOM 1383  C CB   . LEU B 2 1  ? 13.353  -3.653  -7.620  1.00 0.00 ? 99  LEU B CB   1  
ATOM 1384  C CG   . LEU B 2 1  ? 12.528  -3.693  -8.915  1.00 0.00 ? 99  LEU B CG   1  
ATOM 1385  C CD1  . LEU B 2 1  ? 11.389  -4.696  -8.800  1.00 0.00 ? 99  LEU B CD1  1  
ATOM 1386  C CD2  . LEU B 2 1  ? 11.992  -2.309  -9.255  1.00 0.00 ? 99  LEU B CD2  1  
ATOM 1387  H H1   . LEU B 2 1  ? 13.410  -1.523  -6.321  1.00 0.00 ? 99  LEU B H1   1  
ATOM 1388  H H2   . LEU B 2 1  ? 14.025  -2.593  -5.128  1.00 0.00 ? 99  LEU B H2   1  
ATOM 1389  H H3   . LEU B 2 1  ? 12.472  -1.887  -4.934  1.00 0.00 ? 99  LEU B H3   1  
ATOM 1390  H HA   . LEU B 2 1  ? 11.541  -3.131  -6.594  1.00 0.00 ? 99  LEU B HA   1  
ATOM 1391  H HB2  . LEU B 2 1  ? 14.094  -2.873  -7.718  1.00 0.00 ? 99  LEU B HB2  1  
ATOM 1392  H HB3  . LEU B 2 1  ? 13.865  -4.599  -7.520  1.00 0.00 ? 99  LEU B HB3  1  
ATOM 1393  H HG   . LEU B 2 1  ? 13.168  -4.011  -9.727  1.00 0.00 ? 99  LEU B HG   1  
ATOM 1394  H HD11 . LEU B 2 1  ? 11.036  -4.955  -9.788  1.00 0.00 ? 99  LEU B HD11 1  
ATOM 1395  H HD12 . LEU B 2 1  ? 10.581  -4.260  -8.232  1.00 0.00 ? 99  LEU B HD12 1  
ATOM 1396  H HD13 . LEU B 2 1  ? 11.741  -5.586  -8.299  1.00 0.00 ? 99  LEU B HD13 1  
ATOM 1397  H HD21 . LEU B 2 1  ? 11.919  -1.720  -8.353  1.00 0.00 ? 99  LEU B HD21 1  
ATOM 1398  H HD22 . LEU B 2 1  ? 11.015  -2.401  -9.706  1.00 0.00 ? 99  LEU B HD22 1  
ATOM 1399  H HD23 . LEU B 2 1  ? 12.663  -1.823  -9.948  1.00 0.00 ? 99  LEU B HD23 1  
ATOM 1400  N N    . PHE B 2 2  ? 12.389  -4.496  -4.146  1.00 0.00 ? 100 PHE B N    1  
ATOM 1401  C CA   . PHE B 2 2  ? 12.337  -5.629  -3.222  1.00 0.00 ? 100 PHE B CA   1  
ATOM 1402  C C    . PHE B 2 2  ? 10.896  -5.903  -2.788  1.00 0.00 ? 100 PHE B C    1  
ATOM 1403  O O    . PHE B 2 2  ? 9.989   -5.134  -3.111  1.00 0.00 ? 100 PHE B O    1  
ATOM 1404  C CB   . PHE B 2 2  ? 13.217  -5.357  -1.995  1.00 0.00 ? 100 PHE B CB   1  
ATOM 1405  C CG   . PHE B 2 2  ? 14.453  -6.212  -1.937  1.00 0.00 ? 100 PHE B CG   1  
ATOM 1406  C CD1  . PHE B 2 2  ? 14.374  -7.548  -1.575  1.00 0.00 ? 100 PHE B CD1  1  
ATOM 1407  C CD2  . PHE B 2 2  ? 15.696  -5.678  -2.240  1.00 0.00 ? 100 PHE B CD2  1  
ATOM 1408  C CE1  . PHE B 2 2  ? 15.509  -8.334  -1.518  1.00 0.00 ? 100 PHE B CE1  1  
ATOM 1409  C CE2  . PHE B 2 2  ? 16.835  -6.460  -2.184  1.00 0.00 ? 100 PHE B CE2  1  
ATOM 1410  C CZ   . PHE B 2 2  ? 16.741  -7.790  -1.823  1.00 0.00 ? 100 PHE B CZ   1  
ATOM 1411  H H    . PHE B 2 2  ? 12.316  -3.588  -3.785  1.00 0.00 ? 100 PHE B H    1  
ATOM 1412  H HA   . PHE B 2 2  ? 12.714  -6.498  -3.740  1.00 0.00 ? 100 PHE B HA   1  
ATOM 1413  H HB2  . PHE B 2 2  ? 13.530  -4.323  -2.008  1.00 0.00 ? 100 PHE B HB2  1  
ATOM 1414  H HB3  . PHE B 2 2  ? 12.641  -5.541  -1.099  1.00 0.00 ? 100 PHE B HB3  1  
ATOM 1415  H HD1  . PHE B 2 2  ? 13.411  -7.976  -1.336  1.00 0.00 ? 100 PHE B HD1  1  
ATOM 1416  H HD2  . PHE B 2 2  ? 15.772  -4.638  -2.523  1.00 0.00 ? 100 PHE B HD2  1  
ATOM 1417  H HE1  . PHE B 2 2  ? 15.432  -9.373  -1.235  1.00 0.00 ? 100 PHE B HE1  1  
ATOM 1418  H HE2  . PHE B 2 2  ? 17.797  -6.031  -2.423  1.00 0.00 ? 100 PHE B HE2  1  
ATOM 1419  H HZ   . PHE B 2 2  ? 17.629  -8.403  -1.779  1.00 0.00 ? 100 PHE B HZ   1  
ATOM 1420  N N    . SER B 2 3  ? 10.687  -7.000  -2.059  1.00 0.00 ? 101 SER B N    1  
ATOM 1421  C CA   . SER B 2 3  ? 9.350   -7.364  -1.593  1.00 0.00 ? 101 SER B CA   1  
ATOM 1422  C C    . SER B 2 3  ? 9.318   -7.531  -0.074  1.00 0.00 ? 101 SER B C    1  
ATOM 1423  O O    . SER B 2 3  ? 9.707   -8.575  0.454   1.00 0.00 ? 101 SER B O    1  
ATOM 1424  C CB   . SER B 2 3  ? 8.882   -8.653  -2.278  1.00 0.00 ? 101 SER B CB   1  
ATOM 1425  O OG   . SER B 2 3  ? 9.845   -9.686  -2.157  1.00 0.00 ? 101 SER B OG   1  
ATOM 1426  H H    . SER B 2 3  ? 11.444  -7.578  -1.833  1.00 0.00 ? 101 SER B H    1  
ATOM 1427  H HA   . SER B 2 3  ? 8.680   -6.562  -1.866  1.00 0.00 ? 101 SER B HA   1  
ATOM 1428  H HB2  . SER B 2 3  ? 7.961   -8.986  -1.822  1.00 0.00 ? 101 SER B HB2  1  
ATOM 1429  H HB3  . SER B 2 3  ? 8.715   -8.456  -3.328  1.00 0.00 ? 101 SER B HB3  1  
ATOM 1430  H HG   . SER B 2 3  ? 9.642   -10.225 -1.389  1.00 0.00 ? 101 SER B HG   1  
ATOM 1431  N N    . THR B 2 4  ? 8.849   -6.496  0.619   1.00 0.00 ? 102 THR B N    1  
ATOM 1432  C CA   . THR B 2 4  ? 8.759   -6.523  2.077   1.00 0.00 ? 102 THR B CA   1  
ATOM 1433  C C    . THR B 2 4  ? 7.380   -7.021  2.527   1.00 0.00 ? 102 THR B C    1  
ATOM 1434  O O    . THR B 2 4  ? 6.571   -7.452  1.702   1.00 0.00 ? 102 THR B O    1  
ATOM 1435  C CB   . THR B 2 4  ? 9.048   -5.127  2.648   1.00 0.00 ? 102 THR B CB   1  
ATOM 1436  O OG1  . THR B 2 4  ? 9.642   -5.226  3.931   1.00 0.00 ? 102 THR B OG1  1  
ATOM 1437  C CG2  . THR B 2 4  ? 7.819   -4.248  2.781   1.00 0.00 ? 102 THR B CG2  1  
ATOM 1438  H H    . THR B 2 4  ? 8.551   -5.693  0.138   1.00 0.00 ? 102 THR B H    1  
ATOM 1439  H HA   . THR B 2 4  ? 9.509   -7.211  2.439   1.00 0.00 ? 102 THR B HA   1  
ATOM 1440  H HB   . THR B 2 4  ? 9.744   -4.622  1.992   1.00 0.00 ? 102 THR B HB   1  
ATOM 1441  H HG1  . THR B 2 4  ? 9.986   -4.367  4.193   1.00 0.00 ? 102 THR B HG1  1  
ATOM 1442  H HG21 . THR B 2 4  ? 7.015   -4.663  2.190   1.00 0.00 ? 102 THR B HG21 1  
ATOM 1443  H HG22 . THR B 2 4  ? 8.046   -3.254  2.428   1.00 0.00 ? 102 THR B HG22 1  
ATOM 1444  H HG23 . THR B 2 4  ? 7.519   -4.204  3.818   1.00 0.00 ? 102 THR B HG23 1  
ATOM 1445  N N    . GLU B 2 5  ? 7.116   -6.948  3.833   1.00 0.00 ? 103 GLU B N    1  
ATOM 1446  C CA   . GLU B 2 5  ? 5.834   -7.379  4.384   1.00 0.00 ? 103 GLU B CA   1  
ATOM 1447  C C    . GLU B 2 5  ? 5.391   -6.437  5.502   1.00 0.00 ? 103 GLU B C    1  
ATOM 1448  O O    . GLU B 2 5  ? 6.077   -6.297  6.518   1.00 0.00 ? 103 GLU B O    1  
ATOM 1449  C CB   . GLU B 2 5  ? 5.923   -8.825  4.897   1.00 0.00 ? 103 GLU B CB   1  
ATOM 1450  C CG   . GLU B 2 5  ? 4.727   -9.260  5.740   1.00 0.00 ? 103 GLU B CG   1  
ATOM 1451  C CD   . GLU B 2 5  ? 4.716   -10.748 6.046   1.00 0.00 ? 103 GLU B CD   1  
ATOM 1452  O OE1  . GLU B 2 5  ? 5.135   -11.543 5.175   1.00 0.00 ? 103 GLU B OE1  1  
ATOM 1453  O OE2  . GLU B 2 5  ? 4.282   -11.121 7.156   1.00 0.00 ? 103 GLU B OE2  1  
ATOM 1454  H H    . GLU B 2 5  ? 7.796   -6.585  4.440   1.00 0.00 ? 103 GLU B H    1  
ATOM 1455  H HA   . GLU B 2 5  ? 5.107   -7.334  3.587   1.00 0.00 ? 103 GLU B HA   1  
ATOM 1456  H HB2  . GLU B 2 5  ? 5.995   -9.487  4.048   1.00 0.00 ? 103 GLU B HB2  1  
ATOM 1457  H HB3  . GLU B 2 5  ? 6.816   -8.928  5.497   1.00 0.00 ? 103 GLU B HB3  1  
ATOM 1458  H HG2  . GLU B 2 5  ? 4.751   -8.723  6.675   1.00 0.00 ? 103 GLU B HG2  1  
ATOM 1459  H HG3  . GLU B 2 5  ? 3.820   -9.011  5.209   1.00 0.00 ? 103 GLU B HG3  1  
ATOM 1460  N N    . VAL B 2 6  ? 4.245   -5.786  5.299   1.00 0.00 ? 104 VAL B N    1  
ATOM 1461  C CA   . VAL B 2 6  ? 3.707   -4.847  6.281   1.00 0.00 ? 104 VAL B CA   1  
ATOM 1462  C C    . VAL B 2 6  ? 2.493   -5.435  7.011   1.00 0.00 ? 104 VAL B C    1  
ATOM 1463  O O    . VAL B 2 6  ? 1.708   -6.174  6.374   1.00 0.00 ? 104 VAL B O    1  
ATOM 1464  C CB   . VAL B 2 6  ? 3.327   -3.499  5.613   1.00 0.00 ? 104 VAL B CB   1  
ATOM 1465  C CG1  . VAL B 2 6  ? 2.230   -3.691  4.576   1.00 0.00 ? 104 VAL B CG1  1  
ATOM 1466  C CG2  . VAL B 2 6  ? 2.908   -2.474  6.657   1.00 0.00 ? 104 VAL B CG2  1  
ATOM 1467  O OXT  . VAL B 2 6  ? 2.345   -5.161  8.221   1.00 0.00 ? 104 VAL B OXT  1  
ATOM 1468  H H    . VAL B 2 6  ? 3.752   -5.937  4.466   1.00 0.00 ? 104 VAL B H    1  
ATOM 1469  H HA   . VAL B 2 6  ? 4.482   -4.653  7.008   1.00 0.00 ? 104 VAL B HA   1  
ATOM 1470  H HB   . VAL B 2 6  ? 4.204   -3.121  5.104   1.00 0.00 ? 104 VAL B HB   1  
ATOM 1471  H HG11 . VAL B 2 6  ? 2.622   -3.477  3.592   1.00 0.00 ? 104 VAL B HG11 1  
ATOM 1472  H HG12 . VAL B 2 6  ? 1.409   -3.018  4.789   1.00 0.00 ? 104 VAL B HG12 1  
ATOM 1473  H HG13 . VAL B 2 6  ? 1.879   -4.710  4.608   1.00 0.00 ? 104 VAL B HG13 1  
ATOM 1474  H HG21 . VAL B 2 6  ? 2.335   -2.963  7.430   1.00 0.00 ? 104 VAL B HG21 1  
ATOM 1475  H HG22 . VAL B 2 6  ? 2.301   -1.708  6.191   1.00 0.00 ? 104 VAL B HG22 1  
ATOM 1476  H HG23 . VAL B 2 6  ? 3.787   -2.022  7.091   1.00 0.00 ? 104 VAL B HG23 1  
ATOM 1477  N N    . MET A 1 1  ? -2.247  2.489   -19.667 1.00 0.00 ? 1   MET A N    2  
ATOM 1478  C CA   . MET A 1 1  ? -2.996  3.546   -20.405 1.00 0.00 ? 1   MET A CA   2  
ATOM 1479  C C    . MET A 1 1  ? -4.262  3.961   -19.653 1.00 0.00 ? 1   MET A C    2  
ATOM 1480  O O    . MET A 1 1  ? -4.660  3.308   -18.685 1.00 0.00 ? 1   MET A O    2  
ATOM 1481  C CB   . MET A 1 1  ? -3.351  3.017   -21.801 1.00 0.00 ? 1   MET A CB   2  
ATOM 1482  C CG   . MET A 1 1  ? -4.268  1.804   -21.786 1.00 0.00 ? 1   MET A CG   2  
ATOM 1483  S SD   . MET A 1 1  ? -3.586  0.403   -22.694 1.00 0.00 ? 1   MET A SD   2  
ATOM 1484  C CE   . MET A 1 1  ? -4.945  -0.760  -22.592 1.00 0.00 ? 1   MET A CE   2  
ATOM 1485  H H1   . MET A 1 1  ? -2.933  1.774   -19.348 1.00 0.00 ? 1   MET A H1   2  
ATOM 1486  H H2   . MET A 1 1  ? -1.776  2.943   -18.858 1.00 0.00 ? 1   MET A H2   2  
ATOM 1487  H H3   . MET A 1 1  ? -1.553  2.075   -20.320 1.00 0.00 ? 1   MET A H3   2  
ATOM 1488  H HA   . MET A 1 1  ? -2.353  4.408   -20.507 1.00 0.00 ? 1   MET A HA   2  
ATOM 1489  H HB2  . MET A 1 1  ? -3.841  3.802   -22.356 1.00 0.00 ? 1   MET A HB2  2  
ATOM 1490  H HB3  . MET A 1 1  ? -2.439  2.744   -22.312 1.00 0.00 ? 1   MET A HB3  2  
ATOM 1491  H HG2  . MET A 1 1  ? -4.430  1.503   -20.761 1.00 0.00 ? 1   MET A HG2  2  
ATOM 1492  H HG3  . MET A 1 1  ? -5.212  2.079   -22.231 1.00 0.00 ? 1   MET A HG3  2  
ATOM 1493  H HE1  . MET A 1 1  ? -4.746  -1.604  -23.236 1.00 0.00 ? 1   MET A HE1  2  
ATOM 1494  H HE2  . MET A 1 1  ? -5.858  -0.276  -22.906 1.00 0.00 ? 1   MET A HE2  2  
ATOM 1495  H HE3  . MET A 1 1  ? -5.050  -1.102  -21.573 1.00 0.00 ? 1   MET A HE3  2  
ATOM 1496  N N    . LYS A 1 2  ? -4.887  5.054   -20.101 1.00 0.00 ? 2   LYS A N    2  
ATOM 1497  C CA   . LYS A 1 2  ? -6.107  5.569   -19.472 1.00 0.00 ? 2   LYS A CA   2  
ATOM 1498  C C    . LYS A 1 2  ? -5.843  5.990   -18.023 1.00 0.00 ? 2   LYS A C    2  
ATOM 1499  O O    . LYS A 1 2  ? -4.700  5.976   -17.562 1.00 0.00 ? 2   LYS A O    2  
ATOM 1500  C CB   . LYS A 1 2  ? -7.228  4.522   -19.518 1.00 0.00 ? 2   LYS A CB   2  
ATOM 1501  C CG   . LYS A 1 2  ? -7.475  3.941   -20.903 1.00 0.00 ? 2   LYS A CG   2  
ATOM 1502  C CD   . LYS A 1 2  ? -8.158  4.945   -21.819 1.00 0.00 ? 2   LYS A CD   2  
ATOM 1503  C CE   . LYS A 1 2  ? -7.886  4.640   -23.285 1.00 0.00 ? 2   LYS A CE   2  
ATOM 1504  N NZ   . LYS A 1 2  ? -9.144  4.445   -24.062 1.00 0.00 ? 2   LYS A NZ   2  
ATOM 1505  H H    . LYS A 1 2  ? -4.516  5.530   -20.873 1.00 0.00 ? 2   LYS A H    2  
ATOM 1506  H HA   . LYS A 1 2  ? -6.421  6.438   -20.031 1.00 0.00 ? 2   LYS A HA   2  
ATOM 1507  H HB2  . LYS A 1 2  ? -6.974  3.711   -18.853 1.00 0.00 ? 2   LYS A HB2  2  
ATOM 1508  H HB3  . LYS A 1 2  ? -8.145  4.980   -19.176 1.00 0.00 ? 2   LYS A HB3  2  
ATOM 1509  H HG2  . LYS A 1 2  ? -6.529  3.658   -21.338 1.00 0.00 ? 2   LYS A HG2  2  
ATOM 1510  H HG3  . LYS A 1 2  ? -8.105  3.068   -20.807 1.00 0.00 ? 2   LYS A HG3  2  
ATOM 1511  H HD2  . LYS A 1 2  ? -9.223  4.909   -21.645 1.00 0.00 ? 2   LYS A HD2  2  
ATOM 1512  H HD3  . LYS A 1 2  ? -7.789  5.934   -21.592 1.00 0.00 ? 2   LYS A HD3  2  
ATOM 1513  H HE2  . LYS A 1 2  ? -7.335  5.463   -23.714 1.00 0.00 ? 2   LYS A HE2  2  
ATOM 1514  H HE3  . LYS A 1 2  ? -7.293  3.739   -23.347 1.00 0.00 ? 2   LYS A HE3  2  
ATOM 1515  H HZ1  . LYS A 1 2  ? -9.835  5.184   -23.817 1.00 0.00 ? 2   LYS A HZ1  2  
ATOM 1516  H HZ2  . LYS A 1 2  ? -9.558  3.515   -23.848 1.00 0.00 ? 2   LYS A HZ2  2  
ATOM 1517  H HZ3  . LYS A 1 2  ? -8.945  4.496   -25.082 1.00 0.00 ? 2   LYS A HZ3  2  
ATOM 1518  N N    . GLU A 1 3  ? -6.907  6.365   -17.313 1.00 0.00 ? 3   GLU A N    2  
ATOM 1519  C CA   . GLU A 1 3  ? -6.793  6.789   -15.919 1.00 0.00 ? 3   GLU A CA   2  
ATOM 1520  C C    . GLU A 1 3  ? -7.054  5.620   -14.973 1.00 0.00 ? 3   GLU A C    2  
ATOM 1521  O O    . GLU A 1 3  ? -8.043  4.898   -15.129 1.00 0.00 ? 3   GLU A O    2  
ATOM 1522  C CB   . GLU A 1 3  ? -7.777  7.926   -15.629 1.00 0.00 ? 3   GLU A CB   2  
ATOM 1523  C CG   . GLU A 1 3  ? -7.395  9.246   -16.282 1.00 0.00 ? 3   GLU A CG   2  
ATOM 1524  C CD   . GLU A 1 3  ? -8.495  10.286  -16.183 1.00 0.00 ? 3   GLU A CD   2  
ATOM 1525  O OE1  . GLU A 1 3  ? -8.881  10.639  -15.049 1.00 0.00 ? 3   GLU A OE1  2  
ATOM 1526  O OE2  . GLU A 1 3  ? -8.970  10.748  -17.242 1.00 0.00 ? 3   GLU A OE2  2  
ATOM 1527  H H    . GLU A 1 3  ? -7.790  6.355   -17.735 1.00 0.00 ? 3   GLU A H    2  
ATOM 1528  H HA   . GLU A 1 3  ? -5.787  7.148   -15.763 1.00 0.00 ? 3   GLU A HA   2  
ATOM 1529  H HB2  . GLU A 1 3  ? -8.755  7.641   -15.989 1.00 0.00 ? 3   GLU A HB2  2  
ATOM 1530  H HB3  . GLU A 1 3  ? -7.828  8.079   -14.561 1.00 0.00 ? 3   GLU A HB3  2  
ATOM 1531  H HG2  . GLU A 1 3  ? -6.510  9.632   -15.796 1.00 0.00 ? 3   GLU A HG2  2  
ATOM 1532  H HG3  . GLU A 1 3  ? -7.182  9.067   -17.326 1.00 0.00 ? 3   GLU A HG3  2  
ATOM 1533  N N    . PRO A 1 4  ? -6.163  5.409   -13.977 1.00 0.00 ? 4   PRO A N    2  
ATOM 1534  C CA   . PRO A 1 4  ? -6.300  4.312   -13.004 1.00 0.00 ? 4   PRO A CA   2  
ATOM 1535  C C    . PRO A 1 4  ? -7.568  4.433   -12.151 1.00 0.00 ? 4   PRO A C    2  
ATOM 1536  O O    . PRO A 1 4  ? -8.483  5.188   -12.484 1.00 0.00 ? 4   PRO A O    2  
ATOM 1537  C CB   . PRO A 1 4  ? -5.046  4.446   -12.125 1.00 0.00 ? 4   PRO A CB   2  
ATOM 1538  C CG   . PRO A 1 4  ? -4.096  5.274   -12.920 1.00 0.00 ? 4   PRO A CG   2  
ATOM 1539  C CD   . PRO A 1 4  ? -4.949  6.208   -13.726 1.00 0.00 ? 4   PRO A CD   2  
ATOM 1540  H HA   . PRO A 1 4  ? -6.295  3.351   -13.497 1.00 0.00 ? 4   PRO A HA   2  
ATOM 1541  H HB2  . PRO A 1 4  ? -5.306  4.932   -11.196 1.00 0.00 ? 4   PRO A HB2  2  
ATOM 1542  H HB3  . PRO A 1 4  ? -4.640  3.466   -11.922 1.00 0.00 ? 4   PRO A HB3  2  
ATOM 1543  H HG2  . PRO A 1 4  ? -3.451  5.832   -12.256 1.00 0.00 ? 4   PRO A HG2  2  
ATOM 1544  H HG3  . PRO A 1 4  ? -3.510  4.643   -13.571 1.00 0.00 ? 4   PRO A HG3  2  
ATOM 1545  H HD2  . PRO A 1 4  ? -5.176  7.097   -13.155 1.00 0.00 ? 4   PRO A HD2  2  
ATOM 1546  H HD3  . PRO A 1 4  ? -4.457  6.465   -14.651 1.00 0.00 ? 4   PRO A HD3  2  
ATOM 1547  N N    . GLU A 1 5  ? -7.614  3.684   -11.047 1.00 0.00 ? 5   GLU A N    2  
ATOM 1548  C CA   . GLU A 1 5  ? -8.764  3.708   -10.151 1.00 0.00 ? 5   GLU A CA   2  
ATOM 1549  C C    . GLU A 1 5  ? -8.320  3.853   -8.702  1.00 0.00 ? 5   GLU A C    2  
ATOM 1550  O O    . GLU A 1 5  ? -7.884  2.889   -8.069  1.00 0.00 ? 5   GLU A O    2  
ATOM 1551  C CB   . GLU A 1 5  ? -9.602  2.442   -10.321 1.00 0.00 ? 5   GLU A CB   2  
ATOM 1552  C CG   . GLU A 1 5  ? -11.058 2.616   -9.919  1.00 0.00 ? 5   GLU A CG   2  
ATOM 1553  C CD   . GLU A 1 5  ? -12.010 1.921   -10.871 1.00 0.00 ? 5   GLU A CD   2  
ATOM 1554  O OE1  . GLU A 1 5  ? -12.286 2.484   -11.952 1.00 0.00 ? 5   GLU A OE1  2  
ATOM 1555  O OE2  . GLU A 1 5  ? -12.479 0.812   -10.538 1.00 0.00 ? 5   GLU A OE2  2  
ATOM 1556  H H    . GLU A 1 5  ? -6.855  3.107   -10.828 1.00 0.00 ? 5   GLU A H    2  
ATOM 1557  H HA   . GLU A 1 5  ? -9.367  4.565   -10.415 1.00 0.00 ? 5   GLU A HA   2  
ATOM 1558  H HB2  . GLU A 1 5  ? -9.571  2.144   -11.356 1.00 0.00 ? 5   GLU A HB2  2  
ATOM 1559  H HB3  . GLU A 1 5  ? -9.175  1.656   -9.715  1.00 0.00 ? 5   GLU A HB3  2  
ATOM 1560  H HG2  . GLU A 1 5  ? -11.197 2.206   -8.930  1.00 0.00 ? 5   GLU A HG2  2  
ATOM 1561  H HG3  . GLU A 1 5  ? -11.292 3.671   -9.905  1.00 0.00 ? 5   GLU A HG3  2  
ATOM 1562  N N    . ILE A 1 6  ? -8.439  5.068   -8.189  1.00 0.00 ? 6   ILE A N    2  
ATOM 1563  C CA   . ILE A 1 6  ? -8.058  5.370   -6.814  1.00 0.00 ? 6   ILE A CA   2  
ATOM 1564  C C    . ILE A 1 6  ? -9.240  5.182   -5.863  1.00 0.00 ? 6   ILE A C    2  
ATOM 1565  O O    . ILE A 1 6  ? -10.318 5.738   -6.083  1.00 0.00 ? 6   ILE A O    2  
ATOM 1566  C CB   . ILE A 1 6  ? -7.537  6.816   -6.688  1.00 0.00 ? 6   ILE A CB   2  
ATOM 1567  C CG1  . ILE A 1 6  ? -6.426  7.086   -7.711  1.00 0.00 ? 6   ILE A CG1  2  
ATOM 1568  C CG2  . ILE A 1 6  ? -7.048  7.090   -5.271  1.00 0.00 ? 6   ILE A CG2  2  
ATOM 1569  C CD1  . ILE A 1 6  ? -5.291  6.083   -7.672  1.00 0.00 ? 6   ILE A CD1  2  
ATOM 1570  H H    . ILE A 1 6  ? -8.795  5.786   -8.753  1.00 0.00 ? 6   ILE A H    2  
ATOM 1571  H HA   . ILE A 1 6  ? -7.263  4.696   -6.528  1.00 0.00 ? 6   ILE A HA   2  
ATOM 1572  H HB   . ILE A 1 6  ? -8.362  7.480   -6.892  1.00 0.00 ? 6   ILE A HB   2  
ATOM 1573  H HG12 . ILE A 1 6  ? -6.849  7.063   -8.703  1.00 0.00 ? 6   ILE A HG12 2  
ATOM 1574  H HG13 . ILE A 1 6  ? -6.009  8.065   -7.526  1.00 0.00 ? 6   ILE A HG13 2  
ATOM 1575  H HG21 . ILE A 1 6  ? -7.810  6.799   -4.563  1.00 0.00 ? 6   ILE A HG21 2  
ATOM 1576  H HG22 . ILE A 1 6  ? -6.839  8.144   -5.160  1.00 0.00 ? 6   ILE A HG22 2  
ATOM 1577  H HG23 . ILE A 1 6  ? -6.148  6.523   -5.085  1.00 0.00 ? 6   ILE A HG23 2  
ATOM 1578  H HD11 . ILE A 1 6  ? -5.237  5.635   -6.690  1.00 0.00 ? 6   ILE A HD11 2  
ATOM 1579  H HD12 . ILE A 1 6  ? -4.360  6.586   -7.889  1.00 0.00 ? 6   ILE A HD12 2  
ATOM 1580  H HD13 . ILE A 1 6  ? -5.465  5.314   -8.410  1.00 0.00 ? 6   ILE A HD13 2  
ATOM 1581  N N    . ILE A 1 7  ? -9.027  4.401   -4.805  1.00 0.00 ? 7   ILE A N    2  
ATOM 1582  C CA   . ILE A 1 7  ? -10.073 4.143   -3.816  1.00 0.00 ? 7   ILE A CA   2  
ATOM 1583  C C    . ILE A 1 7  ? -9.486  4.010   -2.414  1.00 0.00 ? 7   ILE A C    2  
ATOM 1584  O O    . ILE A 1 7  ? -8.447  3.376   -2.223  1.00 0.00 ? 7   ILE A O    2  
ATOM 1585  C CB   . ILE A 1 7  ? -10.875 2.863   -4.144  1.00 0.00 ? 7   ILE A CB   2  
ATOM 1586  C CG1  . ILE A 1 7  ? -9.934  1.671   -4.357  1.00 0.00 ? 7   ILE A CG1  2  
ATOM 1587  C CG2  . ILE A 1 7  ? -11.757 3.081   -5.365  1.00 0.00 ? 7   ILE A CG2  2  
ATOM 1588  C CD1  . ILE A 1 7  ? -9.780  0.798   -3.130  1.00 0.00 ? 7   ILE A CD1  2  
ATOM 1589  H H    . ILE A 1 7  ? -8.145  3.990   -4.684  1.00 0.00 ? 7   ILE A H    2  
ATOM 1590  H HA   . ILE A 1 7  ? -10.754 4.982   -3.830  1.00 0.00 ? 7   ILE A HA   2  
ATOM 1591  H HB   . ILE A 1 7  ? -11.520 2.652   -3.303  1.00 0.00 ? 7   ILE A HB   2  
ATOM 1592  H HG12 . ILE A 1 7  ? -10.318 1.055   -5.156  1.00 0.00 ? 7   ILE A HG12 2  
ATOM 1593  H HG13 . ILE A 1 7  ? -8.955  2.036   -4.630  1.00 0.00 ? 7   ILE A HG13 2  
ATOM 1594  H HG21 . ILE A 1 7  ? -11.203 2.839   -6.260  1.00 0.00 ? 7   ILE A HG21 2  
ATOM 1595  H HG22 . ILE A 1 7  ? -12.070 4.114   -5.404  1.00 0.00 ? 7   ILE A HG22 2  
ATOM 1596  H HG23 . ILE A 1 7  ? -12.628 2.445   -5.297  1.00 0.00 ? 7   ILE A HG23 2  
ATOM 1597  H HD11 . ILE A 1 7  ? -10.682 0.847   -2.539  1.00 0.00 ? 7   ILE A HD11 2  
ATOM 1598  H HD12 . ILE A 1 7  ? -8.945  1.149   -2.542  1.00 0.00 ? 7   ILE A HD12 2  
ATOM 1599  H HD13 . ILE A 1 7  ? -9.603  -0.223  -3.434  1.00 0.00 ? 7   ILE A HD13 2  
ATOM 1600  N N    . THR A 1 8  ? -10.158 4.608   -1.433  1.00 0.00 ? 8   THR A N    2  
ATOM 1601  C CA   . THR A 1 8  ? -9.701  4.551   -0.047  1.00 0.00 ? 8   THR A CA   2  
ATOM 1602  C C    . THR A 1 8  ? -10.333 3.373   0.688   1.00 0.00 ? 8   THR A C    2  
ATOM 1603  O O    . THR A 1 8  ? -11.519 3.083   0.516   1.00 0.00 ? 8   THR A O    2  
ATOM 1604  C CB   . THR A 1 8  ? -10.025 5.855   0.686   1.00 0.00 ? 8   THR A CB   2  
ATOM 1605  O OG1  . THR A 1 8  ? -9.849  6.977   -0.160  1.00 0.00 ? 8   THR A OG1  2  
ATOM 1606  C CG2  . THR A 1 8  ? -9.183  6.070   1.929   1.00 0.00 ? 8   THR A CG2  2  
ATOM 1607  H H    . THR A 1 8  ? -10.982 5.098   -1.645  1.00 0.00 ? 8   THR A H    2  
ATOM 1608  H HA   . THR A 1 8  ? -8.631  4.414   -0.061  1.00 0.00 ? 8   THR A HA   2  
ATOM 1609  H HB   . THR A 1 8  ? -11.051 5.829   0.991   1.00 0.00 ? 8   THR A HB   2  
ATOM 1610  H HG1  . THR A 1 8  ? -10.608 7.560   -0.085  1.00 0.00 ? 8   THR A HG1  2  
ATOM 1611  H HG21 . THR A 1 8  ? -8.331  5.407   1.906   1.00 0.00 ? 8   THR A HG21 2  
ATOM 1612  H HG22 . THR A 1 8  ? -9.778  5.861   2.806   1.00 0.00 ? 8   THR A HG22 2  
ATOM 1613  H HG23 . THR A 1 8  ? -8.842  7.094   1.961   1.00 0.00 ? 8   THR A HG23 2  
ATOM 1614  N N    . VAL A 1 9  ? -9.531  2.700   1.508   1.00 0.00 ? 9   VAL A N    2  
ATOM 1615  C CA   . VAL A 1 9  ? -10.000 1.552   2.275   1.00 0.00 ? 9   VAL A CA   2  
ATOM 1616  C C    . VAL A 1 9  ? -9.857  1.803   3.774   1.00 0.00 ? 9   VAL A C    2  
ATOM 1617  O O    . VAL A 1 9  ? -8.748  1.990   4.276   1.00 0.00 ? 9   VAL A O    2  
ATOM 1618  C CB   . VAL A 1 9  ? -9.227  0.270   1.903   1.00 0.00 ? 9   VAL A CB   2  
ATOM 1619  C CG1  . VAL A 1 9  ? -9.854  -0.946  2.568   1.00 0.00 ? 9   VAL A CG1  2  
ATOM 1620  C CG2  . VAL A 1 9  ? -9.177  0.095   0.392   1.00 0.00 ? 9   VAL A CG2  2  
ATOM 1621  H H    . VAL A 1 9  ? -8.596  2.982   1.599   1.00 0.00 ? 9   VAL A H    2  
ATOM 1622  H HA   . VAL A 1 9  ? -11.044 1.398   2.043   1.00 0.00 ? 9   VAL A HA   2  
ATOM 1623  H HB   . VAL A 1 9  ? -8.213  0.367   2.266   1.00 0.00 ? 9   VAL A HB   2  
ATOM 1624  H HG11 . VAL A 1 9  ? -9.144  -1.760  2.573   1.00 0.00 ? 9   VAL A HG11 2  
ATOM 1625  H HG12 . VAL A 1 9  ? -10.735 -1.242  2.020   1.00 0.00 ? 9   VAL A HG12 2  
ATOM 1626  H HG13 . VAL A 1 9  ? -10.127 -0.701  3.585   1.00 0.00 ? 9   VAL A HG13 2  
ATOM 1627  H HG21 . VAL A 1 9  ? -8.700  0.956   -0.055  1.00 0.00 ? 9   VAL A HG21 2  
ATOM 1628  H HG22 . VAL A 1 9  ? -10.181 0.001   0.007   1.00 0.00 ? 9   VAL A HG22 2  
ATOM 1629  H HG23 . VAL A 1 9  ? -8.613  -0.794  0.151   1.00 0.00 ? 9   VAL A HG23 2  
ATOM 1630  N N    . THR A 1 10 ? -10.986 1.806   4.480   1.00 0.00 ? 10  THR A N    2  
ATOM 1631  C CA   . THR A 1 10 ? -10.990 2.034   5.922   1.00 0.00 ? 10  THR A CA   2  
ATOM 1632  C C    . THR A 1 10 ? -11.376 0.761   6.673   1.00 0.00 ? 10  THR A C    2  
ATOM 1633  O O    . THR A 1 10 ? -12.552 0.396   6.732   1.00 0.00 ? 10  THR A O    2  
ATOM 1634  C CB   . THR A 1 10 ? -11.954 3.170   6.282   1.00 0.00 ? 10  THR A CB   2  
ATOM 1635  O OG1  . THR A 1 10 ? -11.961 4.172   5.276   1.00 0.00 ? 10  THR A OG1  2  
ATOM 1636  C CG2  . THR A 1 10 ? -11.616 3.841   7.595   1.00 0.00 ? 10  THR A CG2  2  
ATOM 1637  H H    . THR A 1 10 ? -11.838 1.653   4.020   1.00 0.00 ? 10  THR A H    2  
ATOM 1638  H HA   . THR A 1 10 ? -9.990  2.318   6.214   1.00 0.00 ? 10  THR A HA   2  
ATOM 1639  H HB   . THR A 1 10 ? -12.954 2.768   6.365   1.00 0.00 ? 10  THR A HB   2  
ATOM 1640  H HG1  . THR A 1 10 ? -11.059 4.407   5.046   1.00 0.00 ? 10  THR A HG1  2  
ATOM 1641  H HG21 . THR A 1 10 ? -12.179 4.758   7.686   1.00 0.00 ? 10  THR A HG21 2  
ATOM 1642  H HG22 . THR A 1 10 ? -10.560 4.063   7.624   1.00 0.00 ? 10  THR A HG22 2  
ATOM 1643  H HG23 . THR A 1 10 ? -11.868 3.180   8.412   1.00 0.00 ? 10  THR A HG23 2  
ATOM 1644  N N    . LEU A 1 11 ? -10.376 0.090   7.243   1.00 0.00 ? 11  LEU A N    2  
ATOM 1645  C CA   . LEU A 1 11 ? -10.604 -1.146  7.991   1.00 0.00 ? 11  LEU A CA   2  
ATOM 1646  C C    . LEU A 1 11 ? -9.899  -1.105  9.345   1.00 0.00 ? 11  LEU A C    2  
ATOM 1647  O O    . LEU A 1 11 ? -8.937  -0.358  9.531   1.00 0.00 ? 11  LEU A O    2  
ATOM 1648  C CB   . LEU A 1 11 ? -10.108 -2.355  7.189   1.00 0.00 ? 11  LEU A CB   2  
ATOM 1649  C CG   . LEU A 1 11 ? -10.644 -2.452  5.758   1.00 0.00 ? 11  LEU A CG   2  
ATOM 1650  C CD1  . LEU A 1 11 ? -9.708  -3.278  4.891   1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1651  C CD2  . LEU A 1 11 ? -12.045 -3.046  5.751   1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1652  H H    . LEU A 1 11 ? -9.460  0.432   7.158   1.00 0.00 ? 11  LEU A H    2  
ATOM 1653  H HA   . LEU A 1 11 ? -11.666 -1.246  8.155   1.00 0.00 ? 11  LEU A HA   2  
ATOM 1654  H HB2  . LEU A 1 11 ? -9.029  -2.312  7.145   1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1655  H HB3  . LEU A 1 11 ? -10.393 -3.252  7.718   1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1656  H HG   . LEU A 1 11 ? -10.700 -1.459  5.336   1.00 0.00 ? 11  LEU A HG   2  
ATOM 1657  H HD11 . LEU A 1 11 ? -10.020 -3.210  3.860   1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1658  H HD12 . LEU A 1 11 ? -9.738  -4.310  5.209   1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1659  H HD13 . LEU A 1 11 ? -8.700  -2.901  4.987   1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1660  H HD21 . LEU A 1 11 ? -12.508 -2.866  4.792   1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1661  H HD22 . LEU A 1 11 ? -12.637 -2.585  6.528   1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1662  H HD23 . LEU A 1 11 ? -11.986 -4.110  5.928   1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1663  N N    . LYS A 1 12 ? -10.379 -1.919  10.283  1.00 0.00 ? 12  LYS A N    2  
ATOM 1664  C CA   . LYS A 1 12 ? -9.788  -1.985  11.617  1.00 0.00 ? 12  LYS A CA   2  
ATOM 1665  C C    . LYS A 1 12 ? -8.593  -2.937  11.626  1.00 0.00 ? 12  LYS A C    2  
ATOM 1666  O O    . LYS A 1 12 ? -8.654  -4.025  11.051  1.00 0.00 ? 12  LYS A O    2  
ATOM 1667  C CB   . LYS A 1 12 ? -10.832 -2.442  12.641  1.00 0.00 ? 12  LYS A CB   2  
ATOM 1668  C CG   . LYS A 1 12 ? -11.770 -1.333  13.097  1.00 0.00 ? 12  LYS A CG   2  
ATOM 1669  C CD   . LYS A 1 12 ? -11.155 -0.498  14.212  1.00 0.00 ? 12  LYS A CD   2  
ATOM 1670  C CE   . LYS A 1 12 ? -11.901 0.814   14.406  1.00 0.00 ? 12  LYS A CE   2  
ATOM 1671  N NZ   . LYS A 1 12 ? -11.080 1.823   15.134  1.00 0.00 ? 12  LYS A NZ   2  
ATOM 1672  H H    . LYS A 1 12 ? -11.143 -2.495  10.070  1.00 0.00 ? 12  LYS A H    2  
ATOM 1673  H HA   . LYS A 1 12 ? -9.448  -0.994  11.878  1.00 0.00 ? 12  LYS A HA   2  
ATOM 1674  H HB2  . LYS A 1 12 ? -11.428 -3.229  12.203  1.00 0.00 ? 12  LYS A HB2  2  
ATOM 1675  H HB3  . LYS A 1 12 ? -10.321 -2.832  13.509  1.00 0.00 ? 12  LYS A HB3  2  
ATOM 1676  H HG2  . LYS A 1 12 ? -11.987 -0.691  12.258  1.00 0.00 ? 12  LYS A HG2  2  
ATOM 1677  H HG3  . LYS A 1 12 ? -12.686 -1.779  13.458  1.00 0.00 ? 12  LYS A HG3  2  
ATOM 1678  H HD2  . LYS A 1 12 ? -11.194 -1.061  15.133  1.00 0.00 ? 12  LYS A HD2  2  
ATOM 1679  H HD3  . LYS A 1 12 ? -10.127 -0.284  13.962  1.00 0.00 ? 12  LYS A HD3  2  
ATOM 1680  H HE2  . LYS A 1 12 ? -12.164 1.211   13.436  1.00 0.00 ? 12  LYS A HE2  2  
ATOM 1681  H HE3  . LYS A 1 12 ? -12.802 0.621   14.970  1.00 0.00 ? 12  LYS A HE3  2  
ATOM 1682  H HZ1  . LYS A 1 12 ? -10.102 1.818   14.776  1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 1683  H HZ2  . LYS A 1 12 ? -11.064 1.605   16.151  1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 1684  H HZ3  . LYS A 1 12 ? -11.480 2.773   15.002  1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 1685  N N    . LYS A 1 13 ? -7.505  -2.518  12.273  1.00 0.00 ? 13  LYS A N    2  
ATOM 1686  C CA   . LYS A 1 13 ? -6.291  -3.330  12.349  1.00 0.00 ? 13  LYS A CA   2  
ATOM 1687  C C    . LYS A 1 13 ? -6.509  -4.578  13.206  1.00 0.00 ? 13  LYS A C    2  
ATOM 1688  O O    . LYS A 1 13 ? -6.405  -4.526  14.433  1.00 0.00 ? 13  LYS A O    2  
ATOM 1689  C CB   . LYS A 1 13 ? -5.133  -2.502  12.917  1.00 0.00 ? 13  LYS A CB   2  
ATOM 1690  C CG   . LYS A 1 13 ? -3.839  -3.286  13.081  1.00 0.00 ? 13  LYS A CG   2  
ATOM 1691  C CD   . LYS A 1 13 ? -2.649  -2.523  12.520  1.00 0.00 ? 13  LYS A CD   2  
ATOM 1692  C CE   . LYS A 1 13 ? -2.364  -2.918  11.078  1.00 0.00 ? 13  LYS A CE   2  
ATOM 1693  N NZ   . LYS A 1 13 ? -0.904  -3.059  10.812  1.00 0.00 ? 13  LYS A NZ   2  
ATOM 1694  H H    . LYS A 1 13 ? -7.519  -1.637  12.705  1.00 0.00 ? 13  LYS A H    2  
ATOM 1695  H HA   . LYS A 1 13 ? -6.038  -3.639  11.344  1.00 0.00 ? 13  LYS A HA   2  
ATOM 1696  H HB2  . LYS A 1 13 ? -4.943  -1.673  12.255  1.00 0.00 ? 13  LYS A HB2  2  
ATOM 1697  H HB3  . LYS A 1 13 ? -5.421  -2.120  13.886  1.00 0.00 ? 13  LYS A HB3  2  
ATOM 1698  H HG2  . LYS A 1 13 ? -3.673  -3.469  14.133  1.00 0.00 ? 13  LYS A HG2  2  
ATOM 1699  H HG3  . LYS A 1 13 ? -3.931  -4.228  12.561  1.00 0.00 ? 13  LYS A HG3  2  
ATOM 1700  H HD2  . LYS A 1 13 ? -2.861  -1.464  12.556  1.00 0.00 ? 13  LYS A HD2  2  
ATOM 1701  H HD3  . LYS A 1 13 ? -1.779  -2.739  13.123  1.00 0.00 ? 13  LYS A HD3  2  
ATOM 1702  H HE2  . LYS A 1 13 ? -2.849  -3.860  10.873  1.00 0.00 ? 13  LYS A HE2  2  
ATOM 1703  H HE3  . LYS A 1 13 ? -2.768  -2.157  10.425  1.00 0.00 ? 13  LYS A HE3  2  
ATOM 1704  H HZ1  . LYS A 1 13 ? -0.392  -3.243  11.699  1.00 0.00 ? 13  LYS A HZ1  2  
ATOM 1705  H HZ2  . LYS A 1 13 ? -0.533  -2.186  10.386  1.00 0.00 ? 13  LYS A HZ2  2  
ATOM 1706  H HZ3  . LYS A 1 13 ? -0.734  -3.849  10.156  1.00 0.00 ? 13  LYS A HZ3  2  
ATOM 1707  N N    . GLN A 1 14 ? -6.802  -5.699  12.552  1.00 0.00 ? 14  GLN A N    2  
ATOM 1708  C CA   . GLN A 1 14 ? -7.022  -6.961  13.252  1.00 0.00 ? 14  GLN A CA   2  
ATOM 1709  C C    . GLN A 1 14 ? -5.782  -7.853  13.148  1.00 0.00 ? 14  GLN A C    2  
ATOM 1710  O O    . GLN A 1 14 ? -5.541  -8.497  12.126  1.00 0.00 ? 14  GLN A O    2  
ATOM 1711  C CB   . GLN A 1 14 ? -8.279  -7.659  12.708  1.00 0.00 ? 14  GLN A CB   2  
ATOM 1712  C CG   . GLN A 1 14 ? -8.138  -8.231  11.304  1.00 0.00 ? 14  GLN A CG   2  
ATOM 1713  C CD   . GLN A 1 14 ? -8.292  -9.739  11.283  1.00 0.00 ? 14  GLN A CD   2  
ATOM 1714  O OE1  . GLN A 1 14 ? -8.994  -10.290 10.436  1.00 0.00 ? 14  GLN A OE1  2  
ATOM 1715  N NE2  . GLN A 1 14 ? -7.634  -10.414 12.219  1.00 0.00 ? 14  GLN A NE2  2  
ATOM 1716  H H    . GLN A 1 14 ? -6.865  -5.680  11.574  1.00 0.00 ? 14  GLN A H    2  
ATOM 1717  H HA   . GLN A 1 14 ? -7.183  -6.735  14.292  1.00 0.00 ? 14  GLN A HA   2  
ATOM 1718  H HB2  . GLN A 1 14 ? -8.541  -8.466  13.374  1.00 0.00 ? 14  GLN A HB2  2  
ATOM 1719  H HB3  . GLN A 1 14 ? -9.089  -6.943  12.697  1.00 0.00 ? 14  GLN A HB3  2  
ATOM 1720  H HG2  . GLN A 1 14 ? -8.901  -7.797  10.675  1.00 0.00 ? 14  GLN A HG2  2  
ATOM 1721  H HG3  . GLN A 1 14 ? -7.164  -7.975  10.916  1.00 0.00 ? 14  GLN A HG3  2  
ATOM 1722  H HE21 . GLN A 1 14 ? -7.088  -9.911  12.856  1.00 0.00 ? 14  GLN A HE21 2  
ATOM 1723  H HE22 . GLN A 1 14 ? -7.728  -11.382 12.241  1.00 0.00 ? 14  GLN A HE22 2  
ATOM 1724  N N    . ASN A 1 15 ? -4.980  -7.863  14.218  1.00 0.00 ? 15  ASN A N    2  
ATOM 1725  C CA   . ASN A 1 15 ? -3.743  -8.649  14.262  1.00 0.00 ? 15  ASN A CA   2  
ATOM 1726  C C    . ASN A 1 15 ? -2.831  -8.301  13.080  1.00 0.00 ? 15  ASN A C    2  
ATOM 1727  O O    . ASN A 1 15 ? -2.136  -9.166  12.542  1.00 0.00 ? 15  ASN A O    2  
ATOM 1728  C CB   . ASN A 1 15 ? -4.055  -10.152 14.274  1.00 0.00 ? 15  ASN A CB   2  
ATOM 1729  C CG   . ASN A 1 15 ? -4.382  -10.666 15.667  1.00 0.00 ? 15  ASN A CG   2  
ATOM 1730  O OD1  . ASN A 1 15 ? -4.126  -9.994  16.667  1.00 0.00 ? 15  ASN A OD1  2  
ATOM 1731  N ND2  . ASN A 1 15 ? -4.950  -11.866 15.742  1.00 0.00 ? 15  ASN A ND2  2  
ATOM 1732  H H    . ASN A 1 15 ? -5.217  -7.317  14.996  1.00 0.00 ? 15  ASN A H    2  
ATOM 1733  H HA   . ASN A 1 15 ? -3.227  -8.393  15.177  1.00 0.00 ? 15  ASN A HA   2  
ATOM 1734  H HB2  . ASN A 1 15 ? -4.900  -10.345 13.631  1.00 0.00 ? 15  ASN A HB2  2  
ATOM 1735  H HB3  . ASN A 1 15 ? -3.196  -10.695 13.905  1.00 0.00 ? 15  ASN A HB3  2  
ATOM 1736  H HD21 . ASN A 1 15 ? -5.124  -12.351 14.908  1.00 0.00 ? 15  ASN A HD21 2  
ATOM 1737  H HD22 . ASN A 1 15 ? -5.171  -12.217 16.630  1.00 0.00 ? 15  ASN A HD22 2  
ATOM 1738  N N    . GLY A 1 16 ? -2.841  -7.025  12.682  1.00 0.00 ? 16  GLY A N    2  
ATOM 1739  C CA   . GLY A 1 16 ? -2.017  -6.584  11.570  1.00 0.00 ? 16  GLY A CA   2  
ATOM 1740  C C    . GLY A 1 16 ? -2.756  -6.636  10.247  1.00 0.00 ? 16  GLY A C    2  
ATOM 1741  O O    . GLY A 1 16 ? -3.955  -6.922  10.209  1.00 0.00 ? 16  GLY A O    2  
ATOM 1742  H H    . GLY A 1 16 ? -3.414  -6.378  13.146  1.00 0.00 ? 16  GLY A H    2  
ATOM 1743  H HA2  . GLY A 1 16 ? -1.701  -5.568  11.753  1.00 0.00 ? 16  GLY A HA2  2  
ATOM 1744  H HA3  . GLY A 1 16 ? -1.144  -7.216  11.508  1.00 0.00 ? 16  GLY A HA3  2  
ATOM 1745  N N    . MET A 1 17 ? -2.042  -6.357  9.159   1.00 0.00 ? 17  MET A N    2  
ATOM 1746  C CA   . MET A 1 17 ? -2.639  -6.372  7.826   1.00 0.00 ? 17  MET A CA   2  
ATOM 1747  C C    . MET A 1 17 ? -2.261  -7.645  7.068   1.00 0.00 ? 17  MET A C    2  
ATOM 1748  O O    . MET A 1 17 ? -3.076  -8.194  6.326   1.00 0.00 ? 17  MET A O    2  
ATOM 1749  C CB   . MET A 1 17 ? -2.209  -5.136  7.026   1.00 0.00 ? 17  MET A CB   2  
ATOM 1750  C CG   . MET A 1 17 ? -2.611  -3.820  7.678   1.00 0.00 ? 17  MET A CG   2  
ATOM 1751  S SD   . MET A 1 17 ? -2.517  -2.425  6.539   1.00 0.00 ? 17  MET A SD   2  
ATOM 1752  C CE   . MET A 1 17 ? -0.865  -1.824  6.877   1.00 0.00 ? 17  MET A CE   2  
ATOM 1753  H H    . MET A 1 17 ? -1.092  -6.136  9.253   1.00 0.00 ? 17  MET A H    2  
ATOM 1754  H HA   . MET A 1 17 ? -3.712  -6.352  7.949   1.00 0.00 ? 17  MET A HA   2  
ATOM 1755  H HB2  . MET A 1 17 ? -1.133  -5.147  6.910   1.00 0.00 ? 17  MET A HB2  2  
ATOM 1756  H HB3  . MET A 1 17 ? -2.665  -5.180  6.048   1.00 0.00 ? 17  MET A HB3  2  
ATOM 1757  H HG2  . MET A 1 17 ? -3.628  -3.906  8.035   1.00 0.00 ? 17  MET A HG2  2  
ATOM 1758  H HG3  . MET A 1 17 ? -1.954  -3.631  8.514   1.00 0.00 ? 17  MET A HG3  2  
ATOM 1759  H HE1  . MET A 1 17 ? -0.471  -1.343  5.995   1.00 0.00 ? 17  MET A HE1  2  
ATOM 1760  H HE2  . MET A 1 17 ? -0.229  -2.653  7.151   1.00 0.00 ? 17  MET A HE2  2  
ATOM 1761  H HE3  . MET A 1 17 ? -0.900  -1.113  7.689   1.00 0.00 ? 17  MET A HE3  2  
ATOM 1762  N N    . GLY A 1 18 ? -1.023  -8.108  7.260   1.00 0.00 ? 18  GLY A N    2  
ATOM 1763  C CA   . GLY A 1 18 ? -0.564  -9.312  6.590   1.00 0.00 ? 18  GLY A CA   2  
ATOM 1764  C C    . GLY A 1 18 ? -0.549  -9.169  5.079   1.00 0.00 ? 18  GLY A C    2  
ATOM 1765  O O    . GLY A 1 18 ? -1.463  -9.637  4.400   1.00 0.00 ? 18  GLY A O    2  
ATOM 1766  H H    . GLY A 1 18 ? -0.418  -7.629  7.864   1.00 0.00 ? 18  GLY A H    2  
ATOM 1767  H HA2  . GLY A 1 18 ? 0.435   -9.541  6.930   1.00 0.00 ? 18  GLY A HA2  2  
ATOM 1768  H HA3  . GLY A 1 18 ? -1.218  -10.129 6.857   1.00 0.00 ? 18  GLY A HA3  2  
ATOM 1769  N N    . LEU A 1 19 ? 0.489   -8.520  4.552   1.00 0.00 ? 19  LEU A N    2  
ATOM 1770  C CA   . LEU A 1 19 ? 0.622   -8.318  3.107   1.00 0.00 ? 19  LEU A CA   2  
ATOM 1771  C C    . LEU A 1 19 ? 2.070   -7.991  2.725   1.00 0.00 ? 19  LEU A C    2  
ATOM 1772  O O    . LEU A 1 19 ? 2.947   -7.926  3.586   1.00 0.00 ? 19  LEU A O    2  
ATOM 1773  C CB   . LEU A 1 19 ? -0.324  -7.208  2.637   1.00 0.00 ? 19  LEU A CB   2  
ATOM 1774  C CG   . LEU A 1 19 ? -0.059  -5.832  3.244   1.00 0.00 ? 19  LEU A CG   2  
ATOM 1775  C CD1  . LEU A 1 19 ? 0.802   -4.999  2.305   1.00 0.00 ? 19  LEU A CD1  2  
ATOM 1776  C CD2  . LEU A 1 19 ? -1.367  -5.119  3.553   1.00 0.00 ? 19  LEU A CD2  2  
ATOM 1777  H H    . LEU A 1 19 ? 1.185   -8.169  5.148   1.00 0.00 ? 19  LEU A H    2  
ATOM 1778  H HA   . LEU A 1 19 ? 0.341   -9.241  2.622   1.00 0.00 ? 19  LEU A HA   2  
ATOM 1779  H HB2  . LEU A 1 19 ? -0.245  -7.128  1.562   1.00 0.00 ? 19  LEU A HB2  2  
ATOM 1780  H HB3  . LEU A 1 19 ? -1.335  -7.497  2.884   1.00 0.00 ? 19  LEU A HB3  2  
ATOM 1781  H HG   . LEU A 1 19 ? 0.479   -5.959  4.173   1.00 0.00 ? 19  LEU A HG   2  
ATOM 1782  H HD11 . LEU A 1 19 ? 0.607   -5.291  1.283   1.00 0.00 ? 19  LEU A HD11 2  
ATOM 1783  H HD12 . LEU A 1 19 ? 1.845   -5.162  2.532   1.00 0.00 ? 19  LEU A HD12 2  
ATOM 1784  H HD13 . LEU A 1 19 ? 0.567   -3.952  2.432   1.00 0.00 ? 19  LEU A HD13 2  
ATOM 1785  H HD21 . LEU A 1 19 ? -1.505  -4.301  2.862   1.00 0.00 ? 19  LEU A HD21 2  
ATOM 1786  H HD22 . LEU A 1 19 ? -1.337  -4.736  4.562   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 1787  H HD23 . LEU A 1 19 ? -2.189  -5.814  3.457   1.00 0.00 ? 19  LEU A HD23 2  
ATOM 1788  N N    . SER A 1 20 ? 2.312   -7.790  1.428   1.00 0.00 ? 20  SER A N    2  
ATOM 1789  C CA   . SER A 1 20 ? 3.654   -7.476  0.930   1.00 0.00 ? 20  SER A CA   2  
ATOM 1790  C C    . SER A 1 20 ? 3.627   -6.284  -0.029  1.00 0.00 ? 20  SER A C    2  
ATOM 1791  O O    . SER A 1 20 ? 2.593   -5.984  -0.629  1.00 0.00 ? 20  SER A O    2  
ATOM 1792  C CB   . SER A 1 20 ? 4.248   -8.696  0.224   1.00 0.00 ? 20  SER A CB   2  
ATOM 1793  O OG   . SER A 1 20 ? 4.528   -9.735  1.146   1.00 0.00 ? 20  SER A OG   2  
ATOM 1794  H H    . SER A 1 20 ? 1.572   -7.859  0.789   1.00 0.00 ? 20  SER A H    2  
ATOM 1795  H HA   . SER A 1 20 ? 4.273   -7.226  1.779   1.00 0.00 ? 20  SER A HA   2  
ATOM 1796  H HB2  . SER A 1 20 ? 3.544   -9.063  -0.508  1.00 0.00 ? 20  SER A HB2  2  
ATOM 1797  H HB3  . SER A 1 20 ? 5.166   -8.412  -0.270  1.00 0.00 ? 20  SER A HB3  2  
ATOM 1798  H HG   . SER A 1 20 ? 3.712   -10.184 1.381   1.00 0.00 ? 20  SER A HG   2  
ATOM 1799  N N    . ILE A 1 21 ? 4.773   -5.609  -0.174  1.00 0.00 ? 21  ILE A N    2  
ATOM 1800  C CA   . ILE A 1 21 ? 4.873   -4.451  -1.066  1.00 0.00 ? 21  ILE A CA   2  
ATOM 1801  C C    . ILE A 1 21 ? 6.228   -4.384  -1.771  1.00 0.00 ? 21  ILE A C    2  
ATOM 1802  O O    . ILE A 1 21 ? 7.254   -4.772  -1.208  1.00 0.00 ? 21  ILE A O    2  
ATOM 1803  C CB   . ILE A 1 21 ? 4.637   -3.123  -0.313  1.00 0.00 ? 21  ILE A CB   2  
ATOM 1804  C CG1  . ILE A 1 21 ? 5.551   -3.022  0.913   1.00 0.00 ? 21  ILE A CG1  2  
ATOM 1805  C CG2  . ILE A 1 21 ? 3.177   -2.999  0.094   1.00 0.00 ? 21  ILE A CG2  2  
ATOM 1806  C CD1  . ILE A 1 21 ? 6.898   -2.402  0.613   1.00 0.00 ? 21  ILE A CD1  2  
ATOM 1807  H H    . ILE A 1 21 ? 5.566   -5.896  0.328   1.00 0.00 ? 21  ILE A H    2  
ATOM 1808  H HA   . ILE A 1 21 ? 4.102   -4.550  -1.816  1.00 0.00 ? 21  ILE A HA   2  
ATOM 1809  H HB   . ILE A 1 21 ? 4.864   -2.311  -0.988  1.00 0.00 ? 21  ILE A HB   2  
ATOM 1810  H HG12 . ILE A 1 21 ? 5.068   -2.416  1.665   1.00 0.00 ? 21  ILE A HG12 2  
ATOM 1811  H HG13 . ILE A 1 21 ? 5.722   -4.012  1.310   1.00 0.00 ? 21  ILE A HG13 2  
ATOM 1812  H HG21 . ILE A 1 21 ? 2.946   -1.963  0.294   1.00 0.00 ? 21  ILE A HG21 2  
ATOM 1813  H HG22 . ILE A 1 21 ? 2.999   -3.586  0.983   1.00 0.00 ? 21  ILE A HG22 2  
ATOM 1814  H HG23 . ILE A 1 21 ? 2.549   -3.359  -0.706  1.00 0.00 ? 21  ILE A HG23 2  
ATOM 1815  H HD11 . ILE A 1 21 ? 6.882   -1.963  -0.374  1.00 0.00 ? 21  ILE A HD11 2  
ATOM 1816  H HD12 . ILE A 1 21 ? 7.659   -3.165  0.655   1.00 0.00 ? 21  ILE A HD12 2  
ATOM 1817  H HD13 . ILE A 1 21 ? 7.114   -1.638  1.344   1.00 0.00 ? 21  ILE A HD13 2  
ATOM 1818  N N    . VAL A 1 22 ? 6.217   -3.881  -3.009  1.00 0.00 ? 22  VAL A N    2  
ATOM 1819  C CA   . VAL A 1 22 ? 7.436   -3.752  -3.807  1.00 0.00 ? 22  VAL A CA   2  
ATOM 1820  C C    . VAL A 1 22 ? 7.522   -2.376  -4.470  1.00 0.00 ? 22  VAL A C    2  
ATOM 1821  O O    . VAL A 1 22 ? 6.546   -1.892  -5.046  1.00 0.00 ? 22  VAL A O    2  
ATOM 1822  C CB   . VAL A 1 22 ? 7.510   -4.836  -4.906  1.00 0.00 ? 22  VAL A CB   2  
ATOM 1823  C CG1  . VAL A 1 22 ? 8.837   -4.769  -5.653  1.00 0.00 ? 22  VAL A CG1  2  
ATOM 1824  C CG2  . VAL A 1 22 ? 7.296   -6.221  -4.313  1.00 0.00 ? 22  VAL A CG2  2  
ATOM 1825  H H    . VAL A 1 22 ? 5.364   -3.587  -3.395  1.00 0.00 ? 22  VAL A H    2  
ATOM 1826  H HA   . VAL A 1 22 ? 8.281   -3.877  -3.147  1.00 0.00 ? 22  VAL A HA   2  
ATOM 1827  H HB   . VAL A 1 22 ? 6.719   -4.648  -5.616  1.00 0.00 ? 22  VAL A HB   2  
ATOM 1828  H HG11 . VAL A 1 22 ? 9.379   -3.885  -5.352  1.00 0.00 ? 22  VAL A HG11 2  
ATOM 1829  H HG12 . VAL A 1 22 ? 8.649   -4.731  -6.716  1.00 0.00 ? 22  VAL A HG12 2  
ATOM 1830  H HG13 . VAL A 1 22 ? 9.425   -5.646  -5.424  1.00 0.00 ? 22  VAL A HG13 2  
ATOM 1831  H HG21 . VAL A 1 22 ? 6.980   -6.130  -3.285  1.00 0.00 ? 22  VAL A HG21 2  
ATOM 1832  H HG22 . VAL A 1 22 ? 8.219   -6.779  -4.357  1.00 0.00 ? 22  VAL A HG22 2  
ATOM 1833  H HG23 . VAL A 1 22 ? 6.535   -6.739  -4.878  1.00 0.00 ? 22  VAL A HG23 2  
ATOM 1834  N N    . ALA A 1 23 ? 8.702   -1.763  -4.398  1.00 0.00 ? 23  ALA A N    2  
ATOM 1835  C CA   . ALA A 1 23 ? 8.929   -0.452  -5.003  1.00 0.00 ? 23  ALA A CA   2  
ATOM 1836  C C    . ALA A 1 23 ? 9.472   -0.600  -6.423  1.00 0.00 ? 23  ALA A C    2  
ATOM 1837  O O    . ALA A 1 23 ? 10.515  -1.223  -6.634  1.00 0.00 ? 23  ALA A O    2  
ATOM 1838  C CB   . ALA A 1 23 ? 9.887   0.368   -4.150  1.00 0.00 ? 23  ALA A CB   2  
ATOM 1839  H H    . ALA A 1 23 ? 9.442   -2.209  -3.936  1.00 0.00 ? 23  ALA A H    2  
ATOM 1840  H HA   . ALA A 1 23 ? 7.981   0.067   -5.041  1.00 0.00 ? 23  ALA A HA   2  
ATOM 1841  H HB1  . ALA A 1 23 ? 9.398   0.649   -3.229  1.00 0.00 ? 23  ALA A HB1  2  
ATOM 1842  H HB2  . ALA A 1 23 ? 10.177  1.258   -4.690  1.00 0.00 ? 23  ALA A HB2  2  
ATOM 1843  H HB3  . ALA A 1 23 ? 10.765  -0.220  -3.926  1.00 0.00 ? 23  ALA A HB3  2  
ATOM 1844  N N    . ALA A 1 24 ? 8.758   -0.028  -7.393  1.00 0.00 ? 24  ALA A N    2  
ATOM 1845  C CA   . ALA A 1 24 ? 9.167   -0.101  -8.795  1.00 0.00 ? 24  ALA A CA   2  
ATOM 1846  C C    . ALA A 1 24 ? 9.024   1.253   -9.490  1.00 0.00 ? 24  ALA A C    2  
ATOM 1847  O O    . ALA A 1 24 ? 8.152   2.051   -9.142  1.00 0.00 ? 24  ALA A O    2  
ATOM 1848  C CB   . ALA A 1 24 ? 8.350   -1.158  -9.525  1.00 0.00 ? 24  ALA A CB   2  
ATOM 1849  H H    . ALA A 1 24 ? 7.936   0.453   -7.161  1.00 0.00 ? 24  ALA A H    2  
ATOM 1850  H HA   . ALA A 1 24 ? 10.205  -0.400  -8.824  1.00 0.00 ? 24  ALA A HA   2  
ATOM 1851  H HB1  . ALA A 1 24 ? 8.056   -1.930  -8.830  1.00 0.00 ? 24  ALA A HB1  2  
ATOM 1852  H HB2  . ALA A 1 24 ? 8.947   -1.593  -10.313 1.00 0.00 ? 24  ALA A HB2  2  
ATOM 1853  H HB3  . ALA A 1 24 ? 7.468   -0.702  -9.952  1.00 0.00 ? 24  ALA A HB3  2  
ATOM 1854  N N    . LYS A 1 25 ? 9.888   1.501   -10.476 1.00 0.00 ? 25  LYS A N    2  
ATOM 1855  C CA   . LYS A 1 25 ? 9.865   2.757   -11.226 1.00 0.00 ? 25  LYS A CA   2  
ATOM 1856  C C    . LYS A 1 25 ? 9.444   2.528   -12.679 1.00 0.00 ? 25  LYS A C    2  
ATOM 1857  O O    . LYS A 1 25 ? 9.175   1.396   -13.088 1.00 0.00 ? 25  LYS A O    2  
ATOM 1858  C CB   . LYS A 1 25 ? 11.245  3.425   -11.179 1.00 0.00 ? 25  LYS A CB   2  
ATOM 1859  C CG   . LYS A 1 25 ? 11.207  4.877   -10.729 1.00 0.00 ? 25  LYS A CG   2  
ATOM 1860  C CD   . LYS A 1 25 ? 12.598  5.398   -10.406 1.00 0.00 ? 25  LYS A CD   2  
ATOM 1861  C CE   . LYS A 1 25 ? 12.587  6.897   -10.143 1.00 0.00 ? 25  LYS A CE   2  
ATOM 1862  N NZ   . LYS A 1 25 ? 12.991  7.681   -11.345 1.00 0.00 ? 25  LYS A NZ   2  
ATOM 1863  H H    . LYS A 1 25 ? 10.558  0.822   -10.705 1.00 0.00 ? 25  LYS A H    2  
ATOM 1864  H HA   . LYS A 1 25 ? 9.144   3.409   -10.755 1.00 0.00 ? 25  LYS A HA   2  
ATOM 1865  H HB2  . LYS A 1 25 ? 11.876  2.875   -10.497 1.00 0.00 ? 25  LYS A HB2  2  
ATOM 1866  H HB3  . LYS A 1 25 ? 11.683  3.389   -12.167 1.00 0.00 ? 25  LYS A HB3  2  
ATOM 1867  H HG2  . LYS A 1 25 ? 10.784  5.478   -11.519 1.00 0.00 ? 25  LYS A HG2  2  
ATOM 1868  H HG3  . LYS A 1 25 ? 10.589  4.954   -9.846  1.00 0.00 ? 25  LYS A HG3  2  
ATOM 1869  H HD2  . LYS A 1 25 ? 12.967  4.891   -9.526  1.00 0.00 ? 25  LYS A HD2  2  
ATOM 1870  H HD3  . LYS A 1 25 ? 13.252  5.192   -11.242 1.00 0.00 ? 25  LYS A HD3  2  
ATOM 1871  H HE2  . LYS A 1 25 ? 11.589  7.190   -9.853  1.00 0.00 ? 25  LYS A HE2  2  
ATOM 1872  H HE3  . LYS A 1 25 ? 13.273  7.113   -9.336  1.00 0.00 ? 25  LYS A HE3  2  
ATOM 1873  H HZ1  . LYS A 1 25 ? 12.196  7.746   -12.014 1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 1874  H HZ2  . LYS A 1 25 ? 13.793  7.222   -11.821 1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 1875  H HZ3  . LYS A 1 25 ? 13.274  8.643   -11.066 1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 1876  N N    . GLY A 1 26 ? 9.394   3.612   -13.456 1.00 0.00 ? 26  GLY A N    2  
ATOM 1877  C CA   . GLY A 1 26 ? 9.012   3.521   -14.852 1.00 0.00 ? 26  GLY A CA   2  
ATOM 1878  C C    . GLY A 1 26 ? 9.393   4.766   -15.619 1.00 0.00 ? 26  GLY A C    2  
ATOM 1879  O O    . GLY A 1 26 ? 10.464  5.337   -15.393 1.00 0.00 ? 26  GLY A O    2  
ATOM 1880  H H    . GLY A 1 26 ? 9.624   4.490   -13.079 1.00 0.00 ? 26  GLY A H    2  
ATOM 1881  H HA2  . GLY A 1 26 ? 9.501   2.671   -15.300 1.00 0.00 ? 26  GLY A HA2  2  
ATOM 1882  H HA3  . GLY A 1 26 ? 7.943   3.384   -14.915 1.00 0.00 ? 26  GLY A HA3  2  
ATOM 1883  N N    . ALA A 1 27 ? 8.516   5.199   -16.513 1.00 0.00 ? 27  ALA A N    2  
ATOM 1884  C CA   . ALA A 1 27 ? 8.770   6.397   -17.299 1.00 0.00 ? 27  ALA A CA   2  
ATOM 1885  C C    . ALA A 1 27 ? 7.872   7.543   -16.844 1.00 0.00 ? 27  ALA A C    2  
ATOM 1886  O O    . ALA A 1 27 ? 6.734   7.323   -16.425 1.00 0.00 ? 27  ALA A O    2  
ATOM 1887  C CB   . ALA A 1 27 ? 8.575   6.122   -18.784 1.00 0.00 ? 27  ALA A CB   2  
ATOM 1888  H H    . ALA A 1 27 ? 7.679   4.708   -16.640 1.00 0.00 ? 27  ALA A H    2  
ATOM 1889  H HA   . ALA A 1 27 ? 9.801   6.676   -17.135 1.00 0.00 ? 27  ALA A HA   2  
ATOM 1890  H HB1  . ALA A 1 27 ? 8.461   7.058   -19.311 1.00 0.00 ? 27  ALA A HB1  2  
ATOM 1891  H HB2  . ALA A 1 27 ? 7.690   5.519   -18.926 1.00 0.00 ? 27  ALA A HB2  2  
ATOM 1892  H HB3  . ALA A 1 27 ? 9.435   5.595   -19.168 1.00 0.00 ? 27  ALA A HB3  2  
ATOM 1893  N N    . GLY A 1 28 ? 8.398   8.766   -16.914 1.00 0.00 ? 28  GLY A N    2  
ATOM 1894  C CA   . GLY A 1 28 ? 7.636   9.928   -16.488 1.00 0.00 ? 28  GLY A CA   2  
ATOM 1895  C C    . GLY A 1 28 ? 7.247   9.835   -15.026 1.00 0.00 ? 28  GLY A C    2  
ATOM 1896  O O    . GLY A 1 28 ? 6.121   10.166  -14.650 1.00 0.00 ? 28  GLY A O    2  
ATOM 1897  H H    . GLY A 1 28 ? 9.314   8.878   -17.245 1.00 0.00 ? 28  GLY A H    2  
ATOM 1898  H HA2  . GLY A 1 28 ? 8.234   10.816  -16.638 1.00 0.00 ? 28  GLY A HA2  2  
ATOM 1899  H HA3  . GLY A 1 28 ? 6.741   10.001  -17.086 1.00 0.00 ? 28  GLY A HA3  2  
ATOM 1900  N N    . GLN A 1 29 ? 8.185   9.364   -14.204 1.00 0.00 ? 29  GLN A N    2  
ATOM 1901  C CA   . GLN A 1 29 ? 7.948   9.203   -12.779 1.00 0.00 ? 29  GLN A CA   2  
ATOM 1902  C C    . GLN A 1 29 ? 9.118   9.745   -11.966 1.00 0.00 ? 29  GLN A C    2  
ATOM 1903  O O    . GLN A 1 29 ? 10.187  9.131   -11.915 1.00 0.00 ? 29  GLN A O    2  
ATOM 1904  C CB   . GLN A 1 29 ? 7.731   7.727   -12.450 1.00 0.00 ? 29  GLN A CB   2  
ATOM 1905  C CG   . GLN A 1 29 ? 6.876   7.496   -11.215 1.00 0.00 ? 29  GLN A CG   2  
ATOM 1906  C CD   . GLN A 1 29 ? 5.573   6.792   -11.534 1.00 0.00 ? 29  GLN A CD   2  
ATOM 1907  O OE1  . GLN A 1 29 ? 4.502   7.219   -11.103 1.00 0.00 ? 29  GLN A OE1  2  
ATOM 1908  N NE2  . GLN A 1 29 ? 5.656   5.705   -12.296 1.00 0.00 ? 29  GLN A NE2  2  
ATOM 1909  H H    . GLN A 1 29 ? 9.057   9.108   -14.571 1.00 0.00 ? 29  GLN A H    2  
ATOM 1910  H HA   . GLN A 1 29 ? 7.053   9.752   -12.524 1.00 0.00 ? 29  GLN A HA   2  
ATOM 1911  H HB2  . GLN A 1 29 ? 7.247   7.251   -13.290 1.00 0.00 ? 29  GLN A HB2  2  
ATOM 1912  H HB3  . GLN A 1 29 ? 8.692   7.261   -12.288 1.00 0.00 ? 29  GLN A HB3  2  
ATOM 1913  H HG2  . GLN A 1 29 ? 7.433   6.891   -10.516 1.00 0.00 ? 29  GLN A HG2  2  
ATOM 1914  H HG3  . GLN A 1 29 ? 6.652   8.452   -10.764 1.00 0.00 ? 29  GLN A HG3  2  
ATOM 1915  H HE21 . GLN A 1 29 ? 6.541   5.420   -12.605 1.00 0.00 ? 29  GLN A HE21 2  
ATOM 1916  H HE22 . GLN A 1 29 ? 4.829   5.236   -12.520 1.00 0.00 ? 29  GLN A HE22 2  
ATOM 1917  N N    . ASP A 1 30 ? 8.908   10.892  -11.325 1.00 0.00 ? 30  ASP A N    2  
ATOM 1918  C CA   . ASP A 1 30 ? 9.946   11.509  -10.504 1.00 0.00 ? 30  ASP A CA   2  
ATOM 1919  C C    . ASP A 1 30 ? 9.849   11.047  -9.046  1.00 0.00 ? 30  ASP A C    2  
ATOM 1920  O O    . ASP A 1 30 ? 10.381  11.697  -8.143  1.00 0.00 ? 30  ASP A O    2  
ATOM 1921  C CB   . ASP A 1 30 ? 9.845   13.035  -10.586 1.00 0.00 ? 30  ASP A CB   2  
ATOM 1922  C CG   . ASP A 1 30 ? 11.205  13.704  -10.584 1.00 0.00 ? 30  ASP A CG   2  
ATOM 1923  O OD1  . ASP A 1 30 ? 11.819  13.793  -9.500  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 1924  O OD2  . ASP A 1 30 ? 11.655  14.138  -11.664 1.00 0.00 ? 30  ASP A OD2  2  
ATOM 1925  H H    . ASP A 1 30 ? 8.034   11.329  -11.400 1.00 0.00 ? 30  ASP A H    2  
ATOM 1926  H HA   . ASP A 1 30 ? 10.901  11.199  -10.897 1.00 0.00 ? 30  ASP A HA   2  
ATOM 1927  H HB2  . ASP A 1 30 ? 9.333   13.307  -11.497 1.00 0.00 ? 30  ASP A HB2  2  
ATOM 1928  H HB3  . ASP A 1 30 ? 9.282   13.402  -9.739  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 1929  N N    . LYS A 1 31 ? 9.172   9.918   -8.828  1.00 0.00 ? 31  LYS A N    2  
ATOM 1930  C CA   . LYS A 1 31 ? 9.003   9.358   -7.490  1.00 0.00 ? 31  LYS A CA   2  
ATOM 1931  C C    . LYS A 1 31 ? 8.966   7.829   -7.549  1.00 0.00 ? 31  LYS A C    2  
ATOM 1932  O O    . LYS A 1 31 ? 9.224   7.234   -8.598  1.00 0.00 ? 31  LYS A O    2  
ATOM 1933  C CB   . LYS A 1 31 ? 7.712   9.890   -6.851  1.00 0.00 ? 31  LYS A CB   2  
ATOM 1934  C CG   . LYS A 1 31 ? 7.610   11.408  -6.837  1.00 0.00 ? 31  LYS A CG   2  
ATOM 1935  C CD   . LYS A 1 31 ? 8.503   12.018  -5.767  1.00 0.00 ? 31  LYS A CD   2  
ATOM 1936  C CE   . LYS A 1 31 ? 8.227   13.503  -5.586  1.00 0.00 ? 31  LYS A CE   2  
ATOM 1937  N NZ   . LYS A 1 31 ? 8.265   13.905  -4.151  1.00 0.00 ? 31  LYS A NZ   2  
ATOM 1938  H H    . LYS A 1 31 ? 8.779   9.447   -9.586  1.00 0.00 ? 31  LYS A H    2  
ATOM 1939  H HA   . LYS A 1 31 ? 9.846   9.665   -6.891  1.00 0.00 ? 31  LYS A HA   2  
ATOM 1940  H HB2  . LYS A 1 31 ? 6.867   9.501   -7.399  1.00 0.00 ? 31  LYS A HB2  2  
ATOM 1941  H HB3  . LYS A 1 31 ? 7.659   9.539   -5.831  1.00 0.00 ? 31  LYS A HB3  2  
ATOM 1942  H HG2  . LYS A 1 31 ? 7.910   11.789  -7.801  1.00 0.00 ? 31  LYS A HG2  2  
ATOM 1943  H HG3  . LYS A 1 31 ? 6.585   11.687  -6.640  1.00 0.00 ? 31  LYS A HG3  2  
ATOM 1944  H HD2  . LYS A 1 31 ? 8.322   11.513  -4.831  1.00 0.00 ? 31  LYS A HD2  2  
ATOM 1945  H HD3  . LYS A 1 31 ? 9.535   11.886  -6.055  1.00 0.00 ? 31  LYS A HD3  2  
ATOM 1946  H HE2  . LYS A 1 31 ? 8.975   14.064  -6.127  1.00 0.00 ? 31  LYS A HE2  2  
ATOM 1947  H HE3  . LYS A 1 31 ? 7.251   13.727  -5.988  1.00 0.00 ? 31  LYS A HE3  2  
ATOM 1948  H HZ1  . LYS A 1 31 ? 8.127   14.933  -4.064  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM 1949  H HZ2  . LYS A 1 31 ? 9.184   13.654  -3.733  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM 1950  H HZ3  . LYS A 1 31 ? 7.512   13.419  -3.623  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM 1951  N N    . LEU A 1 32 ? 8.643   7.196   -6.420  1.00 0.00 ? 32  LEU A N    2  
ATOM 1952  C CA   . LEU A 1 32 ? 8.570   5.740   -6.351  1.00 0.00 ? 32  LEU A CA   2  
ATOM 1953  C C    . LEU A 1 32 ? 7.190   5.286   -5.884  1.00 0.00 ? 32  LEU A C    2  
ATOM 1954  O O    . LEU A 1 32 ? 6.617   5.863   -4.956  1.00 0.00 ? 32  LEU A O    2  
ATOM 1955  C CB   . LEU A 1 32 ? 9.650   5.188   -5.414  1.00 0.00 ? 32  LEU A CB   2  
ATOM 1956  C CG   . LEU A 1 32 ? 10.589  4.153   -6.046  1.00 0.00 ? 32  LEU A CG   2  
ATOM 1957  C CD1  . LEU A 1 32 ? 9.796   3.015   -6.673  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 1958  C CD2  . LEU A 1 32 ? 11.491  4.811   -7.083  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 1959  H H    . LEU A 1 32 ? 8.446   7.721   -5.615  1.00 0.00 ? 32  LEU A H    2  
ATOM 1960  H HA   . LEU A 1 32 ? 8.742   5.355   -7.346  1.00 0.00 ? 32  LEU A HA   2  
ATOM 1961  H HB2  . LEU A 1 32 ? 10.245  6.018   -5.057  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 1962  H HB3  . LEU A 1 32 ? 9.162   4.728   -4.568  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 1963  H HG   . LEU A 1 32 ? 11.218  3.732   -5.275  1.00 0.00 ? 32  LEU A HG   2  
ATOM 1964  H HD11 . LEU A 1 32 ? 10.388  2.111   -6.655  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 1965  H HD12 . LEU A 1 32 ? 9.554   3.266   -7.695  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 1966  H HD13 . LEU A 1 32 ? 8.885   2.860   -6.115  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 1967  H HD21 . LEU A 1 32 ? 12.425  5.095   -6.621  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 1968  H HD22 . LEU A 1 32 ? 11.003  5.689   -7.478  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 1969  H HD23 . LEU A 1 32 ? 11.684  4.114   -7.886  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 1970  N N    . GLY A 1 33 ? 6.661   4.250   -6.534  1.00 0.00 ? 33  GLY A N    2  
ATOM 1971  C CA   . GLY A 1 33 ? 5.352   3.735   -6.175  1.00 0.00 ? 33  GLY A CA   2  
ATOM 1972  C C    . GLY A 1 33 ? 5.431   2.470   -5.342  1.00 0.00 ? 33  GLY A C    2  
ATOM 1973  O O    . GLY A 1 33 ? 6.065   1.493   -5.748  1.00 0.00 ? 33  GLY A O    2  
ATOM 1974  H H    . GLY A 1 33 ? 7.166   3.831   -7.264  1.00 0.00 ? 33  GLY A H    2  
ATOM 1975  H HA2  . GLY A 1 33 ? 4.824   4.492   -5.614  1.00 0.00 ? 33  GLY A HA2  2  
ATOM 1976  H HA3  . GLY A 1 33 ? 4.802   3.523   -7.080  1.00 0.00 ? 33  GLY A HA3  2  
ATOM 1977  N N    . ILE A 1 34 ? 4.786   2.485   -4.177  1.00 0.00 ? 34  ILE A N    2  
ATOM 1978  C CA   . ILE A 1 34 ? 4.783   1.327   -3.284  1.00 0.00 ? 34  ILE A CA   2  
ATOM 1979  C C    . ILE A 1 34 ? 3.692   0.337   -3.686  1.00 0.00 ? 34  ILE A C    2  
ATOM 1980  O O    . ILE A 1 34 ? 2.583   0.363   -3.152  1.00 0.00 ? 34  ILE A O    2  
ATOM 1981  C CB   . ILE A 1 34 ? 4.580   1.742   -1.811  1.00 0.00 ? 34  ILE A CB   2  
ATOM 1982  C CG1  . ILE A 1 34 ? 5.463   2.944   -1.465  1.00 0.00 ? 34  ILE A CG1  2  
ATOM 1983  C CG2  . ILE A 1 34 ? 4.876   0.574   -0.879  1.00 0.00 ? 34  ILE A CG2  2  
ATOM 1984  C CD1  . ILE A 1 34 ? 6.942   2.705   -1.699  1.00 0.00 ? 34  ILE A CD1  2  
ATOM 1985  H H    . ILE A 1 34 ? 4.298   3.293   -3.911  1.00 0.00 ? 34  ILE A H    2  
ATOM 1986  H HA   . ILE A 1 34 ? 5.745   0.840   -3.369  1.00 0.00 ? 34  ILE A HA   2  
ATOM 1987  H HB   . ILE A 1 34 ? 3.544   2.018   -1.680  1.00 0.00 ? 34  ILE A HB   2  
ATOM 1988  H HG12 . ILE A 1 34 ? 5.166   3.787   -2.070  1.00 0.00 ? 34  ILE A HG12 2  
ATOM 1989  H HG13 . ILE A 1 34 ? 5.328   3.192   -0.422  1.00 0.00 ? 34  ILE A HG13 2  
ATOM 1990  H HG21 . ILE A 1 34 ? 4.449   0.771   0.093   1.00 0.00 ? 34  ILE A HG21 2  
ATOM 1991  H HG22 . ILE A 1 34 ? 5.945   0.453   -0.784  1.00 0.00 ? 34  ILE A HG22 2  
ATOM 1992  H HG23 . ILE A 1 34 ? 4.445   -0.329  -1.285  1.00 0.00 ? 34  ILE A HG23 2  
ATOM 1993  H HD11 . ILE A 1 34 ? 7.133   2.647   -2.761  1.00 0.00 ? 34  ILE A HD11 2  
ATOM 1994  H HD12 . ILE A 1 34 ? 7.237   1.779   -1.229  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 1995  H HD13 . ILE A 1 34 ? 7.508   3.520   -1.276  1.00 0.00 ? 34  ILE A HD13 2  
ATOM 1996  N N    . TYR A 1 35 ? 4.017   -0.528  -4.640  1.00 0.00 ? 35  TYR A N    2  
ATOM 1997  C CA   . TYR A 1 35 ? 3.075   -1.529  -5.135  1.00 0.00 ? 35  TYR A CA   2  
ATOM 1998  C C    . TYR A 1 35 ? 2.948   -2.707  -4.167  1.00 0.00 ? 35  TYR A C    2  
ATOM 1999  O O    . TYR A 1 35 ? 3.732   -2.834  -3.227  1.00 0.00 ? 35  TYR A O    2  
ATOM 2000  C CB   . TYR A 1 35 ? 3.524   -2.021  -6.512  1.00 0.00 ? 35  TYR A CB   2  
ATOM 2001  C CG   . TYR A 1 35 ? 3.713   -0.903  -7.512  1.00 0.00 ? 35  TYR A CG   2  
ATOM 2002  C CD1  . TYR A 1 35 ? 2.625   -0.181  -7.985  1.00 0.00 ? 35  TYR A CD1  2  
ATOM 2003  C CD2  . TYR A 1 35 ? 4.978   -0.565  -7.978  1.00 0.00 ? 35  TYR A CD2  2  
ATOM 2004  C CE1  . TYR A 1 35 ? 2.790   0.842   -8.896  1.00 0.00 ? 35  TYR A CE1  2  
ATOM 2005  C CE2  . TYR A 1 35 ? 5.151   0.459   -8.890  1.00 0.00 ? 35  TYR A CE2  2  
ATOM 2006  C CZ   . TYR A 1 35 ? 4.055   1.159   -9.346  1.00 0.00 ? 35  TYR A CZ   2  
ATOM 2007  O OH   . TYR A 1 35 ? 4.222   2.178   -10.255 1.00 0.00 ? 35  TYR A OH   2  
ATOM 2008  H H    . TYR A 1 35 ? 4.914   -0.490  -5.030  1.00 0.00 ? 35  TYR A H    2  
ATOM 2009  H HA   . TYR A 1 35 ? 2.111   -1.055  -5.232  1.00 0.00 ? 35  TYR A HA   2  
ATOM 2010  H HB2  . TYR A 1 35 ? 4.465   -2.540  -6.411  1.00 0.00 ? 35  TYR A HB2  2  
ATOM 2011  H HB3  . TYR A 1 35 ? 2.783   -2.700  -6.906  1.00 0.00 ? 35  TYR A HB3  2  
ATOM 2012  H HD1  . TYR A 1 35 ? 1.637   -0.431  -7.632  1.00 0.00 ? 35  TYR A HD1  2  
ATOM 2013  H HD2  . TYR A 1 35 ? 5.836   -1.114  -7.619  1.00 0.00 ? 35  TYR A HD2  2  
ATOM 2014  H HE1  . TYR A 1 35 ? 1.931   1.392   -9.248  1.00 0.00 ? 35  TYR A HE1  2  
ATOM 2015  H HE2  . TYR A 1 35 ? 6.142   0.708   -9.241  1.00 0.00 ? 35  TYR A HE2  2  
ATOM 2016  H HH   . TYR A 1 35 ? 3.824   1.928   -11.093 1.00 0.00 ? 35  TYR A HH   2  
ATOM 2017  N N    . VAL A 1 36 ? 1.952   -3.561  -4.403  1.00 0.00 ? 36  VAL A N    2  
ATOM 2018  C CA   . VAL A 1 36 ? 1.714   -4.727  -3.551  1.00 0.00 ? 36  VAL A CA   2  
ATOM 2019  C C    . VAL A 1 36 ? 2.186   -6.015  -4.224  1.00 0.00 ? 36  VAL A C    2  
ATOM 2020  O O    . VAL A 1 36 ? 1.825   -6.298  -5.367  1.00 0.00 ? 36  VAL A O    2  
ATOM 2021  C CB   . VAL A 1 36 ? 0.217   -4.869  -3.195  1.00 0.00 ? 36  VAL A CB   2  
ATOM 2022  C CG1  . VAL A 1 36 ? 0.003   -5.987  -2.184  1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2023  C CG2  . VAL A 1 36 ? -0.343  -3.555  -2.667  1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2024  H H    . VAL A 1 36 ? 1.358   -3.402  -5.168  1.00 0.00 ? 36  VAL A H    2  
ATOM 2025  H HA   . VAL A 1 36 ? 2.270   -4.588  -2.634  1.00 0.00 ? 36  VAL A HA   2  
ATOM 2026  H HB   . VAL A 1 36 ? -0.321  -5.127  -4.095  1.00 0.00 ? 36  VAL A HB   2  
ATOM 2027  H HG11 . VAL A 1 36 ? -1.037  -6.279  -2.187  1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2028  H HG12 . VAL A 1 36 ? 0.276   -5.639  -1.199  1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2029  H HG13 . VAL A 1 36 ? 0.616   -6.836  -2.448  1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2030  H HG21 . VAL A 1 36 ? -0.400  -3.594  -1.589  1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2031  H HG22 . VAL A 1 36 ? -1.330  -3.396  -3.074  1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2032  H HG23 . VAL A 1 36 ? 0.303   -2.741  -2.963  1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2033  N N    . LYS A 1 37 ? 2.984   -6.797  -3.498  1.00 0.00 ? 37  LYS A N    2  
ATOM 2034  C CA   . LYS A 1 37 ? 3.499   -8.066  -4.011  1.00 0.00 ? 37  LYS A CA   2  
ATOM 2035  C C    . LYS A 1 37 ? 2.473   -9.180  -3.817  1.00 0.00 ? 37  LYS A C    2  
ATOM 2036  O O    . LYS A 1 37 ? 2.225   -9.969  -4.728  1.00 0.00 ? 37  LYS A O    2  
ATOM 2037  C CB   . LYS A 1 37 ? 4.808   -8.436  -3.305  1.00 0.00 ? 37  LYS A CB   2  
ATOM 2038  C CG   . LYS A 1 37 ? 5.491   -9.669  -3.884  1.00 0.00 ? 37  LYS A CG   2  
ATOM 2039  C CD   . LYS A 1 37 ? 6.890   -9.354  -4.392  1.00 0.00 ? 37  LYS A CD   2  
ATOM 2040  C CE   . LYS A 1 37 ? 7.724   -10.615 -4.570  1.00 0.00 ? 37  LYS A CE   2  
ATOM 2041  N NZ   . LYS A 1 37 ? 8.706   -10.486 -5.685  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 2042  H H    . LYS A 1 37 ? 3.225   -6.517  -2.590  1.00 0.00 ? 37  LYS A H    2  
ATOM 2043  H HA   . LYS A 1 37 ? 3.688   -7.945  -5.068  1.00 0.00 ? 37  LYS A HA   2  
ATOM 2044  H HB2  . LYS A 1 37 ? 5.490   -7.602  -3.377  1.00 0.00 ? 37  LYS A HB2  2  
ATOM 2045  H HB3  . LYS A 1 37 ? 4.597   -8.625  -2.263  1.00 0.00 ? 37  LYS A HB3  2  
ATOM 2046  H HG2  . LYS A 1 37 ? 5.560   -10.423 -3.115  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 2047  H HG3  . LYS A 1 37 ? 4.896   -10.045 -4.705  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 2048  H HD2  . LYS A 1 37 ? 6.812   -8.851  -5.343  1.00 0.00 ? 37  LYS A HD2  2  
ATOM 2049  H HD3  . LYS A 1 37 ? 7.381   -8.707  -3.681  1.00 0.00 ? 37  LYS A HD3  2  
ATOM 2050  H HE2  . LYS A 1 37 ? 8.262   -10.809 -3.653  1.00 0.00 ? 37  LYS A HE2  2  
ATOM 2051  H HE3  . LYS A 1 37 ? 7.062   -11.444 -4.778  1.00 0.00 ? 37  LYS A HE3  2  
ATOM 2052  H HZ1  . LYS A 1 37 ? 8.941   -9.485  -5.844  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 2053  H HZ2  . LYS A 1 37 ? 8.306   -10.879 -6.561  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 2054  H HZ3  . LYS A 1 37 ? 9.579   -11.004 -5.455  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 2055  N N    . SER A 1 38 ? 1.881   -9.236  -2.621  1.00 0.00 ? 38  SER A N    2  
ATOM 2056  C CA   . SER A 1 38 ? 0.878   -10.252 -2.301  1.00 0.00 ? 38  SER A CA   2  
ATOM 2057  C C    . SER A 1 38 ? 0.195   -9.949  -0.965  1.00 0.00 ? 38  SER A C    2  
ATOM 2058  O O    . SER A 1 38 ? 0.553   -8.990  -0.280  1.00 0.00 ? 38  SER A O    2  
ATOM 2059  C CB   . SER A 1 38 ? 1.518   -11.644 -2.257  1.00 0.00 ? 38  SER A CB   2  
ATOM 2060  O OG   . SER A 1 38 ? 1.365   -12.316 -3.495  1.00 0.00 ? 38  SER A OG   2  
ATOM 2061  H H    . SER A 1 38 ? 2.124   -8.576  -1.938  1.00 0.00 ? 38  SER A H    2  
ATOM 2062  H HA   . SER A 1 38 ? 0.134   -10.235 -3.082  1.00 0.00 ? 38  SER A HA   2  
ATOM 2063  H HB2  . SER A 1 38 ? 2.572   -11.548 -2.042  1.00 0.00 ? 38  SER A HB2  2  
ATOM 2064  H HB3  . SER A 1 38 ? 1.045   -12.229 -1.482  1.00 0.00 ? 38  SER A HB3  2  
ATOM 2065  H HG   . SER A 1 38 ? 0.696   -12.999 -3.408  1.00 0.00 ? 38  SER A HG   2  
ATOM 2066  N N    . VAL A 1 39 ? -0.786  -10.777 -0.600  1.00 0.00 ? 39  VAL A N    2  
ATOM 2067  C CA   . VAL A 1 39 ? -1.514  -10.601 0.655   1.00 0.00 ? 39  VAL A CA   2  
ATOM 2068  C C    . VAL A 1 39 ? -1.381  -11.842 1.537   1.00 0.00 ? 39  VAL A C    2  
ATOM 2069  O O    . VAL A 1 39 ? -1.639  -12.962 1.092   1.00 0.00 ? 39  VAL A O    2  
ATOM 2070  C CB   . VAL A 1 39 ? -3.013  -10.306 0.416   1.00 0.00 ? 39  VAL A CB   2  
ATOM 2071  C CG1  . VAL A 1 39 ? -3.694  -9.894  1.715   1.00 0.00 ? 39  VAL A CG1  2  
ATOM 2072  C CG2  . VAL A 1 39 ? -3.193  -9.226  -0.644  1.00 0.00 ? 39  VAL A CG2  2  
ATOM 2073  H H    . VAL A 1 39 ? -1.024  -11.526 -1.187  1.00 0.00 ? 39  VAL A H    2  
ATOM 2074  H HA   . VAL A 1 39 ? -1.080  -9.758  1.174   1.00 0.00 ? 39  VAL A HA   2  
ATOM 2075  H HB   . VAL A 1 39 ? -3.487  -11.210 0.059   1.00 0.00 ? 39  VAL A HB   2  
ATOM 2076  H HG11 . VAL A 1 39 ? -4.726  -10.210 1.696   1.00 0.00 ? 39  VAL A HG11 2  
ATOM 2077  H HG12 . VAL A 1 39 ? -3.648  -8.821  1.821   1.00 0.00 ? 39  VAL A HG12 2  
ATOM 2078  H HG13 . VAL A 1 39 ? -3.192  -10.361 2.550   1.00 0.00 ? 39  VAL A HG13 2  
ATOM 2079  H HG21 . VAL A 1 39 ? -2.276  -9.111  -1.203  1.00 0.00 ? 39  VAL A HG21 2  
ATOM 2080  H HG22 . VAL A 1 39 ? -3.442  -8.291  -0.167  1.00 0.00 ? 39  VAL A HG22 2  
ATOM 2081  H HG23 . VAL A 1 39 ? -3.989  -9.511  -1.316  1.00 0.00 ? 39  VAL A HG23 2  
ATOM 2082  N N    . VAL A 1 40 ? -0.973  -11.632 2.786   1.00 0.00 ? 40  VAL A N    2  
ATOM 2083  C CA   . VAL A 1 40 ? -0.797  -12.728 3.735   1.00 0.00 ? 40  VAL A CA   2  
ATOM 2084  C C    . VAL A 1 40 ? -2.116  -13.081 4.422   1.00 0.00 ? 40  VAL A C    2  
ATOM 2085  O O    . VAL A 1 40 ? -2.773  -12.219 5.008   1.00 0.00 ? 40  VAL A O    2  
ATOM 2086  C CB   . VAL A 1 40 ? 0.256   -12.380 4.812   1.00 0.00 ? 40  VAL A CB   2  
ATOM 2087  C CG1  . VAL A 1 40 ? 0.587   -13.603 5.654   1.00 0.00 ? 40  VAL A CG1  2  
ATOM 2088  C CG2  . VAL A 1 40 ? 1.516   -11.810 4.174   1.00 0.00 ? 40  VAL A CG2  2  
ATOM 2089  H H    . VAL A 1 40 ? -0.783  -10.714 3.079   1.00 0.00 ? 40  VAL A H    2  
ATOM 2090  H HA   . VAL A 1 40 ? -0.448  -13.589 3.185   1.00 0.00 ? 40  VAL A HA   2  
ATOM 2091  H HB   . VAL A 1 40 ? -0.163  -11.628 5.464   1.00 0.00 ? 40  VAL A HB   2  
ATOM 2092  H HG11 . VAL A 1 40 ? -0.229  -13.804 6.333   1.00 0.00 ? 40  VAL A HG11 2  
ATOM 2093  H HG12 . VAL A 1 40 ? 1.488   -13.418 6.219   1.00 0.00 ? 40  VAL A HG12 2  
ATOM 2094  H HG13 . VAL A 1 40 ? 0.736   -14.456 5.008   1.00 0.00 ? 40  VAL A HG13 2  
ATOM 2095  H HG21 . VAL A 1 40 ? 1.246   -11.048 3.457   1.00 0.00 ? 40  VAL A HG21 2  
ATOM 2096  H HG22 . VAL A 1 40 ? 2.056   -12.599 3.673   1.00 0.00 ? 40  VAL A HG22 2  
ATOM 2097  H HG23 . VAL A 1 40 ? 2.143   -11.376 4.940   1.00 0.00 ? 40  VAL A HG23 2  
ATOM 2098  N N    . LYS A 1 41 ? -2.493  -14.358 4.346   1.00 0.00 ? 41  LYS A N    2  
ATOM 2099  C CA   . LYS A 1 41 ? -3.729  -14.838 4.960   1.00 0.00 ? 41  LYS A CA   2  
ATOM 2100  C C    . LYS A 1 41 ? -3.691  -14.663 6.475   1.00 0.00 ? 41  LYS A C    2  
ATOM 2101  O O    . LYS A 1 41 ? -2.642  -14.823 7.101   1.00 0.00 ? 41  LYS A O    2  
ATOM 2102  C CB   . LYS A 1 41 ? -3.955  -16.314 4.616   1.00 0.00 ? 41  LYS A CB   2  
ATOM 2103  C CG   . LYS A 1 41 ? -4.851  -16.534 3.406   1.00 0.00 ? 41  LYS A CG   2  
ATOM 2104  C CD   . LYS A 1 41 ? -4.263  -15.907 2.149   1.00 0.00 ? 41  LYS A CD   2  
ATOM 2105  C CE   . LYS A 1 41 ? -4.343  -16.850 0.958   1.00 0.00 ? 41  LYS A CE   2  
ATOM 2106  N NZ   . LYS A 1 41 ? -5.749  -17.092 0.526   1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2107  H H    . LYS A 1 41 ? -1.923  -14.994 3.867   1.00 0.00 ? 41  LYS A H    2  
ATOM 2108  H HA   . LYS A 1 41 ? -4.546  -14.255 4.563   1.00 0.00 ? 41  LYS A HA   2  
ATOM 2109  H HB2  . LYS A 1 41 ? -2.999  -16.775 4.418   1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2110  H HB3  . LYS A 1 41 ? -4.410  -16.803 5.466   1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2111  H HG2  . LYS A 1 41 ? -4.966  -17.596 3.246   1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2112  H HG3  . LYS A 1 41 ? -5.817  -16.091 3.601   1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2113  H HD2  . LYS A 1 41 ? -4.813  -15.007 1.920   1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2114  H HD3  . LYS A 1 41 ? -3.227  -15.661 2.332   1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2115  H HE2  . LYS A 1 41 ? -3.795  -16.416 0.136   1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2116  H HE3  . LYS A 1 41 ? -3.892  -17.793 1.232   1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2117  H HZ1  . LYS A 1 41 ? -5.855  -18.070 0.188   1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2118  H HZ2  . LYS A 1 41 ? -6.004  -16.442 -0.244  1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2119  H HZ3  . LYS A 1 41 ? -6.402  -16.940 1.322   1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2120  N N    . GLY A 1 42 ? -4.842  -14.336 7.056   1.00 0.00 ? 42  GLY A N    2  
ATOM 2121  C CA   . GLY A 1 42 ? -4.921  -14.144 8.495   1.00 0.00 ? 42  GLY A CA   2  
ATOM 2122  C C    . GLY A 1 42 ? -4.862  -12.682 8.906   1.00 0.00 ? 42  GLY A C    2  
ATOM 2123  O O    . GLY A 1 42 ? -5.208  -12.341 10.039  1.00 0.00 ? 42  GLY A O    2  
ATOM 2124  H H    . GLY A 1 42 ? -5.645  -14.223 6.504   1.00 0.00 ? 42  GLY A H    2  
ATOM 2125  H HA2  . GLY A 1 42 ? -5.850  -14.567 8.849   1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2126  H HA3  . GLY A 1 42 ? -4.100  -14.669 8.961   1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2127  N N    . GLY A 1 43 ? -4.430  -11.814 7.989   1.00 0.00 ? 43  GLY A N    2  
ATOM 2128  C CA   . GLY A 1 43 ? -4.345  -10.399 8.293   1.00 0.00 ? 43  GLY A CA   2  
ATOM 2129  C C    . GLY A 1 43 ? -5.703  -9.718  8.311   1.00 0.00 ? 43  GLY A C    2  
ATOM 2130  O O    . GLY A 1 43 ? -6.721  -10.352 8.595   1.00 0.00 ? 43  GLY A O    2  
ATOM 2131  H H    . GLY A 1 43 ? -4.171  -12.136 7.100   1.00 0.00 ? 43  GLY A H    2  
ATOM 2132  H HA2  . GLY A 1 43 ? -3.886  -10.281 9.263   1.00 0.00 ? 43  GLY A HA2  2  
ATOM 2133  H HA3  . GLY A 1 43 ? -3.722  -9.921  7.552   1.00 0.00 ? 43  GLY A HA3  2  
ATOM 2134  N N    . ALA A 1 44 ? -5.716  -8.422  8.011   1.00 0.00 ? 44  ALA A N    2  
ATOM 2135  C CA   . ALA A 1 44 ? -6.953  -7.644  7.997   1.00 0.00 ? 44  ALA A CA   2  
ATOM 2136  C C    . ALA A 1 44 ? -7.546  -7.557  6.592   1.00 0.00 ? 44  ALA A C    2  
ATOM 2137  O O    . ALA A 1 44 ? -8.672  -7.999  6.359   1.00 0.00 ? 44  ALA A O    2  
ATOM 2138  C CB   . ALA A 1 44 ? -6.705  -6.249  8.555   1.00 0.00 ? 44  ALA A CB   2  
ATOM 2139  H H    . ALA A 1 44 ? -4.873  -7.978  7.797   1.00 0.00 ? 44  ALA A H    2  
ATOM 2140  H HA   . ALA A 1 44 ? -7.663  -8.141  8.642   1.00 0.00 ? 44  ALA A HA   2  
ATOM 2141  H HB1  . ALA A 1 44 ? -7.012  -6.214  9.591   1.00 0.00 ? 44  ALA A HB1  2  
ATOM 2142  H HB2  . ALA A 1 44 ? -7.274  -5.527  7.988   1.00 0.00 ? 44  ALA A HB2  2  
ATOM 2143  H HB3  . ALA A 1 44 ? -5.654  -6.014  8.483   1.00 0.00 ? 44  ALA A HB3  2  
ATOM 2144  N N    . ALA A 1 45 ? -6.784  -6.981  5.661   1.00 0.00 ? 45  ALA A N    2  
ATOM 2145  C CA   . ALA A 1 45 ? -7.239  -6.833  4.278   1.00 0.00 ? 45  ALA A CA   2  
ATOM 2146  C C    . ALA A 1 45 ? -7.503  -8.186  3.618   1.00 0.00 ? 45  ALA A C    2  
ATOM 2147  O O    . ALA A 1 45 ? -8.311  -8.281  2.693   1.00 0.00 ? 45  ALA A O    2  
ATOM 2148  C CB   . ALA A 1 45 ? -6.222  -6.046  3.467   1.00 0.00 ? 45  ALA A CB   2  
ATOM 2149  H H    . ALA A 1 45 ? -5.897  -6.647  5.910   1.00 0.00 ? 45  ALA A H    2  
ATOM 2150  H HA   . ALA A 1 45 ? -8.161  -6.269  4.292   1.00 0.00 ? 45  ALA A HA   2  
ATOM 2151  H HB1  . ALA A 1 45 ? -5.545  -6.731  2.979   1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2152  H HB2  . ALA A 1 45 ? -5.665  -5.395  4.123   1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2153  H HB3  . ALA A 1 45 ? -6.736  -5.455  2.722   1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2154  N N    . ASP A 1 46 ? -6.821  -9.231  4.091   1.00 0.00 ? 46  ASP A N    2  
ATOM 2155  C CA   . ASP A 1 46 ? -6.998  -10.569 3.535   1.00 0.00 ? 46  ASP A CA   2  
ATOM 2156  C C    . ASP A 1 46 ? -8.346  -11.150 3.949   1.00 0.00 ? 46  ASP A C    2  
ATOM 2157  O O    . ASP A 1 46 ? -9.087  -11.675 3.118   1.00 0.00 ? 46  ASP A O    2  
ATOM 2158  C CB   . ASP A 1 46 ? -5.868  -11.499 3.987   1.00 0.00 ? 46  ASP A CB   2  
ATOM 2159  C CG   . ASP A 1 46 ? -5.641  -12.645 3.020   1.00 0.00 ? 46  ASP A CG   2  
ATOM 2160  O OD1  . ASP A 1 46 ? -6.552  -13.489 2.871   1.00 0.00 ? 46  ASP A OD1  2  
ATOM 2161  O OD2  . ASP A 1 46 ? -4.552  -12.702 2.412   1.00 0.00 ? 46  ASP A OD2  2  
ATOM 2162  H H    . ASP A 1 46 ? -6.188  -9.099  4.828   1.00 0.00 ? 46  ASP A H    2  
ATOM 2163  H HA   . ASP A 1 46 ? -6.973  -10.484 2.458   1.00 0.00 ? 46  ASP A HA   2  
ATOM 2164  H HB2  . ASP A 1 46 ? -4.951  -10.933 4.065   1.00 0.00 ? 46  ASP A HB2  2  
ATOM 2165  H HB3  . ASP A 1 46 ? -6.114  -11.912 4.954   1.00 0.00 ? 46  ASP A HB3  2  
ATOM 2166  N N    . VAL A 1 47 ? -8.658  -11.052 5.240   1.00 0.00 ? 47  VAL A N    2  
ATOM 2167  C CA   . VAL A 1 47 ? -9.919  -11.569 5.766   1.00 0.00 ? 47  VAL A CA   2  
ATOM 2168  C C    . VAL A 1 47 ? -11.096 -10.682 5.357   1.00 0.00 ? 47  VAL A C    2  
ATOM 2169  O O    . VAL A 1 47 ? -12.181 -11.180 5.057   1.00 0.00 ? 47  VAL A O    2  
ATOM 2170  C CB   . VAL A 1 47 ? -9.880  -11.696 7.304   1.00 0.00 ? 47  VAL A CB   2  
ATOM 2171  C CG1  . VAL A 1 47 ? -11.136 -12.384 7.823   1.00 0.00 ? 47  VAL A CG1  2  
ATOM 2172  C CG2  . VAL A 1 47 ? -8.633  -12.449 7.747   1.00 0.00 ? 47  VAL A CG2  2  
ATOM 2173  H H    . VAL A 1 47 ? -8.026  -10.620 5.853   1.00 0.00 ? 47  VAL A H    2  
ATOM 2174  H HA   . VAL A 1 47 ? -10.069 -12.556 5.349   1.00 0.00 ? 47  VAL A HA   2  
ATOM 2175  H HB   . VAL A 1 47 ? -9.843  -10.702 7.727   1.00 0.00 ? 47  VAL A HB   2  
ATOM 2176  H HG11 . VAL A 1 47 ? -10.894 -12.962 8.702   1.00 0.00 ? 47  VAL A HG11 2  
ATOM 2177  H HG12 . VAL A 1 47 ? -11.530 -13.040 7.059   1.00 0.00 ? 47  VAL A HG12 2  
ATOM 2178  H HG13 . VAL A 1 47 ? -11.876 -11.640 8.075   1.00 0.00 ? 47  VAL A HG13 2  
ATOM 2179  H HG21 . VAL A 1 47 ? -7.755  -11.951 7.362   1.00 0.00 ? 47  VAL A HG21 2  
ATOM 2180  H HG22 . VAL A 1 47 ? -8.667  -13.460 7.368   1.00 0.00 ? 47  VAL A HG22 2  
ATOM 2181  H HG23 . VAL A 1 47 ? -8.589  -12.471 8.826   1.00 0.00 ? 47  VAL A HG23 2  
ATOM 2182  N N    . ASP A 1 48 ? -10.875 -9.368  5.342   1.00 0.00 ? 48  ASP A N    2  
ATOM 2183  C CA   . ASP A 1 48 ? -11.921 -8.422  4.964   1.00 0.00 ? 48  ASP A CA   2  
ATOM 2184  C C    . ASP A 1 48 ? -12.149 -8.429  3.453   1.00 0.00 ? 48  ASP A C    2  
ATOM 2185  O O    . ASP A 1 48 ? -13.290 -8.443  2.990   1.00 0.00 ? 48  ASP A O    2  
ATOM 2186  C CB   . ASP A 1 48 ? -11.557 -7.010  5.429   1.00 0.00 ? 48  ASP A CB   2  
ATOM 2187  C CG   . ASP A 1 48 ? -12.093 -6.701  6.813   1.00 0.00 ? 48  ASP A CG   2  
ATOM 2188  O OD1  . ASP A 1 48 ? -13.253 -6.249  6.913   1.00 0.00 ? 48  ASP A OD1  2  
ATOM 2189  O OD2  . ASP A 1 48 ? -11.353 -6.912  7.797   1.00 0.00 ? 48  ASP A OD2  2  
ATOM 2190  H H    . ASP A 1 48 ? -9.988  -9.028  5.589   1.00 0.00 ? 48  ASP A H    2  
ATOM 2191  H HA   . ASP A 1 48 ? -12.835 -8.727  5.454   1.00 0.00 ? 48  ASP A HA   2  
ATOM 2192  H HB2  . ASP A 1 48 ? -10.482 -6.910  5.449   1.00 0.00 ? 48  ASP A HB2  2  
ATOM 2193  H HB3  . ASP A 1 48 ? -11.969 -6.292  4.735   1.00 0.00 ? 48  ASP A HB3  2  
ATOM 2194  N N    . GLY A 1 49 ? -11.055 -8.415  2.691   1.00 0.00 ? 49  GLY A N    2  
ATOM 2195  C CA   . GLY A 1 49 ? -11.153 -8.417  1.241   1.00 0.00 ? 49  GLY A CA   2  
ATOM 2196  C C    . GLY A 1 49 ? -11.088 -7.019  0.653   1.00 0.00 ? 49  GLY A C    2  
ATOM 2197  O O    . GLY A 1 49 ? -12.065 -6.538  0.074   1.00 0.00 ? 49  GLY A O    2  
ATOM 2198  H H    . GLY A 1 49 ? -10.172 -8.402  3.117   1.00 0.00 ? 49  GLY A H    2  
ATOM 2199  H HA2  . GLY A 1 49 ? -10.344 -9.005  0.838   1.00 0.00 ? 49  GLY A HA2  2  
ATOM 2200  H HA3  . GLY A 1 49 ? -12.090 -8.872  0.955   1.00 0.00 ? 49  GLY A HA3  2  
ATOM 2201  N N    . ARG A 1 50 ? -9.935  -6.363  0.801   1.00 0.00 ? 50  ARG A N    2  
ATOM 2202  C CA   . ARG A 1 50 ? -9.751  -5.010  0.277   1.00 0.00 ? 50  ARG A CA   2  
ATOM 2203  C C    . ARG A 1 50 ? -8.349  -4.825  -0.311  1.00 0.00 ? 50  ARG A C    2  
ATOM 2204  O O    . ARG A 1 50 ? -7.800  -3.721  -0.288  1.00 0.00 ? 50  ARG A O    2  
ATOM 2205  C CB   . ARG A 1 50 ? -10.001 -3.977  1.381   1.00 0.00 ? 50  ARG A CB   2  
ATOM 2206  C CG   . ARG A 1 50 ? -11.475 -3.714  1.649   1.00 0.00 ? 50  ARG A CG   2  
ATOM 2207  C CD   . ARG A 1 50 ? -12.101 -2.860  0.556   1.00 0.00 ? 50  ARG A CD   2  
ATOM 2208  N NE   . ARG A 1 50 ? -12.820 -3.667  -0.431  1.00 0.00 ? 50  ARG A NE   2  
ATOM 2209  C CZ   . ARG A 1 50 ? -13.640 -3.163  -1.356  1.00 0.00 ? 50  ARG A CZ   2  
ATOM 2210  N NH1  . ARG A 1 50 ? -13.852 -1.852  -1.431  1.00 0.00 ? 50  ARG A NH1  2  
ATOM 2211  N NH2  . ARG A 1 50 ? -14.251 -3.973  -2.215  1.00 0.00 ? 50  ARG A NH2  2  
ATOM 2212  H H    . ARG A 1 50 ? -9.192  -6.797  1.272   1.00 0.00 ? 50  ARG A H    2  
ATOM 2213  H HA   . ARG A 1 50 ? -10.475 -4.860  -0.510  1.00 0.00 ? 50  ARG A HA   2  
ATOM 2214  H HB2  . ARG A 1 50 ? -9.547  -4.328  2.296   1.00 0.00 ? 50  ARG A HB2  2  
ATOM 2215  H HB3  . ARG A 1 50 ? -9.537  -3.044  1.095   1.00 0.00 ? 50  ARG A HB3  2  
ATOM 2216  H HG2  . ARG A 1 50 ? -11.996 -4.658  1.698   1.00 0.00 ? 50  ARG A HG2  2  
ATOM 2217  H HG3  . ARG A 1 50 ? -11.571 -3.200  2.594   1.00 0.00 ? 50  ARG A HG3  2  
ATOM 2218  H HD2  . ARG A 1 50 ? -12.792 -2.167  1.013   1.00 0.00 ? 50  ARG A HD2  2  
ATOM 2219  H HD3  . ARG A 1 50 ? -11.318 -2.309  0.055   1.00 0.00 ? 50  ARG A HD3  2  
ATOM 2220  H HE   . ARG A 1 50 ? -12.685 -4.639  -0.402  1.00 0.00 ? 50  ARG A HE   2  
ATOM 2221  H HH11 . ARG A 1 50 ? -13.396 -1.233  -0.790  1.00 0.00 ? 50  ARG A HH11 2  
ATOM 2222  H HH12 . ARG A 1 50 ? -14.469 -1.483  -2.127  1.00 0.00 ? 50  ARG A HH12 2  
ATOM 2223  H HH21 . ARG A 1 50 ? -14.097 -4.960  -2.168  1.00 0.00 ? 50  ARG A HH21 2  
ATOM 2224  H HH22 . ARG A 1 50 ? -14.867 -3.596  -2.907  1.00 0.00 ? 50  ARG A HH22 2  
ATOM 2225  N N    . LEU A 1 51 ? -7.778  -5.908  -0.846  1.00 0.00 ? 51  LEU A N    2  
ATOM 2226  C CA   . LEU A 1 51 ? -6.445  -5.859  -1.445  1.00 0.00 ? 51  LEU A CA   2  
ATOM 2227  C C    . LEU A 1 51 ? -6.266  -6.952  -2.495  1.00 0.00 ? 51  LEU A C    2  
ATOM 2228  O O    . LEU A 1 51 ? -7.108  -7.842  -2.632  1.00 0.00 ? 51  LEU A O    2  
ATOM 2229  C CB   . LEU A 1 51 ? -5.364  -6.006  -0.370  1.00 0.00 ? 51  LEU A CB   2  
ATOM 2230  C CG   . LEU A 1 51 ? -4.798  -4.691  0.166   1.00 0.00 ? 51  LEU A CG   2  
ATOM 2231  C CD1  . LEU A 1 51 ? -3.787  -4.958  1.270   1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2232  C CD2  . LEU A 1 51 ? -4.160  -3.883  -0.958  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2233  H H    . LEU A 1 51 ? -8.265  -6.757  -0.842  1.00 0.00 ? 51  LEU A H    2  
ATOM 2234  H HA   . LEU A 1 51 ? -6.334  -4.897  -1.923  1.00 0.00 ? 51  LEU A HA   2  
ATOM 2235  H HB2  . LEU A 1 51 ? -5.783  -6.559  0.459   1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2236  H HB3  . LEU A 1 51 ? -4.549  -6.577  -0.787  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2237  H HG   . LEU A 1 51 ? -5.606  -4.107  0.584   1.00 0.00 ? 51  LEU A HG   2  
ATOM 2238  H HD11 . LEU A 1 51 ? -3.007  -5.604  0.895   1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2239  H HD12 . LEU A 1 51 ? -4.281  -5.436  2.102   1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2240  H HD13 . LEU A 1 51 ? -3.354  -4.024  1.596   1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2241  H HD21 . LEU A 1 51 ? -3.515  -4.524  -1.543  1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2242  H HD22 . LEU A 1 51 ? -3.578  -3.077  -0.536  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2243  H HD23 . LEU A 1 51 ? -4.932  -3.473  -1.593  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2244  N N    . ALA A 1 52 ? -5.154  -6.877  -3.229  1.00 0.00 ? 52  ALA A N    2  
ATOM 2245  C CA   . ALA A 1 52 ? -4.845  -7.858  -4.265  1.00 0.00 ? 52  ALA A CA   2  
ATOM 2246  C C    . ALA A 1 52 ? -3.401  -7.721  -4.739  1.00 0.00 ? 52  ALA A C    2  
ATOM 2247  O O    . ALA A 1 52 ? -2.882  -6.610  -4.862  1.00 0.00 ? 52  ALA A O    2  
ATOM 2248  C CB   . ALA A 1 52 ? -5.801  -7.712  -5.439  1.00 0.00 ? 52  ALA A CB   2  
ATOM 2249  H H    . ALA A 1 52 ? -4.523  -6.144  -3.065  1.00 0.00 ? 52  ALA A H    2  
ATOM 2250  H HA   . ALA A 1 52 ? -4.981  -8.842  -3.841  1.00 0.00 ? 52  ALA A HA   2  
ATOM 2251  H HB1  . ALA A 1 52 ? -6.137  -6.687  -5.507  1.00 0.00 ? 52  ALA A HB1  2  
ATOM 2252  H HB2  . ALA A 1 52 ? -6.652  -8.361  -5.290  1.00 0.00 ? 52  ALA A HB2  2  
ATOM 2253  H HB3  . ALA A 1 52 ? -5.295  -7.987  -6.352  1.00 0.00 ? 52  ALA A HB3  2  
ATOM 2254  N N    . ALA A 1 53 ? -2.758  -8.857  -5.004  1.00 0.00 ? 53  ALA A N    2  
ATOM 2255  C CA   . ALA A 1 53 ? -1.373  -8.864  -5.466  1.00 0.00 ? 53  ALA A CA   2  
ATOM 2256  C C    . ALA A 1 53 ? -1.241  -8.130  -6.800  1.00 0.00 ? 53  ALA A C    2  
ATOM 2257  O O    . ALA A 1 53 ? -1.823  -8.544  -7.804  1.00 0.00 ? 53  ALA A O    2  
ATOM 2258  C CB   . ALA A 1 53 ? -0.862  -10.292 -5.593  1.00 0.00 ? 53  ALA A CB   2  
ATOM 2259  H H    . ALA A 1 53 ? -3.227  -9.711  -4.886  1.00 0.00 ? 53  ALA A H    2  
ATOM 2260  H HA   . ALA A 1 53 ? -0.773  -8.354  -4.724  1.00 0.00 ? 53  ALA A HA   2  
ATOM 2261  H HB1  . ALA A 1 53 ? 0.177   -10.328 -5.307  1.00 0.00 ? 53  ALA A HB1  2  
ATOM 2262  H HB2  . ALA A 1 53 ? -0.965  -10.622 -6.616  1.00 0.00 ? 53  ALA A HB2  2  
ATOM 2263  H HB3  . ALA A 1 53 ? -1.436  -10.939 -4.946  1.00 0.00 ? 53  ALA A HB3  2  
ATOM 2264  N N    . GLY A 1 54 ? -0.478  -7.038  -6.799  1.00 0.00 ? 54  GLY A N    2  
ATOM 2265  C CA   . GLY A 1 54 ? -0.288  -6.257  -8.011  1.00 0.00 ? 54  GLY A CA   2  
ATOM 2266  C C    . GLY A 1 54 ? -1.028  -4.929  -7.973  1.00 0.00 ? 54  GLY A C    2  
ATOM 2267  O O    . GLY A 1 54 ? -1.463  -4.426  -9.011  1.00 0.00 ? 54  GLY A O    2  
ATOM 2268  H H    . GLY A 1 54 ? -0.043  -6.757  -5.966  1.00 0.00 ? 54  GLY A H    2  
ATOM 2269  H HA2  . GLY A 1 54 ? 0.767   -6.067  -8.140  1.00 0.00 ? 54  GLY A HA2  2  
ATOM 2270  H HA3  . GLY A 1 54 ? -0.645  -6.830  -8.854  1.00 0.00 ? 54  GLY A HA3  2  
ATOM 2271  N N    . ASP A 1 55 ? -1.169  -4.360  -6.775  1.00 0.00 ? 55  ASP A N    2  
ATOM 2272  C CA   . ASP A 1 55 ? -1.859  -3.085  -6.606  1.00 0.00 ? 55  ASP A CA   2  
ATOM 2273  C C    . ASP A 1 55 ? -0.867  -1.961  -6.301  1.00 0.00 ? 55  ASP A C    2  
ATOM 2274  O O    . ASP A 1 55 ? 0.344   -2.186  -6.263  1.00 0.00 ? 55  ASP A O    2  
ATOM 2275  C CB   . ASP A 1 55 ? -2.897  -3.193  -5.485  1.00 0.00 ? 55  ASP A CB   2  
ATOM 2276  C CG   . ASP A 1 55 ? -4.312  -3.319  -6.016  1.00 0.00 ? 55  ASP A CG   2  
ATOM 2277  O OD1  . ASP A 1 55 ? -4.740  -2.434  -6.787  1.00 0.00 ? 55  ASP A OD1  2  
ATOM 2278  O OD2  . ASP A 1 55 ? -4.994  -4.304  -5.661  1.00 0.00 ? 55  ASP A OD2  2  
ATOM 2279  H H    . ASP A 1 55 ? -0.799  -4.807  -5.987  1.00 0.00 ? 55  ASP A H    2  
ATOM 2280  H HA   . ASP A 1 55 ? -2.365  -2.859  -7.532  1.00 0.00 ? 55  ASP A HA   2  
ATOM 2281  H HB2  . ASP A 1 55 ? -2.680  -4.065  -4.886  1.00 0.00 ? 55  ASP A HB2  2  
ATOM 2282  H HB3  . ASP A 1 55 ? -2.843  -2.312  -4.863  1.00 0.00 ? 55  ASP A HB3  2  
ATOM 2283  N N    . GLN A 1 56 ? -1.390  -0.750  -6.089  1.00 0.00 ? 56  GLN A N    2  
ATOM 2284  C CA   . GLN A 1 56 ? -0.553  0.415   -5.792  1.00 0.00 ? 56  GLN A CA   2  
ATOM 2285  C C    . GLN A 1 56 ? -0.979  1.084   -4.483  1.00 0.00 ? 56  GLN A C    2  
ATOM 2286  O O    . GLN A 1 56 ? -2.111  0.910   -4.029  1.00 0.00 ? 56  GLN A O    2  
ATOM 2287  C CB   . GLN A 1 56 ? -0.640  1.427   -6.937  1.00 0.00 ? 56  GLN A CB   2  
ATOM 2288  C CG   . GLN A 1 56 ? 0.552   2.367   -7.017  1.00 0.00 ? 56  GLN A CG   2  
ATOM 2289  C CD   . GLN A 1 56 ? 0.233   3.763   -6.514  1.00 0.00 ? 56  GLN A CD   2  
ATOM 2290  O OE1  . GLN A 1 56 ? -0.814  4.326   -6.834  1.00 0.00 ? 56  GLN A OE1  2  
ATOM 2291  N NE2  . GLN A 1 56 ? 1.135   4.329   -5.721  1.00 0.00 ? 56  GLN A NE2  2  
ATOM 2292  H H    . GLN A 1 56 ? -2.362  -0.636  -6.137  1.00 0.00 ? 56  GLN A H    2  
ATOM 2293  H HA   . GLN A 1 56 ? 0.470   0.078   -5.697  1.00 0.00 ? 56  GLN A HA   2  
ATOM 2294  H HB2  . GLN A 1 56 ? -0.711  0.891   -7.872  1.00 0.00 ? 56  GLN A HB2  2  
ATOM 2295  H HB3  . GLN A 1 56 ? -1.532  2.023   -6.807  1.00 0.00 ? 56  GLN A HB3  2  
ATOM 2296  H HG2  . GLN A 1 56 ? 1.355   1.960   -6.420  1.00 0.00 ? 56  GLN A HG2  2  
ATOM 2297  H HG3  . GLN A 1 56 ? 0.870   2.438   -8.047  1.00 0.00 ? 56  GLN A HG3  2  
ATOM 2298  H HE21 . GLN A 1 56 ? 1.947   3.823   -5.506  1.00 0.00 ? 56  GLN A HE21 2  
ATOM 2299  H HE22 . GLN A 1 56 ? 0.953   5.230   -5.384  1.00 0.00 ? 56  GLN A HE22 2  
ATOM 2300  N N    . LEU A 1 57 ? -0.068  1.856   -3.886  1.00 0.00 ? 57  LEU A N    2  
ATOM 2301  C CA   . LEU A 1 57 ? -0.355  2.557   -2.634  1.00 0.00 ? 57  LEU A CA   2  
ATOM 2302  C C    . LEU A 1 57 ? -0.114  4.061   -2.781  1.00 0.00 ? 57  LEU A C    2  
ATOM 2303  O O    . LEU A 1 57 ? 1.032   4.510   -2.855  1.00 0.00 ? 57  LEU A O    2  
ATOM 2304  C CB   . LEU A 1 57 ? 0.506   1.996   -1.494  1.00 0.00 ? 57  LEU A CB   2  
ATOM 2305  C CG   . LEU A 1 57 ? 0.347   0.496   -1.225  1.00 0.00 ? 57  LEU A CG   2  
ATOM 2306  C CD1  . LEU A 1 57 ? 1.399   0.018   -0.233  1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2307  C CD2  . LEU A 1 57 ? -1.053  0.187   -0.710  1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2308  H H    . LEU A 1 57 ? 0.815   1.961   -4.300  1.00 0.00 ? 57  LEU A H    2  
ATOM 2309  H HA   . LEU A 1 57 ? -1.396  2.395   -2.396  1.00 0.00 ? 57  LEU A HA   2  
ATOM 2310  H HB2  . LEU A 1 57 ? 1.543   2.190   -1.728  1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2311  H HB3  . LEU A 1 57 ? 0.255   2.529   -0.589  1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2312  H HG   . LEU A 1 57 ? 0.492   -0.046  -2.149  1.00 0.00 ? 57  LEU A HG   2  
ATOM 2313  H HD11 . LEU A 1 57 ? 2.327   -0.166  -0.754  1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2314  H HD12 . LEU A 1 57 ? 1.063   -0.894  0.238   1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2315  H HD13 . LEU A 1 57 ? 1.553   0.776   0.521   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2316  H HD21 . LEU A 1 57 ? -1.376  0.977   -0.049  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2317  H HD22 . LEU A 1 57 ? -1.040  -0.750  -0.173  1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2318  H HD23 . LEU A 1 57 ? -1.735  0.114   -1.545  1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2319  N N    . LEU A 1 58 ? -1.203  4.832   -2.825  1.00 0.00 ? 58  LEU A N    2  
ATOM 2320  C CA   . LEU A 1 58 ? -1.119  6.288   -2.965  1.00 0.00 ? 58  LEU A CA   2  
ATOM 2321  C C    . LEU A 1 58 ? -0.685  6.945   -1.654  1.00 0.00 ? 58  LEU A C    2  
ATOM 2322  O O    . LEU A 1 58 ? 0.386   7.551   -1.581  1.00 0.00 ? 58  LEU A O    2  
ATOM 2323  C CB   . LEU A 1 58 ? -2.473  6.859   -3.413  1.00 0.00 ? 58  LEU A CB   2  
ATOM 2324  C CG   . LEU A 1 58 ? -2.411  7.910   -4.527  1.00 0.00 ? 58  LEU A CG   2  
ATOM 2325  C CD1  . LEU A 1 58 ? -3.705  7.914   -5.328  1.00 0.00 ? 58  LEU A CD1  2  
ATOM 2326  C CD2  . LEU A 1 58 ? -2.139  9.292   -3.948  1.00 0.00 ? 58  LEU A CD2  2  
ATOM 2327  H H    . LEU A 1 58 ? -2.087  4.410   -2.763  1.00 0.00 ? 58  LEU A H    2  
ATOM 2328  H HA   . LEU A 1 58 ? -0.381  6.504   -3.723  1.00 0.00 ? 58  LEU A HA   2  
ATOM 2329  H HB2  . LEU A 1 58 ? -3.088  6.039   -3.756  1.00 0.00 ? 58  LEU A HB2  2  
ATOM 2330  H HB3  . LEU A 1 58 ? -2.952  7.308   -2.554  1.00 0.00 ? 58  LEU A HB3  2  
ATOM 2331  H HG   . LEU A 1 58 ? -1.603  7.664   -5.202  1.00 0.00 ? 58  LEU A HG   2  
ATOM 2332  H HD11 . LEU A 1 58 ? -4.542  7.773   -4.661  1.00 0.00 ? 58  LEU A HD11 2  
ATOM 2333  H HD12 . LEU A 1 58 ? -3.683  7.114   -6.053  1.00 0.00 ? 58  LEU A HD12 2  
ATOM 2334  H HD13 . LEU A 1 58 ? -3.809  8.860   -5.840  1.00 0.00 ? 58  LEU A HD13 2  
ATOM 2335  H HD21 . LEU A 1 58 ? -1.081  9.406   -3.767  1.00 0.00 ? 58  LEU A HD21 2  
ATOM 2336  H HD22 . LEU A 1 58 ? -2.678  9.406   -3.019  1.00 0.00 ? 58  LEU A HD22 2  
ATOM 2337  H HD23 . LEU A 1 58 ? -2.467  10.047  -4.648  1.00 0.00 ? 58  LEU A HD23 2  
ATOM 2338  N N    . SER A 1 59 ? -1.524  6.825   -0.622  1.00 0.00 ? 59  SER A N    2  
ATOM 2339  C CA   . SER A 1 59 ? -1.225  7.412   0.683   1.00 0.00 ? 59  SER A CA   2  
ATOM 2340  C C    . SER A 1 59 ? -1.799  6.569   1.819   1.00 0.00 ? 59  SER A C    2  
ATOM 2341  O O    . SER A 1 59 ? -2.724  5.777   1.617   1.00 0.00 ? 59  SER A O    2  
ATOM 2342  C CB   . SER A 1 59 ? -1.782  8.837   0.767   1.00 0.00 ? 59  SER A CB   2  
ATOM 2343  O OG   . SER A 1 59 ? -1.031  9.728   -0.040  1.00 0.00 ? 59  SER A OG   2  
ATOM 2344  H H    . SER A 1 59 ? -2.364  6.333   -0.742  1.00 0.00 ? 59  SER A H    2  
ATOM 2345  H HA   . SER A 1 59 ? -0.151  7.451   0.789   1.00 0.00 ? 59  SER A HA   2  
ATOM 2346  H HB2  . SER A 1 59 ? -2.807  8.843   0.428   1.00 0.00 ? 59  SER A HB2  2  
ATOM 2347  H HB3  . SER A 1 59 ? -1.739  9.177   1.792   1.00 0.00 ? 59  SER A HB3  2  
ATOM 2348  H HG   . SER A 1 59 ? -0.206  9.943   0.404   1.00 0.00 ? 59  SER A HG   2  
ATOM 2349  N N    . VAL A 1 60 ? -1.242  6.750   3.017   1.00 0.00 ? 60  VAL A N    2  
ATOM 2350  C CA   . VAL A 1 60 ? -1.689  6.015   4.196   1.00 0.00 ? 60  VAL A CA   2  
ATOM 2351  C C    . VAL A 1 60 ? -2.003  6.971   5.345   1.00 0.00 ? 60  VAL A C    2  
ATOM 2352  O O    . VAL A 1 60 ? -1.162  7.787   5.730   1.00 0.00 ? 60  VAL A O    2  
ATOM 2353  C CB   . VAL A 1 60 ? -0.628  4.994   4.658   1.00 0.00 ? 60  VAL A CB   2  
ATOM 2354  C CG1  . VAL A 1 60 ? -1.155  4.145   5.806   1.00 0.00 ? 60  VAL A CG1  2  
ATOM 2355  C CG2  . VAL A 1 60 ? -0.191  4.117   3.492   1.00 0.00 ? 60  VAL A CG2  2  
ATOM 2356  H H    . VAL A 1 60 ? -0.511  7.395   3.110   1.00 0.00 ? 60  VAL A H    2  
ATOM 2357  H HA   . VAL A 1 60 ? -2.589  5.476   3.933   1.00 0.00 ? 60  VAL A HA   2  
ATOM 2358  H HB   . VAL A 1 60 ? 0.235   5.539   5.011   1.00 0.00 ? 60  VAL A HB   2  
ATOM 2359  H HG11 . VAL A 1 60 ? -1.443  3.174   5.434   1.00 0.00 ? 60  VAL A HG11 2  
ATOM 2360  H HG12 . VAL A 1 60 ? -2.012  4.629   6.251   1.00 0.00 ? 60  VAL A HG12 2  
ATOM 2361  H HG13 . VAL A 1 60 ? -0.382  4.029   6.552   1.00 0.00 ? 60  VAL A HG13 2  
ATOM 2362  H HG21 . VAL A 1 60 ? -0.276  4.672   2.570   1.00 0.00 ? 60  VAL A HG21 2  
ATOM 2363  H HG22 . VAL A 1 60 ? -0.821  3.242   3.444   1.00 0.00 ? 60  VAL A HG22 2  
ATOM 2364  H HG23 . VAL A 1 60 ? 0.834   3.814   3.636   1.00 0.00 ? 60  VAL A HG23 2  
ATOM 2365  N N    . ASP A 1 61 ? -3.220  6.868   5.881   1.00 0.00 ? 61  ASP A N    2  
ATOM 2366  C CA   . ASP A 1 61 ? -3.661  7.725   6.983   1.00 0.00 ? 61  ASP A CA   2  
ATOM 2367  C C    . ASP A 1 61 ? -3.523  9.208   6.619   1.00 0.00 ? 61  ASP A C    2  
ATOM 2368  O O    . ASP A 1 61 ? -3.232  10.044  7.477   1.00 0.00 ? 61  ASP A O    2  
ATOM 2369  C CB   . ASP A 1 61 ? -2.865  7.413   8.258   1.00 0.00 ? 61  ASP A CB   2  
ATOM 2370  C CG   . ASP A 1 61 ? -3.098  5.999   8.760   1.00 0.00 ? 61  ASP A CG   2  
ATOM 2371  O OD1  . ASP A 1 61 ? -4.226  5.707   9.212   1.00 0.00 ? 61  ASP A OD1  2  
ATOM 2372  O OD2  . ASP A 1 61 ? -2.153  5.185   8.704   1.00 0.00 ? 61  ASP A OD2  2  
ATOM 2373  H H    . ASP A 1 61 ? -3.843  6.200   5.522   1.00 0.00 ? 61  ASP A H    2  
ATOM 2374  H HA   . ASP A 1 61 ? -4.704  7.512   7.165   1.00 0.00 ? 61  ASP A HA   2  
ATOM 2375  H HB2  . ASP A 1 61 ? -1.812  7.533   8.056   1.00 0.00 ? 61  ASP A HB2  2  
ATOM 2376  H HB3  . ASP A 1 61 ? -3.158  8.104   9.036   1.00 0.00 ? 61  ASP A HB3  2  
ATOM 2377  N N    . GLY A 1 62 ? -3.734  9.525   5.339   1.00 0.00 ? 62  GLY A N    2  
ATOM 2378  C CA   . GLY A 1 62 ? -3.630  10.900  4.879   1.00 0.00 ? 62  GLY A CA   2  
ATOM 2379  C C    . GLY A 1 62 ? -2.207  11.436  4.920   1.00 0.00 ? 62  GLY A C    2  
ATOM 2380  O O    . GLY A 1 62 ? -1.991  12.609  5.222   1.00 0.00 ? 62  GLY A O    2  
ATOM 2381  H H    . GLY A 1 62 ? -3.964  8.817   4.701   1.00 0.00 ? 62  GLY A H    2  
ATOM 2382  H HA2  . GLY A 1 62 ? -3.992  10.954  3.863   1.00 0.00 ? 62  GLY A HA2  2  
ATOM 2383  H HA3  . GLY A 1 62 ? -4.255  11.524  5.502   1.00 0.00 ? 62  GLY A HA3  2  
ATOM 2384  N N    . ARG A 1 63 ? -1.233  10.577  4.612   1.00 0.00 ? 63  ARG A N    2  
ATOM 2385  C CA   . ARG A 1 63 ? 0.173   10.979  4.613   1.00 0.00 ? 63  ARG A CA   2  
ATOM 2386  C C    . ARG A 1 63 ? 0.794   10.807  3.230   1.00 0.00 ? 63  ARG A C    2  
ATOM 2387  O O    . ARG A 1 63 ? 0.359   9.963   2.443   1.00 0.00 ? 63  ARG A O    2  
ATOM 2388  C CB   . ARG A 1 63 ? 0.967   10.174  5.647   1.00 0.00 ? 63  ARG A CB   2  
ATOM 2389  C CG   . ARG A 1 63 ? 0.849   10.722  7.061   1.00 0.00 ? 63  ARG A CG   2  
ATOM 2390  C CD   . ARG A 1 63 ? 1.202   9.673   8.106   1.00 0.00 ? 63  ARG A CD   2  
ATOM 2391  N NE   . ARG A 1 63 ? 1.586   10.277  9.383   1.00 0.00 ? 63  ARG A NE   2  
ATOM 2392  C CZ   . ARG A 1 63 ? 2.756   10.888  9.604   1.00 0.00 ? 63  ARG A CZ   2  
ATOM 2393  N NH1  . ARG A 1 63 ? 3.654   10.999  8.629   1.00 0.00 ? 63  ARG A NH1  2  
ATOM 2394  N NH2  . ARG A 1 63 ? 3.024   11.392  10.805  1.00 0.00 ? 63  ARG A NH2  2  
ATOM 2395  H H    . ARG A 1 63 ? -1.464  9.653   4.375   1.00 0.00 ? 63  ARG A H    2  
ATOM 2396  H HA   . ARG A 1 63 ? 0.215   12.024  4.880   1.00 0.00 ? 63  ARG A HA   2  
ATOM 2397  H HB2  . ARG A 1 63 ? 0.614   9.153   5.645   1.00 0.00 ? 63  ARG A HB2  2  
ATOM 2398  H HB3  . ARG A 1 63 ? 2.011   10.185  5.367   1.00 0.00 ? 63  ARG A HB3  2  
ATOM 2399  H HG2  . ARG A 1 63 ? 1.521   11.559  7.168   1.00 0.00 ? 63  ARG A HG2  2  
ATOM 2400  H HG3  . ARG A 1 63 ? -0.167  11.051  7.224   1.00 0.00 ? 63  ARG A HG3  2  
ATOM 2401  H HD2  . ARG A 1 63 ? 0.342   9.038   8.264   1.00 0.00 ? 63  ARG A HD2  2  
ATOM 2402  H HD3  . ARG A 1 63 ? 2.025   9.078   7.738   1.00 0.00 ? 63  ARG A HD3  2  
ATOM 2403  H HE   . ARG A 1 63 ? 0.940   10.221  10.119  1.00 0.00 ? 63  ARG A HE   2  
ATOM 2404  H HH11 . ARG A 1 63 ? 3.460   10.625  7.722   1.00 0.00 ? 63  ARG A HH11 2  
ATOM 2405  H HH12 . ARG A 1 63 ? 4.526   11.459  8.802   1.00 0.00 ? 63  ARG A HH12 2  
ATOM 2406  H HH21 . ARG A 1 63 ? 2.352   11.315  11.542  1.00 0.00 ? 63  ARG A HH21 2  
ATOM 2407  H HH22 . ARG A 1 63 ? 3.898   11.850  10.973  1.00 0.00 ? 63  ARG A HH22 2  
ATOM 2408  N N    . SER A 1 64 ? 1.815   11.613  2.944   1.00 0.00 ? 64  SER A N    2  
ATOM 2409  C CA   . SER A 1 64 ? 2.504   11.558  1.657   1.00 0.00 ? 64  SER A CA   2  
ATOM 2410  C C    . SER A 1 64 ? 3.490   10.394  1.608   1.00 0.00 ? 64  SER A C    2  
ATOM 2411  O O    . SER A 1 64 ? 4.445   10.344  2.385   1.00 0.00 ? 64  SER A O    2  
ATOM 2412  C CB   . SER A 1 64 ? 3.243   12.872  1.388   1.00 0.00 ? 64  SER A CB   2  
ATOM 2413  O OG   . SER A 1 64 ? 2.344   13.967  1.342   1.00 0.00 ? 64  SER A OG   2  
ATOM 2414  H H    . SER A 1 64 ? 2.113   12.262  3.615   1.00 0.00 ? 64  SER A H    2  
ATOM 2415  H HA   . SER A 1 64 ? 1.758   11.413  0.890   1.00 0.00 ? 64  SER A HA   2  
ATOM 2416  H HB2  . SER A 1 64 ? 3.961   13.046  2.175   1.00 0.00 ? 64  SER A HB2  2  
ATOM 2417  H HB3  . SER A 1 64 ? 3.758   12.805  0.440   1.00 0.00 ? 64  SER A HB3  2  
ATOM 2418  H HG   . SER A 1 64 ? 2.747   14.693  0.859   1.00 0.00 ? 64  SER A HG   2  
ATOM 2419  N N    . LEU A 1 65 ? 3.257   9.465   0.685   1.00 0.00 ? 65  LEU A N    2  
ATOM 2420  C CA   . LEU A 1 65 ? 4.130   8.304   0.526   1.00 0.00 ? 65  LEU A CA   2  
ATOM 2421  C C    . LEU A 1 65 ? 4.619   8.178   -0.918  1.00 0.00 ? 65  LEU A C    2  
ATOM 2422  O O    . LEU A 1 65 ? 4.852   7.071   -1.410  1.00 0.00 ? 65  LEU A O    2  
ATOM 2423  C CB   . LEU A 1 65 ? 3.401   7.026   0.948   1.00 0.00 ? 65  LEU A CB   2  
ATOM 2424  C CG   . LEU A 1 65 ? 3.398   6.744   2.451   1.00 0.00 ? 65  LEU A CG   2  
ATOM 2425  C CD1  . LEU A 1 65 ? 2.363   5.683   2.786   1.00 0.00 ? 65  LEU A CD1  2  
ATOM 2426  C CD2  . LEU A 1 65 ? 4.780   6.310   2.920   1.00 0.00 ? 65  LEU A CD2  2  
ATOM 2427  H H    . LEU A 1 65 ? 2.482   9.564   0.090   1.00 0.00 ? 65  LEU A H    2  
ATOM 2428  H HA   . LEU A 1 65 ? 4.987   8.446   1.167   1.00 0.00 ? 65  LEU A HA   2  
ATOM 2429  H HB2  . LEU A 1 65 ? 2.376   7.094   0.614   1.00 0.00 ? 65  LEU A HB2  2  
ATOM 2430  H HB3  . LEU A 1 65 ? 3.869   6.190   0.450   1.00 0.00 ? 65  LEU A HB3  2  
ATOM 2431  H HG   . LEU A 1 65 ? 3.133   7.648   2.981   1.00 0.00 ? 65  LEU A HG   2  
ATOM 2432  H HD11 . LEU A 1 65 ? 1.409   6.156   2.962   1.00 0.00 ? 65  LEU A HD11 2  
ATOM 2433  H HD12 . LEU A 1 65 ? 2.669   5.148   3.672   1.00 0.00 ? 65  LEU A HD12 2  
ATOM 2434  H HD13 . LEU A 1 65 ? 2.275   4.992   1.960   1.00 0.00 ? 65  LEU A HD13 2  
ATOM 2435  H HD21 . LEU A 1 65 ? 5.265   5.741   2.140   1.00 0.00 ? 65  LEU A HD21 2  
ATOM 2436  H HD22 . LEU A 1 65 ? 4.684   5.697   3.805   1.00 0.00 ? 65  LEU A HD22 2  
ATOM 2437  H HD23 . LEU A 1 65 ? 5.373   7.183   3.151   1.00 0.00 ? 65  LEU A HD23 2  
ATOM 2438  N N    . VAL A 1 66 ? 4.776   9.317   -1.594  1.00 0.00 ? 66  VAL A N    2  
ATOM 2439  C CA   . VAL A 1 66 ? 5.238   9.333   -2.975  1.00 0.00 ? 66  VAL A CA   2  
ATOM 2440  C C    . VAL A 1 66 ? 6.597   10.017  -3.087  1.00 0.00 ? 66  VAL A C    2  
ATOM 2441  O O    . VAL A 1 66 ? 6.694   11.247  -3.086  1.00 0.00 ? 66  VAL A O    2  
ATOM 2442  C CB   . VAL A 1 66 ? 4.215   10.029  -3.896  1.00 0.00 ? 66  VAL A CB   2  
ATOM 2443  C CG1  . VAL A 1 66 ? 4.785   10.240  -5.293  1.00 0.00 ? 66  VAL A CG1  2  
ATOM 2444  C CG2  . VAL A 1 66 ? 2.935   9.211   -3.953  1.00 0.00 ? 66  VAL A CG2  2  
ATOM 2445  H H    . VAL A 1 66 ? 4.577   10.168  -1.150  1.00 0.00 ? 66  VAL A H    2  
ATOM 2446  H HA   . VAL A 1 66 ? 5.341   8.307   -3.300  1.00 0.00 ? 66  VAL A HA   2  
ATOM 2447  H HB   . VAL A 1 66 ? 3.979   10.996  -3.476  1.00 0.00 ? 66  VAL A HB   2  
ATOM 2448  H HG11 . VAL A 1 66 ? 4.020   10.040  -6.028  1.00 0.00 ? 66  VAL A HG11 2  
ATOM 2449  H HG12 . VAL A 1 66 ? 5.617   9.570   -5.448  1.00 0.00 ? 66  VAL A HG12 2  
ATOM 2450  H HG13 . VAL A 1 66 ? 5.121   11.262  -5.393  1.00 0.00 ? 66  VAL A HG13 2  
ATOM 2451  H HG21 . VAL A 1 66 ? 2.471   9.333   -4.920  1.00 0.00 ? 66  VAL A HG21 2  
ATOM 2452  H HG22 . VAL A 1 66 ? 2.257   9.546   -3.182  1.00 0.00 ? 66  VAL A HG22 2  
ATOM 2453  H HG23 . VAL A 1 66 ? 3.171   8.168   -3.797  1.00 0.00 ? 66  VAL A HG23 2  
ATOM 2454  N N    . GLY A 1 67 ? 7.641   9.200   -3.174  1.00 0.00 ? 67  GLY A N    2  
ATOM 2455  C CA   . GLY A 1 67 ? 8.997   9.715   -3.276  1.00 0.00 ? 67  GLY A CA   2  
ATOM 2456  C C    . GLY A 1 67 ? 9.954   9.027   -2.319  1.00 0.00 ? 67  GLY A C    2  
ATOM 2457  O O    . GLY A 1 67 ? 11.134  8.865   -2.629  1.00 0.00 ? 67  GLY A O    2  
ATOM 2458  H H    . GLY A 1 67 ? 7.489   8.231   -3.162  1.00 0.00 ? 67  GLY A H    2  
ATOM 2459  H HA2  . GLY A 1 67 ? 9.350   9.570   -4.287  1.00 0.00 ? 67  GLY A HA2  2  
ATOM 2460  H HA3  . GLY A 1 67 ? 8.988   10.772  -3.059  1.00 0.00 ? 67  GLY A HA3  2  
ATOM 2461  N N    . LEU A 1 68 ? 9.444   8.616   -1.157  1.00 0.00 ? 68  LEU A N    2  
ATOM 2462  C CA   . LEU A 1 68 ? 10.262  7.932   -0.157  1.00 0.00 ? 68  LEU A CA   2  
ATOM 2463  C C    . LEU A 1 68 ? 10.717  6.568   -0.664  1.00 0.00 ? 68  LEU A C    2  
ATOM 2464  O O    . LEU A 1 68 ? 10.259  6.093   -1.707  1.00 0.00 ? 68  LEU A O    2  
ATOM 2465  C CB   . LEU A 1 68 ? 9.480   7.730   1.146   1.00 0.00 ? 68  LEU A CB   2  
ATOM 2466  C CG   . LEU A 1 68 ? 8.920   8.996   1.793   1.00 0.00 ? 68  LEU A CG   2  
ATOM 2467  C CD1  . LEU A 1 68 ? 7.978   8.628   2.931   1.00 0.00 ? 68  LEU A CD1  2  
ATOM 2468  C CD2  . LEU A 1 68 ? 10.049  9.884   2.295   1.00 0.00 ? 68  LEU A CD2  2  
ATOM 2469  H H    . LEU A 1 68 ? 8.493   8.769   -0.970  1.00 0.00 ? 68  LEU A H    2  
ATOM 2470  H HA   . LEU A 1 68 ? 11.130  8.542   0.042   1.00 0.00 ? 68  LEU A HA   2  
ATOM 2471  H HB2  . LEU A 1 68 ? 8.655   7.064   0.942   1.00 0.00 ? 68  LEU A HB2  2  
ATOM 2472  H HB3  . LEU A 1 68 ? 10.135  7.251   1.858   1.00 0.00 ? 68  LEU A HB3  2  
ATOM 2473  H HG   . LEU A 1 68 ? 8.355   9.550   1.057   1.00 0.00 ? 68  LEU A HG   2  
ATOM 2474  H HD11 . LEU A 1 68 ? 6.955   8.746   2.605   1.00 0.00 ? 68  LEU A HD11 2  
ATOM 2475  H HD12 . LEU A 1 68 ? 8.162   9.274   3.776   1.00 0.00 ? 68  LEU A HD12 2  
ATOM 2476  H HD13 . LEU A 1 68 ? 8.146   7.598   3.220   1.00 0.00 ? 68  LEU A HD13 2  
ATOM 2477  H HD21 . LEU A 1 68 ? 10.230  9.680   3.340   1.00 0.00 ? 68  LEU A HD21 2  
ATOM 2478  H HD22 . LEU A 1 68 ? 9.772   10.921  2.173   1.00 0.00 ? 68  LEU A HD22 2  
ATOM 2479  H HD23 . LEU A 1 68 ? 10.945  9.683   1.728   1.00 0.00 ? 68  LEU A HD23 2  
ATOM 2480  N N    . SER A 1 69 ? 11.600  5.931   0.097   1.00 0.00 ? 69  SER A N    2  
ATOM 2481  C CA   . SER A 1 69 ? 12.096  4.609   -0.253  1.00 0.00 ? 69  SER A CA   2  
ATOM 2482  C C    . SER A 1 69 ? 11.125  3.539   0.236   1.00 0.00 ? 69  SER A C    2  
ATOM 2483  O O    . SER A 1 69 ? 10.308  3.791   1.126   1.00 0.00 ? 69  SER A O    2  
ATOM 2484  C CB   . SER A 1 69 ? 13.485  4.378   0.351   1.00 0.00 ? 69  SER A CB   2  
ATOM 2485  O OG   . SER A 1 69 ? 14.504  4.777   -0.550  1.00 0.00 ? 69  SER A OG   2  
ATOM 2486  H H    . SER A 1 69 ? 11.910  6.352   0.926   1.00 0.00 ? 69  SER A H    2  
ATOM 2487  H HA   . SER A 1 69 ? 12.165  4.552   -1.331  1.00 0.00 ? 69  SER A HA   2  
ATOM 2488  H HB2  . SER A 1 69 ? 13.582  4.952   1.261   1.00 0.00 ? 69  SER A HB2  2  
ATOM 2489  H HB3  . SER A 1 69 ? 13.610  3.329   0.574   1.00 0.00 ? 69  SER A HB3  2  
ATOM 2490  H HG   . SER A 1 69 ? 14.390  5.703   -0.776  1.00 0.00 ? 69  SER A HG   2  
ATOM 2491  N N    . GLN A 1 70 ? 11.217  2.348   -0.347  1.00 0.00 ? 70  GLN A N    2  
ATOM 2492  C CA   . GLN A 1 70 ? 10.348  1.233   0.028   1.00 0.00 ? 70  GLN A CA   2  
ATOM 2493  C C    . GLN A 1 70 ? 10.368  1.000   1.541   1.00 0.00 ? 70  GLN A C    2  
ATOM 2494  O O    . GLN A 1 70 ? 9.360   0.603   2.128   1.00 0.00 ? 70  GLN A O    2  
ATOM 2495  C CB   . GLN A 1 70 ? 10.784  -0.036  -0.704  1.00 0.00 ? 70  GLN A CB   2  
ATOM 2496  C CG   . GLN A 1 70 ? 9.851   -1.215  -0.494  1.00 0.00 ? 70  GLN A CG   2  
ATOM 2497  C CD   . GLN A 1 70 ? 10.471  -2.528  -0.926  1.00 0.00 ? 70  GLN A CD   2  
ATOM 2498  O OE1  . GLN A 1 70 ? 11.266  -2.576  -1.867  1.00 0.00 ? 70  GLN A OE1  2  
ATOM 2499  N NE2  . GLN A 1 70 ? 10.111  -3.604  -0.240  1.00 0.00 ? 70  GLN A NE2  2  
ATOM 2500  H H    . GLN A 1 70 ? 11.890  2.213   -1.048  1.00 0.00 ? 70  GLN A H    2  
ATOM 2501  H HA   . GLN A 1 70 ? 9.340   1.483   -0.272  1.00 0.00 ? 70  GLN A HA   2  
ATOM 2502  H HB2  . GLN A 1 70 ? 10.833  0.171   -1.763  1.00 0.00 ? 70  GLN A HB2  2  
ATOM 2503  H HB3  . GLN A 1 70 ? 11.767  -0.318  -0.357  1.00 0.00 ? 70  GLN A HB3  2  
ATOM 2504  H HG2  . GLN A 1 70 ? 9.604   -1.280  0.556   1.00 0.00 ? 70  GLN A HG2  2  
ATOM 2505  H HG3  . GLN A 1 70 ? 8.949   -1.052  -1.065  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 2506  H HE21 . GLN A 1 70 ? 9.475   -3.492  0.495   1.00 0.00 ? 70  GLN A HE21 2  
ATOM 2507  H HE22 . GLN A 1 70 ? 10.498  -4.464  -0.493  1.00 0.00 ? 70  GLN A HE22 2  
ATOM 2508  N N    . GLU A 1 71 ? 11.522  1.250   2.164   1.00 0.00 ? 71  GLU A N    2  
ATOM 2509  C CA   . GLU A 1 71 ? 11.676  1.069   3.605   1.00 0.00 ? 71  GLU A CA   2  
ATOM 2510  C C    . GLU A 1 71 ? 10.706  1.964   4.377   1.00 0.00 ? 71  GLU A C    2  
ATOM 2511  O O    . GLU A 1 71 ? 9.925   1.479   5.198   1.00 0.00 ? 71  GLU A O    2  
ATOM 2512  C CB   . GLU A 1 71 ? 13.117  1.371   4.027   1.00 0.00 ? 71  GLU A CB   2  
ATOM 2513  C CG   . GLU A 1 71 ? 13.413  1.033   5.480   1.00 0.00 ? 71  GLU A CG   2  
ATOM 2514  C CD   . GLU A 1 71 ? 14.810  1.443   5.906   1.00 0.00 ? 71  GLU A CD   2  
ATOM 2515  O OE1  . GLU A 1 71 ? 15.079  2.662   5.972   1.00 0.00 ? 71  GLU A OE1  2  
ATOM 2516  O OE2  . GLU A 1 71 ? 15.635  0.545   6.175   1.00 0.00 ? 71  GLU A OE2  2  
ATOM 2517  H H    . GLU A 1 71 ? 12.288  1.563   1.640   1.00 0.00 ? 71  GLU A H    2  
ATOM 2518  H HA   . GLU A 1 71 ? 11.452  0.037   3.833   1.00 0.00 ? 71  GLU A HA   2  
ATOM 2519  H HB2  . GLU A 1 71 ? 13.789  0.798   3.404   1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2520  H HB3  . GLU A 1 71 ? 13.312  2.422   3.877   1.00 0.00 ? 71  GLU A HB3  2  
ATOM 2521  H HG2  . GLU A 1 71 ? 12.698  1.544   6.108   1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2522  H HG3  . GLU A 1 71 ? 13.309  -0.035  5.615   1.00 0.00 ? 71  GLU A HG3  2  
ATOM 2523  N N    . ARG A 1 72 ? 10.754  3.270   4.101   1.00 0.00 ? 72  ARG A N    2  
ATOM 2524  C CA   . ARG A 1 72 ? 9.874   4.228   4.769   1.00 0.00 ? 72  ARG A CA   2  
ATOM 2525  C C    . ARG A 1 72 ? 8.407   3.900   4.496   1.00 0.00 ? 72  ARG A C    2  
ATOM 2526  O O    . ARG A 1 72 ? 7.563   4.030   5.381   1.00 0.00 ? 72  ARG A O    2  
ATOM 2527  C CB   . ARG A 1 72 ? 10.181  5.660   4.310   1.00 0.00 ? 72  ARG A CB   2  
ATOM 2528  C CG   . ARG A 1 72 ? 11.547  6.168   4.746   1.00 0.00 ? 72  ARG A CG   2  
ATOM 2529  C CD   . ARG A 1 72 ? 11.586  6.448   6.241   1.00 0.00 ? 72  ARG A CD   2  
ATOM 2530  N NE   . ARG A 1 72 ? 12.317  7.675   6.552   1.00 0.00 ? 72  ARG A NE   2  
ATOM 2531  C CZ   . ARG A 1 72 ? 12.252  8.310   7.725   1.00 0.00 ? 72  ARG A CZ   2  
ATOM 2532  N NH1  . ARG A 1 72 ? 11.491  7.837   8.709   1.00 0.00 ? 72  ARG A NH1  2  
ATOM 2533  N NH2  . ARG A 1 72 ? 12.950  9.422   7.913   1.00 0.00 ? 72  ARG A NH2  2  
ATOM 2534  H H    . ARG A 1 72 ? 11.392  3.595   3.431   1.00 0.00 ? 72  ARG A H    2  
ATOM 2535  H HA   . ARG A 1 72 ? 10.053  4.150   5.832   1.00 0.00 ? 72  ARG A HA   2  
ATOM 2536  H HB2  . ARG A 1 72 ? 10.134  5.698   3.231   1.00 0.00 ? 72  ARG A HB2  2  
ATOM 2537  H HB3  . ARG A 1 72 ? 9.430   6.322   4.716   1.00 0.00 ? 72  ARG A HB3  2  
ATOM 2538  H HG2  . ARG A 1 72 ? 12.291  5.421   4.509   1.00 0.00 ? 72  ARG A HG2  2  
ATOM 2539  H HG3  . ARG A 1 72 ? 11.767  7.081   4.210   1.00 0.00 ? 72  ARG A HG3  2  
ATOM 2540  H HD2  . ARG A 1 72 ? 10.572  6.544   6.601   1.00 0.00 ? 72  ARG A HD2  2  
ATOM 2541  H HD3  . ARG A 1 72 ? 12.066  5.617   6.737   1.00 0.00 ? 72  ARG A HD3  2  
ATOM 2542  H HE   . ARG A 1 72 ? 12.890  8.049   5.849   1.00 0.00 ? 72  ARG A HE   2  
ATOM 2543  H HH11 . ARG A 1 72 ? 10.963  6.999   8.577   1.00 0.00 ? 72  ARG A HH11 2  
ATOM 2544  H HH12 . ARG A 1 72 ? 11.449  8.321   9.584   1.00 0.00 ? 72  ARG A HH12 2  
ATOM 2545  H HH21 . ARG A 1 72 ? 13.524  9.784   7.178   1.00 0.00 ? 72  ARG A HH21 2  
ATOM 2546  H HH22 . ARG A 1 72 ? 12.903  9.901   8.790   1.00 0.00 ? 72  ARG A HH22 2  
ATOM 2547  N N    . ALA A 1 73 ? 8.116   3.471   3.267   1.00 0.00 ? 73  ALA A N    2  
ATOM 2548  C CA   . ALA A 1 73 ? 6.753   3.117   2.877   1.00 0.00 ? 73  ALA A CA   2  
ATOM 2549  C C    . ALA A 1 73 ? 6.143   2.113   3.850   1.00 0.00 ? 73  ALA A C    2  
ATOM 2550  O O    . ALA A 1 73 ? 5.154   2.412   4.520   1.00 0.00 ? 73  ALA A O    2  
ATOM 2551  C CB   . ALA A 1 73 ? 6.735   2.560   1.463   1.00 0.00 ? 73  ALA A CB   2  
ATOM 2552  H H    . ALA A 1 73 ? 8.837   3.386   2.608   1.00 0.00 ? 73  ALA A H    2  
ATOM 2553  H HA   . ALA A 1 73 ? 6.161   4.021   2.891   1.00 0.00 ? 73  ALA A HA   2  
ATOM 2554  H HB1  . ALA A 1 73 ? 7.018   3.335   0.767   1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2555  H HB2  . ALA A 1 73 ? 5.741   2.209   1.228   1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2556  H HB3  . ALA A 1 73 ? 7.432   1.739   1.391   1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2557  N N    . ALA A 1 74 ? 6.747   0.926   3.938   1.00 0.00 ? 74  ALA A N    2  
ATOM 2558  C CA   . ALA A 1 74 ? 6.260   -0.102  4.852   1.00 0.00 ? 74  ALA A CA   2  
ATOM 2559  C C    . ALA A 1 74 ? 6.300   0.416   6.286   1.00 0.00 ? 74  ALA A C    2  
ATOM 2560  O O    . ALA A 1 74 ? 5.260   0.568   6.922   1.00 0.00 ? 74  ALA A O    2  
ATOM 2561  C CB   . ALA A 1 74 ? 7.077   -1.384  4.723   1.00 0.00 ? 74  ALA A CB   2  
ATOM 2562  H H    . ALA A 1 74 ? 7.541   0.747   3.389   1.00 0.00 ? 74  ALA A H    2  
ATOM 2563  H HA   . ALA A 1 74 ? 5.234   -0.321  4.588   1.00 0.00 ? 74  ALA A HA   2  
ATOM 2564  H HB1  . ALA A 1 74 ? 7.272   -1.586  3.680   1.00 0.00 ? 74  ALA A HB1  2  
ATOM 2565  H HB2  . ALA A 1 74 ? 6.524   -2.207  5.152   1.00 0.00 ? 74  ALA A HB2  2  
ATOM 2566  H HB3  . ALA A 1 74 ? 8.013   -1.268  5.248   1.00 0.00 ? 74  ALA A HB3  2  
ATOM 2567  N N    . GLU A 1 75 ? 7.515   0.696   6.775   1.00 0.00 ? 75  GLU A N    2  
ATOM 2568  C CA   . GLU A 1 75 ? 7.731   1.215   8.129   1.00 0.00 ? 75  GLU A CA   2  
ATOM 2569  C C    . GLU A 1 75 ? 6.617   2.181   8.561   1.00 0.00 ? 75  GLU A C    2  
ATOM 2570  O O    . GLU A 1 75 ? 6.166   2.140   9.705   1.00 0.00 ? 75  GLU A O    2  
ATOM 2571  C CB   . GLU A 1 75 ? 9.085   1.926   8.215   1.00 0.00 ? 75  GLU A CB   2  
ATOM 2572  C CG   . GLU A 1 75 ? 9.621   2.039   9.635   1.00 0.00 ? 75  GLU A CG   2  
ATOM 2573  C CD   . GLU A 1 75 ? 10.698  1.015   9.948   1.00 0.00 ? 75  GLU A CD   2  
ATOM 2574  O OE1  . GLU A 1 75 ? 10.550  -0.153  9.531   1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2575  O OE2  . GLU A 1 75 ? 11.687  1.382   10.618  1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2576  H H    . GLU A 1 75 ? 8.293   0.550   6.204   1.00 0.00 ? 75  GLU A H    2  
ATOM 2577  H HA   . GLU A 1 75 ? 7.741   0.373   8.803   1.00 0.00 ? 75  GLU A HA   2  
ATOM 2578  H HB2  . GLU A 1 75 ? 9.804   1.381   7.621   1.00 0.00 ? 75  GLU A HB2  2  
ATOM 2579  H HB3  . GLU A 1 75 ? 8.982   2.923   7.813   1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2580  H HG2  . GLU A 1 75 ? 10.036  3.025   9.770   1.00 0.00 ? 75  GLU A HG2  2  
ATOM 2581  H HG3  . GLU A 1 75 ? 8.801   1.898   10.324  1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2582  N N    . LEU A 1 76 ? 6.183   3.047   7.642   1.00 0.00 ? 76  LEU A N    2  
ATOM 2583  C CA   . LEU A 1 76 ? 5.129   4.019   7.939   1.00 0.00 ? 76  LEU A CA   2  
ATOM 2584  C C    . LEU A 1 76 ? 3.785   3.331   8.203   1.00 0.00 ? 76  LEU A C    2  
ATOM 2585  O O    . LEU A 1 76 ? 3.099   3.649   9.176   1.00 0.00 ? 76  LEU A O    2  
ATOM 2586  C CB   . LEU A 1 76 ? 4.996   5.026   6.788   1.00 0.00 ? 76  LEU A CB   2  
ATOM 2587  C CG   . LEU A 1 76 ? 5.710   6.367   7.002   1.00 0.00 ? 76  LEU A CG   2  
ATOM 2588  C CD1  . LEU A 1 76 ? 5.451   7.301   5.830   1.00 0.00 ? 76  LEU A CD1  2  
ATOM 2589  C CD2  . LEU A 1 76 ? 5.263   7.015   8.306   1.00 0.00 ? 76  LEU A CD2  2  
ATOM 2590  H H    . LEU A 1 76 ? 6.582   3.035   6.745   1.00 0.00 ? 76  LEU A H    2  
ATOM 2591  H HA   . LEU A 1 76 ? 5.422   4.551   8.833   1.00 0.00 ? 76  LEU A HA   2  
ATOM 2592  H HB2  . LEU A 1 76 ? 5.398   4.570   5.895   1.00 0.00 ? 76  LEU A HB2  2  
ATOM 2593  H HB3  . LEU A 1 76 ? 3.947   5.223   6.627   1.00 0.00 ? 76  LEU A HB3  2  
ATOM 2594  H HG   . LEU A 1 76 ? 6.776   6.195   7.061   1.00 0.00 ? 76  LEU A HG   2  
ATOM 2595  H HD11 . LEU A 1 76 ? 4.457   7.127   5.443   1.00 0.00 ? 76  LEU A HD11 2  
ATOM 2596  H HD12 . LEU A 1 76 ? 6.177   7.113   5.052   1.00 0.00 ? 76  LEU A HD12 2  
ATOM 2597  H HD13 . LEU A 1 76 ? 5.534   8.326   6.159   1.00 0.00 ? 76  LEU A HD13 2  
ATOM 2598  H HD21 . LEU A 1 76 ? 4.193   6.911   8.411   1.00 0.00 ? 76  LEU A HD21 2  
ATOM 2599  H HD22 . LEU A 1 76 ? 5.524   8.062   8.293   1.00 0.00 ? 76  LEU A HD22 2  
ATOM 2600  H HD23 . LEU A 1 76 ? 5.756   6.531   9.136   1.00 0.00 ? 76  LEU A HD23 2  
ATOM 2601  N N    . MET A 1 77 ? 3.413   2.391   7.335   1.00 0.00 ? 77  MET A N    2  
ATOM 2602  C CA   . MET A 1 77 ? 2.149   1.664   7.478   1.00 0.00 ? 77  MET A CA   2  
ATOM 2603  C C    . MET A 1 77 ? 2.214   0.615   8.588   1.00 0.00 ? 77  MET A C    2  
ATOM 2604  O O    . MET A 1 77 ? 1.201   0.316   9.217   1.00 0.00 ? 77  MET A O    2  
ATOM 2605  C CB   . MET A 1 77 ? 1.773   0.987   6.160   1.00 0.00 ? 77  MET A CB   2  
ATOM 2606  C CG   . MET A 1 77 ? 1.435   1.965   5.046   1.00 0.00 ? 77  MET A CG   2  
ATOM 2607  S SD   . MET A 1 77 ? 2.026   1.418   3.433   1.00 0.00 ? 77  MET A SD   2  
ATOM 2608  C CE   . MET A 1 77 ? 1.457   -0.279  3.421   1.00 0.00 ? 77  MET A CE   2  
ATOM 2609  H H    . MET A 1 77 ? 4.001   2.181   6.578   1.00 0.00 ? 77  MET A H    2  
ATOM 2610  H HA   . MET A 1 77 ? 1.383   2.383   7.729   1.00 0.00 ? 77  MET A HA   2  
ATOM 2611  H HB2  . MET A 1 77 ? 2.600   0.375   5.834   1.00 0.00 ? 77  MET A HB2  2  
ATOM 2612  H HB3  . MET A 1 77 ? 0.913   0.354   6.327   1.00 0.00 ? 77  MET A HB3  2  
ATOM 2613  H HG2  . MET A 1 77 ? 0.363   2.078   5.000   1.00 0.00 ? 77  MET A HG2  2  
ATOM 2614  H HG3  . MET A 1 77 ? 1.887   2.919   5.273   1.00 0.00 ? 77  MET A HG3  2  
ATOM 2615  H HE1  . MET A 1 77 ? 0.403   -0.306  3.655   1.00 0.00 ? 77  MET A HE1  2  
ATOM 2616  H HE2  . MET A 1 77 ? 2.004   -0.846  4.160   1.00 0.00 ? 77  MET A HE2  2  
ATOM 2617  H HE3  . MET A 1 77 ? 1.621   -0.708  2.444   1.00 0.00 ? 77  MET A HE3  2  
ATOM 2618  N N    . THR A 1 78 ? 3.399   0.054   8.823   1.00 0.00 ? 78  THR A N    2  
ATOM 2619  C CA   . THR A 1 78 ? 3.570   -0.961  9.860   1.00 0.00 ? 78  THR A CA   2  
ATOM 2620  C C    . THR A 1 78 ? 3.167   -0.406  11.227  1.00 0.00 ? 78  THR A C    2  
ATOM 2621  O O    . THR A 1 78 ? 2.663   -1.140  12.079  1.00 0.00 ? 78  THR A O    2  
ATOM 2622  C CB   . THR A 1 78 ? 5.021   -1.453  9.897   1.00 0.00 ? 78  THR A CB   2  
ATOM 2623  O OG1  . THR A 1 78 ? 5.691   -1.146  8.695   1.00 0.00 ? 78  THR A OG1  2  
ATOM 2624  C CG2  . THR A 1 78 ? 5.156   -2.940  10.095  1.00 0.00 ? 78  THR A CG2  2  
ATOM 2625  H H    . THR A 1 78 ? 4.176   0.325   8.290   1.00 0.00 ? 78  THR A H    2  
ATOM 2626  H HA   . THR A 1 78 ? 2.921   -1.792  9.619   1.00 0.00 ? 78  THR A HA   2  
ATOM 2627  H HB   . THR A 1 78 ? 5.534   -0.959  10.708  1.00 0.00 ? 78  THR A HB   2  
ATOM 2628  H HG1  . THR A 1 78 ? 6.035   -0.261  8.747   1.00 0.00 ? 78  THR A HG1  2  
ATOM 2629  H HG21 . THR A 1 78 ? 5.937   -3.311  9.444   1.00 0.00 ? 78  THR A HG21 2  
ATOM 2630  H HG22 . THR A 1 78 ? 4.222   -3.425  9.852   1.00 0.00 ? 78  THR A HG22 2  
ATOM 2631  H HG23 . THR A 1 78 ? 5.416   -3.147  11.122  1.00 0.00 ? 78  THR A HG23 2  
ATOM 2632  N N    . ARG A 1 79 ? 3.380   0.897   11.422  1.00 0.00 ? 79  ARG A N    2  
ATOM 2633  C CA   . ARG A 1 79 ? 3.032   1.558   12.676  1.00 0.00 ? 79  ARG A CA   2  
ATOM 2634  C C    . ARG A 1 79 ? 1.617   2.149   12.609  1.00 0.00 ? 79  ARG A C    2  
ATOM 2635  O O    . ARG A 1 79 ? 1.389   3.285   13.031  1.00 0.00 ? 79  ARG A O    2  
ATOM 2636  C CB   . ARG A 1 79 ? 4.050   2.662   12.987  1.00 0.00 ? 79  ARG A CB   2  
ATOM 2637  C CG   . ARG A 1 79 ? 5.489   2.175   13.002  1.00 0.00 ? 79  ARG A CG   2  
ATOM 2638  C CD   . ARG A 1 79 ? 6.379   3.068   13.853  1.00 0.00 ? 79  ARG A CD   2  
ATOM 2639  N NE   . ARG A 1 79 ? 7.781   2.654   13.791  1.00 0.00 ? 79  ARG A NE   2  
ATOM 2640  C CZ   . ARG A 1 79 ? 8.783   3.302   14.391  1.00 0.00 ? 79  ARG A CZ   2  
ATOM 2641  N NH1  . ARG A 1 79 ? 8.548   4.403   15.100  1.00 0.00 ? 79  ARG A NH1  2  
ATOM 2642  N NH2  . ARG A 1 79 ? 10.027  2.850   14.279  1.00 0.00 ? 79  ARG A NH2  2  
ATOM 2643  H H    . ARG A 1 79 ? 3.776   1.430   10.702  1.00 0.00 ? 79  ARG A H    2  
ATOM 2644  H HA   . ARG A 1 79 ? 3.069   0.818   13.463  1.00 0.00 ? 79  ARG A HA   2  
ATOM 2645  H HB2  . ARG A 1 79 ? 3.963   3.436   12.238  1.00 0.00 ? 79  ARG A HB2  2  
ATOM 2646  H HB3  . ARG A 1 79 ? 3.823   3.083   13.956  1.00 0.00 ? 79  ARG A HB3  2  
ATOM 2647  H HG2  . ARG A 1 79 ? 5.515   1.172   13.402  1.00 0.00 ? 79  ARG A HG2  2  
ATOM 2648  H HG3  . ARG A 1 79 ? 5.864   2.169   11.989  1.00 0.00 ? 79  ARG A HG3  2  
ATOM 2649  H HD2  . ARG A 1 79 ? 6.296   4.083   13.494  1.00 0.00 ? 79  ARG A HD2  2  
ATOM 2650  H HD3  . ARG A 1 79 ? 6.043   3.019   14.878  1.00 0.00 ? 79  ARG A HD3  2  
ATOM 2651  H HE   . ARG A 1 79 ? 7.988   1.845   13.276  1.00 0.00 ? 79  ARG A HE   2  
ATOM 2652  H HH11 . ARG A 1 79 ? 7.615   4.752   15.190  1.00 0.00 ? 79  ARG A HH11 2  
ATOM 2653  H HH12 . ARG A 1 79 ? 9.305   4.882   15.547  1.00 0.00 ? 79  ARG A HH12 2  
ATOM 2654  H HH21 . ARG A 1 79 ? 10.213  2.023   13.746  1.00 0.00 ? 79  ARG A HH21 2  
ATOM 2655  H HH22 . ARG A 1 79 ? 10.780  3.333   14.728  1.00 0.00 ? 79  ARG A HH22 2  
ATOM 2656  N N    . THR A 1 80 ? 0.670   1.372   12.076  1.00 0.00 ? 80  THR A N    2  
ATOM 2657  C CA   . THR A 1 80 ? -0.717  1.824   11.956  1.00 0.00 ? 80  THR A CA   2  
ATOM 2658  C C    . THR A 1 80 ? -1.465  1.659   13.279  1.00 0.00 ? 80  THR A C    2  
ATOM 2659  O O    . THR A 1 80 ? -1.041  0.897   14.150  1.00 0.00 ? 80  THR A O    2  
ATOM 2660  C CB   . THR A 1 80 ? -1.452  1.057   10.849  1.00 0.00 ? 80  THR A CB   2  
ATOM 2661  O OG1  . THR A 1 80 ? -0.866  -0.218  10.630  1.00 0.00 ? 80  THR A OG1  2  
ATOM 2662  C CG2  . THR A 1 80 ? -1.475  1.794   9.525   1.00 0.00 ? 80  THR A CG2  2  
ATOM 2663  H H    . THR A 1 80 ? 0.907   0.477   11.758  1.00 0.00 ? 80  THR A H    2  
ATOM 2664  H HA   . THR A 1 80 ? -0.698  2.873   11.700  1.00 0.00 ? 80  THR A HA   2  
ATOM 2665  H HB   . THR A 1 80 ? -2.478  0.904   11.156  1.00 0.00 ? 80  THR A HB   2  
ATOM 2666  H HG1  . THR A 1 80 ? -0.106  -0.129  10.043  1.00 0.00 ? 80  THR A HG1  2  
ATOM 2667  H HG21 . THR A 1 80 ? -0.489  2.177   9.311   1.00 0.00 ? 80  THR A HG21 2  
ATOM 2668  H HG22 . THR A 1 80 ? -2.176  2.615   9.583   1.00 0.00 ? 80  THR A HG22 2  
ATOM 2669  H HG23 . THR A 1 80 ? -1.778  1.117   8.741   1.00 0.00 ? 80  THR A HG23 2  
ATOM 2670  N N    . SER A 1 81 ? -2.580  2.376   13.419  1.00 0.00 ? 81  SER A N    2  
ATOM 2671  C CA   . SER A 1 81 ? -3.391  2.310   14.634  1.00 0.00 ? 81  SER A CA   2  
ATOM 2672  C C    . SER A 1 81 ? -4.641  1.457   14.414  1.00 0.00 ? 81  SER A C    2  
ATOM 2673  O O    . SER A 1 81 ? -4.726  0.708   13.439  1.00 0.00 ? 81  SER A O    2  
ATOM 2674  C CB   . SER A 1 81 ? -3.784  3.722   15.082  1.00 0.00 ? 81  SER A CB   2  
ATOM 2675  O OG   . SER A 1 81 ? -3.836  3.808   16.496  1.00 0.00 ? 81  SER A OG   2  
ATOM 2676  H H    . SER A 1 81 ? -2.867  2.962   12.687  1.00 0.00 ? 81  SER A H    2  
ATOM 2677  H HA   . SER A 1 81 ? -2.792  1.852   15.407  1.00 0.00 ? 81  SER A HA   2  
ATOM 2678  H HB2  . SER A 1 81 ? -3.054  4.429   14.717  1.00 0.00 ? 81  SER A HB2  2  
ATOM 2679  H HB3  . SER A 1 81 ? -4.756  3.969   14.681  1.00 0.00 ? 81  SER A HB3  2  
ATOM 2680  H HG   . SER A 1 81 ? -4.557  4.385   16.757  1.00 0.00 ? 81  SER A HG   2  
ATOM 2681  N N    . SER A 1 82 ? -5.610  1.574   15.327  1.00 0.00 ? 82  SER A N    2  
ATOM 2682  C CA   . SER A 1 82 ? -6.855  0.813   15.230  1.00 0.00 ? 82  SER A CA   2  
ATOM 2683  C C    . SER A 1 82 ? -7.479  0.951   13.840  1.00 0.00 ? 82  SER A C    2  
ATOM 2684  O O    . SER A 1 82 ? -7.942  -0.031  13.262  1.00 0.00 ? 82  SER A O    2  
ATOM 2685  C CB   . SER A 1 82 ? -7.847  1.275   16.302  1.00 0.00 ? 82  SER A CB   2  
ATOM 2686  O OG   . SER A 1 82 ? -8.323  2.582   16.031  1.00 0.00 ? 82  SER A OG   2  
ATOM 2687  H H    . SER A 1 82 ? -5.483  2.186   16.082  1.00 0.00 ? 82  SER A H    2  
ATOM 2688  H HA   . SER A 1 82 ? -6.617  -0.228  15.400  1.00 0.00 ? 82  SER A HA   2  
ATOM 2689  H HB2  . SER A 1 82 ? -8.687  0.597   16.327  1.00 0.00 ? 82  SER A HB2  2  
ATOM 2690  H HB3  . SER A 1 82 ? -7.357  1.275   17.265  1.00 0.00 ? 82  SER A HB3  2  
ATOM 2691  H HG   . SER A 1 82 ? -7.655  3.226   16.280  1.00 0.00 ? 82  SER A HG   2  
ATOM 2692  N N    . VAL A 1 83 ? -7.480  2.173   13.306  1.00 0.00 ? 83  VAL A N    2  
ATOM 2693  C CA   . VAL A 1 83 ? -8.037  2.426   11.981  1.00 0.00 ? 83  VAL A CA   2  
ATOM 2694  C C    . VAL A 1 83 ? -6.941  2.412   10.921  1.00 0.00 ? 83  VAL A C    2  
ATOM 2695  O O    . VAL A 1 83 ? -5.845  2.932   11.141  1.00 0.00 ? 83  VAL A O    2  
ATOM 2696  C CB   . VAL A 1 83 ? -8.780  3.777   11.912  1.00 0.00 ? 83  VAL A CB   2  
ATOM 2697  C CG1  . VAL A 1 83 ? -9.489  3.927   10.574  1.00 0.00 ? 83  VAL A CG1  2  
ATOM 2698  C CG2  . VAL A 1 83 ? -9.768  3.911   13.060  1.00 0.00 ? 83  VAL A CG2  2  
ATOM 2699  H H    . VAL A 1 83 ? -7.090  2.918   13.811  1.00 0.00 ? 83  VAL A H    2  
ATOM 2700  H HA   . VAL A 1 83 ? -8.744  1.638   11.762  1.00 0.00 ? 83  VAL A HA   2  
ATOM 2701  H HB   . VAL A 1 83 ? -8.051  4.570   11.997  1.00 0.00 ? 83  VAL A HB   2  
ATOM 2702  H HG11 . VAL A 1 83 ? -10.222 4.718   10.641  1.00 0.00 ? 83  VAL A HG11 2  
ATOM 2703  H HG12 . VAL A 1 83 ? -9.982  3.000   10.321  1.00 0.00 ? 83  VAL A HG12 2  
ATOM 2704  H HG13 . VAL A 1 83 ? -8.766  4.170   9.808   1.00 0.00 ? 83  VAL A HG13 2  
ATOM 2705  H HG21 . VAL A 1 83 ? -9.238  3.859   14.000  1.00 0.00 ? 83  VAL A HG21 2  
ATOM 2706  H HG22 . VAL A 1 83 ? -10.490 3.111   13.008  1.00 0.00 ? 83  VAL A HG22 2  
ATOM 2707  H HG23 . VAL A 1 83 ? -10.277 4.861   12.986  1.00 0.00 ? 83  VAL A HG23 2  
ATOM 2708  N N    . VAL A 1 84 ? -7.247  1.816   9.774   1.00 0.00 ? 84  VAL A N    2  
ATOM 2709  C CA   . VAL A 1 84 ? -6.295  1.733   8.674   1.00 0.00 ? 84  VAL A CA   2  
ATOM 2710  C C    . VAL A 1 84 ? -6.882  2.339   7.402   1.00 0.00 ? 84  VAL A C    2  
ATOM 2711  O O    . VAL A 1 84 ? -7.613  1.672   6.668   1.00 0.00 ? 84  VAL A O    2  
ATOM 2712  C CB   . VAL A 1 84 ? -5.876  0.274   8.396   1.00 0.00 ? 84  VAL A CB   2  
ATOM 2713  C CG1  . VAL A 1 84 ? -4.739  0.231   7.386   1.00 0.00 ? 84  VAL A CG1  2  
ATOM 2714  C CG2  . VAL A 1 84 ? -5.479  -0.430  9.688   1.00 0.00 ? 84  VAL A CG2  2  
ATOM 2715  H H    . VAL A 1 84 ? -8.138  1.421   9.663   1.00 0.00 ? 84  VAL A H    2  
ATOM 2716  H HA   . VAL A 1 84 ? -5.413  2.292   8.954   1.00 0.00 ? 84  VAL A HA   2  
ATOM 2717  H HB   . VAL A 1 84 ? -6.723  -0.248  7.972   1.00 0.00 ? 84  VAL A HB   2  
ATOM 2718  H HG11 . VAL A 1 84 ? -4.877  -0.610  6.722   1.00 0.00 ? 84  VAL A HG11 2  
ATOM 2719  H HG12 . VAL A 1 84 ? -3.798  0.130   7.905   1.00 0.00 ? 84  VAL A HG12 2  
ATOM 2720  H HG13 . VAL A 1 84 ? -4.735  1.146   6.811   1.00 0.00 ? 84  VAL A HG13 2  
ATOM 2721  H HG21 . VAL A 1 84 ? -5.062  0.290   10.377  1.00 0.00 ? 84  VAL A HG21 2  
ATOM 2722  H HG22 . VAL A 1 84 ? -4.745  -1.190  9.472   1.00 0.00 ? 84  VAL A HG22 2  
ATOM 2723  H HG23 . VAL A 1 84 ? -6.352  -0.887  10.131  1.00 0.00 ? 84  VAL A HG23 2  
ATOM 2724  N N    . THR A 1 85 ? -6.557  3.606   7.151   1.00 0.00 ? 85  THR A N    2  
ATOM 2725  C CA   . THR A 1 85 ? -7.052  4.306   5.967   1.00 0.00 ? 85  THR A CA   2  
ATOM 2726  C C    . THR A 1 85 ? -6.005  4.294   4.855   1.00 0.00 ? 85  THR A C    2  
ATOM 2727  O O    . THR A 1 85 ? -5.165  5.192   4.768   1.00 0.00 ? 85  THR A O    2  
ATOM 2728  C CB   . THR A 1 85 ? -7.439  5.748   6.316   1.00 0.00 ? 85  THR A CB   2  
ATOM 2729  O OG1  . THR A 1 85 ? -6.706  6.216   7.436   1.00 0.00 ? 85  THR A OG1  2  
ATOM 2730  C CG2  . THR A 1 85 ? -8.911  5.907   6.630   1.00 0.00 ? 85  THR A CG2  2  
ATOM 2731  H H    . THR A 1 85 ? -5.972  4.084   7.777   1.00 0.00 ? 85  THR A H    2  
ATOM 2732  H HA   . THR A 1 85 ? -7.930  3.783   5.619   1.00 0.00 ? 85  THR A HA   2  
ATOM 2733  H HB   . THR A 1 85 ? -7.211  6.386   5.472   1.00 0.00 ? 85  THR A HB   2  
ATOM 2734  H HG1  . THR A 1 85 ? -6.716  7.175   7.450   1.00 0.00 ? 85  THR A HG1  2  
ATOM 2735  H HG21 . THR A 1 85 ? -9.190  6.945   6.529   1.00 0.00 ? 85  THR A HG21 2  
ATOM 2736  H HG22 . THR A 1 85 ? -9.100  5.581   7.642   1.00 0.00 ? 85  THR A HG22 2  
ATOM 2737  H HG23 . THR A 1 85 ? -9.491  5.309   5.945   1.00 0.00 ? 85  THR A HG23 2  
ATOM 2738  N N    . LEU A 1 86 ? -6.063  3.267   4.010   1.00 0.00 ? 86  LEU A N    2  
ATOM 2739  C CA   . LEU A 1 86 ? -5.124  3.126   2.902   1.00 0.00 ? 86  LEU A CA   2  
ATOM 2740  C C    . LEU A 1 86 ? -5.846  3.214   1.560   1.00 0.00 ? 86  LEU A C    2  
ATOM 2741  O O    . LEU A 1 86 ? -6.829  2.507   1.329   1.00 0.00 ? 86  LEU A O    2  
ATOM 2742  C CB   . LEU A 1 86 ? -4.384  1.789   3.005   1.00 0.00 ? 86  LEU A CB   2  
ATOM 2743  C CG   . LEU A 1 86 ? -2.975  1.867   3.600   1.00 0.00 ? 86  LEU A CG   2  
ATOM 2744  C CD1  . LEU A 1 86 ? -2.942  1.238   4.986   1.00 0.00 ? 86  LEU A CD1  2  
ATOM 2745  C CD2  . LEU A 1 86 ? -1.972  1.189   2.678   1.00 0.00 ? 86  LEU A CD2  2  
ATOM 2746  H H    . LEU A 1 86 ? -6.756  2.584   4.136   1.00 0.00 ? 86  LEU A H    2  
ATOM 2747  H HA   . LEU A 1 86 ? -4.407  3.932   2.968   1.00 0.00 ? 86  LEU A HA   2  
ATOM 2748  H HB2  . LEU A 1 86 ? -4.974  1.120   3.615   1.00 0.00 ? 86  LEU A HB2  2  
ATOM 2749  H HB3  . LEU A 1 86 ? -4.307  1.367   2.013   1.00 0.00 ? 86  LEU A HB3  2  
ATOM 2750  H HG   . LEU A 1 86 ? -2.691  2.904   3.699   1.00 0.00 ? 86  LEU A HG   2  
ATOM 2751  H HD11 . LEU A 1 86 ? -3.666  0.438   5.037   1.00 0.00 ? 86  LEU A HD11 2  
ATOM 2752  H HD12 . LEU A 1 86 ? -3.182  1.986   5.727   1.00 0.00 ? 86  LEU A HD12 2  
ATOM 2753  H HD13 . LEU A 1 86 ? -1.955  0.844   5.180   1.00 0.00 ? 86  LEU A HD13 2  
ATOM 2754  H HD21 . LEU A 1 86 ? -1.170  0.768   3.265   1.00 0.00 ? 86  LEU A HD21 2  
ATOM 2755  H HD22 . LEU A 1 86 ? -1.570  1.915   1.988   1.00 0.00 ? 86  LEU A HD22 2  
ATOM 2756  H HD23 . LEU A 1 86 ? -2.465  0.402   2.126   1.00 0.00 ? 86  LEU A HD23 2  
ATOM 2757  N N    . GLU A 1 87 ? -5.348  4.075   0.674   1.00 0.00 ? 87  GLU A N    2  
ATOM 2758  C CA   . GLU A 1 87 ? -5.941  4.243   -0.651  1.00 0.00 ? 87  GLU A CA   2  
ATOM 2759  C C    . GLU A 1 87 ? -5.157  3.445   -1.693  1.00 0.00 ? 87  GLU A C    2  
ATOM 2760  O O    . GLU A 1 87 ? -4.005  3.767   -1.995  1.00 0.00 ? 87  GLU A O    2  
ATOM 2761  C CB   . GLU A 1 87 ? -5.977  5.724   -1.041  1.00 0.00 ? 87  GLU A CB   2  
ATOM 2762  C CG   . GLU A 1 87 ? -7.269  6.426   -0.681  1.00 0.00 ? 87  GLU A CG   2  
ATOM 2763  C CD   . GLU A 1 87 ? -7.207  7.923   -0.923  1.00 0.00 ? 87  GLU A CD   2  
ATOM 2764  O OE1  . GLU A 1 87 ? -6.743  8.650   -0.019  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 2765  O OE2  . GLU A 1 87 ? -7.620  8.365   -2.015  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 2766  H H    . GLU A 1 87 ? -4.558  4.605   0.914   1.00 0.00 ? 87  GLU A H    2  
ATOM 2767  H HA   . GLU A 1 87 ? -6.951  3.864   -0.610  1.00 0.00 ? 87  GLU A HA   2  
ATOM 2768  H HB2  . GLU A 1 87 ? -5.175  6.237   -0.541  1.00 0.00 ? 87  GLU A HB2  2  
ATOM 2769  H HB3  . GLU A 1 87 ? -5.840  5.806   -2.107  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 2770  H HG2  . GLU A 1 87 ? -8.067  6.014   -1.281  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 2771  H HG3  . GLU A 1 87 ? -7.478  6.254   0.362   1.00 0.00 ? 87  GLU A HG3  2  
ATOM 2772  N N    . VAL A 1 88 ? -5.785  2.400   -2.231  1.00 0.00 ? 88  VAL A N    2  
ATOM 2773  C CA   . VAL A 1 88 ? -5.147  1.546   -3.233  1.00 0.00 ? 88  VAL A CA   2  
ATOM 2774  C C    . VAL A 1 88 ? -5.539  1.957   -4.654  1.00 0.00 ? 88  VAL A C    2  
ATOM 2775  O O    . VAL A 1 88 ? -6.688  2.322   -4.908  1.00 0.00 ? 88  VAL A O    2  
ATOM 2776  C CB   . VAL A 1 88 ? -5.521  0.060   -3.024  1.00 0.00 ? 88  VAL A CB   2  
ATOM 2777  C CG1  . VAL A 1 88 ? -4.710  -0.838  -3.946  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 2778  C CG2  . VAL A 1 88 ? -5.326  -0.353  -1.572  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 2779  H H    . VAL A 1 88 ? -6.700  2.194   -1.944  1.00 0.00 ? 88  VAL A H    2  
ATOM 2780  H HA   . VAL A 1 88 ? -4.076  1.644   -3.121  1.00 0.00 ? 88  VAL A HA   2  
ATOM 2781  H HB   . VAL A 1 88 ? -6.566  -0.064  -3.271  1.00 0.00 ? 88  VAL A HB   2  
ATOM 2782  H HG11 . VAL A 1 88 ? -5.084  -1.849  -3.883  1.00 0.00 ? 88  VAL A HG11 2  
ATOM 2783  H HG12 . VAL A 1 88 ? -3.673  -0.818  -3.646  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 2784  H HG13 . VAL A 1 88 ? -4.797  -0.485  -4.963  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 2785  H HG21 . VAL A 1 88 ? -5.347  -1.430  -1.499  1.00 0.00 ? 88  VAL A HG21 2  
ATOM 2786  H HG22 . VAL A 1 88 ? -6.119  0.064   -0.968  1.00 0.00 ? 88  VAL A HG22 2  
ATOM 2787  H HG23 . VAL A 1 88 ? -4.373  0.012   -1.218  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 2788  N N    . ALA A 1 89 ? -4.580  1.877   -5.578  1.00 0.00 ? 89  ALA A N    2  
ATOM 2789  C CA   . ALA A 1 89 ? -4.825  2.223   -6.977  1.00 0.00 ? 89  ALA A CA   2  
ATOM 2790  C C    . ALA A 1 89 ? -4.920  0.962   -7.835  1.00 0.00 ? 89  ALA A C    2  
ATOM 2791  O O    . ALA A 1 89 ? -3.916  0.287   -8.071  1.00 0.00 ? 89  ALA A O    2  
ATOM 2792  C CB   . ALA A 1 89 ? -3.729  3.141   -7.504  1.00 0.00 ? 89  ALA A CB   2  
ATOM 2793  H H    . ALA A 1 89 ? -3.687  1.567   -5.314  1.00 0.00 ? 89  ALA A H    2  
ATOM 2794  H HA   . ALA A 1 89 ? -5.764  2.754   -7.030  1.00 0.00 ? 89  ALA A HA   2  
ATOM 2795  H HB1  . ALA A 1 89 ? -4.148  3.815   -8.236  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 2796  H HB2  . ALA A 1 89 ? -2.951  2.549   -7.964  1.00 0.00 ? 89  ALA A HB2  2  
ATOM 2797  H HB3  . ALA A 1 89 ? -3.312  3.711   -6.688  1.00 0.00 ? 89  ALA A HB3  2  
ATOM 2798  N N    . LYS A 1 90 ? -6.131  0.648   -8.294  1.00 0.00 ? 90  LYS A N    2  
ATOM 2799  C CA   . LYS A 1 90 ? -6.359  -0.537  -9.120  1.00 0.00 ? 90  LYS A CA   2  
ATOM 2800  C C    . LYS A 1 90 ? -5.763  -0.360  -10.514 1.00 0.00 ? 90  LYS A C    2  
ATOM 2801  O O    . LYS A 1 90 ? -5.942  0.680   -11.150 1.00 0.00 ? 90  LYS A O    2  
ATOM 2802  C CB   . LYS A 1 90 ? -7.857  -0.842  -9.223  1.00 0.00 ? 90  LYS A CB   2  
ATOM 2803  C CG   . LYS A 1 90 ? -8.540  -0.977  -7.870  1.00 0.00 ? 90  LYS A CG   2  
ATOM 2804  C CD   . LYS A 1 90 ? -9.796  -1.831  -7.952  1.00 0.00 ? 90  LYS A CD   2  
ATOM 2805  C CE   . LYS A 1 90 ? -11.013 -0.997  -8.317  1.00 0.00 ? 90  LYS A CE   2  
ATOM 2806  N NZ   . LYS A 1 90 ? -11.898 -1.695  -9.289  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 2807  H H    . LYS A 1 90 ? -6.891  1.226   -8.068  1.00 0.00 ? 90  LYS A H    2  
ATOM 2808  H HA   . LYS A 1 90 ? -5.867  -1.369  -8.639  1.00 0.00 ? 90  LYS A HA   2  
ATOM 2809  H HB2  . LYS A 1 90 ? -8.339  -0.045  -9.769  1.00 0.00 ? 90  LYS A HB2  2  
ATOM 2810  H HB3  . LYS A 1 90 ? -7.989  -1.769  -9.763  1.00 0.00 ? 90  LYS A HB3  2  
ATOM 2811  H HG2  . LYS A 1 90 ? -7.852  -1.436  -7.176  1.00 0.00 ? 90  LYS A HG2  2  
ATOM 2812  H HG3  . LYS A 1 90 ? -8.808  0.008   -7.514  1.00 0.00 ? 90  LYS A HG3  2  
ATOM 2813  H HD2  . LYS A 1 90 ? -9.654  -2.593  -8.704  1.00 0.00 ? 90  LYS A HD2  2  
ATOM 2814  H HD3  . LYS A 1 90 ? -9.965  -2.297  -6.992  1.00 0.00 ? 90  LYS A HD3  2  
ATOM 2815  H HE2  . LYS A 1 90 ? -11.574 -0.791  -7.418  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 2816  H HE3  . LYS A 1 90 ? -10.678 -0.067  -8.752  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 2817  H HZ1  . LYS A 1 90 ? -12.248 -2.585  -8.881  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 2818  H HZ2  . LYS A 1 90 ? -11.372 -1.909  -10.162 1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 2819  H HZ3  . LYS A 1 90 ? -12.711 -1.091  -9.529  1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 2820  N N    . GLN A 1 91 ? -5.051  -1.385  -10.977 1.00 0.00 ? 91  GLN A N    2  
ATOM 2821  C CA   . GLN A 1 91 ? -4.419  -1.355  -12.292 1.00 0.00 ? 91  GLN A CA   2  
ATOM 2822  C C    . GLN A 1 91 ? -5.317  -1.992  -13.352 1.00 0.00 ? 91  GLN A C    2  
ATOM 2823  O O    . GLN A 1 91 ? -6.379  -2.535  -13.039 1.00 0.00 ? 91  GLN A O    2  
ATOM 2824  C CB   . GLN A 1 91 ? -3.070  -2.079  -12.241 1.00 0.00 ? 91  GLN A CB   2  
ATOM 2825  C CG   . GLN A 1 91 ? -1.897  -1.150  -11.972 1.00 0.00 ? 91  GLN A CG   2  
ATOM 2826  C CD   . GLN A 1 91 ? -2.040  -0.401  -10.659 1.00 0.00 ? 91  GLN A CD   2  
ATOM 2827  O OE1  . GLN A 1 91 ? -2.443  0.763   -10.634 1.00 0.00 ? 91  GLN A OE1  2  
ATOM 2828  N NE2  . GLN A 1 91 ? -1.714  -1.069  -9.559  1.00 0.00 ? 91  GLN A NE2  2  
ATOM 2829  H H    . GLN A 1 91 ? -4.944  -2.183  -10.418 1.00 0.00 ? 91  GLN A H    2  
ATOM 2830  H HA   . GLN A 1 91 ? -4.251  -0.320  -12.554 1.00 0.00 ? 91  GLN A HA   2  
ATOM 2831  H HB2  . GLN A 1 91 ? -3.102  -2.821  -11.455 1.00 0.00 ? 91  GLN A HB2  2  
ATOM 2832  H HB3  . GLN A 1 91 ? -2.901  -2.576  -13.185 1.00 0.00 ? 91  GLN A HB3  2  
ATOM 2833  H HG2  . GLN A 1 91 ? -0.991  -1.736  -11.937 1.00 0.00 ? 91  GLN A HG2  2  
ATOM 2834  H HG3  . GLN A 1 91 ? -1.830  -0.431  -12.776 1.00 0.00 ? 91  GLN A HG3  2  
ATOM 2835  H HE21 . GLN A 1 91 ? -1.403  -1.994  -9.653  1.00 0.00 ? 91  GLN A HE21 2  
ATOM 2836  H HE22 . GLN A 1 91 ? -1.799  -0.610  -8.698  1.00 0.00 ? 91  GLN A HE22 2  
ATOM 2837  N N    . GLY A 1 92 ? -4.879  -1.917  -14.609 1.00 0.00 ? 92  GLY A N    2  
ATOM 2838  C CA   . GLY A 1 92 ? -5.644  -2.487  -15.708 1.00 0.00 ? 92  GLY A CA   2  
ATOM 2839  C C    . GLY A 1 92 ? -5.180  -3.865  -16.125 1.00 0.00 ? 92  GLY A C    2  
ATOM 2840  O O    . GLY A 1 92 ? -5.718  -4.461  -17.058 1.00 0.00 ? 92  GLY A O    2  
ATOM 2841  H H    . GLY A 1 92 ? -4.027  -1.470  -14.793 1.00 0.00 ? 92  GLY A H    2  
ATOM 2842  H HA2  . GLY A 1 92 ? -6.669  -2.554  -15.408 1.00 0.00 ? 92  GLY A HA2  2  
ATOM 2843  H HA3  . GLY A 1 92 ? -5.562  -1.834  -16.549 1.00 0.00 ? 92  GLY A HA3  2  
ATOM 2844  N N    . ALA A 1 93 ? -4.186  -4.357  -15.426 1.00 0.00 ? 93  ALA A N    2  
ATOM 2845  C CA   . ALA A 1 93 ? -3.620  -5.678  -15.690 1.00 0.00 ? 93  ALA A CA   2  
ATOM 2846  C C    . ALA A 1 93 ? -4.355  -6.762  -14.903 1.00 0.00 ? 93  ALA A C    2  
ATOM 2847  O O    . ALA A 1 93 ? -4.811  -6.472  -13.775 1.00 0.00 ? 93  ALA A O    2  
ATOM 2848  C CB   . ALA A 1 93 ? -2.135  -5.699  -15.356 1.00 0.00 ? 93  ALA A CB   2  
ATOM 2849  O OXT  . ALA A 1 93 ? -4.466  -7.894  -15.419 1.00 0.00 ? 93  ALA A OXT  2  
ATOM 2850  H H    . ALA A 1 93 ? -3.829  -3.814  -14.707 1.00 0.00 ? 93  ALA A H    2  
ATOM 2851  H HA   . ALA A 1 93 ? -3.730  -5.880  -16.745 1.00 0.00 ? 93  ALA A HA   2  
ATOM 2852  H HB1  . ALA A 1 93 ? -1.565  -5.437  -16.234 1.00 0.00 ? 93  ALA A HB1  2  
ATOM 2853  H HB2  . ALA A 1 93 ? -1.856  -6.689  -15.028 1.00 0.00 ? 93  ALA A HB2  2  
ATOM 2854  H HB3  . ALA A 1 93 ? -1.933  -4.989  -14.568 1.00 0.00 ? 93  ALA A HB3  2  
ATOM 2855  N N    . LEU B 2 1  ? 13.373  -2.315  -5.453  1.00 0.00 ? 99  LEU B N    2  
ATOM 2856  C CA   . LEU B 2 1  ? 12.620  -3.498  -5.955  1.00 0.00 ? 99  LEU B CA   2  
ATOM 2857  C C    . LEU B 2 1  ? 12.729  -4.687  -4.994  1.00 0.00 ? 99  LEU B C    2  
ATOM 2858  O O    . LEU B 2 1  ? 13.285  -5.731  -5.339  1.00 0.00 ? 99  LEU B O    2  
ATOM 2859  C CB   . LEU B 2 1  ? 13.162  -3.873  -7.341  1.00 0.00 ? 99  LEU B CB   2  
ATOM 2860  C CG   . LEU B 2 1  ? 12.657  -2.999  -8.493  1.00 0.00 ? 99  LEU B CG   2  
ATOM 2861  C CD1  . LEU B 2 1  ? 13.523  -3.189  -9.731  1.00 0.00 ? 99  LEU B CD1  2  
ATOM 2862  C CD2  . LEU B 2 1  ? 11.200  -3.316  -8.803  1.00 0.00 ? 99  LEU B CD2  2  
ATOM 2863  H H1   . LEU B 2 1  ? 14.331  -2.629  -5.201  1.00 0.00 ? 99  LEU B H1   2  
ATOM 2864  H H2   . LEU B 2 1  ? 12.867  -1.946  -4.622  1.00 0.00 ? 99  LEU B H2   2  
ATOM 2865  H H3   . LEU B 2 1  ? 13.401  -1.609  -6.217  1.00 0.00 ? 99  LEU B H3   2  
ATOM 2866  H HA   . LEU B 2 1  ? 11.579  -3.223  -6.047  1.00 0.00 ? 99  LEU B HA   2  
ATOM 2867  H HB2  . LEU B 2 1  ? 14.239  -3.808  -7.313  1.00 0.00 ? 99  LEU B HB2  2  
ATOM 2868  H HB3  . LEU B 2 1  ? 12.884  -4.895  -7.549  1.00 0.00 ? 99  LEU B HB3  2  
ATOM 2869  H HG   . LEU B 2 1  ? 12.718  -1.960  -8.202  1.00 0.00 ? 99  LEU B HG   2  
ATOM 2870  H HD11 . LEU B 2 1  ? 13.944  -4.184  -9.727  1.00 0.00 ? 99  LEU B HD11 2  
ATOM 2871  H HD12 . LEU B 2 1  ? 14.321  -2.461  -9.728  1.00 0.00 ? 99  LEU B HD12 2  
ATOM 2872  H HD13 . LEU B 2 1  ? 12.920  -3.057  -10.617 1.00 0.00 ? 99  LEU B HD13 2  
ATOM 2873  H HD21 . LEU B 2 1  ? 10.772  -2.511  -9.383  1.00 0.00 ? 99  LEU B HD21 2  
ATOM 2874  H HD22 . LEU B 2 1  ? 10.651  -3.424  -7.879  1.00 0.00 ? 99  LEU B HD22 2  
ATOM 2875  H HD23 . LEU B 2 1  ? 11.143  -4.235  -9.365  1.00 0.00 ? 99  LEU B HD23 2  
ATOM 2876  N N    . PHE B 2 2  ? 12.188  -4.517  -3.789  1.00 0.00 ? 100 PHE B N    2  
ATOM 2877  C CA   . PHE B 2 2  ? 12.210  -5.566  -2.771  1.00 0.00 ? 100 PHE B CA   2  
ATOM 2878  C C    . PHE B 2 2  ? 10.784  -5.920  -2.342  1.00 0.00 ? 100 PHE B C    2  
ATOM 2879  O O    . PHE B 2 2  ? 9.819   -5.409  -2.910  1.00 0.00 ? 100 PHE B O    2  
ATOM 2880  C CB   . PHE B 2 2  ? 13.032  -5.105  -1.561  1.00 0.00 ? 100 PHE B CB   2  
ATOM 2881  C CG   . PHE B 2 2  ? 14.314  -5.868  -1.368  1.00 0.00 ? 100 PHE B CG   2  
ATOM 2882  C CD1  . PHE B 2 2  ? 15.279  -5.901  -2.365  1.00 0.00 ? 100 PHE B CD1  2  
ATOM 2883  C CD2  . PHE B 2 2  ? 14.557  -6.546  -0.185  1.00 0.00 ? 100 PHE B CD2  2  
ATOM 2884  C CE1  . PHE B 2 2  ? 16.459  -6.598  -2.183  1.00 0.00 ? 100 PHE B CE1  2  
ATOM 2885  C CE2  . PHE B 2 2  ? 15.735  -7.243  0.003   1.00 0.00 ? 100 PHE B CE2  2  
ATOM 2886  C CZ   . PHE B 2 2  ? 16.687  -7.269  -0.997  1.00 0.00 ? 100 PHE B CZ   2  
ATOM 2887  H H    . PHE B 2 2  ? 11.756  -3.662  -3.575  1.00 0.00 ? 100 PHE B H    2  
ATOM 2888  H HA   . PHE B 2 2  ? 12.673  -6.443  -3.202  1.00 0.00 ? 100 PHE B HA   2  
ATOM 2889  H HB2  . PHE B 2 2  ? 13.284  -4.062  -1.685  1.00 0.00 ? 100 PHE B HB2  2  
ATOM 2890  H HB3  . PHE B 2 2  ? 12.438  -5.220  -0.665  1.00 0.00 ? 100 PHE B HB3  2  
ATOM 2891  H HD1  . PHE B 2 2  ? 15.102  -5.377  -3.292  1.00 0.00 ? 100 PHE B HD1  2  
ATOM 2892  H HD2  . PHE B 2 2  ? 13.813  -6.528  0.597   1.00 0.00 ? 100 PHE B HD2  2  
ATOM 2893  H HE1  . PHE B 2 2  ? 17.203  -6.617  -2.966  1.00 0.00 ? 100 PHE B HE1  2  
ATOM 2894  H HE2  . PHE B 2 2  ? 15.911  -7.767  0.931   1.00 0.00 ? 100 PHE B HE2  2  
ATOM 2895  H HZ   . PHE B 2 2  ? 17.609  -7.813  -0.852  1.00 0.00 ? 100 PHE B HZ   2  
ATOM 2896  N N    . SER B 2 3  ? 10.648  -6.792  -1.341  1.00 0.00 ? 101 SER B N    2  
ATOM 2897  C CA   . SER B 2 3  ? 9.325   -7.193  -0.862  1.00 0.00 ? 101 SER B CA   2  
ATOM 2898  C C    . SER B 2 3  ? 9.274   -7.281  0.664   1.00 0.00 ? 101 SER B C    2  
ATOM 2899  O O    . SER B 2 3  ? 9.750   -8.252  1.257   1.00 0.00 ? 101 SER B O    2  
ATOM 2900  C CB   . SER B 2 3  ? 8.921   -8.534  -1.479  1.00 0.00 ? 101 SER B CB   2  
ATOM 2901  O OG   . SER B 2 3  ? 9.919   -9.518  -1.272  1.00 0.00 ? 101 SER B OG   2  
ATOM 2902  H H    . SER B 2 3  ? 11.447  -7.172  -0.919  1.00 0.00 ? 101 SER B H    2  
ATOM 2903  H HA   . SER B 2 3  ? 8.621   -6.440  -1.182  1.00 0.00 ? 101 SER B HA   2  
ATOM 2904  H HB2  . SER B 2 3  ? 8.000   -8.873  -1.029  1.00 0.00 ? 101 SER B HB2  2  
ATOM 2905  H HB3  . SER B 2 3  ? 8.777   -8.406  -2.541  1.00 0.00 ? 101 SER B HB3  2  
ATOM 2906  H HG   . SER B 2 3  ? 9.574   -10.380 -1.516  1.00 0.00 ? 101 SER B HG   2  
ATOM 2907  N N    . THR B 2 4  ? 8.678   -6.266  1.292   1.00 0.00 ? 102 THR B N    2  
ATOM 2908  C CA   . THR B 2 4  ? 8.545   -6.235  2.748   1.00 0.00 ? 102 THR B CA   2  
ATOM 2909  C C    . THR B 2 4  ? 7.188   -6.798  3.169   1.00 0.00 ? 102 THR B C    2  
ATOM 2910  O O    . THR B 2 4  ? 6.433   -7.307  2.338   1.00 0.00 ? 102 THR B O    2  
ATOM 2911  C CB   . THR B 2 4  ? 8.702   -4.805  3.282   1.00 0.00 ? 102 THR B CB   2  
ATOM 2912  O OG1  . THR B 2 4  ? 7.612   -3.995  2.880   1.00 0.00 ? 102 THR B OG1  2  
ATOM 2913  C CG2  . THR B 2 4  ? 9.974   -4.119  2.828   1.00 0.00 ? 102 THR B CG2  2  
ATOM 2914  H H    . THR B 2 4  ? 8.306   -5.528  0.764   1.00 0.00 ? 102 THR B H    2  
ATOM 2915  H HA   . THR B 2 4  ? 9.324   -6.856  3.166   1.00 0.00 ? 102 THR B HA   2  
ATOM 2916  H HB   . THR B 2 4  ? 8.715   -4.837  4.362   1.00 0.00 ? 102 THR B HB   2  
ATOM 2917  H HG1  . THR B 2 4  ? 6.920   -4.033  3.546   1.00 0.00 ? 102 THR B HG1  2  
ATOM 2918  H HG21 . THR B 2 4  ? 9.738   -3.133  2.457   1.00 0.00 ? 102 THR B HG21 2  
ATOM 2919  H HG22 . THR B 2 4  ? 10.436  -4.698  2.042   1.00 0.00 ? 102 THR B HG22 2  
ATOM 2920  H HG23 . THR B 2 4  ? 10.655  -4.037  3.662   1.00 0.00 ? 102 THR B HG23 2  
ATOM 2921  N N    . GLU B 2 5  ? 6.880   -6.697  4.460   1.00 0.00 ? 103 GLU B N    2  
ATOM 2922  C CA   . GLU B 2 5  ? 5.611   -7.190  4.985   1.00 0.00 ? 103 GLU B CA   2  
ATOM 2923  C C    . GLU B 2 5  ? 5.060   -6.243  6.052   1.00 0.00 ? 103 GLU B C    2  
ATOM 2924  O O    . GLU B 2 5  ? 5.513   -6.250  7.200   1.00 0.00 ? 103 GLU B O    2  
ATOM 2925  C CB   . GLU B 2 5  ? 5.775   -8.604  5.554   1.00 0.00 ? 103 GLU B CB   2  
ATOM 2926  C CG   . GLU B 2 5  ? 7.038   -8.796  6.382   1.00 0.00 ? 103 GLU B CG   2  
ATOM 2927  C CD   . GLU B 2 5  ? 6.973   -10.022 7.274   1.00 0.00 ? 103 GLU B CD   2  
ATOM 2928  O OE1  . GLU B 2 5  ? 6.090   -10.071 8.157   1.00 0.00 ? 103 GLU B OE1  2  
ATOM 2929  O OE2  . GLU B 2 5  ? 7.807   -10.933 7.091   1.00 0.00 ? 103 GLU B OE2  2  
ATOM 2930  H H    . GLU B 2 5  ? 7.517   -6.277  5.074   1.00 0.00 ? 103 GLU B H    2  
ATOM 2931  H HA   . GLU B 2 5  ? 4.911   -7.225  4.165   1.00 0.00 ? 103 GLU B HA   2  
ATOM 2932  H HB2  . GLU B 2 5  ? 4.924   -8.828  6.180   1.00 0.00 ? 103 GLU B HB2  2  
ATOM 2933  H HB3  . GLU B 2 5  ? 5.799   -9.307  4.734   1.00 0.00 ? 103 GLU B HB3  2  
ATOM 2934  H HG2  . GLU B 2 5  ? 7.878   -8.903  5.713   1.00 0.00 ? 103 GLU B HG2  2  
ATOM 2935  H HG3  . GLU B 2 5  ? 7.182   -7.925  7.003   1.00 0.00 ? 103 GLU B HG3  2  
ATOM 2936  N N    . VAL B 2 6  ? 4.082   -5.425  5.660   1.00 0.00 ? 104 VAL B N    2  
ATOM 2937  C CA   . VAL B 2 6  ? 3.464   -4.465  6.573   1.00 0.00 ? 104 VAL B CA   2  
ATOM 2938  C C    . VAL B 2 6  ? 2.253   -5.072  7.287   1.00 0.00 ? 104 VAL B C    2  
ATOM 2939  O O    . VAL B 2 6  ? 2.047   -4.748  8.475   1.00 0.00 ? 104 VAL B O    2  
ATOM 2940  C CB   . VAL B 2 6  ? 3.038   -3.177  5.827   1.00 0.00 ? 104 VAL B CB   2  
ATOM 2941  C CG1  . VAL B 2 6  ? 1.896   -3.463  4.861   1.00 0.00 ? 104 VAL B CG1  2  
ATOM 2942  C CG2  . VAL B 2 6  ? 2.648   -2.084  6.812   1.00 0.00 ? 104 VAL B CG2  2  
ATOM 2943  O OXT  . VAL B 2 6  ? 1.521   -5.867  6.653   1.00 0.00 ? 104 VAL B OXT  2  
ATOM 2944  H H    . VAL B 2 6  ? 3.770   -5.467  4.732   1.00 0.00 ? 104 VAL B H    2  
ATOM 2945  H HA   . VAL B 2 6  ? 4.203   -4.195  7.314   1.00 0.00 ? 104 VAL B HA   2  
ATOM 2946  H HB   . VAL B 2 6  ? 3.883   -2.826  5.252   1.00 0.00 ? 104 VAL B HB   2  
ATOM 2947  H HG11 . VAL B 2 6  ? 0.964   -3.136  5.300   1.00 0.00 ? 104 VAL B HG11 2  
ATOM 2948  H HG12 . VAL B 2 6  ? 1.850   -4.523  4.665   1.00 0.00 ? 104 VAL B HG12 2  
ATOM 2949  H HG13 . VAL B 2 6  ? 2.065   -2.935  3.935   1.00 0.00 ? 104 VAL B HG13 2  
ATOM 2950  H HG21 . VAL B 2 6  ? 3.477   -1.405  6.944   1.00 0.00 ? 104 VAL B HG21 2  
ATOM 2951  H HG22 . VAL B 2 6  ? 2.394   -2.530  7.762   1.00 0.00 ? 104 VAL B HG22 2  
ATOM 2952  H HG23 . VAL B 2 6  ? 1.796   -1.541  6.431   1.00 0.00 ? 104 VAL B HG23 2  
ATOM 2953  N N    . MET A 1 1  ? -9.517  6.258   -21.976 1.00 0.00 ? 1   MET A N    3  
ATOM 2954  C CA   . MET A 1 1  ? -9.565  6.160   -20.491 1.00 0.00 ? 1   MET A CA   3  
ATOM 2955  C C    . MET A 1 1  ? -8.160  6.026   -19.900 1.00 0.00 ? 1   MET A C    3  
ATOM 2956  O O    . MET A 1 1  ? -7.660  4.915   -19.710 1.00 0.00 ? 1   MET A O    3  
ATOM 2957  C CB   . MET A 1 1  ? -10.425 4.949   -20.105 1.00 0.00 ? 1   MET A CB   3  
ATOM 2958  C CG   . MET A 1 1  ? -11.914 5.253   -20.022 1.00 0.00 ? 1   MET A CG   3  
ATOM 2959  S SD   . MET A 1 1  ? -12.935 3.907   -20.654 1.00 0.00 ? 1   MET A SD   3  
ATOM 2960  C CE   . MET A 1 1  ? -13.604 3.247   -19.128 1.00 0.00 ? 1   MET A CE   3  
ATOM 2961  H H1   . MET A 1 1  ? -9.082  7.170   -22.219 1.00 0.00 ? 1   MET A H1   3  
ATOM 2962  H H2   . MET A 1 1  ? -10.495 6.202   -22.330 1.00 0.00 ? 1   MET A H2   3  
ATOM 2963  H H3   . MET A 1 1  ? -8.943  5.466   -22.330 1.00 0.00 ? 1   MET A H3   3  
ATOM 2964  H HA   . MET A 1 1  ? -10.022 7.059   -20.104 1.00 0.00 ? 1   MET A HA   3  
ATOM 2965  H HB2  . MET A 1 1  ? -10.279 4.170   -20.839 1.00 0.00 ? 1   MET A HB2  3  
ATOM 2966  H HB3  . MET A 1 1  ? -10.100 4.586   -19.141 1.00 0.00 ? 1   MET A HB3  3  
ATOM 2967  H HG2  . MET A 1 1  ? -12.175 5.425   -18.988 1.00 0.00 ? 1   MET A HG2  3  
ATOM 2968  H HG3  . MET A 1 1  ? -12.122 6.144   -20.597 1.00 0.00 ? 1   MET A HG3  3  
ATOM 2969  H HE1  . MET A 1 1  ? -13.154 2.287   -18.923 1.00 0.00 ? 1   MET A HE1  3  
ATOM 2970  H HE2  . MET A 1 1  ? -14.673 3.132   -19.224 1.00 0.00 ? 1   MET A HE2  3  
ATOM 2971  H HE3  . MET A 1 1  ? -13.386 3.927   -18.317 1.00 0.00 ? 1   MET A HE3  3  
ATOM 2972  N N    . LYS A 1 2  ? -7.530  7.165   -19.610 1.00 0.00 ? 2   LYS A N    3  
ATOM 2973  C CA   . LYS A 1 2  ? -6.185  7.177   -19.036 1.00 0.00 ? 2   LYS A CA   3  
ATOM 2974  C C    . LYS A 1 2  ? -6.216  7.652   -17.579 1.00 0.00 ? 2   LYS A C    3  
ATOM 2975  O O    . LYS A 1 2  ? -5.282  8.306   -17.109 1.00 0.00 ? 2   LYS A O    3  
ATOM 2976  C CB   . LYS A 1 2  ? -5.264  8.076   -19.866 1.00 0.00 ? 2   LYS A CB   3  
ATOM 2977  C CG   . LYS A 1 2  ? -3.969  7.397   -20.278 1.00 0.00 ? 2   LYS A CG   3  
ATOM 2978  C CD   . LYS A 1 2  ? -2.898  8.411   -20.646 1.00 0.00 ? 2   LYS A CD   3  
ATOM 2979  C CE   . LYS A 1 2  ? -3.082  8.935   -22.064 1.00 0.00 ? 2   LYS A CE   3  
ATOM 2980  N NZ   . LYS A 1 2  ? -4.042  10.077  -22.128 1.00 0.00 ? 2   LYS A NZ   3  
ATOM 2981  H H    . LYS A 1 2  ? -7.981  8.018   -19.784 1.00 0.00 ? 2   LYS A H    3  
ATOM 2982  H HA   . LYS A 1 2  ? -5.805  6.166   -19.063 1.00 0.00 ? 2   LYS A HA   3  
ATOM 2983  H HB2  . LYS A 1 2  ? -5.785  8.381   -20.761 1.00 0.00 ? 2   LYS A HB2  3  
ATOM 2984  H HB3  . LYS A 1 2  ? -5.016  8.954   -19.288 1.00 0.00 ? 2   LYS A HB3  3  
ATOM 2985  H HG2  . LYS A 1 2  ? -3.612  6.796   -19.454 1.00 0.00 ? 2   LYS A HG2  3  
ATOM 2986  H HG3  . LYS A 1 2  ? -4.162  6.762   -21.131 1.00 0.00 ? 2   LYS A HG3  3  
ATOM 2987  H HD2  . LYS A 1 2  ? -2.949  9.240   -19.955 1.00 0.00 ? 2   LYS A HD2  3  
ATOM 2988  H HD3  . LYS A 1 2  ? -1.930  7.937   -20.570 1.00 0.00 ? 2   LYS A HD3  3  
ATOM 2989  H HE2  . LYS A 1 2  ? -2.124  9.264   -22.438 1.00 0.00 ? 2   LYS A HE2  3  
ATOM 2990  H HE3  . LYS A 1 2  ? -3.451  8.131   -22.685 1.00 0.00 ? 2   LYS A HE3  3  
ATOM 2991  H HZ1  . LYS A 1 2  ? -4.026  10.611  -21.235 1.00 0.00 ? 2   LYS A HZ1  3  
ATOM 2992  H HZ2  . LYS A 1 2  ? -5.007  9.726   -22.291 1.00 0.00 ? 2   LYS A HZ2  3  
ATOM 2993  H HZ3  . LYS A 1 2  ? -3.784  10.717  -22.907 1.00 0.00 ? 2   LYS A HZ3  3  
ATOM 2994  N N    . GLU A 1 3  ? -7.295  7.316   -16.868 1.00 0.00 ? 3   GLU A N    3  
ATOM 2995  C CA   . GLU A 1 3  ? -7.450  7.705   -15.472 1.00 0.00 ? 3   GLU A CA   3  
ATOM 2996  C C    . GLU A 1 3  ? -7.910  6.521   -14.630 1.00 0.00 ? 3   GLU A C    3  
ATOM 2997  O O    . GLU A 1 3  ? -9.103  6.203   -14.598 1.00 0.00 ? 3   GLU A O    3  
ATOM 2998  C CB   . GLU A 1 3  ? -8.457  8.852   -15.349 1.00 0.00 ? 3   GLU A CB   3  
ATOM 2999  C CG   . GLU A 1 3  ? -7.902  10.200  -15.785 1.00 0.00 ? 3   GLU A CG   3  
ATOM 3000  C CD   . GLU A 1 3  ? -8.973  11.163  -16.268 1.00 0.00 ? 3   GLU A CD   3  
ATOM 3001  O OE1  . GLU A 1 3  ? -9.961  10.704  -16.883 1.00 0.00 ? 3   GLU A OE1  3  
ATOM 3002  O OE2  . GLU A 1 3  ? -8.821  12.381  -16.036 1.00 0.00 ? 3   GLU A OE2  3  
ATOM 3003  H H    . GLU A 1 3  ? -8.004  6.794   -17.294 1.00 0.00 ? 3   GLU A H    3  
ATOM 3004  H HA   . GLU A 1 3  ? -6.490  8.040   -15.107 1.00 0.00 ? 3   GLU A HA   3  
ATOM 3005  H HB2  . GLU A 1 3  ? -9.318  8.624   -15.961 1.00 0.00 ? 3   GLU A HB2  3  
ATOM 3006  H HB3  . GLU A 1 3  ? -8.770  8.932   -14.319 1.00 0.00 ? 3   GLU A HB3  3  
ATOM 3007  H HG2  . GLU A 1 3  ? -7.393  10.650  -14.947 1.00 0.00 ? 3   GLU A HG2  3  
ATOM 3008  H HG3  . GLU A 1 3  ? -7.196  10.038  -16.587 1.00 0.00 ? 3   GLU A HG3  3  
ATOM 3009  N N    . PRO A 1 4  ? -6.962  5.843   -13.944 1.00 0.00 ? 4   PRO A N    3  
ATOM 3010  C CA   . PRO A 1 4  ? -7.263  4.677   -13.096 1.00 0.00 ? 4   PRO A CA   3  
ATOM 3011  C C    . PRO A 1 4  ? -8.266  4.996   -11.980 1.00 0.00 ? 4   PRO A C    3  
ATOM 3012  O O    . PRO A 1 4  ? -8.758  6.120   -11.872 1.00 0.00 ? 4   PRO A O    3  
ATOM 3013  C CB   . PRO A 1 4  ? -5.897  4.304   -12.499 1.00 0.00 ? 4   PRO A CB   3  
ATOM 3014  C CG   . PRO A 1 4  ? -4.898  4.884   -13.438 1.00 0.00 ? 4   PRO A CG   3  
ATOM 3015  C CD   . PRO A 1 4  ? -5.517  6.150   -13.955 1.00 0.00 ? 4   PRO A CD   3  
ATOM 3016  H HA   . PRO A 1 4  ? -7.637  3.853   -13.684 1.00 0.00 ? 4   PRO A HA   3  
ATOM 3017  H HB2  . PRO A 1 4  ? -5.803  4.732   -11.513 1.00 0.00 ? 4   PRO A HB2  3  
ATOM 3018  H HB3  . PRO A 1 4  ? -5.805  3.230   -12.442 1.00 0.00 ? 4   PRO A HB3  3  
ATOM 3019  H HG2  . PRO A 1 4  ? -3.981  5.102   -12.910 1.00 0.00 ? 4   PRO A HG2  3  
ATOM 3020  H HG3  . PRO A 1 4  ? -4.712  4.197   -14.250 1.00 0.00 ? 4   PRO A HG3  3  
ATOM 3021  H HD2  . PRO A 1 4  ? -5.291  6.977   -13.297 1.00 0.00 ? 4   PRO A HD2  3  
ATOM 3022  H HD3  . PRO A 1 4  ? -5.175  6.356   -14.958 1.00 0.00 ? 4   PRO A HD3  3  
ATOM 3023  N N    . GLU A 1 5  ? -8.564  3.994   -11.152 1.00 0.00 ? 5   GLU A N    3  
ATOM 3024  C CA   . GLU A 1 5  ? -9.509  4.160   -10.052 1.00 0.00 ? 5   GLU A CA   3  
ATOM 3025  C C    . GLU A 1 5  ? -8.822  3.974   -8.705  1.00 0.00 ? 5   GLU A C    3  
ATOM 3026  O O    . GLU A 1 5  ? -8.709  2.855   -8.198  1.00 0.00 ? 5   GLU A O    3  
ATOM 3027  C CB   . GLU A 1 5  ? -10.667 3.173   -10.194 1.00 0.00 ? 5   GLU A CB   3  
ATOM 3028  C CG   . GLU A 1 5  ? -11.793 3.404   -9.198  1.00 0.00 ? 5   GLU A CG   3  
ATOM 3029  C CD   . GLU A 1 5  ? -13.093 2.755   -9.630  1.00 0.00 ? 5   GLU A CD   3  
ATOM 3030  O OE1  . GLU A 1 5  ? -13.842 3.385   -10.406 1.00 0.00 ? 5   GLU A OE1  3  
ATOM 3031  O OE2  . GLU A 1 5  ? -13.362 1.616   -9.194  1.00 0.00 ? 5   GLU A OE2  3  
ATOM 3032  H H    . GLU A 1 5  ? -8.138  3.124   -11.284 1.00 0.00 ? 5   GLU A H    3  
ATOM 3033  H HA   . GLU A 1 5  ? -9.900  5.166   -10.103 1.00 0.00 ? 5   GLU A HA   3  
ATOM 3034  H HB2  . GLU A 1 5  ? -11.072 3.258   -11.190 1.00 0.00 ? 5   GLU A HB2  3  
ATOM 3035  H HB3  . GLU A 1 5  ? -10.290 2.172   -10.052 1.00 0.00 ? 5   GLU A HB3  3  
ATOM 3036  H HG2  . GLU A 1 5  ? -11.502 2.991   -8.243  1.00 0.00 ? 5   GLU A HG2  3  
ATOM 3037  H HG3  . GLU A 1 5  ? -11.954 4.468   -9.095  1.00 0.00 ? 5   GLU A HG3  3  
ATOM 3038  N N    . ILE A 1 6  ? -8.373  5.081   -8.131  1.00 0.00 ? 6   ILE A N    3  
ATOM 3039  C CA   . ILE A 1 6  ? -7.701  5.062   -6.839  1.00 0.00 ? 6   ILE A CA   3  
ATOM 3040  C C    . ILE A 1 6  ? -8.692  5.344   -5.712  1.00 0.00 ? 6   ILE A C    3  
ATOM 3041  O O    . ILE A 1 6  ? -9.237  6.445   -5.612  1.00 0.00 ? 6   ILE A O    3  
ATOM 3042  C CB   . ILE A 1 6  ? -6.560  6.095   -6.785  1.00 0.00 ? 6   ILE A CB   3  
ATOM 3043  C CG1  . ILE A 1 6  ? -5.617  5.920   -7.978  1.00 0.00 ? 6   ILE A CG1  3  
ATOM 3044  C CG2  . ILE A 1 6  ? -5.791  5.979   -5.475  1.00 0.00 ? 6   ILE A CG2  3  
ATOM 3045  C CD1  . ILE A 1 6  ? -5.002  7.218   -8.451  1.00 0.00 ? 6   ILE A CD1  3  
ATOM 3046  H H    . ILE A 1 6  ? -8.501  5.937   -8.590  1.00 0.00 ? 6   ILE A H    3  
ATOM 3047  H HA   . ILE A 1 6  ? -7.276  4.078   -6.696  1.00 0.00 ? 6   ILE A HA   3  
ATOM 3048  H HB   . ILE A 1 6  ? -7.001  7.078   -6.830  1.00 0.00 ? 6   ILE A HB   3  
ATOM 3049  H HG12 . ILE A 1 6  ? -4.815  5.253   -7.701  1.00 0.00 ? 6   ILE A HG12 3  
ATOM 3050  H HG13 . ILE A 1 6  ? -6.166  5.493   -8.804  1.00 0.00 ? 6   ILE A HG13 3  
ATOM 3051  H HG21 . ILE A 1 6  ? -6.420  5.520   -4.726  1.00 0.00 ? 6   ILE A HG21 3  
ATOM 3052  H HG22 . ILE A 1 6  ? -5.497  6.962   -5.142  1.00 0.00 ? 6   ILE A HG22 3  
ATOM 3053  H HG23 . ILE A 1 6  ? -4.911  5.370   -5.626  1.00 0.00 ? 6   ILE A HG23 3  
ATOM 3054  H HD11 . ILE A 1 6  ? -3.930  7.172   -8.331  1.00 0.00 ? 6   ILE A HD11 3  
ATOM 3055  H HD12 . ILE A 1 6  ? -5.394  8.037   -7.866  1.00 0.00 ? 6   ILE A HD12 3  
ATOM 3056  H HD13 . ILE A 1 6  ? -5.242  7.372   -9.493  1.00 0.00 ? 6   ILE A HD13 3  
ATOM 3057  N N    . ILE A 1 7  ? -8.922  4.337   -4.871  1.00 0.00 ? 7   ILE A N    3  
ATOM 3058  C CA   . ILE A 1 7  ? -9.851  4.460   -3.751  1.00 0.00 ? 7   ILE A CA   3  
ATOM 3059  C C    . ILE A 1 7  ? -9.190  4.056   -2.434  1.00 0.00 ? 7   ILE A C    3  
ATOM 3060  O O    . ILE A 1 7  ? -8.290  3.215   -2.413  1.00 0.00 ? 7   ILE A O    3  
ATOM 3061  C CB   . ILE A 1 7  ? -11.113 3.596   -3.967  1.00 0.00 ? 7   ILE A CB   3  
ATOM 3062  C CG1  . ILE A 1 7  ? -10.739 2.112   -4.079  1.00 0.00 ? 7   ILE A CG1  3  
ATOM 3063  C CG2  . ILE A 1 7  ? -11.868 4.054   -5.209  1.00 0.00 ? 7   ILE A CG2  3  
ATOM 3064  C CD1  . ILE A 1 7  ? -11.768 1.182   -3.475  1.00 0.00 ? 7   ILE A CD1  3  
ATOM 3065  H H    . ILE A 1 7  ? -8.456  3.485   -5.011  1.00 0.00 ? 7   ILE A H    3  
ATOM 3066  H HA   . ILE A 1 7  ? -10.157 5.495   -3.683  1.00 0.00 ? 7   ILE A HA   3  
ATOM 3067  H HB   . ILE A 1 7  ? -11.762 3.732   -3.115  1.00 0.00 ? 7   ILE A HB   3  
ATOM 3068  H HG12 . ILE A 1 7  ? -10.629 1.851   -5.121  1.00 0.00 ? 7   ILE A HG12 3  
ATOM 3069  H HG13 . ILE A 1 7  ? -9.801  1.944   -3.571  1.00 0.00 ? 7   ILE A HG13 3  
ATOM 3070  H HG21 . ILE A 1 7  ? -11.586 3.440   -6.051  1.00 0.00 ? 7   ILE A HG21 3  
ATOM 3071  H HG22 . ILE A 1 7  ? -11.625 5.086   -5.420  1.00 0.00 ? 7   ILE A HG22 3  
ATOM 3072  H HG23 . ILE A 1 7  ? -12.931 3.964   -5.039  1.00 0.00 ? 7   ILE A HG23 3  
ATOM 3073  H HD11 . ILE A 1 7  ? -11.300 0.242   -3.224  1.00 0.00 ? 7   ILE A HD11 3  
ATOM 3074  H HD12 . ILE A 1 7  ? -12.561 1.012   -4.187  1.00 0.00 ? 7   ILE A HD12 3  
ATOM 3075  H HD13 . ILE A 1 7  ? -12.176 1.630   -2.581  1.00 0.00 ? 7   ILE A HD13 3  
ATOM 3076  N N    . THR A 1 8  ? -9.649  4.655   -1.336  1.00 0.00 ? 8   THR A N    3  
ATOM 3077  C CA   . THR A 1 8  ? -9.110  4.355   -0.013  1.00 0.00 ? 8   THR A CA   3  
ATOM 3078  C C    . THR A 1 8  ? -10.122 3.578   0.824   1.00 0.00 ? 8   THR A C    3  
ATOM 3079  O O    . THR A 1 8  ? -11.294 3.949   0.907   1.00 0.00 ? 8   THR A O    3  
ATOM 3080  C CB   . THR A 1 8  ? -8.699  5.646   0.706   1.00 0.00 ? 8   THR A CB   3  
ATOM 3081  O OG1  . THR A 1 8  ? -8.190  5.362   1.999   1.00 0.00 ? 8   THR A OG1  3  
ATOM 3082  C CG2  . THR A 1 8  ? -9.832  6.640   0.866   1.00 0.00 ? 8   THR A CG2  3  
ATOM 3083  H H    . THR A 1 8  ? -10.373 5.310   -1.418  1.00 0.00 ? 8   THR A H    3  
ATOM 3084  H HA   . THR A 1 8  ? -8.234  3.740   -0.149  1.00 0.00 ? 8   THR A HA   3  
ATOM 3085  H HB   . THR A 1 8  ? -7.919  6.126   0.134   1.00 0.00 ? 8   THR A HB   3  
ATOM 3086  H HG1  . THR A 1 8  ? -7.520  6.010   2.230   1.00 0.00 ? 8   THR A HG1  3  
ATOM 3087  H HG21 . THR A 1 8  ? -10.124 7.008   -0.106  1.00 0.00 ? 8   THR A HG21 3  
ATOM 3088  H HG22 . THR A 1 8  ? -9.503  7.466   1.479   1.00 0.00 ? 8   THR A HG22 3  
ATOM 3089  H HG23 . THR A 1 8  ? -10.675 6.156   1.335   1.00 0.00 ? 8   THR A HG23 3  
ATOM 3090  N N    . VAL A 1 9  ? -9.658  2.496   1.442   1.00 0.00 ? 9   VAL A N    3  
ATOM 3091  C CA   . VAL A 1 9  ? -10.514 1.659   2.273   1.00 0.00 ? 9   VAL A CA   3  
ATOM 3092  C C    . VAL A 1 9  ? -10.208 1.864   3.754   1.00 0.00 ? 9   VAL A C    3  
ATOM 3093  O O    . VAL A 1 9  ? -9.072  1.678   4.193   1.00 0.00 ? 9   VAL A O    3  
ATOM 3094  C CB   . VAL A 1 9  ? -10.356 0.165   1.910   1.00 0.00 ? 9   VAL A CB   3  
ATOM 3095  C CG1  . VAL A 1 9  ? -8.945  -0.327  2.216   1.00 0.00 ? 9   VAL A CG1  3  
ATOM 3096  C CG2  . VAL A 1 9  ? -11.400 -0.674  2.637   1.00 0.00 ? 9   VAL A CG2  3  
ATOM 3097  H H    . VAL A 1 9  ? -8.714  2.253   1.334   1.00 0.00 ? 9   VAL A H    3  
ATOM 3098  H HA   . VAL A 1 9  ? -11.540 1.944   2.086   1.00 0.00 ? 9   VAL A HA   3  
ATOM 3099  H HB   . VAL A 1 9  ? -10.522 0.060   0.849   1.00 0.00 ? 9   VAL A HB   3  
ATOM 3100  H HG11 . VAL A 1 9  ? -8.924  -0.774  3.199   1.00 0.00 ? 9   VAL A HG11 3  
ATOM 3101  H HG12 . VAL A 1 9  ? -8.259  0.506   2.186   1.00 0.00 ? 9   VAL A HG12 3  
ATOM 3102  H HG13 . VAL A 1 9  ? -8.652  -1.061  1.480   1.00 0.00 ? 9   VAL A HG13 3  
ATOM 3103  H HG21 . VAL A 1 9  ? -11.521 -0.306  3.645   1.00 0.00 ? 9   VAL A HG21 3  
ATOM 3104  H HG22 . VAL A 1 9  ? -11.078 -1.704  2.666   1.00 0.00 ? 9   VAL A HG22 3  
ATOM 3105  H HG23 . VAL A 1 9  ? -12.343 -0.606  2.115   1.00 0.00 ? 9   VAL A HG23 3  
ATOM 3106  N N    . THR A 1 10 ? -11.229 2.248   4.519   1.00 0.00 ? 10  THR A N    3  
ATOM 3107  C CA   . THR A 1 10 ? -11.075 2.478   5.953   1.00 0.00 ? 10  THR A CA   3  
ATOM 3108  C C    . THR A 1 10 ? -11.492 1.239   6.744   1.00 0.00 ? 10  THR A C    3  
ATOM 3109  O O    . THR A 1 10 ? -12.684 0.963   6.900   1.00 0.00 ? 10  THR A O    3  
ATOM 3110  C CB   . THR A 1 10 ? -11.904 3.690   6.391   1.00 0.00 ? 10  THR A CB   3  
ATOM 3111  O OG1  . THR A 1 10 ? -11.744 4.765   5.480   1.00 0.00 ? 10  THR A OG1  3  
ATOM 3112  C CG2  . THR A 1 10 ? -11.539 4.199   7.770   1.00 0.00 ? 10  THR A CG2  3  
ATOM 3113  H H    . THR A 1 10 ? -12.110 2.379   4.108   1.00 0.00 ? 10  THR A H    3  
ATOM 3114  H HA   . THR A 1 10 ? -10.031 2.678   6.144   1.00 0.00 ? 10  THR A HA   3  
ATOM 3115  H HB   . THR A 1 10 ? -12.948 3.412   6.407   1.00 0.00 ? 10  THR A HB   3  
ATOM 3116  H HG1  . THR A 1 10 ? -12.510 5.342   5.525   1.00 0.00 ? 10  THR A HG1  3  
ATOM 3117  H HG21 . THR A 1 10 ? -10.501 3.980   7.972   1.00 0.00 ? 10  THR A HG21 3  
ATOM 3118  H HG22 . THR A 1 10 ? -12.160 3.713   8.507   1.00 0.00 ? 10  THR A HG22 3  
ATOM 3119  H HG23 . THR A 1 10 ? -11.696 5.266   7.813   1.00 0.00 ? 10  THR A HG23 3  
ATOM 3120  N N    . LEU A 1 11 ? -10.502 0.494   7.236   1.00 0.00 ? 11  LEU A N    3  
ATOM 3121  C CA   . LEU A 1 11 ? -10.759 -0.722  8.007   1.00 0.00 ? 11  LEU A CA   3  
ATOM 3122  C C    . LEU A 1 11 ? -10.058 -0.671  9.365   1.00 0.00 ? 11  LEU A C    3  
ATOM 3123  O O    . LEU A 1 11 ? -9.295  0.257   9.646   1.00 0.00 ? 11  LEU A O    3  
ATOM 3124  C CB   . LEU A 1 11 ? -10.292 -1.953  7.222   1.00 0.00 ? 11  LEU A CB   3  
ATOM 3125  C CG   . LEU A 1 11 ? -10.773 -2.016  5.769   1.00 0.00 ? 11  LEU A CG   3  
ATOM 3126  C CD1  . LEU A 1 11 ? -9.819  -2.845  4.920   1.00 0.00 ? 11  LEU A CD1  3  
ATOM 3127  C CD2  . LEU A 1 11 ? -12.186 -2.580  5.699   1.00 0.00 ? 11  LEU A CD2  3  
ATOM 3128  H H    . LEU A 1 11 ? -9.573  0.765   7.072   1.00 0.00 ? 11  LEU A H    3  
ATOM 3129  H HA   . LEU A 1 11 ? -11.825 -0.794  8.169   1.00 0.00 ? 11  LEU A HA   3  
ATOM 3130  H HB2  . LEU A 1 11 ? -9.211  -1.965  7.224   1.00 0.00 ? 11  LEU A HB2  3  
ATOM 3131  H HB3  . LEU A 1 11 ? -10.645 -2.836  7.734   1.00 0.00 ? 11  LEU A HB3  3  
ATOM 3132  H HG   . LEU A 1 11 ? -10.793 -1.016  5.363   1.00 0.00 ? 11  LEU A HG   3  
ATOM 3133  H HD11 . LEU A 1 11 ? -8.886  -2.976  5.448   1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3134  H HD12 . LEU A 1 11 ? -9.634  -2.335  3.987   1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3135  H HD13 . LEU A 1 11 ? -10.259 -3.811  4.722   1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3136  H HD21 . LEU A 1 11 ? -12.898 -1.768  5.727   1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3137  H HD22 . LEU A 1 11 ? -12.355 -3.236  6.541   1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3138  H HD23 . LEU A 1 11 ? -12.308 -3.135  4.781   1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3139  N N    . LYS A 1 12 ? -10.320 -1.675  10.205  1.00 0.00 ? 12  LYS A N    3  
ATOM 3140  C CA   . LYS A 1 12 ? -9.714  -1.747  11.531  1.00 0.00 ? 12  LYS A CA   3  
ATOM 3141  C C    . LYS A 1 12 ? -8.798  -2.965  11.647  1.00 0.00 ? 12  LYS A C    3  
ATOM 3142  O O    . LYS A 1 12 ? -9.099  -4.033  11.109  1.00 0.00 ? 12  LYS A O    3  
ATOM 3143  C CB   . LYS A 1 12 ? -10.801 -1.804  12.609  1.00 0.00 ? 12  LYS A CB   3  
ATOM 3144  C CG   . LYS A 1 12 ? -10.815 -0.591  13.528  1.00 0.00 ? 12  LYS A CG   3  
ATOM 3145  C CD   . LYS A 1 12 ? -10.854 -1.001  14.993  1.00 0.00 ? 12  LYS A CD   3  
ATOM 3146  C CE   . LYS A 1 12 ? -10.764 0.207   15.917  1.00 0.00 ? 12  LYS A CE   3  
ATOM 3147  N NZ   . LYS A 1 12 ? -12.094 0.603   16.465  1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3148  H H    . LYS A 1 12 ? -10.935 -2.385  9.923   1.00 0.00 ? 12  LYS A H    3  
ATOM 3149  H HA   . LYS A 1 12 ? -9.124  -0.853  11.674  1.00 0.00 ? 12  LYS A HA   3  
ATOM 3150  H HB2  . LYS A 1 12 ? -11.765 -1.872  12.126  1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3151  H HB3  . LYS A 1 12 ? -10.648 -2.687  13.212  1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3152  H HG2  . LYS A 1 12 ? -9.923  -0.008  13.352  1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3153  H HG3  . LYS A 1 12 ? -11.687 0.005   13.306  1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3154  H HD2  . LYS A 1 12 ? -11.780 -1.522  15.185  1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3155  H HD3  . LYS A 1 12 ? -10.021 -1.659  15.194  1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3156  H HE2  . LYS A 1 12 ? -10.107 -0.036  16.739  1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3157  H HE3  . LYS A 1 12 ? -10.351 1.037   15.363  1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3158  H HZ1  . LYS A 1 12 ? -12.754 -0.201  16.427  1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3159  H HZ2  . LYS A 1 12 ? -12.491 1.388   15.909  1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3160  H HZ3  . LYS A 1 12 ? -11.996 0.911   17.454  1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3161  N N    . LYS A 1 13 ? -7.680  -2.796  12.353  1.00 0.00 ? 13  LYS A N    3  
ATOM 3162  C CA   . LYS A 1 13 ? -6.716  -3.879  12.542  1.00 0.00 ? 13  LYS A CA   3  
ATOM 3163  C C    . LYS A 1 13 ? -7.210  -4.877  13.588  1.00 0.00 ? 13  LYS A C    3  
ATOM 3164  O O    . LYS A 1 13 ? -7.697  -4.486  14.650  1.00 0.00 ? 13  LYS A O    3  
ATOM 3165  C CB   . LYS A 1 13 ? -5.359  -3.316  12.969  1.00 0.00 ? 13  LYS A CB   3  
ATOM 3166  C CG   . LYS A 1 13 ? -4.424  -3.021  11.807  1.00 0.00 ? 13  LYS A CG   3  
ATOM 3167  C CD   . LYS A 1 13 ? -3.777  -1.651  11.949  1.00 0.00 ? 13  LYS A CD   3  
ATOM 3168  C CE   . LYS A 1 13 ? -2.380  -1.749  12.543  1.00 0.00 ? 13  LYS A CE   3  
ATOM 3169  N NZ   . LYS A 1 13 ? -2.407  -1.809  14.031  1.00 0.00 ? 13  LYS A NZ   3  
ATOM 3170  H H    . LYS A 1 13 ? -7.499  -1.921  12.757  1.00 0.00 ? 13  LYS A H    3  
ATOM 3171  H HA   . LYS A 1 13 ? -6.603  -4.392  11.598  1.00 0.00 ? 13  LYS A HA   3  
ATOM 3172  H HB2  . LYS A 1 13 ? -5.521  -2.399  13.515  1.00 0.00 ? 13  LYS A HB2  3  
ATOM 3173  H HB3  . LYS A 1 13 ? -4.876  -4.030  13.620  1.00 0.00 ? 13  LYS A HB3  3  
ATOM 3174  H HG2  . LYS A 1 13 ? -3.649  -3.773  11.782  1.00 0.00 ? 13  LYS A HG2  3  
ATOM 3175  H HG3  . LYS A 1 13 ? -4.986  -3.051  10.886  1.00 0.00 ? 13  LYS A HG3  3  
ATOM 3176  H HD2  . LYS A 1 13 ? -3.711  -1.193  10.973  1.00 0.00 ? 13  LYS A HD2  3  
ATOM 3177  H HD3  . LYS A 1 13 ? -4.392  -1.040  12.595  1.00 0.00 ? 13  LYS A HD3  3  
ATOM 3178  H HE2  . LYS A 1 13 ? -1.903  -2.640  12.164  1.00 0.00 ? 13  LYS A HE2  3  
ATOM 3179  H HE3  . LYS A 1 13 ? -1.813  -0.882  12.237  1.00 0.00 ? 13  LYS A HE3  3  
ATOM 3180  H HZ1  . LYS A 1 13 ? -1.463  -2.054  14.396  1.00 0.00 ? 13  LYS A HZ1  3  
ATOM 3181  H HZ2  . LYS A 1 13 ? -3.086  -2.530  14.349  1.00 0.00 ? 13  LYS A HZ2  3  
ATOM 3182  H HZ3  . LYS A 1 13 ? -2.688  -0.887  14.422  1.00 0.00 ? 13  LYS A HZ3  3  
ATOM 3183  N N    . GLN A 1 14 ? -7.070  -6.168  13.281  1.00 0.00 ? 14  GLN A N    3  
ATOM 3184  C CA   . GLN A 1 14 ? -7.496  -7.228  14.197  1.00 0.00 ? 14  GLN A CA   3  
ATOM 3185  C C    . GLN A 1 14 ? -6.336  -7.650  15.095  1.00 0.00 ? 14  GLN A C    3  
ATOM 3186  O O    . GLN A 1 14 ? -6.408  -7.522  16.318  1.00 0.00 ? 14  GLN A O    3  
ATOM 3187  C CB   . GLN A 1 14 ? -8.035  -8.441  13.421  1.00 0.00 ? 14  GLN A CB   3  
ATOM 3188  C CG   . GLN A 1 14 ? -8.781  -8.081  12.141  1.00 0.00 ? 14  GLN A CG   3  
ATOM 3189  C CD   . GLN A 1 14 ? -10.125 -7.419  12.401  1.00 0.00 ? 14  GLN A CD   3  
ATOM 3190  O OE1  . GLN A 1 14 ? -10.453 -7.067  13.535  1.00 0.00 ? 14  GLN A OE1  3  
ATOM 3191  N NE2  . GLN A 1 14 ? -10.914 -7.244  11.346  1.00 0.00 ? 14  GLN A NE2  3  
ATOM 3192  H H    . GLN A 1 14 ? -6.666  -6.412  12.422  1.00 0.00 ? 14  GLN A H    3  
ATOM 3193  H HA   . GLN A 1 14 ? -8.286  -6.830  14.817  1.00 0.00 ? 14  GLN A HA   3  
ATOM 3194  H HB2  . GLN A 1 14 ? -7.208  -9.085  13.158  1.00 0.00 ? 14  GLN A HB2  3  
ATOM 3195  H HB3  . GLN A 1 14 ? -8.711  -8.988  14.062  1.00 0.00 ? 14  GLN A HB3  3  
ATOM 3196  H HG2  . GLN A 1 14 ? -8.171  -7.400  11.565  1.00 0.00 ? 14  GLN A HG2  3  
ATOM 3197  H HG3  . GLN A 1 14 ? -8.944  -8.983  11.570  1.00 0.00 ? 14  GLN A HG3  3  
ATOM 3198  H HE21 . GLN A 1 14 ? -10.593 -7.545  10.469  1.00 0.00 ? 14  GLN A HE21 3  
ATOM 3199  H HE22 . GLN A 1 14 ? -11.785 -6.821  11.487  1.00 0.00 ? 14  GLN A HE22 3  
ATOM 3200  N N    . ASN A 1 15 ? -5.264  -8.140  14.473  1.00 0.00 ? 15  ASN A N    3  
ATOM 3201  C CA   . ASN A 1 15 ? -4.072  -8.573  15.202  1.00 0.00 ? 15  ASN A CA   3  
ATOM 3202  C C    . ASN A 1 15 ? -2.842  -8.565  14.285  1.00 0.00 ? 15  ASN A C    3  
ATOM 3203  O O    . ASN A 1 15 ? -1.969  -9.431  14.390  1.00 0.00 ? 15  ASN A O    3  
ATOM 3204  C CB   . ASN A 1 15 ? -4.286  -9.971  15.796  1.00 0.00 ? 15  ASN A CB   3  
ATOM 3205  C CG   . ASN A 1 15 ? -3.773  -10.082 17.220  1.00 0.00 ? 15  ASN A CG   3  
ATOM 3206  O OD1  . ASN A 1 15 ? -4.522  -10.421 18.136  1.00 0.00 ? 15  ASN A OD1  3  
ATOM 3207  N ND2  . ASN A 1 15 ? -2.489  -9.796  17.416  1.00 0.00 ? 15  ASN A ND2  3  
ATOM 3208  H H    . ASN A 1 15 ? -5.272  -8.207  13.495  1.00 0.00 ? 15  ASN A H    3  
ATOM 3209  H HA   . ASN A 1 15 ? -3.906  -7.872  16.007  1.00 0.00 ? 15  ASN A HA   3  
ATOM 3210  H HB2  . ASN A 1 15 ? -5.343  -10.198 15.797  1.00 0.00 ? 15  ASN A HB2  3  
ATOM 3211  H HB3  . ASN A 1 15 ? -3.768  -10.698 15.188  1.00 0.00 ? 15  ASN A HB3  3  
ATOM 3212  H HD21 . ASN A 1 15 ? -1.948  -9.531  16.642  1.00 0.00 ? 15  ASN A HD21 3  
ATOM 3213  H HD22 . ASN A 1 15 ? -2.136  -9.860  18.328  1.00 0.00 ? 15  ASN A HD22 3  
ATOM 3214  N N    . GLY A 1 16 ? -2.786  -7.580  13.384  1.00 0.00 ? 16  GLY A N    3  
ATOM 3215  C CA   . GLY A 1 16 ? -1.674  -7.468  12.455  1.00 0.00 ? 16  GLY A CA   3  
ATOM 3216  C C    . GLY A 1 16 ? -2.135  -7.495  11.010  1.00 0.00 ? 16  GLY A C    3  
ATOM 3217  O O    . GLY A 1 16 ? -3.096  -8.192  10.675  1.00 0.00 ? 16  GLY A O    3  
ATOM 3218  H H    . GLY A 1 16 ? -3.510  -6.922  13.347  1.00 0.00 ? 16  GLY A H    3  
ATOM 3219  H HA2  . GLY A 1 16 ? -1.154  -6.540  12.641  1.00 0.00 ? 16  GLY A HA2  3  
ATOM 3220  H HA3  . GLY A 1 16 ? -0.994  -8.290  12.620  1.00 0.00 ? 16  GLY A HA3  3  
ATOM 3221  N N    . MET A 1 17 ? -1.453  -6.732  10.156  1.00 0.00 ? 17  MET A N    3  
ATOM 3222  C CA   . MET A 1 17 ? -1.798  -6.669  8.737   1.00 0.00 ? 17  MET A CA   3  
ATOM 3223  C C    . MET A 1 17 ? -1.390  -7.954  8.023   1.00 0.00 ? 17  MET A C    3  
ATOM 3224  O O    . MET A 1 17 ? -2.238  -8.665  7.483   1.00 0.00 ? 17  MET A O    3  
ATOM 3225  C CB   . MET A 1 17 ? -1.128  -5.461  8.071   1.00 0.00 ? 17  MET A CB   3  
ATOM 3226  C CG   . MET A 1 17 ? -1.846  -4.146  8.336   1.00 0.00 ? 17  MET A CG   3  
ATOM 3227  S SD   . MET A 1 17 ? -1.695  -2.982  6.966   1.00 0.00 ? 17  MET A SD   3  
ATOM 3228  C CE   . MET A 1 17 ? -0.375  -1.925  7.558   1.00 0.00 ? 17  MET A CE   3  
ATOM 3229  H H    . MET A 1 17 ? -0.700  -6.199  10.487  1.00 0.00 ? 17  MET A H    3  
ATOM 3230  H HA   . MET A 1 17 ? -2.870  -6.559  8.664   1.00 0.00 ? 17  MET A HA   3  
ATOM 3231  H HB2  . MET A 1 17 ? -0.116  -5.375  8.442   1.00 0.00 ? 17  MET A HB2  3  
ATOM 3232  H HB3  . MET A 1 17 ? -1.096  -5.621  7.001   1.00 0.00 ? 17  MET A HB3  3  
ATOM 3233  H HG2  . MET A 1 17 ? -2.894  -4.351  8.499   1.00 0.00 ? 17  MET A HG2  3  
ATOM 3234  H HG3  . MET A 1 17 ? -1.427  -3.695  9.224   1.00 0.00 ? 17  MET A HG3  3  
ATOM 3235  H HE1  . MET A 1 17 ? 0.482   -2.529  7.817   1.00 0.00 ? 17  MET A HE1  3  
ATOM 3236  H HE2  . MET A 1 17 ? -0.711  -1.381  8.429   1.00 0.00 ? 17  MET A HE2  3  
ATOM 3237  H HE3  . MET A 1 17 ? -0.100  -1.227  6.782   1.00 0.00 ? 17  MET A HE3  3  
ATOM 3238  N N    . GLY A 1 18 ? -0.087  -8.247  8.029   1.00 0.00 ? 18  GLY A N    3  
ATOM 3239  C CA   . GLY A 1 18 ? 0.411   -9.448  7.384   1.00 0.00 ? 18  GLY A CA   3  
ATOM 3240  C C    . GLY A 1 18 ? 0.284   -9.393  5.874   1.00 0.00 ? 18  GLY A C    3  
ATOM 3241  O O    . GLY A 1 18 ? -0.654  -9.949  5.307   1.00 0.00 ? 18  GLY A O    3  
ATOM 3242  H H    . GLY A 1 18 ? 0.541   -7.643  8.480   1.00 0.00 ? 18  GLY A H    3  
ATOM 3243  H HA2  . GLY A 1 18 ? 1.452   -9.578  7.642   1.00 0.00 ? 18  GLY A HA2  3  
ATOM 3244  H HA3  . GLY A 1 18 ? -0.147  -10.297 7.750   1.00 0.00 ? 18  GLY A HA3  3  
ATOM 3245  N N    . LEU A 1 19 ? 1.234   -8.722  5.224   1.00 0.00 ? 19  LEU A N    3  
ATOM 3246  C CA   . LEU A 1 19 ? 1.237   -8.601  3.764   1.00 0.00 ? 19  LEU A CA   3  
ATOM 3247  C C    . LEU A 1 19 ? 2.628   -8.213  3.253   1.00 0.00 ? 19  LEU A C    3  
ATOM 3248  O O    . LEU A 1 19 ? 3.558   -8.036  4.041   1.00 0.00 ? 19  LEU A O    3  
ATOM 3249  C CB   . LEU A 1 19 ? 0.187   -7.584  3.300   1.00 0.00 ? 19  LEU A CB   3  
ATOM 3250  C CG   . LEU A 1 19 ? 0.358   -6.177  3.865   1.00 0.00 ? 19  LEU A CG   3  
ATOM 3251  C CD1  . LEU A 1 19 ? 0.995   -5.261  2.828   1.00 0.00 ? 19  LEU A CD1  3  
ATOM 3252  C CD2  . LEU A 1 19 ? -0.977  -5.618  4.334   1.00 0.00 ? 19  LEU A CD2  3  
ATOM 3253  H H    . LEU A 1 19 ? 1.957   -8.302  5.738   1.00 0.00 ? 19  LEU A H    3  
ATOM 3254  H HA   . LEU A 1 19 ? 0.984   -9.569  3.358   1.00 0.00 ? 19  LEU A HA   3  
ATOM 3255  H HB2  . LEU A 1 19 ? 0.226   -7.525  2.222   1.00 0.00 ? 19  LEU A HB2  3  
ATOM 3256  H HB3  . LEU A 1 19 ? -0.788  -7.947  3.587   1.00 0.00 ? 19  LEU A HB3  3  
ATOM 3257  H HG   . LEU A 1 19 ? 1.016   -6.229  4.719   1.00 0.00 ? 19  LEU A HG   3  
ATOM 3258  H HD11 . LEU A 1 19 ? 0.717   -5.592  1.837   1.00 0.00 ? 19  LEU A HD11 3  
ATOM 3259  H HD12 . LEU A 1 19 ? 2.070   -5.295  2.930   1.00 0.00 ? 19  LEU A HD12 3  
ATOM 3260  H HD13 . LEU A 1 19 ? 0.653   -4.249  2.980   1.00 0.00 ? 19  LEU A HD13 3  
ATOM 3261  H HD21 . LEU A 1 19 ? -1.562  -6.408  4.781   1.00 0.00 ? 19  LEU A HD21 3  
ATOM 3262  H HD22 . LEU A 1 19 ? -1.513  -5.206  3.491   1.00 0.00 ? 19  LEU A HD22 3  
ATOM 3263  H HD23 . LEU A 1 19 ? -0.804  -4.841  5.064   1.00 0.00 ? 19  LEU A HD23 3  
ATOM 3264  N N    . SER A 1 20 ? 2.765   -8.081  1.932   1.00 0.00 ? 20  SER A N    3  
ATOM 3265  C CA   . SER A 1 20 ? 4.047   -7.719  1.324   1.00 0.00 ? 20  SER A CA   3  
ATOM 3266  C C    . SER A 1 20 ? 3.862   -6.678  0.222   1.00 0.00 ? 20  SER A C    3  
ATOM 3267  O O    . SER A 1 20 ? 2.830   -6.654  -0.450  1.00 0.00 ? 20  SER A O    3  
ATOM 3268  C CB   . SER A 1 20 ? 4.732   -8.962  0.754   1.00 0.00 ? 20  SER A CB   3  
ATOM 3269  O OG   . SER A 1 20 ? 4.924   -9.945  1.756   1.00 0.00 ? 20  SER A OG   3  
ATOM 3270  H H    . SER A 1 20 ? 1.989   -8.236  1.354   1.00 0.00 ? 20  SER A H    3  
ATOM 3271  H HA   . SER A 1 20 ? 4.673   -7.298  2.097   1.00 0.00 ? 20  SER A HA   3  
ATOM 3272  H HB2  . SER A 1 20 ? 4.121   -9.382  -0.030  1.00 0.00 ? 20  SER A HB2  3  
ATOM 3273  H HB3  . SER A 1 20 ? 5.696   -8.686  0.348   1.00 0.00 ? 20  SER A HB3  3  
ATOM 3274  H HG   . SER A 1 20 ? 5.663   -10.509 1.515   1.00 0.00 ? 20  SER A HG   3  
ATOM 3275  N N    . ILE A 1 21 ? 4.871   -5.824  0.035   1.00 0.00 ? 21  ILE A N    3  
ATOM 3276  C CA   . ILE A 1 21 ? 4.818   -4.783  -0.994  1.00 0.00 ? 21  ILE A CA   3  
ATOM 3277  C C    . ILE A 1 21 ? 6.141   -4.673  -1.752  1.00 0.00 ? 21  ILE A C    3  
ATOM 3278  O O    . ILE A 1 21 ? 7.190   -5.073  -1.245  1.00 0.00 ? 21  ILE A O    3  
ATOM 3279  C CB   . ILE A 1 21 ? 4.455   -3.398  -0.402  1.00 0.00 ? 21  ILE A CB   3  
ATOM 3280  C CG1  . ILE A 1 21 ? 5.338   -3.065  0.804   1.00 0.00 ? 21  ILE A CG1  3  
ATOM 3281  C CG2  . ILE A 1 21 ? 2.983   -3.354  -0.018  1.00 0.00 ? 21  ILE A CG2  3  
ATOM 3282  C CD1  . ILE A 1 21 ? 6.690   -2.504  0.421   1.00 0.00 ? 21  ILE A CD1  3  
ATOM 3283  H H    . ILE A 1 21 ? 5.672   -5.896  0.599   1.00 0.00 ? 21  ILE A H    3  
ATOM 3284  H HA   . ILE A 1 21 ? 4.046   -5.059  -1.696  1.00 0.00 ? 21  ILE A HA   3  
ATOM 3285  H HB   . ILE A 1 21 ? 4.618   -2.656  -1.169  1.00 0.00 ? 21  ILE A HB   3  
ATOM 3286  H HG12 . ILE A 1 21 ? 4.837   -2.332  1.419   1.00 0.00 ? 21  ILE A HG12 3  
ATOM 3287  H HG13 . ILE A 1 21 ? 5.500   -3.962  1.382   1.00 0.00 ? 21  ILE A HG13 3  
ATOM 3288  H HG21 . ILE A 1 21 ? 2.435   -2.799  -0.764  1.00 0.00 ? 21  ILE A HG21 3  
ATOM 3289  H HG22 . ILE A 1 21 ? 2.874   -2.871  0.943   1.00 0.00 ? 21  ILE A HG22 3  
ATOM 3290  H HG23 . ILE A 1 21 ? 2.595   -4.360  0.039   1.00 0.00 ? 21  ILE A HG23 3  
ATOM 3291  H HD11 . ILE A 1 21 ? 7.418   -3.300  0.407   1.00 0.00 ? 21  ILE A HD11 3  
ATOM 3292  H HD12 . ILE A 1 21 ? 6.989   -1.758  1.143   1.00 0.00 ? 21  ILE A HD12 3  
ATOM 3293  H HD13 . ILE A 1 21 ? 6.629   -2.053  -0.559  1.00 0.00 ? 21  ILE A HD13 3  
ATOM 3294  N N    . VAL A 1 22 ? 6.078   -4.128  -2.969  1.00 0.00 ? 22  VAL A N    3  
ATOM 3295  C CA   . VAL A 1 22 ? 7.262   -3.963  -3.812  1.00 0.00 ? 22  VAL A CA   3  
ATOM 3296  C C    . VAL A 1 22 ? 7.399   -2.524  -4.313  1.00 0.00 ? 22  VAL A C    3  
ATOM 3297  O O    . VAL A 1 22 ? 6.402   -1.854  -4.588  1.00 0.00 ? 22  VAL A O    3  
ATOM 3298  C CB   . VAL A 1 22 ? 7.220   -4.911  -5.031  1.00 0.00 ? 22  VAL A CB   3  
ATOM 3299  C CG1  . VAL A 1 22 ? 8.561   -4.922  -5.753  1.00 0.00 ? 22  VAL A CG1  3  
ATOM 3300  C CG2  . VAL A 1 22 ? 6.824   -6.318  -4.605  1.00 0.00 ? 22  VAL A CG2  3  
ATOM 3301  H H    . VAL A 1 22 ? 5.207   -3.833  -3.313  1.00 0.00 ? 22  VAL A H    3  
ATOM 3302  H HA   . VAL A 1 22 ? 8.130   -4.212  -3.220  1.00 0.00 ? 22  VAL A HA   3  
ATOM 3303  H HB   . VAL A 1 22 ? 6.472   -4.545  -5.719  1.00 0.00 ? 22  VAL A HB   3  
ATOM 3304  H HG11 . VAL A 1 22 ? 8.808   -3.920  -6.071  1.00 0.00 ? 22  VAL A HG11 3  
ATOM 3305  H HG12 . VAL A 1 22 ? 8.499   -5.568  -6.616  1.00 0.00 ? 22  VAL A HG12 3  
ATOM 3306  H HG13 . VAL A 1 22 ? 9.326   -5.287  -5.085  1.00 0.00 ? 22  VAL A HG13 3  
ATOM 3307  H HG21 . VAL A 1 22 ? 7.257   -7.037  -5.284  1.00 0.00 ? 22  VAL A HG21 3  
ATOM 3308  H HG22 . VAL A 1 22 ? 5.748   -6.409  -4.622  1.00 0.00 ? 22  VAL A HG22 3  
ATOM 3309  H HG23 . VAL A 1 22 ? 7.184   -6.506  -3.603  1.00 0.00 ? 22  VAL A HG23 3  
ATOM 3310  N N    . ALA A 1 23 ? 8.644   -2.062  -4.440  1.00 0.00 ? 23  ALA A N    3  
ATOM 3311  C CA   . ALA A 1 23 ? 8.925   -0.710  -4.919  1.00 0.00 ? 23  ALA A CA   3  
ATOM 3312  C C    . ALA A 1 23 ? 9.359   -0.732  -6.384  1.00 0.00 ? 23  ALA A C    3  
ATOM 3313  O O    . ALA A 1 23 ? 10.076  -1.640  -6.811  1.00 0.00 ? 23  ALA A O    3  
ATOM 3314  C CB   . ALA A 1 23 ? 9.998   -0.058  -4.060  1.00 0.00 ? 23  ALA A CB   3  
ATOM 3315  H H    . ALA A 1 23 ? 9.396   -2.649  -4.212  1.00 0.00 ? 23  ALA A H    3  
ATOM 3316  H HA   . ALA A 1 23 ? 8.020   -0.127  -4.829  1.00 0.00 ? 23  ALA A HA   3  
ATOM 3317  H HB1  . ALA A 1 23 ? 10.607  0.589   -4.673  1.00 0.00 ? 23  ALA A HB1  3  
ATOM 3318  H HB2  . ALA A 1 23 ? 10.620  -0.823  -3.617  1.00 0.00 ? 23  ALA A HB2  3  
ATOM 3319  H HB3  . ALA A 1 23 ? 9.530   0.521   -3.279  1.00 0.00 ? 23  ALA A HB3  3  
ATOM 3320  N N    . ALA A 1 24 ? 8.918   0.268   -7.149  1.00 0.00 ? 24  ALA A N    3  
ATOM 3321  C CA   . ALA A 1 24 ? 9.261   0.356   -8.567  1.00 0.00 ? 24  ALA A CA   3  
ATOM 3322  C C    . ALA A 1 24 ? 9.497   1.802   -9.003  1.00 0.00 ? 24  ALA A C    3  
ATOM 3323  O O    . ALA A 1 24 ? 8.805   2.718   -8.554  1.00 0.00 ? 24  ALA A O    3  
ATOM 3324  C CB   . ALA A 1 24 ? 8.164   -0.275  -9.411  1.00 0.00 ? 24  ALA A CB   3  
ATOM 3325  H H    . ALA A 1 24 ? 8.348   0.961   -6.752  1.00 0.00 ? 24  ALA A H    3  
ATOM 3326  H HA   . ALA A 1 24 ? 10.170  -0.208  -8.724  1.00 0.00 ? 24  ALA A HA   3  
ATOM 3327  H HB1  . ALA A 1 24 ? 7.876   -1.221  -8.978  1.00 0.00 ? 24  ALA A HB1  3  
ATOM 3328  H HB2  . ALA A 1 24 ? 8.528   -0.434  -10.415 1.00 0.00 ? 24  ALA A HB2  3  
ATOM 3329  H HB3  . ALA A 1 24 ? 7.307   0.383   -9.439  1.00 0.00 ? 24  ALA A HB3  3  
ATOM 3330  N N    . LYS A 1 25 ? 10.479  1.993   -9.888  1.00 0.00 ? 25  LYS A N    3  
ATOM 3331  C CA   . LYS A 1 25 ? 10.816  3.322   -10.400 1.00 0.00 ? 25  LYS A CA   3  
ATOM 3332  C C    . LYS A 1 25 ? 10.124  3.589   -11.740 1.00 0.00 ? 25  LYS A C    3  
ATOM 3333  O O    . LYS A 1 25 ? 9.386   2.741   -12.248 1.00 0.00 ? 25  LYS A O    3  
ATOM 3334  C CB   . LYS A 1 25 ? 12.335  3.465   -10.554 1.00 0.00 ? 25  LYS A CB   3  
ATOM 3335  C CG   . LYS A 1 25 ? 12.953  4.473   -9.597  1.00 0.00 ? 25  LYS A CG   3  
ATOM 3336  C CD   . LYS A 1 25 ? 13.335  5.766   -10.305 1.00 0.00 ? 25  LYS A CD   3  
ATOM 3337  C CE   . LYS A 1 25 ? 12.939  6.990   -9.491  1.00 0.00 ? 25  LYS A CE   3  
ATOM 3338  N NZ   . LYS A 1 25 ? 13.801  8.169   -9.792  1.00 0.00 ? 25  LYS A NZ   3  
ATOM 3339  H H    . LYS A 1 25 ? 10.987  1.218   -10.209 1.00 0.00 ? 25  LYS A H    3  
ATOM 3340  H HA   . LYS A 1 25 ? 10.467  4.049   -9.682  1.00 0.00 ? 25  LYS A HA   3  
ATOM 3341  H HB2  . LYS A 1 25 ? 12.795  2.505   -10.378 1.00 0.00 ? 25  LYS A HB2  3  
ATOM 3342  H HB3  . LYS A 1 25 ? 12.554  3.778   -11.565 1.00 0.00 ? 25  LYS A HB3  3  
ATOM 3343  H HG2  . LYS A 1 25 ? 12.240  4.700   -8.818  1.00 0.00 ? 25  LYS A HG2  3  
ATOM 3344  H HG3  . LYS A 1 25 ? 13.840  4.039   -9.158  1.00 0.00 ? 25  LYS A HG3  3  
ATOM 3345  H HD2  . LYS A 1 25 ? 14.404  5.778   -10.456 1.00 0.00 ? 25  LYS A HD2  3  
ATOM 3346  H HD3  . LYS A 1 25 ? 12.835  5.805   -11.262 1.00 0.00 ? 25  LYS A HD3  3  
ATOM 3347  H HE2  . LYS A 1 25 ? 11.913  7.242   -9.717  1.00 0.00 ? 25  LYS A HE2  3  
ATOM 3348  H HE3  . LYS A 1 25 ? 13.026  6.752   -8.441  1.00 0.00 ? 25  LYS A HE3  3  
ATOM 3349  H HZ1  . LYS A 1 25 ? 13.719  8.876   -9.032  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 3350  H HZ2  . LYS A 1 25 ? 13.507  8.609   -10.688 1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 3351  H HZ3  . LYS A 1 25 ? 14.796  7.876   -9.873  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 3352  N N    . GLY A 1 26 ? 10.369  4.772   -12.310 1.00 0.00 ? 26  GLY A N    3  
ATOM 3353  C CA   . GLY A 1 26 ? 9.769   5.128   -13.579 1.00 0.00 ? 26  GLY A CA   3  
ATOM 3354  C C    . GLY A 1 26 ? 10.531  6.238   -14.265 1.00 0.00 ? 26  GLY A C    3  
ATOM 3355  O O    . GLY A 1 26 ? 11.058  7.133   -13.599 1.00 0.00 ? 26  GLY A O    3  
ATOM 3356  H H    . GLY A 1 26 ? 10.970  5.410   -11.869 1.00 0.00 ? 26  GLY A H    3  
ATOM 3357  H HA2  . GLY A 1 26 ? 9.757   4.260   -14.217 1.00 0.00 ? 26  GLY A HA2  3  
ATOM 3358  H HA3  . GLY A 1 26 ? 8.753   5.453   -13.410 1.00 0.00 ? 26  GLY A HA3  3  
ATOM 3359  N N    . ALA A 1 27 ? 10.597  6.191   -15.593 1.00 0.00 ? 27  ALA A N    3  
ATOM 3360  C CA   . ALA A 1 27 ? 11.308  7.218   -16.341 1.00 0.00 ? 27  ALA A CA   3  
ATOM 3361  C C    . ALA A 1 27 ? 10.569  8.548   -16.241 1.00 0.00 ? 27  ALA A C    3  
ATOM 3362  O O    . ALA A 1 27 ? 9.337   8.576   -16.241 1.00 0.00 ? 27  ALA A O    3  
ATOM 3363  C CB   . ALA A 1 27 ? 11.489  6.812   -17.795 1.00 0.00 ? 27  ALA A CB   3  
ATOM 3364  H H    . ALA A 1 27 ? 10.158  5.457   -16.072 1.00 0.00 ? 27  ALA A H    3  
ATOM 3365  H HA   . ALA A 1 27 ? 12.285  7.322   -15.887 1.00 0.00 ? 27  ALA A HA   3  
ATOM 3366  H HB1  . ALA A 1 27 ? 11.890  5.811   -17.843 1.00 0.00 ? 27  ALA A HB1  3  
ATOM 3367  H HB2  . ALA A 1 27 ? 12.171  7.497   -18.276 1.00 0.00 ? 27  ALA A HB2  3  
ATOM 3368  H HB3  . ALA A 1 27 ? 10.534  6.842   -18.298 1.00 0.00 ? 27  ALA A HB3  3  
ATOM 3369  N N    . GLY A 1 28 ? 11.321  9.646   -16.123 1.00 0.00 ? 28  GLY A N    3  
ATOM 3370  C CA   . GLY A 1 28 ? 10.697  10.953  -15.980 1.00 0.00 ? 28  GLY A CA   3  
ATOM 3371  C C    . GLY A 1 28 ? 9.769   10.974  -14.779 1.00 0.00 ? 28  GLY A C    3  
ATOM 3372  O O    . GLY A 1 28 ? 8.711   11.607  -14.802 1.00 0.00 ? 28  GLY A O    3  
ATOM 3373  H H    . GLY A 1 28 ? 12.299  9.564   -16.105 1.00 0.00 ? 28  GLY A H    3  
ATOM 3374  H HA2  . GLY A 1 28 ? 11.464  11.702  -15.851 1.00 0.00 ? 28  GLY A HA2  3  
ATOM 3375  H HA3  . GLY A 1 28 ? 10.129  11.177  -16.872 1.00 0.00 ? 28  GLY A HA3  3  
ATOM 3376  N N    . GLN A 1 29 ? 10.168  10.239  -13.739 1.00 0.00 ? 29  GLN A N    3  
ATOM 3377  C CA   . GLN A 1 29 ? 9.394   10.116  -12.521 1.00 0.00 ? 29  GLN A CA   3  
ATOM 3378  C C    . GLN A 1 29 ? 10.303  10.226  -11.304 1.00 0.00 ? 29  GLN A C    3  
ATOM 3379  O O    . GLN A 1 29 ? 11.100  9.324   -11.030 1.00 0.00 ? 29  GLN A O    3  
ATOM 3380  C CB   . GLN A 1 29 ? 8.669   8.773   -12.520 1.00 0.00 ? 29  GLN A CB   3  
ATOM 3381  C CG   . GLN A 1 29 ? 7.162   8.901   -12.615 1.00 0.00 ? 29  GLN A CG   3  
ATOM 3382  C CD   . GLN A 1 29 ? 6.472   8.469   -11.341 1.00 0.00 ? 29  GLN A CD   3  
ATOM 3383  O OE1  . GLN A 1 29 ? 5.567   9.143   -10.853 1.00 0.00 ? 29  GLN A OE1  3  
ATOM 3384  N NE2  . GLN A 1 29 ? 6.898   7.337   -10.794 1.00 0.00 ? 29  GLN A NE2  3  
ATOM 3385  H H    . GLN A 1 29 ? 11.012  9.747   -13.803 1.00 0.00 ? 29  GLN A H    3  
ATOM 3386  H HA   . GLN A 1 29 ? 8.661   10.907  -12.492 1.00 0.00 ? 29  GLN A HA   3  
ATOM 3387  H HB2  . GLN A 1 29 ? 9.012   8.190   -13.362 1.00 0.00 ? 29  GLN A HB2  3  
ATOM 3388  H HB3  . GLN A 1 29 ? 8.910   8.249   -11.608 1.00 0.00 ? 29  GLN A HB3  3  
ATOM 3389  H HG2  . GLN A 1 29 ? 6.912   9.934   -12.810 1.00 0.00 ? 29  GLN A HG2  3  
ATOM 3390  H HG3  . GLN A 1 29 ? 6.808   8.285   -13.428 1.00 0.00 ? 29  GLN A HG3  3  
ATOM 3391  H HE21 . GLN A 1 29 ? 7.622   6.846   -11.237 1.00 0.00 ? 29  GLN A HE21 3  
ATOM 3392  H HE22 . GLN A 1 29 ? 6.479   7.045   -9.968  1.00 0.00 ? 29  GLN A HE22 3  
ATOM 3393  N N    . ASP A 1 30 ? 10.181  11.332  -10.577 1.00 0.00 ? 30  ASP A N    3  
ATOM 3394  C CA   . ASP A 1 30 ? 10.993  11.558  -9.386  1.00 0.00 ? 30  ASP A CA   3  
ATOM 3395  C C    . ASP A 1 30 ? 10.316  10.978  -8.134  1.00 0.00 ? 30  ASP A C    3  
ATOM 3396  O O    . ASP A 1 30 ? 10.535  11.457  -7.020  1.00 0.00 ? 30  ASP A O    3  
ATOM 3397  C CB   . ASP A 1 30 ? 11.261  13.057  -9.207  1.00 0.00 ? 30  ASP A CB   3  
ATOM 3398  C CG   . ASP A 1 30 ? 12.547  13.324  -8.450  1.00 0.00 ? 30  ASP A CG   3  
ATOM 3399  O OD1  . ASP A 1 30 ? 13.630  13.187  -9.057  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 3400  O OD2  . ASP A 1 30 ? 12.471  13.667  -7.250  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 3401  H H    . ASP A 1 30 ? 9.532   12.014  -10.847 1.00 0.00 ? 30  ASP A H    3  
ATOM 3402  H HA   . ASP A 1 30 ? 11.937  11.051  -9.533  1.00 0.00 ? 30  ASP A HA   3  
ATOM 3403  H HB2  . ASP A 1 30 ? 11.337  13.520  -10.179 1.00 0.00 ? 30  ASP A HB2  3  
ATOM 3404  H HB3  . ASP A 1 30 ? 10.444  13.504  -8.662  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 3405  N N    . LYS A 1 31 ? 9.495   9.939   -8.322  1.00 0.00 ? 31  LYS A N    3  
ATOM 3406  C CA   . LYS A 1 31 ? 8.798   9.298   -7.211  1.00 0.00 ? 31  LYS A CA   3  
ATOM 3407  C C    . LYS A 1 31 ? 8.903   7.777   -7.319  1.00 0.00 ? 31  LYS A C    3  
ATOM 3408  O O    . LYS A 1 31 ? 9.622   7.254   -8.175  1.00 0.00 ? 31  LYS A O    3  
ATOM 3409  C CB   . LYS A 1 31 ? 7.323   9.726   -7.183  1.00 0.00 ? 31  LYS A CB   3  
ATOM 3410  C CG   . LYS A 1 31 ? 7.109   11.207  -7.461  1.00 0.00 ? 31  LYS A CG   3  
ATOM 3411  C CD   . LYS A 1 31 ? 6.493   11.429  -8.834  1.00 0.00 ? 31  LYS A CD   3  
ATOM 3412  C CE   . LYS A 1 31 ? 5.468   12.555  -8.819  1.00 0.00 ? 31  LYS A CE   3  
ATOM 3413  N NZ   . LYS A 1 31 ? 6.039   13.843  -9.309  1.00 0.00 ? 31  LYS A NZ   3  
ATOM 3414  H H    . LYS A 1 31 ? 9.357   9.593   -9.224  1.00 0.00 ? 31  LYS A H    3  
ATOM 3415  H HA   . LYS A 1 31 ? 9.272   9.613   -6.296  1.00 0.00 ? 31  LYS A HA   3  
ATOM 3416  H HB2  . LYS A 1 31 ? 6.782   9.160   -7.927  1.00 0.00 ? 31  LYS A HB2  3  
ATOM 3417  H HB3  . LYS A 1 31 ? 6.913   9.502   -6.209  1.00 0.00 ? 31  LYS A HB3  3  
ATOM 3418  H HG2  . LYS A 1 31 ? 6.452   11.614  -6.709  1.00 0.00 ? 31  LYS A HG2  3  
ATOM 3419  H HG3  . LYS A 1 31 ? 8.063   11.711  -7.419  1.00 0.00 ? 31  LYS A HG3  3  
ATOM 3420  H HD2  . LYS A 1 31 ? 7.277   11.679  -9.531  1.00 0.00 ? 31  LYS A HD2  3  
ATOM 3421  H HD3  . LYS A 1 31 ? 6.007   10.518  -9.150  1.00 0.00 ? 31  LYS A HD3  3  
ATOM 3422  H HE2  . LYS A 1 31 ? 4.640   12.276  -9.455  1.00 0.00 ? 31  LYS A HE2  3  
ATOM 3423  H HE3  . LYS A 1 31 ? 5.114   12.689  -7.808  1.00 0.00 ? 31  LYS A HE3  3  
ATOM 3424  H HZ1  . LYS A 1 31 ? 5.303   14.398  -9.792  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM 3425  H HZ2  . LYS A 1 31 ? 6.816   13.664  -9.977  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM 3426  H HZ3  . LYS A 1 31 ? 6.406   14.398  -8.509  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM 3427  N N    . LEU A 1 32 ? 8.184   7.070   -6.448  1.00 0.00 ? 32  LEU A N    3  
ATOM 3428  C CA   . LEU A 1 32 ? 8.198   5.611   -6.447  1.00 0.00 ? 32  LEU A CA   3  
ATOM 3429  C C    . LEU A 1 32 ? 6.818   5.053   -6.116  1.00 0.00 ? 32  LEU A C    3  
ATOM 3430  O O    . LEU A 1 32 ? 6.174   5.494   -5.160  1.00 0.00 ? 32  LEU A O    3  
ATOM 3431  C CB   . LEU A 1 32 ? 9.228   5.085   -5.445  1.00 0.00 ? 32  LEU A CB   3  
ATOM 3432  C CG   . LEU A 1 32 ? 10.370  4.275   -6.065  1.00 0.00 ? 32  LEU A CG   3  
ATOM 3433  C CD1  . LEU A 1 32 ? 11.635  5.115   -6.169  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 3434  C CD2  . LEU A 1 32 ? 10.627  3.010   -5.259  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 3435  H H    . LEU A 1 32 ? 7.632   7.540   -5.790  1.00 0.00 ? 32  LEU A H    3  
ATOM 3436  H HA   . LEU A 1 32 ? 8.475   5.282   -7.439  1.00 0.00 ? 32  LEU A HA   3  
ATOM 3437  H HB2  . LEU A 1 32 ? 9.651   5.928   -4.917  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 3438  H HB3  . LEU A 1 32 ? 8.716   4.456   -4.732  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 3439  H HG   . LEU A 1 32 ? 10.088  3.981   -7.065  1.00 0.00 ? 32  LEU A HG   3  
ATOM 3440  H HD11 . LEU A 1 32 ? 11.392  6.082   -6.584  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 3441  H HD12 . LEU A 1 32 ? 12.346  4.617   -6.812  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 3442  H HD13 . LEU A 1 32 ? 12.066  5.243   -5.187  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 3443  H HD21 . LEU A 1 32 ? 10.757  3.264   -4.217  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 3444  H HD22 . LEU A 1 32 ? 11.520  2.525   -5.625  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 3445  H HD23 . LEU A 1 32 ? 9.787   2.340   -5.365  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 3446  N N    . GLY A 1 33 ? 6.376   4.078   -6.908  1.00 0.00 ? 33  GLY A N    3  
ATOM 3447  C CA   . GLY A 1 33 ? 5.081   3.468   -6.684  1.00 0.00 ? 33  GLY A CA   3  
ATOM 3448  C C    . GLY A 1 33 ? 5.176   2.228   -5.816  1.00 0.00 ? 33  GLY A C    3  
ATOM 3449  O O    . GLY A 1 33 ? 5.849   1.264   -6.183  1.00 0.00 ? 33  GLY A O    3  
ATOM 3450  H H    . GLY A 1 33 ? 6.938   3.766   -7.650  1.00 0.00 ? 33  GLY A H    3  
ATOM 3451  H HA2  . GLY A 1 33 ? 4.435   4.187   -6.202  1.00 0.00 ? 33  GLY A HA2  3  
ATOM 3452  H HA3  . GLY A 1 33 ? 4.655   3.195   -7.637  1.00 0.00 ? 33  GLY A HA3  3  
ATOM 3453  N N    . ILE A 1 34 ? 4.506   2.250   -4.664  1.00 0.00 ? 34  ILE A N    3  
ATOM 3454  C CA   . ILE A 1 34 ? 4.523   1.111   -3.748  1.00 0.00 ? 34  ILE A CA   3  
ATOM 3455  C C    . ILE A 1 34 ? 3.408   0.130   -4.093  1.00 0.00 ? 34  ILE A C    3  
ATOM 3456  O O    . ILE A 1 34 ? 2.235   0.387   -3.825  1.00 0.00 ? 34  ILE A O    3  
ATOM 3457  C CB   . ILE A 1 34 ? 4.380   1.552   -2.273  1.00 0.00 ? 34  ILE A CB   3  
ATOM 3458  C CG1  . ILE A 1 34 ? 5.332   2.712   -1.970  1.00 0.00 ? 34  ILE A CG1  3  
ATOM 3459  C CG2  . ILE A 1 34 ? 4.647   0.380   -1.334  1.00 0.00 ? 34  ILE A CG2  3  
ATOM 3460  C CD1  . ILE A 1 34 ? 6.789   2.401   -2.258  1.00 0.00 ? 34  ILE A CD1  3  
ATOM 3461  H H    . ILE A 1 34 ? 3.988   3.048   -4.426  1.00 0.00 ? 34  ILE A H    3  
ATOM 3462  H HA   . ILE A 1 34 ? 5.475   0.611   -3.860  1.00 0.00 ? 34  ILE A HA   3  
ATOM 3463  H HB   . ILE A 1 34 ? 3.364   1.880   -2.117  1.00 0.00 ? 34  ILE A HB   3  
ATOM 3464  H HG12 . ILE A 1 34 ? 5.053   3.563   -2.574  1.00 0.00 ? 34  ILE A HG12 3  
ATOM 3465  H HG13 . ILE A 1 34 ? 5.248   2.975   -0.926  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 3466  H HG21 . ILE A 1 34 ? 5.565   -0.111  -1.623  1.00 0.00 ? 34  ILE A HG21 3  
ATOM 3467  H HG22 . ILE A 1 34 ? 3.830   -0.323  -1.392  1.00 0.00 ? 34  ILE A HG22 3  
ATOM 3468  H HG23 . ILE A 1 34 ? 4.737   0.744   -0.321  1.00 0.00 ? 34  ILE A HG23 3  
ATOM 3469  H HD11 . ILE A 1 34 ? 6.956   2.414   -3.325  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 3470  H HD12 . ILE A 1 34 ? 7.033   1.424   -1.867  1.00 0.00 ? 34  ILE A HD12 3  
ATOM 3471  H HD13 . ILE A 1 34 ? 7.416   3.144   -1.786  1.00 0.00 ? 34  ILE A HD13 3  
ATOM 3472  N N    . TYR A 1 35 ? 3.785   -0.991  -4.699  1.00 0.00 ? 35  TYR A N    3  
ATOM 3473  C CA   . TYR A 1 35 ? 2.823   -2.013  -5.097  1.00 0.00 ? 35  TYR A CA   3  
ATOM 3474  C C    . TYR A 1 35 ? 2.777   -3.155  -4.083  1.00 0.00 ? 35  TYR A C    3  
ATOM 3475  O O    . TYR A 1 35 ? 3.621   -3.233  -3.193  1.00 0.00 ? 35  TYR A O    3  
ATOM 3476  C CB   . TYR A 1 35 ? 3.185   -2.552  -6.483  1.00 0.00 ? 35  TYR A CB   3  
ATOM 3477  C CG   . TYR A 1 35 ? 3.274   -1.472  -7.540  1.00 0.00 ? 35  TYR A CG   3  
ATOM 3478  C CD1  . TYR A 1 35 ? 4.466   -0.794  -7.773  1.00 0.00 ? 35  TYR A CD1  3  
ATOM 3479  C CD2  . TYR A 1 35 ? 2.167   -1.131  -8.305  1.00 0.00 ? 35  TYR A CD2  3  
ATOM 3480  C CE1  . TYR A 1 35 ? 4.547   0.197   -8.731  1.00 0.00 ? 35  TYR A CE1  3  
ATOM 3481  C CE2  . TYR A 1 35 ? 2.242   -0.141  -9.265  1.00 0.00 ? 35  TYR A CE2  3  
ATOM 3482  C CZ   . TYR A 1 35 ? 3.435   0.517   -9.477  1.00 0.00 ? 35  TYR A CZ   3  
ATOM 3483  O OH   . TYR A 1 35 ? 3.513   1.505   -10.434 1.00 0.00 ? 35  TYR A OH   3  
ATOM 3484  H H    . TYR A 1 35 ? 4.738   -1.132  -4.893  1.00 0.00 ? 35  TYR A H    3  
ATOM 3485  H HA   . TYR A 1 35 ? 1.850   -1.550  -5.146  1.00 0.00 ? 35  TYR A HA   3  
ATOM 3486  H HB2  . TYR A 1 35 ? 4.143   -3.046  -6.430  1.00 0.00 ? 35  TYR A HB2  3  
ATOM 3487  H HB3  . TYR A 1 35 ? 2.435   -3.263  -6.794  1.00 0.00 ? 35  TYR A HB3  3  
ATOM 3488  H HD1  . TYR A 1 35 ? 5.338   -1.045  -7.188  1.00 0.00 ? 35  TYR A HD1  3  
ATOM 3489  H HD2  . TYR A 1 35 ? 1.233   -1.648  -8.137  1.00 0.00 ? 35  TYR A HD2  3  
ATOM 3490  H HE1  . TYR A 1 35 ? 5.482   0.712   -8.894  1.00 0.00 ? 35  TYR A HE1  3  
ATOM 3491  H HE2  . TYR A 1 35 ? 1.368   0.113   -9.844  1.00 0.00 ? 35  TYR A HE2  3  
ATOM 3492  H HH   . TYR A 1 35 ? 4.255   1.328   -11.020 1.00 0.00 ? 35  TYR A HH   3  
ATOM 3493  N N    . VAL A 1 36 ? 1.790   -4.040  -4.225  1.00 0.00 ? 36  VAL A N    3  
ATOM 3494  C CA   . VAL A 1 36 ? 1.644   -5.181  -3.320  1.00 0.00 ? 36  VAL A CA   3  
ATOM 3495  C C    . VAL A 1 36 ? 2.274   -6.437  -3.917  1.00 0.00 ? 36  VAL A C    3  
ATOM 3496  O O    . VAL A 1 36 ? 2.146   -6.702  -5.112  1.00 0.00 ? 36  VAL A O    3  
ATOM 3497  C CB   . VAL A 1 36 ? 0.161   -5.469  -2.986  1.00 0.00 ? 36  VAL A CB   3  
ATOM 3498  C CG1  . VAL A 1 36 ? 0.046   -6.569  -1.937  1.00 0.00 ? 36  VAL A CG1  3  
ATOM 3499  C CG2  . VAL A 1 36 ? -0.539  -4.203  -2.513  1.00 0.00 ? 36  VAL A CG2  3  
ATOM 3500  H H    . VAL A 1 36 ? 1.148   -3.927  -4.958  1.00 0.00 ? 36  VAL A H    3  
ATOM 3501  H HA   . VAL A 1 36 ? 2.157   -4.940  -2.399  1.00 0.00 ? 36  VAL A HA   3  
ATOM 3502  H HB   . VAL A 1 36 ? -0.329  -5.811  -3.886  1.00 0.00 ? 36  VAL A HB   3  
ATOM 3503  H HG11 . VAL A 1 36 ? 0.569   -7.450  -2.278  1.00 0.00 ? 36  VAL A HG11 3  
ATOM 3504  H HG12 . VAL A 1 36 ? -0.996  -6.808  -1.779  1.00 0.00 ? 36  VAL A HG12 3  
ATOM 3505  H HG13 . VAL A 1 36 ? 0.482   -6.229  -1.010  1.00 0.00 ? 36  VAL A HG13 3  
ATOM 3506  H HG21 . VAL A 1 36 ? -1.293  -4.459  -1.783  1.00 0.00 ? 36  VAL A HG21 3  
ATOM 3507  H HG22 . VAL A 1 36 ? -1.005  -3.714  -3.356  1.00 0.00 ? 36  VAL A HG22 3  
ATOM 3508  H HG23 . VAL A 1 36 ? 0.185   -3.538  -2.067  1.00 0.00 ? 36  VAL A HG23 3  
ATOM 3509  N N    . LYS A 1 37 ? 2.948   -7.204  -3.068  1.00 0.00 ? 37  LYS A N    3  
ATOM 3510  C CA   . LYS A 1 37 ? 3.600   -8.440  -3.485  1.00 0.00 ? 37  LYS A CA   3  
ATOM 3511  C C    . LYS A 1 37 ? 2.754   -9.653  -3.104  1.00 0.00 ? 37  LYS A C    3  
ATOM 3512  O O    . LYS A 1 37 ? 2.574   -10.566 -3.911  1.00 0.00 ? 37  LYS A O    3  
ATOM 3513  C CB   . LYS A 1 37 ? 4.983   -8.554  -2.839  1.00 0.00 ? 37  LYS A CB   3  
ATOM 3514  C CG   . LYS A 1 37 ? 5.792   -9.741  -3.338  1.00 0.00 ? 37  LYS A CG   3  
ATOM 3515  C CD   . LYS A 1 37 ? 6.242   -9.546  -4.778  1.00 0.00 ? 37  LYS A CD   3  
ATOM 3516  C CE   . LYS A 1 37 ? 6.237   -10.858 -5.550  1.00 0.00 ? 37  LYS A CE   3  
ATOM 3517  N NZ   . LYS A 1 37 ? 7.456   -11.017 -6.395  1.00 0.00 ? 37  LYS A NZ   3  
ATOM 3518  H H    . LYS A 1 37 ? 3.006   -6.933  -2.127  1.00 0.00 ? 37  LYS A H    3  
ATOM 3519  H HA   . LYS A 1 37 ? 3.712   -8.413  -4.559  1.00 0.00 ? 37  LYS A HA   3  
ATOM 3520  H HB2  . LYS A 1 37 ? 5.539   -7.652  -3.043  1.00 0.00 ? 37  LYS A HB2  3  
ATOM 3521  H HB3  . LYS A 1 37 ? 4.859   -8.655  -1.771  1.00 0.00 ? 37  LYS A HB3  3  
ATOM 3522  H HG2  . LYS A 1 37 ? 6.664   -9.857  -2.713  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 3523  H HG3  . LYS A 1 37 ? 5.181   -10.631 -3.277  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 3524  H HD2  . LYS A 1 37 ? 5.571   -8.854  -5.263  1.00 0.00 ? 37  LYS A HD2  3  
ATOM 3525  H HD3  . LYS A 1 37 ? 7.243   -9.141  -4.777  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 3526  H HE2  . LYS A 1 37 ? 6.190   -11.675 -4.847  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 3527  H HE3  . LYS A 1 37 ? 5.364   -10.882 -6.186  1.00 0.00 ? 37  LYS A HE3  3  
ATOM 3528  H HZ1  . LYS A 1 37 ? 7.224   -11.543 -7.262  1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 3529  H HZ2  . LYS A 1 37 ? 8.187   -11.540 -5.872  1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 3530  H HZ3  . LYS A 1 37 ? 7.836   -10.085 -6.660  1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 3531  N N    . SER A 1 38 ? 2.246   -9.653  -1.866  1.00 0.00 ? 38  SER A N    3  
ATOM 3532  C CA   . SER A 1 38 ? 1.426   -10.754 -1.360  1.00 0.00 ? 38  SER A CA   3  
ATOM 3533  C C    . SER A 1 38 ? 0.619   -10.318 -0.133  1.00 0.00 ? 38  SER A C    3  
ATOM 3534  O O    . SER A 1 38 ? 0.847   -9.240  0.421   1.00 0.00 ? 38  SER A O    3  
ATOM 3535  C CB   . SER A 1 38 ? 2.310   -11.956 -0.994  1.00 0.00 ? 38  SER A CB   3  
ATOM 3536  O OG   . SER A 1 38 ? 3.163   -12.325 -2.067  1.00 0.00 ? 38  SER A OG   3  
ATOM 3537  H H    . SER A 1 38 ? 2.433   -8.892  -1.275  1.00 0.00 ? 38  SER A H    3  
ATOM 3538  H HA   . SER A 1 38 ? 0.742   -11.046 -2.141  1.00 0.00 ? 38  SER A HA   3  
ATOM 3539  H HB2  . SER A 1 38 ? 2.921   -11.704 -0.141  1.00 0.00 ? 38  SER A HB2  3  
ATOM 3540  H HB3  . SER A 1 38 ? 1.682   -12.797 -0.746  1.00 0.00 ? 38  SER A HB3  3  
ATOM 3541  H HG   . SER A 1 38 ? 2.638   -12.478 -2.857  1.00 0.00 ? 38  SER A HG   3  
ATOM 3542  N N    . VAL A 1 39 ? -0.318  -11.167 0.289   1.00 0.00 ? 39  VAL A N    3  
ATOM 3543  C CA   . VAL A 1 39 ? -1.153  -10.879 1.452   1.00 0.00 ? 39  VAL A CA   3  
ATOM 3544  C C    . VAL A 1 39 ? -1.211  -12.086 2.383   1.00 0.00 ? 39  VAL A C    3  
ATOM 3545  O O    . VAL A 1 39 ? -1.725  -13.144 2.015   1.00 0.00 ? 39  VAL A O    3  
ATOM 3546  C CB   . VAL A 1 39 ? -2.585  -10.472 1.044   1.00 0.00 ? 39  VAL A CB   3  
ATOM 3547  C CG1  . VAL A 1 39 ? -2.606  -9.036  0.539   1.00 0.00 ? 39  VAL A CG1  3  
ATOM 3548  C CG2  . VAL A 1 39 ? -3.142  -11.423 -0.008  1.00 0.00 ? 39  VAL A CG2  3  
ATOM 3549  H H    . VAL A 1 39 ? -0.449  -12.012 -0.190  1.00 0.00 ? 39  VAL A H    3  
ATOM 3550  H HA   . VAL A 1 39 ? -0.705  -10.052 1.986   1.00 0.00 ? 39  VAL A HA   3  
ATOM 3551  H HB   . VAL A 1 39 ? -3.217  -10.529 1.920   1.00 0.00 ? 39  VAL A HB   3  
ATOM 3552  H HG11 . VAL A 1 39 ? -3.586  -8.612  0.697   1.00 0.00 ? 39  VAL A HG11 3  
ATOM 3553  H HG12 . VAL A 1 39 ? -2.374  -9.022  -0.516  1.00 0.00 ? 39  VAL A HG12 3  
ATOM 3554  H HG13 . VAL A 1 39 ? -1.871  -8.455  1.077   1.00 0.00 ? 39  VAL A HG13 3  
ATOM 3555  H HG21 . VAL A 1 39 ? -4.196  -11.577 0.169   1.00 0.00 ? 39  VAL A HG21 3  
ATOM 3556  H HG22 . VAL A 1 39 ? -2.626  -12.370 0.052   1.00 0.00 ? 39  VAL A HG22 3  
ATOM 3557  H HG23 . VAL A 1 39 ? -3.001  -10.997 -0.991  1.00 0.00 ? 39  VAL A HG23 3  
ATOM 3558  N N    . VAL A 1 40 ? -0.669  -11.923 3.587   1.00 0.00 ? 40  VAL A N    3  
ATOM 3559  C CA   . VAL A 1 40 ? -0.648  -13.003 4.571   1.00 0.00 ? 40  VAL A CA   3  
ATOM 3560  C C    . VAL A 1 40 ? -2.046  -13.276 5.117   1.00 0.00 ? 40  VAL A C    3  
ATOM 3561  O O    . VAL A 1 40 ? -2.730  -12.364 5.588   1.00 0.00 ? 40  VAL A O    3  
ATOM 3562  C CB   . VAL A 1 40 ? 0.304   -12.688 5.747   1.00 0.00 ? 40  VAL A CB   3  
ATOM 3563  C CG1  . VAL A 1 40 ? 0.407   -13.874 6.693   1.00 0.00 ? 40  VAL A CG1  3  
ATOM 3564  C CG2  . VAL A 1 40 ? 1.682   -12.286 5.235   1.00 0.00 ? 40  VAL A CG2  3  
ATOM 3565  H H    . VAL A 1 40 ? -0.269  -11.053 3.820   1.00 0.00 ? 40  VAL A H    3  
ATOM 3566  H HA   . VAL A 1 40 ? -0.289  -13.894 4.074   1.00 0.00 ? 40  VAL A HA   3  
ATOM 3567  H HB   . VAL A 1 40 ? -0.105  -11.856 6.299   1.00 0.00 ? 40  VAL A HB   3  
ATOM 3568  H HG11 . VAL A 1 40 ? -0.539  -14.017 7.194   1.00 0.00 ? 40  VAL A HG11 3  
ATOM 3569  H HG12 . VAL A 1 40 ? 1.177   -13.684 7.426   1.00 0.00 ? 40  VAL A HG12 3  
ATOM 3570  H HG13 . VAL A 1 40 ? 0.655   -14.763 6.132   1.00 0.00 ? 40  VAL A HG13 3  
ATOM 3571  H HG21 . VAL A 1 40 ? 2.038   -13.026 4.534   1.00 0.00 ? 40  VAL A HG21 3  
ATOM 3572  H HG22 . VAL A 1 40 ? 2.370   -12.217 6.066   1.00 0.00 ? 40  VAL A HG22 3  
ATOM 3573  H HG23 . VAL A 1 40 ? 1.619   -11.326 4.743   1.00 0.00 ? 40  VAL A HG23 3  
ATOM 3574  N N    . LYS A 1 41 ? -2.463  -14.539 5.048   1.00 0.00 ? 41  LYS A N    3  
ATOM 3575  C CA   . LYS A 1 41 ? -3.780  -14.947 5.534   1.00 0.00 ? 41  LYS A CA   3  
ATOM 3576  C C    . LYS A 1 41 ? -3.934  -14.647 7.023   1.00 0.00 ? 41  LYS A C    3  
ATOM 3577  O O    . LYS A 1 41 ? -2.958  -14.674 7.776   1.00 0.00 ? 41  LYS A O    3  
ATOM 3578  C CB   . LYS A 1 41 ? -4.001  -16.442 5.281   1.00 0.00 ? 41  LYS A CB   3  
ATOM 3579  C CG   . LYS A 1 41 ? -4.967  -16.733 4.144   1.00 0.00 ? 41  LYS A CG   3  
ATOM 3580  C CD   . LYS A 1 41 ? -4.245  -16.827 2.809   1.00 0.00 ? 41  LYS A CD   3  
ATOM 3581  C CE   . LYS A 1 41 ? -4.952  -17.779 1.856   1.00 0.00 ? 41  LYS A CE   3  
ATOM 3582  N NZ   . LYS A 1 41 ? -4.456  -17.645 0.457   1.00 0.00 ? 41  LYS A NZ   3  
ATOM 3583  H H    . LYS A 1 41 ? -1.869  -15.215 4.661   1.00 0.00 ? 41  LYS A H    3  
ATOM 3584  H HA   . LYS A 1 41 ? -4.522  -14.384 4.988   1.00 0.00 ? 41  LYS A HA   3  
ATOM 3585  H HB2  . LYS A 1 41 ? -3.052  -16.900 5.044   1.00 0.00 ? 41  LYS A HB2  3  
ATOM 3586  H HB3  . LYS A 1 41 ? -4.393  -16.893 6.180   1.00 0.00 ? 41  LYS A HB3  3  
ATOM 3587  H HG2  . LYS A 1 41 ? -5.466  -17.671 4.340   1.00 0.00 ? 41  LYS A HG2  3  
ATOM 3588  H HG3  . LYS A 1 41 ? -5.698  -15.939 4.092   1.00 0.00 ? 41  LYS A HG3  3  
ATOM 3589  H HD2  . LYS A 1 41 ? -4.210  -15.845 2.360   1.00 0.00 ? 41  LYS A HD2  3  
ATOM 3590  H HD3  . LYS A 1 41 ? -3.240  -17.183 2.979   1.00 0.00 ? 41  LYS A HD3  3  
ATOM 3591  H HE2  . LYS A 1 41 ? -4.784  -18.792 2.191   1.00 0.00 ? 41  LYS A HE2  3  
ATOM 3592  H HE3  . LYS A 1 41 ? -6.011  -17.565 1.875   1.00 0.00 ? 41  LYS A HE3  3  
ATOM 3593  H HZ1  . LYS A 1 41 ? -3.683  -18.318 0.285   1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 3594  H HZ2  . LYS A 1 41 ? -4.103  -16.680 0.290   1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 3595  H HZ3  . LYS A 1 41 ? -5.226  -17.839 -0.216  1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 3596  N N    . GLY A 1 42 ? -5.167  -14.362 7.439   1.00 0.00 ? 42  GLY A N    3  
ATOM 3597  C CA   . GLY A 1 42 ? -5.432  -14.058 8.836   1.00 0.00 ? 42  GLY A CA   3  
ATOM 3598  C C    . GLY A 1 42 ? -5.523  -12.567 9.112   1.00 0.00 ? 42  GLY A C    3  
ATOM 3599  O O    . GLY A 1 42 ? -6.157  -12.158 10.086  1.00 0.00 ? 42  GLY A O    3  
ATOM 3600  H H    . GLY A 1 42 ? -5.904  -14.355 6.792   1.00 0.00 ? 42  GLY A H    3  
ATOM 3601  H HA2  . GLY A 1 42 ? -6.366  -14.522 9.120   1.00 0.00 ? 42  GLY A HA2  3  
ATOM 3602  H HA3  . GLY A 1 42 ? -4.641  -14.474 9.440   1.00 0.00 ? 42  GLY A HA3  3  
ATOM 3603  N N    . GLY A 1 43 ? -4.895  -11.753 8.258   1.00 0.00 ? 43  GLY A N    3  
ATOM 3604  C CA   . GLY A 1 43 ? -4.930  -10.313 8.438   1.00 0.00 ? 43  GLY A CA   3  
ATOM 3605  C C    . GLY A 1 43 ? -6.302  -9.721  8.148   1.00 0.00 ? 43  GLY A C    3  
ATOM 3606  O O    . GLY A 1 43 ? -7.293  -10.447 8.053   1.00 0.00 ? 43  GLY A O    3  
ATOM 3607  H H    . GLY A 1 43 ? -4.407  -12.134 7.497   1.00 0.00 ? 43  GLY A H    3  
ATOM 3608  H HA2  . GLY A 1 43 ? -4.659  -10.084 9.458   1.00 0.00 ? 43  GLY A HA2  3  
ATOM 3609  H HA3  . GLY A 1 43 ? -4.206  -9.862  7.775   1.00 0.00 ? 43  GLY A HA3  3  
ATOM 3610  N N    . ALA A 1 44 ? -6.363  -8.400  8.008   1.00 0.00 ? 44  ALA A N    3  
ATOM 3611  C CA   . ALA A 1 44 ? -7.624  -7.718  7.732   1.00 0.00 ? 44  ALA A CA   3  
ATOM 3612  C C    . ALA A 1 44 ? -7.875  -7.586  6.234   1.00 0.00 ? 44  ALA A C    3  
ATOM 3613  O O    . ALA A 1 44 ? -8.939  -7.964  5.743   1.00 0.00 ? 44  ALA A O    3  
ATOM 3614  C CB   . ALA A 1 44 ? -7.639  -6.341  8.386   1.00 0.00 ? 44  ALA A CB   3  
ATOM 3615  H H    . ALA A 1 44 ? -5.542  -7.872  8.093   1.00 0.00 ? 44  ALA A H    3  
ATOM 3616  H HA   . ALA A 1 44 ? -8.421  -8.304  8.168   1.00 0.00 ? 44  ALA A HA   3  
ATOM 3617  H HB1  . ALA A 1 44 ? -7.835  -6.445  9.442   1.00 0.00 ? 44  ALA A HB1  3  
ATOM 3618  H HB2  . ALA A 1 44 ? -8.413  -5.738  7.933   1.00 0.00 ? 44  ALA A HB2  3  
ATOM 3619  H HB3  . ALA A 1 44 ? -6.681  -5.865  8.241   1.00 0.00 ? 44  ALA A HB3  3  
ATOM 3620  N N    . ALA A 1 45 ? -6.895  -7.035  5.517   1.00 0.00 ? 45  ALA A N    3  
ATOM 3621  C CA   . ALA A 1 45 ? -7.010  -6.832  4.071   1.00 0.00 ? 45  ALA A CA   3  
ATOM 3622  C C    . ALA A 1 45 ? -7.447  -8.105  3.346   1.00 0.00 ? 45  ALA A C    3  
ATOM 3623  O O    . ALA A 1 45 ? -8.220  -8.042  2.388   1.00 0.00 ? 45  ALA A O    3  
ATOM 3624  C CB   . ALA A 1 45 ? -5.692  -6.325  3.499   1.00 0.00 ? 45  ALA A CB   3  
ATOM 3625  H H    . ALA A 1 45 ? -6.076  -6.748  5.975   1.00 0.00 ? 45  ALA A H    3  
ATOM 3626  H HA   . ALA A 1 45 ? -7.756  -6.069  3.907   1.00 0.00 ? 45  ALA A HA   3  
ATOM 3627  H HB1  . ALA A 1 45 ? -5.147  -7.148  3.062   1.00 0.00 ? 45  ALA A HB1  3  
ATOM 3628  H HB2  . ALA A 1 45 ? -5.103  -5.883  4.288   1.00 0.00 ? 45  ALA A HB2  3  
ATOM 3629  H HB3  . ALA A 1 45 ? -5.893  -5.581  2.740   1.00 0.00 ? 45  ALA A HB3  3  
ATOM 3630  N N    . ASP A 1 46 ? -6.942  -9.251  3.800   1.00 0.00 ? 46  ASP A N    3  
ATOM 3631  C CA   . ASP A 1 46 ? -7.272  -10.532 3.185   1.00 0.00 ? 46  ASP A CA   3  
ATOM 3632  C C    . ASP A 1 46 ? -8.726  -10.920 3.439   1.00 0.00 ? 46  ASP A C    3  
ATOM 3633  O O    . ASP A 1 46 ? -9.479  -11.170 2.497   1.00 0.00 ? 46  ASP A O    3  
ATOM 3634  C CB   . ASP A 1 46 ? -6.334  -11.631 3.701   1.00 0.00 ? 46  ASP A CB   3  
ATOM 3635  C CG   . ASP A 1 46 ? -6.013  -12.677 2.646   1.00 0.00 ? 46  ASP A CG   3  
ATOM 3636  O OD1  . ASP A 1 46 ? -6.009  -12.337 1.441   1.00 0.00 ? 46  ASP A OD1  3  
ATOM 3637  O OD2  . ASP A 1 46 ? -5.764  -13.841 3.025   1.00 0.00 ? 46  ASP A OD2  3  
ATOM 3638  H H    . ASP A 1 46 ? -6.326  -9.232  4.562   1.00 0.00 ? 46  ASP A H    3  
ATOM 3639  H HA   . ASP A 1 46 ? -7.128  -10.425 2.120   1.00 0.00 ? 46  ASP A HA   3  
ATOM 3640  H HB2  . ASP A 1 46 ? -5.407  -11.182 4.026   1.00 0.00 ? 46  ASP A HB2  3  
ATOM 3641  H HB3  . ASP A 1 46 ? -6.801  -12.126 4.541   1.00 0.00 ? 46  ASP A HB3  3  
ATOM 3642  N N    . VAL A 1 47 ? -9.115  -10.970 4.713   1.00 0.00 ? 47  VAL A N    3  
ATOM 3643  C CA   . VAL A 1 47 ? -10.483 -11.332 5.083   1.00 0.00 ? 47  VAL A CA   3  
ATOM 3644  C C    . VAL A 1 47 ? -11.495 -10.308 4.561   1.00 0.00 ? 47  VAL A C    3  
ATOM 3645  O O    . VAL A 1 47 ? -12.634 -10.658 4.248   1.00 0.00 ? 47  VAL A O    3  
ATOM 3646  C CB   . VAL A 1 47 ? -10.644 -11.471 6.614   1.00 0.00 ? 47  VAL A CB   3  
ATOM 3647  C CG1  . VAL A 1 47 ? -12.043 -11.966 6.961   1.00 0.00 ? 47  VAL A CG1  3  
ATOM 3648  C CG2  . VAL A 1 47 ? -9.582  -12.402 7.189   1.00 0.00 ? 47  VAL A CG2  3  
ATOM 3649  H H    . VAL A 1 47 ? -8.468  -10.759 5.419   1.00 0.00 ? 47  VAL A H    3  
ATOM 3650  H HA   . VAL A 1 47 ? -10.700 -12.292 4.635   1.00 0.00 ? 47  VAL A HA   3  
ATOM 3651  H HB   . VAL A 1 47 ? -10.514 -10.494 7.057   1.00 0.00 ? 47  VAL A HB   3  
ATOM 3652  H HG11 . VAL A 1 47 ? -12.425 -12.566 6.148   1.00 0.00 ? 47  VAL A HG11 3  
ATOM 3653  H HG12 . VAL A 1 47 ? -12.695 -11.120 7.119   1.00 0.00 ? 47  VAL A HG12 3  
ATOM 3654  H HG13 . VAL A 1 47 ? -12.002 -12.562 7.860   1.00 0.00 ? 47  VAL A HG13 3  
ATOM 3655  H HG21 . VAL A 1 47 ? -8.613  -11.929 7.125   1.00 0.00 ? 47  VAL A HG21 3  
ATOM 3656  H HG22 . VAL A 1 47 ? -9.568  -13.325 6.629   1.00 0.00 ? 47  VAL A HG22 3  
ATOM 3657  H HG23 . VAL A 1 47 ? -9.810  -12.613 8.224   1.00 0.00 ? 47  VAL A HG23 3  
ATOM 3658  N N    . ASP A 1 48 ? -11.071 -9.045  4.468   1.00 0.00 ? 48  ASP A N    3  
ATOM 3659  C CA   . ASP A 1 48 ? -11.938 -7.973  3.983   1.00 0.00 ? 48  ASP A CA   3  
ATOM 3660  C C    . ASP A 1 48 ? -12.295 -8.178  2.509   1.00 0.00 ? 48  ASP A C    3  
ATOM 3661  O O    . ASP A 1 48 ? -13.473 -8.245  2.154   1.00 0.00 ? 48  ASP A O    3  
ATOM 3662  C CB   . ASP A 1 48 ? -11.258 -6.611  4.176   1.00 0.00 ? 48  ASP A CB   3  
ATOM 3663  C CG   . ASP A 1 48 ? -11.545 -5.998  5.535   1.00 0.00 ? 48  ASP A CG   3  
ATOM 3664  O OD1  . ASP A 1 48 ? -12.728 -5.720  5.824   1.00 0.00 ? 48  ASP A OD1  3  
ATOM 3665  O OD2  . ASP A 1 48 ? -10.585 -5.790  6.309   1.00 0.00 ? 48  ASP A OD2  3  
ATOM 3666  H H    . ASP A 1 48 ? -10.151 -8.829  4.733   1.00 0.00 ? 48  ASP A H    3  
ATOM 3667  H HA   . ASP A 1 48 ? -12.847 -7.997  4.565   1.00 0.00 ? 48  ASP A HA   3  
ATOM 3668  H HB2  . ASP A 1 48 ? -10.189 -6.732  4.077   1.00 0.00 ? 48  ASP A HB2  3  
ATOM 3669  H HB3  . ASP A 1 48 ? -11.608 -5.930  3.414   1.00 0.00 ? 48  ASP A HB3  3  
ATOM 3670  N N    . GLY A 1 49 ? -11.272 -8.276  1.656   1.00 0.00 ? 49  GLY A N    3  
ATOM 3671  C CA   . GLY A 1 49 ? -11.501 -8.472  0.234   1.00 0.00 ? 49  GLY A CA   3  
ATOM 3672  C C    . GLY A 1 49 ? -11.656 -7.164  -0.522  1.00 0.00 ? 49  GLY A C    3  
ATOM 3673  O O    . GLY A 1 49 ? -12.675 -6.937  -1.176  1.00 0.00 ? 49  GLY A O    3  
ATOM 3674  H H    . GLY A 1 49 ? -10.353 -8.217  1.996   1.00 0.00 ? 49  GLY A H    3  
ATOM 3675  H HA2  . GLY A 1 49 ? -10.666 -9.016  -0.182  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 3676  H HA3  . GLY A 1 49 ? -12.398 -9.059  0.102   1.00 0.00 ? 49  GLY A HA3  3  
ATOM 3677  N N    . ARG A 1 50 ? -10.638 -6.306  -0.436  1.00 0.00 ? 50  ARG A N    3  
ATOM 3678  C CA   . ARG A 1 50 ? -10.656 -5.014  -1.123  1.00 0.00 ? 50  ARG A CA   3  
ATOM 3679  C C    . ARG A 1 50 ? -9.499  -4.906  -2.113  1.00 0.00 ? 50  ARG A C    3  
ATOM 3680  O O    . ARG A 1 50 ? -9.687  -4.474  -3.251  1.00 0.00 ? 50  ARG A O    3  
ATOM 3681  C CB   . ARG A 1 50 ? -10.590 -3.860  -0.117  1.00 0.00 ? 50  ARG A CB   3  
ATOM 3682  C CG   . ARG A 1 50 ? -11.936 -3.198  0.133   1.00 0.00 ? 50  ARG A CG   3  
ATOM 3683  C CD   . ARG A 1 50 ? -12.261 -2.167  -0.939  1.00 0.00 ? 50  ARG A CD   3  
ATOM 3684  N NE   . ARG A 1 50 ? -13.082 -2.729  -2.013  1.00 0.00 ? 50  ARG A NE   3  
ATOM 3685  C CZ   . ARG A 1 50 ? -14.404 -2.922  -1.926  1.00 0.00 ? 50  ARG A CZ   3  
ATOM 3686  N NH1  . ARG A 1 50 ? -15.062 -2.604  -0.812  1.00 0.00 ? 50  ARG A NH1  3  
ATOM 3687  N NH2  . ARG A 1 50 ? -15.070 -3.436  -2.956  1.00 0.00 ? 50  ARG A NH2  3  
ATOM 3688  H H    . ARG A 1 50 ? -9.853  -6.552  0.098   1.00 0.00 ? 50  ARG A H    3  
ATOM 3689  H HA   . ARG A 1 50 ? -11.584 -4.945  -1.670  1.00 0.00 ? 50  ARG A HA   3  
ATOM 3690  H HB2  . ARG A 1 50 ? -10.215 -4.233  0.824   1.00 0.00 ? 50  ARG A HB2  3  
ATOM 3691  H HB3  . ARG A 1 50 ? -9.910  -3.109  -0.494  1.00 0.00 ? 50  ARG A HB3  3  
ATOM 3692  H HG2  . ARG A 1 50 ? -12.704 -3.957  0.133   1.00 0.00 ? 50  ARG A HG2  3  
ATOM 3693  H HG3  . ARG A 1 50 ? -11.910 -2.709  1.096   1.00 0.00 ? 50  ARG A HG3  3  
ATOM 3694  H HD2  . ARG A 1 50 ? -12.794 -1.348  -0.480  1.00 0.00 ? 50  ARG A HD2  3  
ATOM 3695  H HD3  . ARG A 1 50 ? -11.335 -1.800  -1.359  1.00 0.00 ? 50  ARG A HD3  3  
ATOM 3696  H HE   . ARG A 1 50 ? -12.625 -2.975  -2.846  1.00 0.00 ? 50  ARG A HE   3  
ATOM 3697  H HH11 . ARG A 1 50 ? -14.571 -2.218  -0.030  1.00 0.00 ? 50  ARG A HH11 3  
ATOM 3698  H HH12 . ARG A 1 50 ? -16.051 -2.750  -0.756  1.00 0.00 ? 50  ARG A HH12 3  
ATOM 3699  H HH21 . ARG A 1 50 ? -14.585 -3.679  -3.796  1.00 0.00 ? 50  ARG A HH21 3  
ATOM 3700  H HH22 . ARG A 1 50 ? -16.059 -3.581  -2.892  1.00 0.00 ? 50  ARG A HH22 3  
ATOM 3701  N N    . LEU A 1 51 ? -8.303  -5.299  -1.671  1.00 0.00 ? 51  LEU A N    3  
ATOM 3702  C CA   . LEU A 1 51 ? -7.111  -5.249  -2.515  1.00 0.00 ? 51  LEU A CA   3  
ATOM 3703  C C    . LEU A 1 51 ? -6.392  -6.597  -2.523  1.00 0.00 ? 51  LEU A C    3  
ATOM 3704  O O    . LEU A 1 51 ? -6.787  -7.525  -1.813  1.00 0.00 ? 51  LEU A O    3  
ATOM 3705  C CB   . LEU A 1 51 ? -6.160  -4.148  -2.026  1.00 0.00 ? 51  LEU A CB   3  
ATOM 3706  C CG   . LEU A 1 51 ? -5.899  -4.132  -0.516  1.00 0.00 ? 51  LEU A CG   3  
ATOM 3707  C CD1  . LEU A 1 51 ? -4.874  -5.191  -0.129  1.00 0.00 ? 51  LEU A CD1  3  
ATOM 3708  C CD2  . LEU A 1 51 ? -5.438  -2.753  -0.071  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 3709  H H    . LEU A 1 51 ? -8.219  -5.631  -0.753  1.00 0.00 ? 51  LEU A H    3  
ATOM 3710  H HA   . LEU A 1 51 ? -7.427  -5.019  -3.522  1.00 0.00 ? 51  LEU A HA   3  
ATOM 3711  H HB2  . LEU A 1 51 ? -5.215  -4.267  -2.535  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 3712  H HB3  . LEU A 1 51 ? -6.582  -3.193  -2.305  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 3713  H HG   . LEU A 1 51 ? -6.819  -4.358  0.001   1.00 0.00 ? 51  LEU A HG   3  
ATOM 3714  H HD11 . LEU A 1 51 ? -3.980  -5.060  -0.720  1.00 0.00 ? 51  LEU A HD11 3  
ATOM 3715  H HD12 . LEU A 1 51 ? -5.285  -6.173  -0.310  1.00 0.00 ? 51  LEU A HD12 3  
ATOM 3716  H HD13 . LEU A 1 51 ? -4.632  -5.090  0.918   1.00 0.00 ? 51  LEU A HD13 3  
ATOM 3717  H HD21 . LEU A 1 51 ? -5.849  -2.535  0.904   1.00 0.00 ? 51  LEU A HD21 3  
ATOM 3718  H HD22 . LEU A 1 51 ? -5.781  -2.012  -0.779  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 3719  H HD23 . LEU A 1 51 ? -4.360  -2.731  -0.021  1.00 0.00 ? 51  LEU A HD23 3  
ATOM 3720  N N    . ALA A 1 52 ? -5.335  -6.697  -3.330  1.00 0.00 ? 52  ALA A N    3  
ATOM 3721  C CA   . ALA A 1 52 ? -4.554  -7.927  -3.438  1.00 0.00 ? 52  ALA A CA   3  
ATOM 3722  C C    . ALA A 1 52 ? -3.150  -7.648  -3.976  1.00 0.00 ? 52  ALA A C    3  
ATOM 3723  O O    . ALA A 1 52 ? -2.761  -6.492  -4.151  1.00 0.00 ? 52  ALA A O    3  
ATOM 3724  C CB   . ALA A 1 52 ? -5.278  -8.928  -4.331  1.00 0.00 ? 52  ALA A CB   3  
ATOM 3725  H H    . ALA A 1 52 ? -5.072  -5.920  -3.869  1.00 0.00 ? 52  ALA A H    3  
ATOM 3726  H HA   . ALA A 1 52 ? -4.471  -8.358  -2.450  1.00 0.00 ? 52  ALA A HA   3  
ATOM 3727  H HB1  . ALA A 1 52 ? -4.678  -9.820  -4.436  1.00 0.00 ? 52  ALA A HB1  3  
ATOM 3728  H HB2  . ALA A 1 52 ? -5.442  -8.489  -5.304  1.00 0.00 ? 52  ALA A HB2  3  
ATOM 3729  H HB3  . ALA A 1 52 ? -6.228  -9.184  -3.887  1.00 0.00 ? 52  ALA A HB3  3  
ATOM 3730  N N    . ALA A 1 53 ? -2.392  -8.717  -4.234  1.00 0.00 ? 53  ALA A N    3  
ATOM 3731  C CA   . ALA A 1 53 ? -1.032  -8.592  -4.752  1.00 0.00 ? 53  ALA A CA   3  
ATOM 3732  C C    . ALA A 1 53 ? -1.032  -8.046  -6.181  1.00 0.00 ? 53  ALA A C    3  
ATOM 3733  O O    . ALA A 1 53 ? -1.725  -8.571  -7.054  1.00 0.00 ? 53  ALA A O    3  
ATOM 3734  C CB   . ALA A 1 53 ? -0.323  -9.936  -4.699  1.00 0.00 ? 53  ALA A CB   3  
ATOM 3735  H H    . ALA A 1 53 ? -2.759  -9.611  -4.069  1.00 0.00 ? 53  ALA A H    3  
ATOM 3736  H HA   . ALA A 1 53 ? -0.495  -7.907  -4.114  1.00 0.00 ? 53  ALA A HA   3  
ATOM 3737  H HB1  . ALA A 1 53 ? -1.053  -10.729 -4.762  1.00 0.00 ? 53  ALA A HB1  3  
ATOM 3738  H HB2  . ALA A 1 53 ? 0.221   -10.019 -3.769  1.00 0.00 ? 53  ALA A HB2  3  
ATOM 3739  H HB3  . ALA A 1 53 ? 0.366   -10.014 -5.527  1.00 0.00 ? 53  ALA A HB3  3  
ATOM 3740  N N    . GLY A 1 54 ? -0.256  -6.985  -6.407  1.00 0.00 ? 54  GLY A N    3  
ATOM 3741  C CA   . GLY A 1 54 ? -0.179  -6.377  -7.728  1.00 0.00 ? 54  GLY A CA   3  
ATOM 3742  C C    . GLY A 1 54 ? -0.985  -5.092  -7.828  1.00 0.00 ? 54  GLY A C    3  
ATOM 3743  O O    . GLY A 1 54 ? -1.446  -4.727  -8.909  1.00 0.00 ? 54  GLY A O    3  
ATOM 3744  H H    . GLY A 1 54 ? 0.272   -6.611  -5.671  1.00 0.00 ? 54  GLY A H    3  
ATOM 3745  H HA2  . GLY A 1 54 ? 0.852   -6.157  -7.951  1.00 0.00 ? 54  GLY A HA2  3  
ATOM 3746  H HA3  . GLY A 1 54 ? -0.549  -7.080  -8.457  1.00 0.00 ? 54  GLY A HA3  3  
ATOM 3747  N N    . ASP A 1 55 ? -1.156  -4.406  -6.698  1.00 0.00 ? 55  ASP A N    3  
ATOM 3748  C CA   . ASP A 1 55 ? -1.915  -3.162  -6.658  1.00 0.00 ? 55  ASP A CA   3  
ATOM 3749  C C    . ASP A 1 55 ? -1.025  -2.010  -6.206  1.00 0.00 ? 55  ASP A C    3  
ATOM 3750  O O    . ASP A 1 55 ? -0.225  -2.166  -5.281  1.00 0.00 ? 55  ASP A O    3  
ATOM 3751  C CB   . ASP A 1 55 ? -3.109  -3.301  -5.707  1.00 0.00 ? 55  ASP A CB   3  
ATOM 3752  C CG   . ASP A 1 55 ? -4.180  -4.247  -6.229  1.00 0.00 ? 55  ASP A CG   3  
ATOM 3753  O OD1  . ASP A 1 55 ? -3.833  -5.372  -6.656  1.00 0.00 ? 55  ASP A OD1  3  
ATOM 3754  O OD2  . ASP A 1 55 ? -5.370  -3.864  -6.199  1.00 0.00 ? 55  ASP A OD2  3  
ATOM 3755  H H    . ASP A 1 55 ? -0.766  -4.748  -5.866  1.00 0.00 ? 55  ASP A H    3  
ATOM 3756  H HA   . ASP A 1 55 ? -2.278  -2.956  -7.654  1.00 0.00 ? 55  ASP A HA   3  
ATOM 3757  H HB2  . ASP A 1 55 ? -2.761  -3.676  -4.757  1.00 0.00 ? 55  ASP A HB2  3  
ATOM 3758  H HB3  . ASP A 1 55 ? -3.555  -2.329  -5.564  1.00 0.00 ? 55  ASP A HB3  3  
ATOM 3759  N N    . GLN A 1 56 ? -1.166  -0.854  -6.859  1.00 0.00 ? 56  GLN A N    3  
ATOM 3760  C CA   . GLN A 1 56 ? -0.366  0.321   -6.512  1.00 0.00 ? 56  GLN A CA   3  
ATOM 3761  C C    . GLN A 1 56 ? -0.970  1.071   -5.324  1.00 0.00 ? 56  GLN A C    3  
ATOM 3762  O O    . GLN A 1 56 ? -2.182  1.028   -5.099  1.00 0.00 ? 56  GLN A O    3  
ATOM 3763  C CB   . GLN A 1 56 ? -0.230  1.270   -7.710  1.00 0.00 ? 56  GLN A CB   3  
ATOM 3764  C CG   . GLN A 1 56 ? 0.944   2.233   -7.582  1.00 0.00 ? 56  GLN A CG   3  
ATOM 3765  C CD   . GLN A 1 56 ? 1.034   3.222   -8.729  1.00 0.00 ? 56  GLN A CD   3  
ATOM 3766  O OE1  . GLN A 1 56 ? 0.679   2.913   -9.867  1.00 0.00 ? 56  GLN A OE1  3  
ATOM 3767  N NE2  . GLN A 1 56 ? 1.513   4.426   -8.431  1.00 0.00 ? 56  GLN A NE2  3  
ATOM 3768  H H    . GLN A 1 56 ? -1.819  -0.793  -7.587  1.00 0.00 ? 56  GLN A H    3  
ATOM 3769  H HA   . GLN A 1 56 ? 0.617   -0.028  -6.233  1.00 0.00 ? 56  GLN A HA   3  
ATOM 3770  H HB2  . GLN A 1 56 ? -0.096  0.686   -8.609  1.00 0.00 ? 56  GLN A HB2  3  
ATOM 3771  H HB3  . GLN A 1 56 ? -1.135  1.851   -7.801  1.00 0.00 ? 56  GLN A HB3  3  
ATOM 3772  H HG2  . GLN A 1 56 ? 0.837   2.787   -6.663  1.00 0.00 ? 56  GLN A HG2  3  
ATOM 3773  H HG3  . GLN A 1 56 ? 1.860   1.660   -7.549  1.00 0.00 ? 56  GLN A HG3  3  
ATOM 3774  H HE21 . GLN A 1 56 ? 1.776   4.604   -7.503  1.00 0.00 ? 56  GLN A HE21 3  
ATOM 3775  H HE22 . GLN A 1 56 ? 1.585   5.085   -9.151  1.00 0.00 ? 56  GLN A HE22 3  
ATOM 3776  N N    . LEU A 1 57 ? -0.108  1.755   -4.568  1.00 0.00 ? 57  LEU A N    3  
ATOM 3777  C CA   . LEU A 1 57 ? -0.538  2.519   -3.395  1.00 0.00 ? 57  LEU A CA   3  
ATOM 3778  C C    . LEU A 1 57 ? -0.208  4.002   -3.556  1.00 0.00 ? 57  LEU A C    3  
ATOM 3779  O O    . LEU A 1 57 ? 0.828   4.358   -4.123  1.00 0.00 ? 57  LEU A O    3  
ATOM 3780  C CB   . LEU A 1 57 ? 0.143   1.975   -2.132  1.00 0.00 ? 57  LEU A CB   3  
ATOM 3781  C CG   . LEU A 1 57 ? -0.544  0.775   -1.468  1.00 0.00 ? 57  LEU A CG   3  
ATOM 3782  C CD1  . LEU A 1 57 ? -0.746  -0.359  -2.464  1.00 0.00 ? 57  LEU A CD1  3  
ATOM 3783  C CD2  . LEU A 1 57 ? 0.270   0.292   -0.275  1.00 0.00 ? 57  LEU A CD2  3  
ATOM 3784  H H    . LEU A 1 57 ? 0.845   1.745   -4.806  1.00 0.00 ? 57  LEU A H    3  
ATOM 3785  H HA   . LEU A 1 57 ? -1.608  2.409   -3.295  1.00 0.00 ? 57  LEU A HA   3  
ATOM 3786  H HB2  . LEU A 1 57 ? 1.152   1.687   -2.391  1.00 0.00 ? 57  LEU A HB2  3  
ATOM 3787  H HB3  . LEU A 1 57 ? 0.194   2.775   -1.407  1.00 0.00 ? 57  LEU A HB3  3  
ATOM 3788  H HG   . LEU A 1 57 ? -1.516  1.079   -1.107  1.00 0.00 ? 57  LEU A HG   3  
ATOM 3789  H HD11 . LEU A 1 57 ? -1.671  -0.207  -2.999  1.00 0.00 ? 57  LEU A HD11 3  
ATOM 3790  H HD12 . LEU A 1 57 ? -0.788  -1.301  -1.935  1.00 0.00 ? 57  LEU A HD12 3  
ATOM 3791  H HD13 . LEU A 1 57 ? 0.075   -0.377  -3.164  1.00 0.00 ? 57  LEU A HD13 3  
ATOM 3792  H HD21 . LEU A 1 57 ? 0.586   1.141   0.314   1.00 0.00 ? 57  LEU A HD21 3  
ATOM 3793  H HD22 . LEU A 1 57 ? 1.139   -0.246  -0.625  1.00 0.00 ? 57  LEU A HD22 3  
ATOM 3794  H HD23 . LEU A 1 57 ? -0.335  -0.362  0.335   1.00 0.00 ? 57  LEU A HD23 3  
ATOM 3795  N N    . LEU A 1 58 ? -1.091  4.862   -3.048  1.00 0.00 ? 58  LEU A N    3  
ATOM 3796  C CA   . LEU A 1 58 ? -0.888  6.306   -3.129  1.00 0.00 ? 58  LEU A CA   3  
ATOM 3797  C C    . LEU A 1 58 ? -0.731  6.921   -1.738  1.00 0.00 ? 58  LEU A C    3  
ATOM 3798  O O    . LEU A 1 58 ? 0.303   7.516   -1.430  1.00 0.00 ? 58  LEU A O    3  
ATOM 3799  C CB   . LEU A 1 58 ? -2.055  6.974   -3.865  1.00 0.00 ? 58  LEU A CB   3  
ATOM 3800  C CG   . LEU A 1 58 ? -1.690  7.650   -5.192  1.00 0.00 ? 58  LEU A CG   3  
ATOM 3801  C CD1  . LEU A 1 58 ? -2.947  8.068   -5.939  1.00 0.00 ? 58  LEU A CD1  3  
ATOM 3802  C CD2  . LEU A 1 58 ? -0.788  8.853   -4.953  1.00 0.00 ? 58  LEU A CD2  3  
ATOM 3803  H H    . LEU A 1 58 ? -1.895  4.516   -2.603  1.00 0.00 ? 58  LEU A H    3  
ATOM 3804  H HA   . LEU A 1 58 ? 0.020   6.479   -3.688  1.00 0.00 ? 58  LEU A HA   3  
ATOM 3805  H HB2  . LEU A 1 58 ? -2.806  6.223   -4.062  1.00 0.00 ? 58  LEU A HB2  3  
ATOM 3806  H HB3  . LEU A 1 58 ? -2.483  7.722   -3.214  1.00 0.00 ? 58  LEU A HB3  3  
ATOM 3807  H HG   . LEU A 1 58 ? -1.153  6.946   -5.812  1.00 0.00 ? 58  LEU A HG   3  
ATOM 3808  H HD11 . LEU A 1 58 ? -3.691  7.290   -5.858  1.00 0.00 ? 58  LEU A HD11 3  
ATOM 3809  H HD12 . LEU A 1 58 ? -2.709  8.230   -6.980  1.00 0.00 ? 58  LEU A HD12 3  
ATOM 3810  H HD13 . LEU A 1 58 ? -3.333  8.982   -5.512  1.00 0.00 ? 58  LEU A HD13 3  
ATOM 3811  H HD21 . LEU A 1 58 ? -0.963  9.592   -5.722  1.00 0.00 ? 58  LEU A HD21 3  
ATOM 3812  H HD22 . LEU A 1 58 ? 0.245   8.541   -4.983  1.00 0.00 ? 58  LEU A HD22 3  
ATOM 3813  H HD23 . LEU A 1 58 ? -1.007  9.283   -3.986  1.00 0.00 ? 58  LEU A HD23 3  
ATOM 3814  N N    . SER A 1 59 ? -1.765  6.776   -0.905  1.00 0.00 ? 59  SER A N    3  
ATOM 3815  C CA   . SER A 1 59 ? -1.746  7.321   0.451   1.00 0.00 ? 59  SER A CA   3  
ATOM 3816  C C    . SER A 1 59 ? -1.984  6.231   1.492   1.00 0.00 ? 59  SER A C    3  
ATOM 3817  O O    . SER A 1 59 ? -2.567  5.185   1.192   1.00 0.00 ? 59  SER A O    3  
ATOM 3818  C CB   . SER A 1 59 ? -2.804  8.418   0.595   1.00 0.00 ? 59  SER A CB   3  
ATOM 3819  O OG   . SER A 1 59 ? -2.285  9.677   0.205   1.00 0.00 ? 59  SER A OG   3  
ATOM 3820  H H    . SER A 1 59 ? -2.562  6.293   -1.213  1.00 0.00 ? 59  SER A H    3  
ATOM 3821  H HA   . SER A 1 59 ? -0.770  7.754   0.621   1.00 0.00 ? 59  SER A HA   3  
ATOM 3822  H HB2  . SER A 1 59 ? -3.653  8.183   -0.029  1.00 0.00 ? 59  SER A HB2  3  
ATOM 3823  H HB3  . SER A 1 59 ? -3.120  8.476   1.627   1.00 0.00 ? 59  SER A HB3  3  
ATOM 3824  H HG   . SER A 1 59 ? -2.276  10.268  0.963   1.00 0.00 ? 59  SER A HG   3  
ATOM 3825  N N    . VAL A 1 60 ? -1.525  6.487   2.718   1.00 0.00 ? 60  VAL A N    3  
ATOM 3826  C CA   . VAL A 1 60 ? -1.679  5.534   3.813   1.00 0.00 ? 60  VAL A CA   3  
ATOM 3827  C C    . VAL A 1 60 ? -1.974  6.250   5.127   1.00 0.00 ? 60  VAL A C    3  
ATOM 3828  O O    . VAL A 1 60 ? -1.176  7.072   5.584   1.00 0.00 ? 60  VAL A O    3  
ATOM 3829  C CB   . VAL A 1 60 ? -0.411  4.671   3.989   1.00 0.00 ? 60  VAL A CB   3  
ATOM 3830  C CG1  . VAL A 1 60 ? -0.661  3.541   4.979   1.00 0.00 ? 60  VAL A CG1  3  
ATOM 3831  C CG2  . VAL A 1 60 ? 0.052   4.127   2.646   1.00 0.00 ? 60  VAL A CG2  3  
ATOM 3832  H H    . VAL A 1 60 ? -1.070  7.339   2.890   1.00 0.00 ? 60  VAL A H    3  
ATOM 3833  H HA   . VAL A 1 60 ? -2.505  4.880   3.575   1.00 0.00 ? 60  VAL A HA   3  
ATOM 3834  H HB   . VAL A 1 60 ? 0.373   5.298   4.387   1.00 0.00 ? 60  VAL A HB   3  
ATOM 3835  H HG11 . VAL A 1 60 ? -1.724  3.434   5.144   1.00 0.00 ? 60  VAL A HG11 3  
ATOM 3836  H HG12 . VAL A 1 60 ? -0.174  3.768   5.916   1.00 0.00 ? 60  VAL A HG12 3  
ATOM 3837  H HG13 . VAL A 1 60 ? -0.265  2.619   4.581   1.00 0.00 ? 60  VAL A HG13 3  
ATOM 3838  H HG21 . VAL A 1 60 ? -0.729  3.521   2.214   1.00 0.00 ? 60  VAL A HG21 3  
ATOM 3839  H HG22 . VAL A 1 60 ? 0.939   3.527   2.787   1.00 0.00 ? 60  VAL A HG22 3  
ATOM 3840  H HG23 . VAL A 1 60 ? 0.277   4.949   1.982   1.00 0.00 ? 60  VAL A HG23 3  
ATOM 3841  N N    . ASP A 1 61 ? -3.122  5.928   5.730   1.00 0.00 ? 61  ASP A N    3  
ATOM 3842  C CA   . ASP A 1 61 ? -3.529  6.535   6.999   1.00 0.00 ? 61  ASP A CA   3  
ATOM 3843  C C    . ASP A 1 61 ? -3.585  8.063   6.890   1.00 0.00 ? 61  ASP A C    3  
ATOM 3844  O O    . ASP A 1 61 ? -3.259  8.778   7.841   1.00 0.00 ? 61  ASP A O    3  
ATOM 3845  C CB   . ASP A 1 61 ? -2.568  6.115   8.117   1.00 0.00 ? 61  ASP A CB   3  
ATOM 3846  C CG   . ASP A 1 61 ? -3.290  5.511   9.304   1.00 0.00 ? 61  ASP A CG   3  
ATOM 3847  O OD1  . ASP A 1 61 ? -3.764  4.363   9.186   1.00 0.00 ? 61  ASP A OD1  3  
ATOM 3848  O OD2  . ASP A 1 61 ? -3.377  6.186   10.353  1.00 0.00 ? 61  ASP A OD2  3  
ATOM 3849  H H    . ASP A 1 61 ? -3.709  5.263   5.312   1.00 0.00 ? 61  ASP A H    3  
ATOM 3850  H HA   . ASP A 1 61 ? -4.518  6.169   7.236   1.00 0.00 ? 61  ASP A HA   3  
ATOM 3851  H HB2  . ASP A 1 61 ? -1.877  5.380   7.730   1.00 0.00 ? 61  ASP A HB2  3  
ATOM 3852  H HB3  . ASP A 1 61 ? -2.016  6.979   8.455   1.00 0.00 ? 61  ASP A HB3  3  
ATOM 3853  N N    . GLY A 1 62 ? -3.998  8.557   5.720   1.00 0.00 ? 62  GLY A N    3  
ATOM 3854  C CA   . GLY A 1 62 ? -4.087  9.992   5.501   1.00 0.00 ? 62  GLY A CA   3  
ATOM 3855  C C    . GLY A 1 62 ? -2.723  10.654  5.336   1.00 0.00 ? 62  GLY A C    3  
ATOM 3856  O O    . GLY A 1 62 ? -2.594  11.863  5.530   1.00 0.00 ? 62  GLY A O    3  
ATOM 3857  H H    . GLY A 1 62 ? -4.246  7.941   4.999   1.00 0.00 ? 62  GLY A H    3  
ATOM 3858  H HA2  . GLY A 1 62 ? -4.669  10.170  4.610   1.00 0.00 ? 62  GLY A HA2  3  
ATOM 3859  H HA3  . GLY A 1 62 ? -4.594  10.441  6.342   1.00 0.00 ? 62  GLY A HA3  3  
ATOM 3860  N N    . ARG A 1 63 ? -1.706  9.862   4.976   1.00 0.00 ? 63  ARG A N    3  
ATOM 3861  C CA   . ARG A 1 63 ? -0.354  10.380  4.783   1.00 0.00 ? 63  ARG A CA   3  
ATOM 3862  C C    . ARG A 1 63 ? 0.062   10.274  3.320   1.00 0.00 ? 63  ARG A C    3  
ATOM 3863  O O    . ARG A 1 63 ? -0.336  9.339   2.620   1.00 0.00 ? 63  ARG A O    3  
ATOM 3864  C CB   . ARG A 1 63 ? 0.642   9.616   5.661   1.00 0.00 ? 63  ARG A CB   3  
ATOM 3865  C CG   . ARG A 1 63 ? 0.194   9.460   7.105   1.00 0.00 ? 63  ARG A CG   3  
ATOM 3866  C CD   . ARG A 1 63 ? 1.357   9.111   8.017   1.00 0.00 ? 63  ARG A CD   3  
ATOM 3867  N NE   . ARG A 1 63 ? 1.416   7.681   8.317   1.00 0.00 ? 63  ARG A NE   3  
ATOM 3868  C CZ   . ARG A 1 63 ? 0.667   7.078   9.245   1.00 0.00 ? 63  ARG A CZ   3  
ATOM 3869  N NH1  . ARG A 1 63 ? -0.250  7.763   9.927   1.00 0.00 ? 63  ARG A NH1  3  
ATOM 3870  N NH2  . ARG A 1 63 ? 0.826   5.779   9.479   1.00 0.00 ? 63  ARG A NH2  3  
ATOM 3871  H H    . ARG A 1 63 ? -1.869  8.907   4.834   1.00 0.00 ? 63  ARG A H    3  
ATOM 3872  H HA   . ARG A 1 63 ? -0.350  11.421  5.073   1.00 0.00 ? 63  ARG A HA   3  
ATOM 3873  H HB2  . ARG A 1 63 ? 0.788   8.630   5.244   1.00 0.00 ? 63  ARG A HB2  3  
ATOM 3874  H HB3  . ARG A 1 63 ? 1.587   10.142  5.654   1.00 0.00 ? 63  ARG A HB3  3  
ATOM 3875  H HG2  . ARG A 1 63 ? -0.244  10.389  7.438   1.00 0.00 ? 63  ARG A HG2  3  
ATOM 3876  H HG3  . ARG A 1 63 ? -0.543  8.672   7.159   1.00 0.00 ? 63  ARG A HG3  3  
ATOM 3877  H HD2  . ARG A 1 63 ? 2.276   9.404   7.533   1.00 0.00 ? 63  ARG A HD2  3  
ATOM 3878  H HD3  . ARG A 1 63 ? 1.247   9.659   8.941   1.00 0.00 ? 63  ARG A HD3  3  
ATOM 3879  H HE   . ARG A 1 63 ? 2.061   7.142   7.811   1.00 0.00 ? 63  ARG A HE   3  
ATOM 3880  H HH11 . ARG A 1 63 ? -0.386  8.739   9.747   1.00 0.00 ? 63  ARG A HH11 3  
ATOM 3881  H HH12 . ARG A 1 63 ? -0.806  7.302   10.621  1.00 0.00 ? 63  ARG A HH12 3  
ATOM 3882  H HH21 . ARG A 1 63 ? 1.504   5.256   8.961   1.00 0.00 ? 63  ARG A HH21 3  
ATOM 3883  H HH22 . ARG A 1 63 ? 0.273   5.325   10.178  1.00 0.00 ? 63  ARG A HH22 3  
ATOM 3884  N N    . SER A 1 64 ? 0.866   11.236  2.867   1.00 0.00 ? 64  SER A N    3  
ATOM 3885  C CA   . SER A 1 64 ? 1.344   11.260  1.486   1.00 0.00 ? 64  SER A CA   3  
ATOM 3886  C C    . SER A 1 64 ? 2.785   10.765  1.399   1.00 0.00 ? 64  SER A C    3  
ATOM 3887  O O    . SER A 1 64 ? 3.722   11.488  1.740   1.00 0.00 ? 64  SER A O    3  
ATOM 3888  C CB   . SER A 1 64 ? 1.244   12.676  0.911   1.00 0.00 ? 64  SER A CB   3  
ATOM 3889  O OG   . SER A 1 64 ? -0.106  13.103  0.844   1.00 0.00 ? 64  SER A OG   3  
ATOM 3890  H H    . SER A 1 64 ? 1.148   11.948  3.479   1.00 0.00 ? 64  SER A H    3  
ATOM 3891  H HA   . SER A 1 64 ? 0.715   10.600  0.905   1.00 0.00 ? 64  SER A HA   3  
ATOM 3892  H HB2  . SER A 1 64 ? 1.796   13.360  1.541   1.00 0.00 ? 64  SER A HB2  3  
ATOM 3893  H HB3  . SER A 1 64 ? 1.662   12.688  -0.085  1.00 0.00 ? 64  SER A HB3  3  
ATOM 3894  H HG   . SER A 1 64 ? -0.605  12.506  0.279   1.00 0.00 ? 64  SER A HG   3  
ATOM 3895  N N    . LEU A 1 65 ? 2.955   9.526   0.936   1.00 0.00 ? 65  LEU A N    3  
ATOM 3896  C CA   . LEU A 1 65 ? 4.284   8.931   0.800   1.00 0.00 ? 65  LEU A CA   3  
ATOM 3897  C C    . LEU A 1 65 ? 4.680   8.795   -0.673  1.00 0.00 ? 65  LEU A C    3  
ATOM 3898  O O    . LEU A 1 65 ? 5.245   7.779   -1.087  1.00 0.00 ? 65  LEU A O    3  
ATOM 3899  C CB   . LEU A 1 65 ? 4.334   7.567   1.501   1.00 0.00 ? 65  LEU A CB   3  
ATOM 3900  C CG   . LEU A 1 65 ? 3.295   6.544   1.030   1.00 0.00 ? 65  LEU A CG   3  
ATOM 3901  C CD1  . LEU A 1 65 ? 3.921   5.534   0.078   1.00 0.00 ? 65  LEU A CD1  3  
ATOM 3902  C CD2  . LEU A 1 65 ? 2.672   5.840   2.225   1.00 0.00 ? 65  LEU A CD2  3  
ATOM 3903  H H    . LEU A 1 65 ? 2.167   9.001   0.679   1.00 0.00 ? 65  LEU A H    3  
ATOM 3904  H HA   . LEU A 1 65 ? 4.990   9.593   1.280   1.00 0.00 ? 65  LEU A HA   3  
ATOM 3905  H HB2  . LEU A 1 65 ? 5.317   7.145   1.353   1.00 0.00 ? 65  LEU A HB2  3  
ATOM 3906  H HB3  . LEU A 1 65 ? 4.187   7.730   2.557   1.00 0.00 ? 65  LEU A HB3  3  
ATOM 3907  H HG   . LEU A 1 65 ? 2.509   7.058   0.497   1.00 0.00 ? 65  LEU A HG   3  
ATOM 3908  H HD11 . LEU A 1 65 ? 4.976   5.440   0.293   1.00 0.00 ? 65  LEU A HD11 3  
ATOM 3909  H HD12 . LEU A 1 65 ? 3.791   5.871   -0.939  1.00 0.00 ? 65  LEU A HD12 3  
ATOM 3910  H HD13 . LEU A 1 65 ? 3.441   4.575   0.203   1.00 0.00 ? 65  LEU A HD13 3  
ATOM 3911  H HD21 . LEU A 1 65 ? 3.387   5.801   3.033   1.00 0.00 ? 65  LEU A HD21 3  
ATOM 3912  H HD22 . LEU A 1 65 ? 2.389   4.837   1.945   1.00 0.00 ? 65  LEU A HD22 3  
ATOM 3913  H HD23 . LEU A 1 65 ? 1.796   6.385   2.545   1.00 0.00 ? 65  LEU A HD23 3  
ATOM 3914  N N    . VAL A 1 66 ? 4.389   9.829   -1.460  1.00 0.00 ? 66  VAL A N    3  
ATOM 3915  C CA   . VAL A 1 66 ? 4.721   9.825   -2.878  1.00 0.00 ? 66  VAL A CA   3  
ATOM 3916  C C    . VAL A 1 66 ? 6.133   10.352  -3.105  1.00 0.00 ? 66  VAL A C    3  
ATOM 3917  O O    . VAL A 1 66 ? 6.370   11.563  -3.110  1.00 0.00 ? 66  VAL A O    3  
ATOM 3918  C CB   . VAL A 1 66 ? 3.710   10.651  -3.699  1.00 0.00 ? 66  VAL A CB   3  
ATOM 3919  C CG1  . VAL A 1 66 ? 4.175   10.802  -5.142  1.00 0.00 ? 66  VAL A CG1  3  
ATOM 3920  C CG2  . VAL A 1 66 ? 2.337   10.001  -3.637  1.00 0.00 ? 66  VAL A CG2  3  
ATOM 3921  H H    . VAL A 1 66 ? 3.946   10.615  -1.076  1.00 0.00 ? 66  VAL A H    3  
ATOM 3922  H HA   . VAL A 1 66 ? 4.676   8.800   -3.222  1.00 0.00 ? 66  VAL A HA   3  
ATOM 3923  H HB   . VAL A 1 66 ? 3.639   11.636  -3.261  1.00 0.00 ? 66  VAL A HB   3  
ATOM 3924  H HG11 . VAL A 1 66 ? 4.789   9.955   -5.413  1.00 0.00 ? 66  VAL A HG11 3  
ATOM 3925  H HG12 . VAL A 1 66 ? 4.753   11.709  -5.239  1.00 0.00 ? 66  VAL A HG12 3  
ATOM 3926  H HG13 . VAL A 1 66 ? 3.316   10.850  -5.794  1.00 0.00 ? 66  VAL A HG13 3  
ATOM 3927  H HG21 . VAL A 1 66 ? 1.777   10.422  -2.814  1.00 0.00 ? 66  VAL A HG21 3  
ATOM 3928  H HG22 . VAL A 1 66 ? 2.452   8.937   -3.487  1.00 0.00 ? 66  VAL A HG22 3  
ATOM 3929  H HG23 . VAL A 1 66 ? 1.810   10.180  -4.561  1.00 0.00 ? 66  VAL A HG23 3  
ATOM 3930  N N    . GLY A 1 67 ? 7.064   9.422   -3.283  1.00 0.00 ? 67  GLY A N    3  
ATOM 3931  C CA   . GLY A 1 67 ? 8.458   9.778   -3.502  1.00 0.00 ? 67  GLY A CA   3  
ATOM 3932  C C    . GLY A 1 67 ? 9.356   9.330   -2.361  1.00 0.00 ? 67  GLY A C    3  
ATOM 3933  O O    . GLY A 1 67 ? 10.256  10.064  -1.948  1.00 0.00 ? 67  GLY A O    3  
ATOM 3934  H H    . GLY A 1 67 ? 6.800   8.478   -3.260  1.00 0.00 ? 67  GLY A H    3  
ATOM 3935  H HA2  . GLY A 1 67 ? 8.797   9.314   -4.415  1.00 0.00 ? 67  GLY A HA2  3  
ATOM 3936  H HA3  . GLY A 1 67 ? 8.534   10.850  -3.606  1.00 0.00 ? 67  GLY A HA3  3  
ATOM 3937  N N    . LEU A 1 68 ? 9.107   8.124   -1.852  1.00 0.00 ? 68  LEU A N    3  
ATOM 3938  C CA   . LEU A 1 68 ? 9.891   7.571   -0.753  1.00 0.00 ? 68  LEU A CA   3  
ATOM 3939  C C    . LEU A 1 68 ? 10.405  6.180   -1.102  1.00 0.00 ? 68  LEU A C    3  
ATOM 3940  O O    . LEU A 1 68 ? 9.838   5.495   -1.957  1.00 0.00 ? 68  LEU A O    3  
ATOM 3941  C CB   . LEU A 1 68 ? 9.039   7.499   0.519   1.00 0.00 ? 68  LEU A CB   3  
ATOM 3942  C CG   . LEU A 1 68 ? 8.986   8.782   1.352   1.00 0.00 ? 68  LEU A CG   3  
ATOM 3943  C CD1  . LEU A 1 68 ? 8.211   8.542   2.639   1.00 0.00 ? 68  LEU A CD1  3  
ATOM 3944  C CD2  . LEU A 1 68 ? 10.391  9.286   1.657   1.00 0.00 ? 68  LEU A CD2  3  
ATOM 3945  H H    . LEU A 1 68 ? 8.375   7.589   -2.225  1.00 0.00 ? 68  LEU A H    3  
ATOM 3946  H HA   . LEU A 1 68 ? 10.734  8.223   -0.578  1.00 0.00 ? 68  LEU A HA   3  
ATOM 3947  H HB2  . LEU A 1 68 ? 8.029   7.242   0.233   1.00 0.00 ? 68  LEU A HB2  3  
ATOM 3948  H HB3  . LEU A 1 68 ? 9.428   6.709   1.143   1.00 0.00 ? 68  LEU A HB3  3  
ATOM 3949  H HG   . LEU A 1 68 ? 8.469   9.547   0.788   1.00 0.00 ? 68  LEU A HG   3  
ATOM 3950  H HD11 . LEU A 1 68 ? 7.185   8.853   2.504   1.00 0.00 ? 68  LEU A HD11 3  
ATOM 3951  H HD12 . LEU A 1 68 ? 8.656   9.112   3.441   1.00 0.00 ? 68  LEU A HD12 3  
ATOM 3952  H HD13 . LEU A 1 68 ? 8.240   7.490   2.885   1.00 0.00 ? 68  LEU A HD13 3  
ATOM 3953  H HD21 . LEU A 1 68 ? 11.011  8.458   1.970   1.00 0.00 ? 68  LEU A HD21 3  
ATOM 3954  H HD22 . LEU A 1 68 ? 10.346  10.021  2.446   1.00 0.00 ? 68  LEU A HD22 3  
ATOM 3955  H HD23 . LEU A 1 68 ? 10.813  9.736   0.770   1.00 0.00 ? 68  LEU A HD23 3  
ATOM 3956  N N    . SER A 1 69 ? 11.474  5.761   -0.427  1.00 0.00 ? 69  SER A N    3  
ATOM 3957  C CA   . SER A 1 69 ? 12.053  4.442   -0.657  1.00 0.00 ? 69  SER A CA   3  
ATOM 3958  C C    . SER A 1 69 ? 11.127  3.359   -0.109  1.00 0.00 ? 69  SER A C    3  
ATOM 3959  O O    . SER A 1 69 ? 10.278  3.633   0.743   1.00 0.00 ? 69  SER A O    3  
ATOM 3960  C CB   . SER A 1 69 ? 13.434  4.342   0.001   1.00 0.00 ? 69  SER A CB   3  
ATOM 3961  O OG   . SER A 1 69 ? 13.332  4.360   1.416   1.00 0.00 ? 69  SER A OG   3  
ATOM 3962  H H    . SER A 1 69 ? 11.874  6.347   0.250   1.00 0.00 ? 69  SER A H    3  
ATOM 3963  H HA   . SER A 1 69 ? 12.157  4.307   -1.723  1.00 0.00 ? 69  SER A HA   3  
ATOM 3964  H HB2  . SER A 1 69 ? 13.909  3.421   -0.302  1.00 0.00 ? 69  SER A HB2  3  
ATOM 3965  H HB3  . SER A 1 69 ? 14.040  5.179   -0.314  1.00 0.00 ? 69  SER A HB3  3  
ATOM 3966  H HG   . SER A 1 69 ? 13.524  3.484   1.763   1.00 0.00 ? 69  SER A HG   3  
ATOM 3967  N N    . GLN A 1 70 ? 11.289  2.131   -0.597  1.00 0.00 ? 70  GLN A N    3  
ATOM 3968  C CA   . GLN A 1 70 ? 10.460  1.015   -0.144  1.00 0.00 ? 70  GLN A CA   3  
ATOM 3969  C C    . GLN A 1 70 ? 10.521  0.871   1.376   1.00 0.00 ? 70  GLN A C    3  
ATOM 3970  O O    . GLN A 1 70 ? 9.504   0.606   2.019   1.00 0.00 ? 70  GLN A O    3  
ATOM 3971  C CB   . GLN A 1 70 ? 10.896  -0.290  -0.806  1.00 0.00 ? 70  GLN A CB   3  
ATOM 3972  C CG   . GLN A 1 70 ? 9.846   -1.384  -0.714  1.00 0.00 ? 70  GLN A CG   3  
ATOM 3973  C CD   . GLN A 1 70 ? 10.380  -2.746  -1.107  1.00 0.00 ? 70  GLN A CD   3  
ATOM 3974  O OE1  . GLN A 1 70 ? 11.590  -2.961  -1.174  1.00 0.00 ? 70  GLN A OE1  3  
ATOM 3975  N NE2  . GLN A 1 70 ? 9.475   -3.680  -1.362  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 3976  H H    . GLN A 1 70 ? 11.981  1.971   -1.274  1.00 0.00 ? 70  GLN A H    3  
ATOM 3977  H HA   . GLN A 1 70 ? 9.439   1.228   -0.430  1.00 0.00 ? 70  GLN A HA   3  
ATOM 3978  H HB2  . GLN A 1 70 ? 11.103  -0.102  -1.848  1.00 0.00 ? 70  GLN A HB2  3  
ATOM 3979  H HB3  . GLN A 1 70 ? 11.797  -0.642  -0.326  1.00 0.00 ? 70  GLN A HB3  3  
ATOM 3980  H HG2  . GLN A 1 70 ? 9.489   -1.436  0.304   1.00 0.00 ? 70  GLN A HG2  3  
ATOM 3981  H HG3  . GLN A 1 70 ? 9.025   -1.133  -1.369  1.00 0.00 ? 70  GLN A HG3  3  
ATOM 3982  H HE21 . GLN A 1 70 ? 8.527   -3.441  -1.284  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 3983  H HE22 . GLN A 1 70 ? 9.789   -4.571  -1.613  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 3984  N N    . GLU A 1 71 ? 11.717  1.053   1.945   1.00 0.00 ? 71  GLU A N    3  
ATOM 3985  C CA   . GLU A 1 71 ? 11.901  0.952   3.391   1.00 0.00 ? 71  GLU A CA   3  
ATOM 3986  C C    . GLU A 1 71 ? 10.977  1.928   4.115   1.00 0.00 ? 71  GLU A C    3  
ATOM 3987  O O    . GLU A 1 71 ? 10.289  1.554   5.066   1.00 0.00 ? 71  GLU A O    3  
ATOM 3988  C CB   . GLU A 1 71 ? 13.360  1.227   3.772   1.00 0.00 ? 71  GLU A CB   3  
ATOM 3989  C CG   . GLU A 1 71 ? 13.854  0.376   4.930   1.00 0.00 ? 71  GLU A CG   3  
ATOM 3990  C CD   . GLU A 1 71 ? 14.108  -1.065  4.529   1.00 0.00 ? 71  GLU A CD   3  
ATOM 3991  O OE1  . GLU A 1 71 ? 13.126  -1.823  4.376   1.00 0.00 ? 71  GLU A OE1  3  
ATOM 3992  O OE2  . GLU A 1 71 ? 15.289  -1.436  4.367   1.00 0.00 ? 71  GLU A OE2  3  
ATOM 3993  H H    . GLU A 1 71 ? 12.488  1.266   1.378   1.00 0.00 ? 71  GLU A H    3  
ATOM 3994  H HA   . GLU A 1 71 ? 11.643  -0.055  3.686   1.00 0.00 ? 71  GLU A HA   3  
ATOM 3995  H HB2  . GLU A 1 71 ? 13.989  1.030   2.916   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 3996  H HB3  . GLU A 1 71 ? 13.459  2.266   4.049   1.00 0.00 ? 71  GLU A HB3  3  
ATOM 3997  H HG2  . GLU A 1 71 ? 14.775  0.797   5.303   1.00 0.00 ? 71  GLU A HG2  3  
ATOM 3998  H HG3  . GLU A 1 71 ? 13.110  0.390   5.714   1.00 0.00 ? 71  GLU A HG3  3  
ATOM 3999  N N    . ARG A 1 72 ? 10.954  3.176   3.642   1.00 0.00 ? 72  ARG A N    3  
ATOM 4000  C CA   . ARG A 1 72 ? 10.099  4.206   4.227   1.00 0.00 ? 72  ARG A CA   3  
ATOM 4001  C C    . ARG A 1 72 ? 8.627   3.902   3.953   1.00 0.00 ? 72  ARG A C    3  
ATOM 4002  O O    . ARG A 1 72 ? 7.774   4.111   4.815   1.00 0.00 ? 72  ARG A O    3  
ATOM 4003  C CB   . ARG A 1 72 ? 10.457  5.587   3.666   1.00 0.00 ? 72  ARG A CB   3  
ATOM 4004  C CG   . ARG A 1 72 ? 11.773  6.141   4.187   1.00 0.00 ? 72  ARG A CG   3  
ATOM 4005  C CD   . ARG A 1 72 ? 11.571  6.924   5.475   1.00 0.00 ? 72  ARG A CD   3  
ATOM 4006  N NE   . ARG A 1 72 ? 11.828  8.355   5.301   1.00 0.00 ? 72  ARG A NE   3  
ATOM 4007  C CZ   . ARG A 1 72 ? 11.393  9.302   6.139   1.00 0.00 ? 72  ARG A CZ   3  
ATOM 4008  N NH1  . ARG A 1 72 ? 10.678  8.979   7.214   1.00 0.00 ? 72  ARG A NH1  3  
ATOM 4009  N NH2  . ARG A 1 72 ? 11.675  10.579  5.900   1.00 0.00 ? 72  ARG A NH2  3  
ATOM 4010  H H    . ARG A 1 72 ? 11.515  3.405   2.872   1.00 0.00 ? 72  ARG A H    3  
ATOM 4011  H HA   . ARG A 1 72 ? 10.261  4.204   5.296   1.00 0.00 ? 72  ARG A HA   3  
ATOM 4012  H HB2  . ARG A 1 72 ? 10.521  5.520   2.590   1.00 0.00 ? 72  ARG A HB2  3  
ATOM 4013  H HB3  . ARG A 1 72 ? 9.672   6.282   3.928   1.00 0.00 ? 72  ARG A HB3  3  
ATOM 4014  H HG2  . ARG A 1 72 ? 12.451  5.321   4.376   1.00 0.00 ? 72  ARG A HG2  3  
ATOM 4015  H HG3  . ARG A 1 72 ? 12.198  6.796   3.440   1.00 0.00 ? 72  ARG A HG3  3  
ATOM 4016  H HD2  . ARG A 1 72 ? 10.551  6.790   5.803   1.00 0.00 ? 72  ARG A HD2  3  
ATOM 4017  H HD3  . ARG A 1 72 ? 12.243  6.534   6.226   1.00 0.00 ? 72  ARG A HD3  3  
ATOM 4018  H HE   . ARG A 1 72 ? 12.354  8.627   4.519   1.00 0.00 ? 72  ARG A HE   3  
ATOM 4019  H HH11 . ARG A 1 72 ? 10.460  8.022   7.404   1.00 0.00 ? 72  ARG A HH11 3  
ATOM 4020  H HH12 . ARG A 1 72 ? 10.357  9.696   7.835   1.00 0.00 ? 72  ARG A HH12 3  
ATOM 4021  H HH21 . ARG A 1 72 ? 12.213  10.832  5.095   1.00 0.00 ? 72  ARG A HH21 3  
ATOM 4022  H HH22 . ARG A 1 72 ? 11.350  11.289  6.525   1.00 0.00 ? 72  ARG A HH22 3  
ATOM 4023  N N    . ALA A 1 73 ? 8.341   3.402   2.746   1.00 0.00 ? 73  ALA A N    3  
ATOM 4024  C CA   . ALA A 1 73 ? 6.976   3.059   2.355   1.00 0.00 ? 73  ALA A CA   3  
ATOM 4025  C C    . ALA A 1 73 ? 6.332   2.132   3.381   1.00 0.00 ? 73  ALA A C    3  
ATOM 4026  O O    . ALA A 1 73 ? 5.313   2.476   3.981   1.00 0.00 ? 73  ALA A O    3  
ATOM 4027  C CB   . ALA A 1 73 ? 6.963   2.416   0.977   1.00 0.00 ? 73  ALA A CB   3  
ATOM 4028  H H    . ALA A 1 73 ? 9.070   3.256   2.105   1.00 0.00 ? 73  ALA A H    3  
ATOM 4029  H HA   . ALA A 1 73 ? 6.407   3.976   2.306   1.00 0.00 ? 73  ALA A HA   3  
ATOM 4030  H HB1  . ALA A 1 73 ? 7.872   1.852   0.833   1.00 0.00 ? 73  ALA A HB1  3  
ATOM 4031  H HB2  . ALA A 1 73 ? 6.893   3.185   0.222   1.00 0.00 ? 73  ALA A HB2  3  
ATOM 4032  H HB3  . ALA A 1 73 ? 6.113   1.755   0.897   1.00 0.00 ? 73  ALA A HB3  3  
ATOM 4033  N N    . ALA A 1 74 ? 6.946   0.964   3.595   1.00 0.00 ? 74  ALA A N    3  
ATOM 4034  C CA   . ALA A 1 74 ? 6.433   0.005   4.572   1.00 0.00 ? 74  ALA A CA   3  
ATOM 4035  C C    . ALA A 1 74 ? 6.392   0.644   5.955   1.00 0.00 ? 74  ALA A C    3  
ATOM 4036  O O    . ALA A 1 74 ? 5.314   0.876   6.496   1.00 0.00 ? 74  ALA A O    3  
ATOM 4037  C CB   . ALA A 1 74 ? 7.279   -1.264  4.588   1.00 0.00 ? 74  ALA A CB   3  
ATOM 4038  H H    . ALA A 1 74 ? 7.766   0.754   3.098   1.00 0.00 ? 74  ALA A H    3  
ATOM 4039  H HA   . ALA A 1 74 ? 5.426   -0.260  4.278   1.00 0.00 ? 74  ALA A HA   3  
ATOM 4040  H HB1  . ALA A 1 74 ? 8.277   -1.028  4.927   1.00 0.00 ? 74  ALA A HB1  3  
ATOM 4041  H HB2  . ALA A 1 74 ? 7.326   -1.680  3.593   1.00 0.00 ? 74  ALA A HB2  3  
ATOM 4042  H HB3  . ALA A 1 74 ? 6.831   -1.985  5.258   1.00 0.00 ? 74  ALA A HB3  3  
ATOM 4043  N N    . GLU A 1 75 ? 7.579   0.937   6.506   1.00 0.00 ? 75  GLU A N    3  
ATOM 4044  C CA   . GLU A 1 75 ? 7.722   1.573   7.824   1.00 0.00 ? 75  GLU A CA   3  
ATOM 4045  C C    . GLU A 1 75 ? 6.603   2.590   8.102   1.00 0.00 ? 75  GLU A C    3  
ATOM 4046  O O    . GLU A 1 75 ? 6.084   2.654   9.217   1.00 0.00 ? 75  GLU A O    3  
ATOM 4047  C CB   . GLU A 1 75 ? 9.086   2.263   7.923   1.00 0.00 ? 75  GLU A CB   3  
ATOM 4048  C CG   . GLU A 1 75 ? 9.579   2.444   9.352   1.00 0.00 ? 75  GLU A CG   3  
ATOM 4049  C CD   . GLU A 1 75 ? 11.050  2.106   9.517   1.00 0.00 ? 75  GLU A CD   3  
ATOM 4050  O OE1  . GLU A 1 75 ? 11.876  2.635   8.741   1.00 0.00 ? 75  GLU A OE1  3  
ATOM 4051  O OE2  . GLU A 1 75 ? 11.376  1.315   10.426  1.00 0.00 ? 75  GLU A OE2  3  
ATOM 4052  H H    . GLU A 1 75 ? 8.390   0.719   6.007   1.00 0.00 ? 75  GLU A H    3  
ATOM 4053  H HA   . GLU A 1 75 ? 7.676   0.794   8.571   1.00 0.00 ? 75  GLU A HA   3  
ATOM 4054  H HB2  . GLU A 1 75 ? 9.816   1.674   7.387   1.00 0.00 ? 75  GLU A HB2  3  
ATOM 4055  H HB3  . GLU A 1 75 ? 9.017   3.237   7.464   1.00 0.00 ? 75  GLU A HB3  3  
ATOM 4056  H HG2  . GLU A 1 75 ? 9.429   3.474   9.643   1.00 0.00 ? 75  GLU A HG2  3  
ATOM 4057  H HG3  . GLU A 1 75 ? 9.002   1.801   10.001  1.00 0.00 ? 75  GLU A HG3  3  
ATOM 4058  N N    . LEU A 1 76 ? 6.240   3.381   7.085   1.00 0.00 ? 76  LEU A N    3  
ATOM 4059  C CA   . LEU A 1 76 ? 5.185   4.391   7.225   1.00 0.00 ? 76  LEU A CA   3  
ATOM 4060  C C    . LEU A 1 76 ? 3.828   3.746   7.526   1.00 0.00 ? 76  LEU A C    3  
ATOM 4061  O O    . LEU A 1 76 ? 3.130   4.158   8.453   1.00 0.00 ? 76  LEU A O    3  
ATOM 4062  C CB   . LEU A 1 76 ? 5.087   5.235   5.949   1.00 0.00 ? 76  LEU A CB   3  
ATOM 4063  C CG   . LEU A 1 76 ? 5.922   6.519   5.935   1.00 0.00 ? 76  LEU A CG   3  
ATOM 4064  C CD1  . LEU A 1 76 ? 5.742   7.249   4.612   1.00 0.00 ? 76  LEU A CD1  3  
ATOM 4065  C CD2  . LEU A 1 76 ? 5.539   7.423   7.099   1.00 0.00 ? 76  LEU A CD2  3  
ATOM 4066  H H    . LEU A 1 76 ? 6.692   3.283   6.219   1.00 0.00 ? 76  LEU A H    3  
ATOM 4067  H HA   . LEU A 1 76 ? 5.453   5.032   8.053   1.00 0.00 ? 76  LEU A HA   3  
ATOM 4068  H HB2  . LEU A 1 76 ? 5.400   4.624   5.116   1.00 0.00 ? 76  LEU A HB2  3  
ATOM 4069  H HB3  . LEU A 1 76 ? 4.052   5.506   5.803   1.00 0.00 ? 76  LEU A HB3  3  
ATOM 4070  H HG   . LEU A 1 76 ? 6.968   6.265   6.036   1.00 0.00 ? 76  LEU A HG   3  
ATOM 4071  H HD11 . LEU A 1 76 ? 6.021   6.595   3.799   1.00 0.00 ? 76  LEU A HD11 3  
ATOM 4072  H HD12 . LEU A 1 76 ? 6.368   8.129   4.596   1.00 0.00 ? 76  LEU A HD12 3  
ATOM 4073  H HD13 . LEU A 1 76 ? 4.708   7.540   4.499   1.00 0.00 ? 76  LEU A HD13 3  
ATOM 4074  H HD21 . LEU A 1 76 ? 5.877   8.430   6.900   1.00 0.00 ? 76  LEU A HD21 3  
ATOM 4075  H HD22 . LEU A 1 76 ? 6.003   7.061   8.004   1.00 0.00 ? 76  LEU A HD22 3  
ATOM 4076  H HD23 . LEU A 1 76 ? 4.466   7.422   7.218   1.00 0.00 ? 76  LEU A HD23 3  
ATOM 4077  N N    . MET A 1 77 ? 3.462   2.733   6.740   1.00 0.00 ? 77  MET A N    3  
ATOM 4078  C CA   . MET A 1 77 ? 2.192   2.026   6.930   1.00 0.00 ? 77  MET A CA   3  
ATOM 4079  C C    . MET A 1 77 ? 2.231   1.176   8.202   1.00 0.00 ? 77  MET A C    3  
ATOM 4080  O O    . MET A 1 77 ? 1.220   1.010   8.877   1.00 0.00 ? 77  MET A O    3  
ATOM 4081  C CB   . MET A 1 77 ? 1.885   1.132   5.725   1.00 0.00 ? 77  MET A CB   3  
ATOM 4082  C CG   . MET A 1 77 ? 2.177   1.779   4.378   1.00 0.00 ? 77  MET A CG   3  
ATOM 4083  S SD   . MET A 1 77 ? 1.298   0.989   3.015   1.00 0.00 ? 77  MET A SD   3  
ATOM 4084  C CE   . MET A 1 77 ? 1.499   -0.742  3.428   1.00 0.00 ? 77  MET A CE   3  
ATOM 4085  H H    . MET A 1 77 ? 4.064   2.448   6.019   1.00 0.00 ? 77  MET A H    3  
ATOM 4086  H HA   . MET A 1 77 ? 1.409   2.765   7.030   1.00 0.00 ? 77  MET A HA   3  
ATOM 4087  H HB2  . MET A 1 77 ? 2.481   0.237   5.801   1.00 0.00 ? 77  MET A HB2  3  
ATOM 4088  H HB3  . MET A 1 77 ? 0.839   0.861   5.751   1.00 0.00 ? 77  MET A HB3  3  
ATOM 4089  H HG2  . MET A 1 77 ? 1.886   2.817   4.421   1.00 0.00 ? 77  MET A HG2  3  
ATOM 4090  H HG3  . MET A 1 77 ? 3.237   1.713   4.188   1.00 0.00 ? 77  MET A HG3  3  
ATOM 4091  H HE1  . MET A 1 77 ? 0.613   -1.096  3.933   1.00 0.00 ? 77  MET A HE1  3  
ATOM 4092  H HE2  . MET A 1 77 ? 2.354   -0.859  4.077   1.00 0.00 ? 77  MET A HE2  3  
ATOM 4093  H HE3  . MET A 1 77 ? 1.653   -1.312  2.525   1.00 0.00 ? 77  MET A HE3  3  
ATOM 4094  N N    . THR A 1 78 ? 3.412   0.644   8.518   1.00 0.00 ? 78  THR A N    3  
ATOM 4095  C CA   . THR A 1 78 ? 3.598   -0.183  9.709   1.00 0.00 ? 78  THR A CA   3  
ATOM 4096  C C    . THR A 1 78 ? 3.333   0.628   10.983  1.00 0.00 ? 78  THR A C    3  
ATOM 4097  O O    . THR A 1 78 ? 2.910   0.075   12.000  1.00 0.00 ? 78  THR A O    3  
ATOM 4098  C CB   . THR A 1 78 ? 5.022   -0.763  9.741   1.00 0.00 ? 78  THR A CB   3  
ATOM 4099  O OG1  . THR A 1 78 ? 5.600   -0.760  8.454   1.00 0.00 ? 78  THR A OG1  3  
ATOM 4100  C CG2  . THR A 1 78 ? 5.099   -2.184  10.232  1.00 0.00 ? 78  THR A CG2  3  
ATOM 4101  H H    . THR A 1 78 ? 4.182   0.816   7.936   1.00 0.00 ? 78  THR A H    3  
ATOM 4102  H HA   . THR A 1 78 ? 2.888   -0.996  9.663   1.00 0.00 ? 78  THR A HA   3  
ATOM 4103  H HB   . THR A 1 78 ? 5.632   -0.154  10.393  1.00 0.00 ? 78  THR A HB   3  
ATOM 4104  H HG1  . THR A 1 78 ? 5.964   0.101   8.278   1.00 0.00 ? 78  THR A HG1  3  
ATOM 4105  H HG21 . THR A 1 78 ? 5.860   -2.706  9.668   1.00 0.00 ? 78  THR A HG21 3  
ATOM 4106  H HG22 . THR A 1 78 ? 4.145   -2.668  10.087  1.00 0.00 ? 78  THR A HG22 3  
ATOM 4107  H HG23 . THR A 1 78 ? 5.356   -2.192  11.279  1.00 0.00 ? 78  THR A HG23 3  
ATOM 4108  N N    . ARG A 1 79 ? 3.581   1.944   10.922  1.00 0.00 ? 79  ARG A N    3  
ATOM 4109  C CA   . ARG A 1 79 ? 3.370   2.826   12.071  1.00 0.00 ? 79  ARG A CA   3  
ATOM 4110  C C    . ARG A 1 79 ? 1.953   3.427   12.072  1.00 0.00 ? 79  ARG A C    3  
ATOM 4111  O O    . ARG A 1 79 ? 1.772   4.616   12.354  1.00 0.00 ? 79  ARG A O    3  
ATOM 4112  C CB   . ARG A 1 79 ? 4.433   3.938   12.079  1.00 0.00 ? 79  ARG A CB   3  
ATOM 4113  C CG   . ARG A 1 79 ? 4.285   4.957   10.957  1.00 0.00 ? 79  ARG A CG   3  
ATOM 4114  C CD   . ARG A 1 79 ? 4.577   6.371   11.437  1.00 0.00 ? 79  ARG A CD   3  
ATOM 4115  N NE   . ARG A 1 79 ? 5.998   6.578   11.724  1.00 0.00 ? 79  ARG A NE   3  
ATOM 4116  C CZ   . ARG A 1 79 ? 6.568   7.781   11.843  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 4117  N NH1  . ARG A 1 79 ? 5.843   8.889   11.697  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 4118  N NH2  . ARG A 1 79 ? 7.867   7.878   12.111  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 4119  H H    . ARG A 1 79 ? 3.916   2.330   10.086  1.00 0.00 ? 79  ARG A H    3  
ATOM 4120  H HA   . ARG A 1 79 ? 3.489   2.230   12.965  1.00 0.00 ? 79  ARG A HA   3  
ATOM 4121  H HB2  . ARG A 1 79 ? 4.380   4.463   13.020  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 4122  H HB3  . ARG A 1 79 ? 5.409   3.482   11.989  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 4123  H HG2  . ARG A 1 79 ? 4.975   4.708   10.166  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 4124  H HG3  . ARG A 1 79 ? 3.274   4.919   10.580  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 4125  H HD2  . ARG A 1 79 ? 4.272   7.065   10.669  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 4126  H HD3  . ARG A 1 79 ? 4.007   6.558   12.336  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 4127  H HE   . ARG A 1 79 ? 6.558   5.779   11.835  1.00 0.00 ? 79  ARG A HE   3  
ATOM 4128  H HH11 . ARG A 1 79 ? 4.865   8.826   11.497  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 4129  H HH12 . ARG A 1 79 ? 6.277   9.786   11.788  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 4130  H HH21 . ARG A 1 79 ? 8.418   7.051   12.224  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 4131  H HH22 . ARG A 1 79 ? 8.294   8.778   12.201  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 4132  N N    . THR A 1 80 ? 0.947   2.599   11.765  1.00 0.00 ? 80  THR A N    3  
ATOM 4133  C CA   . THR A 1 80 ? -0.444  3.056   11.743  1.00 0.00 ? 80  THR A CA   3  
ATOM 4134  C C    . THR A 1 80 ? -1.167  2.688   13.039  1.00 0.00 ? 80  THR A C    3  
ATOM 4135  O O    . THR A 1 80 ? -0.647  1.926   13.857  1.00 0.00 ? 80  THR A O    3  
ATOM 4136  C CB   . THR A 1 80 ? -1.194  2.457   10.545  1.00 0.00 ? 80  THR A CB   3  
ATOM 4137  O OG1  . THR A 1 80 ? -0.995  1.053   10.461  1.00 0.00 ? 80  THR A OG1  3  
ATOM 4138  C CG2  . THR A 1 80 ? -0.779  3.056   9.220   1.00 0.00 ? 80  THR A CG2  3  
ATOM 4139  H H    . THR A 1 80 ? 1.142   1.663   11.556  1.00 0.00 ? 80  THR A H    3  
ATOM 4140  H HA   . THR A 1 80 ? -0.436  4.132   11.647  1.00 0.00 ? 80  THR A HA   3  
ATOM 4141  H HB   . THR A 1 80 ? -2.252  2.639   10.670  1.00 0.00 ? 80  THR A HB   3  
ATOM 4142  H HG1  . THR A 1 80 ? -1.052  0.663   11.335  1.00 0.00 ? 80  THR A HG1  3  
ATOM 4143  H HG21 . THR A 1 80 ? -1.167  4.061   9.144   1.00 0.00 ? 80  THR A HG21 3  
ATOM 4144  H HG22 . THR A 1 80 ? -1.172  2.456   8.413   1.00 0.00 ? 80  THR A HG22 3  
ATOM 4145  H HG23 . THR A 1 80 ? 0.299   3.081   9.159   1.00 0.00 ? 80  THR A HG23 3  
ATOM 4146  N N    . SER A 1 81 ? -2.373  3.229   13.213  1.00 0.00 ? 81  SER A N    3  
ATOM 4147  C CA   . SER A 1 81 ? -3.177  2.957   14.403  1.00 0.00 ? 81  SER A CA   3  
ATOM 4148  C C    . SER A 1 81 ? -4.241  1.897   14.101  1.00 0.00 ? 81  SER A C    3  
ATOM 4149  O O    . SER A 1 81 ? -4.130  1.166   13.114  1.00 0.00 ? 81  SER A O    3  
ATOM 4150  C CB   . SER A 1 81 ? -3.829  4.255   14.899  1.00 0.00 ? 81  SER A CB   3  
ATOM 4151  O OG   . SER A 1 81 ? -4.924  4.632   14.075  1.00 0.00 ? 81  SER A OG   3  
ATOM 4152  H H    . SER A 1 81 ? -2.736  3.823   12.521  1.00 0.00 ? 81  SER A H    3  
ATOM 4153  H HA   . SER A 1 81 ? -2.516  2.579   15.171  1.00 0.00 ? 81  SER A HA   3  
ATOM 4154  H HB2  . SER A 1 81 ? -4.187  4.113   15.907  1.00 0.00 ? 81  SER A HB2  3  
ATOM 4155  H HB3  . SER A 1 81 ? -3.096  5.048   14.886  1.00 0.00 ? 81  SER A HB3  3  
ATOM 4156  H HG   . SER A 1 81 ? -4.597  4.968   13.236  1.00 0.00 ? 81  SER A HG   3  
ATOM 4157  N N    . SER A 1 82 ? -5.272  1.822   14.946  1.00 0.00 ? 82  SER A N    3  
ATOM 4158  C CA   . SER A 1 82 ? -6.356  0.857   14.754  1.00 0.00 ? 82  SER A CA   3  
ATOM 4159  C C    . SER A 1 82 ? -7.003  1.040   13.381  1.00 0.00 ? 82  SER A C    3  
ATOM 4160  O O    . SER A 1 82 ? -7.335  0.062   12.711  1.00 0.00 ? 82  SER A O    3  
ATOM 4161  C CB   . SER A 1 82 ? -7.410  1.013   15.851  1.00 0.00 ? 82  SER A CB   3  
ATOM 4162  O OG   . SER A 1 82 ? -6.918  0.558   17.099  1.00 0.00 ? 82  SER A OG   3  
ATOM 4163  H H    . SER A 1 82 ? -5.308  2.432   15.712  1.00 0.00 ? 82  SER A H    3  
ATOM 4164  H HA   . SER A 1 82 ? -5.932  -0.135  14.811  1.00 0.00 ? 82  SER A HA   3  
ATOM 4165  H HB2  . SER A 1 82 ? -7.681  2.054   15.943  1.00 0.00 ? 82  SER A HB2  3  
ATOM 4166  H HB3  . SER A 1 82 ? -8.284  0.435   15.590  1.00 0.00 ? 82  SER A HB3  3  
ATOM 4167  H HG   . SER A 1 82 ? -6.199  1.128   17.388  1.00 0.00 ? 82  SER A HG   3  
ATOM 4168  N N    . VAL A 1 83 ? -7.168  2.301   12.968  1.00 0.00 ? 83  VAL A N    3  
ATOM 4169  C CA   . VAL A 1 83 ? -7.763  2.616   11.672  1.00 0.00 ? 83  VAL A CA   3  
ATOM 4170  C C    . VAL A 1 83 ? -6.715  2.538   10.567  1.00 0.00 ? 83  VAL A C    3  
ATOM 4171  O O    . VAL A 1 83 ? -5.548  2.866   10.787  1.00 0.00 ? 83  VAL A O    3  
ATOM 4172  C CB   . VAL A 1 83 ? -8.406  4.024   11.660  1.00 0.00 ? 83  VAL A CB   3  
ATOM 4173  C CG1  . VAL A 1 83 ? -9.204  4.240   10.380  1.00 0.00 ? 83  VAL A CG1  3  
ATOM 4174  C CG2  . VAL A 1 83 ? -9.288  4.229   12.883  1.00 0.00 ? 83  VAL A CG2  3  
ATOM 4175  H H    . VAL A 1 83 ? -6.874  3.036   13.548  1.00 0.00 ? 83  VAL A H    3  
ATOM 4176  H HA   . VAL A 1 83 ? -8.536  1.886   11.474  1.00 0.00 ? 83  VAL A HA   3  
ATOM 4177  H HB   . VAL A 1 83 ? -7.614  4.759   11.688  1.00 0.00 ? 83  VAL A HB   3  
ATOM 4178  H HG11 . VAL A 1 83 ? -10.031 4.905   10.579  1.00 0.00 ? 83  VAL A HG11 3  
ATOM 4179  H HG12 . VAL A 1 83 ? -9.583  3.291   10.027  1.00 0.00 ? 83  VAL A HG12 3  
ATOM 4180  H HG13 . VAL A 1 83 ? -8.566  4.676   9.627   1.00 0.00 ? 83  VAL A HG13 3  
ATOM 4181  H HG21 . VAL A 1 83 ? -10.031 3.447   12.926  1.00 0.00 ? 83  VAL A HG21 3  
ATOM 4182  H HG22 . VAL A 1 83 ? -9.779  5.188   12.816  1.00 0.00 ? 83  VAL A HG22 3  
ATOM 4183  H HG23 . VAL A 1 83 ? -8.680  4.198   13.776  1.00 0.00 ? 83  VAL A HG23 3  
ATOM 4184  N N    . VAL A 1 84 ? -7.137  2.098   9.385   1.00 0.00 ? 84  VAL A N    3  
ATOM 4185  C CA   . VAL A 1 84 ? -6.235  1.974   8.244   1.00 0.00 ? 84  VAL A CA   3  
ATOM 4186  C C    . VAL A 1 84 ? -6.908  2.446   6.958   1.00 0.00 ? 84  VAL A C    3  
ATOM 4187  O O    . VAL A 1 84 ? -7.948  1.913   6.567   1.00 0.00 ? 84  VAL A O    3  
ATOM 4188  C CB   . VAL A 1 84 ? -5.758  0.516   8.051   1.00 0.00 ? 84  VAL A CB   3  
ATOM 4189  C CG1  . VAL A 1 84 ? -4.664  0.448   6.994   1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4190  C CG2  . VAL A 1 84 ? -5.272  -0.079  9.366   1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4191  H H    . VAL A 1 84 ? -8.080  1.849   9.276   1.00 0.00 ? 84  VAL A H    3  
ATOM 4192  H HA   . VAL A 1 84 ? -5.369  2.593   8.436   1.00 0.00 ? 84  VAL A HA   3  
ATOM 4193  H HB   . VAL A 1 84 ? -6.596  -0.071  7.703   1.00 0.00 ? 84  VAL A HB   3  
ATOM 4194  H HG11 . VAL A 1 84 ? -4.694  -0.515  6.506   1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4195  H HG12 . VAL A 1 84 ? -3.702  0.583   7.463   1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4196  H HG13 . VAL A 1 84 ? -4.821  1.227   6.263   1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4197  H HG21 . VAL A 1 84 ? -4.585  -0.888  9.161   1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4198  H HG22 . VAL A 1 84 ? -6.115  -0.459  9.924   1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4199  H HG23 . VAL A 1 84 ? -4.772  0.683   9.945   1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4200  N N    . THR A 1 85 ? -6.304  3.438   6.303   1.00 0.00 ? 85  THR A N    3  
ATOM 4201  C CA   . THR A 1 85 ? -6.834  3.977   5.051   1.00 0.00 ? 85  THR A CA   3  
ATOM 4202  C C    . THR A 1 85 ? -5.795  3.864   3.938   1.00 0.00 ? 85  THR A C    3  
ATOM 4203  O O    . THR A 1 85 ? -4.881  4.686   3.844   1.00 0.00 ? 85  THR A O    3  
ATOM 4204  C CB   . THR A 1 85 ? -7.269  5.437   5.226   1.00 0.00 ? 85  THR A CB   3  
ATOM 4205  O OG1  . THR A 1 85 ? -6.517  6.079   6.241   1.00 0.00 ? 85  THR A OG1  3  
ATOM 4206  C CG2  . THR A 1 85 ? -8.732  5.581   5.579   1.00 0.00 ? 85  THR A CG2  3  
ATOM 4207  H H    . THR A 1 85 ? -5.475  3.814   6.668   1.00 0.00 ? 85  THR A H    3  
ATOM 4208  H HA   . THR A 1 85 ? -7.695  3.386   4.778   1.00 0.00 ? 85  THR A HA   3  
ATOM 4209  H HB   . THR A 1 85 ? -7.102  5.966   4.297   1.00 0.00 ? 85  THR A HB   3  
ATOM 4210  H HG1  . THR A 1 85 ? -6.231  6.941   5.933   1.00 0.00 ? 85  THR A HG1  3  
ATOM 4211  H HG21 . THR A 1 85 ? -8.992  4.851   6.331   1.00 0.00 ? 85  THR A HG21 3  
ATOM 4212  H HG22 . THR A 1 85 ? -9.334  5.418   4.697   1.00 0.00 ? 85  THR A HG22 3  
ATOM 4213  H HG23 . THR A 1 85 ? -8.915  6.573   5.962   1.00 0.00 ? 85  THR A HG23 3  
ATOM 4214  N N    . LEU A 1 86 ? -5.936  2.833   3.104   1.00 0.00 ? 86  LEU A N    3  
ATOM 4215  C CA   . LEU A 1 86 ? -5.005  2.602   2.002   1.00 0.00 ? 86  LEU A CA   3  
ATOM 4216  C C    . LEU A 1 86 ? -5.639  2.959   0.659   1.00 0.00 ? 86  LEU A C    3  
ATOM 4217  O O    . LEU A 1 86 ? -6.596  2.313   0.226   1.00 0.00 ? 86  LEU A O    3  
ATOM 4218  C CB   . LEU A 1 86 ? -4.547  1.137   1.988   1.00 0.00 ? 86  LEU A CB   3  
ATOM 4219  C CG   . LEU A 1 86 ? -3.185  0.865   2.635   1.00 0.00 ? 86  LEU A CG   3  
ATOM 4220  C CD1  . LEU A 1 86 ? -2.072  1.531   1.841   1.00 0.00 ? 86  LEU A CD1  3  
ATOM 4221  C CD2  . LEU A 1 86 ? -3.170  1.338   4.083   1.00 0.00 ? 86  LEU A CD2  3  
ATOM 4222  H H    . LEU A 1 86 ? -6.682  2.208   3.237   1.00 0.00 ? 86  LEU A H    3  
ATOM 4223  H HA   . LEU A 1 86 ? -4.144  3.235   2.159   1.00 0.00 ? 86  LEU A HA   3  
ATOM 4224  H HB2  . LEU A 1 86 ? -5.290  0.544   2.504   1.00 0.00 ? 86  LEU A HB2  3  
ATOM 4225  H HB3  . LEU A 1 86 ? -4.501  0.807   0.961   1.00 0.00 ? 86  LEU A HB3  3  
ATOM 4226  H HG   . LEU A 1 86 ? -3.001  -0.200  2.631   1.00 0.00 ? 86  LEU A HG   3  
ATOM 4227  H HD11 . LEU A 1 86 ? -2.402  2.501   1.499   1.00 0.00 ? 86  LEU A HD11 3  
ATOM 4228  H HD12 . LEU A 1 86 ? -1.821  0.916   0.990   1.00 0.00 ? 86  LEU A HD12 3  
ATOM 4229  H HD13 . LEU A 1 86 ? -1.201  1.649   2.469   1.00 0.00 ? 86  LEU A HD13 3  
ATOM 4230  H HD21 . LEU A 1 86 ? -3.648  0.598   4.707   1.00 0.00 ? 86  LEU A HD21 3  
ATOM 4231  H HD22 . LEU A 1 86 ? -3.703  2.274   4.163   1.00 0.00 ? 86  LEU A HD22 3  
ATOM 4232  H HD23 . LEU A 1 86 ? -2.149  1.476   4.407   1.00 0.00 ? 86  LEU A HD23 3  
ATOM 4233  N N    . GLU A 1 87 ? -5.089  3.982   -0.001  1.00 0.00 ? 87  GLU A N    3  
ATOM 4234  C CA   . GLU A 1 87 ? -5.592  4.417   -1.303  1.00 0.00 ? 87  GLU A CA   3  
ATOM 4235  C C    . GLU A 1 87 ? -5.031  3.524   -2.409  1.00 0.00 ? 87  GLU A C    3  
ATOM 4236  O O    . GLU A 1 87 ? -3.968  3.801   -2.972  1.00 0.00 ? 87  GLU A O    3  
ATOM 4237  C CB   . GLU A 1 87 ? -5.222  5.881   -1.563  1.00 0.00 ? 87  GLU A CB   3  
ATOM 4238  C CG   . GLU A 1 87 ? -6.425  6.803   -1.707  1.00 0.00 ? 87  GLU A CG   3  
ATOM 4239  C CD   . GLU A 1 87 ? -6.224  7.870   -2.768  1.00 0.00 ? 87  GLU A CD   3  
ATOM 4240  O OE1  . GLU A 1 87 ? -5.135  8.482   -2.800  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 4241  O OE2  . GLU A 1 87 ? -7.159  8.096   -3.565  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 4242  H H    . GLU A 1 87 ? -4.322  4.448   0.394   1.00 0.00 ? 87  GLU A H    3  
ATOM 4243  H HA   . GLU A 1 87 ? -6.670  4.324   -1.289  1.00 0.00 ? 87  GLU A HA   3  
ATOM 4244  H HB2  . GLU A 1 87 ? -4.619  6.239   -0.742  1.00 0.00 ? 87  GLU A HB2  3  
ATOM 4245  H HB3  . GLU A 1 87 ? -4.642  5.938   -2.474  1.00 0.00 ? 87  GLU A HB3  3  
ATOM 4246  H HG2  . GLU A 1 87 ? -7.287  6.210   -1.975  1.00 0.00 ? 87  GLU A HG2  3  
ATOM 4247  H HG3  . GLU A 1 87 ? -6.604  7.288   -0.759  1.00 0.00 ? 87  GLU A HG3  3  
ATOM 4248  N N    . VAL A 1 88 ? -5.751  2.445   -2.704  1.00 0.00 ? 88  VAL A N    3  
ATOM 4249  C CA   . VAL A 1 88 ? -5.336  1.490   -3.728  1.00 0.00 ? 88  VAL A CA   3  
ATOM 4250  C C    . VAL A 1 88 ? -5.954  1.824   -5.090  1.00 0.00 ? 88  VAL A C    3  
ATOM 4251  O O    . VAL A 1 88 ? -7.047  2.386   -5.165  1.00 0.00 ? 88  VAL A O    3  
ATOM 4252  C CB   . VAL A 1 88 ? -5.721  0.047   -3.326  1.00 0.00 ? 88  VAL A CB   3  
ATOM 4253  C CG1  . VAL A 1 88 ? -7.233  -0.105  -3.219  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4254  C CG2  . VAL A 1 88 ? -5.144  -0.960  -4.311  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4255  H H    . VAL A 1 88 ? -6.583  2.280   -2.211  1.00 0.00 ? 88  VAL A H    3  
ATOM 4256  H HA   . VAL A 1 88 ? -4.260  1.542   -3.811  1.00 0.00 ? 88  VAL A HA   3  
ATOM 4257  H HB   . VAL A 1 88 ? -5.297  -0.155  -2.353  1.00 0.00 ? 88  VAL A HB   3  
ATOM 4258  H HG11 . VAL A 1 88 ? -7.602  0.515   -2.415  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4259  H HG12 . VAL A 1 88 ? -7.479  -1.137  -3.019  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4260  H HG13 . VAL A 1 88 ? -7.692  0.201   -4.148  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4261  H HG21 . VAL A 1 88 ? -4.092  -0.762  -4.452  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4262  H HG22 . VAL A 1 88 ? -5.656  -0.872  -5.258  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4263  H HG23 . VAL A 1 88 ? -5.274  -1.959  -3.922  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4264  N N    . ALA A 1 89 ? -5.244  1.467   -6.164  1.00 0.00 ? 89  ALA A N    3  
ATOM 4265  C CA   . ALA A 1 89 ? -5.718  1.722   -7.524  1.00 0.00 ? 89  ALA A CA   3  
ATOM 4266  C C    . ALA A 1 89 ? -6.280  0.456   -8.167  1.00 0.00 ? 89  ALA A C    3  
ATOM 4267  O O    . ALA A 1 89 ? -5.763  -0.642  -7.951  1.00 0.00 ? 89  ALA A O    3  
ATOM 4268  C CB   . ALA A 1 89 ? -4.591  2.283   -8.379  1.00 0.00 ? 89  ALA A CB   3  
ATOM 4269  H H    . ALA A 1 89 ? -4.380  1.019   -6.038  1.00 0.00 ? 89  ALA A H    3  
ATOM 4270  H HA   . ALA A 1 89 ? -6.499  2.466   -7.471  1.00 0.00 ? 89  ALA A HA   3  
ATOM 4271  H HB1  . ALA A 1 89 ? -4.780  2.054   -9.417  1.00 0.00 ? 89  ALA A HB1  3  
ATOM 4272  H HB2  . ALA A 1 89 ? -3.653  1.838   -8.078  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 4273  H HB3  . ALA A 1 89 ? -4.539  3.354   -8.250  1.00 0.00 ? 89  ALA A HB3  3  
ATOM 4274  N N    . LYS A 1 90 ? -7.334  0.622   -8.968  1.00 0.00 ? 90  LYS A N    3  
ATOM 4275  C CA   . LYS A 1 90 ? -7.968  -0.500  -9.659  1.00 0.00 ? 90  LYS A CA   3  
ATOM 4276  C C    . LYS A 1 90 ? -7.196  -0.850  -10.931 1.00 0.00 ? 90  LYS A C    3  
ATOM 4277  O O    . LYS A 1 90 ? -7.608  -0.503  -12.042 1.00 0.00 ? 90  LYS A O    3  
ATOM 4278  C CB   . LYS A 1 90 ? -9.426  -0.164  -9.996  1.00 0.00 ? 90  LYS A CB   3  
ATOM 4279  C CG   . LYS A 1 90 ? -10.315 -1.387  -10.162 1.00 0.00 ? 90  LYS A CG   3  
ATOM 4280  C CD   . LYS A 1 90 ? -10.744 -1.955  -8.817  1.00 0.00 ? 90  LYS A CD   3  
ATOM 4281  C CE   . LYS A 1 90 ? -11.863 -1.132  -8.192  1.00 0.00 ? 90  LYS A CE   3  
ATOM 4282  N NZ   . LYS A 1 90 ? -13.107 -1.928  -7.988  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 4283  H H    . LYS A 1 90 ? -7.691  1.525   -9.104  1.00 0.00 ? 90  LYS A H    3  
ATOM 4284  H HA   . LYS A 1 90 ? -7.947  -1.353  -8.995  1.00 0.00 ? 90  LYS A HA   3  
ATOM 4285  H HB2  . LYS A 1 90 ? -9.833  0.446   -9.204  1.00 0.00 ? 90  LYS A HB2  3  
ATOM 4286  H HB3  . LYS A 1 90 ? -9.450  0.399   -10.918 1.00 0.00 ? 90  LYS A HB3  3  
ATOM 4287  H HG2  . LYS A 1 90 ? -11.197 -1.105  -10.719 1.00 0.00 ? 90  LYS A HG2  3  
ATOM 4288  H HG3  . LYS A 1 90 ? -9.772  -2.145  -10.707 1.00 0.00 ? 90  LYS A HG3  3  
ATOM 4289  H HD2  . LYS A 1 90 ? -11.089 -2.968  -8.959  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 4290  H HD3  . LYS A 1 90 ? -9.893  -1.954  -8.150  1.00 0.00 ? 90  LYS A HD3  3  
ATOM 4291  H HE2  . LYS A 1 90 ? -11.526 -0.759  -7.236  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 4292  H HE3  . LYS A 1 90 ? -12.083 -0.299  -8.843  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 4293  H HZ1  . LYS A 1 90 ? -13.125 -2.324  -7.027  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 4294  H HZ2  . LYS A 1 90 ? -13.153 -2.710  -8.674  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 4295  H HZ3  . LYS A 1 90 ? -13.943 -1.322  -8.116  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 4296  N N    . GLN A 1 91 ? -6.068  -1.534  -10.755 1.00 0.00 ? 91  GLN A N    3  
ATOM 4297  C CA   . GLN A 1 91 ? -5.219  -1.936  -11.873 1.00 0.00 ? 91  GLN A CA   3  
ATOM 4298  C C    . GLN A 1 91 ? -4.960  -3.445  -11.850 1.00 0.00 ? 91  GLN A C    3  
ATOM 4299  O O    . GLN A 1 91 ? -5.406  -4.145  -10.937 1.00 0.00 ? 91  GLN A O    3  
ATOM 4300  C CB   . GLN A 1 91 ? -3.888  -1.174  -11.821 1.00 0.00 ? 91  GLN A CB   3  
ATOM 4301  C CG   . GLN A 1 91 ? -3.201  -1.241  -10.464 1.00 0.00 ? 91  GLN A CG   3  
ATOM 4302  C CD   . GLN A 1 91 ? -1.756  -0.782  -10.515 1.00 0.00 ? 91  GLN A CD   3  
ATOM 4303  O OE1  . GLN A 1 91 ? -1.474  0.401   -10.705 1.00 0.00 ? 91  GLN A OE1  3  
ATOM 4304  N NE2  . GLN A 1 91 ? -0.828  -1.717  -10.340 1.00 0.00 ? 91  GLN A NE2  3  
ATOM 4305  H H    . GLN A 1 91 ? -5.796  -1.773  -9.843  1.00 0.00 ? 91  GLN A H    3  
ATOM 4306  H HA   . GLN A 1 91 ? -5.732  -1.684  -12.790 1.00 0.00 ? 91  GLN A HA   3  
ATOM 4307  H HB2  . GLN A 1 91 ? -3.218  -1.588  -12.561 1.00 0.00 ? 91  GLN A HB2  3  
ATOM 4308  H HB3  . GLN A 1 91 ? -4.072  -0.135  -12.055 1.00 0.00 ? 91  GLN A HB3  3  
ATOM 4309  H HG2  . GLN A 1 91 ? -3.737  -0.609  -9.773  1.00 0.00 ? 91  GLN A HG2  3  
ATOM 4310  H HG3  . GLN A 1 91 ? -3.228  -2.262  -10.112 1.00 0.00 ? 91  GLN A HG3  3  
ATOM 4311  H HE21 . GLN A 1 91 ? -1.122  -2.640  -10.188 1.00 0.00 ? 91  GLN A HE21 3  
ATOM 4312  H HE22 . GLN A 1 91 ? 0.113   -1.446  -10.372 1.00 0.00 ? 91  GLN A HE22 3  
ATOM 4313  N N    . GLY A 1 92 ? -4.235  -3.938  -12.857 1.00 0.00 ? 92  GLY A N    3  
ATOM 4314  C CA   . GLY A 1 92 ? -3.926  -5.354  -12.931 1.00 0.00 ? 92  GLY A CA   3  
ATOM 4315  C C    . GLY A 1 92 ? -2.474  -5.646  -12.611 1.00 0.00 ? 92  GLY A C    3  
ATOM 4316  O O    . GLY A 1 92 ? -1.887  -5.019  -11.726 1.00 0.00 ? 92  GLY A O    3  
ATOM 4317  H H    . GLY A 1 92 ? -3.903  -3.335  -13.553 1.00 0.00 ? 92  GLY A H    3  
ATOM 4318  H HA2  . GLY A 1 92 ? -4.551  -5.888  -12.231 1.00 0.00 ? 92  GLY A HA2  3  
ATOM 4319  H HA3  . GLY A 1 92 ? -4.140  -5.706  -13.929 1.00 0.00 ? 92  GLY A HA3  3  
ATOM 4320  N N    . ALA A 1 93 ? -1.898  -6.601  -13.335 1.00 0.00 ? 93  ALA A N    3  
ATOM 4321  C CA   . ALA A 1 93 ? -0.506  -6.990  -13.136 1.00 0.00 ? 93  ALA A CA   3  
ATOM 4322  C C    . ALA A 1 93 ? 0.398   -6.372  -14.202 1.00 0.00 ? 93  ALA A C    3  
ATOM 4323  O O    . ALA A 1 93 ? 0.179   -6.648  -15.402 1.00 0.00 ? 93  ALA A O    3  
ATOM 4324  C CB   . ALA A 1 93 ? -0.378  -8.508  -13.140 1.00 0.00 ? 93  ALA A CB   3  
ATOM 4325  O OXT  . ALA A 1 93 ? 1.315   -5.611  -13.827 1.00 0.00 ? 93  ALA A OXT  3  
ATOM 4326  H H    . ALA A 1 93 ? -2.426  -7.057  -14.023 1.00 0.00 ? 93  ALA A H    3  
ATOM 4327  H HA   . ALA A 1 93 ? -0.196  -6.630  -12.165 1.00 0.00 ? 93  ALA A HA   3  
ATOM 4328  H HB1  . ALA A 1 93 ? -1.236  -8.943  -12.648 1.00 0.00 ? 93  ALA A HB1  3  
ATOM 4329  H HB2  . ALA A 1 93 ? 0.521   -8.794  -12.616 1.00 0.00 ? 93  ALA A HB2  3  
ATOM 4330  H HB3  . ALA A 1 93 ? -0.330  -8.863  -14.159 1.00 0.00 ? 93  ALA A HB3  3  
ATOM 4331  N N    . LEU B 2 1  ? 10.578  -6.818  -8.101  1.00 0.00 ? 99  LEU B N    3  
ATOM 4332  C CA   . LEU B 2 1  ? 11.568  -7.768  -7.517  1.00 0.00 ? 99  LEU B CA   3  
ATOM 4333  C C    . LEU B 2 1  ? 11.570  -7.712  -5.986  1.00 0.00 ? 99  LEU B C    3  
ATOM 4334  O O    . LEU B 2 1  ? 11.563  -8.751  -5.326  1.00 0.00 ? 99  LEU B O    3  
ATOM 4335  C CB   . LEU B 2 1  ? 12.960  -7.431  -8.063  1.00 0.00 ? 99  LEU B CB   3  
ATOM 4336  C CG   . LEU B 2 1  ? 13.153  -7.690  -9.561  1.00 0.00 ? 99  LEU B CG   3  
ATOM 4337  C CD1  . LEU B 2 1  ? 14.249  -6.795  -10.124 1.00 0.00 ? 99  LEU B CD1  3  
ATOM 4338  C CD2  . LEU B 2 1  ? 13.477  -9.158  -9.808  1.00 0.00 ? 99  LEU B CD2  3  
ATOM 4339  H H1   . LEU B 2 1  ? 9.694   -6.911  -7.563  1.00 0.00 ? 99  LEU B H1   3  
ATOM 4340  H H2   . LEU B 2 1  ? 10.437  -7.082  -9.099  1.00 0.00 ? 99  LEU B H2   3  
ATOM 4341  H H3   . LEU B 2 1  ? 10.967  -5.857  -8.019  1.00 0.00 ? 99  LEU B H3   3  
ATOM 4342  H HA   . LEU B 2 1  ? 11.302  -8.767  -7.827  1.00 0.00 ? 99  LEU B HA   3  
ATOM 4343  H HB2  . LEU B 2 1  ? 13.157  -6.386  -7.871  1.00 0.00 ? 99  LEU B HB2  3  
ATOM 4344  H HB3  . LEU B 2 1  ? 13.687  -8.021  -7.524  1.00 0.00 ? 99  LEU B HB3  3  
ATOM 4345  H HG   . LEU B 2 1  ? 12.236  -7.458  -10.082 1.00 0.00 ? 99  LEU B HG   3  
ATOM 4346  H HD11 . LEU B 2 1  ? 13.815  -5.864  -10.459 1.00 0.00 ? 99  LEU B HD11 3  
ATOM 4347  H HD12 . LEU B 2 1  ? 14.727  -7.289  -10.956 1.00 0.00 ? 99  LEU B HD12 3  
ATOM 4348  H HD13 . LEU B 2 1  ? 14.981  -6.594  -9.355  1.00 0.00 ? 99  LEU B HD13 3  
ATOM 4349  H HD21 . LEU B 2 1  ? 12.627  -9.765  -9.532  1.00 0.00 ? 99  LEU B HD21 3  
ATOM 4350  H HD22 . LEU B 2 1  ? 14.331  -9.444  -9.213  1.00 0.00 ? 99  LEU B HD22 3  
ATOM 4351  H HD23 . LEU B 2 1  ? 13.701  -9.308  -10.854 1.00 0.00 ? 99  LEU B HD23 3  
ATOM 4352  N N    . PHE B 2 2  ? 11.579  -6.495  -5.429  1.00 0.00 ? 100 PHE B N    3  
ATOM 4353  C CA   . PHE B 2 2  ? 11.580  -6.302  -3.975  1.00 0.00 ? 100 PHE B CA   3  
ATOM 4354  C C    . PHE B 2 2  ? 10.328  -6.907  -3.333  1.00 0.00 ? 100 PHE B C    3  
ATOM 4355  O O    . PHE B 2 2  ? 9.413   -7.347  -4.032  1.00 0.00 ? 100 PHE B O    3  
ATOM 4356  C CB   . PHE B 2 2  ? 11.650  -4.810  -3.639  1.00 0.00 ? 100 PHE B CB   3  
ATOM 4357  C CG   . PHE B 2 2  ? 12.970  -4.166  -3.962  1.00 0.00 ? 100 PHE B CG   3  
ATOM 4358  C CD1  . PHE B 2 2  ? 14.109  -4.488  -3.241  1.00 0.00 ? 100 PHE B CD1  3  
ATOM 4359  C CD2  . PHE B 2 2  ? 13.068  -3.228  -4.979  1.00 0.00 ? 100 PHE B CD2  3  
ATOM 4360  C CE1  . PHE B 2 2  ? 15.321  -3.891  -3.530  1.00 0.00 ? 100 PHE B CE1  3  
ATOM 4361  C CE2  . PHE B 2 2  ? 14.278  -2.629  -5.273  1.00 0.00 ? 100 PHE B CE2  3  
ATOM 4362  C CZ   . PHE B 2 2  ? 15.405  -2.959  -4.547  1.00 0.00 ? 100 PHE B CZ   3  
ATOM 4363  H H    . PHE B 2 2  ? 11.586  -5.705  -6.010  1.00 0.00 ? 100 PHE B H    3  
ATOM 4364  H HA   . PHE B 2 2  ? 12.453  -6.795  -3.574  1.00 0.00 ? 100 PHE B HA   3  
ATOM 4365  H HB2  . PHE B 2 2  ? 10.884  -4.288  -4.193  1.00 0.00 ? 100 PHE B HB2  3  
ATOM 4366  H HB3  . PHE B 2 2  ? 11.469  -4.683  -2.583  1.00 0.00 ? 100 PHE B HB3  3  
ATOM 4367  H HD1  . PHE B 2 2  ? 14.045  -5.217  -2.446  1.00 0.00 ? 100 PHE B HD1  3  
ATOM 4368  H HD2  . PHE B 2 2  ? 12.187  -2.969  -5.547  1.00 0.00 ? 100 PHE B HD2  3  
ATOM 4369  H HE1  . PHE B 2 2  ? 16.201  -4.150  -2.961  1.00 0.00 ? 100 PHE B HE1  3  
ATOM 4370  H HE2  . PHE B 2 2  ? 14.341  -1.901  -6.068  1.00 0.00 ? 100 PHE B HE2  3  
ATOM 4371  H HZ   . PHE B 2 2  ? 16.352  -2.491  -4.774  1.00 0.00 ? 100 PHE B HZ   3  
ATOM 4372  N N    . SER B 2 3  ? 10.290  -6.916  -1.995  1.00 0.00 ? 101 SER B N    3  
ATOM 4373  C CA   . SER B 2 3  ? 9.145   -7.455  -1.259  1.00 0.00 ? 101 SER B CA   3  
ATOM 4374  C C    . SER B 2 3  ? 9.357   -7.357  0.254   1.00 0.00 ? 101 SER B C    3  
ATOM 4375  O O    . SER B 2 3  ? 10.054  -8.184  0.845   1.00 0.00 ? 101 SER B O    3  
ATOM 4376  C CB   . SER B 2 3  ? 8.891   -8.914  -1.658  1.00 0.00 ? 101 SER B CB   3  
ATOM 4377  O OG   . SER B 2 3  ? 7.852   -9.489  -0.882  1.00 0.00 ? 101 SER B OG   3  
ATOM 4378  H H    . SER B 2 3  ? 11.046  -6.544  -1.494  1.00 0.00 ? 101 SER B H    3  
ATOM 4379  H HA   . SER B 2 3  ? 8.280   -6.868  -1.525  1.00 0.00 ? 101 SER B HA   3  
ATOM 4380  H HB2  . SER B 2 3  ? 8.607   -8.955  -2.697  1.00 0.00 ? 101 SER B HB2  3  
ATOM 4381  H HB3  . SER B 2 3  ? 9.795   -9.488  -1.510  1.00 0.00 ? 101 SER B HB3  3  
ATOM 4382  H HG   . SER B 2 3  ? 7.901   -10.447 -0.944  1.00 0.00 ? 101 SER B HG   3  
ATOM 4383  N N    . THR B 2 4  ? 8.740   -6.352  0.879   1.00 0.00 ? 102 THR B N    3  
ATOM 4384  C CA   . THR B 2 4  ? 8.855   -6.168  2.327   1.00 0.00 ? 102 THR B CA   3  
ATOM 4385  C C    . THR B 2 4  ? 7.628   -6.758  3.027   1.00 0.00 ? 102 THR B C    3  
ATOM 4386  O O    . THR B 2 4  ? 6.884   -7.537  2.428   1.00 0.00 ? 102 THR B O    3  
ATOM 4387  C CB   . THR B 2 4  ? 9.017   -4.678  2.684   1.00 0.00 ? 102 THR B CB   3  
ATOM 4388  O OG1  . THR B 2 4  ? 7.764   -4.012  2.708   1.00 0.00 ? 102 THR B OG1  3  
ATOM 4389  C CG2  . THR B 2 4  ? 9.917   -3.917  1.733   1.00 0.00 ? 102 THR B CG2  3  
ATOM 4390  H H    . THR B 2 4  ? 8.188   -5.727  0.358   1.00 0.00 ? 102 THR B H    3  
ATOM 4391  H HA   . THR B 2 4  ? 9.733   -6.706  2.658   1.00 0.00 ? 102 THR B HA   3  
ATOM 4392  H HB   . THR B 2 4  ? 9.452   -4.605  3.672   1.00 0.00 ? 102 THR B HB   3  
ATOM 4393  H HG1  . THR B 2 4  ? 7.132   -4.488  2.165   1.00 0.00 ? 102 THR B HG1  3  
ATOM 4394  H HG21 . THR B 2 4  ? 10.267  -4.579  0.957   1.00 0.00 ? 102 THR B HG21 3  
ATOM 4395  H HG22 . THR B 2 4  ? 10.763  -3.522  2.277   1.00 0.00 ? 102 THR B HG22 3  
ATOM 4396  H HG23 . THR B 2 4  ? 9.362   -3.103  1.289   1.00 0.00 ? 102 THR B HG23 3  
ATOM 4397  N N    . GLU B 2 5  ? 7.414   -6.385  4.289   1.00 0.00 ? 103 GLU B N    3  
ATOM 4398  C CA   . GLU B 2 5  ? 6.268   -6.879  5.046   1.00 0.00 ? 103 GLU B CA   3  
ATOM 4399  C C    . GLU B 2 5  ? 5.810   -5.854  6.083   1.00 0.00 ? 103 GLU B C    3  
ATOM 4400  O O    . GLU B 2 5  ? 6.512   -5.590  7.063   1.00 0.00 ? 103 GLU B O    3  
ATOM 4401  C CB   . GLU B 2 5  ? 6.599   -8.216  5.723   1.00 0.00 ? 103 GLU B CB   3  
ATOM 4402  C CG   . GLU B 2 5  ? 7.975   -8.263  6.373   1.00 0.00 ? 103 GLU B CG   3  
ATOM 4403  C CD   . GLU B 2 5  ? 8.433   -9.680  6.666   1.00 0.00 ? 103 GLU B CD   3  
ATOM 4404  O OE1  . GLU B 2 5  ? 7.800   -10.348 7.510   1.00 0.00 ? 103 GLU B OE1  3  
ATOM 4405  O OE2  . GLU B 2 5  ? 9.428   -10.119 6.051   1.00 0.00 ? 103 GLU B OE2  3  
ATOM 4406  H H    . GLU B 2 5  ? 8.035   -5.759  4.718   1.00 0.00 ? 103 GLU B H    3  
ATOM 4407  H HA   . GLU B 2 5  ? 5.464   -7.037  4.344   1.00 0.00 ? 103 GLU B HA   3  
ATOM 4408  H HB2  . GLU B 2 5  ? 5.859   -8.409  6.486   1.00 0.00 ? 103 GLU B HB2  3  
ATOM 4409  H HB3  . GLU B 2 5  ? 6.548   -9.000  4.981   1.00 0.00 ? 103 GLU B HB3  3  
ATOM 4410  H HG2  . GLU B 2 5  ? 8.689   -7.802  5.708   1.00 0.00 ? 103 GLU B HG2  3  
ATOM 4411  H HG3  . GLU B 2 5  ? 7.940   -7.712  7.300   1.00 0.00 ? 103 GLU B HG3  3  
ATOM 4412  N N    . VAL B 2 6  ? 4.626   -5.281  5.857   1.00 0.00 ? 104 VAL B N    3  
ATOM 4413  C CA   . VAL B 2 6  ? 4.062   -4.282  6.766   1.00 0.00 ? 104 VAL B CA   3  
ATOM 4414  C C    . VAL B 2 6  ? 3.028   -4.911  7.710   1.00 0.00 ? 104 VAL B C    3  
ATOM 4415  O O    . VAL B 2 6  ? 2.251   -5.783  7.255   1.00 0.00 ? 104 VAL B O    3  
ATOM 4416  C CB   . VAL B 2 6  ? 3.416   -3.109  5.988   1.00 0.00 ? 104 VAL B CB   3  
ATOM 4417  C CG1  . VAL B 2 6  ? 2.169   -3.570  5.250   1.00 0.00 ? 104 VAL B CG1  3  
ATOM 4418  C CG2  . VAL B 2 6  ? 3.094   -1.953  6.927   1.00 0.00 ? 104 VAL B CG2  3  
ATOM 4419  O OXT  . VAL B 2 6  ? 3.006   -4.526  8.898   1.00 0.00 ? 104 VAL B OXT  3  
ATOM 4420  H H    . VAL B 2 6  ? 4.119   -5.534  5.056   1.00 0.00 ? 104 VAL B H    3  
ATOM 4421  H HA   . VAL B 2 6  ? 4.873   -3.886  7.360   1.00 0.00 ? 104 VAL B HA   3  
ATOM 4422  H HB   . VAL B 2 6  ? 4.127   -2.756  5.254   1.00 0.00 ? 104 VAL B HB   3  
ATOM 4423  H HG11 . VAL B 2 6  ? 2.238   -4.630  5.062   1.00 0.00 ? 104 VAL B HG11 3  
ATOM 4424  H HG12 . VAL B 2 6  ? 2.089   -3.045  4.311   1.00 0.00 ? 104 VAL B HG12 3  
ATOM 4425  H HG13 . VAL B 2 6  ? 1.296   -3.366  5.855   1.00 0.00 ? 104 VAL B HG13 3  
ATOM 4426  H HG21 . VAL B 2 6  ? 2.183   -1.472  6.607   1.00 0.00 ? 104 VAL B HG21 3  
ATOM 4427  H HG22 . VAL B 2 6  ? 3.906   -1.240  6.911   1.00 0.00 ? 104 VAL B HG22 3  
ATOM 4428  H HG23 . VAL B 2 6  ? 2.967   -2.329  7.931   1.00 0.00 ? 104 VAL B HG23 3  
ATOM 4429  N N    . MET A 1 1  ? -7.516  12.526  -20.001 1.00 0.00 ? 1   MET A N    4  
ATOM 4430  C CA   . MET A 1 1  ? -7.700  11.063  -20.209 1.00 0.00 ? 1   MET A CA   4  
ATOM 4431  C C    . MET A 1 1  ? -6.900  10.252  -19.190 1.00 0.00 ? 1   MET A C    4  
ATOM 4432  O O    . MET A 1 1  ? -6.205  10.819  -18.345 1.00 0.00 ? 1   MET A O    4  
ATOM 4433  C CB   . MET A 1 1  ? -7.262  10.708  -21.635 1.00 0.00 ? 1   MET A CB   4  
ATOM 4434  C CG   . MET A 1 1  ? -8.235  9.794   -22.364 1.00 0.00 ? 1   MET A CG   4  
ATOM 4435  S SD   . MET A 1 1  ? -7.471  8.931   -23.749 1.00 0.00 ? 1   MET A SD   4  
ATOM 4436  C CE   . MET A 1 1  ? -7.304  10.268  -24.929 1.00 0.00 ? 1   MET A CE   4  
ATOM 4437  H H1   . MET A 1 1  ? -7.636  12.718  -18.986 1.00 0.00 ? 1   MET A H1   4  
ATOM 4438  H H2   . MET A 1 1  ? -8.239  13.019  -20.564 1.00 0.00 ? 1   MET A H2   4  
ATOM 4439  H H3   . MET A 1 1  ? -6.557  12.775  -20.318 1.00 0.00 ? 1   MET A H3   4  
ATOM 4440  H HA   . MET A 1 1  ? -8.749  10.832  -20.093 1.00 0.00 ? 1   MET A HA   4  
ATOM 4441  H HB2  . MET A 1 1  ? -7.162  11.619  -22.207 1.00 0.00 ? 1   MET A HB2  4  
ATOM 4442  H HB3  . MET A 1 1  ? -6.302  10.215  -21.592 1.00 0.00 ? 1   MET A HB3  4  
ATOM 4443  H HG2  . MET A 1 1  ? -8.612  9.061   -21.666 1.00 0.00 ? 1   MET A HG2  4  
ATOM 4444  H HG3  . MET A 1 1  ? -9.057  10.389  -22.737 1.00 0.00 ? 1   MET A HG3  4  
ATOM 4445  H HE1  . MET A 1 1  ? -8.228  10.382  -25.476 1.00 0.00 ? 1   MET A HE1  4  
ATOM 4446  H HE2  . MET A 1 1  ? -6.503  10.042  -25.617 1.00 0.00 ? 1   MET A HE2  4  
ATOM 4447  H HE3  . MET A 1 1  ? -7.080  11.185  -24.404 1.00 0.00 ? 1   MET A HE3  4  
ATOM 4448  N N    . LYS A 1 2  ? -7.009  8.923   -19.277 1.00 0.00 ? 2   LYS A N    4  
ATOM 4449  C CA   . LYS A 1 2  ? -6.306  8.021   -18.365 1.00 0.00 ? 2   LYS A CA   4  
ATOM 4450  C C    . LYS A 1 2  ? -6.790  8.217   -16.926 1.00 0.00 ? 2   LYS A C    4  
ATOM 4451  O O    . LYS A 1 2  ? -6.167  8.934   -16.141 1.00 0.00 ? 2   LYS A O    4  
ATOM 4452  C CB   . LYS A 1 2  ? -4.788  8.231   -18.453 1.00 0.00 ? 2   LYS A CB   4  
ATOM 4453  C CG   . LYS A 1 2  ? -4.025  6.972   -18.832 1.00 0.00 ? 2   LYS A CG   4  
ATOM 4454  C CD   . LYS A 1 2  ? -2.566  7.272   -19.140 1.00 0.00 ? 2   LYS A CD   4  
ATOM 4455  C CE   . LYS A 1 2  ? -1.787  6.000   -19.449 1.00 0.00 ? 2   LYS A CE   4  
ATOM 4456  N NZ   . LYS A 1 2  ? -1.438  5.244   -18.213 1.00 0.00 ? 2   LYS A NZ   4  
ATOM 4457  H H    . LYS A 1 2  ? -7.582  8.538   -19.973 1.00 0.00 ? 2   LYS A H    4  
ATOM 4458  H HA   . LYS A 1 2  ? -6.535  7.009   -18.670 1.00 0.00 ? 2   LYS A HA   4  
ATOM 4459  H HB2  . LYS A 1 2  ? -4.582  8.990   -19.194 1.00 0.00 ? 2   LYS A HB2  4  
ATOM 4460  H HB3  . LYS A 1 2  ? -4.427  8.570   -17.494 1.00 0.00 ? 2   LYS A HB3  4  
ATOM 4461  H HG2  . LYS A 1 2  ? -4.073  6.274   -18.010 1.00 0.00 ? 2   LYS A HG2  4  
ATOM 4462  H HG3  . LYS A 1 2  ? -4.485  6.534   -19.705 1.00 0.00 ? 2   LYS A HG3  4  
ATOM 4463  H HD2  . LYS A 1 2  ? -2.516  7.929   -19.996 1.00 0.00 ? 2   LYS A HD2  4  
ATOM 4464  H HD3  . LYS A 1 2  ? -2.120  7.758   -18.284 1.00 0.00 ? 2   LYS A HD3  4  
ATOM 4465  H HE2  . LYS A 1 2  ? -2.388  5.370   -20.089 1.00 0.00 ? 2   LYS A HE2  4  
ATOM 4466  H HE3  . LYS A 1 2  ? -0.876  6.270   -19.966 1.00 0.00 ? 2   LYS A HE3  4  
ATOM 4467  H HZ1  . LYS A 1 2  ? -2.138  5.431   -17.467 1.00 0.00 ? 2   LYS A HZ1  4  
ATOM 4468  H HZ2  . LYS A 1 2  ? -0.499  5.533   -17.870 1.00 0.00 ? 2   LYS A HZ2  4  
ATOM 4469  H HZ3  . LYS A 1 2  ? -1.422  4.223   -18.410 1.00 0.00 ? 2   LYS A HZ3  4  
ATOM 4470  N N    . GLU A 1 3  ? -7.913  7.578   -16.593 1.00 0.00 ? 3   GLU A N    4  
ATOM 4471  C CA   . GLU A 1 3  ? -8.492  7.681   -15.255 1.00 0.00 ? 3   GLU A CA   4  
ATOM 4472  C C    . GLU A 1 3  ? -8.605  6.305   -14.600 1.00 0.00 ? 3   GLU A C    4  
ATOM 4473  O O    . GLU A 1 3  ? -9.627  5.627   -14.737 1.00 0.00 ? 3   GLU A O    4  
ATOM 4474  C CB   . GLU A 1 3  ? -9.872  8.343   -15.325 1.00 0.00 ? 3   GLU A CB   4  
ATOM 4475  C CG   . GLU A 1 3  ? -10.009 9.555   -14.419 1.00 0.00 ? 3   GLU A CG   4  
ATOM 4476  C CD   . GLU A 1 3  ? -10.632 9.217   -13.078 1.00 0.00 ? 3   GLU A CD   4  
ATOM 4477  O OE1  . GLU A 1 3  ? -11.876 9.125   -13.007 1.00 0.00 ? 3   GLU A OE1  4  
ATOM 4478  O OE2  . GLU A 1 3  ? -9.876  9.046   -12.098 1.00 0.00 ? 3   GLU A OE2  4  
ATOM 4479  H H    . GLU A 1 3  ? -8.366  7.027   -17.265 1.00 0.00 ? 3   GLU A H    4  
ATOM 4480  H HA   . GLU A 1 3  ? -7.839  8.299   -14.656 1.00 0.00 ? 3   GLU A HA   4  
ATOM 4481  H HB2  . GLU A 1 3  ? -10.059 8.657   -16.341 1.00 0.00 ? 3   GLU A HB2  4  
ATOM 4482  H HB3  . GLU A 1 3  ? -10.621 7.620   -15.037 1.00 0.00 ? 3   GLU A HB3  4  
ATOM 4483  H HG2  . GLU A 1 3  ? -9.028  9.971   -14.246 1.00 0.00 ? 3   GLU A HG2  4  
ATOM 4484  H HG3  . GLU A 1 3  ? -10.628 10.289  -14.913 1.00 0.00 ? 3   GLU A HG3  4  
ATOM 4485  N N    . PRO A 1 4  ? -7.547  5.870   -13.881 1.00 0.00 ? 4   PRO A N    4  
ATOM 4486  C CA   . PRO A 1 4  ? -7.525  4.566   -13.201 1.00 0.00 ? 4   PRO A CA   4  
ATOM 4487  C C    . PRO A 1 4  ? -8.599  4.444   -12.117 1.00 0.00 ? 4   PRO A C    4  
ATOM 4488  O O    . PRO A 1 4  ? -9.465  5.311   -11.983 1.00 0.00 ? 4   PRO A O    4  
ATOM 4489  C CB   . PRO A 1 4  ? -6.126  4.508   -12.570 1.00 0.00 ? 4   PRO A CB   4  
ATOM 4490  C CG   . PRO A 1 4  ? -5.323  5.526   -13.302 1.00 0.00 ? 4   PRO A CG   4  
ATOM 4491  C CD   . PRO A 1 4  ? -6.290  6.610   -13.681 1.00 0.00 ? 4   PRO A CD   4  
ATOM 4492  H HA   . PRO A 1 4  ? -7.637  3.754   -13.906 1.00 0.00 ? 4   PRO A HA   4  
ATOM 4493  H HB2  . PRO A 1 4  ? -6.195  4.745   -11.518 1.00 0.00 ? 4   PRO A HB2  4  
ATOM 4494  H HB3  . PRO A 1 4  ? -5.713  3.518   -12.693 1.00 0.00 ? 4   PRO A HB3  4  
ATOM 4495  H HG2  . PRO A 1 4  ? -4.551  5.918   -12.656 1.00 0.00 ? 4   PRO A HG2  4  
ATOM 4496  H HG3  . PRO A 1 4  ? -4.887  5.086   -14.187 1.00 0.00 ? 4   PRO A HG3  4  
ATOM 4497  H HD2  . PRO A 1 4  ? -6.385  7.328   -12.880 1.00 0.00 ? 4   PRO A HD2  4  
ATOM 4498  H HD3  . PRO A 1 4  ? -5.976  7.095   -14.593 1.00 0.00 ? 4   PRO A HD3  4  
ATOM 4499  N N    . GLU A 1 5  ? -8.528  3.362   -11.340 1.00 0.00 ? 5   GLU A N    4  
ATOM 4500  C CA   . GLU A 1 5  ? -9.484  3.120   -10.265 1.00 0.00 ? 5   GLU A CA   4  
ATOM 4501  C C    . GLU A 1 5  ? -8.800  3.211   -8.906  1.00 0.00 ? 5   GLU A C    4  
ATOM 4502  O O    . GLU A 1 5  ? -8.260  2.226   -8.395  1.00 0.00 ? 5   GLU A O    4  
ATOM 4503  C CB   . GLU A 1 5  ? -10.145 1.751   -10.435 1.00 0.00 ? 5   GLU A CB   4  
ATOM 4504  C CG   . GLU A 1 5  ? -11.273 1.489   -9.446  1.00 0.00 ? 5   GLU A CG   4  
ATOM 4505  C CD   . GLU A 1 5  ? -12.125 0.294   -9.830  1.00 0.00 ? 5   GLU A CD   4  
ATOM 4506  O OE1  . GLU A 1 5  ? -11.627 -0.847  -9.733  1.00 0.00 ? 5   GLU A OE1  4  
ATOM 4507  O OE2  . GLU A 1 5  ? -13.291 0.500   -10.227 1.00 0.00 ? 5   GLU A OE2  4  
ATOM 4508  H H    . GLU A 1 5  ? -7.811  2.714   -11.489 1.00 0.00 ? 5   GLU A H    4  
ATOM 4509  H HA   . GLU A 1 5  ? -10.244 3.886   -10.321 1.00 0.00 ? 5   GLU A HA   4  
ATOM 4510  H HB2  . GLU A 1 5  ? -10.548 1.684   -11.433 1.00 0.00 ? 5   GLU A HB2  4  
ATOM 4511  H HB3  . GLU A 1 5  ? -9.397  0.984   -10.306 1.00 0.00 ? 5   GLU A HB3  4  
ATOM 4512  H HG2  . GLU A 1 5  ? -10.844 1.306   -8.471  1.00 0.00 ? 5   GLU A HG2  4  
ATOM 4513  H HG3  . GLU A 1 5  ? -11.905 2.365   -9.400  1.00 0.00 ? 5   GLU A HG3  4  
ATOM 4514  N N    . ILE A 1 6  ? -8.830  4.406   -8.330  1.00 0.00 ? 6   ILE A N    4  
ATOM 4515  C CA   . ILE A 1 6  ? -8.221  4.654   -7.029  1.00 0.00 ? 6   ILE A CA   4  
ATOM 4516  C C    . ILE A 1 6  ? -9.260  4.541   -5.915  1.00 0.00 ? 6   ILE A C    4  
ATOM 4517  O O    . ILE A 1 6  ? -10.343 5.124   -6.005  1.00 0.00 ? 6   ILE A O    4  
ATOM 4518  C CB   . ILE A 1 6  ? -7.567  6.051   -6.979  1.00 0.00 ? 6   ILE A CB   4  
ATOM 4519  C CG1  . ILE A 1 6  ? -6.613  6.248   -8.165  1.00 0.00 ? 6   ILE A CG1  4  
ATOM 4520  C CG2  . ILE A 1 6  ? -6.833  6.253   -5.660  1.00 0.00 ? 6   ILE A CG2  4  
ATOM 4521  C CD1  . ILE A 1 6  ? -5.519  5.204   -8.260  1.00 0.00 ? 6   ILE A CD1  4  
ATOM 4522  H H    . ILE A 1 6  ? -9.277  5.144   -8.795  1.00 0.00 ? 6   ILE A H    4  
ATOM 4523  H HA   . ILE A 1 6  ? -7.453  3.911   -6.871  1.00 0.00 ? 6   ILE A HA   4  
ATOM 4524  H HB   . ILE A 1 6  ? -8.353  6.786   -7.040  1.00 0.00 ? 6   ILE A HB   4  
ATOM 4525  H HG12 . ILE A 1 6  ? -7.181  6.213   -9.082  1.00 0.00 ? 6   ILE A HG12 4  
ATOM 4526  H HG13 . ILE A 1 6  ? -6.141  7.215   -8.078  1.00 0.00 ? 6   ILE A HG13 4  
ATOM 4527  H HG21 . ILE A 1 6  ? -6.266  7.172   -5.702  1.00 0.00 ? 6   ILE A HG21 4  
ATOM 4528  H HG22 . ILE A 1 6  ? -6.161  5.424   -5.489  1.00 0.00 ? 6   ILE A HG22 4  
ATOM 4529  H HG23 . ILE A 1 6  ? -7.549  6.309   -4.854  1.00 0.00 ? 6   ILE A HG23 4  
ATOM 4530  H HD11 . ILE A 1 6  ? -5.590  4.527   -7.422  1.00 0.00 ? 6   ILE A HD11 4  
ATOM 4531  H HD12 . ILE A 1 6  ? -4.555  5.692   -8.247  1.00 0.00 ? 6   ILE A HD12 4  
ATOM 4532  H HD13 . ILE A 1 6  ? -5.629  4.651   -9.180  1.00 0.00 ? 6   ILE A HD13 4  
ATOM 4533  N N    . ILE A 1 7  ? -8.924  3.788   -4.866  1.00 0.00 ? 7   ILE A N    4  
ATOM 4534  C CA   . ILE A 1 7  ? -9.832  3.596   -3.735  1.00 0.00 ? 7   ILE A CA   4  
ATOM 4535  C C    . ILE A 1 7  ? -9.061  3.422   -2.428  1.00 0.00 ? 7   ILE A C    4  
ATOM 4536  O O    . ILE A 1 7  ? -7.984  2.824   -2.407  1.00 0.00 ? 7   ILE A O    4  
ATOM 4537  C CB   . ILE A 1 7  ? -10.753 2.369   -3.935  1.00 0.00 ? 7   ILE A CB   4  
ATOM 4538  C CG1  . ILE A 1 7  ? -9.923  1.102   -4.176  1.00 0.00 ? 7   ILE A CG1  4  
ATOM 4539  C CG2  . ILE A 1 7  ? -11.721 2.602   -5.087  1.00 0.00 ? 7   ILE A CG2  4  
ATOM 4540  C CD1  . ILE A 1 7  ? -10.024 0.091   -3.054  1.00 0.00 ? 7   ILE A CD1  4  
ATOM 4541  H H    . ILE A 1 7  ? -8.045  3.351   -4.851  1.00 0.00 ? 7   ILE A H    4  
ATOM 4542  H HA   . ILE A 1 7  ? -10.454 4.477   -3.658  1.00 0.00 ? 7   ILE A HA   4  
ATOM 4543  H HB   . ILE A 1 7  ? -11.335 2.239   -3.035  1.00 0.00 ? 7   ILE A HB   4  
ATOM 4544  H HG12 . ILE A 1 7  ? -10.261 0.624   -5.084  1.00 0.00 ? 7   ILE A HG12 4  
ATOM 4545  H HG13 . ILE A 1 7  ? -8.883  1.374   -4.285  1.00 0.00 ? 7   ILE A HG13 4  
ATOM 4546  H HG21 . ILE A 1 7  ? -11.187 2.555   -6.025  1.00 0.00 ? 7   ILE A HG21 4  
ATOM 4547  H HG22 . ILE A 1 7  ? -12.178 3.576   -4.982  1.00 0.00 ? 7   ILE A HG22 4  
ATOM 4548  H HG23 . ILE A 1 7  ? -12.489 1.842   -5.071  1.00 0.00 ? 7   ILE A HG23 4  
ATOM 4549  H HD11 . ILE A 1 7  ? -10.887 -0.538  -3.214  1.00 0.00 ? 7   ILE A HD11 4  
ATOM 4550  H HD12 . ILE A 1 7  ? -10.125 0.608   -2.111  1.00 0.00 ? 7   ILE A HD12 4  
ATOM 4551  H HD13 . ILE A 1 7  ? -9.133  -0.518  -3.037  1.00 0.00 ? 7   ILE A HD13 4  
ATOM 4552  N N    . THR A 1 8  ? -9.627  3.942   -1.339  1.00 0.00 ? 8   THR A N    4  
ATOM 4553  C CA   . THR A 1 8  ? -8.998  3.840   -0.024  1.00 0.00 ? 8   THR A CA   4  
ATOM 4554  C C    . THR A 1 8  ? -9.830  2.962   0.910   1.00 0.00 ? 8   THR A C    4  
ATOM 4555  O O    . THR A 1 8  ? -11.026 3.196   1.093   1.00 0.00 ? 8   THR A O    4  
ATOM 4556  C CB   . THR A 1 8  ? -8.812  5.230   0.598   1.00 0.00 ? 8   THR A CB   4  
ATOM 4557  O OG1  . THR A 1 8  ? -8.592  6.215   -0.399  1.00 0.00 ? 8   THR A OG1  4  
ATOM 4558  C CG2  . THR A 1 8  ? -7.656  5.295   1.573   1.00 0.00 ? 8   THR A CG2  4  
ATOM 4559  H H    . THR A 1 8  ? -10.488 4.403   -1.421  1.00 0.00 ? 8   THR A H    4  
ATOM 4560  H HA   . THR A 1 8  ? -8.029  3.384   -0.157  1.00 0.00 ? 8   THR A HA   4  
ATOM 4561  H HB   . THR A 1 8  ? -9.711  5.493   1.138   1.00 0.00 ? 8   THR A HB   4  
ATOM 4562  H HG1  . THR A 1 8  ? -7.887  5.930   -0.986  1.00 0.00 ? 8   THR A HG1  4  
ATOM 4563  H HG21 . THR A 1 8  ? -6.726  5.349   1.026   1.00 0.00 ? 8   THR A HG21 4  
ATOM 4564  H HG22 . THR A 1 8  ? -7.657  4.411   2.194   1.00 0.00 ? 8   THR A HG22 4  
ATOM 4565  H HG23 . THR A 1 8  ? -7.758  6.172   2.194   1.00 0.00 ? 8   THR A HG23 4  
ATOM 4566  N N    . VAL A 1 9  ? -9.186  1.956   1.499   1.00 0.00 ? 9   VAL A N    4  
ATOM 4567  C CA   . VAL A 1 9  ? -9.862  1.044   2.420   1.00 0.00 ? 9   VAL A CA   4  
ATOM 4568  C C    . VAL A 1 9  ? -9.585  1.428   3.871   1.00 0.00 ? 9   VAL A C    4  
ATOM 4569  O O    . VAL A 1 9  ? -8.448  1.339   4.337   1.00 0.00 ? 9   VAL A O    4  
ATOM 4570  C CB   . VAL A 1 9  ? -9.435  -0.426  2.196   1.00 0.00 ? 9   VAL A CB   4  
ATOM 4571  C CG1  . VAL A 1 9  ? -10.081 -0.981  0.936   1.00 0.00 ? 9   VAL A CG1  4  
ATOM 4572  C CG2  . VAL A 1 9  ? -7.916  -0.554  2.129   1.00 0.00 ? 9   VAL A CG2  4  
ATOM 4573  H H    . VAL A 1 9  ? -8.231  1.826   1.313   1.00 0.00 ? 9   VAL A H    4  
ATOM 4574  H HA   . VAL A 1 9  ? -10.925 1.117   2.238   1.00 0.00 ? 9   VAL A HA   4  
ATOM 4575  H HB   . VAL A 1 9  ? -9.786  -1.009  3.036   1.00 0.00 ? 9   VAL A HB   4  
ATOM 4576  H HG11 . VAL A 1 9  ? -9.729  -1.987  0.764   1.00 0.00 ? 9   VAL A HG11 4  
ATOM 4577  H HG12 . VAL A 1 9  ? -9.820  -0.358  0.093   1.00 0.00 ? 9   VAL A HG12 4  
ATOM 4578  H HG13 . VAL A 1 9  ? -11.154 -0.991  1.057   1.00 0.00 ? 9   VAL A HG13 4  
ATOM 4579  H HG21 . VAL A 1 9  ? -7.608  -1.449  2.648   1.00 0.00 ? 9   VAL A HG21 4  
ATOM 4580  H HG22 . VAL A 1 9  ? -7.460  0.307   2.596   1.00 0.00 ? 9   VAL A HG22 4  
ATOM 4581  H HG23 . VAL A 1 9  ? -7.604  -0.610  1.097   1.00 0.00 ? 9   VAL A HG23 4  
ATOM 4582  N N    . THR A 1 10 ? -10.628 1.856   4.576   1.00 0.00 ? 10  THR A N    4  
ATOM 4583  C CA   . THR A 1 10 ? -10.499 2.256   5.974   1.00 0.00 ? 10  THR A CA   4  
ATOM 4584  C C    . THR A 1 10 ? -10.962 1.129   6.898   1.00 0.00 ? 10  THR A C    4  
ATOM 4585  O O    . THR A 1 10 ? -12.147 1.024   7.220   1.00 0.00 ? 10  THR A O    4  
ATOM 4586  C CB   . THR A 1 10 ? -11.308 3.530   6.244   1.00 0.00 ? 10  THR A CB   4  
ATOM 4587  O OG1  . THR A 1 10 ? -11.355 4.353   5.091   1.00 0.00 ? 10  THR A OG1  4  
ATOM 4588  C CG2  . THR A 1 10 ? -10.749 4.361   7.379   1.00 0.00 ? 10  THR A CG2  4  
ATOM 4589  H H    . THR A 1 10 ? -11.507 1.907   4.146   1.00 0.00 ? 10  THR A H    4  
ATOM 4590  H HA   . THR A 1 10 ? -9.455  2.456   6.166   1.00 0.00 ? 10  THR A HA   4  
ATOM 4591  H HB   . THR A 1 10 ? -12.319 3.253   6.505   1.00 0.00 ? 10  THR A HB   4  
ATOM 4592  H HG1  . THR A 1 10 ? -12.066 4.992   5.180   1.00 0.00 ? 10  THR A HG1  4  
ATOM 4593  H HG21 . THR A 1 10 ? -9.716  4.092   7.549   1.00 0.00 ? 10  THR A HG21 4  
ATOM 4594  H HG22 . THR A 1 10 ? -11.321 4.176   8.276   1.00 0.00 ? 10  THR A HG22 4  
ATOM 4595  H HG23 . THR A 1 10 ? -10.809 5.408   7.123   1.00 0.00 ? 10  THR A HG23 4  
ATOM 4596  N N    . LEU A 1 11 ? -10.020 0.283   7.313   1.00 0.00 ? 11  LEU A N    4  
ATOM 4597  C CA   . LEU A 1 11 ? -10.330 -0.843  8.192   1.00 0.00 ? 11  LEU A CA   4  
ATOM 4598  C C    . LEU A 1 11 ? -9.631  -0.698  9.545   1.00 0.00 ? 11  LEU A C    4  
ATOM 4599  O O    . LEU A 1 11 ? -8.827  0.216   9.744   1.00 0.00 ? 11  LEU A O    4  
ATOM 4600  C CB   . LEU A 1 11 ? -9.917  -2.159  7.526   1.00 0.00 ? 11  LEU A CB   4  
ATOM 4601  C CG   . LEU A 1 11 ? -10.780 -2.582  6.334   1.00 0.00 ? 11  LEU A CG   4  
ATOM 4602  C CD1  . LEU A 1 11 ? -10.120 -3.723  5.574   1.00 0.00 ? 11  LEU A CD1  4  
ATOM 4603  C CD2  . LEU A 1 11 ? -12.174 -2.980  6.798   1.00 0.00 ? 11  LEU A CD2  4  
ATOM 4604  H H    . LEU A 1 11 ? -9.093  0.414   7.016   1.00 0.00 ? 11  LEU A H    4  
ATOM 4605  H HA   . LEU A 1 11 ? -11.398 -0.853  8.352   1.00 0.00 ? 11  LEU A HA   4  
ATOM 4606  H HB2  . LEU A 1 11 ? -8.895  -2.061  7.188   1.00 0.00 ? 11  LEU A HB2  4  
ATOM 4607  H HB3  . LEU A 1 11 ? -9.958  -2.943  8.267   1.00 0.00 ? 11  LEU A HB3  4  
ATOM 4608  H HG   . LEU A 1 11 ? -10.879 -1.746  5.657   1.00 0.00 ? 11  LEU A HG   4  
ATOM 4609  H HD11 . LEU A 1 11 ? -9.509  -4.301  6.251   1.00 0.00 ? 11  LEU A HD11 4  
ATOM 4610  H HD12 . LEU A 1 11 ? -9.502  -3.320  4.786   1.00 0.00 ? 11  LEU A HD12 4  
ATOM 4611  H HD13 . LEU A 1 11 ? -10.881 -4.358  5.145   1.00 0.00 ? 11  LEU A HD13 4  
ATOM 4612  H HD21 . LEU A 1 11 ? -12.824 -2.118  6.769   1.00 0.00 ? 11  LEU A HD21 4  
ATOM 4613  H HD22 . LEU A 1 11 ? -12.125 -3.360  7.807   1.00 0.00 ? 11  LEU A HD22 4  
ATOM 4614  H HD23 . LEU A 1 11 ? -12.566 -3.746  6.145   1.00 0.00 ? 11  LEU A HD23 4  
ATOM 4615  N N    . LYS A 1 12 ? -9.944  -1.606  10.473  1.00 0.00 ? 12  LYS A N    4  
ATOM 4616  C CA   . LYS A 1 12 ? -9.346  -1.580  11.806  1.00 0.00 ? 12  LYS A CA   4  
ATOM 4617  C C    . LYS A 1 12 ? -8.242  -2.632  11.933  1.00 0.00 ? 12  LYS A C    4  
ATOM 4618  O O    . LYS A 1 12 ? -8.164  -3.564  11.130  1.00 0.00 ? 12  LYS A O    4  
ATOM 4619  C CB   . LYS A 1 12 ? -10.418 -1.807  12.877  1.00 0.00 ? 12  LYS A CB   4  
ATOM 4620  C CG   . LYS A 1 12 ? -10.736 -0.562  13.693  1.00 0.00 ? 12  LYS A CG   4  
ATOM 4621  C CD   . LYS A 1 12 ? -11.306 0.550   12.822  1.00 0.00 ? 12  LYS A CD   4  
ATOM 4622  C CE   . LYS A 1 12 ? -12.814 0.421   12.660  1.00 0.00 ? 12  LYS A CE   4  
ATOM 4623  N NZ   . LYS A 1 12 ? -13.551 0.954   13.840  1.00 0.00 ? 12  LYS A NZ   4  
ATOM 4624  H H    . LYS A 1 12 ? -10.590 -2.310  10.254  1.00 0.00 ? 12  LYS A H    4  
ATOM 4625  H HA   . LYS A 1 12 ? -8.909  -0.603  11.950  1.00 0.00 ? 12  LYS A HA   4  
ATOM 4626  H HB2  . LYS A 1 12 ? -11.327 -2.138  12.396  1.00 0.00 ? 12  LYS A HB2  4  
ATOM 4627  H HB3  . LYS A 1 12 ? -10.079 -2.577  13.553  1.00 0.00 ? 12  LYS A HB3  4  
ATOM 4628  H HG2  . LYS A 1 12 ? -11.460 -0.817  14.452  1.00 0.00 ? 12  LYS A HG2  4  
ATOM 4629  H HG3  . LYS A 1 12 ? -9.829  -0.210  14.162  1.00 0.00 ? 12  LYS A HG3  4  
ATOM 4630  H HD2  . LYS A 1 12 ? -11.083 1.502   13.280  1.00 0.00 ? 12  LYS A HD2  4  
ATOM 4631  H HD3  . LYS A 1 12 ? -10.843 0.503   11.846  1.00 0.00 ? 12  LYS A HD3  4  
ATOM 4632  H HE2  . LYS A 1 12 ? -13.116 0.970   11.780  1.00 0.00 ? 12  LYS A HE2  4  
ATOM 4633  H HE3  . LYS A 1 12 ? -13.061 -0.623  12.533  1.00 0.00 ? 12  LYS A HE3  4  
ATOM 4634  H HZ1  . LYS A 1 12 ? -14.480 0.492   13.919  1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 4635  H HZ2  . LYS A 1 12 ? -13.695 1.979   13.740  1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 4636  H HZ3  . LYS A 1 12 ? -13.012 0.776   14.712  1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 4637  N N    . LYS A 1 13 ? -7.386  -2.471  12.945  1.00 0.00 ? 13  LYS A N    4  
ATOM 4638  C CA   . LYS A 1 13 ? -6.282  -3.400  13.174  1.00 0.00 ? 13  LYS A CA   4  
ATOM 4639  C C    . LYS A 1 13 ? -6.657  -4.476  14.193  1.00 0.00 ? 13  LYS A C    4  
ATOM 4640  O O    . LYS A 1 13 ? -6.860  -4.184  15.374  1.00 0.00 ? 13  LYS A O    4  
ATOM 4641  C CB   . LYS A 1 13 ? -5.039  -2.640  13.648  1.00 0.00 ? 13  LYS A CB   4  
ATOM 4642  C CG   . LYS A 1 13 ? -3.727  -3.331  13.303  1.00 0.00 ? 13  LYS A CG   4  
ATOM 4643  C CD   . LYS A 1 13 ? -2.937  -3.695  14.552  1.00 0.00 ? 13  LYS A CD   4  
ATOM 4644  C CE   . LYS A 1 13 ? -1.843  -2.676  14.842  1.00 0.00 ? 13  LYS A CE   4  
ATOM 4645  N NZ   . LYS A 1 13 ? -0.956  -3.109  15.960  1.00 0.00 ? 13  LYS A NZ   4  
ATOM 4646  H H    . LYS A 1 13 ? -7.498  -1.706  13.550  1.00 0.00 ? 13  LYS A H    4  
ATOM 4647  H HA   . LYS A 1 13 ? -6.058  -3.880  12.233  1.00 0.00 ? 13  LYS A HA   4  
ATOM 4648  H HB2  . LYS A 1 13 ? -5.035  -1.664  13.190  1.00 0.00 ? 13  LYS A HB2  4  
ATOM 4649  H HB3  . LYS A 1 13 ? -5.089  -2.523  14.722  1.00 0.00 ? 13  LYS A HB3  4  
ATOM 4650  H HG2  . LYS A 1 13 ? -3.941  -4.234  12.750  1.00 0.00 ? 13  LYS A HG2  4  
ATOM 4651  H HG3  . LYS A 1 13 ? -3.133  -2.666  12.692  1.00 0.00 ? 13  LYS A HG3  4  
ATOM 4652  H HD2  . LYS A 1 13 ? -3.611  -3.733  15.395  1.00 0.00 ? 13  LYS A HD2  4  
ATOM 4653  H HD3  . LYS A 1 13 ? -2.483  -4.665  14.409  1.00 0.00 ? 13  LYS A HD3  4  
ATOM 4654  H HE2  . LYS A 1 13 ? -1.245  -2.546  13.952  1.00 0.00 ? 13  LYS A HE2  4  
ATOM 4655  H HE3  . LYS A 1 13 ? -2.306  -1.736  15.104  1.00 0.00 ? 13  LYS A HE3  4  
ATOM 4656  H HZ1  . LYS A 1 13 ? -0.447  -2.289  16.349  1.00 0.00 ? 13  LYS A HZ1  4  
ATOM 4657  H HZ2  . LYS A 1 13 ? -0.261  -3.803  15.618  1.00 0.00 ? 13  LYS A HZ2  4  
ATOM 4658  H HZ3  . LYS A 1 13 ? -1.520  -3.545  16.718  1.00 0.00 ? 13  LYS A HZ3  4  
ATOM 4659  N N    . GLN A 1 14 ? -6.731  -5.722  13.728  1.00 0.00 ? 14  GLN A N    4  
ATOM 4660  C CA   . GLN A 1 14 ? -7.062  -6.854  14.593  1.00 0.00 ? 14  GLN A CA   4  
ATOM 4661  C C    . GLN A 1 14 ? -5.800  -7.633  14.957  1.00 0.00 ? 14  GLN A C    4  
ATOM 4662  O O    . GLN A 1 14 ? -5.624  -8.050  16.103  1.00 0.00 ? 14  GLN A O    4  
ATOM 4663  C CB   . GLN A 1 14 ? -8.069  -7.778  13.905  1.00 0.00 ? 14  GLN A CB   4  
ATOM 4664  C CG   . GLN A 1 14 ? -9.516  -7.428  14.210  1.00 0.00 ? 14  GLN A CG   4  
ATOM 4665  C CD   . GLN A 1 14 ? -10.000 -6.219  13.431  1.00 0.00 ? 14  GLN A CD   4  
ATOM 4666  O OE1  . GLN A 1 14 ? -10.247 -5.157  14.003  1.00 0.00 ? 14  GLN A OE1  4  
ATOM 4667  N NE2  . GLN A 1 14 ? -10.137 -6.372  12.118  1.00 0.00 ? 14  GLN A NE2  4  
ATOM 4668  H H    . GLN A 1 14 ? -6.546  -5.887  12.779  1.00 0.00 ? 14  GLN A H    4  
ATOM 4669  H HA   . GLN A 1 14 ? -7.502  -6.463  15.499  1.00 0.00 ? 14  GLN A HA   4  
ATOM 4670  H HB2  . GLN A 1 14 ? -7.924  -7.719  12.836  1.00 0.00 ? 14  GLN A HB2  4  
ATOM 4671  H HB3  . GLN A 1 14 ? -7.890  -8.793  14.229  1.00 0.00 ? 14  GLN A HB3  4  
ATOM 4672  H HG2  . GLN A 1 14 ? -10.138 -8.273  13.957  1.00 0.00 ? 14  GLN A HG2  4  
ATOM 4673  H HG3  . GLN A 1 14 ? -9.607  -7.219  15.266  1.00 0.00 ? 14  GLN A HG3  4  
ATOM 4674  H HE21 . GLN A 1 14 ? -9.921  -7.245  11.727  1.00 0.00 ? 14  GLN A HE21 4  
ATOM 4675  H HE22 . GLN A 1 14 ? -10.448 -5.605  11.594  1.00 0.00 ? 14  GLN A HE22 4  
ATOM 4676  N N    . ASN A 1 15 ? -4.924  -7.819  13.969  1.00 0.00 ? 15  ASN A N    4  
ATOM 4677  C CA   . ASN A 1 15 ? -3.669  -8.536  14.170  1.00 0.00 ? 15  ASN A CA   4  
ATOM 4678  C C    . ASN A 1 15 ? -2.699  -8.256  13.017  1.00 0.00 ? 15  ASN A C    4  
ATOM 4679  O O    . ASN A 1 15 ? -2.066  -9.169  12.483  1.00 0.00 ? 15  ASN A O    4  
ATOM 4680  C CB   . ASN A 1 15 ? -3.928  -10.042 14.296  1.00 0.00 ? 15  ASN A CB   4  
ATOM 4681  C CG   . ASN A 1 15 ? -2.807  -10.761 15.028  1.00 0.00 ? 15  ASN A CG   4  
ATOM 4682  O OD1  . ASN A 1 15 ? -1.792  -11.120 14.432  1.00 0.00 ? 15  ASN A OD1  4  
ATOM 4683  N ND2  . ASN A 1 15 ? -2.981  -10.971 16.329  1.00 0.00 ? 15  ASN A ND2  4  
ATOM 4684  H H    . ASN A 1 15 ? -5.125  -7.457  13.081  1.00 0.00 ? 15  ASN A H    4  
ATOM 4685  H HA   . ASN A 1 15 ? -3.228  -8.178  15.089  1.00 0.00 ? 15  ASN A HA   4  
ATOM 4686  H HB2  . ASN A 1 15 ? -4.848  -10.200 14.839  1.00 0.00 ? 15  ASN A HB2  4  
ATOM 4687  H HB3  . ASN A 1 15 ? -4.021  -10.469 13.308  1.00 0.00 ? 15  ASN A HB3  4  
ATOM 4688  H HD21 . ASN A 1 15 ? -3.810  -10.656 16.744  1.00 0.00 ? 15  ASN A HD21 4  
ATOM 4689  H HD22 . ASN A 1 15 ? -2.270  -11.434 16.820  1.00 0.00 ? 15  ASN A HD22 4  
ATOM 4690  N N    . GLY A 1 16 ? -2.596  -6.981  12.633  1.00 0.00 ? 16  GLY A N    4  
ATOM 4691  C CA   . GLY A 1 16 ? -1.713  -6.597  11.544  1.00 0.00 ? 16  GLY A CA   4  
ATOM 4692  C C    . GLY A 1 16 ? -2.402  -6.657  10.193  1.00 0.00 ? 16  GLY A C    4  
ATOM 4693  O O    . GLY A 1 16 ? -3.356  -7.417  10.013  1.00 0.00 ? 16  GLY A O    4  
ATOM 4694  H H    . GLY A 1 16 ? -3.129  -6.296  13.089  1.00 0.00 ? 16  GLY A H    4  
ATOM 4695  H HA2  . GLY A 1 16 ? -1.367  -5.588  11.715  1.00 0.00 ? 16  GLY A HA2  4  
ATOM 4696  H HA3  . GLY A 1 16 ? -0.863  -7.261  11.531  1.00 0.00 ? 16  GLY A HA3  4  
ATOM 4697  N N    . MET A 1 17 ? -1.921  -5.856  9.241   1.00 0.00 ? 17  MET A N    4  
ATOM 4698  C CA   . MET A 1 17 ? -2.502  -5.828  7.899   1.00 0.00 ? 17  MET A CA   4  
ATOM 4699  C C    . MET A 1 17 ? -2.387  -7.193  7.223   1.00 0.00 ? 17  MET A C    4  
ATOM 4700  O O    . MET A 1 17 ? -3.367  -7.706  6.679   1.00 0.00 ? 17  MET A O    4  
ATOM 4701  C CB   . MET A 1 17 ? -1.820  -4.761  7.038   1.00 0.00 ? 17  MET A CB   4  
ATOM 4702  C CG   . MET A 1 17 ? -2.508  -3.406  7.088   1.00 0.00 ? 17  MET A CG   4  
ATOM 4703  S SD   . MET A 1 17 ? -1.520  -2.158  7.934   1.00 0.00 ? 17  MET A SD   4  
ATOM 4704  C CE   . MET A 1 17 ? -0.175  -1.942  6.771   1.00 0.00 ? 17  MET A CE   4  
ATOM 4705  H H    . MET A 1 17 ? -1.158  -5.273  9.445   1.00 0.00 ? 17  MET A H    4  
ATOM 4706  H HA   . MET A 1 17 ? -3.549  -5.580  8.000   1.00 0.00 ? 17  MET A HA   4  
ATOM 4707  H HB2  . MET A 1 17 ? -0.802  -4.638  7.376   1.00 0.00 ? 17  MET A HB2  4  
ATOM 4708  H HB3  . MET A 1 17 ? -1.809  -5.097  6.011   1.00 0.00 ? 17  MET A HB3  4  
ATOM 4709  H HG2  . MET A 1 17 ? -2.693  -3.073  6.079   1.00 0.00 ? 17  MET A HG2  4  
ATOM 4710  H HG3  . MET A 1 17 ? -3.448  -3.514  7.609   1.00 0.00 ? 17  MET A HG3  4  
ATOM 4711  H HE1  . MET A 1 17 ? -0.578  -1.711  5.796   1.00 0.00 ? 17  MET A HE1  4  
ATOM 4712  H HE2  . MET A 1 17 ? 0.404   -2.851  6.717   1.00 0.00 ? 17  MET A HE2  4  
ATOM 4713  H HE3  . MET A 1 17 ? 0.458   -1.131  7.100   1.00 0.00 ? 17  MET A HE3  4  
ATOM 4714  N N    . GLY A 1 18 ? -1.188  -7.777  7.264   1.00 0.00 ? 18  GLY A N    4  
ATOM 4715  C CA   . GLY A 1 18 ? -0.972  -9.077  6.656   1.00 0.00 ? 18  GLY A CA   4  
ATOM 4716  C C    . GLY A 1 18 ? -0.849  -9.007  5.146   1.00 0.00 ? 18  GLY A C    4  
ATOM 4717  O O    . GLY A 1 18 ? -1.733  -9.465  4.426   1.00 0.00 ? 18  GLY A O    4  
ATOM 4718  H H    . GLY A 1 18 ? -0.444  -7.321  7.714   1.00 0.00 ? 18  GLY A H    4  
ATOM 4719  H HA2  . GLY A 1 18 ? -0.064  -9.503  7.059   1.00 0.00 ? 18  GLY A HA2  4  
ATOM 4720  H HA3  . GLY A 1 18 ? -1.800  -9.723  6.908   1.00 0.00 ? 18  GLY A HA3  4  
ATOM 4721  N N    . LEU A 1 19 ? 0.250   -8.428  4.670   1.00 0.00 ? 19  LEU A N    4  
ATOM 4722  C CA   . LEU A 1 19 ? 0.505   -8.300  3.234   1.00 0.00 ? 19  LEU A CA   4  
ATOM 4723  C C    . LEU A 1 19 ? 1.991   -8.050  2.972   1.00 0.00 ? 19  LEU A C    4  
ATOM 4724  O O    . LEU A 1 19 ? 2.778   -7.933  3.908   1.00 0.00 ? 19  LEU A O    4  
ATOM 4725  C CB   . LEU A 1 19 ? -0.339  -7.168  2.638   1.00 0.00 ? 19  LEU A CB   4  
ATOM 4726  C CG   . LEU A 1 19 ? 0.027   -5.771  3.133   1.00 0.00 ? 19  LEU A CG   4  
ATOM 4727  C CD1  . LEU A 1 19 ? 0.981   -5.092  2.162   1.00 0.00 ? 19  LEU A CD1  4  
ATOM 4728  C CD2  . LEU A 1 19 ? -1.222  -4.927  3.341   1.00 0.00 ? 19  LEU A CD2  4  
ATOM 4729  H H    . LEU A 1 19 ? 0.918   -8.082  5.304   1.00 0.00 ? 19  LEU A H    4  
ATOM 4730  H HA   . LEU A 1 19 ? 0.225   -9.229  2.762   1.00 0.00 ? 19  LEU A HA   4  
ATOM 4731  H HB2  . LEU A 1 19 ? -0.229  -7.193  1.563   1.00 0.00 ? 19  LEU A HB2  4  
ATOM 4732  H HB3  . LEU A 1 19 ? -1.374  -7.353  2.881   1.00 0.00 ? 19  LEU A HB3  4  
ATOM 4733  H HG   . LEU A 1 19 ? 0.529   -5.864  4.083   1.00 0.00 ? 19  LEU A HG   4  
ATOM 4734  H HD11 . LEU A 1 19 ? 1.981   -5.470  2.317   1.00 0.00 ? 19  LEU A HD11 4  
ATOM 4735  H HD12 . LEU A 1 19 ? 0.970   -4.026  2.331   1.00 0.00 ? 19  LEU A HD12 4  
ATOM 4736  H HD13 . LEU A 1 19 ? 0.672   -5.299  1.148   1.00 0.00 ? 19  LEU A HD13 4  
ATOM 4737  H HD21 . LEU A 1 19 ? -1.084  -4.288  4.201   1.00 0.00 ? 19  LEU A HD21 4  
ATOM 4738  H HD22 . LEU A 1 19 ? -2.071  -5.574  3.507   1.00 0.00 ? 19  LEU A HD22 4  
ATOM 4739  H HD23 . LEU A 1 19 ? -1.397  -4.320  2.466   1.00 0.00 ? 19  LEU A HD23 4  
ATOM 4740  N N    . SER A 1 20 ? 2.367   -7.966  1.699   1.00 0.00 ? 20  SER A N    4  
ATOM 4741  C CA   . SER A 1 20 ? 3.757   -7.727  1.323   1.00 0.00 ? 20  SER A CA   4  
ATOM 4742  C C    . SER A 1 20 ? 3.840   -6.730  0.171   1.00 0.00 ? 20  SER A C    4  
ATOM 4743  O O    . SER A 1 20 ? 3.094   -6.837  -0.803  1.00 0.00 ? 20  SER A O    4  
ATOM 4744  C CB   . SER A 1 20 ? 4.427   -9.044  0.932   1.00 0.00 ? 20  SER A CB   4  
ATOM 4745  O OG   . SER A 1 20 ? 4.766   -9.807  2.077   1.00 0.00 ? 20  SER A OG   4  
ATOM 4746  H H    . SER A 1 20 ? 1.693   -8.067  0.992   1.00 0.00 ? 20  SER A H    4  
ATOM 4747  H HA   . SER A 1 20 ? 4.268   -7.313  2.181   1.00 0.00 ? 20  SER A HA   4  
ATOM 4748  H HB2  . SER A 1 20 ? 3.751   -9.621  0.319   1.00 0.00 ? 20  SER A HB2  4  
ATOM 4749  H HB3  . SER A 1 20 ? 5.328   -8.835  0.375   1.00 0.00 ? 20  SER A HB3  4  
ATOM 4750  H HG   . SER A 1 20 ? 5.449   -9.352  2.576   1.00 0.00 ? 20  SER A HG   4  
ATOM 4751  N N    . ILE A 1 21 ? 4.743   -5.754  0.291   1.00 0.00 ? 21  ILE A N    4  
ATOM 4752  C CA   . ILE A 1 21 ? 4.904   -4.731  -0.744  1.00 0.00 ? 21  ILE A CA   4  
ATOM 4753  C C    . ILE A 1 21 ? 6.318   -4.708  -1.322  1.00 0.00 ? 21  ILE A C    4  
ATOM 4754  O O    . ILE A 1 21 ? 7.245   -5.282  -0.749  1.00 0.00 ? 21  ILE A O    4  
ATOM 4755  C CB   . ILE A 1 21 ? 4.566   -3.323  -0.202  1.00 0.00 ? 21  ILE A CB   4  
ATOM 4756  C CG1  . ILE A 1 21 ? 5.606   -2.867  0.831   1.00 0.00 ? 21  ILE A CG1  4  
ATOM 4757  C CG2  . ILE A 1 21 ? 3.169   -3.312  0.402   1.00 0.00 ? 21  ILE A CG2  4  
ATOM 4758  C CD1  . ILE A 1 21 ? 6.822   -2.197  0.222   1.00 0.00 ? 21  ILE A CD1  4  
ATOM 4759  H H    . ILE A 1 21 ? 5.304   -5.714  1.094   1.00 0.00 ? 21  ILE A H    4  
ATOM 4760  H HA   . ILE A 1 21 ? 4.210   -4.958  -1.539  1.00 0.00 ? 21  ILE A HA   4  
ATOM 4761  H HB   . ILE A 1 21 ? 4.573   -2.635  -1.034  1.00 0.00 ? 21  ILE A HB   4  
ATOM 4762  H HG12 . ILE A 1 21 ? 5.147   -2.161  1.507   1.00 0.00 ? 21  ILE A HG12 4  
ATOM 4763  H HG13 . ILE A 1 21 ? 5.947   -3.725  1.393   1.00 0.00 ? 21  ILE A HG13 4  
ATOM 4764  H HG21 . ILE A 1 21 ? 3.238   -3.426  1.474   1.00 0.00 ? 21  ILE A HG21 4  
ATOM 4765  H HG22 . ILE A 1 21 ? 2.593   -4.127  -0.010  1.00 0.00 ? 21  ILE A HG22 4  
ATOM 4766  H HG23 . ILE A 1 21 ? 2.683   -2.376  0.170   1.00 0.00 ? 21  ILE A HG23 4  
ATOM 4767  H HD11 . ILE A 1 21 ? 6.605   -1.907  -0.795  1.00 0.00 ? 21  ILE A HD11 4  
ATOM 4768  H HD12 . ILE A 1 21 ? 7.653   -2.887  0.229   1.00 0.00 ? 21  ILE A HD12 4  
ATOM 4769  H HD13 . ILE A 1 21 ? 7.080   -1.320  0.800   1.00 0.00 ? 21  ILE A HD13 4  
ATOM 4770  N N    . VAL A 1 22 ? 6.468   -4.022  -2.458  1.00 0.00 ? 22  VAL A N    4  
ATOM 4771  C CA   . VAL A 1 22 ? 7.760   -3.890  -3.129  1.00 0.00 ? 22  VAL A CA   4  
ATOM 4772  C C    . VAL A 1 22 ? 7.838   -2.562  -3.885  1.00 0.00 ? 22  VAL A C    4  
ATOM 4773  O O    . VAL A 1 22 ? 6.880   -2.158  -4.549  1.00 0.00 ? 22  VAL A O    4  
ATOM 4774  C CB   . VAL A 1 22 ? 8.017   -5.049  -4.123  1.00 0.00 ? 22  VAL A CB   4  
ATOM 4775  C CG1  . VAL A 1 22 ? 9.398   -4.930  -4.756  1.00 0.00 ? 22  VAL A CG1  4  
ATOM 4776  C CG2  . VAL A 1 22 ? 7.861   -6.399  -3.439  1.00 0.00 ? 22  VAL A CG2  4  
ATOM 4777  H H    . VAL A 1 22 ? 5.684   -3.581  -2.852  1.00 0.00 ? 22  VAL A H    4  
ATOM 4778  H HA   . VAL A 1 22 ? 8.532   -3.907  -2.372  1.00 0.00 ? 22  VAL A HA   4  
ATOM 4779  H HB   . VAL A 1 22 ? 7.281   -4.986  -4.912  1.00 0.00 ? 22  VAL A HB   4  
ATOM 4780  H HG11 . VAL A 1 22 ? 9.470   -5.611  -5.591  1.00 0.00 ? 22  VAL A HG11 4  
ATOM 4781  H HG12 . VAL A 1 22 ? 10.151  -5.178  -4.025  1.00 0.00 ? 22  VAL A HG12 4  
ATOM 4782  H HG13 . VAL A 1 22 ? 9.552   -3.919  -5.103  1.00 0.00 ? 22  VAL A HG13 4  
ATOM 4783  H HG21 . VAL A 1 22 ? 6.827   -6.549  -3.165  1.00 0.00 ? 22  VAL A HG21 4  
ATOM 4784  H HG22 . VAL A 1 22 ? 8.475   -6.425  -2.552  1.00 0.00 ? 22  VAL A HG22 4  
ATOM 4785  H HG23 . VAL A 1 22 ? 8.171   -7.183  -4.114  1.00 0.00 ? 22  VAL A HG23 4  
ATOM 4786  N N    . ALA A 1 23 ? 8.984   -1.892  -3.782  1.00 0.00 ? 23  ALA A N    4  
ATOM 4787  C CA   . ALA A 1 23 ? 9.191   -0.614  -4.458  1.00 0.00 ? 23  ALA A CA   4  
ATOM 4788  C C    . ALA A 1 23 ? 9.746   -0.826  -5.865  1.00 0.00 ? 23  ALA A C    4  
ATOM 4789  O O    . ALA A 1 23 ? 10.785  -1.465  -6.038  1.00 0.00 ? 23  ALA A O    4  
ATOM 4790  C CB   . ALA A 1 23 ? 10.126  0.269   -3.642  1.00 0.00 ? 23  ALA A CB   4  
ATOM 4791  H H    . ALA A 1 23 ? 9.710   -2.270  -3.241  1.00 0.00 ? 23  ALA A H    4  
ATOM 4792  H HA   . ALA A 1 23 ? 8.234   -0.117  -4.528  1.00 0.00 ? 23  ALA A HA   4  
ATOM 4793  H HB1  . ALA A 1 23 ? 9.545   0.894   -2.981  1.00 0.00 ? 23  ALA A HB1  4  
ATOM 4794  H HB2  . ALA A 1 23 ? 10.706  0.890   -4.307  1.00 0.00 ? 23  ALA A HB2  4  
ATOM 4795  H HB3  . ALA A 1 23 ? 10.791  -0.351  -3.058  1.00 0.00 ? 23  ALA A HB3  4  
ATOM 4796  N N    . ALA A 1 24 ? 9.046   -0.290  -6.867  1.00 0.00 ? 24  ALA A N    4  
ATOM 4797  C CA   . ALA A 1 24 ? 9.472   -0.429  -8.260  1.00 0.00 ? 24  ALA A CA   4  
ATOM 4798  C C    . ALA A 1 24 ? 9.277   0.871   -9.042  1.00 0.00 ? 24  ALA A C    4  
ATOM 4799  O O    . ALA A 1 24 ? 8.468   1.722   -8.663  1.00 0.00 ? 24  ALA A O    4  
ATOM 4800  C CB   . ALA A 1 24 ? 8.713   -1.567  -8.929  1.00 0.00 ? 24  ALA A CB   4  
ATOM 4801  H H    . ALA A 1 24 ? 8.224   0.205   -6.667  1.00 0.00 ? 24  ALA A H    4  
ATOM 4802  H HA   . ALA A 1 24 ? 10.522  -0.681  -8.263  1.00 0.00 ? 24  ALA A HA   4  
ATOM 4803  H HB1  . ALA A 1 24 ? 8.281   -2.206  -8.172  1.00 0.00 ? 24  ALA A HB1  4  
ATOM 4804  H HB2  . ALA A 1 24 ? 9.392   -2.142  -9.539  1.00 0.00 ? 24  ALA A HB2  4  
ATOM 4805  H HB3  . ALA A 1 24 ? 7.927   -1.162  -9.549  1.00 0.00 ? 24  ALA A HB3  4  
ATOM 4806  N N    . LYS A 1 25 ? 10.026  1.011   -10.139 1.00 0.00 ? 25  LYS A N    4  
ATOM 4807  C CA   . LYS A 1 25 ? 9.944   2.200   -10.988 1.00 0.00 ? 25  LYS A CA   4  
ATOM 4808  C C    . LYS A 1 25 ? 9.595   1.822   -12.429 1.00 0.00 ? 25  LYS A C    4  
ATOM 4809  O O    . LYS A 1 25 ? 9.431   0.642   -12.750 1.00 0.00 ? 25  LYS A O    4  
ATOM 4810  C CB   . LYS A 1 25 ? 11.272  2.967   -10.953 1.00 0.00 ? 25  LYS A CB   4  
ATOM 4811  C CG   . LYS A 1 25 ? 11.112  4.450   -10.658 1.00 0.00 ? 25  LYS A CG   4  
ATOM 4812  C CD   . LYS A 1 25 ? 12.458  5.151   -10.563 1.00 0.00 ? 25  LYS A CD   4  
ATOM 4813  C CE   . LYS A 1 25 ? 12.391  6.367   -9.651  1.00 0.00 ? 25  LYS A CE   4  
ATOM 4814  N NZ   . LYS A 1 25 ? 13.650  6.555   -8.876  1.00 0.00 ? 25  LYS A NZ   4  
ATOM 4815  H H    . LYS A 1 25 ? 10.648  0.294   -10.386 1.00 0.00 ? 25  LYS A H    4  
ATOM 4816  H HA   . LYS A 1 25 ? 9.162   2.833   -10.596 1.00 0.00 ? 25  LYS A HA   4  
ATOM 4817  H HB2  . LYS A 1 25 ? 11.904  2.536   -10.191 1.00 0.00 ? 25  LYS A HB2  4  
ATOM 4818  H HB3  . LYS A 1 25 ? 11.759  2.864   -11.912 1.00 0.00 ? 25  LYS A HB3  4  
ATOM 4819  H HG2  . LYS A 1 25 ? 10.536  4.905   -11.450 1.00 0.00 ? 25  LYS A HG2  4  
ATOM 4820  H HG3  . LYS A 1 25 ? 10.589  4.565   -9.720  1.00 0.00 ? 25  LYS A HG3  4  
ATOM 4821  H HD2  . LYS A 1 25 ? 13.187  4.458   -10.172 1.00 0.00 ? 25  LYS A HD2  4  
ATOM 4822  H HD3  . LYS A 1 25 ? 12.757  5.471   -11.551 1.00 0.00 ? 25  LYS A HD3  4  
ATOM 4823  H HE2  . LYS A 1 25 ? 12.217  7.245   -10.255 1.00 0.00 ? 25  LYS A HE2  4  
ATOM 4824  H HE3  . LYS A 1 25 ? 11.570  6.238   -8.961  1.00 0.00 ? 25  LYS A HE3  4  
ATOM 4825  H HZ1  . LYS A 1 25 ? 14.022  5.634   -8.565  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 4826  H HZ2  . LYS A 1 25 ? 13.469  7.144   -8.038  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 4827  H HZ3  . LYS A 1 25 ? 14.366  7.025   -9.467  1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 4828  N N    . GLY A 1 26 ? 9.487   2.832   -13.295 1.00 0.00 ? 26  GLY A N    4  
ATOM 4829  C CA   . GLY A 1 26 ? 9.163   2.594   -14.688 1.00 0.00 ? 26  GLY A CA   4  
ATOM 4830  C C    . GLY A 1 26 ? 9.418   3.816   -15.540 1.00 0.00 ? 26  GLY A C    4  
ATOM 4831  O O    . GLY A 1 26 ? 10.396  4.536   -15.322 1.00 0.00 ? 26  GLY A O    4  
ATOM 4832  H H    . GLY A 1 26 ? 9.632   3.754   -12.987 1.00 0.00 ? 26  GLY A H    4  
ATOM 4833  H HA2  . GLY A 1 26 ? 9.763   1.779   -15.057 1.00 0.00 ? 26  GLY A HA2  4  
ATOM 4834  H HA3  . GLY A 1 26 ? 8.120   2.324   -14.764 1.00 0.00 ? 26  GLY A HA3  4  
ATOM 4835  N N    . ALA A 1 27 ? 8.536   4.062   -16.500 1.00 0.00 ? 27  ALA A N    4  
ATOM 4836  C CA   . ALA A 1 27 ? 8.673   5.219   -17.371 1.00 0.00 ? 27  ALA A CA   4  
ATOM 4837  C C    . ALA A 1 27 ? 7.622   6.273   -17.040 1.00 0.00 ? 27  ALA A C    4  
ATOM 4838  O O    . ALA A 1 27 ? 6.508   5.942   -16.626 1.00 0.00 ? 27  ALA A O    4  
ATOM 4839  C CB   . ALA A 1 27 ? 8.578   4.810   -18.834 1.00 0.00 ? 27  ALA A CB   4  
ATOM 4840  H H    . ALA A 1 27 ? 7.774   3.459   -16.616 1.00 0.00 ? 27  ALA A H    4  
ATOM 4841  H HA   . ALA A 1 27 ? 9.654   5.638   -17.195 1.00 0.00 ? 27  ALA A HA   4  
ATOM 4842  H HB1  . ALA A 1 27 ? 7.599   4.398   -19.030 1.00 0.00 ? 27  ALA A HB1  4  
ATOM 4843  H HB2  . ALA A 1 27 ? 9.331   4.067   -19.050 1.00 0.00 ? 27  ALA A HB2  4  
ATOM 4844  H HB3  . ALA A 1 27 ? 8.736   5.676   -19.460 1.00 0.00 ? 27  ALA A HB3  4  
ATOM 4845  N N    . GLY A 1 28 ? 7.988   7.544   -17.212 1.00 0.00 ? 28  GLY A N    4  
ATOM 4846  C CA   . GLY A 1 28 ? 7.068   8.628   -16.908 1.00 0.00 ? 28  GLY A CA   4  
ATOM 4847  C C    . GLY A 1 28 ? 6.647   8.617   -15.451 1.00 0.00 ? 28  GLY A C    4  
ATOM 4848  O O    . GLY A 1 28 ? 5.493   8.900   -15.125 1.00 0.00 ? 28  GLY A O    4  
ATOM 4849  H H    . GLY A 1 28 ? 8.891   7.746   -17.533 1.00 0.00 ? 28  GLY A H    4  
ATOM 4850  H HA2  . GLY A 1 28 ? 7.548   9.570   -17.128 1.00 0.00 ? 28  GLY A HA2  4  
ATOM 4851  H HA3  . GLY A 1 28 ? 6.190   8.527   -17.528 1.00 0.00 ? 28  GLY A HA3  4  
ATOM 4852  N N    . GLN A 1 29 ? 7.592   8.271   -14.575 1.00 0.00 ? 29  GLN A N    4  
ATOM 4853  C CA   . GLN A 1 29 ? 7.330   8.202   -13.147 1.00 0.00 ? 29  GLN A CA   4  
ATOM 4854  C C    . GLN A 1 29 ? 8.399   8.952   -12.363 1.00 0.00 ? 29  GLN A C    4  
ATOM 4855  O O    . GLN A 1 29 ? 9.528   8.474   -12.223 1.00 0.00 ? 29  GLN A O    4  
ATOM 4856  C CB   . GLN A 1 29 ? 7.284   6.744   -12.693 1.00 0.00 ? 29  GLN A CB   4  
ATOM 4857  C CG   . GLN A 1 29 ? 6.428   6.520   -11.457 1.00 0.00 ? 29  GLN A CG   4  
ATOM 4858  C CD   . GLN A 1 29 ? 5.233   5.628   -11.730 1.00 0.00 ? 29  GLN A CD   4  
ATOM 4859  O OE1  . GLN A 1 29 ? 4.110   5.939   -11.331 1.00 0.00 ? 29  GLN A OE1  4  
ATOM 4860  N NE2  . GLN A 1 29 ? 5.465   4.511   -12.413 1.00 0.00 ? 29  GLN A NE2  4  
ATOM 4861  H H    . GLN A 1 29 ? 8.488   8.048   -14.901 1.00 0.00 ? 29  GLN A H    4  
ATOM 4862  H HA   . GLN A 1 29 ? 6.368   8.656   -12.961 1.00 0.00 ? 29  GLN A HA   4  
ATOM 4863  H HB2  . GLN A 1 29 ? 6.885   6.142   -13.496 1.00 0.00 ? 29  GLN A HB2  4  
ATOM 4864  H HB3  . GLN A 1 29 ? 8.288   6.415   -12.472 1.00 0.00 ? 29  GLN A HB3  4  
ATOM 4865  H HG2  . GLN A 1 29 ? 7.036   6.058   -10.694 1.00 0.00 ? 29  GLN A HG2  4  
ATOM 4866  H HG3  . GLN A 1 29 ? 6.073   7.476   -11.102 1.00 0.00 ? 29  GLN A HG3  4  
ATOM 4867  H HE21 . GLN A 1 29 ? 6.383   4.323   -12.700 1.00 0.00 ? 29  GLN A HE21 4  
ATOM 4868  H HE22 . GLN A 1 29 ? 4.709   3.923   -12.603 1.00 0.00 ? 29  GLN A HE22 4  
ATOM 4869  N N    . ASP A 1 30 ? 8.037   10.121  -11.841 1.00 0.00 ? 30  ASP A N    4  
ATOM 4870  C CA   . ASP A 1 30 ? 8.966   10.928  -11.056 1.00 0.00 ? 30  ASP A CA   4  
ATOM 4871  C C    . ASP A 1 30 ? 8.897   10.570  -9.567  1.00 0.00 ? 30  ASP A C    4  
ATOM 4872  O O    . ASP A 1 30 ? 9.351   11.333  -8.713  1.00 0.00 ? 30  ASP A O    4  
ATOM 4873  C CB   . ASP A 1 30 ? 8.672   12.418  -11.256 1.00 0.00 ? 30  ASP A CB   4  
ATOM 4874  C CG   . ASP A 1 30 ? 9.785   13.305  -10.738 1.00 0.00 ? 30  ASP A CG   4  
ATOM 4875  O OD1  . ASP A 1 30 ? 10.910  13.218  -11.271 1.00 0.00 ? 30  ASP A OD1  4  
ATOM 4876  O OD2  . ASP A 1 30 ? 9.531   14.085  -9.795  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 4877  H H    . ASP A 1 30 ? 7.123   10.443  -11.980 1.00 0.00 ? 30  ASP A H    4  
ATOM 4878  H HA   . ASP A 1 30 ? 9.961   10.716  -11.410 1.00 0.00 ? 30  ASP A HA   4  
ATOM 4879  H HB2  . ASP A 1 30 ? 8.543   12.615  -12.309 1.00 0.00 ? 30  ASP A HB2  4  
ATOM 4880  H HB3  . ASP A 1 30 ? 7.761   12.673  -10.734 1.00 0.00 ? 30  ASP A HB3  4  
ATOM 4881  N N    . LYS A 1 31 ? 8.334   9.400   -9.265  1.00 0.00 ? 31  LYS A N    4  
ATOM 4882  C CA   . LYS A 1 31 ? 8.206   8.932   -7.888  1.00 0.00 ? 31  LYS A CA   4  
ATOM 4883  C C    . LYS A 1 31 ? 8.367   7.412   -7.818  1.00 0.00 ? 31  LYS A C    4  
ATOM 4884  O O    . LYS A 1 31 ? 8.731   6.770   -8.807  1.00 0.00 ? 31  LYS A O    4  
ATOM 4885  C CB   . LYS A 1 31 ? 6.841   9.342   -7.311  1.00 0.00 ? 31  LYS A CB   4  
ATOM 4886  C CG   . LYS A 1 31 ? 6.513   10.820  -7.483  1.00 0.00 ? 31  LYS A CG   4  
ATOM 4887  C CD   . LYS A 1 31 ? 7.295   11.692  -6.510  1.00 0.00 ? 31  LYS A CD   4  
ATOM 4888  C CE   . LYS A 1 31 ? 6.729   13.104  -6.445  1.00 0.00 ? 31  LYS A CE   4  
ATOM 4889  N NZ   . LYS A 1 31 ? 5.674   13.238  -5.400  1.00 0.00 ? 31  LYS A NZ   4  
ATOM 4890  H H    . LYS A 1 31 ? 8.001   8.833   -9.986  1.00 0.00 ? 31  LYS A H    4  
ATOM 4891  H HA   . LYS A 1 31 ? 8.988   9.394   -7.306  1.00 0.00 ? 31  LYS A HA   4  
ATOM 4892  H HB2  . LYS A 1 31 ? 6.070   8.768   -7.803  1.00 0.00 ? 31  LYS A HB2  4  
ATOM 4893  H HB3  . LYS A 1 31 ? 6.826   9.113   -6.256  1.00 0.00 ? 31  LYS A HB3  4  
ATOM 4894  H HG2  . LYS A 1 31 ? 6.757   11.118  -8.491  1.00 0.00 ? 31  LYS A HG2  4  
ATOM 4895  H HG3  . LYS A 1 31 ? 5.456   10.963  -7.310  1.00 0.00 ? 31  LYS A HG3  4  
ATOM 4896  H HD2  . LYS A 1 31 ? 7.248   11.250  -5.527  1.00 0.00 ? 31  LYS A HD2  4  
ATOM 4897  H HD3  . LYS A 1 31 ? 8.325   11.742  -6.834  1.00 0.00 ? 31  LYS A HD3  4  
ATOM 4898  H HE2  . LYS A 1 31 ? 7.533   13.790  -6.222  1.00 0.00 ? 31  LYS A HE2  4  
ATOM 4899  H HE3  . LYS A 1 31 ? 6.305   13.351  -7.408  1.00 0.00 ? 31  LYS A HE3  4  
ATOM 4900  H HZ1  . LYS A 1 31 ? 5.799   12.511  -4.665  1.00 0.00 ? 31  LYS A HZ1  4  
ATOM 4901  H HZ2  . LYS A 1 31 ? 4.732   13.125  -5.826  1.00 0.00 ? 31  LYS A HZ2  4  
ATOM 4902  H HZ3  . LYS A 1 31 ? 5.730   14.178  -4.955  1.00 0.00 ? 31  LYS A HZ3  4  
ATOM 4903  N N    . LEU A 1 32 ? 8.089   6.841   -6.646  1.00 0.00 ? 32  LEU A N    4  
ATOM 4904  C CA   . LEU A 1 32 ? 8.192   5.399   -6.448  1.00 0.00 ? 32  LEU A CA   4  
ATOM 4905  C C    . LEU A 1 32 ? 6.869   4.833   -5.945  1.00 0.00 ? 32  LEU A C    4  
ATOM 4906  O O    . LEU A 1 32 ? 6.202   5.444   -5.105  1.00 0.00 ? 32  LEU A O    4  
ATOM 4907  C CB   . LEU A 1 32 ? 9.316   5.068   -5.462  1.00 0.00 ? 32  LEU A CB   4  
ATOM 4908  C CG   . LEU A 1 32 ? 10.190  3.868   -5.847  1.00 0.00 ? 32  LEU A CG   4  
ATOM 4909  C CD1  . LEU A 1 32 ? 10.745  4.030   -7.257  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 4910  C CD2  . LEU A 1 32 ? 11.321  3.693   -4.843  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 4911  H H    . LEU A 1 32 ? 7.800   7.402   -5.897  1.00 0.00 ? 32  LEU A H    4  
ATOM 4912  H HA   . LEU A 1 32 ? 8.420   4.950   -7.404  1.00 0.00 ? 32  LEU A HA   4  
ATOM 4913  H HB2  . LEU A 1 32 ? 9.953   5.937   -5.368  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 4914  H HB3  . LEU A 1 32 ? 8.872   4.865   -4.499  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 4915  H HG   . LEU A 1 32 ? 9.586   2.973   -5.829  1.00 0.00 ? 32  LEU A HG   4  
ATOM 4916  H HD11 . LEU A 1 32 ? 10.987  5.068   -7.432  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 4917  H HD12 . LEU A 1 32 ? 10.005  3.707   -7.975  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 4918  H HD13 . LEU A 1 32 ? 11.636  3.429   -7.365  1.00 0.00 ? 32  LEU A HD13 4  
ATOM 4919  H HD21 . LEU A 1 32 ? 11.827  2.758   -5.030  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 4920  H HD22 . LEU A 1 32 ? 10.916  3.688   -3.842  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 4921  H HD23 . LEU A 1 32 ? 12.022  4.508   -4.944  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 4922  N N    . GLY A 1 33 ? 6.491   3.668   -6.468  1.00 0.00 ? 33  GLY A N    4  
ATOM 4923  C CA   . GLY A 1 33 ? 5.244   3.044   -6.068  1.00 0.00 ? 33  GLY A CA   4  
ATOM 4924  C C    . GLY A 1 33 ? 5.446   1.842   -5.163  1.00 0.00 ? 33  GLY A C    4  
ATOM 4925  O O    . GLY A 1 33 ? 6.275   0.975   -5.447  1.00 0.00 ? 33  GLY A O    4  
ATOM 4926  H H    . GLY A 1 33 ? 7.062   3.232   -7.137  1.00 0.00 ? 33  GLY A H    4  
ATOM 4927  H HA2  . GLY A 1 33 ? 4.644   3.774   -5.546  1.00 0.00 ? 33  GLY A HA2  4  
ATOM 4928  H HA3  . GLY A 1 33 ? 4.716   2.726   -6.954  1.00 0.00 ? 33  GLY A HA3  4  
ATOM 4929  N N    . ILE A 1 34 ? 4.680   1.790   -4.072  1.00 0.00 ? 34  ILE A N    4  
ATOM 4930  C CA   . ILE A 1 34 ? 4.766   0.685   -3.119  1.00 0.00 ? 34  ILE A CA   4  
ATOM 4931  C C    . ILE A 1 34 ? 3.760   -0.410  -3.476  1.00 0.00 ? 34  ILE A C    4  
ATOM 4932  O O    . ILE A 1 34 ? 2.755   -0.600  -2.790  1.00 0.00 ? 34  ILE A O    4  
ATOM 4933  C CB   . ILE A 1 34 ? 4.515   1.172   -1.671  1.00 0.00 ? 34  ILE A CB   4  
ATOM 4934  C CG1  . ILE A 1 34 ? 5.362   2.410   -1.370  1.00 0.00 ? 34  ILE A CG1  4  
ATOM 4935  C CG2  . ILE A 1 34 ? 4.816   0.067   -0.668  1.00 0.00 ? 34  ILE A CG2  4  
ATOM 4936  C CD1  . ILE A 1 34 ? 6.852   2.183   -1.528  1.00 0.00 ? 34  ILE A CD1  4  
ATOM 4937  H H    . ILE A 1 34 ? 4.035   2.512   -3.908  1.00 0.00 ? 34  ILE A H    4  
ATOM 4938  H HA   . ILE A 1 34 ? 5.765   0.275   -3.172  1.00 0.00 ? 34  ILE A HA   4  
ATOM 4939  H HB   . ILE A 1 34 ? 3.472   1.430   -1.579  1.00 0.00 ? 34  ILE A HB   4  
ATOM 4940  H HG12 . ILE A 1 34 ? 5.076   3.205   -2.042  1.00 0.00 ? 34  ILE A HG12 4  
ATOM 4941  H HG13 . ILE A 1 34 ? 5.179   2.722   -0.353  1.00 0.00 ? 34  ILE A HG13 4  
ATOM 4942  H HG21 . ILE A 1 34 ? 4.077   -0.714  -0.756  1.00 0.00 ? 34  ILE A HG21 4  
ATOM 4943  H HG22 . ILE A 1 34 ? 4.791   0.475   0.333   1.00 0.00 ? 34  ILE A HG22 4  
ATOM 4944  H HG23 . ILE A 1 34 ? 5.796   -0.339  -0.864  1.00 0.00 ? 34  ILE A HG23 4  
ATOM 4945  H HD11 . ILE A 1 34 ? 7.372   3.123   -1.426  1.00 0.00 ? 34  ILE A HD11 4  
ATOM 4946  H HD12 . ILE A 1 34 ? 7.052   1.765   -2.504  1.00 0.00 ? 34  ILE A HD12 4  
ATOM 4947  H HD13 . ILE A 1 34 ? 7.195   1.497   -0.766  1.00 0.00 ? 34  ILE A HD13 4  
ATOM 4948  N N    . TYR A 1 35 ? 4.038   -1.120  -4.567  1.00 0.00 ? 35  TYR A N    4  
ATOM 4949  C CA   . TYR A 1 35 ? 3.160   -2.190  -5.037  1.00 0.00 ? 35  TYR A CA   4  
ATOM 4950  C C    . TYR A 1 35 ? 3.066   -3.331  -4.026  1.00 0.00 ? 35  TYR A C    4  
ATOM 4951  O O    . TYR A 1 35 ? 3.849   -3.402  -3.080  1.00 0.00 ? 35  TYR A O    4  
ATOM 4952  C CB   . TYR A 1 35 ? 3.650   -2.733  -6.379  1.00 0.00 ? 35  TYR A CB   4  
ATOM 4953  C CG   . TYR A 1 35 ? 3.883   -1.666  -7.422  1.00 0.00 ? 35  TYR A CG   4  
ATOM 4954  C CD1  . TYR A 1 35 ? 2.817   -1.050  -8.061  1.00 0.00 ? 35  TYR A CD1  4  
ATOM 4955  C CD2  . TYR A 1 35 ? 5.171   -1.274  -7.766  1.00 0.00 ? 35  TYR A CD2  4  
ATOM 4956  C CE1  . TYR A 1 35 ? 3.025   -0.078  -9.016  1.00 0.00 ? 35  TYR A CE1  4  
ATOM 4957  C CE2  . TYR A 1 35 ? 5.387   -0.302  -8.722  1.00 0.00 ? 35  TYR A CE2  4  
ATOM 4958  C CZ   . TYR A 1 35 ? 4.311   0.295   -9.343  1.00 0.00 ? 35  TYR A CZ   4  
ATOM 4959  O OH   . TYR A 1 35 ? 4.525   1.263   -10.300 1.00 0.00 ? 35  TYR A OH   4  
ATOM 4960  H H    . TYR A 1 35 ? 4.852   -0.914  -5.074  1.00 0.00 ? 35  TYR A H    4  
ATOM 4961  H HA   . TYR A 1 35 ? 2.176   -1.769  -5.171  1.00 0.00 ? 35  TYR A HA   4  
ATOM 4962  H HB2  . TYR A 1 35 ? 4.581   -3.258  -6.228  1.00 0.00 ? 35  TYR A HB2  4  
ATOM 4963  H HB3  . TYR A 1 35 ? 2.914   -3.422  -6.769  1.00 0.00 ? 35  TYR A HB3  4  
ATOM 4964  H HD1  . TYR A 1 35 ? 1.809   -1.342  -7.802  1.00 0.00 ? 35  TYR A HD1  4  
ATOM 4965  H HD2  . TYR A 1 35 ? 6.011   -1.742  -7.275  1.00 0.00 ? 35  TYR A HD2  4  
ATOM 4966  H HE1  . TYR A 1 35 ? 2.181   0.388   -9.498  1.00 0.00 ? 35  TYR A HE1  4  
ATOM 4967  H HE2  . TYR A 1 35 ? 6.395   -0.012  -8.977  1.00 0.00 ? 35  TYR A HE2  4  
ATOM 4968  H HH   . TYR A 1 35 ? 3.989   2.035   -10.104 1.00 0.00 ? 35  TYR A HH   4  
ATOM 4969  N N    . VAL A 1 36 ? 2.102   -4.225  -4.244  1.00 0.00 ? 36  VAL A N    4  
ATOM 4970  C CA   . VAL A 1 36 ? 1.897   -5.372  -3.361  1.00 0.00 ? 36  VAL A CA   4  
ATOM 4971  C C    . VAL A 1 36 ? 2.240   -6.681  -4.071  1.00 0.00 ? 36  VAL A C    4  
ATOM 4972  O O    . VAL A 1 36 ? 1.710   -6.974  -5.144  1.00 0.00 ? 36  VAL A O    4  
ATOM 4973  C CB   . VAL A 1 36 ? 0.443   -5.437  -2.848  1.00 0.00 ? 36  VAL A CB   4  
ATOM 4974  C CG1  . VAL A 1 36 ? 0.261   -6.593  -1.874  1.00 0.00 ? 36  VAL A CG1  4  
ATOM 4975  C CG2  . VAL A 1 36 ? 0.048   -4.121  -2.194  1.00 0.00 ? 36  VAL A CG2  4  
ATOM 4976  H H    . VAL A 1 36 ? 1.515   -4.111  -5.022  1.00 0.00 ? 36  VAL A H    4  
ATOM 4977  H HA   . VAL A 1 36 ? 2.551   -5.257  -2.509  1.00 0.00 ? 36  VAL A HA   4  
ATOM 4978  H HB   . VAL A 1 36 ? -0.210  -5.603  -3.693  1.00 0.00 ? 36  VAL A HB   4  
ATOM 4979  H HG11 . VAL A 1 36 ? -0.792  -6.788  -1.741  1.00 0.00 ? 36  VAL A HG11 4  
ATOM 4980  H HG12 . VAL A 1 36 ? 0.703   -6.334  -0.923  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 4981  H HG13 . VAL A 1 36 ? 0.744   -7.475  -2.267  1.00 0.00 ? 36  VAL A HG13 4  
ATOM 4982  H HG21 . VAL A 1 36 ? 0.684   -3.937  -1.341  1.00 0.00 ? 36  VAL A HG21 4  
ATOM 4983  H HG22 . VAL A 1 36 ? -0.981  -4.175  -1.872  1.00 0.00 ? 36  VAL A HG22 4  
ATOM 4984  H HG23 . VAL A 1 36 ? 0.160   -3.318  -2.907  1.00 0.00 ? 36  VAL A HG23 4  
ATOM 4985  N N    . LYS A 1 37 ? 3.130   -7.462  -3.461  1.00 0.00 ? 37  LYS A N    4  
ATOM 4986  C CA   . LYS A 1 37 ? 3.553   -8.743  -4.026  1.00 0.00 ? 37  LYS A CA   4  
ATOM 4987  C C    . LYS A 1 37 ? 2.619   -9.880  -3.605  1.00 0.00 ? 37  LYS A C    4  
ATOM 4988  O O    . LYS A 1 37 ? 2.357   -10.792 -4.391  1.00 0.00 ? 37  LYS A O    4  
ATOM 4989  C CB   . LYS A 1 37 ? 4.994   -9.062  -3.611  1.00 0.00 ? 37  LYS A CB   4  
ATOM 4990  C CG   . LYS A 1 37 ? 5.171   -9.297  -2.118  1.00 0.00 ? 37  LYS A CG   4  
ATOM 4991  C CD   . LYS A 1 37 ? 6.640   -9.289  -1.723  1.00 0.00 ? 37  LYS A CD   4  
ATOM 4992  C CE   . LYS A 1 37 ? 6.979   -10.439 -0.781  1.00 0.00 ? 37  LYS A CE   4  
ATOM 4993  N NZ   . LYS A 1 37 ? 7.643   -9.970  0.470   1.00 0.00 ? 37  LYS A NZ   4  
ATOM 4994  H H    . LYS A 1 37 ? 3.513   -7.169  -2.606  1.00 0.00 ? 37  LYS A H    4  
ATOM 4995  H HA   . LYS A 1 37 ? 3.516   -8.651  -5.102  1.00 0.00 ? 37  LYS A HA   4  
ATOM 4996  H HB2  . LYS A 1 37 ? 5.317   -9.951  -4.132  1.00 0.00 ? 37  LYS A HB2  4  
ATOM 4997  H HB3  . LYS A 1 37 ? 5.630   -8.237  -3.900  1.00 0.00 ? 37  LYS A HB3  4  
ATOM 4998  H HG2  . LYS A 1 37 ? 4.660   -8.515  -1.578  1.00 0.00 ? 37  LYS A HG2  4  
ATOM 4999  H HG3  . LYS A 1 37 ? 4.742   -10.255 -1.861  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 5000  H HD2  . LYS A 1 37 ? 7.242   -9.381  -2.615  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 5001  H HD3  . LYS A 1 37 ? 6.862   -8.353  -1.232  1.00 0.00 ? 37  LYS A HD3  4  
ATOM 5002  H HE2  . LYS A 1 37 ? 6.066   -10.954 -0.520  1.00 0.00 ? 37  LYS A HE2  4  
ATOM 5003  H HE3  . LYS A 1 37 ? 7.640   -11.122 -1.294  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 5004  H HZ1  . LYS A 1 37 ? 7.357   -8.994  0.688   1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 5005  H HZ2  . LYS A 1 37 ? 8.678   -9.999  0.360   1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 5006  H HZ3  . LYS A 1 37 ? 7.375   -10.583 1.267   1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 5007  N N    . SER A 1 38 ? 2.123   -9.828  -2.365  1.00 0.00 ? 38  SER A N    4  
ATOM 5008  C CA   . SER A 1 38 ? 1.224   -10.863 -1.855  1.00 0.00 ? 38  SER A CA   4  
ATOM 5009  C C    . SER A 1 38 ? 0.488   -10.383 -0.605  1.00 0.00 ? 38  SER A C    4  
ATOM 5010  O O    . SER A 1 38 ? 0.937   -9.455  0.067   1.00 0.00 ? 38  SER A O    4  
ATOM 5011  C CB   . SER A 1 38 ? 2.007   -12.143 -1.538  1.00 0.00 ? 38  SER A CB   4  
ATOM 5012  O OG   . SER A 1 38 ? 2.036   -13.017 -2.655  1.00 0.00 ? 38  SER A OG   4  
ATOM 5013  H H    . SER A 1 38 ? 2.369   -9.078  -1.778  1.00 0.00 ? 38  SER A H    4  
ATOM 5014  H HA   . SER A 1 38 ? 0.499   -11.078 -2.625  1.00 0.00 ? 38  SER A HA   4  
ATOM 5015  H HB2  . SER A 1 38 ? 3.021   -11.886 -1.270  1.00 0.00 ? 38  SER A HB2  4  
ATOM 5016  H HB3  . SER A 1 38 ? 1.535   -12.653 -0.712  1.00 0.00 ? 38  SER A HB3  4  
ATOM 5017  H HG   . SER A 1 38 ? 2.513   -12.599 -3.378  1.00 0.00 ? 38  SER A HG   4  
ATOM 5018  N N    . VAL A 1 39 ? -0.637  -11.028 -0.295  1.00 0.00 ? 39  VAL A N    4  
ATOM 5019  C CA   . VAL A 1 39 ? -1.426  -10.670 0.881   1.00 0.00 ? 39  VAL A CA   4  
ATOM 5020  C C    . VAL A 1 39 ? -1.504  -11.841 1.858   1.00 0.00 ? 39  VAL A C    4  
ATOM 5021  O O    . VAL A 1 39 ? -1.949  -12.933 1.501   1.00 0.00 ? 39  VAL A O    4  
ATOM 5022  C CB   . VAL A 1 39 ? -2.857  -10.227 0.507   1.00 0.00 ? 39  VAL A CB   4  
ATOM 5023  C CG1  . VAL A 1 39 ? -3.565  -9.634  1.718   1.00 0.00 ? 39  VAL A CG1  4  
ATOM 5024  C CG2  . VAL A 1 39 ? -2.832  -9.226  -0.640  1.00 0.00 ? 39  VAL A CG2  4  
ATOM 5025  H H    . VAL A 1 39 ? -0.941  -11.765 -0.867  1.00 0.00 ? 39  VAL A H    4  
ATOM 5026  H HA   . VAL A 1 39 ? -0.933  -9.842  1.370   1.00 0.00 ? 39  VAL A HA   4  
ATOM 5027  H HB   . VAL A 1 39 ? -3.411  -11.098 0.186   1.00 0.00 ? 39  VAL A HB   4  
ATOM 5028  H HG11 . VAL A 1 39 ? -3.014  -8.775  2.072   1.00 0.00 ? 39  VAL A HG11 4  
ATOM 5029  H HG12 . VAL A 1 39 ? -3.619  -10.375 2.502   1.00 0.00 ? 39  VAL A HG12 4  
ATOM 5030  H HG13 . VAL A 1 39 ? -4.564  -9.332  1.439   1.00 0.00 ? 39  VAL A HG13 4  
ATOM 5031  H HG21 . VAL A 1 39 ? -2.267  -9.635  -1.464  1.00 0.00 ? 39  VAL A HG21 4  
ATOM 5032  H HG22 . VAL A 1 39 ? -2.369  -8.308  -0.307  1.00 0.00 ? 39  VAL A HG22 4  
ATOM 5033  H HG23 . VAL A 1 39 ? -3.842  -9.022  -0.962  1.00 0.00 ? 39  VAL A HG23 4  
ATOM 5034  N N    . VAL A 1 40 ? -1.065  -11.601 3.091   1.00 0.00 ? 40  VAL A N    4  
ATOM 5035  C CA   . VAL A 1 40 ? -1.076  -12.627 4.129   1.00 0.00 ? 40  VAL A CA   4  
ATOM 5036  C C    . VAL A 1 40 ? -2.479  -12.827 4.700   1.00 0.00 ? 40  VAL A C    4  
ATOM 5037  O O    . VAL A 1 40 ? -3.169  -11.860 5.029   1.00 0.00 ? 40  VAL A O    4  
ATOM 5038  C CB   . VAL A 1 40 ? -0.113  -12.269 5.283   1.00 0.00 ? 40  VAL A CB   4  
ATOM 5039  C CG1  . VAL A 1 40 ? 0.014   -13.427 6.261   1.00 0.00 ? 40  VAL A CG1  4  
ATOM 5040  C CG2  . VAL A 1 40 ? 1.254   -11.868 4.741   1.00 0.00 ? 40  VAL A CG2  4  
ATOM 5041  H H    . VAL A 1 40 ? -0.723  -10.707 3.310   1.00 0.00 ? 40  VAL A H    4  
ATOM 5042  H HA   . VAL A 1 40 ? -0.743  -13.554 3.685   1.00 0.00 ? 40  VAL A HA   4  
ATOM 5043  H HB   . VAL A 1 40 ? -0.524  -11.426 5.816   1.00 0.00 ? 40  VAL A HB   4  
ATOM 5044  H HG11 . VAL A 1 40 ? 0.998   -13.418 6.704   1.00 0.00 ? 40  VAL A HG11 4  
ATOM 5045  H HG12 . VAL A 1 40 ? -0.138  -14.360 5.738   1.00 0.00 ? 40  VAL A HG12 4  
ATOM 5046  H HG13 . VAL A 1 40 ? -0.732  -13.325 7.037   1.00 0.00 ? 40  VAL A HG13 4  
ATOM 5047  H HG21 . VAL A 1 40 ? 2.023   -12.191 5.428   1.00 0.00 ? 40  VAL A HG21 4  
ATOM 5048  H HG22 . VAL A 1 40 ? 1.296   -10.794 4.634   1.00 0.00 ? 40  VAL A HG22 4  
ATOM 5049  H HG23 . VAL A 1 40 ? 1.412   -12.332 3.779   1.00 0.00 ? 40  VAL A HG23 4  
ATOM 5050  N N    . LYS A 1 41 ? -2.889  -14.088 4.826   1.00 0.00 ? 41  LYS A N    4  
ATOM 5051  C CA   . LYS A 1 41 ? -4.205  -14.420 5.369   1.00 0.00 ? 41  LYS A CA   4  
ATOM 5052  C C    . LYS A 1 41 ? -4.259  -14.135 6.868   1.00 0.00 ? 41  LYS A C    4  
ATOM 5053  O O    . LYS A 1 41 ? -3.231  -14.146 7.549   1.00 0.00 ? 41  LYS A O    4  
ATOM 5054  C CB   . LYS A 1 41 ? -4.530  -15.896 5.118   1.00 0.00 ? 41  LYS A CB   4  
ATOM 5055  C CG   . LYS A 1 41 ? -5.318  -16.146 3.840   1.00 0.00 ? 41  LYS A CG   4  
ATOM 5056  C CD   . LYS A 1 41 ? -4.399  -16.298 2.636   1.00 0.00 ? 41  LYS A CD   4  
ATOM 5057  C CE   . LYS A 1 41 ? -3.999  -17.751 2.414   1.00 0.00 ? 41  LYS A CE   4  
ATOM 5058  N NZ   . LYS A 1 41 ? -3.110  -18.260 3.498   1.00 0.00 ? 41  LYS A NZ   4  
ATOM 5059  H H    . LYS A 1 41 ? -2.289  -14.813 4.554   1.00 0.00 ? 41  LYS A H    4  
ATOM 5060  H HA   . LYS A 1 41 ? -4.936  -13.805 4.868   1.00 0.00 ? 41  LYS A HA   4  
ATOM 5061  H HB2  . LYS A 1 41 ? -3.605  -16.449 5.059   1.00 0.00 ? 41  LYS A HB2  4  
ATOM 5062  H HB3  . LYS A 1 41 ? -5.108  -16.271 5.949   1.00 0.00 ? 41  LYS A HB3  4  
ATOM 5063  H HG2  . LYS A 1 41 ? -5.895  -17.052 3.958   1.00 0.00 ? 41  LYS A HG2  4  
ATOM 5064  H HG3  . LYS A 1 41 ? -5.984  -15.313 3.671   1.00 0.00 ? 41  LYS A HG3  4  
ATOM 5065  H HD2  . LYS A 1 41 ? -4.915  -15.941 1.757   1.00 0.00 ? 41  LYS A HD2  4  
ATOM 5066  H HD3  . LYS A 1 41 ? -3.509  -15.708 2.798   1.00 0.00 ? 41  LYS A HD3  4  
ATOM 5067  H HE2  . LYS A 1 41 ? -4.893  -18.357 2.381   1.00 0.00 ? 41  LYS A HE2  4  
ATOM 5068  H HE3  . LYS A 1 41 ? -3.480  -17.827 1.469   1.00 0.00 ? 41  LYS A HE3  4  
ATOM 5069  H HZ1  . LYS A 1 41 ? -2.361  -17.567 3.702   1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 5070  H HZ2  . LYS A 1 41 ? -2.667  -19.155 3.207   1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 5071  H HZ3  . LYS A 1 41 ? -3.661  -18.426 4.364   1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 5072  N N    . GLY A 1 42 ? -5.464  -13.882 7.376   1.00 0.00 ? 42  GLY A N    4  
ATOM 5073  C CA   . GLY A 1 42 ? -5.630  -13.601 8.794   1.00 0.00 ? 42  GLY A CA   4  
ATOM 5074  C C    . GLY A 1 42 ? -5.694  -12.116 9.108   1.00 0.00 ? 42  GLY A C    4  
ATOM 5075  O O    . GLY A 1 42 ? -6.215  -11.727 10.156  1.00 0.00 ? 42  GLY A O    4  
ATOM 5076  H H    . GLY A 1 42 ? -6.247  -13.888 6.785   1.00 0.00 ? 42  GLY A H    4  
ATOM 5077  H HA2  . GLY A 1 42 ? -6.544  -14.067 9.133   1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5078  H HA3  . GLY A 1 42 ? -4.800  -14.034 9.334   1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5079  N N    . GLY A 1 43 ? -5.169  -11.283 8.206   1.00 0.00 ? 43  GLY A N    4  
ATOM 5080  C CA   . GLY A 1 43 ? -5.190  -9.847  8.421   1.00 0.00 ? 43  GLY A CA   4  
ATOM 5081  C C    . GLY A 1 43 ? -6.589  -9.258  8.301   1.00 0.00 ? 43  GLY A C    4  
ATOM 5082  O O    . GLY A 1 43 ? -7.582  -9.983  8.352   1.00 0.00 ? 43  GLY A O    4  
ATOM 5083  H H    . GLY A 1 43 ? -4.770  -11.644 7.388   1.00 0.00 ? 43  GLY A H    4  
ATOM 5084  H HA2  . GLY A 1 43 ? -4.809  -9.640  9.410   1.00 0.00 ? 43  GLY A HA2  4  
ATOM 5085  H HA3  . GLY A 1 43 ? -4.546  -9.376  7.693   1.00 0.00 ? 43  GLY A HA3  4  
ATOM 5086  N N    . ALA A 1 44 ? -6.669  -7.938  8.148   1.00 0.00 ? 44  ALA A N    4  
ATOM 5087  C CA   . ALA A 1 44 ? -7.958  -7.254  8.028   1.00 0.00 ? 44  ALA A CA   4  
ATOM 5088  C C    . ALA A 1 44 ? -8.341  -7.007  6.569   1.00 0.00 ? 44  ALA A C    4  
ATOM 5089  O O    . ALA A 1 44 ? -9.522  -7.045  6.218   1.00 0.00 ? 44  ALA A O    4  
ATOM 5090  C CB   . ALA A 1 44 ? -7.930  -5.937  8.792   1.00 0.00 ? 44  ALA A CB   4  
ATOM 5091  H H    . ALA A 1 44 ? -5.844  -7.411  8.117   1.00 0.00 ? 44  ALA A H    4  
ATOM 5092  H HA   . ALA A 1 44 ? -8.711  -7.883  8.481   1.00 0.00 ? 44  ALA A HA   4  
ATOM 5093  H HB1  . ALA A 1 44 ? -7.037  -5.390  8.532   1.00 0.00 ? 44  ALA A HB1  4  
ATOM 5094  H HB2  . ALA A 1 44 ? -7.936  -6.136  9.853   1.00 0.00 ? 44  ALA A HB2  4  
ATOM 5095  H HB3  . ALA A 1 44 ? -8.800  -5.351  8.531   1.00 0.00 ? 44  ALA A HB3  4  
ATOM 5096  N N    . ALA A 1 45 ? -7.344  -6.748  5.723   1.00 0.00 ? 45  ALA A N    4  
ATOM 5097  C CA   . ALA A 1 45 ? -7.590  -6.490  4.306   1.00 0.00 ? 45  ALA A CA   4  
ATOM 5098  C C    . ALA A 1 45 ? -7.944  -7.770  3.555   1.00 0.00 ? 45  ALA A C    4  
ATOM 5099  O O    . ALA A 1 45 ? -8.904  -7.798  2.781   1.00 0.00 ? 45  ALA A O    4  
ATOM 5100  C CB   . ALA A 1 45 ? -6.379  -5.825  3.669   1.00 0.00 ? 45  ALA A CB   4  
ATOM 5101  H H    . ALA A 1 45 ? -6.423  -6.726  6.060   1.00 0.00 ? 45  ALA A H    4  
ATOM 5102  H HA   . ALA A 1 45 ? -8.423  -5.804  4.236   1.00 0.00 ? 45  ALA A HA   4  
ATOM 5103  H HB1  . ALA A 1 45 ? -6.710  -5.110  2.930   1.00 0.00 ? 45  ALA A HB1  4  
ATOM 5104  H HB2  . ALA A 1 45 ? -5.765  -6.576  3.193   1.00 0.00 ? 45  ALA A HB2  4  
ATOM 5105  H HB3  . ALA A 1 45 ? -5.804  -5.317  4.429   1.00 0.00 ? 45  ALA A HB3  4  
ATOM 5106  N N    . ASP A 1 46 ? -7.162  -8.826  3.780   1.00 0.00 ? 46  ASP A N    4  
ATOM 5107  C CA   . ASP A 1 46 ? -7.393  -10.108 3.114   1.00 0.00 ? 46  ASP A CA   4  
ATOM 5108  C C    . ASP A 1 46 ? -8.780  -10.662 3.435   1.00 0.00 ? 46  ASP A C    4  
ATOM 5109  O O    . ASP A 1 46 ? -9.436  -11.242 2.569   1.00 0.00 ? 46  ASP A O    4  
ATOM 5110  C CB   . ASP A 1 46 ? -6.317  -11.125 3.511   1.00 0.00 ? 46  ASP A CB   4  
ATOM 5111  C CG   . ASP A 1 46 ? -5.916  -12.037 2.363   1.00 0.00 ? 46  ASP A CG   4  
ATOM 5112  O OD1  . ASP A 1 46 ? -5.982  -11.599 1.193   1.00 0.00 ? 46  ASP A OD1  4  
ATOM 5113  O OD2  . ASP A 1 46 ? -5.532  -13.192 2.633   1.00 0.00 ? 46  ASP A OD2  4  
ATOM 5114  H H    . ASP A 1 46 ? -6.411  -8.740  4.404   1.00 0.00 ? 46  ASP A H    4  
ATOM 5115  H HA   . ASP A 1 46 ? -7.333  -9.934  2.050   1.00 0.00 ? 46  ASP A HA   4  
ATOM 5116  H HB2  . ASP A 1 46 ? -5.437  -10.597 3.848   1.00 0.00 ? 46  ASP A HB2  4  
ATOM 5117  H HB3  . ASP A 1 46 ? -6.692  -11.739 4.318   1.00 0.00 ? 46  ASP A HB3  4  
ATOM 5118  N N    . VAL A 1 47 ? -9.223  -10.479 4.679   1.00 0.00 ? 47  VAL A N    4  
ATOM 5119  C CA   . VAL A 1 47 ? -10.536 -10.960 5.101   1.00 0.00 ? 47  VAL A CA   4  
ATOM 5120  C C    . VAL A 1 47 ? -11.656 -10.094 4.522   1.00 0.00 ? 47  VAL A C    4  
ATOM 5121  O O    . VAL A 1 47 ? -12.743 -10.593 4.229   1.00 0.00 ? 47  VAL A O    4  
ATOM 5122  C CB   . VAL A 1 47 ? -10.661 -10.992 6.639   1.00 0.00 ? 47  VAL A CB   4  
ATOM 5123  C CG1  . VAL A 1 47 ? -11.997 -11.593 7.059   1.00 0.00 ? 47  VAL A CG1  4  
ATOM 5124  C CG2  . VAL A 1 47 ? -9.506  -11.769 7.252   1.00 0.00 ? 47  VAL A CG2  4  
ATOM 5125  H H    . VAL A 1 47 ? -8.655  -10.006 5.325   1.00 0.00 ? 47  VAL A H    4  
ATOM 5126  H HA   . VAL A 1 47 ? -10.652 -11.969 4.732   1.00 0.00 ? 47  VAL A HA   4  
ATOM 5127  H HB   . VAL A 1 47 ? -10.618 -9.977  7.005   1.00 0.00 ? 47  VAL A HB   4  
ATOM 5128  H HG11 . VAL A 1 47 ? -12.758 -10.827 7.037   1.00 0.00 ? 47  VAL A HG11 4  
ATOM 5129  H HG12 . VAL A 1 47 ? -11.915 -11.990 8.059   1.00 0.00 ? 47  VAL A HG12 4  
ATOM 5130  H HG13 . VAL A 1 47 ? -12.265 -12.387 6.377   1.00 0.00 ? 47  VAL A HG13 4  
ATOM 5131  H HG21 . VAL A 1 47 ? -9.639  -12.824 7.063   1.00 0.00 ? 47  VAL A HG21 4  
ATOM 5132  H HG22 . VAL A 1 47 ? -9.479  -11.594 8.317   1.00 0.00 ? 47  VAL A HG22 4  
ATOM 5133  H HG23 . VAL A 1 47 ? -8.576  -11.441 6.810   1.00 0.00 ? 47  VAL A HG23 4  
ATOM 5134  N N    . ASP A 1 48 ? -11.385 -8.797  4.357   1.00 0.00 ? 48  ASP A N    4  
ATOM 5135  C CA   . ASP A 1 48 ? -12.374 -7.872  3.807   1.00 0.00 ? 48  ASP A CA   4  
ATOM 5136  C C    . ASP A 1 48 ? -12.642 -8.167  2.331   1.00 0.00 ? 48  ASP A C    4  
ATOM 5137  O O    . ASP A 1 48 ? -13.790 -8.137  1.883   1.00 0.00 ? 48  ASP A O    4  
ATOM 5138  C CB   . ASP A 1 48 ? -11.900 -6.425  3.973   1.00 0.00 ? 48  ASP A CB   4  
ATOM 5139  C CG   . ASP A 1 48 ? -13.033 -5.476  4.316   1.00 0.00 ? 48  ASP A CG   4  
ATOM 5140  O OD1  . ASP A 1 48 ? -13.719 -5.711  5.334   1.00 0.00 ? 48  ASP A OD1  4  
ATOM 5141  O OD2  . ASP A 1 48 ? -13.231 -4.495  3.570   1.00 0.00 ? 48  ASP A OD2  4  
ATOM 5142  H H    . ASP A 1 48 ? -10.500 -8.457  4.607   1.00 0.00 ? 48  ASP A H    4  
ATOM 5143  H HA   . ASP A 1 48 ? -13.291 -8.006  4.361   1.00 0.00 ? 48  ASP A HA   4  
ATOM 5144  H HB2  . ASP A 1 48 ? -11.168 -6.382  4.766   1.00 0.00 ? 48  ASP A HB2  4  
ATOM 5145  H HB3  . ASP A 1 48 ? -11.443 -6.095  3.051   1.00 0.00 ? 48  ASP A HB3  4  
ATOM 5146  N N    . GLY A 1 49 ? -11.576 -8.453  1.581   1.00 0.00 ? 49  GLY A N    4  
ATOM 5147  C CA   . GLY A 1 49 ? -11.715 -8.752  0.166   1.00 0.00 ? 49  GLY A CA   4  
ATOM 5148  C C    . GLY A 1 49 ? -11.990 -7.516  -0.672  1.00 0.00 ? 49  GLY A C    4  
ATOM 5149  O O    . GLY A 1 49 ? -12.918 -7.505  -1.482  1.00 0.00 ? 49  GLY A O    4  
ATOM 5150  H H    . GLY A 1 49 ? -10.686 -8.462  1.995   1.00 0.00 ? 49  GLY A H    4  
ATOM 5151  H HA2  . GLY A 1 49 ? -10.805 -9.216  -0.182  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 5152  H HA3  . GLY A 1 49 ? -12.531 -9.448  0.037   1.00 0.00 ? 49  GLY A HA3  4  
ATOM 5153  N N    . ARG A 1 50 ? -11.182 -6.472  -0.481  1.00 0.00 ? 50  ARG A N    4  
ATOM 5154  C CA   . ARG A 1 50 ? -11.347 -5.226  -1.231  1.00 0.00 ? 50  ARG A CA   4  
ATOM 5155  C C    . ARG A 1 50 ? -10.268 -5.076  -2.307  1.00 0.00 ? 50  ARG A C    4  
ATOM 5156  O O    . ARG A 1 50 ? -10.534 -4.559  -3.394  1.00 0.00 ? 50  ARG A O    4  
ATOM 5157  C CB   . ARG A 1 50 ? -11.312 -4.021  -0.286  1.00 0.00 ? 50  ARG A CB   4  
ATOM 5158  C CG   . ARG A 1 50 ? -12.574 -3.860  0.549   1.00 0.00 ? 50  ARG A CG   4  
ATOM 5159  C CD   . ARG A 1 50 ? -13.520 -2.833  -0.058  1.00 0.00 ? 50  ARG A CD   4  
ATOM 5160  N NE   . ARG A 1 50 ? -14.439 -2.274  0.935   1.00 0.00 ? 50  ARG A NE   4  
ATOM 5161  C CZ   . ARG A 1 50 ? -15.500 -1.519  0.633   1.00 0.00 ? 50  ARG A CZ   4  
ATOM 5162  N NH1  . ARG A 1 50 ? -15.788 -1.231  -0.634  1.00 0.00 ? 50  ARG A NH1  4  
ATOM 5163  N NH2  . ARG A 1 50 ? -16.278 -1.052  1.603   1.00 0.00 ? 50  ARG A NH2  4  
ATOM 5164  H H    . ARG A 1 50 ? -10.458 -6.542  0.178   1.00 0.00 ? 50  ARG A H    4  
ATOM 5165  H HA   . ARG A 1 50 ? -12.310 -5.259  -1.717  1.00 0.00 ? 50  ARG A HA   4  
ATOM 5166  H HB2  . ARG A 1 50 ? -10.474 -4.128  0.387   1.00 0.00 ? 50  ARG A HB2  4  
ATOM 5167  H HB3  . ARG A 1 50 ? -11.178 -3.123  -0.871  1.00 0.00 ? 50  ARG A HB3  4  
ATOM 5168  H HG2  . ARG A 1 50 ? -13.081 -4.812  0.607   1.00 0.00 ? 50  ARG A HG2  4  
ATOM 5169  H HG3  . ARG A 1 50 ? -12.296 -3.538  1.542   1.00 0.00 ? 50  ARG A HG3  4  
ATOM 5170  H HD2  . ARG A 1 50 ? -12.935 -2.031  -0.483  1.00 0.00 ? 50  ARG A HD2  4  
ATOM 5171  H HD3  . ARG A 1 50 ? -14.094 -3.311  -0.838  1.00 0.00 ? 50  ARG A HD3  4  
ATOM 5172  H HE   . ARG A 1 50 ? -14.255 -2.469  1.879   1.00 0.00 ? 50  ARG A HE   4  
ATOM 5173  H HH11 . ARG A 1 50 ? -15.210 -1.578  -1.372  1.00 0.00 ? 50  ARG A HH11 4  
ATOM 5174  H HH12 . ARG A 1 50 ? -16.586 -0.667  -0.849  1.00 0.00 ? 50  ARG A HH12 4  
ATOM 5175  H HH21 . ARG A 1 50 ? -16.070 -1.265  2.559   1.00 0.00 ? 50  ARG A HH21 4  
ATOM 5176  H HH22 . ARG A 1 50 ? -17.074 -0.489  1.380   1.00 0.00 ? 50  ARG A HH22 4  
ATOM 5177  N N    . LEU A 1 51 ? -9.049  -5.529  -1.999  1.00 0.00 ? 51  LEU A N    4  
ATOM 5178  C CA   . LEU A 1 51 ? -7.937  -5.440  -2.943  1.00 0.00 ? 51  LEU A CA   4  
ATOM 5179  C C    . LEU A 1 51 ? -7.310  -6.814  -3.194  1.00 0.00 ? 51  LEU A C    4  
ATOM 5180  O O    . LEU A 1 51 ? -7.669  -7.799  -2.546  1.00 0.00 ? 51  LEU A O    4  
ATOM 5181  C CB   . LEU A 1 51 ? -6.873  -4.468  -2.421  1.00 0.00 ? 51  LEU A CB   4  
ATOM 5182  C CG   . LEU A 1 51 ? -6.240  -4.856  -1.082  1.00 0.00 ? 51  LEU A CG   4  
ATOM 5183  C CD1  . LEU A 1 51 ? -4.729  -4.967  -1.214  1.00 0.00 ? 51  LEU A CD1  4  
ATOM 5184  C CD2  . LEU A 1 51 ? -6.614  -3.847  -0.006  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 5185  H H    . LEU A 1 51 ? -8.894  -5.931  -1.119  1.00 0.00 ? 51  LEU A H    4  
ATOM 5186  H HA   . LEU A 1 51 ? -8.326  -5.063  -3.876  1.00 0.00 ? 51  LEU A HA   4  
ATOM 5187  H HB2  . LEU A 1 51 ? -6.087  -4.398  -3.160  1.00 0.00 ? 51  LEU A HB2  4  
ATOM 5188  H HB3  . LEU A 1 51 ? -7.326  -3.495  -2.311  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 5189  H HG   . LEU A 1 51 ? -6.618  -5.823  -0.780  1.00 0.00 ? 51  LEU A HG   4  
ATOM 5190  H HD11 . LEU A 1 51 ? -4.465  -5.976  -1.492  1.00 0.00 ? 51  LEU A HD11 4  
ATOM 5191  H HD12 . LEU A 1 51 ? -4.267  -4.722  -0.269  1.00 0.00 ? 51  LEU A HD12 4  
ATOM 5192  H HD13 . LEU A 1 51 ? -4.383  -4.282  -1.973  1.00 0.00 ? 51  LEU A HD13 4  
ATOM 5193  H HD21 . LEU A 1 51 ? -6.284  -2.864  -0.305  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 5194  H HD22 . LEU A 1 51 ? -6.139  -4.119  0.925   1.00 0.00 ? 51  LEU A HD22 4  
ATOM 5195  H HD23 . LEU A 1 51 ? -7.686  -3.843  0.126   1.00 0.00 ? 51  LEU A HD23 4  
ATOM 5196  N N    . ALA A 1 52 ? -6.369  -6.865  -4.141  1.00 0.00 ? 52  ALA A N    4  
ATOM 5197  C CA   . ALA A 1 52 ? -5.682  -8.107  -4.486  1.00 0.00 ? 52  ALA A CA   4  
ATOM 5198  C C    . ALA A 1 52 ? -4.199  -7.860  -4.759  1.00 0.00 ? 52  ALA A C    4  
ATOM 5199  O O    . ALA A 1 52 ? -3.776  -6.718  -4.939  1.00 0.00 ? 52  ALA A O    4  
ATOM 5200  C CB   . ALA A 1 52 ? -6.341  -8.756  -5.697  1.00 0.00 ? 52  ALA A CB   4  
ATOM 5201  H H    . ALA A 1 52 ? -6.129  -6.043  -4.618  1.00 0.00 ? 52  ALA A H    4  
ATOM 5202  H HA   . ALA A 1 52 ? -5.776  -8.784  -3.649  1.00 0.00 ? 52  ALA A HA   4  
ATOM 5203  H HB1  . ALA A 1 52 ? -7.404  -8.573  -5.669  1.00 0.00 ? 52  ALA A HB1  4  
ATOM 5204  H HB2  . ALA A 1 52 ? -6.159  -9.820  -5.678  1.00 0.00 ? 52  ALA A HB2  4  
ATOM 5205  H HB3  . ALA A 1 52 ? -5.927  -8.336  -6.602  1.00 0.00 ? 52  ALA A HB3  4  
ATOM 5206  N N    . ALA A 1 53 ? -3.416  -8.940  -4.792  1.00 0.00 ? 53  ALA A N    4  
ATOM 5207  C CA   . ALA A 1 53 ? -1.977  -8.847  -5.044  1.00 0.00 ? 53  ALA A CA   4  
ATOM 5208  C C    . ALA A 1 53 ? -1.684  -8.155  -6.375  1.00 0.00 ? 53  ALA A C    4  
ATOM 5209  O O    . ALA A 1 53 ? -2.226  -8.536  -7.415  1.00 0.00 ? 53  ALA A O    4  
ATOM 5210  C CB   . ALA A 1 53 ? -1.347  -10.233 -5.025  1.00 0.00 ? 53  ALA A CB   4  
ATOM 5211  H H    . ALA A 1 53 ? -3.818  -9.822  -4.643  1.00 0.00 ? 53  ALA A H    4  
ATOM 5212  H HA   . ALA A 1 53 ? -1.538  -8.269  -4.245  1.00 0.00 ? 53  ALA A HA   4  
ATOM 5213  H HB1  . ALA A 1 53 ? -1.980  -10.910 -4.472  1.00 0.00 ? 53  ALA A HB1  4  
ATOM 5214  H HB2  . ALA A 1 53 ? -0.376  -10.182 -4.553  1.00 0.00 ? 53  ALA A HB2  4  
ATOM 5215  H HB3  . ALA A 1 53 ? -1.235  -10.590 -6.038  1.00 0.00 ? 53  ALA A HB3  4  
ATOM 5216  N N    . GLY A 1 54 ? -0.819  -7.142  -6.333  1.00 0.00 ? 54  GLY A N    4  
ATOM 5217  C CA   . GLY A 1 54 ? -0.457  -6.412  -7.538  1.00 0.00 ? 54  GLY A CA   4  
ATOM 5218  C C    . GLY A 1 54 ? -1.110  -5.044  -7.622  1.00 0.00 ? 54  GLY A C    4  
ATOM 5219  O O    . GLY A 1 54 ? -1.517  -4.612  -8.702  1.00 0.00 ? 54  GLY A O    4  
ATOM 5220  H H    . GLY A 1 54 ? -0.418  -6.890  -5.473  1.00 0.00 ? 54  GLY A H    4  
ATOM 5221  H HA2  . GLY A 1 54 ? 0.616   -6.285  -7.556  1.00 0.00 ? 54  GLY A HA2  4  
ATOM 5222  H HA3  . GLY A 1 54 ? -0.752  -6.993  -8.400  1.00 0.00 ? 54  GLY A HA3  4  
ATOM 5223  N N    . ASP A 1 55 ? -1.204  -4.359  -6.483  1.00 0.00 ? 55  ASP A N    4  
ATOM 5224  C CA   . ASP A 1 55 ? -1.808  -3.031  -6.433  1.00 0.00 ? 55  ASP A CA   4  
ATOM 5225  C C    . ASP A 1 55 ? -0.779  -1.983  -6.008  1.00 0.00 ? 55  ASP A C    4  
ATOM 5226  O O    . ASP A 1 55 ? 0.063   -2.242  -5.145  1.00 0.00 ? 55  ASP A O    4  
ATOM 5227  C CB   . ASP A 1 55 ? -3.007  -3.022  -5.477  1.00 0.00 ? 55  ASP A CB   4  
ATOM 5228  C CG   . ASP A 1 55 ? -2.621  -3.332  -4.043  1.00 0.00 ? 55  ASP A CG   4  
ATOM 5229  O OD1  . ASP A 1 55 ? -2.234  -2.393  -3.315  1.00 0.00 ? 55  ASP A OD1  4  
ATOM 5230  O OD2  . ASP A 1 55 ? -2.707  -4.511  -3.648  1.00 0.00 ? 55  ASP A OD2  4  
ATOM 5231  H H    . ASP A 1 55 ? -0.858  -4.755  -5.655  1.00 0.00 ? 55  ASP A H    4  
ATOM 5232  H HA   . ASP A 1 55 ? -2.152  -2.789  -7.428  1.00 0.00 ? 55  ASP A HA   4  
ATOM 5233  H HB2  . ASP A 1 55 ? -3.469  -2.046  -5.501  1.00 0.00 ? 55  ASP A HB2  4  
ATOM 5234  H HB3  . ASP A 1 55 ? -3.723  -3.762  -5.806  1.00 0.00 ? 55  ASP A HB3  4  
ATOM 5235  N N    . GLN A 1 56 ? -0.852  -0.800  -6.621  1.00 0.00 ? 56  GLN A N    4  
ATOM 5236  C CA   . GLN A 1 56 ? 0.073   0.289   -6.310  1.00 0.00 ? 56  GLN A CA   4  
ATOM 5237  C C    . GLN A 1 56 ? -0.423  1.108   -5.117  1.00 0.00 ? 56  GLN A C    4  
ATOM 5238  O O    . GLN A 1 56 ? -1.626  1.324   -4.958  1.00 0.00 ? 56  GLN A O    4  
ATOM 5239  C CB   . GLN A 1 56 ? 0.253   1.198   -7.530  1.00 0.00 ? 56  GLN A CB   4  
ATOM 5240  C CG   . GLN A 1 56 ? 1.365   2.227   -7.372  1.00 0.00 ? 56  GLN A CG   4  
ATOM 5241  C CD   . GLN A 1 56 ? 0.853   3.657   -7.376  1.00 0.00 ? 56  GLN A CD   4  
ATOM 5242  O OE1  . GLN A 1 56 ? -0.277  3.928   -7.786  1.00 0.00 ? 56  GLN A OE1  4  
ATOM 5243  N NE2  . GLN A 1 56 ? 1.685   4.585   -6.916  1.00 0.00 ? 56  GLN A NE2  4  
ATOM 5244  H H    . GLN A 1 56 ? -1.545  -0.658  -7.300  1.00 0.00 ? 56  GLN A H    4  
ATOM 5245  H HA   . GLN A 1 56 ? 1.026   -0.150  -6.057  1.00 0.00 ? 56  GLN A HA   4  
ATOM 5246  H HB2  . GLN A 1 56 ? 0.482   0.585   -8.389  1.00 0.00 ? 56  GLN A HB2  4  
ATOM 5247  H HB3  . GLN A 1 56 ? -0.673  1.723   -7.712  1.00 0.00 ? 56  GLN A HB3  4  
ATOM 5248  H HG2  . GLN A 1 56 ? 1.873   2.047   -6.437  1.00 0.00 ? 56  GLN A HG2  4  
ATOM 5249  H HG3  . GLN A 1 56 ? 2.063   2.109   -8.188  1.00 0.00 ? 56  GLN A HG3  4  
ATOM 5250  H HE21 . GLN A 1 56 ? 2.570   4.302   -6.602  1.00 0.00 ? 56  GLN A HE21 4  
ATOM 5251  H HE22 . GLN A 1 56 ? 1.380   5.515   -6.910  1.00 0.00 ? 56  GLN A HE22 4  
ATOM 5252  N N    . LEU A 1 57 ? 0.516   1.563   -4.286  1.00 0.00 ? 57  LEU A N    4  
ATOM 5253  C CA   . LEU A 1 57 ? 0.181   2.362   -3.107  1.00 0.00 ? 57  LEU A CA   4  
ATOM 5254  C C    . LEU A 1 57 ? 0.397   3.852   -3.366  1.00 0.00 ? 57  LEU A C    4  
ATOM 5255  O O    . LEU A 1 57 ? 1.339   4.240   -4.061  1.00 0.00 ? 57  LEU A O    4  
ATOM 5256  C CB   . LEU A 1 57 ? 1.019   1.918   -1.903  1.00 0.00 ? 57  LEU A CB   4  
ATOM 5257  C CG   . LEU A 1 57 ? 0.220   1.539   -0.652  1.00 0.00 ? 57  LEU A CG   4  
ATOM 5258  C CD1  . LEU A 1 57 ? -0.557  2.739   -0.129  1.00 0.00 ? 57  LEU A CD1  4  
ATOM 5259  C CD2  . LEU A 1 57 ? -0.718  0.376   -0.949  1.00 0.00 ? 57  LEU A CD2  4  
ATOM 5260  H H    . LEU A 1 57 ? 1.457   1.360   -4.473  1.00 0.00 ? 57  LEU A H    4  
ATOM 5261  H HA   . LEU A 1 57 ? -0.863  2.198   -2.884  1.00 0.00 ? 57  LEU A HA   4  
ATOM 5262  H HB2  . LEU A 1 57 ? 1.609   1.064   -2.197  1.00 0.00 ? 57  LEU A HB2  4  
ATOM 5263  H HB3  . LEU A 1 57 ? 1.691   2.722   -1.641  1.00 0.00 ? 57  LEU A HB3  4  
ATOM 5264  H HG   . LEU A 1 57 ? 0.906   1.226   0.122   1.00 0.00 ? 57  LEU A HG   4  
ATOM 5265  H HD11 . LEU A 1 57 ? -0.651  2.667   0.944   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 5266  H HD12 . LEU A 1 57 ? -1.540  2.755   -0.575  1.00 0.00 ? 57  LEU A HD12 4  
ATOM 5267  H HD13 . LEU A 1 57 ? -0.032  3.648   -0.383  1.00 0.00 ? 57  LEU A HD13 4  
ATOM 5268  H HD21 . LEU A 1 57 ? -0.942  0.353   -2.006  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 5269  H HD22 . LEU A 1 57 ? -1.634  0.499   -0.390  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 5270  H HD23 . LEU A 1 57 ? -0.243  -0.551  -0.662  1.00 0.00 ? 57  LEU A HD23 4  
ATOM 5271  N N    . LEU A 1 58 ? -0.479  4.679   -2.795  1.00 0.00 ? 58  LEU A N    4  
ATOM 5272  C CA   . LEU A 1 58 ? -0.392  6.129   -2.955  1.00 0.00 ? 58  LEU A CA   4  
ATOM 5273  C C    . LEU A 1 58 ? -0.280  6.827   -1.598  1.00 0.00 ? 58  LEU A C    4  
ATOM 5274  O O    . LEU A 1 58 ? 0.687   7.551   -1.343  1.00 0.00 ? 58  LEU A O    4  
ATOM 5275  C CB   . LEU A 1 58 ? -1.617  6.654   -3.711  1.00 0.00 ? 58  LEU A CB   4  
ATOM 5276  C CG   . LEU A 1 58 ? -1.363  7.875   -4.602  1.00 0.00 ? 58  LEU A CG   4  
ATOM 5277  C CD1  . LEU A 1 58 ? -2.362  7.916   -5.749  1.00 0.00 ? 58  LEU A CD1  4  
ATOM 5278  C CD2  . LEU A 1 58 ? -1.438  9.158   -3.786  1.00 0.00 ? 58  LEU A CD2  4  
ATOM 5279  H H    . LEU A 1 58 ? -1.202  4.304   -2.250  1.00 0.00 ? 58  LEU A H    4  
ATOM 5280  H HA   . LEU A 1 58 ? 0.495   6.347   -3.531  1.00 0.00 ? 58  LEU A HA   4  
ATOM 5281  H HB2  . LEU A 1 58 ? -2.000  5.856   -4.330  1.00 0.00 ? 58  LEU A HB2  4  
ATOM 5282  H HB3  . LEU A 1 58 ? -2.374  6.917   -2.987  1.00 0.00 ? 58  LEU A HB3  4  
ATOM 5283  H HG   . LEU A 1 58 ? -0.372  7.804   -5.026  1.00 0.00 ? 58  LEU A HG   4  
ATOM 5284  H HD11 . LEU A 1 58 ? -2.670  6.911   -5.997  1.00 0.00 ? 58  LEU A HD11 4  
ATOM 5285  H HD12 . LEU A 1 58 ? -1.901  8.374   -6.612  1.00 0.00 ? 58  LEU A HD12 4  
ATOM 5286  H HD13 . LEU A 1 58 ? -3.226  8.494   -5.454  1.00 0.00 ? 58  LEU A HD13 4  
ATOM 5287  H HD21 . LEU A 1 58 ? -1.193  8.947   -2.756  1.00 0.00 ? 58  LEU A HD21 4  
ATOM 5288  H HD22 . LEU A 1 58 ? -2.439  9.562   -3.841  1.00 0.00 ? 58  LEU A HD22 4  
ATOM 5289  H HD23 . LEU A 1 58 ? -0.738  9.878   -4.182  1.00 0.00 ? 58  LEU A HD23 4  
ATOM 5290  N N    . SER A 1 59 ? -1.278  6.616   -0.736  1.00 0.00 ? 59  SER A N    4  
ATOM 5291  C CA   . SER A 1 59 ? -1.294  7.236   0.587   1.00 0.00 ? 59  SER A CA   4  
ATOM 5292  C C    . SER A 1 59 ? -1.816  6.276   1.658   1.00 0.00 ? 59  SER A C    4  
ATOM 5293  O O    . SER A 1 59 ? -2.586  5.356   1.366   1.00 0.00 ? 59  SER A O    4  
ATOM 5294  C CB   . SER A 1 59 ? -2.151  8.506   0.565   1.00 0.00 ? 59  SER A CB   4  
ATOM 5295  O OG   . SER A 1 59 ? -3.403  8.272   -0.058  1.00 0.00 ? 59  SER A OG   4  
ATOM 5296  H H    . SER A 1 59 ? -2.025  6.037   -1.000  1.00 0.00 ? 59  SER A H    4  
ATOM 5297  H HA   . SER A 1 59 ? -0.279  7.508   0.836   1.00 0.00 ? 59  SER A HA   4  
ATOM 5298  H HB2  . SER A 1 59 ? -2.325  8.838   1.578   1.00 0.00 ? 59  SER A HB2  4  
ATOM 5299  H HB3  . SER A 1 59 ? -1.630  9.279   0.019   1.00 0.00 ? 59  SER A HB3  4  
ATOM 5300  H HG   . SER A 1 59 ? -3.355  8.531   -0.982  1.00 0.00 ? 59  SER A HG   4  
ATOM 5301  N N    . VAL A 1 60 ? -1.392  6.509   2.903   1.00 0.00 ? 60  VAL A N    4  
ATOM 5302  C CA   . VAL A 1 60 ? -1.810  5.685   4.034   1.00 0.00 ? 60  VAL A CA   4  
ATOM 5303  C C    . VAL A 1 60 ? -2.190  6.564   5.222   1.00 0.00 ? 60  VAL A C    4  
ATOM 5304  O O    . VAL A 1 60 ? -1.337  7.237   5.805   1.00 0.00 ? 60  VAL A O    4  
ATOM 5305  C CB   . VAL A 1 60 ? -0.705  4.698   4.468   1.00 0.00 ? 60  VAL A CB   4  
ATOM 5306  C CG1  . VAL A 1 60 ? -1.230  3.732   5.523   1.00 0.00 ? 60  VAL A CG1  4  
ATOM 5307  C CG2  . VAL A 1 60 ? -0.160  3.939   3.267   1.00 0.00 ? 60  VAL A CG2  4  
ATOM 5308  H H    . VAL A 1 60 ? -0.783  7.262   3.065   1.00 0.00 ? 60  VAL A H    4  
ATOM 5309  H HA   . VAL A 1 60 ? -2.677  5.114   3.729   1.00 0.00 ? 60  VAL A HA   4  
ATOM 5310  H HB   . VAL A 1 60 ? 0.104   5.265   4.906   1.00 0.00 ? 60  VAL A HB   4  
ATOM 5311  H HG11 . VAL A 1 60 ? -1.502  2.799   5.053   1.00 0.00 ? 60  VAL A HG11 4  
ATOM 5312  H HG12 . VAL A 1 60 ? -2.099  4.159   6.004   1.00 0.00 ? 60  VAL A HG12 4  
ATOM 5313  H HG13 . VAL A 1 60 ? -0.463  3.553   6.261   1.00 0.00 ? 60  VAL A HG13 4  
ATOM 5314  H HG21 . VAL A 1 60 ? -0.918  3.272   2.889   1.00 0.00 ? 60  VAL A HG21 4  
ATOM 5315  H HG22 . VAL A 1 60 ? 0.706   3.367   3.566   1.00 0.00 ? 60  VAL A HG22 4  
ATOM 5316  H HG23 . VAL A 1 60 ? 0.122   4.640   2.495   1.00 0.00 ? 60  VAL A HG23 4  
ATOM 5317  N N    . ASP A 1 61 ? -3.479  6.558   5.569   1.00 0.00 ? 61  ASP A N    4  
ATOM 5318  C CA   . ASP A 1 61 ? -3.991  7.360   6.682   1.00 0.00 ? 61  ASP A CA   4  
ATOM 5319  C C    . ASP A 1 61 ? -3.671  8.848   6.488   1.00 0.00 ? 61  ASP A C    4  
ATOM 5320  O O    . ASP A 1 61 ? -3.417  9.570   7.455   1.00 0.00 ? 61  ASP A O    4  
ATOM 5321  C CB   . ASP A 1 61 ? -3.415  6.863   8.017   1.00 0.00 ? 61  ASP A CB   4  
ATOM 5322  C CG   . ASP A 1 61 ? -4.212  5.714   8.609   1.00 0.00 ? 61  ASP A CG   4  
ATOM 5323  O OD1  . ASP A 1 61 ? -5.460  5.790   8.612   1.00 0.00 ? 61  ASP A OD1  4  
ATOM 5324  O OD2  . ASP A 1 61 ? -3.587  4.736   9.069   1.00 0.00 ? 61  ASP A OD2  4  
ATOM 5325  H H    . ASP A 1 61 ? -4.105  6.003   5.057   1.00 0.00 ? 61  ASP A H    4  
ATOM 5326  H HA   . ASP A 1 61 ? -5.064  7.241   6.702   1.00 0.00 ? 61  ASP A HA   4  
ATOM 5327  H HB2  . ASP A 1 61 ? -2.401  6.528   7.861   1.00 0.00 ? 61  ASP A HB2  4  
ATOM 5328  H HB3  . ASP A 1 61 ? -3.414  7.678   8.726   1.00 0.00 ? 61  ASP A HB3  4  
ATOM 5329  N N    . GLY A 1 62 ? -3.684  9.298   5.230   1.00 0.00 ? 62  GLY A N    4  
ATOM 5330  C CA   . GLY A 1 62 ? -3.393  10.692  4.929   1.00 0.00 ? 62  GLY A CA   4  
ATOM 5331  C C    . GLY A 1 62 ? -1.938  10.938  4.552   1.00 0.00 ? 62  GLY A C    4  
ATOM 5332  O O    . GLY A 1 62 ? -1.625  11.950  3.925   1.00 0.00 ? 62  GLY A O    4  
ATOM 5333  H H    . GLY A 1 62 ? -3.892  8.678   4.499   1.00 0.00 ? 62  GLY A H    4  
ATOM 5334  H HA2  . GLY A 1 62 ? -4.021  11.004  4.106   1.00 0.00 ? 62  GLY A HA2  4  
ATOM 5335  H HA3  . GLY A 1 62 ? -3.633  11.292  5.793   1.00 0.00 ? 62  GLY A HA3  4  
ATOM 5336  N N    . ARG A 1 63 ? -1.044  10.019  4.929   1.00 0.00 ? 63  ARG A N    4  
ATOM 5337  C CA   . ARG A 1 63 ? 0.375   10.167  4.615   1.00 0.00 ? 63  ARG A CA   4  
ATOM 5338  C C    . ARG A 1 63 ? 0.631   9.966   3.122   1.00 0.00 ? 63  ARG A C    4  
ATOM 5339  O O    . ARG A 1 63 ? -0.100  9.239   2.450   1.00 0.00 ? 63  ARG A O    4  
ATOM 5340  C CB   . ARG A 1 63 ? 1.217   9.182   5.431   1.00 0.00 ? 63  ARG A CB   4  
ATOM 5341  C CG   . ARG A 1 63 ? 1.506   9.657   6.847   1.00 0.00 ? 63  ARG A CG   4  
ATOM 5342  C CD   . ARG A 1 63 ? 0.586   8.994   7.862   1.00 0.00 ? 63  ARG A CD   4  
ATOM 5343  N NE   . ARG A 1 63 ? 0.698   9.602   9.189   1.00 0.00 ? 63  ARG A NE   4  
ATOM 5344  C CZ   . ARG A 1 63 ? -0.060  9.263   10.236  1.00 0.00 ? 63  ARG A CZ   4  
ATOM 5345  N NH1  . ARG A 1 63 ? -0.985  8.314   10.121  1.00 0.00 ? 63  ARG A NH1  4  
ATOM 5346  N NH2  . ARG A 1 63 ? 0.109   9.873   11.404  1.00 0.00 ? 63  ARG A NH2  4  
ATOM 5347  H H    . ARG A 1 63 ? -1.344  9.228   5.424   1.00 0.00 ? 63  ARG A H    4  
ATOM 5348  H HA   . ARG A 1 63 ? 0.663   11.174  4.880   1.00 0.00 ? 63  ARG A HA   4  
ATOM 5349  H HB2  . ARG A 1 63 ? 0.696   8.240   5.486   1.00 0.00 ? 63  ARG A HB2  4  
ATOM 5350  H HB3  . ARG A 1 63 ? 2.160   9.032   4.927   1.00 0.00 ? 63  ARG A HB3  4  
ATOM 5351  H HG2  . ARG A 1 63 ? 2.529   9.418   7.095   1.00 0.00 ? 63  ARG A HG2  4  
ATOM 5352  H HG3  . ARG A 1 63 ? 1.364   10.728  6.892   1.00 0.00 ? 63  ARG A HG3  4  
ATOM 5353  H HD2  . ARG A 1 63 ? -0.434  9.088   7.520   1.00 0.00 ? 63  ARG A HD2  4  
ATOM 5354  H HD3  . ARG A 1 63 ? 0.845   7.947   7.933   1.00 0.00 ? 63  ARG A HD3  4  
ATOM 5355  H HE   . ARG A 1 63 ? 1.374   10.303  9.308   1.00 0.00 ? 63  ARG A HE   4  
ATOM 5356  H HH11 . ARG A 1 63 ? -1.120  7.848   9.249   1.00 0.00 ? 63  ARG A HH11 4  
ATOM 5357  H HH12 . ARG A 1 63 ? -1.547  8.067   10.912  1.00 0.00 ? 63  ARG A HH12 4  
ATOM 5358  H HH21 . ARG A 1 63 ? 0.803   10.586  11.501  1.00 0.00 ? 63  ARG A HH21 4  
ATOM 5359  H HH22 . ARG A 1 63 ? -0.457  9.619   12.189  1.00 0.00 ? 63  ARG A HH22 4  
ATOM 5360  N N    . SER A 1 64 ? 1.674   10.617  2.613   1.00 0.00 ? 64  SER A N    4  
ATOM 5361  C CA   . SER A 1 64 ? 2.031   10.519  1.200   1.00 0.00 ? 64  SER A CA   4  
ATOM 5362  C C    . SER A 1 64 ? 3.288   9.676   1.012   1.00 0.00 ? 64  SER A C    4  
ATOM 5363  O O    . SER A 1 64 ? 4.355   10.015  1.527   1.00 0.00 ? 64  SER A O    4  
ATOM 5364  C CB   . SER A 1 64 ? 2.246   11.916  0.604   1.00 0.00 ? 64  SER A CB   4  
ATOM 5365  O OG   . SER A 1 64 ? 3.012   12.735  1.473   1.00 0.00 ? 64  SER A OG   4  
ATOM 5366  H H    . SER A 1 64 ? 2.217   11.181  3.203   1.00 0.00 ? 64  SER A H    4  
ATOM 5367  H HA   . SER A 1 64 ? 1.212   10.041  0.684   1.00 0.00 ? 64  SER A HA   4  
ATOM 5368  H HB2  . SER A 1 64 ? 2.769   11.828  -0.338  1.00 0.00 ? 64  SER A HB2  4  
ATOM 5369  H HB3  . SER A 1 64 ? 1.288   12.385  0.439   1.00 0.00 ? 64  SER A HB3  4  
ATOM 5370  H HG   . SER A 1 64 ? 3.878   12.339  1.610   1.00 0.00 ? 64  SER A HG   4  
ATOM 5371  N N    . LEU A 1 65 ? 3.156   8.579   0.270   1.00 0.00 ? 65  LEU A N    4  
ATOM 5372  C CA   . LEU A 1 65 ? 4.287   7.688   0.011   1.00 0.00 ? 65  LEU A CA   4  
ATOM 5373  C C    . LEU A 1 65 ? 4.738   7.754   -1.452  1.00 0.00 ? 65  LEU A C    4  
ATOM 5374  O O    . LEU A 1 65 ? 5.782   7.200   -1.805  1.00 0.00 ? 65  LEU A O    4  
ATOM 5375  C CB   . LEU A 1 65 ? 3.928   6.247   0.376   1.00 0.00 ? 65  LEU A CB   4  
ATOM 5376  C CG   . LEU A 1 65 ? 3.277   6.066   1.747   1.00 0.00 ? 65  LEU A CG   4  
ATOM 5377  C CD1  . LEU A 1 65 ? 2.542   4.737   1.808   1.00 0.00 ? 65  LEU A CD1  4  
ATOM 5378  C CD2  . LEU A 1 65 ? 4.322   6.158   2.851   1.00 0.00 ? 65  LEU A CD2  4  
ATOM 5379  H H    . LEU A 1 65 ? 2.278   8.362   -0.114  1.00 0.00 ? 65  LEU A H    4  
ATOM 5380  H HA   . LEU A 1 65 ? 5.106   8.009   0.636   1.00 0.00 ? 65  LEU A HA   4  
ATOM 5381  H HB2  . LEU A 1 65 ? 3.250   5.865   -0.374  1.00 0.00 ? 65  LEU A HB2  4  
ATOM 5382  H HB3  . LEU A 1 65 ? 4.832   5.657   0.352   1.00 0.00 ? 65  LEU A HB3  4  
ATOM 5383  H HG   . LEU A 1 65 ? 2.553   6.854   1.903   1.00 0.00 ? 65  LEU A HG   4  
ATOM 5384  H HD11 . LEU A 1 65 ? 1.638   4.800   1.220   1.00 0.00 ? 65  LEU A HD11 4  
ATOM 5385  H HD12 . LEU A 1 65 ? 2.290   4.511   2.833   1.00 0.00 ? 65  LEU A HD12 4  
ATOM 5386  H HD13 . LEU A 1 65 ? 3.175   3.957   1.412   1.00 0.00 ? 65  LEU A HD13 4  
ATOM 5387  H HD21 . LEU A 1 65 ? 4.378   7.175   3.210   1.00 0.00 ? 65  LEU A HD21 4  
ATOM 5388  H HD22 . LEU A 1 65 ? 5.285   5.861   2.461   1.00 0.00 ? 65  LEU A HD22 4  
ATOM 5389  H HD23 . LEU A 1 65 ? 4.047   5.504   3.665   1.00 0.00 ? 65  LEU A HD23 4  
ATOM 5390  N N    . VAL A 1 66 ? 3.954   8.432   -2.300  1.00 0.00 ? 66  VAL A N    4  
ATOM 5391  C CA   . VAL A 1 66 ? 4.286   8.562   -3.714  1.00 0.00 ? 66  VAL A CA   4  
ATOM 5392  C C    . VAL A 1 66 ? 5.520   9.450   -3.902  1.00 0.00 ? 66  VAL A C    4  
ATOM 5393  O O    . VAL A 1 66 ? 5.420   10.656  -4.149  1.00 0.00 ? 66  VAL A O    4  
ATOM 5394  C CB   . VAL A 1 66 ? 3.094   9.124   -4.520  1.00 0.00 ? 66  VAL A CB   4  
ATOM 5395  C CG1  . VAL A 1 66 ? 2.698   10.496  -4.001  1.00 0.00 ? 66  VAL A CG1  4  
ATOM 5396  C CG2  . VAL A 1 66 ? 3.424   9.173   -6.005  1.00 0.00 ? 66  VAL A CG2  4  
ATOM 5397  H H    . VAL A 1 66 ? 3.136   8.852   -1.966  1.00 0.00 ? 66  VAL A H    4  
ATOM 5398  H HA   . VAL A 1 66 ? 4.511   7.573   -4.089  1.00 0.00 ? 66  VAL A HA   4  
ATOM 5399  H HB   . VAL A 1 66 ? 2.253   8.460   -4.384  1.00 0.00 ? 66  VAL A HB   4  
ATOM 5400  H HG11 . VAL A 1 66 ? 1.712   10.445  -3.566  1.00 0.00 ? 66  VAL A HG11 4  
ATOM 5401  H HG12 . VAL A 1 66 ? 2.698   11.204  -4.816  1.00 0.00 ? 66  VAL A HG12 4  
ATOM 5402  H HG13 . VAL A 1 66 ? 3.409   10.810  -3.250  1.00 0.00 ? 66  VAL A HG13 4  
ATOM 5403  H HG21 . VAL A 1 66 ? 2.652   9.718   -6.528  1.00 0.00 ? 66  VAL A HG21 4  
ATOM 5404  H HG22 . VAL A 1 66 ? 3.480   8.167   -6.394  1.00 0.00 ? 66  VAL A HG22 4  
ATOM 5405  H HG23 . VAL A 1 66 ? 4.373   9.667   -6.148  1.00 0.00 ? 66  VAL A HG23 4  
ATOM 5406  N N    . GLY A 1 67 ? 6.687   8.836   -3.763  1.00 0.00 ? 67  GLY A N    4  
ATOM 5407  C CA   . GLY A 1 67 ? 7.942   9.555   -3.899  1.00 0.00 ? 67  GLY A CA   4  
ATOM 5408  C C    . GLY A 1 67 ? 8.987   9.106   -2.889  1.00 0.00 ? 67  GLY A C    4  
ATOM 5409  O O    . GLY A 1 67 ? 10.186  9.270   -3.118  1.00 0.00 ? 67  GLY A O    4  
ATOM 5410  H H    . GLY A 1 67 ? 6.694   7.881   -3.554  1.00 0.00 ? 67  GLY A H    4  
ATOM 5411  H HA2  . GLY A 1 67 ? 8.328   9.395   -4.894  1.00 0.00 ? 67  GLY A HA2  4  
ATOM 5412  H HA3  . GLY A 1 67 ? 7.758   10.610  -3.761  1.00 0.00 ? 67  GLY A HA3  4  
ATOM 5413  N N    . LEU A 1 68 ? 8.531   8.536   -1.770  1.00 0.00 ? 68  LEU A N    4  
ATOM 5414  C CA   . LEU A 1 68 ? 9.431   8.062   -0.723  1.00 0.00 ? 68  LEU A CA   4  
ATOM 5415  C C    . LEU A 1 68 ? 9.976   6.671   -1.049  1.00 0.00 ? 68  LEU A C    4  
ATOM 5416  O O    . LEU A 1 68 ? 9.497   6.002   -1.968  1.00 0.00 ? 68  LEU A O    4  
ATOM 5417  C CB   . LEU A 1 68 ? 8.704   8.017   0.625   1.00 0.00 ? 68  LEU A CB   4  
ATOM 5418  C CG   . LEU A 1 68 ? 8.159   9.356   1.128   1.00 0.00 ? 68  LEU A CG   4  
ATOM 5419  C CD1  . LEU A 1 68 ? 7.428   9.165   2.450   1.00 0.00 ? 68  LEU A CD1  4  
ATOM 5420  C CD2  . LEU A 1 68 ? 9.284   10.371  1.279   1.00 0.00 ? 68  LEU A CD2  4  
ATOM 5421  H H    . LEU A 1 68 ? 7.564   8.432   -1.645  1.00 0.00 ? 68  LEU A H    4  
ATOM 5422  H HA   . LEU A 1 68 ? 10.255  8.755   -0.655  1.00 0.00 ? 68  LEU A HA   4  
ATOM 5423  H HB2  . LEU A 1 68 ? 7.877   7.328   0.539   1.00 0.00 ? 68  LEU A HB2  4  
ATOM 5424  H HB3  . LEU A 1 68 ? 9.392   7.636   1.364   1.00 0.00 ? 68  LEU A HB3  4  
ATOM 5425  H HG   . LEU A 1 68 ? 7.451   9.743   0.409   1.00 0.00 ? 68  LEU A HG   4  
ATOM 5426  H HD11 . LEU A 1 68 ? 6.383   8.971   2.259   1.00 0.00 ? 68  LEU A HD11 4  
ATOM 5427  H HD12 . LEU A 1 68 ? 7.524   10.059  3.048   1.00 0.00 ? 68  LEU A HD12 4  
ATOM 5428  H HD13 . LEU A 1 68 ? 7.858   8.329   2.982   1.00 0.00 ? 68  LEU A HD13 4  
ATOM 5429  H HD21 . LEU A 1 68 ? 10.136  9.898   1.746   1.00 0.00 ? 68  LEU A HD21 4  
ATOM 5430  H HD22 . LEU A 1 68 ? 8.947   11.193  1.893   1.00 0.00 ? 68  LEU A HD22 4  
ATOM 5431  H HD23 . LEU A 1 68 ? 9.568   10.742  0.305   1.00 0.00 ? 68  LEU A HD23 4  
ATOM 5432  N N    . SER A 1 69 ? 10.974  6.238   -0.278  1.00 0.00 ? 69  SER A N    4  
ATOM 5433  C CA   . SER A 1 69 ? 11.582  4.923   -0.468  1.00 0.00 ? 69  SER A CA   4  
ATOM 5434  C C    . SER A 1 69 ? 10.803  3.852   0.291   1.00 0.00 ? 69  SER A C    4  
ATOM 5435  O O    . SER A 1 69 ? 9.969   4.165   1.146   1.00 0.00 ? 69  SER A O    4  
ATOM 5436  C CB   . SER A 1 69 ? 13.040  4.933   0.002   1.00 0.00 ? 69  SER A CB   4  
ATOM 5437  O OG   . SER A 1 69 ? 13.777  5.964   -0.634  1.00 0.00 ? 69  SER A OG   4  
ATOM 5438  H H    . SER A 1 69 ? 11.303  6.814   0.442   1.00 0.00 ? 69  SER A H    4  
ATOM 5439  H HA   . SER A 1 69 ? 11.554  4.693   -1.522  1.00 0.00 ? 69  SER A HA   4  
ATOM 5440  H HB2  . SER A 1 69 ? 13.072  5.091   1.070   1.00 0.00 ? 69  SER A HB2  4  
ATOM 5441  H HB3  . SER A 1 69 ? 13.497  3.983   -0.234  1.00 0.00 ? 69  SER A HB3  4  
ATOM 5442  H HG   . SER A 1 69 ? 13.554  6.809   -0.239  1.00 0.00 ? 69  SER A HG   4  
ATOM 5443  N N    . GLN A 1 70 ? 11.083  2.586   -0.021  1.00 0.00 ? 70  GLN A N    4  
ATOM 5444  C CA   . GLN A 1 70 ? 10.412  1.462   0.633   1.00 0.00 ? 70  GLN A CA   4  
ATOM 5445  C C    . GLN A 1 70 ? 10.610  1.499   2.150   1.00 0.00 ? 70  GLN A C    4  
ATOM 5446  O O    . GLN A 1 70 ? 9.760   1.019   2.898   1.00 0.00 ? 70  GLN A O    4  
ATOM 5447  C CB   . GLN A 1 70 ? 10.929  0.133   0.076   1.00 0.00 ? 70  GLN A CB   4  
ATOM 5448  C CG   . GLN A 1 70 ? 10.177  -1.086  0.599   1.00 0.00 ? 70  GLN A CG   4  
ATOM 5449  C CD   . GLN A 1 70 ? 11.102  -2.219  1.007   1.00 0.00 ? 70  GLN A CD   4  
ATOM 5450  O OE1  . GLN A 1 70 ? 12.266  -1.998  1.352   1.00 0.00 ? 70  GLN A OE1  4  
ATOM 5451  N NE2  . GLN A 1 70 ? 10.591  -3.443  0.974   1.00 0.00 ? 70  GLN A NE2  4  
ATOM 5452  H H    . GLN A 1 70 ? 11.761  2.404   -0.707  1.00 0.00 ? 70  GLN A H    4  
ATOM 5453  H HA   . GLN A 1 70 ? 9.356   1.543   0.421   1.00 0.00 ? 70  GLN A HA   4  
ATOM 5454  H HB2  . GLN A 1 70 ? 10.840  0.150   -1.000  1.00 0.00 ? 70  GLN A HB2  4  
ATOM 5455  H HB3  . GLN A 1 70 ? 11.971  0.029   0.340   1.00 0.00 ? 70  GLN A HB3  4  
ATOM 5456  H HG2  . GLN A 1 70 ? 9.594   -0.796  1.457   1.00 0.00 ? 70  GLN A HG2  4  
ATOM 5457  H HG3  . GLN A 1 70 ? 9.515   -1.440  -0.175  1.00 0.00 ? 70  GLN A HG3  4  
ATOM 5458  H HE21 . GLN A 1 70 ? 9.658   -3.549  0.693   1.00 0.00 ? 70  GLN A HE21 4  
ATOM 5459  H HE22 . GLN A 1 70 ? 11.168  -4.190  1.232   1.00 0.00 ? 70  GLN A HE22 4  
ATOM 5460  N N    . GLU A 1 71 ? 11.730  2.070   2.598   1.00 0.00 ? 71  GLU A N    4  
ATOM 5461  C CA   . GLU A 1 71 ? 12.024  2.165   4.025   1.00 0.00 ? 71  GLU A CA   4  
ATOM 5462  C C    . GLU A 1 71 ? 11.008  3.059   4.728   1.00 0.00 ? 71  GLU A C    4  
ATOM 5463  O O    . GLU A 1 71 ? 10.467  2.694   5.770   1.00 0.00 ? 71  GLU A O    4  
ATOM 5464  C CB   . GLU A 1 71 ? 13.437  2.711   4.245   1.00 0.00 ? 71  GLU A CB   4  
ATOM 5465  C CG   . GLU A 1 71 ? 14.527  1.883   3.581   1.00 0.00 ? 71  GLU A CG   4  
ATOM 5466  C CD   . GLU A 1 71 ? 15.778  1.775   4.430   1.00 0.00 ? 71  GLU A CD   4  
ATOM 5467  O OE1  . GLU A 1 71 ? 15.760  1.015   5.421   1.00 0.00 ? 71  GLU A OE1  4  
ATOM 5468  O OE2  . GLU A 1 71 ? 16.777  2.451   4.105   1.00 0.00 ? 71  GLU A OE2  4  
ATOM 5469  H H    . GLU A 1 71 ? 12.370  2.439   1.955   1.00 0.00 ? 71  GLU A H    4  
ATOM 5470  H HA   . GLU A 1 71 ? 11.961  1.171   4.443   1.00 0.00 ? 71  GLU A HA   4  
ATOM 5471  H HB2  . GLU A 1 71 ? 13.488  3.714   3.850   1.00 0.00 ? 71  GLU A HB2  4  
ATOM 5472  H HB3  . GLU A 1 71 ? 13.635  2.741   5.307   1.00 0.00 ? 71  GLU A HB3  4  
ATOM 5473  H HG2  . GLU A 1 71 ? 14.147  0.889   3.399   1.00 0.00 ? 71  GLU A HG2  4  
ATOM 5474  H HG3  . GLU A 1 71 ? 14.787  2.345   2.639   1.00 0.00 ? 71  GLU A HG3  4  
ATOM 5475  N N    . ARG A 1 72 ? 10.750  4.228   4.144   1.00 0.00 ? 72  ARG A N    4  
ATOM 5476  C CA   . ARG A 1 72 ? 9.795   5.173   4.713   1.00 0.00 ? 72  ARG A CA   4  
ATOM 5477  C C    . ARG A 1 72 ? 8.383   4.597   4.693   1.00 0.00 ? 72  ARG A C    4  
ATOM 5478  O O    . ARG A 1 72 ? 7.717   4.538   5.728   1.00 0.00 ? 72  ARG A O    4  
ATOM 5479  C CB   . ARG A 1 72 ? 9.836   6.499   3.948   1.00 0.00 ? 72  ARG A CB   4  
ATOM 5480  C CG   . ARG A 1 72 ? 10.560  7.606   4.695   1.00 0.00 ? 72  ARG A CG   4  
ATOM 5481  C CD   . ARG A 1 72 ? 12.005  7.233   4.996   1.00 0.00 ? 72  ARG A CD   4  
ATOM 5482  N NE   . ARG A 1 72 ? 12.922  8.341   4.735   1.00 0.00 ? 72  ARG A NE   4  
ATOM 5483  C CZ   . ARG A 1 72 ? 13.337  8.695   3.515   1.00 0.00 ? 72  ARG A CZ   4  
ATOM 5484  N NH1  . ARG A 1 72 ? 12.921  8.027   2.440   1.00 0.00 ? 72  ARG A NH1  4  
ATOM 5485  N NH2  . ARG A 1 72 ? 14.170  9.719   3.371   1.00 0.00 ? 72  ARG A NH2  4  
ATOM 5486  H H    . ARG A 1 72 ? 11.210  4.458   3.310   1.00 0.00 ? 72  ARG A H    4  
ATOM 5487  H HA   . ARG A 1 72 ? 10.081  5.349   5.739   1.00 0.00 ? 72  ARG A HA   4  
ATOM 5488  H HB2  . ARG A 1 72 ? 10.339  6.343   3.005   1.00 0.00 ? 72  ARG A HB2  4  
ATOM 5489  H HB3  . ARG A 1 72 ? 8.825   6.824   3.757   1.00 0.00 ? 72  ARG A HB3  4  
ATOM 5490  H HG2  . ARG A 1 72 ? 10.550  8.500   4.090   1.00 0.00 ? 72  ARG A HG2  4  
ATOM 5491  H HG3  . ARG A 1 72 ? 10.046  7.794   5.625   1.00 0.00 ? 72  ARG A HG3  4  
ATOM 5492  H HD2  . ARG A 1 72 ? 12.082  6.952   6.037   1.00 0.00 ? 72  ARG A HD2  4  
ATOM 5493  H HD3  . ARG A 1 72 ? 12.284  6.393   4.377   1.00 0.00 ? 72  ARG A HD3  4  
ATOM 5494  H HE   . ARG A 1 72 ? 13.244  8.850   5.508   1.00 0.00 ? 72  ARG A HE   4  
ATOM 5495  H HH11 . ARG A 1 72 ? 12.294  7.254   2.541   1.00 0.00 ? 72  ARG A HH11 4  
ATOM 5496  H HH12 . ARG A 1 72 ? 13.235  8.298   1.531   1.00 0.00 ? 72  ARG A HH12 4  
ATOM 5497  H HH21 . ARG A 1 72 ? 14.485  10.225  4.174   1.00 0.00 ? 72  ARG A HH21 4  
ATOM 5498  H HH22 . ARG A 1 72 ? 14.482  9.986   2.459   1.00 0.00 ? 72  ARG A HH22 4  
ATOM 5499  N N    . ALA A 1 73 ? 7.935   4.163   3.514   1.00 0.00 ? 73  ALA A N    4  
ATOM 5500  C CA   . ALA A 1 73 ? 6.602   3.582   3.371   1.00 0.00 ? 73  ALA A CA   4  
ATOM 5501  C C    . ALA A 1 73 ? 6.431   2.385   4.301   1.00 0.00 ? 73  ALA A C    4  
ATOM 5502  O O    . ALA A 1 73 ? 5.459   2.312   5.053   1.00 0.00 ? 73  ALA A O    4  
ATOM 5503  C CB   . ALA A 1 73 ? 6.344   3.178   1.927   1.00 0.00 ? 73  ALA A CB   4  
ATOM 5504  H H    . ALA A 1 73 ? 8.517   4.228   2.727   1.00 0.00 ? 73  ALA A H    4  
ATOM 5505  H HA   . ALA A 1 73 ? 5.881   4.339   3.645   1.00 0.00 ? 73  ALA A HA   4  
ATOM 5506  H HB1  . ALA A 1 73 ? 6.913   2.289   1.695   1.00 0.00 ? 73  ALA A HB1  4  
ATOM 5507  H HB2  . ALA A 1 73 ? 6.645   3.979   1.268   1.00 0.00 ? 73  ALA A HB2  4  
ATOM 5508  H HB3  . ALA A 1 73 ? 5.291   2.977   1.792   1.00 0.00 ? 73  ALA A HB3  4  
ATOM 5509  N N    . ALA A 1 74 ? 7.388   1.456   4.255   1.00 0.00 ? 74  ALA A N    4  
ATOM 5510  C CA   . ALA A 1 74 ? 7.345   0.271   5.107   1.00 0.00 ? 74  ALA A CA   4  
ATOM 5511  C C    . ALA A 1 74 ? 7.256   0.663   6.581   1.00 0.00 ? 74  ALA A C    4  
ATOM 5512  O O    . ALA A 1 74 ? 6.271   0.357   7.244   1.00 0.00 ? 74  ALA A O    4  
ATOM 5513  C CB   . ALA A 1 74 ? 8.569   -0.604  4.872   1.00 0.00 ? 74  ALA A CB   4  
ATOM 5514  H H    . ALA A 1 74 ? 8.145   1.574   3.637   1.00 0.00 ? 74  ALA A H    4  
ATOM 5515  H HA   . ALA A 1 74 ? 6.465   -0.297  4.842   1.00 0.00 ? 74  ALA A HA   4  
ATOM 5516  H HB1  . ALA A 1 74 ? 9.464   -0.006  4.971   1.00 0.00 ? 74  ALA A HB1  4  
ATOM 5517  H HB2  . ALA A 1 74 ? 8.528   -1.025  3.881   1.00 0.00 ? 74  ALA A HB2  4  
ATOM 5518  H HB3  . ALA A 1 74 ? 8.588   -1.400  5.601   1.00 0.00 ? 74  ALA A HB3  4  
ATOM 5519  N N    . GLU A 1 75 ? 8.295   1.342   7.076   1.00 0.00 ? 75  GLU A N    4  
ATOM 5520  C CA   . GLU A 1 75 ? 8.356   1.785   8.473   1.00 0.00 ? 75  GLU A CA   4  
ATOM 5521  C C    . GLU A 1 75 ? 7.050   2.441   8.927   1.00 0.00 ? 75  GLU A C    4  
ATOM 5522  O O    . GLU A 1 75 ? 6.527   2.118   9.995   1.00 0.00 ? 75  GLU A O    4  
ATOM 5523  C CB   . GLU A 1 75 ? 9.515   2.761   8.673   1.00 0.00 ? 75  GLU A CB   4  
ATOM 5524  C CG   . GLU A 1 75 ? 10.856  2.077   8.870   1.00 0.00 ? 75  GLU A CG   4  
ATOM 5525  C CD   . GLU A 1 75 ? 10.962  1.383   10.214  1.00 0.00 ? 75  GLU A CD   4  
ATOM 5526  O OE1  . GLU A 1 75 ? 10.479  0.236   10.329  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 5527  O OE2  . GLU A 1 75 ? 11.522  1.987   11.152  1.00 0.00 ? 75  GLU A OE2  4  
ATOM 5528  H H    . GLU A 1 75 ? 9.047   1.550   6.484   1.00 0.00 ? 75  GLU A H    4  
ATOM 5529  H HA   . GLU A 1 75 ? 8.532   0.913   9.081   1.00 0.00 ? 75  GLU A HA   4  
ATOM 5530  H HB2  . GLU A 1 75 ? 9.585   3.401   7.807   1.00 0.00 ? 75  GLU A HB2  4  
ATOM 5531  H HB3  . GLU A 1 75 ? 9.315   3.368   9.543   1.00 0.00 ? 75  GLU A HB3  4  
ATOM 5532  H HG2  . GLU A 1 75 ? 10.989  1.342   8.090   1.00 0.00 ? 75  GLU A HG2  4  
ATOM 5533  H HG3  . GLU A 1 75 ? 11.637  2.821   8.801   1.00 0.00 ? 75  GLU A HG3  4  
ATOM 5534  N N    . LEU A 1 76 ? 6.533   3.364   8.120   1.00 0.00 ? 76  LEU A N    4  
ATOM 5535  C CA   . LEU A 1 76 ? 5.291   4.061   8.449   1.00 0.00 ? 76  LEU A CA   4  
ATOM 5536  C C    . LEU A 1 76 ? 4.085   3.117   8.399   1.00 0.00 ? 76  LEU A C    4  
ATOM 5537  O O    . LEU A 1 76 ? 3.093   3.334   9.096   1.00 0.00 ? 76  LEU A O    4  
ATOM 5538  C CB   . LEU A 1 76 ? 5.083   5.238   7.491   1.00 0.00 ? 76  LEU A CB   4  
ATOM 5539  C CG   . LEU A 1 76 ? 6.009   6.437   7.720   1.00 0.00 ? 76  LEU A CG   4  
ATOM 5540  C CD1  . LEU A 1 76 ? 5.642   7.578   6.783   1.00 0.00 ? 76  LEU A CD1  4  
ATOM 5541  C CD2  . LEU A 1 76 ? 5.946   6.894   9.171   1.00 0.00 ? 76  LEU A CD2  4  
ATOM 5542  H H    . LEU A 1 76 ? 6.998   3.584   7.282   1.00 0.00 ? 76  LEU A H    4  
ATOM 5543  H HA   . LEU A 1 76 ? 5.387   4.444   9.456   1.00 0.00 ? 76  LEU A HA   4  
ATOM 5544  H HB2  . LEU A 1 76 ? 5.237   4.882   6.483   1.00 0.00 ? 76  LEU A HB2  4  
ATOM 5545  H HB3  . LEU A 1 76 ? 4.063   5.577   7.582   1.00 0.00 ? 76  LEU A HB3  4  
ATOM 5546  H HG   . LEU A 1 76 ? 7.028   6.145   7.505   1.00 0.00 ? 76  LEU A HG   4  
ATOM 5547  H HD11 . LEU A 1 76 ? 5.751   7.251   5.759   1.00 0.00 ? 76  LEU A HD11 4  
ATOM 5548  H HD12 . LEU A 1 76 ? 6.295   8.419   6.963   1.00 0.00 ? 76  LEU A HD12 4  
ATOM 5549  H HD13 . LEU A 1 76 ? 4.618   7.873   6.958   1.00 0.00 ? 76  LEU A HD13 4  
ATOM 5550  H HD21 . LEU A 1 76 ? 4.914   6.958   9.483   1.00 0.00 ? 76  LEU A HD21 4  
ATOM 5551  H HD22 . LEU A 1 76 ? 6.412   7.863   9.267   1.00 0.00 ? 76  LEU A HD22 4  
ATOM 5552  H HD23 . LEU A 1 76 ? 6.467   6.182   9.794   1.00 0.00 ? 76  LEU A HD23 4  
ATOM 5553  N N    . MET A 1 77 ? 4.175   2.073   7.573   1.00 0.00 ? 77  MET A N    4  
ATOM 5554  C CA   . MET A 1 77 ? 3.092   1.101   7.435   1.00 0.00 ? 77  MET A CA   4  
ATOM 5555  C C    . MET A 1 77 ? 3.179   -0.010  8.486   1.00 0.00 ? 77  MET A C    4  
ATOM 5556  O O    . MET A 1 77 ? 2.186   -0.688  8.754   1.00 0.00 ? 77  MET A O    4  
ATOM 5557  C CB   . MET A 1 77 ? 3.110   0.490   6.034   1.00 0.00 ? 77  MET A CB   4  
ATOM 5558  C CG   . MET A 1 77 ? 2.452   1.366   4.980   1.00 0.00 ? 77  MET A CG   4  
ATOM 5559  S SD   . MET A 1 77 ? 2.402   0.581   3.357   1.00 0.00 ? 77  MET A SD   4  
ATOM 5560  C CE   . MET A 1 77 ? 1.234   -0.745  3.653   1.00 0.00 ? 77  MET A CE   4  
ATOM 5561  H H    . MET A 1 77 ? 4.991   1.952   7.042   1.00 0.00 ? 77  MET A H    4  
ATOM 5562  H HA   . MET A 1 77 ? 2.161   1.628   7.572   1.00 0.00 ? 77  MET A HA   4  
ATOM 5563  H HB2  . MET A 1 77 ? 4.136   0.320   5.740   1.00 0.00 ? 77  MET A HB2  4  
ATOM 5564  H HB3  . MET A 1 77 ? 2.591   -0.457  6.060   1.00 0.00 ? 77  MET A HB3  4  
ATOM 5565  H HG2  . MET A 1 77 ? 1.441   1.583   5.291   1.00 0.00 ? 77  MET A HG2  4  
ATOM 5566  H HG3  . MET A 1 77 ? 3.009   2.288   4.900   1.00 0.00 ? 77  MET A HG3  4  
ATOM 5567  H HE1  . MET A 1 77 ? 1.391   -1.150  4.641   1.00 0.00 ? 77  MET A HE1  4  
ATOM 5568  H HE2  . MET A 1 77 ? 1.380   -1.524  2.918   1.00 0.00 ? 77  MET A HE2  4  
ATOM 5569  H HE3  . MET A 1 77 ? 0.229   -0.363  3.577   1.00 0.00 ? 77  MET A HE3  4  
ATOM 5570  N N    . THR A 1 78 ? 4.360   -0.200  9.076   1.00 0.00 ? 78  THR A N    4  
ATOM 5571  C CA   . THR A 1 78 ? 4.557   -1.223  10.084  1.00 0.00 ? 78  THR A CA   4  
ATOM 5572  C C    . THR A 1 78 ? 3.880   -0.825  11.393  1.00 0.00 ? 78  THR A C    4  
ATOM 5573  O O    . THR A 1 78 ? 3.233   -1.646  12.043  1.00 0.00 ? 78  THR A O    4  
ATOM 5574  C CB   . THR A 1 78 ? 6.053   -1.438  10.318  1.00 0.00 ? 78  THR A CB   4  
ATOM 5575  O OG1  . THR A 1 78 ? 6.828   -0.525  9.568   1.00 0.00 ? 78  THR A OG1  4  
ATOM 5576  C CG2  . THR A 1 78 ? 6.532   -2.823  9.961   1.00 0.00 ? 78  THR A CG2  4  
ATOM 5577  H H    . THR A 1 78 ? 5.125   0.360   8.833   1.00 0.00 ? 78  THR A H    4  
ATOM 5578  H HA   . THR A 1 78 ? 4.116   -2.141  9.723   1.00 0.00 ? 78  THR A HA   4  
ATOM 5579  H HB   . THR A 1 78 ? 6.261   -1.267  11.355  1.00 0.00 ? 78  THR A HB   4  
ATOM 5580  H HG1  . THR A 1 78 ? 7.164   0.158   10.150  1.00 0.00 ? 78  THR A HG1  4  
ATOM 5581  H HG21 . THR A 1 78 ? 7.431   -2.745  9.366   1.00 0.00 ? 78  THR A HG21 4  
ATOM 5582  H HG22 . THR A 1 78 ? 5.768   -3.333  9.393   1.00 0.00 ? 78  THR A HG22 4  
ATOM 5583  H HG23 . THR A 1 78 ? 6.743   -3.376  10.863  1.00 0.00 ? 78  THR A HG23 4  
ATOM 5584  N N    . ARG A 1 79 ? 4.041   0.443   11.773  1.00 0.00 ? 79  ARG A N    4  
ATOM 5585  C CA   . ARG A 1 79 ? 3.455   0.959   13.005  1.00 0.00 ? 79  ARG A CA   4  
ATOM 5586  C C    . ARG A 1 79 ? 2.113   1.640   12.729  1.00 0.00 ? 79  ARG A C    4  
ATOM 5587  O O    . ARG A 1 79 ? 1.971   2.852   12.907  1.00 0.00 ? 79  ARG A O    4  
ATOM 5588  C CB   . ARG A 1 79 ? 4.421   1.946   13.670  1.00 0.00 ? 79  ARG A CB   4  
ATOM 5589  C CG   . ARG A 1 79 ? 5.828   1.397   13.851  1.00 0.00 ? 79  ARG A CG   4  
ATOM 5590  C CD   . ARG A 1 79 ? 6.856   2.515   13.940  1.00 0.00 ? 79  ARG A CD   4  
ATOM 5591  N NE   . ARG A 1 79 ? 7.092   3.155   12.645  1.00 0.00 ? 79  ARG A NE   4  
ATOM 5592  C CZ   . ARG A 1 79 ? 7.651   4.360   12.500  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 5593  N NH1  . ARG A 1 79 ? 8.038   5.056   13.565  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 5594  N NH2  . ARG A 1 79 ? 7.826   4.870   11.287  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 5595  H H    . ARG A 1 79 ? 4.572   1.047   11.211  1.00 0.00 ? 79  ARG A H    4  
ATOM 5596  H HA   . ARG A 1 79 ? 3.293   0.124   13.671  1.00 0.00 ? 79  ARG A HA   4  
ATOM 5597  H HB2  . ARG A 1 79 ? 4.481   2.836   13.062  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 5598  H HB3  . ARG A 1 79 ? 4.032   2.211   14.643  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 5599  H HG2  . ARG A 1 79 ? 5.864   0.814   14.759  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 5600  H HG3  . ARG A 1 79 ? 6.070   0.766   13.008  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 5601  H HD2  . ARG A 1 79 ? 6.498   3.257   14.637  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 5602  H HD3  . ARG A 1 79 ? 7.785   2.102   14.301  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 5603  H HE   . ARG A 1 79 ? 6.819   2.663   11.840  1.00 0.00 ? 79  ARG A HE   4  
ATOM 5604  H HH11 . ARG A 1 79 ? 7.911   4.682   14.482  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 5605  H HH12 . ARG A 1 79 ? 8.456   5.957   13.448  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 5606  H HH21 . ARG A 1 79 ? 7.538   4.355   10.481  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 5607  H HH22 . ARG A 1 79 ? 8.245   5.772   11.179  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 5608  N N    . THR A 1 80 ? 1.127   0.855   12.293  1.00 0.00 ? 80  THR A N    4  
ATOM 5609  C CA   . THR A 1 80 ? -0.201  1.390   11.994  1.00 0.00 ? 80  THR A CA   4  
ATOM 5610  C C    . THR A 1 80 ? -1.050  1.490   13.259  1.00 0.00 ? 80  THR A C    4  
ATOM 5611  O O    . THR A 1 80 ? -0.921  0.672   14.172  1.00 0.00 ? 80  THR A O    4  
ATOM 5612  C CB   . THR A 1 80 ? -0.917  0.517   10.958  1.00 0.00 ? 80  THR A CB   4  
ATOM 5613  O OG1  . THR A 1 80 ? -0.631  -0.856  11.168  1.00 0.00 ? 80  THR A OG1  4  
ATOM 5614  C CG2  . THR A 1 80 ? -0.541  0.852   9.530   1.00 0.00 ? 80  THR A CG2  4  
ATOM 5615  H H    . THR A 1 80 ? 1.294   -0.104  12.168  1.00 0.00 ? 80  THR A H    4  
ATOM 5616  H HA   . THR A 1 80 ? -0.071  2.382   11.585  1.00 0.00 ? 80  THR A HA   4  
ATOM 5617  H HB   . THR A 1 80 ? -1.984  0.660   11.061  1.00 0.00 ? 80  THR A HB   4  
ATOM 5618  H HG1  . THR A 1 80 ? -1.102  -1.166  11.945  1.00 0.00 ? 80  THR A HG1  4  
ATOM 5619  H HG21 . THR A 1 80 ? -1.383  1.311   9.034   1.00 0.00 ? 80  THR A HG21 4  
ATOM 5620  H HG22 . THR A 1 80 ? -0.264  -0.052  9.009   1.00 0.00 ? 80  THR A HG22 4  
ATOM 5621  H HG23 . THR A 1 80 ? 0.294   1.537   9.528   1.00 0.00 ? 80  THR A HG23 4  
ATOM 5622  N N    . SER A 1 81 ? -1.923  2.495   13.303  1.00 0.00 ? 81  SER A N    4  
ATOM 5623  C CA   . SER A 1 81 ? -2.799  2.701   14.452  1.00 0.00 ? 81  SER A CA   4  
ATOM 5624  C C    . SER A 1 81 ? -4.057  1.837   14.337  1.00 0.00 ? 81  SER A C    4  
ATOM 5625  O O    . SER A 1 81 ? -4.127  0.935   13.498  1.00 0.00 ? 81  SER A O    4  
ATOM 5626  C CB   . SER A 1 81 ? -3.175  4.184   14.570  1.00 0.00 ? 81  SER A CB   4  
ATOM 5627  O OG   . SER A 1 81 ? -2.894  4.681   15.868  1.00 0.00 ? 81  SER A OG   4  
ATOM 5628  H H    . SER A 1 81 ? -1.983  3.111   12.542  1.00 0.00 ? 81  SER A H    4  
ATOM 5629  H HA   . SER A 1 81 ? -2.255  2.406   15.338  1.00 0.00 ? 81  SER A HA   4  
ATOM 5630  H HB2  . SER A 1 81 ? -2.607  4.756   13.850  1.00 0.00 ? 81  SER A HB2  4  
ATOM 5631  H HB3  . SER A 1 81 ? -4.230  4.304   14.371  1.00 0.00 ? 81  SER A HB3  4  
ATOM 5632  H HG   . SER A 1 81 ? -3.382  4.173   16.520  1.00 0.00 ? 81  SER A HG   4  
ATOM 5633  N N    . SER A 1 82 ? -5.050  2.119   15.183  1.00 0.00 ? 82  SER A N    4  
ATOM 5634  C CA   . SER A 1 82 ? -6.307  1.373   15.174  1.00 0.00 ? 82  SER A CA   4  
ATOM 5635  C C    . SER A 1 82 ? -6.960  1.420   13.792  1.00 0.00 ? 82  SER A C    4  
ATOM 5636  O O    . SER A 1 82 ? -7.437  0.403   13.289  1.00 0.00 ? 82  SER A O    4  
ATOM 5637  C CB   . SER A 1 82 ? -7.267  1.932   16.228  1.00 0.00 ? 82  SER A CB   4  
ATOM 5638  O OG   . SER A 1 82 ? -7.142  1.232   17.453  1.00 0.00 ? 82  SER A OG   4  
ATOM 5639  H H    . SER A 1 82 ? -4.936  2.849   15.826  1.00 0.00 ? 82  SER A H    4  
ATOM 5640  H HA   . SER A 1 82 ? -6.083  0.344   15.416  1.00 0.00 ? 82  SER A HA   4  
ATOM 5641  H HB2  . SER A 1 82 ? -7.042  2.975   16.400  1.00 0.00 ? 82  SER A HB2  4  
ATOM 5642  H HB3  . SER A 1 82 ? -8.283  1.837   15.873  1.00 0.00 ? 82  SER A HB3  4  
ATOM 5643  H HG   . SER A 1 82 ? -6.245  1.321   17.784  1.00 0.00 ? 82  SER A HG   4  
ATOM 5644  N N    . VAL A 1 83 ? -6.969  2.607   13.181  1.00 0.00 ? 83  VAL A N    4  
ATOM 5645  C CA   . VAL A 1 83 ? -7.553  2.780   11.855  1.00 0.00 ? 83  VAL A CA   4  
ATOM 5646  C C    . VAL A 1 83 ? -6.469  2.795   10.780  1.00 0.00 ? 83  VAL A C    4  
ATOM 5647  O O    . VAL A 1 83 ? -5.370  3.307   11.003  1.00 0.00 ? 83  VAL A O    4  
ATOM 5648  C CB   . VAL A 1 83 ? -8.377  4.084   11.753  1.00 0.00 ? 83  VAL A CB   4  
ATOM 5649  C CG1  . VAL A 1 83 ? -9.136  4.136   10.434  1.00 0.00 ? 83  VAL A CG1  4  
ATOM 5650  C CG2  . VAL A 1 83 ? -9.336  4.210   12.929  1.00 0.00 ? 83  VAL A CG2  4  
ATOM 5651  H H    . VAL A 1 83 ? -6.568  3.380   13.632  1.00 0.00 ? 83  VAL A H    4  
ATOM 5652  H HA   . VAL A 1 83 ? -8.215  1.946   11.672  1.00 0.00 ? 83  VAL A HA   4  
ATOM 5653  H HB   . VAL A 1 83 ? -7.694  4.921   11.782  1.00 0.00 ? 83  VAL A HB   4  
ATOM 5654  H HG11 . VAL A 1 83 ? -9.818  4.974   10.442  1.00 0.00 ? 83  VAL A HG11 4  
ATOM 5655  H HG12 . VAL A 1 83 ? -9.693  3.220   10.301  1.00 0.00 ? 83  VAL A HG12 4  
ATOM 5656  H HG13 . VAL A 1 83 ? -8.435  4.252   9.619   1.00 0.00 ? 83  VAL A HG13 4  
ATOM 5657  H HG21 . VAL A 1 83 ? -9.783  5.193   12.923  1.00 0.00 ? 83  VAL A HG21 4  
ATOM 5658  H HG22 . VAL A 1 83 ? -8.795  4.066   13.852  1.00 0.00 ? 83  VAL A HG22 4  
ATOM 5659  H HG23 . VAL A 1 83 ? -10.110 3.462   12.843  1.00 0.00 ? 83  VAL A HG23 4  
ATOM 5660  N N    . VAL A 1 84 ? -6.788  2.232   9.617   1.00 0.00 ? 84  VAL A N    4  
ATOM 5661  C CA   . VAL A 1 84 ? -5.847  2.181   8.503   1.00 0.00 ? 84  VAL A CA   4  
ATOM 5662  C C    . VAL A 1 84 ? -6.547  2.503   7.188   1.00 0.00 ? 84  VAL A C    4  
ATOM 5663  O O    . VAL A 1 84 ? -7.404  1.746   6.732   1.00 0.00 ? 84  VAL A O    4  
ATOM 5664  C CB   . VAL A 1 84 ? -5.167  0.800   8.386   1.00 0.00 ? 84  VAL A CB   4  
ATOM 5665  C CG1  . VAL A 1 84 ? -4.033  0.850   7.371   1.00 0.00 ? 84  VAL A CG1  4  
ATOM 5666  C CG2  . VAL A 1 84 ? -4.655  0.335   9.743   1.00 0.00 ? 84  VAL A CG2  4  
ATOM 5667  H H    . VAL A 1 84 ? -7.681  1.841   9.503   1.00 0.00 ? 84  VAL A H    4  
ATOM 5668  H HA   . VAL A 1 84 ? -5.082  2.922   8.682   1.00 0.00 ? 84  VAL A HA   4  
ATOM 5669  H HB   . VAL A 1 84 ? -5.901  0.088   8.037   1.00 0.00 ? 84  VAL A HB   4  
ATOM 5670  H HG11 . VAL A 1 84 ? -3.164  1.304   7.825   1.00 0.00 ? 84  VAL A HG11 4  
ATOM 5671  H HG12 . VAL A 1 84 ? -4.339  1.435   6.516   1.00 0.00 ? 84  VAL A HG12 4  
ATOM 5672  H HG13 . VAL A 1 84 ? -3.791  -0.153  7.053   1.00 0.00 ? 84  VAL A HG13 4  
ATOM 5673  H HG21 . VAL A 1 84 ? -3.966  -0.485  9.606   1.00 0.00 ? 84  VAL A HG21 4  
ATOM 5674  H HG22 . VAL A 1 84 ? -5.488  0.008   10.349  1.00 0.00 ? 84  VAL A HG22 4  
ATOM 5675  H HG23 . VAL A 1 84 ? -4.150  1.152   10.237  1.00 0.00 ? 84  VAL A HG23 4  
ATOM 5676  N N    . THR A 1 85 ? -6.178  3.633   6.586   1.00 0.00 ? 85  THR A N    4  
ATOM 5677  C CA   . THR A 1 85 ? -6.771  4.062   5.323   1.00 0.00 ? 85  THR A CA   4  
ATOM 5678  C C    . THR A 1 85 ? -5.748  3.979   4.192   1.00 0.00 ? 85  THR A C    4  
ATOM 5679  O O    . THR A 1 85 ? -5.060  4.957   3.887   1.00 0.00 ? 85  THR A O    4  
ATOM 5680  C CB   . THR A 1 85 ? -7.320  5.489   5.442   1.00 0.00 ? 85  THR A CB   4  
ATOM 5681  O OG1  . THR A 1 85 ? -7.604  5.817   6.793   1.00 0.00 ? 85  THR A OG1  4  
ATOM 5682  C CG2  . THR A 1 85 ? -8.590  5.704   4.646   1.00 0.00 ? 85  THR A CG2  4  
ATOM 5683  H H    . THR A 1 85 ? -5.493  4.195   7.005   1.00 0.00 ? 85  THR A H    4  
ATOM 5684  H HA   . THR A 1 85 ? -7.587  3.391   5.099   1.00 0.00 ? 85  THR A HA   4  
ATOM 5685  H HB   . THR A 1 85 ? -6.578  6.183   5.072   1.00 0.00 ? 85  THR A HB   4  
ATOM 5686  H HG1  . THR A 1 85 ? -6.786  6.033   7.252   1.00 0.00 ? 85  THR A HG1  4  
ATOM 5687  H HG21 . THR A 1 85 ? -8.705  4.903   3.930   1.00 0.00 ? 85  THR A HG21 4  
ATOM 5688  H HG22 . THR A 1 85 ? -8.532  6.647   4.124   1.00 0.00 ? 85  THR A HG22 4  
ATOM 5689  H HG23 . THR A 1 85 ? -9.437  5.713   5.315   1.00 0.00 ? 85  THR A HG23 4  
ATOM 5690  N N    . LEU A 1 86 ? -5.648  2.800   3.579   1.00 0.00 ? 86  LEU A N    4  
ATOM 5691  C CA   . LEU A 1 86 ? -4.705  2.575   2.485   1.00 0.00 ? 86  LEU A CA   4  
ATOM 5692  C C    . LEU A 1 86 ? -5.369  2.792   1.127   1.00 0.00 ? 86  LEU A C    4  
ATOM 5693  O O    . LEU A 1 86 ? -6.381  2.161   0.813   1.00 0.00 ? 86  LEU A O    4  
ATOM 5694  C CB   . LEU A 1 86 ? -4.140  1.154   2.558   1.00 0.00 ? 86  LEU A CB   4  
ATOM 5695  C CG   . LEU A 1 86 ? -3.065  0.935   3.626   1.00 0.00 ? 86  LEU A CG   4  
ATOM 5696  C CD1  . LEU A 1 86 ? -3.345  -0.337  4.414   1.00 0.00 ? 86  LEU A CD1  4  
ATOM 5697  C CD2  . LEU A 1 86 ? -1.685  0.879   2.987   1.00 0.00 ? 86  LEU A CD2  4  
ATOM 5698  H H    . LEU A 1 86 ? -6.220  2.059   3.874   1.00 0.00 ? 86  LEU A H    4  
ATOM 5699  H HA   . LEU A 1 86 ? -3.895  3.280   2.594   1.00 0.00 ? 86  LEU A HA   4  
ATOM 5700  H HB2  . LEU A 1 86 ? -4.957  0.474   2.753   1.00 0.00 ? 86  LEU A HB2  4  
ATOM 5701  H HB3  . LEU A 1 86 ? -3.715  0.910   1.596   1.00 0.00 ? 86  LEU A HB3  4  
ATOM 5702  H HG   . LEU A 1 86 ? -3.081  1.764   4.318   1.00 0.00 ? 86  LEU A HG   4  
ATOM 5703  H HD11 . LEU A 1 86 ? -3.449  -1.169  3.732   1.00 0.00 ? 86  LEU A HD11 4  
ATOM 5704  H HD12 . LEU A 1 86 ? -4.259  -0.217  4.977   1.00 0.00 ? 86  LEU A HD12 4  
ATOM 5705  H HD13 . LEU A 1 86 ? -2.527  -0.528  5.093   1.00 0.00 ? 86  LEU A HD13 4  
ATOM 5706  H HD21 . LEU A 1 86 ? -1.450  -0.142  2.725   1.00 0.00 ? 86  LEU A HD21 4  
ATOM 5707  H HD22 . LEU A 1 86 ? -0.950  1.249   3.687   1.00 0.00 ? 86  LEU A HD22 4  
ATOM 5708  H HD23 . LEU A 1 86 ? -1.674  1.490   2.097   1.00 0.00 ? 86  LEU A HD23 4  
ATOM 5709  N N    . GLU A 1 87 ? -4.784  3.679   0.322   1.00 0.00 ? 87  GLU A N    4  
ATOM 5710  C CA   . GLU A 1 87 ? -5.306  3.973   -1.010  1.00 0.00 ? 87  GLU A CA   4  
ATOM 5711  C C    . GLU A 1 87 ? -4.524  3.200   -2.067  1.00 0.00 ? 87  GLU A C    4  
ATOM 5712  O O    . GLU A 1 87 ? -3.304  3.345   -2.179  1.00 0.00 ? 87  GLU A O    4  
ATOM 5713  C CB   . GLU A 1 87 ? -5.236  5.476   -1.294  1.00 0.00 ? 87  GLU A CB   4  
ATOM 5714  C CG   . GLU A 1 87 ? -5.806  5.880   -2.645  1.00 0.00 ? 87  GLU A CG   4  
ATOM 5715  C CD   . GLU A 1 87 ? -5.695  7.372   -2.896  1.00 0.00 ? 87  GLU A CD   4  
ATOM 5716  O OE1  . GLU A 1 87 ? -4.629  7.816   -3.369  1.00 0.00 ? 87  GLU A OE1  4  
ATOM 5717  O OE2  . GLU A 1 87 ? -6.673  8.097   -2.618  1.00 0.00 ? 87  GLU A OE2  4  
ATOM 5718  H H    . GLU A 1 87 ? -3.974  4.141   0.628   1.00 0.00 ? 87  GLU A H    4  
ATOM 5719  H HA   . GLU A 1 87 ? -6.338  3.656   -1.039  1.00 0.00 ? 87  GLU A HA   4  
ATOM 5720  H HB2  . GLU A 1 87 ? -5.787  5.998   -0.529  1.00 0.00 ? 87  GLU A HB2  4  
ATOM 5721  H HB3  . GLU A 1 87 ? -4.204  5.789   -1.256  1.00 0.00 ? 87  GLU A HB3  4  
ATOM 5722  H HG2  . GLU A 1 87 ? -5.268  5.358   -3.421  1.00 0.00 ? 87  GLU A HG2  4  
ATOM 5723  H HG3  . GLU A 1 87 ? -6.849  5.601   -2.682  1.00 0.00 ? 87  GLU A HG3  4  
ATOM 5724  N N    . VAL A 1 88 ? -5.233  2.376   -2.834  1.00 0.00 ? 88  VAL A N    4  
ATOM 5725  C CA   . VAL A 1 88 ? -4.603  1.572   -3.876  1.00 0.00 ? 88  VAL A CA   4  
ATOM 5726  C C    . VAL A 1 88 ? -5.130  1.932   -5.265  1.00 0.00 ? 88  VAL A C    4  
ATOM 5727  O O    . VAL A 1 88 ? -6.125  2.649   -5.401  1.00 0.00 ? 88  VAL A O    4  
ATOM 5728  C CB   . VAL A 1 88 ? -4.819  0.064   -3.633  1.00 0.00 ? 88  VAL A CB   4  
ATOM 5729  C CG1  . VAL A 1 88 ? -4.199  -0.360  -2.310  1.00 0.00 ? 88  VAL A CG1  4  
ATOM 5730  C CG2  . VAL A 1 88 ? -6.299  -0.283  -3.672  1.00 0.00 ? 88  VAL A CG2  4  
ATOM 5731  H H    . VAL A 1 88 ? -6.202  2.302   -2.692  1.00 0.00 ? 88  VAL A H    4  
ATOM 5732  H HA   . VAL A 1 88 ? -3.542  1.769   -3.847  1.00 0.00 ? 88  VAL A HA   4  
ATOM 5733  H HB   . VAL A 1 88 ? -4.324  -0.480  -4.424  1.00 0.00 ? 88  VAL A HB   4  
ATOM 5734  H HG11 . VAL A 1 88 ? -3.129  -0.222  -2.355  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 5735  H HG12 . VAL A 1 88 ? -4.420  -1.402  -2.127  1.00 0.00 ? 88  VAL A HG12 4  
ATOM 5736  H HG13 . VAL A 1 88 ? -4.608  0.240   -1.510  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 5737  H HG21 . VAL A 1 88 ? -6.817  0.260   -2.896  1.00 0.00 ? 88  VAL A HG21 4  
ATOM 5738  H HG22 . VAL A 1 88 ? -6.425  -1.344  -3.514  1.00 0.00 ? 88  VAL A HG22 4  
ATOM 5739  H HG23 . VAL A 1 88 ? -6.706  -0.011  -4.634  1.00 0.00 ? 88  VAL A HG23 4  
ATOM 5740  N N    . ALA A 1 89 ? -4.452  1.420   -6.292  1.00 0.00 ? 89  ALA A N    4  
ATOM 5741  C CA   . ALA A 1 89 ? -4.837  1.672   -7.677  1.00 0.00 ? 89  ALA A CA   4  
ATOM 5742  C C    . ALA A 1 89 ? -4.965  0.364   -8.456  1.00 0.00 ? 89  ALA A C    4  
ATOM 5743  O O    . ALA A 1 89 ? -3.966  -0.312  -8.713  1.00 0.00 ? 89  ALA A O    4  
ATOM 5744  C CB   . ALA A 1 89 ? -3.823  2.588   -8.351  1.00 0.00 ? 89  ALA A CB   4  
ATOM 5745  H H    . ALA A 1 89 ? -3.672  0.853   -6.112  1.00 0.00 ? 89  ALA A H    4  
ATOM 5746  H HA   . ALA A 1 89 ? -5.794  2.173   -7.673  1.00 0.00 ? 89  ALA A HA   4  
ATOM 5747  H HB1  . ALA A 1 89 ? -4.248  2.988   -9.259  1.00 0.00 ? 89  ALA A HB1  4  
ATOM 5748  H HB2  . ALA A 1 89 ? -2.930  2.027   -8.588  1.00 0.00 ? 89  ALA A HB2  4  
ATOM 5749  H HB3  . ALA A 1 89 ? -3.572  3.399   -7.683  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 5750  N N    . LYS A 1 90 ? -6.197  0.014   -8.831  1.00 0.00 ? 90  LYS A N    4  
ATOM 5751  C CA   . LYS A 1 90 ? -6.450  -1.215  -9.586  1.00 0.00 ? 90  LYS A CA   4  
ATOM 5752  C C    . LYS A 1 90 ? -5.802  -1.138  -10.967 1.00 0.00 ? 90  LYS A C    4  
ATOM 5753  O O    . LYS A 1 90 ? -6.237  -0.365  -11.823 1.00 0.00 ? 90  LYS A O    4  
ATOM 5754  C CB   . LYS A 1 90 ? -7.956  -1.465  -9.727  1.00 0.00 ? 90  LYS A CB   4  
ATOM 5755  C CG   . LYS A 1 90 ? -8.671  -1.664  -8.399  1.00 0.00 ? 90  LYS A CG   4  
ATOM 5756  C CD   . LYS A 1 90 ? -8.273  -2.975  -7.737  1.00 0.00 ? 90  LYS A CD   4  
ATOM 5757  C CE   . LYS A 1 90 ? -9.392  -3.520  -6.862  1.00 0.00 ? 90  LYS A CE   4  
ATOM 5758  N NZ   . LYS A 1 90 ? -9.622  -4.973  -7.093  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 5759  H H    . LYS A 1 90 ? -6.952  0.596   -8.597  1.00 0.00 ? 90  LYS A H    4  
ATOM 5760  H HA   . LYS A 1 90 ? -6.007  -2.035  -9.039  1.00 0.00 ? 90  LYS A HA   4  
ATOM 5761  H HB2  . LYS A 1 90 ? -8.404  -0.621  -10.228 1.00 0.00 ? 90  LYS A HB2  4  
ATOM 5762  H HB3  . LYS A 1 90 ? -8.107  -2.350  -10.328 1.00 0.00 ? 90  LYS A HB3  4  
ATOM 5763  H HG2  . LYS A 1 90 ? -8.416  -0.849  -7.739  1.00 0.00 ? 90  LYS A HG2  4  
ATOM 5764  H HG3  . LYS A 1 90 ? -9.736  -1.668  -8.574  1.00 0.00 ? 90  LYS A HG3  4  
ATOM 5765  H HD2  . LYS A 1 90 ? -8.044  -3.700  -8.504  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 5766  H HD3  . LYS A 1 90 ? -7.398  -2.808  -7.125  1.00 0.00 ? 90  LYS A HD3  4  
ATOM 5767  H HE2  . LYS A 1 90 ? -9.128  -3.367  -5.826  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 5768  H HE3  . LYS A 1 90 ? -10.301 -2.980  -7.085  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 5769  H HZ1  . LYS A 1 90 ? -10.462 -5.289  -6.567  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 5770  H HZ2  . LYS A 1 90 ? -8.799  -5.522  -6.772  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 5771  H HZ3  . LYS A 1 90 ? -9.773  -5.155  -8.107  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 5772  N N    . GLN A 1 91 ? -4.751  -1.935  -11.171 1.00 0.00 ? 91  GLN A N    4  
ATOM 5773  C CA   . GLN A 1 91 ? -4.028  -1.950  -12.444 1.00 0.00 ? 91  GLN A CA   4  
ATOM 5774  C C    . GLN A 1 91 ? -3.211  -3.236  -12.601 1.00 0.00 ? 91  GLN A C    4  
ATOM 5775  O O    . GLN A 1 91 ? -3.247  -4.115  -11.737 1.00 0.00 ? 91  GLN A O    4  
ATOM 5776  C CB   . GLN A 1 91 ? -3.104  -0.729  -12.537 1.00 0.00 ? 91  GLN A CB   4  
ATOM 5777  C CG   . GLN A 1 91 ? -2.215  -0.539  -11.312 1.00 0.00 ? 91  GLN A CG   4  
ATOM 5778  C CD   . GLN A 1 91 ? -0.736  -0.474  -11.653 1.00 0.00 ? 91  GLN A CD   4  
ATOM 5779  O OE1  . GLN A 1 91 ? -0.356  -0.194  -12.790 1.00 0.00 ? 91  GLN A OE1  4  
ATOM 5780  N NE2  . GLN A 1 91 ? 0.112   -0.732  -10.662 1.00 0.00 ? 91  GLN A NE2  4  
ATOM 5781  H H    . GLN A 1 91 ? -4.448  -2.521  -10.445 1.00 0.00 ? 91  GLN A H    4  
ATOM 5782  H HA   . GLN A 1 91 ? -4.756  -1.901  -13.239 1.00 0.00 ? 91  GLN A HA   4  
ATOM 5783  H HB2  . GLN A 1 91 ? -2.468  -0.838  -13.404 1.00 0.00 ? 91  GLN A HB2  4  
ATOM 5784  H HB3  . GLN A 1 91 ? -3.709  0.158   -12.655 1.00 0.00 ? 91  GLN A HB3  4  
ATOM 5785  H HG2  . GLN A 1 91 ? -2.494  0.381   -10.821 1.00 0.00 ? 91  GLN A HG2  4  
ATOM 5786  H HG3  . GLN A 1 91 ? -2.377  -1.367  -10.637 1.00 0.00 ? 91  GLN A HG3  4  
ATOM 5787  H HE21 . GLN A 1 91 ? -0.256  -0.948  -9.779  1.00 0.00 ? 91  GLN A HE21 4  
ATOM 5788  H HE22 . GLN A 1 91 ? 1.071   -0.692  -10.855 1.00 0.00 ? 91  GLN A HE22 4  
ATOM 5789  N N    . GLY A 1 92 ? -2.471  -3.332  -13.709 1.00 0.00 ? 92  GLY A N    4  
ATOM 5790  C CA   . GLY A 1 92 ? -1.650  -4.501  -13.962 1.00 0.00 ? 92  GLY A CA   4  
ATOM 5791  C C    . GLY A 1 92 ? -1.151  -4.560  -15.391 1.00 0.00 ? 92  GLY A C    4  
ATOM 5792  O O    . GLY A 1 92 ? -1.899  -4.288  -16.332 1.00 0.00 ? 92  GLY A O    4  
ATOM 5793  H H    . GLY A 1 92 ? -2.479  -2.599  -14.359 1.00 0.00 ? 92  GLY A H    4  
ATOM 5794  H HA2  . GLY A 1 92 ? -0.800  -4.479  -13.297 1.00 0.00 ? 92  GLY A HA2  4  
ATOM 5795  H HA3  . GLY A 1 92 ? -2.226  -5.389  -13.759 1.00 0.00 ? 92  GLY A HA3  4  
ATOM 5796  N N    . ALA A 1 93 ? 0.120   -4.916  -15.546 1.00 0.00 ? 93  ALA A N    4  
ATOM 5797  C CA   . ALA A 1 93 ? 0.743   -5.017  -16.863 1.00 0.00 ? 93  ALA A CA   4  
ATOM 5798  C C    . ALA A 1 93 ? 1.458   -6.356  -17.032 1.00 0.00 ? 93  ALA A C    4  
ATOM 5799  O O    . ALA A 1 93 ? 1.183   -7.048  -18.034 1.00 0.00 ? 93  ALA A O    4  
ATOM 5800  C CB   . ALA A 1 93 ? 1.715   -3.864  -17.081 1.00 0.00 ? 93  ALA A CB   4  
ATOM 5801  O OXT  . ALA A 1 93 ? 2.288   -6.701  -16.162 1.00 0.00 ? 93  ALA A OXT  4  
ATOM 5802  H H    . ALA A 1 93 ? 0.652   -5.117  -14.749 1.00 0.00 ? 93  ALA A H    4  
ATOM 5803  H HA   . ALA A 1 93 ? -0.038  -4.943  -17.607 1.00 0.00 ? 93  ALA A HA   4  
ATOM 5804  H HB1  . ALA A 1 93 ? 1.451   -3.042  -16.432 1.00 0.00 ? 93  ALA A HB1  4  
ATOM 5805  H HB2  . ALA A 1 93 ? 1.664   -3.540  -18.110 1.00 0.00 ? 93  ALA A HB2  4  
ATOM 5806  H HB3  . ALA A 1 93 ? 2.719   -4.192  -16.856 1.00 0.00 ? 93  ALA A HB3  4  
ATOM 5807  N N    . LEU B 2 1  ? 14.441  -1.230  -4.029  1.00 0.00 ? 99  LEU B N    4  
ATOM 5808  C CA   . LEU B 2 1  ? 13.707  -2.315  -4.734  1.00 0.00 ? 99  LEU B CA   4  
ATOM 5809  C C    . LEU B 2 1  ? 13.690  -3.603  -3.902  1.00 0.00 ? 99  LEU B C    4  
ATOM 5810  O O    . LEU B 2 1  ? 14.192  -4.644  -4.332  1.00 0.00 ? 99  LEU B O    4  
ATOM 5811  C CB   . LEU B 2 1  ? 14.374  -2.552  -6.097  1.00 0.00 ? 99  LEU B CB   4  
ATOM 5812  C CG   . LEU B 2 1  ? 13.416  -2.903  -7.238  1.00 0.00 ? 99  LEU B CG   4  
ATOM 5813  C CD1  . LEU B 2 1  ? 14.108  -2.759  -8.586  1.00 0.00 ? 99  LEU B CD1  4  
ATOM 5814  C CD2  . LEU B 2 1  ? 12.869  -4.313  -7.064  1.00 0.00 ? 99  LEU B CD2  4  
ATOM 5815  H H1   . LEU B 2 1  ? 15.338  -1.625  -3.682  1.00 0.00 ? 99  LEU B H1   4  
ATOM 5816  H H2   . LEU B 2 1  ? 13.844  -0.905  -3.241  1.00 0.00 ? 99  LEU B H2   4  
ATOM 5817  H H3   . LEU B 2 1  ? 14.609  -0.463  -4.711  1.00 0.00 ? 99  LEU B H3   4  
ATOM 5818  H HA   . LEU B 2 1  ? 12.689  -1.990  -4.890  1.00 0.00 ? 99  LEU B HA   4  
ATOM 5819  H HB2  . LEU B 2 1  ? 14.910  -1.653  -6.371  1.00 0.00 ? 99  LEU B HB2  4  
ATOM 5820  H HB3  . LEU B 2 1  ? 15.088  -3.356  -5.994  1.00 0.00 ? 99  LEU B HB3  4  
ATOM 5821  H HG   . LEU B 2 1  ? 12.582  -2.218  -7.220  1.00 0.00 ? 99  LEU B HG   4  
ATOM 5822  H HD11 . LEU B 2 1  ? 14.834  -1.960  -8.535  1.00 0.00 ? 99  LEU B HD11 4  
ATOM 5823  H HD12 . LEU B 2 1  ? 13.374  -2.530  -9.344  1.00 0.00 ? 99  LEU B HD12 4  
ATOM 5824  H HD13 . LEU B 2 1  ? 14.608  -3.683  -8.836  1.00 0.00 ? 99  LEU B HD13 4  
ATOM 5825  H HD21 . LEU B 2 1  ? 12.041  -4.294  -6.371  1.00 0.00 ? 99  LEU B HD21 4  
ATOM 5826  H HD22 . LEU B 2 1  ? 13.647  -4.956  -6.677  1.00 0.00 ? 99  LEU B HD22 4  
ATOM 5827  H HD23 . LEU B 2 1  ? 12.532  -4.690  -8.018  1.00 0.00 ? 99  LEU B HD23 4  
ATOM 5828  N N    . PHE B 2 2  ? 13.106  -3.520  -2.705  1.00 0.00 ? 100 PHE B N    4  
ATOM 5829  C CA   . PHE B 2 2  ? 13.015  -4.670  -1.807  1.00 0.00 ? 100 PHE B CA   4  
ATOM 5830  C C    . PHE B 2 2  ? 11.553  -4.980  -1.481  1.00 0.00 ? 100 PHE B C    4  
ATOM 5831  O O    . PHE B 2 2  ? 10.650  -4.259  -1.910  1.00 0.00 ? 100 PHE B O    4  
ATOM 5832  C CB   . PHE B 2 2  ? 13.810  -4.407  -0.521  1.00 0.00 ? 100 PHE B CB   4  
ATOM 5833  C CG   . PHE B 2 2  ? 15.244  -4.005  -0.761  1.00 0.00 ? 100 PHE B CG   4  
ATOM 5834  C CD1  . PHE B 2 2  ? 16.118  -4.852  -1.428  1.00 0.00 ? 100 PHE B CD1  4  
ATOM 5835  C CD2  . PHE B 2 2  ? 15.717  -2.780  -0.315  1.00 0.00 ? 100 PHE B CD2  4  
ATOM 5836  C CE1  . PHE B 2 2  ? 17.433  -4.483  -1.647  1.00 0.00 ? 100 PHE B CE1  4  
ATOM 5837  C CE2  . PHE B 2 2  ? 17.031  -2.407  -0.531  1.00 0.00 ? 100 PHE B CE2  4  
ATOM 5838  C CZ   . PHE B 2 2  ? 17.889  -3.259  -1.197  1.00 0.00 ? 100 PHE B CZ   4  
ATOM 5839  H H    . PHE B 2 2  ? 12.722  -2.664  -2.418  1.00 0.00 ? 100 PHE B H    4  
ATOM 5840  H HA   . PHE B 2 2  ? 13.442  -5.522  -2.316  1.00 0.00 ? 100 PHE B HA   4  
ATOM 5841  H HB2  . PHE B 2 2  ? 13.333  -3.613  0.032   1.00 0.00 ? 100 PHE B HB2  4  
ATOM 5842  H HB3  . PHE B 2 2  ? 13.813  -5.305  0.081   1.00 0.00 ? 100 PHE B HB3  4  
ATOM 5843  H HD1  . PHE B 2 2  ? 15.763  -5.809  -1.781  1.00 0.00 ? 100 PHE B HD1  4  
ATOM 5844  H HD2  . PHE B 2 2  ? 15.048  -2.112  0.207   1.00 0.00 ? 100 PHE B HD2  4  
ATOM 5845  H HE1  . PHE B 2 2  ? 18.102  -5.151  -2.168  1.00 0.00 ? 100 PHE B HE1  4  
ATOM 5846  H HE2  . PHE B 2 2  ? 17.387  -1.450  -0.178  1.00 0.00 ? 100 PHE B HE2  4  
ATOM 5847  H HZ   . PHE B 2 2  ? 18.917  -2.970  -1.366  1.00 0.00 ? 100 PHE B HZ   4  
ATOM 5848  N N    . SER B 2 3  ? 11.321  -6.059  -0.729  1.00 0.00 ? 101 SER B N    4  
ATOM 5849  C CA   . SER B 2 3  ? 9.962   -6.458  -0.366  1.00 0.00 ? 101 SER B CA   4  
ATOM 5850  C C    . SER B 2 3  ? 9.751   -6.443  1.151   1.00 0.00 ? 101 SER B C    4  
ATOM 5851  O O    . SER B 2 3  ? 10.578  -6.955  1.907   1.00 0.00 ? 101 SER B O    4  
ATOM 5852  C CB   . SER B 2 3  ? 9.654   -7.847  -0.933  1.00 0.00 ? 101 SER B CB   4  
ATOM 5853  O OG   . SER B 2 3  ? 10.479  -8.842  -0.352  1.00 0.00 ? 101 SER B OG   4  
ATOM 5854  H H    . SER B 2 3  ? 12.078  -6.601  -0.420  1.00 0.00 ? 101 SER B H    4  
ATOM 5855  H HA   . SER B 2 3  ? 9.286   -5.745  -0.814  1.00 0.00 ? 101 SER B HA   4  
ATOM 5856  H HB2  . SER B 2 3  ? 8.624   -8.093  -0.731  1.00 0.00 ? 101 SER B HB2  4  
ATOM 5857  H HB3  . SER B 2 3  ? 9.817   -7.842  -2.000  1.00 0.00 ? 101 SER B HB3  4  
ATOM 5858  H HG   . SER B 2 3  ? 11.248  -8.986  -0.910  1.00 0.00 ? 101 SER B HG   4  
ATOM 5859  N N    . THR B 2 4  ? 8.633   -5.849  1.584   1.00 0.00 ? 102 THR B N    4  
ATOM 5860  C CA   . THR B 2 4  ? 8.301   -5.761  3.009   1.00 0.00 ? 102 THR B CA   4  
ATOM 5861  C C    . THR B 2 4  ? 7.298   -6.858  3.403   1.00 0.00 ? 102 THR B C    4  
ATOM 5862  O O    . THR B 2 4  ? 7.268   -7.925  2.782   1.00 0.00 ? 102 THR B O    4  
ATOM 5863  C CB   . THR B 2 4  ? 7.753   -4.363  3.343   1.00 0.00 ? 102 THR B CB   4  
ATOM 5864  O OG1  . THR B 2 4  ? 8.303   -3.385  2.477   1.00 0.00 ? 102 THR B OG1  4  
ATOM 5865  C CG2  . THR B 2 4  ? 8.051   -3.923  4.762   1.00 0.00 ? 102 THR B CG2  4  
ATOM 5866  H H    . THR B 2 4  ? 8.016   -5.461  0.927   1.00 0.00 ? 102 THR B H    4  
ATOM 5867  H HA   . THR B 2 4  ? 9.214   -5.919  3.565   1.00 0.00 ? 102 THR B HA   4  
ATOM 5868  H HB   . THR B 2 4  ? 6.679   -4.364  3.214   1.00 0.00 ? 102 THR B HB   4  
ATOM 5869  H HG1  . THR B 2 4  ? 7.820   -2.561  2.575   1.00 0.00 ? 102 THR B HG1  4  
ATOM 5870  H HG21 . THR B 2 4  ? 9.007   -3.424  4.791   1.00 0.00 ? 102 THR B HG21 4  
ATOM 5871  H HG22 . THR B 2 4  ? 8.077   -4.787  5.410   1.00 0.00 ? 102 THR B HG22 4  
ATOM 5872  H HG23 . THR B 2 4  ? 7.280   -3.245  5.099   1.00 0.00 ? 102 THR B HG23 4  
ATOM 5873  N N    . GLU B 2 5  ? 6.477   -6.598  4.431   1.00 0.00 ? 103 GLU B N    4  
ATOM 5874  C CA   . GLU B 2 5  ? 5.487   -7.564  4.896   1.00 0.00 ? 103 GLU B CA   4  
ATOM 5875  C C    . GLU B 2 5  ? 4.621   -6.923  5.970   1.00 0.00 ? 103 GLU B C    4  
ATOM 5876  O O    . GLU B 2 5  ? 4.352   -7.510  7.020   1.00 0.00 ? 103 GLU B O    4  
ATOM 5877  C CB   . GLU B 2 5  ? 6.164   -8.827  5.440   1.00 0.00 ? 103 GLU B CB   4  
ATOM 5878  C CG   . GLU B 2 5  ? 7.328   -8.550  6.383   1.00 0.00 ? 103 GLU B CG   4  
ATOM 5879  C CD   . GLU B 2 5  ? 6.918   -8.551  7.844   1.00 0.00 ? 103 GLU B CD   4  
ATOM 5880  O OE1  . GLU B 2 5  ? 6.500   -9.617  8.344   1.00 0.00 ? 103 GLU B OE1  4  
ATOM 5881  O OE2  . GLU B 2 5  ? 7.016   -7.485  8.489   1.00 0.00 ? 103 GLU B OE2  4  
ATOM 5882  H H    . GLU B 2 5  ? 6.530   -5.729  4.891   1.00 0.00 ? 103 GLU B H    4  
ATOM 5883  H HA   . GLU B 2 5  ? 4.864   -7.828  4.055   1.00 0.00 ? 103 GLU B HA   4  
ATOM 5884  H HB2  . GLU B 2 5  ? 5.429   -9.410  5.973   1.00 0.00 ? 103 GLU B HB2  4  
ATOM 5885  H HB3  . GLU B 2 5  ? 6.534   -9.407  4.608   1.00 0.00 ? 103 GLU B HB3  4  
ATOM 5886  H HG2  . GLU B 2 5  ? 8.079   -9.311  6.238   1.00 0.00 ? 103 GLU B HG2  4  
ATOM 5887  H HG3  . GLU B 2 5  ? 7.748   -7.584  6.144   1.00 0.00 ? 103 GLU B HG3  4  
ATOM 5888  N N    . VAL B 2 6  ? 4.205   -5.696  5.690   1.00 0.00 ? 104 VAL B N    4  
ATOM 5889  C CA   . VAL B 2 6  ? 3.387   -4.924  6.604   1.00 0.00 ? 104 VAL B CA   4  
ATOM 5890  C C    . VAL B 2 6  ? 2.068   -5.634  6.936   1.00 0.00 ? 104 VAL B C    4  
ATOM 5891  O O    . VAL B 2 6  ? 1.550   -5.422  8.052   1.00 0.00 ? 104 VAL B O    4  
ATOM 5892  C CB   . VAL B 2 6  ? 3.095   -3.533  6.015   1.00 0.00 ? 104 VAL B CB   4  
ATOM 5893  C CG1  . VAL B 2 6  ? 4.382   -2.751  5.797   1.00 0.00 ? 104 VAL B CG1  4  
ATOM 5894  C CG2  . VAL B 2 6  ? 2.311   -3.644  4.714   1.00 0.00 ? 104 VAL B CG2  4  
ATOM 5895  O OXT  . VAL B 2 6  ? 1.569   -6.400  6.085   1.00 0.00 ? 104 VAL B OXT  4  
ATOM 5896  H H    . VAL B 2 6  ? 4.468   -5.291  4.838   1.00 0.00 ? 104 VAL B H    4  
ATOM 5897  H HA   . VAL B 2 6  ? 3.951   -4.793  7.516   1.00 0.00 ? 104 VAL B HA   4  
ATOM 5898  H HB   . VAL B 2 6  ? 2.503   -2.999  6.721   1.00 0.00 ? 104 VAL B HB   4  
ATOM 5899  H HG11 . VAL B 2 6  ? 5.085   -3.357  5.245   1.00 0.00 ? 104 VAL B HG11 4  
ATOM 5900  H HG12 . VAL B 2 6  ? 4.808   -2.485  6.752   1.00 0.00 ? 104 VAL B HG12 4  
ATOM 5901  H HG13 . VAL B 2 6  ? 4.164   -1.853  5.238   1.00 0.00 ? 104 VAL B HG13 4  
ATOM 5902  H HG21 . VAL B 2 6  ? 1.305   -3.286  4.867   1.00 0.00 ? 104 VAL B HG21 4  
ATOM 5903  H HG22 . VAL B 2 6  ? 2.283   -4.677  4.398   1.00 0.00 ? 104 VAL B HG22 4  
ATOM 5904  H HG23 . VAL B 2 6  ? 2.793   -3.048  3.953   1.00 0.00 ? 104 VAL B HG23 4  
ATOM 5905  N N    . MET A 1 1  ? -5.088  9.633   -21.262 1.00 0.00 ? 1   MET A N    5  
ATOM 5906  C CA   . MET A 1 1  ? -6.556  9.388   -21.382 1.00 0.00 ? 1   MET A CA   5  
ATOM 5907  C C    . MET A 1 1  ? -7.027  8.255   -20.464 1.00 0.00 ? 1   MET A C    5  
ATOM 5908  O O    . MET A 1 1  ? -8.178  8.251   -20.026 1.00 0.00 ? 1   MET A O    5  
ATOM 5909  C CB   . MET A 1 1  ? -6.902  9.070   -22.846 1.00 0.00 ? 1   MET A CB   5  
ATOM 5910  C CG   . MET A 1 1  ? -6.345  7.745   -23.353 1.00 0.00 ? 1   MET A CG   5  
ATOM 5911  S SD   . MET A 1 1  ? -7.156  7.184   -24.863 1.00 0.00 ? 1   MET A SD   5  
ATOM 5912  C CE   . MET A 1 1  ? -6.105  5.808   -25.320 1.00 0.00 ? 1   MET A CE   5  
ATOM 5913  H H1   . MET A 1 1  ? -4.846  9.621   -20.250 1.00 0.00 ? 1   MET A H1   5  
ATOM 5914  H H2   . MET A 1 1  ? -4.887  10.563  -21.682 1.00 0.00 ? 1   MET A H2   5  
ATOM 5915  H H3   . MET A 1 1  ? -4.592  8.876   -21.773 1.00 0.00 ? 1   MET A H3   5  
ATOM 5916  H HA   . MET A 1 1  ? -7.069  10.295  -21.094 1.00 0.00 ? 1   MET A HA   5  
ATOM 5917  H HB2  . MET A 1 1  ? -7.977  9.041   -22.946 1.00 0.00 ? 1   MET A HB2  5  
ATOM 5918  H HB3  . MET A 1 1  ? -6.516  9.861   -23.472 1.00 0.00 ? 1   MET A HB3  5  
ATOM 5919  H HG2  . MET A 1 1  ? -5.290  7.864   -23.553 1.00 0.00 ? 1   MET A HG2  5  
ATOM 5920  H HG3  . MET A 1 1  ? -6.482  6.995   -22.589 1.00 0.00 ? 1   MET A HG3  5  
ATOM 5921  H HE1  . MET A 1 1  ? -5.255  6.175   -25.875 1.00 0.00 ? 1   MET A HE1  5  
ATOM 5922  H HE2  . MET A 1 1  ? -6.663  5.115   -25.932 1.00 0.00 ? 1   MET A HE2  5  
ATOM 5923  H HE3  . MET A 1 1  ? -5.762  5.305   -24.428 1.00 0.00 ? 1   MET A HE3  5  
ATOM 5924  N N    . LYS A 1 2  ? -6.139  7.295   -20.178 1.00 0.00 ? 2   LYS A N    5  
ATOM 5925  C CA   . LYS A 1 2  ? -6.480  6.165   -19.314 1.00 0.00 ? 2   LYS A CA   5  
ATOM 5926  C C    . LYS A 1 2  ? -6.999  6.648   -17.962 1.00 0.00 ? 2   LYS A C    5  
ATOM 5927  O O    . LYS A 1 2  ? -6.260  7.258   -17.188 1.00 0.00 ? 2   LYS A O    5  
ATOM 5928  C CB   . LYS A 1 2  ? -5.265  5.258   -19.104 1.00 0.00 ? 2   LYS A CB   5  
ATOM 5929  C CG   . LYS A 1 2  ? -4.983  4.335   -20.278 1.00 0.00 ? 2   LYS A CG   5  
ATOM 5930  C CD   . LYS A 1 2  ? -3.499  4.020   -20.399 1.00 0.00 ? 2   LYS A CD   5  
ATOM 5931  C CE   . LYS A 1 2  ? -3.184  2.602   -19.939 1.00 0.00 ? 2   LYS A CE   5  
ATOM 5932  N NZ   . LYS A 1 2  ? -2.888  1.687   -21.080 1.00 0.00 ? 2   LYS A NZ   5  
ATOM 5933  H H    . LYS A 1 2  ? -5.237  7.347   -20.557 1.00 0.00 ? 2   LYS A H    5  
ATOM 5934  H HA   . LYS A 1 2  ? -7.258  5.599   -19.805 1.00 0.00 ? 2   LYS A HA   5  
ATOM 5935  H HB2  . LYS A 1 2  ? -4.393  5.875   -18.940 1.00 0.00 ? 2   LYS A HB2  5  
ATOM 5936  H HB3  . LYS A 1 2  ? -5.433  4.650   -18.228 1.00 0.00 ? 2   LYS A HB3  5  
ATOM 5937  H HG2  . LYS A 1 2  ? -5.529  3.413   -20.139 1.00 0.00 ? 2   LYS A HG2  5  
ATOM 5938  H HG3  . LYS A 1 2  ? -5.315  4.816   -21.187 1.00 0.00 ? 2   LYS A HG3  5  
ATOM 5939  H HD2  . LYS A 1 2  ? -3.201  4.130   -21.431 1.00 0.00 ? 2   LYS A HD2  5  
ATOM 5940  H HD3  . LYS A 1 2  ? -2.945  4.718   -19.788 1.00 0.00 ? 2   LYS A HD3  5  
ATOM 5941  H HE2  . LYS A 1 2  ? -2.324  2.634   -19.286 1.00 0.00 ? 2   LYS A HE2  5  
ATOM 5942  H HE3  . LYS A 1 2  ? -4.032  2.218   -19.392 1.00 0.00 ? 2   LYS A HE3  5  
ATOM 5943  H HZ1  . LYS A 1 2  ? -1.862  1.637   -21.242 1.00 0.00 ? 2   LYS A HZ1  5  
ATOM 5944  H HZ2  . LYS A 1 2  ? -3.349  2.029   -21.947 1.00 0.00 ? 2   LYS A HZ2  5  
ATOM 5945  H HZ3  . LYS A 1 2  ? -3.240  0.730   -20.870 1.00 0.00 ? 2   LYS A HZ3  5  
ATOM 5946  N N    . GLU A 1 3  ? -8.273  6.374   -17.688 1.00 0.00 ? 3   GLU A N    5  
ATOM 5947  C CA   . GLU A 1 3  ? -8.893  6.783   -16.434 1.00 0.00 ? 3   GLU A CA   5  
ATOM 5948  C C    . GLU A 1 3  ? -9.084  5.583   -15.509 1.00 0.00 ? 3   GLU A C    5  
ATOM 5949  O O    . GLU A 1 3  ? -10.102 4.891   -15.580 1.00 0.00 ? 3   GLU A O    5  
ATOM 5950  C CB   . GLU A 1 3  ? -10.239 7.460   -16.706 1.00 0.00 ? 3   GLU A CB   5  
ATOM 5951  C CG   . GLU A 1 3  ? -10.494 8.688   -15.842 1.00 0.00 ? 3   GLU A CG   5  
ATOM 5952  C CD   . GLU A 1 3  ? -10.910 8.345   -14.421 1.00 0.00 ? 3   GLU A CD   5  
ATOM 5953  O OE1  . GLU A 1 3  ? -11.721 7.410   -14.244 1.00 0.00 ? 3   GLU A OE1  5  
ATOM 5954  O OE2  . GLU A 1 3  ? -10.426 9.016   -13.486 1.00 0.00 ? 3   GLU A OE2  5  
ATOM 5955  H H    . GLU A 1 3  ? -8.810  5.888   -18.348 1.00 0.00 ? 3   GLU A H    5  
ATOM 5956  H HA   . GLU A 1 3  ? -8.235  7.492   -15.954 1.00 0.00 ? 3   GLU A HA   5  
ATOM 5957  H HB2  . GLU A 1 3  ? -10.273 7.764   -17.742 1.00 0.00 ? 3   GLU A HB2  5  
ATOM 5958  H HB3  . GLU A 1 3  ? -11.031 6.749   -16.525 1.00 0.00 ? 3   GLU A HB3  5  
ATOM 5959  H HG2  . GLU A 1 3  ? -9.588  9.273   -15.799 1.00 0.00 ? 3   GLU A HG2  5  
ATOM 5960  H HG3  . GLU A 1 3  ? -11.277 9.274   -16.299 1.00 0.00 ? 3   GLU A HG3  5  
ATOM 5961  N N    . PRO A 1 4  ? -8.101  5.311   -14.630 1.00 0.00 ? 4   PRO A N    5  
ATOM 5962  C CA   . PRO A 1 4  ? -8.171  4.182   -13.696 1.00 0.00 ? 4   PRO A CA   5  
ATOM 5963  C C    . PRO A 1 4  ? -9.208  4.397   -12.590 1.00 0.00 ? 4   PRO A C    5  
ATOM 5964  O O    . PRO A 1 4  ? -9.993  5.346   -12.637 1.00 0.00 ? 4   PRO A O    5  
ATOM 5965  C CB   . PRO A 1 4  ? -6.760  4.121   -13.109 1.00 0.00 ? 4   PRO A CB   5  
ATOM 5966  C CG   . PRO A 1 4  ? -6.243  5.512   -13.223 1.00 0.00 ? 4   PRO A CG   5  
ATOM 5967  C CD   . PRO A 1 4  ? -6.842  6.073   -14.482 1.00 0.00 ? 4   PRO A CD   5  
ATOM 5968  H HA   . PRO A 1 4  ? -8.389  3.260   -14.214 1.00 0.00 ? 4   PRO A HA   5  
ATOM 5969  H HB2  . PRO A 1 4  ? -6.810  3.799   -12.078 1.00 0.00 ? 4   PRO A HB2  5  
ATOM 5970  H HB3  . PRO A 1 4  ? -6.160  3.428   -13.680 1.00 0.00 ? 4   PRO A HB3  5  
ATOM 5971  H HG2  . PRO A 1 4  ? -6.557  6.092   -12.368 1.00 0.00 ? 4   PRO A HG2  5  
ATOM 5972  H HG3  . PRO A 1 4  ? -5.165  5.500   -13.294 1.00 0.00 ? 4   PRO A HG3  5  
ATOM 5973  H HD2  . PRO A 1 4  ? -7.038  7.130   -14.369 1.00 0.00 ? 4   PRO A HD2  5  
ATOM 5974  H HD3  . PRO A 1 4  ? -6.186  5.897   -15.323 1.00 0.00 ? 4   PRO A HD3  5  
ATOM 5975  N N    . GLU A 1 5  ? -9.202  3.508   -11.595 1.00 0.00 ? 5   GLU A N    5  
ATOM 5976  C CA   . GLU A 1 5  ? -10.136 3.595   -10.480 1.00 0.00 ? 5   GLU A CA   5  
ATOM 5977  C C    . GLU A 1 5  ? -9.399  3.508   -9.149  1.00 0.00 ? 5   GLU A C    5  
ATOM 5978  O O    . GLU A 1 5  ? -8.976  2.430   -8.725  1.00 0.00 ? 5   GLU A O    5  
ATOM 5979  C CB   . GLU A 1 5  ? -11.186 2.488   -10.575 1.00 0.00 ? 5   GLU A CB   5  
ATOM 5980  C CG   . GLU A 1 5  ? -12.431 2.758   -9.745  1.00 0.00 ? 5   GLU A CG   5  
ATOM 5981  C CD   . GLU A 1 5  ? -13.661 2.067   -10.298 1.00 0.00 ? 5   GLU A CD   5  
ATOM 5982  O OE1  . GLU A 1 5  ? -13.678 0.817   -10.329 1.00 0.00 ? 5   GLU A OE1  5  
ATOM 5983  O OE2  . GLU A 1 5  ? -14.609 2.774   -10.700 1.00 0.00 ? 5   GLU A OE2  5  
ATOM 5984  H H    . GLU A 1 5  ? -8.551  2.777   -11.612 1.00 0.00 ? 5   GLU A H    5  
ATOM 5985  H HA   . GLU A 1 5  ? -10.631 4.553   -10.538 1.00 0.00 ? 5   GLU A HA   5  
ATOM 5986  H HB2  . GLU A 1 5  ? -11.483 2.380   -11.606 1.00 0.00 ? 5   GLU A HB2  5  
ATOM 5987  H HB3  . GLU A 1 5  ? -10.748 1.562   -10.236 1.00 0.00 ? 5   GLU A HB3  5  
ATOM 5988  H HG2  . GLU A 1 5  ? -12.261 2.404   -8.738  1.00 0.00 ? 5   GLU A HG2  5  
ATOM 5989  H HG3  . GLU A 1 5  ? -12.611 3.823   -9.725  1.00 0.00 ? 5   GLU A HG3  5  
ATOM 5990  N N    . ILE A 1 6  ? -9.251  4.654   -8.498  1.00 0.00 ? 6   ILE A N    5  
ATOM 5991  C CA   . ILE A 1 6  ? -8.569  4.731   -7.213  1.00 0.00 ? 6   ILE A CA   5  
ATOM 5992  C C    . ILE A 1 6  ? -9.579  4.731   -6.068  1.00 0.00 ? 6   ILE A C    5  
ATOM 5993  O O    . ILE A 1 6  ? -10.608 5.407   -6.137  1.00 0.00 ? 6   ILE A O    5  
ATOM 5994  C CB   . ILE A 1 6  ? -7.689  5.996   -7.125  1.00 0.00 ? 6   ILE A CB   5  
ATOM 5995  C CG1  . ILE A 1 6  ? -6.721  6.058   -8.310  1.00 0.00 ? 6   ILE A CG1  5  
ATOM 5996  C CG2  . ILE A 1 6  ? -6.922  6.030   -5.809  1.00 0.00 ? 6   ILE A CG2  5  
ATOM 5997  C CD1  . ILE A 1 6  ? -6.555  7.451   -8.877  1.00 0.00 ? 6   ILE A CD1  5  
ATOM 5998  H H    . ILE A 1 6  ? -9.613  5.475   -8.895  1.00 0.00 ? 6   ILE A H    5  
ATOM 5999  H HA   . ILE A 1 6  ? -7.932  3.863   -7.120  1.00 0.00 ? 6   ILE A HA   5  
ATOM 6000  H HB   . ILE A 1 6  ? -8.337  6.856   -7.158  1.00 0.00 ? 6   ILE A HB   5  
ATOM 6001  H HG12 . ILE A 1 6  ? -5.749  5.711   -7.993  1.00 0.00 ? 6   ILE A HG12 5  
ATOM 6002  H HG13 . ILE A 1 6  ? -7.086  5.419   -9.101  1.00 0.00 ? 6   ILE A HG13 5  
ATOM 6003  H HG21 . ILE A 1 6  ? -7.599  5.834   -4.990  1.00 0.00 ? 6   ILE A HG21 5  
ATOM 6004  H HG22 . ILE A 1 6  ? -6.475  7.004   -5.679  1.00 0.00 ? 6   ILE A HG22 5  
ATOM 6005  H HG23 . ILE A 1 6  ? -6.147  5.277   -5.823  1.00 0.00 ? 6   ILE A HG23 5  
ATOM 6006  H HD11 . ILE A 1 6  ? -5.841  7.427   -9.686  1.00 0.00 ? 6   ILE A HD11 5  
ATOM 6007  H HD12 . ILE A 1 6  ? -6.201  8.114   -8.103  1.00 0.00 ? 6   ILE A HD12 5  
ATOM 6008  H HD13 . ILE A 1 6  ? -7.507  7.804   -9.247  1.00 0.00 ? 6   ILE A HD13 5  
ATOM 6009  N N    . ILE A 1 7  ? -9.277  3.968   -5.017  1.00 0.00 ? 7   ILE A N    5  
ATOM 6010  C CA   . ILE A 1 7  ? -10.156 3.875   -3.853  1.00 0.00 ? 7   ILE A CA   5  
ATOM 6011  C C    . ILE A 1 7  ? -9.353  3.669   -2.571  1.00 0.00 ? 7   ILE A C    5  
ATOM 6012  O O    . ILE A 1 7  ? -8.275  3.069   -2.591  1.00 0.00 ? 7   ILE A O    5  
ATOM 6013  C CB   . ILE A 1 7  ? -11.178 2.720   -3.992  1.00 0.00 ? 7   ILE A CB   5  
ATOM 6014  C CG1  . ILE A 1 7  ? -10.463 1.397   -4.298  1.00 0.00 ? 7   ILE A CG1  5  
ATOM 6015  C CG2  . ILE A 1 7  ? -12.208 3.033   -5.070  1.00 0.00 ? 7   ILE A CG2  5  
ATOM 6016  C CD1  . ILE A 1 7  ? -10.764 0.298   -3.300  1.00 0.00 ? 7   ILE A CD1  5  
ATOM 6017  H H    . ILE A 1 7  ? -8.440  3.457   -5.023  1.00 0.00 ? 7   ILE A H    5  
ATOM 6018  H HA   . ILE A 1 7  ? -10.704 4.803   -3.776  1.00 0.00 ? 7   ILE A HA   5  
ATOM 6019  H HB   . ILE A 1 7  ? -11.702 2.625   -3.052  1.00 0.00 ? 7   ILE A HB   5  
ATOM 6020  H HG12 . ILE A 1 7  ? -10.766 1.049   -5.273  1.00 0.00 ? 7   ILE A HG12 5  
ATOM 6021  H HG13 . ILE A 1 7  ? -9.396  1.563   -4.296  1.00 0.00 ? 7   ILE A HG13 5  
ATOM 6022  H HG21 . ILE A 1 7  ? -13.122 2.498   -4.860  1.00 0.00 ? 7   ILE A HG21 5  
ATOM 6023  H HG22 . ILE A 1 7  ? -11.827 2.730   -6.034  1.00 0.00 ? 7   ILE A HG22 5  
ATOM 6024  H HG23 . ILE A 1 7  ? -12.408 4.095   -5.081  1.00 0.00 ? 7   ILE A HG23 5  
ATOM 6025  H HD11 . ILE A 1 7  ? -9.843  -0.041  -2.849  1.00 0.00 ? 7   ILE A HD11 5  
ATOM 6026  H HD12 . ILE A 1 7  ? -11.242 -0.527  -3.807  1.00 0.00 ? 7   ILE A HD12 5  
ATOM 6027  H HD13 . ILE A 1 7  ? -11.422 0.677   -2.531  1.00 0.00 ? 7   ILE A HD13 5  
ATOM 6028  N N    . THR A 1 8  ? -9.891  4.165   -1.457  1.00 0.00 ? 8   THR A N    5  
ATOM 6029  C CA   . THR A 1 8  ? -9.233  4.035   -0.160  1.00 0.00 ? 8   THR A CA   5  
ATOM 6030  C C    . THR A 1 8  ? -10.046 3.142   0.776   1.00 0.00 ? 8   THR A C    5  
ATOM 6031  O O    . THR A 1 8  ? -11.257 3.322   0.929   1.00 0.00 ? 8   THR A O    5  
ATOM 6032  C CB   . THR A 1 8  ? -9.026  5.414   0.478   1.00 0.00 ? 8   THR A CB   5  
ATOM 6033  O OG1  . THR A 1 8  ? -8.506  6.335   -0.466  1.00 0.00 ? 8   THR A OG1  5  
ATOM 6034  C CG2  . THR A 1 8  ? -8.080  5.389   1.660   1.00 0.00 ? 8   THR A CG2  5  
ATOM 6035  H H    . THR A 1 8  ? -10.753 4.627   -1.509  1.00 0.00 ? 8   THR A H    5  
ATOM 6036  H HA   . THR A 1 8  ? -8.269  3.577   -0.323  1.00 0.00 ? 8   THR A HA   5  
ATOM 6037  H HB   . THR A 1 8  ? -9.980  5.786   0.826   1.00 0.00 ? 8   THR A HB   5  
ATOM 6038  H HG1  . THR A 1 8  ? -9.202  6.608   -1.069  1.00 0.00 ? 8   THR A HG1  5  
ATOM 6039  H HG21 . THR A 1 8  ? -8.532  4.835   2.471   1.00 0.00 ? 8   THR A HG21 5  
ATOM 6040  H HG22 . THR A 1 8  ? -7.880  6.400   1.982   1.00 0.00 ? 8   THR A HG22 5  
ATOM 6041  H HG23 . THR A 1 8  ? -7.155  4.912   1.372   1.00 0.00 ? 8   THR A HG23 5  
ATOM 6042  N N    . VAL A 1 9  ? -9.368  2.180   1.400   1.00 0.00 ? 9   VAL A N    5  
ATOM 6043  C CA   . VAL A 1 9  ? -10.010 1.250   2.325   1.00 0.00 ? 9   VAL A CA   5  
ATOM 6044  C C    . VAL A 1 9  ? -9.728  1.634   3.774   1.00 0.00 ? 9   VAL A C    5  
ATOM 6045  O O    . VAL A 1 9  ? -8.579  1.612   4.217   1.00 0.00 ? 9   VAL A O    5  
ATOM 6046  C CB   . VAL A 1 9  ? -9.549  -0.206  2.086   1.00 0.00 ? 9   VAL A CB   5  
ATOM 6047  C CG1  . VAL A 1 9  ? -10.183 -0.759  0.820   1.00 0.00 ? 9   VAL A CG1  5  
ATOM 6048  C CG2  . VAL A 1 9  ? -8.027  -0.299  2.016   1.00 0.00 ? 9   VAL A CG2  5  
ATOM 6049  H H    . VAL A 1 9  ? -8.405  2.094   1.232   1.00 0.00 ? 9   VAL A H    5  
ATOM 6050  H HA   . VAL A 1 9  ? -11.077 1.297   2.155   1.00 0.00 ? 9   VAL A HA   5  
ATOM 6051  H HB   . VAL A 1 9  ? -9.885  -0.807  2.919   1.00 0.00 ? 9   VAL A HB   5  
ATOM 6052  H HG11 . VAL A 1 9  ? -10.445 0.057   0.162   1.00 0.00 ? 9   VAL A HG11 5  
ATOM 6053  H HG12 . VAL A 1 9  ? -11.074 -1.312  1.078   1.00 0.00 ? 9   VAL A HG12 5  
ATOM 6054  H HG13 . VAL A 1 9  ? -9.484  -1.414  0.321   1.00 0.00 ? 9   VAL A HG13 5  
ATOM 6055  H HG21 . VAL A 1 9  ? -7.697  -1.198  2.515   1.00 0.00 ? 9   VAL A HG21 5  
ATOM 6056  H HG22 . VAL A 1 9  ? -7.589  0.561   2.500   1.00 0.00 ? 9   VAL A HG22 5  
ATOM 6057  H HG23 . VAL A 1 9  ? -7.714  -0.326  0.982   1.00 0.00 ? 9   VAL A HG23 5  
ATOM 6058  N N    . THR A 1 10 ? -10.784 1.983   4.505   1.00 0.00 ? 10  THR A N    5  
ATOM 6059  C CA   . THR A 1 10 ? -10.656 2.370   5.906   1.00 0.00 ? 10  THR A CA   5  
ATOM 6060  C C    . THR A 1 10 ? -11.158 1.251   6.820   1.00 0.00 ? 10  THR A C    5  
ATOM 6061  O O    . THR A 1 10 ? -12.362 1.110   7.040   1.00 0.00 ? 10  THR A O    5  
ATOM 6062  C CB   . THR A 1 10 ? -11.429 3.665   6.177   1.00 0.00 ? 10  THR A CB   5  
ATOM 6063  O OG1  . THR A 1 10 ? -11.109 4.655   5.213   1.00 0.00 ? 10  THR A OG1  5  
ATOM 6064  C CG2  . THR A 1 10 ? -11.153 4.253   7.545   1.00 0.00 ? 10  THR A CG2  5  
ATOM 6065  H H    . THR A 1 10 ? -11.673 1.980   4.092   1.00 0.00 ? 10  THR A H    5  
ATOM 6066  H HA   . THR A 1 10 ? -9.608  2.538   6.108   1.00 0.00 ? 10  THR A HA   5  
ATOM 6067  H HB   . THR A 1 10 ? -12.489 3.461   6.113   1.00 0.00 ? 10  THR A HB   5  
ATOM 6068  H HG1  . THR A 1 10 ? -11.790 5.333   5.208   1.00 0.00 ? 10  THR A HG1  5  
ATOM 6069  H HG21 . THR A 1 10 ? -10.140 4.020   7.839   1.00 0.00 ? 10  THR A HG21 5  
ATOM 6070  H HG22 . THR A 1 10 ? -11.841 3.831   8.263   1.00 0.00 ? 10  THR A HG22 5  
ATOM 6071  H HG23 . THR A 1 10 ? -11.280 5.324   7.509   1.00 0.00 ? 10  THR A HG23 5  
ATOM 6072  N N    . LEU A 1 11 ? -10.226 0.454   7.341   1.00 0.00 ? 11  LEU A N    5  
ATOM 6073  C CA   . LEU A 1 11 ? -10.567 -0.660  8.226   1.00 0.00 ? 11  LEU A CA   5  
ATOM 6074  C C    . LEU A 1 11 ? -9.778  -0.581  9.532   1.00 0.00 ? 11  LEU A C    5  
ATOM 6075  O O    . LEU A 1 11 ? -8.695  0.002   9.575   1.00 0.00 ? 11  LEU A O    5  
ATOM 6076  C CB   . LEU A 1 11 ? -10.288 -1.996  7.528   1.00 0.00 ? 11  LEU A CB   5  
ATOM 6077  C CG   . LEU A 1 11 ? -10.986 -2.181  6.177   1.00 0.00 ? 11  LEU A CG   5  
ATOM 6078  C CD1  . LEU A 1 11 ? -10.145 -3.046  5.249   1.00 0.00 ? 11  LEU A CD1  5  
ATOM 6079  C CD2  . LEU A 1 11 ? -12.370 -2.787  6.369   1.00 0.00 ? 11  LEU A CD2  5  
ATOM 6080  H H    . LEU A 1 11 ? -9.283  0.615   7.123   1.00 0.00 ? 11  LEU A H    5  
ATOM 6081  H HA   . LEU A 1 11 ? -11.621 -0.595  8.451   1.00 0.00 ? 11  LEU A HA   5  
ATOM 6082  H HB2  . LEU A 1 11 ? -9.222  -2.081  7.375   1.00 0.00 ? 11  LEU A HB2  5  
ATOM 6083  H HB3  . LEU A 1 11 ? -10.604 -2.794  8.184   1.00 0.00 ? 11  LEU A HB3  5  
ATOM 6084  H HG   . LEU A 1 11 ? -11.108 -1.215  5.709   1.00 0.00 ? 11  LEU A HG   5  
ATOM 6085  H HD11 . LEU A 1 11 ? -9.106  -2.977  5.535   1.00 0.00 ? 11  LEU A HD11 5  
ATOM 6086  H HD12 . LEU A 1 11 ? -10.262 -2.702  4.232   1.00 0.00 ? 11  LEU A HD12 5  
ATOM 6087  H HD13 . LEU A 1 11 ? -10.470 -4.074  5.320   1.00 0.00 ? 11  LEU A HD13 5  
ATOM 6088  H HD21 . LEU A 1 11 ? -12.740 -2.538  7.352   1.00 0.00 ? 11  LEU A HD21 5  
ATOM 6089  H HD22 . LEU A 1 11 ? -12.309 -3.860  6.269   1.00 0.00 ? 11  LEU A HD22 5  
ATOM 6090  H HD23 . LEU A 1 11 ? -13.042 -2.394  5.621   1.00 0.00 ? 11  LEU A HD23 5  
ATOM 6091  N N    . LYS A 1 12 ? -10.324 -1.172  10.595  1.00 0.00 ? 12  LYS A N    5  
ATOM 6092  C CA   . LYS A 1 12 ? -9.660  -1.165  11.898  1.00 0.00 ? 12  LYS A CA   5  
ATOM 6093  C C    . LYS A 1 12 ? -8.711  -2.357  12.033  1.00 0.00 ? 12  LYS A C    5  
ATOM 6094  O O    . LYS A 1 12 ? -8.912  -3.398  11.404  1.00 0.00 ? 12  LYS A O    5  
ATOM 6095  C CB   . LYS A 1 12 ? -10.693 -1.181  13.030  1.00 0.00 ? 12  LYS A CB   5  
ATOM 6096  C CG   . LYS A 1 12 ? -10.786 0.135   13.790  1.00 0.00 ? 12  LYS A CG   5  
ATOM 6097  C CD   . LYS A 1 12 ? -11.974 0.969   13.331  1.00 0.00 ? 12  LYS A CD   5  
ATOM 6098  C CE   . LYS A 1 12 ? -11.662 1.731   12.049  1.00 0.00 ? 12  LYS A CE   5  
ATOM 6099  N NZ   . LYS A 1 12 ? -12.350 3.054   11.997  1.00 0.00 ? 12  LYS A NZ   5  
ATOM 6100  H H    . LYS A 1 12 ? -11.189 -1.624  10.501  1.00 0.00 ? 12  LYS A H    5  
ATOM 6101  H HA   . LYS A 1 12 ? -9.081  -0.256  11.965  1.00 0.00 ? 12  LYS A HA   5  
ATOM 6102  H HB2  . LYS A 1 12 ? -11.665 -1.402  12.614  1.00 0.00 ? 12  LYS A HB2  5  
ATOM 6103  H HB3  . LYS A 1 12 ? -10.428 -1.958  13.732  1.00 0.00 ? 12  LYS A HB3  5  
ATOM 6104  H HG2  . LYS A 1 12 ? -10.896 -0.077  14.843  1.00 0.00 ? 12  LYS A HG2  5  
ATOM 6105  H HG3  . LYS A 1 12 ? -9.878  0.698   13.629  1.00 0.00 ? 12  LYS A HG3  5  
ATOM 6106  H HD2  . LYS A 1 12 ? -12.813 0.314   13.152  1.00 0.00 ? 12  LYS A HD2  5  
ATOM 6107  H HD3  . LYS A 1 12 ? -12.227 1.675   14.108  1.00 0.00 ? 12  LYS A HD3  5  
ATOM 6108  H HE2  . LYS A 1 12 ? -10.596 1.889   11.992  1.00 0.00 ? 12  LYS A HE2  5  
ATOM 6109  H HE3  . LYS A 1 12 ? -11.983 1.136   11.206  1.00 0.00 ? 12  LYS A HE3  5  
ATOM 6110  H HZ1  . LYS A 1 12 ? -12.611 3.283   11.016  1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 6111  H HZ2  . LYS A 1 12 ? -11.720 3.799   12.358  1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 6112  H HZ3  . LYS A 1 12 ? -13.213 3.035   12.578  1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 6113  N N    . LYS A 1 13 ? -7.675  -2.195  12.858  1.00 0.00 ? 13  LYS A N    5  
ATOM 6114  C CA   . LYS A 1 13 ? -6.687  -3.250  13.079  1.00 0.00 ? 13  LYS A CA   5  
ATOM 6115  C C    . LYS A 1 13 ? -7.282  -4.404  13.882  1.00 0.00 ? 13  LYS A C    5  
ATOM 6116  O O    . LYS A 1 13 ? -7.476  -4.298  15.095  1.00 0.00 ? 13  LYS A O    5  
ATOM 6117  C CB   . LYS A 1 13 ? -5.457  -2.690  13.802  1.00 0.00 ? 13  LYS A CB   5  
ATOM 6118  C CG   . LYS A 1 13 ? -4.258  -3.627  13.785  1.00 0.00 ? 13  LYS A CG   5  
ATOM 6119  C CD   . LYS A 1 13 ? -2.965  -2.884  14.086  1.00 0.00 ? 13  LYS A CD   5  
ATOM 6120  C CE   . LYS A 1 13 ? -2.511  -2.039  12.903  1.00 0.00 ? 13  LYS A CE   5  
ATOM 6121  N NZ   . LYS A 1 13 ? -2.070  -2.875  11.749  1.00 0.00 ? 13  LYS A NZ   5  
ATOM 6122  H H    . LYS A 1 13 ? -7.571  -1.339  13.327  1.00 0.00 ? 13  LYS A H    5  
ATOM 6123  H HA   . LYS A 1 13 ? -6.383  -3.623  12.112  1.00 0.00 ? 13  LYS A HA   5  
ATOM 6124  H HB2  . LYS A 1 13 ? -5.170  -1.762  13.331  1.00 0.00 ? 13  LYS A HB2  5  
ATOM 6125  H HB3  . LYS A 1 13 ? -5.718  -2.494  14.832  1.00 0.00 ? 13  LYS A HB3  5  
ATOM 6126  H HG2  . LYS A 1 13 ? -4.403  -4.393  14.534  1.00 0.00 ? 13  LYS A HG2  5  
ATOM 6127  H HG3  . LYS A 1 13 ? -4.183  -4.085  12.810  1.00 0.00 ? 13  LYS A HG3  5  
ATOM 6128  H HD2  . LYS A 1 13 ? -3.124  -2.237  14.936  1.00 0.00 ? 13  LYS A HD2  5  
ATOM 6129  H HD3  . LYS A 1 13 ? -2.194  -3.604  14.321  1.00 0.00 ? 13  LYS A HD3  5  
ATOM 6130  H HE2  . LYS A 1 13 ? -3.333  -1.413  12.588  1.00 0.00 ? 13  LYS A HE2  5  
ATOM 6131  H HE3  . LYS A 1 13 ? -1.688  -1.415  13.219  1.00 0.00 ? 13  LYS A HE3  5  
ATOM 6132  H HZ1  . LYS A 1 13 ? -1.337  -3.547  12.053  1.00 0.00 ? 13  LYS A HZ1  5  
ATOM 6133  H HZ2  . LYS A 1 13 ? -1.680  -2.270  10.997  1.00 0.00 ? 13  LYS A HZ2  5  
ATOM 6134  H HZ3  . LYS A 1 13 ? -2.876  -3.408  11.364  1.00 0.00 ? 13  LYS A HZ3  5  
ATOM 6135  N N    . GLN A 1 14 ? -7.563  -5.507  13.192  1.00 0.00 ? 14  GLN A N    5  
ATOM 6136  C CA   . GLN A 1 14 ? -8.132  -6.695  13.825  1.00 0.00 ? 14  GLN A CA   5  
ATOM 6137  C C    . GLN A 1 14 ? -7.036  -7.686  14.221  1.00 0.00 ? 14  GLN A C    5  
ATOM 6138  O O    . GLN A 1 14 ? -7.111  -8.315  15.278  1.00 0.00 ? 14  GLN A O    5  
ATOM 6139  C CB   . GLN A 1 14 ? -9.129  -7.365  12.880  1.00 0.00 ? 14  GLN A CB   5  
ATOM 6140  C CG   . GLN A 1 14 ? -10.314 -7.990  13.599  1.00 0.00 ? 14  GLN A CG   5  
ATOM 6141  C CD   . GLN A 1 14 ? -10.442 -9.479  13.337  1.00 0.00 ? 14  GLN A CD   5  
ATOM 6142  O OE1  . GLN A 1 14 ? -11.525 -9.972  13.026  1.00 0.00 ? 14  GLN A OE1  5  
ATOM 6143  N NE2  . GLN A 1 14 ? -9.337  -10.207 13.464  1.00 0.00 ? 14  GLN A NE2  5  
ATOM 6144  H H    . GLN A 1 14 ? -7.380  -5.523  12.229  1.00 0.00 ? 14  GLN A H    5  
ATOM 6145  H HA   . GLN A 1 14 ? -8.653  -6.382  14.716  1.00 0.00 ? 14  GLN A HA   5  
ATOM 6146  H HB2  . GLN A 1 14 ? -9.505  -6.625  12.188  1.00 0.00 ? 14  GLN A HB2  5  
ATOM 6147  H HB3  . GLN A 1 14 ? -8.620  -8.139  12.326  1.00 0.00 ? 14  GLN A HB3  5  
ATOM 6148  H HG2  . GLN A 1 14 ? -10.195 -7.837  14.661  1.00 0.00 ? 14  GLN A HG2  5  
ATOM 6149  H HG3  . GLN A 1 14 ? -11.218 -7.501  13.266  1.00 0.00 ? 14  GLN A HG3  5  
ATOM 6150  H HE21 . GLN A 1 14 ? -8.506  -9.754  13.718  1.00 0.00 ? 14  GLN A HE21 5  
ATOM 6151  H HE22 . GLN A 1 14 ? -9.398  -11.168 13.295  1.00 0.00 ? 14  GLN A HE22 5  
ATOM 6152  N N    . ASN A 1 15 ? -6.022  -7.818  13.364  1.00 0.00 ? 15  ASN A N    5  
ATOM 6153  C CA   . ASN A 1 15 ? -4.904  -8.727  13.614  1.00 0.00 ? 15  ASN A CA   5  
ATOM 6154  C C    . ASN A 1 15 ? -3.701  -8.355  12.738  1.00 0.00 ? 15  ASN A C    5  
ATOM 6155  O O    . ASN A 1 15 ? -3.045  -9.223  12.158  1.00 0.00 ? 15  ASN A O    5  
ATOM 6156  C CB   . ASN A 1 15 ? -5.333  -10.178 13.353  1.00 0.00 ? 15  ASN A CB   5  
ATOM 6157  C CG   . ASN A 1 15 ? -4.292  -11.183 13.812  1.00 0.00 ? 15  ASN A CG   5  
ATOM 6158  O OD1  . ASN A 1 15 ? -3.742  -11.933 13.006  1.00 0.00 ? 15  ASN A OD1  5  
ATOM 6159  N ND2  . ASN A 1 15 ? -4.012  -11.203 15.112  1.00 0.00 ? 15  ASN A ND2  5  
ATOM 6160  H H    . ASN A 1 15 ? -6.025  -7.290  12.540  1.00 0.00 ? 15  ASN A H    5  
ATOM 6161  H HA   . ASN A 1 15 ? -4.621  -8.627  14.652  1.00 0.00 ? 15  ASN A HA   5  
ATOM 6162  H HB2  . ASN A 1 15 ? -6.254  -10.375 13.882  1.00 0.00 ? 15  ASN A HB2  5  
ATOM 6163  H HB3  . ASN A 1 15 ? -5.496  -10.314 12.294  1.00 0.00 ? 15  ASN A HB3  5  
ATOM 6164  H HD21 . ASN A 1 15 ? -4.487  -10.578 15.701  1.00 0.00 ? 15  ASN A HD21 5  
ATOM 6165  H HD22 . ASN A 1 15 ? -3.340  -11.842 15.430  1.00 0.00 ? 15  ASN A HD22 5  
ATOM 6166  N N    . GLY A 1 16 ? -3.425  -7.052  12.639  1.00 0.00 ? 16  GLY A N    5  
ATOM 6167  C CA   . GLY A 1 16 ? -2.314  -6.584  11.826  1.00 0.00 ? 16  GLY A CA   5  
ATOM 6168  C C    . GLY A 1 16 ? -2.624  -6.652  10.340  1.00 0.00 ? 16  GLY A C    5  
ATOM 6169  O O    . GLY A 1 16 ? -3.495  -7.415  9.919   1.00 0.00 ? 16  GLY A O    5  
ATOM 6170  H H    . GLY A 1 16 ? -3.983  -6.404  13.117  1.00 0.00 ? 16  GLY A H    5  
ATOM 6171  H HA2  . GLY A 1 16 ? -2.092  -5.561  12.091  1.00 0.00 ? 16  GLY A HA2  5  
ATOM 6172  H HA3  . GLY A 1 16 ? -1.448  -7.195  12.031  1.00 0.00 ? 16  GLY A HA3  5  
ATOM 6173  N N    . MET A 1 17 ? -1.910  -5.857  9.542   1.00 0.00 ? 17  MET A N    5  
ATOM 6174  C CA   . MET A 1 17 ? -2.117  -5.840  8.095   1.00 0.00 ? 17  MET A CA   5  
ATOM 6175  C C    . MET A 1 17 ? -1.738  -7.187  7.483   1.00 0.00 ? 17  MET A C    5  
ATOM 6176  O O    . MET A 1 17 ? -2.557  -7.827  6.820   1.00 0.00 ? 17  MET A O    5  
ATOM 6177  C CB   . MET A 1 17 ? -1.302  -4.716  7.444   1.00 0.00 ? 17  MET A CB   5  
ATOM 6178  C CG   . MET A 1 17 ? -2.069  -3.410  7.307   1.00 0.00 ? 17  MET A CG   5  
ATOM 6179  S SD   . MET A 1 17 ? -1.735  -2.568  5.746   1.00 0.00 ? 17  MET A SD   5  
ATOM 6180  C CE   . MET A 1 17 ? -0.063  -1.988  6.017   1.00 0.00 ? 17  MET A CE   5  
ATOM 6181  H H    . MET A 1 17 ? -1.227  -5.272  9.934   1.00 0.00 ? 17  MET A H    5  
ATOM 6182  H HA   . MET A 1 17 ? -3.168  -5.662  7.915   1.00 0.00 ? 17  MET A HA   5  
ATOM 6183  H HB2  . MET A 1 17 ? -0.421  -4.531  8.041   1.00 0.00 ? 17  MET A HB2  5  
ATOM 6184  H HB3  . MET A 1 17 ? -0.997  -5.033  6.457   1.00 0.00 ? 17  MET A HB3  5  
ATOM 6185  H HG2  . MET A 1 17 ? -3.127  -3.623  7.365   1.00 0.00 ? 17  MET A HG2  5  
ATOM 6186  H HG3  . MET A 1 17 ? -1.791  -2.757  8.120   1.00 0.00 ? 17  MET A HG3  5  
ATOM 6187  H HE1  . MET A 1 17 ? 0.288   -1.482  5.130   1.00 0.00 ? 17  MET A HE1  5  
ATOM 6188  H HE2  . MET A 1 17 ? 0.580   -2.830  6.230   1.00 0.00 ? 17  MET A HE2  5  
ATOM 6189  H HE3  . MET A 1 17 ? -0.049  -1.303  6.852   1.00 0.00 ? 17  MET A HE3  5  
ATOM 6190  N N    . GLY A 1 18 ? -0.496  -7.616  7.724   1.00 0.00 ? 18  GLY A N    5  
ATOM 6191  C CA   . GLY A 1 18 ? -0.024  -8.889  7.206   1.00 0.00 ? 18  GLY A CA   5  
ATOM 6192  C C    . GLY A 1 18 ? -0.043  -8.953  5.691   1.00 0.00 ? 18  GLY A C    5  
ATOM 6193  O O    . GLY A 1 18 ? -0.948  -9.544  5.106   1.00 0.00 ? 18  GLY A O    5  
ATOM 6194  H H    . GLY A 1 18 ? 0.105   -7.062  8.267   1.00 0.00 ? 18  GLY A H    5  
ATOM 6195  H HA2  . GLY A 1 18 ? 0.987   -9.050  7.548   1.00 0.00 ? 18  GLY A HA2  5  
ATOM 6196  H HA3  . GLY A 1 18 ? -0.652  -9.677  7.596   1.00 0.00 ? 18  GLY A HA3  5  
ATOM 6197  N N    . LEU A 1 19 ? 0.957   -8.344  5.057   1.00 0.00 ? 19  LEU A N    5  
ATOM 6198  C CA   . LEU A 1 19 ? 1.057   -8.341  3.596   1.00 0.00 ? 19  LEU A CA   5  
ATOM 6199  C C    . LEU A 1 19 ? 2.479   -8.012  3.141   1.00 0.00 ? 19  LEU A C    5  
ATOM 6200  O O    . LEU A 1 19 ? 3.356   -7.746  3.960   1.00 0.00 ? 19  LEU A O    5  
ATOM 6201  C CB   . LEU A 1 19 ? 0.065   -7.344  2.989   1.00 0.00 ? 19  LEU A CB   5  
ATOM 6202  C CG   . LEU A 1 19 ? 0.357   -5.879  3.304   1.00 0.00 ? 19  LEU A CG   5  
ATOM 6203  C CD1  . LEU A 1 19 ? 1.274   -5.276  2.250   1.00 0.00 ? 19  LEU A CD1  5  
ATOM 6204  C CD2  . LEU A 1 19 ? -0.934  -5.082  3.411   1.00 0.00 ? 19  LEU A CD2  5  
ATOM 6205  H H    . LEU A 1 19 ? 1.651   -7.890  5.584   1.00 0.00 ? 19  LEU A H    5  
ATOM 6206  H HA   . LEU A 1 19 ? 0.808   -9.332  3.248   1.00 0.00 ? 19  LEU A HA   5  
ATOM 6207  H HB2  . LEU A 1 19 ? 0.071   -7.471  1.916   1.00 0.00 ? 19  LEU A HB2  5  
ATOM 6208  H HB3  . LEU A 1 19 ? -0.922  -7.579  3.358   1.00 0.00 ? 19  LEU A HB3  5  
ATOM 6209  H HG   . LEU A 1 19 ? 0.863   -5.827  4.254   1.00 0.00 ? 19  LEU A HG   5  
ATOM 6210  H HD11 . LEU A 1 19 ? 1.159   -4.202  2.243   1.00 0.00 ? 19  LEU A HD11 5  
ATOM 6211  H HD12 . LEU A 1 19 ? 1.017   -5.671  1.278   1.00 0.00 ? 19  LEU A HD12 5  
ATOM 6212  H HD13 . LEU A 1 19 ? 2.299   -5.525  2.480   1.00 0.00 ? 19  LEU A HD13 5  
ATOM 6213  H HD21 . LEU A 1 19 ? -1.476  -5.391  4.292   1.00 0.00 ? 19  LEU A HD21 5  
ATOM 6214  H HD22 . LEU A 1 19 ? -1.541  -5.258  2.535   1.00 0.00 ? 19  LEU A HD22 5  
ATOM 6215  H HD23 . LEU A 1 19 ? -0.702  -4.030  3.482   1.00 0.00 ? 19  LEU A HD23 5  
ATOM 6216  N N    . SER A 1 20 ? 2.693   -8.029  1.826   1.00 0.00 ? 20  SER A N    5  
ATOM 6217  C CA   . SER A 1 20 ? 4.001   -7.731  1.248   1.00 0.00 ? 20  SER A CA   5  
ATOM 6218  C C    . SER A 1 20 ? 3.900   -6.606  0.218   1.00 0.00 ? 20  SER A C    5  
ATOM 6219  O O    . SER A 1 20 ? 2.846   -6.404  -0.390  1.00 0.00 ? 20  SER A O    5  
ATOM 6220  C CB   . SER A 1 20 ? 4.585   -8.986  0.599   1.00 0.00 ? 20  SER A CB   5  
ATOM 6221  O OG   . SER A 1 20 ? 5.556   -9.589  1.437   1.00 0.00 ? 20  SER A OG   5  
ATOM 6222  H H    . SER A 1 20 ? 1.947   -8.245  1.226   1.00 0.00 ? 20  SER A H    5  
ATOM 6223  H HA   . SER A 1 20 ? 4.652   -7.411  2.047   1.00 0.00 ? 20  SER A HA   5  
ATOM 6224  H HB2  . SER A 1 20 ? 3.792   -9.696  0.421   1.00 0.00 ? 20  SER A HB2  5  
ATOM 6225  H HB3  . SER A 1 20 ? 5.050   -8.722  -0.339  1.00 0.00 ? 20  SER A HB3  5  
ATOM 6226  H HG   . SER A 1 20 ? 6.265   -8.961  1.611   1.00 0.00 ? 20  SER A HG   5  
ATOM 6227  N N    . ILE A 1 21 ? 5.000   -5.872  0.029   1.00 0.00 ? 21  ILE A N    5  
ATOM 6228  C CA   . ILE A 1 21 ? 5.026   -4.761  -0.923  1.00 0.00 ? 21  ILE A CA   5  
ATOM 6229  C C    . ILE A 1 21 ? 6.384   -4.630  -1.618  1.00 0.00 ? 21  ILE A C    5  
ATOM 6230  O O    . ILE A 1 21 ? 7.402   -5.108  -1.115  1.00 0.00 ? 21  ILE A O    5  
ATOM 6231  C CB   . ILE A 1 21 ? 4.682   -3.420  -0.232  1.00 0.00 ? 21  ILE A CB   5  
ATOM 6232  C CG1  . ILE A 1 21 ? 5.505   -3.238  1.047   1.00 0.00 ? 21  ILE A CG1  5  
ATOM 6233  C CG2  . ILE A 1 21 ? 3.194   -3.353  0.080   1.00 0.00 ? 21  ILE A CG2  5  
ATOM 6234  C CD1  . ILE A 1 21 ? 6.954   -2.895  0.789   1.00 0.00 ? 21  ILE A CD1  5  
ATOM 6235  H H    . ILE A 1 21 ? 5.808   -6.078  0.546   1.00 0.00 ? 21  ILE A H    5  
ATOM 6236  H HA   . ILE A 1 21 ? 4.274   -4.954  -1.673  1.00 0.00 ? 21  ILE A HA   5  
ATOM 6237  H HB   . ILE A 1 21 ? 4.914   -2.618  -0.918  1.00 0.00 ? 21  ILE A HB   5  
ATOM 6238  H HG12 . ILE A 1 21 ? 5.077   -2.437  1.633   1.00 0.00 ? 21  ILE A HG12 5  
ATOM 6239  H HG13 . ILE A 1 21 ? 5.476   -4.152  1.622   1.00 0.00 ? 21  ILE A HG13 5  
ATOM 6240  H HG21 . ILE A 1 21 ? 2.876   -2.321  0.102   1.00 0.00 ? 21  ILE A HG21 5  
ATOM 6241  H HG22 . ILE A 1 21 ? 3.008   -3.807  1.043   1.00 0.00 ? 21  ILE A HG22 5  
ATOM 6242  H HG23 . ILE A 1 21 ? 2.642   -3.884  -0.680  1.00 0.00 ? 21  ILE A HG23 5  
ATOM 6243  H HD11 . ILE A 1 21 ? 7.279   -2.143  1.492   1.00 0.00 ? 21  ILE A HD11 5  
ATOM 6244  H HD12 . ILE A 1 21 ? 7.059   -2.517  -0.217  1.00 0.00 ? 21  ILE A HD12 5  
ATOM 6245  H HD13 . ILE A 1 21 ? 7.560   -3.781  0.905   1.00 0.00 ? 21  ILE A HD13 5  
ATOM 6246  N N    . VAL A 1 22 ? 6.383   -3.971  -2.779  1.00 0.00 ? 22  VAL A N    5  
ATOM 6247  C CA   . VAL A 1 22 ? 7.606   -3.759  -3.555  1.00 0.00 ? 22  VAL A CA   5  
ATOM 6248  C C    . VAL A 1 22 ? 7.531   -2.460  -4.361  1.00 0.00 ? 22  VAL A C    5  
ATOM 6249  O O    . VAL A 1 22 ? 6.477   -2.106  -4.892  1.00 0.00 ? 22  VAL A O    5  
ATOM 6250  C CB   . VAL A 1 22 ? 7.886   -4.945  -4.513  1.00 0.00 ? 22  VAL A CB   5  
ATOM 6251  C CG1  . VAL A 1 22 ? 6.644   -5.307  -5.316  1.00 0.00 ? 22  VAL A CG1  5  
ATOM 6252  C CG2  . VAL A 1 22 ? 9.057   -4.631  -5.441  1.00 0.00 ? 22  VAL A CG2  5  
ATOM 6253  H H    . VAL A 1 22 ? 5.537   -3.610  -3.121  1.00 0.00 ? 22  VAL A H    5  
ATOM 6254  H HA   . VAL A 1 22 ? 8.429   -3.687  -2.858  1.00 0.00 ? 22  VAL A HA   5  
ATOM 6255  H HB   . VAL A 1 22 ? 8.156   -5.802  -3.913  1.00 0.00 ? 22  VAL A HB   5  
ATOM 6256  H HG11 . VAL A 1 22 ? 6.768   -4.982  -6.339  1.00 0.00 ? 22  VAL A HG11 5  
ATOM 6257  H HG12 . VAL A 1 22 ? 5.780   -4.821  -4.887  1.00 0.00 ? 22  VAL A HG12 5  
ATOM 6258  H HG13 . VAL A 1 22 ? 6.501   -6.377  -5.294  1.00 0.00 ? 22  VAL A HG13 5  
ATOM 6259  H HG21 . VAL A 1 22 ? 8.682   -4.247  -6.378  1.00 0.00 ? 22  VAL A HG21 5  
ATOM 6260  H HG22 . VAL A 1 22 ? 9.624   -5.532  -5.623  1.00 0.00 ? 22  VAL A HG22 5  
ATOM 6261  H HG23 . VAL A 1 22 ? 9.696   -3.893  -4.979  1.00 0.00 ? 22  VAL A HG23 5  
ATOM 6262  N N    . ALA A 1 23 ? 8.659   -1.754  -4.442  1.00 0.00 ? 23  ALA A N    5  
ATOM 6263  C CA   . ALA A 1 23 ? 8.732   -0.494  -5.177  1.00 0.00 ? 23  ALA A CA   5  
ATOM 6264  C C    . ALA A 1 23 ? 8.885   -0.736  -6.677  1.00 0.00 ? 23  ALA A C    5  
ATOM 6265  O O    . ALA A 1 23 ? 9.473   -1.735  -7.097  1.00 0.00 ? 23  ALA A O    5  
ATOM 6266  C CB   . ALA A 1 23 ? 9.884   0.355   -4.656  1.00 0.00 ? 23  ALA A CB   5  
ATOM 6267  H H    . ALA A 1 23 ? 9.464   -2.091  -3.995  1.00 0.00 ? 23  ALA A H    5  
ATOM 6268  H HA   . ALA A 1 23 ? 7.812   0.045   -5.002  1.00 0.00 ? 23  ALA A HA   5  
ATOM 6269  H HB1  . ALA A 1 23 ? 9.972   0.227   -3.587  1.00 0.00 ? 23  ALA A HB1  5  
ATOM 6270  H HB2  . ALA A 1 23 ? 9.695   1.394   -4.879  1.00 0.00 ? 23  ALA A HB2  5  
ATOM 6271  H HB3  . ALA A 1 23 ? 10.804  0.045   -5.132  1.00 0.00 ? 23  ALA A HB3  5  
ATOM 6272  N N    . ALA A 1 24 ? 8.355   0.186   -7.479  1.00 0.00 ? 24  ALA A N    5  
ATOM 6273  C CA   . ALA A 1 24 ? 8.432   0.076   -8.933  1.00 0.00 ? 24  ALA A CA   5  
ATOM 6274  C C    . ALA A 1 24 ? 8.537   1.450   -9.589  1.00 0.00 ? 24  ALA A C    5  
ATOM 6275  O O    . ALA A 1 24 ? 7.808   2.377   -9.230  1.00 0.00 ? 24  ALA A O    5  
ATOM 6276  C CB   . ALA A 1 24 ? 7.221   -0.674  -9.472  1.00 0.00 ? 24  ALA A CB   5  
ATOM 6277  H H    . ALA A 1 24 ? 7.901   0.960   -7.084  1.00 0.00 ? 24  ALA A H    5  
ATOM 6278  H HA   . ALA A 1 24 ? 9.317   -0.495  -9.177  1.00 0.00 ? 24  ALA A HA   5  
ATOM 6279  H HB1  . ALA A 1 24 ? 6.418   0.024   -9.656  1.00 0.00 ? 24  ALA A HB1  5  
ATOM 6280  H HB2  . ALA A 1 24 ? 6.902   -1.410  -8.748  1.00 0.00 ? 24  ALA A HB2  5  
ATOM 6281  H HB3  . ALA A 1 24 ? 7.486   -1.169  -10.395 1.00 0.00 ? 24  ALA A HB3  5  
ATOM 6282  N N    . LYS A 1 25 ? 9.446   1.571   -10.557 1.00 0.00 ? 25  LYS A N    5  
ATOM 6283  C CA   . LYS A 1 25 ? 9.649   2.828   -11.275 1.00 0.00 ? 25  LYS A CA   5  
ATOM 6284  C C    . LYS A 1 25 ? 9.385   2.651   -12.771 1.00 0.00 ? 25  LYS A C    5  
ATOM 6285  O O    . LYS A 1 25 ? 9.051   1.556   -13.228 1.00 0.00 ? 25  LYS A O    5  
ATOM 6286  C CB   . LYS A 1 25 ? 11.074  3.346   -11.048 1.00 0.00 ? 25  LYS A CB   5  
ATOM 6287  C CG   . LYS A 1 25 ? 11.130  4.815   -10.662 1.00 0.00 ? 25  LYS A CG   5  
ATOM 6288  C CD   . LYS A 1 25 ? 12.528  5.230   -10.235 1.00 0.00 ? 25  LYS A CD   5  
ATOM 6289  C CE   . LYS A 1 25 ? 12.609  6.728   -9.973  1.00 0.00 ? 25  LYS A CE   5  
ATOM 6290  N NZ   . LYS A 1 25 ? 13.462  7.047   -8.792  1.00 0.00 ? 25  LYS A NZ   5  
ATOM 6291  H H    . LYS A 1 25 ? 9.992   0.793   -10.798 1.00 0.00 ? 25  LYS A H    5  
ATOM 6292  H HA   . LYS A 1 25 ? 8.947   3.549   -10.883 1.00 0.00 ? 25  LYS A HA   5  
ATOM 6293  H HB2  . LYS A 1 25 ? 11.534  2.770   -10.258 1.00 0.00 ? 25  LYS A HB2  5  
ATOM 6294  H HB3  . LYS A 1 25 ? 11.644  3.213   -11.956 1.00 0.00 ? 25  LYS A HB3  5  
ATOM 6295  H HG2  . LYS A 1 25 ? 10.833  5.412   -11.512 1.00 0.00 ? 25  LYS A HG2  5  
ATOM 6296  H HG3  . LYS A 1 25 ? 10.446  4.987   -9.843  1.00 0.00 ? 25  LYS A HG3  5  
ATOM 6297  H HD2  . LYS A 1 25 ? 12.789  4.701   -9.331  1.00 0.00 ? 25  LYS A HD2  5  
ATOM 6298  H HD3  . LYS A 1 25 ? 13.225  4.973   -11.019 1.00 0.00 ? 25  LYS A HD3  5  
ATOM 6299  H HE2  . LYS A 1 25 ? 13.025  7.210   -10.845 1.00 0.00 ? 25  LYS A HE2  5  
ATOM 6300  H HE3  . LYS A 1 25 ? 11.611  7.103   -9.797  1.00 0.00 ? 25  LYS A HE3  5  
ATOM 6301  H HZ1  . LYS A 1 25 ? 13.095  7.890   -8.305  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 6302  H HZ2  . LYS A 1 25 ? 14.438  7.237   -9.097  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 6303  H HZ3  . LYS A 1 25 ? 13.468  6.249   -8.125  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 6304  N N    . GLY A 1 26 ? 9.540   3.738   -13.528 1.00 0.00 ? 26  GLY A N    5  
ATOM 6305  C CA   . GLY A 1 26 ? 9.318   3.694   -14.959 1.00 0.00 ? 26  GLY A CA   5  
ATOM 6306  C C    . GLY A 1 26 ? 9.933   4.883   -15.656 1.00 0.00 ? 26  GLY A C    5  
ATOM 6307  O O    . GLY A 1 26 ? 11.048  5.295   -15.327 1.00 0.00 ? 26  GLY A O    5  
ATOM 6308  H H    . GLY A 1 26 ? 9.810   4.585   -13.111 1.00 0.00 ? 26  GLY A H    5  
ATOM 6309  H HA2  . GLY A 1 26 ? 9.749   2.792   -15.360 1.00 0.00 ? 26  GLY A HA2  5  
ATOM 6310  H HA3  . GLY A 1 26 ? 8.254   3.689   -15.148 1.00 0.00 ? 26  GLY A HA3  5  
ATOM 6311  N N    . ALA A 1 27 ? 9.203   5.445   -16.608 1.00 0.00 ? 27  ALA A N    5  
ATOM 6312  C CA   . ALA A 1 27 ? 9.679   6.607   -17.343 1.00 0.00 ? 27  ALA A CA   5  
ATOM 6313  C C    . ALA A 1 27 ? 8.878   7.851   -16.971 1.00 0.00 ? 27  ALA A C    5  
ATOM 6314  O O    . ALA A 1 27 ? 7.669   7.775   -16.741 1.00 0.00 ? 27  ALA A O    5  
ATOM 6315  C CB   . ALA A 1 27 ? 9.617   6.358   -18.844 1.00 0.00 ? 27  ALA A CB   5  
ATOM 6316  H H    . ALA A 1 27 ? 8.320   5.074   -16.813 1.00 0.00 ? 27  ALA A H    5  
ATOM 6317  H HA   . ALA A 1 27 ? 10.713  6.761   -17.065 1.00 0.00 ? 27  ALA A HA   5  
ATOM 6318  H HB1  . ALA A 1 27 ? 10.021  5.382   -19.065 1.00 0.00 ? 27  ALA A HB1  5  
ATOM 6319  H HB2  . ALA A 1 27 ? 10.195  7.112   -19.357 1.00 0.00 ? 27  ALA A HB2  5  
ATOM 6320  H HB3  . ALA A 1 27 ? 8.589   6.407   -19.174 1.00 0.00 ? 27  ALA A HB3  5  
ATOM 6321  N N    . GLY A 1 28 ? 9.565   8.993   -16.900 1.00 0.00 ? 28  GLY A N    5  
ATOM 6322  C CA   . GLY A 1 28 ? 8.908   10.239  -16.538 1.00 0.00 ? 28  GLY A CA   5  
ATOM 6323  C C    . GLY A 1 28 ? 8.318   10.183  -15.142 1.00 0.00 ? 28  GLY A C    5  
ATOM 6324  O O    . GLY A 1 28 ? 7.183   10.612  -14.920 1.00 0.00 ? 28  GLY A O    5  
ATOM 6325  H H    . GLY A 1 28 ? 10.527  8.986   -17.084 1.00 0.00 ? 28  GLY A H    5  
ATOM 6326  H HA2  . GLY A 1 28 ? 9.629   11.042  -16.583 1.00 0.00 ? 28  GLY A HA2  5  
ATOM 6327  H HA3  . GLY A 1 28 ? 8.117   10.438  -17.246 1.00 0.00 ? 28  GLY A HA3  5  
ATOM 6328  N N    . GLN A 1 29 ? 9.089   9.637   -14.201 1.00 0.00 ? 29  GLN A N    5  
ATOM 6329  C CA   . GLN A 1 29 ? 8.645   9.503   -12.819 1.00 0.00 ? 29  GLN A CA   5  
ATOM 6330  C C    . GLN A 1 29 ? 9.735   9.945   -11.849 1.00 0.00 ? 29  GLN A C    5  
ATOM 6331  O O    . GLN A 1 29 ? 10.738  9.249   -11.668 1.00 0.00 ? 29  GLN A O    5  
ATOM 6332  C CB   . GLN A 1 29 ? 8.256   8.052   -12.534 1.00 0.00 ? 29  GLN A CB   5  
ATOM 6333  C CG   . GLN A 1 29 ? 7.167   7.904   -11.483 1.00 0.00 ? 29  GLN A CG   5  
ATOM 6334  C CD   . GLN A 1 29 ? 5.874   7.353   -12.056 1.00 0.00 ? 29  GLN A CD   5  
ATOM 6335  O OE1  . GLN A 1 29 ? 4.801   7.917   -11.845 1.00 0.00 ? 29  GLN A OE1  5  
ATOM 6336  N NE2  . GLN A 1 29 ? 5.968   6.245   -12.785 1.00 0.00 ? 29  GLN A NE2  5  
ATOM 6337  H H    . GLN A 1 29 ? 9.979   9.306   -14.445 1.00 0.00 ? 29  GLN A H    5  
ATOM 6338  H HA   . GLN A 1 29 ? 7.777   10.131  -12.685 1.00 0.00 ? 29  GLN A HA   5  
ATOM 6339  H HB2  . GLN A 1 29 ? 7.905   7.601   -13.451 1.00 0.00 ? 29  GLN A HB2  5  
ATOM 6340  H HB3  . GLN A 1 29 ? 9.130   7.517   -12.193 1.00 0.00 ? 29  GLN A HB3  5  
ATOM 6341  H HG2  . GLN A 1 29 ? 7.516   7.232   -10.714 1.00 0.00 ? 29  GLN A HG2  5  
ATOM 6342  H HG3  . GLN A 1 29 ? 6.968   8.873   -11.050 1.00 0.00 ? 29  GLN A HG3  5  
ATOM 6343  H HE21 . GLN A 1 29 ? 6.854   5.846   -12.913 1.00 0.00 ? 29  GLN A HE21 5  
ATOM 6344  H HE22 . GLN A 1 29 ? 5.148   5.875   -13.167 1.00 0.00 ? 29  GLN A HE22 5  
ATOM 6345  N N    . ASP A 1 30 ? 9.530   11.100  -11.221 1.00 0.00 ? 30  ASP A N    5  
ATOM 6346  C CA   . ASP A 1 30 ? 10.492  11.633  -10.258 1.00 0.00 ? 30  ASP A CA   5  
ATOM 6347  C C    . ASP A 1 30 ? 10.176  11.165  -8.833  1.00 0.00 ? 30  ASP A C    5  
ATOM 6348  O O    . ASP A 1 30 ? 10.589  11.795  -7.857  1.00 0.00 ? 30  ASP A O    5  
ATOM 6349  C CB   . ASP A 1 30 ? 10.510  13.164  -10.321 1.00 0.00 ? 30  ASP A CB   5  
ATOM 6350  C CG   . ASP A 1 30 ? 11.812  13.748  -9.809  1.00 0.00 ? 30  ASP A CG   5  
ATOM 6351  O OD1  . ASP A 1 30 ? 12.867  13.472  -10.418 1.00 0.00 ? 30  ASP A OD1  5  
ATOM 6352  O OD2  . ASP A 1 30 ? 11.776  14.481  -8.797  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 6353  H H    . ASP A 1 30 ? 8.709   11.604  -11.405 1.00 0.00 ? 30  ASP A H    5  
ATOM 6354  H HA   . ASP A 1 30 ? 11.467  11.261  -10.532 1.00 0.00 ? 30  ASP A HA   5  
ATOM 6355  H HB2  . ASP A 1 30 ? 10.376  13.477  -11.346 1.00 0.00 ? 30  ASP A HB2  5  
ATOM 6356  H HB3  . ASP A 1 30 ? 9.700   13.554  -9.721  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 6357  N N    . LYS A 1 31 ? 9.446   10.053  -8.721  1.00 0.00 ? 31  LYS A N    5  
ATOM 6358  C CA   . LYS A 1 31 ? 9.077   9.494   -7.425  1.00 0.00 ? 31  LYS A CA   5  
ATOM 6359  C C    . LYS A 1 31 ? 9.077   7.964   -7.477  1.00 0.00 ? 31  LYS A C    5  
ATOM 6360  O O    . LYS A 1 31 ? 9.502   7.369   -8.471  1.00 0.00 ? 31  LYS A O    5  
ATOM 6361  C CB   . LYS A 1 31 ? 7.694   10.009  -7.001  1.00 0.00 ? 31  LYS A CB   5  
ATOM 6362  C CG   . LYS A 1 31 ? 7.579   11.527  -6.984  1.00 0.00 ? 31  LYS A CG   5  
ATOM 6363  C CD   . LYS A 1 31 ? 8.299   12.130  -5.787  1.00 0.00 ? 31  LYS A CD   5  
ATOM 6364  C CE   . LYS A 1 31 ? 8.056   13.628  -5.682  1.00 0.00 ? 31  LYS A CE   5  
ATOM 6365  N NZ   . LYS A 1 31 ? 9.277   14.418  -6.009  1.00 0.00 ? 31  LYS A NZ   5  
ATOM 6366  H H    . LYS A 1 31 ? 9.152   9.593   -9.531  1.00 0.00 ? 31  LYS A H    5  
ATOM 6367  H HA   . LYS A 1 31 ? 9.811   9.818   -6.702  1.00 0.00 ? 31  LYS A HA   5  
ATOM 6368  H HB2  . LYS A 1 31 ? 6.954   9.622   -7.686  1.00 0.00 ? 31  LYS A HB2  5  
ATOM 6369  H HB3  . LYS A 1 31 ? 7.476   9.644   -6.008  1.00 0.00 ? 31  LYS A HB3  5  
ATOM 6370  H HG2  . LYS A 1 31 ? 8.015   11.922  -7.890  1.00 0.00 ? 31  LYS A HG2  5  
ATOM 6371  H HG3  . LYS A 1 31 ? 6.535   11.798  -6.938  1.00 0.00 ? 31  LYS A HG3  5  
ATOM 6372  H HD2  . LYS A 1 31 ? 7.940   11.655  -4.887  1.00 0.00 ? 31  LYS A HD2  5  
ATOM 6373  H HD3  . LYS A 1 31 ? 9.360   11.952  -5.890  1.00 0.00 ? 31  LYS A HD3  5  
ATOM 6374  H HE2  . LYS A 1 31 ? 7.268   13.902  -6.368  1.00 0.00 ? 31  LYS A HE2  5  
ATOM 6375  H HE3  . LYS A 1 31 ? 7.748   13.859  -4.672  1.00 0.00 ? 31  LYS A HE3  5  
ATOM 6376  H HZ1  . LYS A 1 31 ? 10.066  14.127  -5.396  1.00 0.00 ? 31  LYS A HZ1  5  
ATOM 6377  H HZ2  . LYS A 1 31 ? 9.097   15.432  -5.863  1.00 0.00 ? 31  LYS A HZ2  5  
ATOM 6378  H HZ3  . LYS A 1 31 ? 9.549   14.265  -7.003  1.00 0.00 ? 31  LYS A HZ3  5  
ATOM 6379  N N    . LEU A 1 32 ? 8.597   7.333   -6.405  1.00 0.00 ? 32  LEU A N    5  
ATOM 6380  C CA   . LEU A 1 32 ? 8.540   5.876   -6.330  1.00 0.00 ? 32  LEU A CA   5  
ATOM 6381  C C    . LEU A 1 32 ? 7.203   5.412   -5.759  1.00 0.00 ? 32  LEU A C    5  
ATOM 6382  O O    . LEU A 1 32 ? 6.702   5.982   -4.786  1.00 0.00 ? 32  LEU A O    5  
ATOM 6383  C CB   . LEU A 1 32 ? 9.690   5.339   -5.474  1.00 0.00 ? 32  LEU A CB   5  
ATOM 6384  C CG   . LEU A 1 32 ? 10.297  4.019   -5.957  1.00 0.00 ? 32  LEU A CG   5  
ATOM 6385  C CD1  . LEU A 1 32 ? 10.762  4.138   -7.403  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 6386  C CD2  . LEU A 1 32 ? 11.449  3.606   -5.053  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 6387  H H    . LEU A 1 32 ? 8.273   7.859   -5.646  1.00 0.00 ? 32  LEU A H    5  
ATOM 6388  H HA   . LEU A 1 32 ? 8.641   5.491   -7.334  1.00 0.00 ? 32  LEU A HA   5  
ATOM 6389  H HB2  . LEU A 1 32 ? 10.473  6.085   -5.451  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 6390  H HB3  . LEU A 1 32 ? 9.326   5.195   -4.468  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 6391  H HG   . LEU A 1 32 ? 9.543   3.247   -5.913  1.00 0.00 ? 32  LEU A HG   5  
ATOM 6392  H HD11 . LEU A 1 32 ? 11.601  3.477   -7.567  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 6393  H HD12 . LEU A 1 32 ? 11.062  5.156   -7.603  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 6394  H HD13 . LEU A 1 32 ? 9.954   3.864   -8.065  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 6395  H HD21 . LEU A 1 32 ? 12.257  4.316   -5.151  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 6396  H HD22 . LEU A 1 32 ? 11.796  2.624   -5.338  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 6397  H HD23 . LEU A 1 32 ? 11.111  3.584   -4.027  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 6398  N N    . GLY A 1 33 ? 6.632   4.375   -6.372  1.00 0.00 ? 33  GLY A N    5  
ATOM 6399  C CA   . GLY A 1 33 ? 5.357   3.845   -5.919  1.00 0.00 ? 33  GLY A CA   5  
ATOM 6400  C C    . GLY A 1 33 ? 5.509   2.600   -5.062  1.00 0.00 ? 33  GLY A C    5  
ATOM 6401  O O    . GLY A 1 33 ? 6.557   1.951   -5.079  1.00 0.00 ? 33  GLY A O    5  
ATOM 6402  H H    . GLY A 1 33 ? 7.082   3.965   -7.141  1.00 0.00 ? 33  GLY A H    5  
ATOM 6403  H HA2  . GLY A 1 33 ? 4.850   4.604   -5.343  1.00 0.00 ? 33  GLY A HA2  5  
ATOM 6404  H HA3  . GLY A 1 33 ? 4.757   3.601   -6.782  1.00 0.00 ? 33  GLY A HA3  5  
ATOM 6405  N N    . ILE A 1 34 ? 4.460   2.269   -4.309  1.00 0.00 ? 34  ILE A N    5  
ATOM 6406  C CA   . ILE A 1 34 ? 4.475   1.098   -3.436  1.00 0.00 ? 34  ILE A CA   5  
ATOM 6407  C C    . ILE A 1 34 ? 3.449   0.060   -3.891  1.00 0.00 ? 34  ILE A C    5  
ATOM 6408  O O    . ILE A 1 34 ? 2.250   0.216   -3.662  1.00 0.00 ? 34  ILE A O    5  
ATOM 6409  C CB   . ILE A 1 34 ? 4.195   1.489   -1.965  1.00 0.00 ? 34  ILE A CB   5  
ATOM 6410  C CG1  . ILE A 1 34 ? 5.068   2.681   -1.550  1.00 0.00 ? 34  ILE A CG1  5  
ATOM 6411  C CG2  . ILE A 1 34 ? 4.430   0.305   -1.033  1.00 0.00 ? 34  ILE A CG2  5  
ATOM 6412  C CD1  . ILE A 1 34 ? 6.556   2.445   -1.728  1.00 0.00 ? 34  ILE A CD1  5  
ATOM 6413  H H    . ILE A 1 34 ? 3.654   2.828   -4.340  1.00 0.00 ? 34  ILE A H    5  
ATOM 6414  H HA   . ILE A 1 34 ? 5.462   0.658   -3.487  1.00 0.00 ? 34  ILE A HA   5  
ATOM 6415  H HB   . ILE A 1 34 ? 3.157   1.772   -1.885  1.00 0.00 ? 34  ILE A HB   5  
ATOM 6416  H HG12 . ILE A 1 34 ? 4.799   3.539   -2.146  1.00 0.00 ? 34  ILE A HG12 5  
ATOM 6417  H HG13 . ILE A 1 34 ? 4.890   2.902   -0.508  1.00 0.00 ? 34  ILE A HG13 5  
ATOM 6418  H HG21 . ILE A 1 34 ? 4.432   -0.611  -1.605  1.00 0.00 ? 34  ILE A HG21 5  
ATOM 6419  H HG22 . ILE A 1 34 ? 3.643   0.267   -0.295  1.00 0.00 ? 34  ILE A HG22 5  
ATOM 6420  H HG23 . ILE A 1 34 ? 5.382   0.421   -0.536  1.00 0.00 ? 34  ILE A HG23 5  
ATOM 6421  H HD11 . ILE A 1 34 ? 6.741   2.026   -2.706  1.00 0.00 ? 34  ILE A HD11 5  
ATOM 6422  H HD12 . ILE A 1 34 ? 6.904   1.758   -0.971  1.00 0.00 ? 34  ILE A HD12 5  
ATOM 6423  H HD13 . ILE A 1 34 ? 7.082   3.382   -1.632  1.00 0.00 ? 34  ILE A HD13 5  
ATOM 6424  N N    . TYR A 1 35 ? 3.931   -0.999  -4.538  1.00 0.00 ? 35  TYR A N    5  
ATOM 6425  C CA   . TYR A 1 35 ? 3.059   -2.065  -5.027  1.00 0.00 ? 35  TYR A CA   5  
ATOM 6426  C C    . TYR A 1 35 ? 2.893   -3.160  -3.975  1.00 0.00 ? 35  TYR A C    5  
ATOM 6427  O O    . TYR A 1 35 ? 3.668   -3.238  -3.023  1.00 0.00 ? 35  TYR A O    5  
ATOM 6428  C CB   . TYR A 1 35 ? 3.623   -2.667  -6.317  1.00 0.00 ? 35  TYR A CB   5  
ATOM 6429  C CG   . TYR A 1 35 ? 3.516   -1.756  -7.521  1.00 0.00 ? 35  TYR A CG   5  
ATOM 6430  C CD1  . TYR A 1 35 ? 4.120   -0.503  -7.532  1.00 0.00 ? 35  TYR A CD1  5  
ATOM 6431  C CD2  . TYR A 1 35 ? 2.814   -2.154  -8.650  1.00 0.00 ? 35  TYR A CD2  5  
ATOM 6432  C CE1  . TYR A 1 35 ? 4.026   0.324   -8.634  1.00 0.00 ? 35  TYR A CE1  5  
ATOM 6433  C CE2  . TYR A 1 35 ? 2.715   -1.333  -9.755  1.00 0.00 ? 35  TYR A CE2  5  
ATOM 6434  C CZ   . TYR A 1 35 ? 3.323   -0.097  -9.743  1.00 0.00 ? 35  TYR A CZ   5  
ATOM 6435  O OH   . TYR A 1 35 ? 3.228   0.722   -10.844 1.00 0.00 ? 35  TYR A OH   5  
ATOM 6436  H H    . TYR A 1 35 ? 4.897   -1.066  -4.692  1.00 0.00 ? 35  TYR A H    5  
ATOM 6437  H HA   . TYR A 1 35 ? 2.093   -1.632  -5.235  1.00 0.00 ? 35  TYR A HA   5  
ATOM 6438  H HB2  . TYR A 1 35 ? 4.667   -2.898  -6.171  1.00 0.00 ? 35  TYR A HB2  5  
ATOM 6439  H HB3  . TYR A 1 35 ? 3.087   -3.578  -6.541  1.00 0.00 ? 35  TYR A HB3  5  
ATOM 6440  H HD1  . TYR A 1 35 ? 4.670   -0.176  -6.663  1.00 0.00 ? 35  TYR A HD1  5  
ATOM 6441  H HD2  . TYR A 1 35 ? 2.338   -3.124  -8.657  1.00 0.00 ? 35  TYR A HD2  5  
ATOM 6442  H HE1  . TYR A 1 35 ? 4.501   1.293   -8.624  1.00 0.00 ? 35  TYR A HE1  5  
ATOM 6443  H HE2  . TYR A 1 35 ? 2.164   -1.663  -10.624 1.00 0.00 ? 35  TYR A HE2  5  
ATOM 6444  H HH   . TYR A 1 35 ? 4.050   0.690   -11.340 1.00 0.00 ? 35  TYR A HH   5  
ATOM 6445  N N    . VAL A 1 36 ? 1.878   -4.006  -4.156  1.00 0.00 ? 36  VAL A N    5  
ATOM 6446  C CA   . VAL A 1 36 ? 1.606   -5.099  -3.223  1.00 0.00 ? 36  VAL A CA   5  
ATOM 6447  C C    . VAL A 1 36 ? 2.041   -6.441  -3.809  1.00 0.00 ? 36  VAL A C    5  
ATOM 6448  O O    . VAL A 1 36 ? 1.461   -6.921  -4.785  1.00 0.00 ? 36  VAL A O    5  
ATOM 6449  C CB   . VAL A 1 36 ? 0.106   -5.171  -2.856  1.00 0.00 ? 36  VAL A CB   5  
ATOM 6450  C CG1  . VAL A 1 36 ? -0.135  -6.201  -1.759  1.00 0.00 ? 36  VAL A CG1  5  
ATOM 6451  C CG2  . VAL A 1 36 ? -0.413  -3.802  -2.434  1.00 0.00 ? 36  VAL A CG2  5  
ATOM 6452  H H    . VAL A 1 36 ? 1.294   -3.891  -4.937  1.00 0.00 ? 36  VAL A H    5  
ATOM 6453  H HA   . VAL A 1 36 ? 2.168   -4.913  -2.319  1.00 0.00 ? 36  VAL A HA   5  
ATOM 6454  H HB   . VAL A 1 36 ? -0.443  -5.482  -3.733  1.00 0.00 ? 36  VAL A HB   5  
ATOM 6455  H HG11 . VAL A 1 36 ? -0.947  -5.871  -1.127  1.00 0.00 ? 36  VAL A HG11 5  
ATOM 6456  H HG12 . VAL A 1 36 ? 0.760   -6.312  -1.166  1.00 0.00 ? 36  VAL A HG12 5  
ATOM 6457  H HG13 . VAL A 1 36 ? -0.391  -7.149  -2.206  1.00 0.00 ? 36  VAL A HG13 5  
ATOM 6458  H HG21 . VAL A 1 36 ? -0.846  -3.303  -3.288  1.00 0.00 ? 36  VAL A HG21 5  
ATOM 6459  H HG22 . VAL A 1 36 ? 0.404   -3.210  -2.047  1.00 0.00 ? 36  VAL A HG22 5  
ATOM 6460  H HG23 . VAL A 1 36 ? -1.164  -3.922  -1.667  1.00 0.00 ? 36  VAL A HG23 5  
ATOM 6461  N N    . LYS A 1 37 ? 3.062   -7.045  -3.202  1.00 0.00 ? 37  LYS A N    5  
ATOM 6462  C CA   . LYS A 1 37 ? 3.575   -8.336  -3.655  1.00 0.00 ? 37  LYS A CA   5  
ATOM 6463  C C    . LYS A 1 37 ? 2.585   -9.458  -3.343  1.00 0.00 ? 37  LYS A C    5  
ATOM 6464  O O    . LYS A 1 37 ? 2.349   -10.336 -4.174  1.00 0.00 ? 37  LYS A O    5  
ATOM 6465  C CB   . LYS A 1 37 ? 4.926   -8.637  -2.997  1.00 0.00 ? 37  LYS A CB   5  
ATOM 6466  C CG   . LYS A 1 37 ? 6.106   -8.528  -3.950  1.00 0.00 ? 37  LYS A CG   5  
ATOM 6467  C CD   . LYS A 1 37 ? 6.899   -9.825  -4.014  1.00 0.00 ? 37  LYS A CD   5  
ATOM 6468  C CE   . LYS A 1 37 ? 6.520   -10.657 -5.231  1.00 0.00 ? 37  LYS A CE   5  
ATOM 6469  N NZ   . LYS A 1 37 ? 7.110   -10.116 -6.489  1.00 0.00 ? 37  LYS A NZ   5  
ATOM 6470  H H    . LYS A 1 37 ? 3.478   -6.612  -2.427  1.00 0.00 ? 37  LYS A H    5  
ATOM 6471  H HA   . LYS A 1 37 ? 3.710   -8.281  -4.725  1.00 0.00 ? 37  LYS A HA   5  
ATOM 6472  H HB2  . LYS A 1 37 ? 5.081   -7.941  -2.186  1.00 0.00 ? 37  LYS A HB2  5  
ATOM 6473  H HB3  . LYS A 1 37 ? 4.903   -9.641  -2.598  1.00 0.00 ? 37  LYS A HB3  5  
ATOM 6474  H HG2  . LYS A 1 37 ? 5.736   -8.295  -4.938  1.00 0.00 ? 37  LYS A HG2  5  
ATOM 6475  H HG3  . LYS A 1 37 ? 6.756   -7.735  -3.611  1.00 0.00 ? 37  LYS A HG3  5  
ATOM 6476  H HD2  . LYS A 1 37 ? 7.951   -9.588  -4.067  1.00 0.00 ? 37  LYS A HD2  5  
ATOM 6477  H HD3  . LYS A 1 37 ? 6.704   -10.400 -3.120  1.00 0.00 ? 37  LYS A HD3  5  
ATOM 6478  H HE2  . LYS A 1 37 ? 6.875   -11.666 -5.084  1.00 0.00 ? 37  LYS A HE2  5  
ATOM 6479  H HE3  . LYS A 1 37 ? 5.443   -10.666 -5.323  1.00 0.00 ? 37  LYS A HE3  5  
ATOM 6480  H HZ1  . LYS A 1 37 ? 6.723   -10.622 -7.311  1.00 0.00 ? 37  LYS A HZ1  5  
ATOM 6481  H HZ2  . LYS A 1 37 ? 8.143   -10.235 -6.480  1.00 0.00 ? 37  LYS A HZ2  5  
ATOM 6482  H HZ3  . LYS A 1 37 ? 6.890   -9.104  -6.582  1.00 0.00 ? 37  LYS A HZ3  5  
ATOM 6483  N N    . SER A 1 38 ? 2.012   -9.423  -2.137  1.00 0.00 ? 38  SER A N    5  
ATOM 6484  C CA   . SER A 1 38 ? 1.048   -10.436 -1.705  1.00 0.00 ? 38  SER A CA   5  
ATOM 6485  C C    . SER A 1 38 ? 0.413   -10.046 -0.370  1.00 0.00 ? 38  SER A C    5  
ATOM 6486  O O    . SER A 1 38 ? 0.894   -9.140  0.311   1.00 0.00 ? 38  SER A O    5  
ATOM 6487  C CB   . SER A 1 38 ? 1.729   -11.807 -1.580  1.00 0.00 ? 38  SER A CB   5  
ATOM 6488  O OG   . SER A 1 38 ? 3.066   -11.683 -1.118  1.00 0.00 ? 38  SER A OG   5  
ATOM 6489  H H    . SER A 1 38 ? 2.245   -8.698  -1.519  1.00 0.00 ? 38  SER A H    5  
ATOM 6490  H HA   . SER A 1 38 ? 0.274   -10.496 -2.455  1.00 0.00 ? 38  SER A HA   5  
ATOM 6491  H HB2  . SER A 1 38 ? 1.177   -12.419 -0.882  1.00 0.00 ? 38  SER A HB2  5  
ATOM 6492  H HB3  . SER A 1 38 ? 1.739   -12.289 -2.547  1.00 0.00 ? 38  SER A HB3  5  
ATOM 6493  H HG   . SER A 1 38 ? 3.066   -11.539 -0.168  1.00 0.00 ? 38  SER A HG   5  
ATOM 6494  N N    . VAL A 1 39 ? -0.662  -10.739 0.003   1.00 0.00 ? 39  VAL A N    5  
ATOM 6495  C CA   . VAL A 1 39 ? -1.352  -10.467 1.264   1.00 0.00 ? 39  VAL A CA   5  
ATOM 6496  C C    . VAL A 1 39 ? -1.350  -11.701 2.160   1.00 0.00 ? 39  VAL A C    5  
ATOM 6497  O O    . VAL A 1 39 ? -1.741  -12.791 1.736   1.00 0.00 ? 39  VAL A O    5  
ATOM 6498  C CB   . VAL A 1 39 ? -2.809  -9.998  1.041   1.00 0.00 ? 39  VAL A CB   5  
ATOM 6499  C CG1  . VAL A 1 39 ? -2.837  -8.651  0.332   1.00 0.00 ? 39  VAL A CG1  5  
ATOM 6500  C CG2  . VAL A 1 39 ? -3.604  -11.038 0.261   1.00 0.00 ? 39  VAL A CG2  5  
ATOM 6501  H H    . VAL A 1 39 ? -0.997  -11.454 -0.578  1.00 0.00 ? 39  VAL A H    5  
ATOM 6502  H HA   . VAL A 1 39 ? -0.817  -9.674  1.768   1.00 0.00 ? 39  VAL A HA   5  
ATOM 6503  H HB   . VAL A 1 39 ? -3.274  -9.875  2.008   1.00 0.00 ? 39  VAL A HB   5  
ATOM 6504  H HG11 . VAL A 1 39 ? -2.038  -8.608  -0.394  1.00 0.00 ? 39  VAL A HG11 5  
ATOM 6505  H HG12 . VAL A 1 39 ? -2.706  -7.861  1.057   1.00 0.00 ? 39  VAL A HG12 5  
ATOM 6506  H HG13 . VAL A 1 39 ? -3.785  -8.527  -0.168  1.00 0.00 ? 39  VAL A HG13 5  
ATOM 6507  H HG21 . VAL A 1 39 ? -4.565  -10.627 -0.010  1.00 0.00 ? 39  VAL A HG21 5  
ATOM 6508  H HG22 . VAL A 1 39 ? -3.749  -11.915 0.876   1.00 0.00 ? 39  VAL A HG22 5  
ATOM 6509  H HG23 . VAL A 1 39 ? -3.064  -11.311 -0.633  1.00 0.00 ? 39  VAL A HG23 5  
ATOM 6510  N N    . VAL A 1 40 ? -0.906  -11.523 3.402   1.00 0.00 ? 40  VAL A N    5  
ATOM 6511  C CA   . VAL A 1 40 ? -0.849  -12.621 4.363   1.00 0.00 ? 40  VAL A CA   5  
ATOM 6512  C C    . VAL A 1 40 ? -2.239  -12.939 4.907   1.00 0.00 ? 40  VAL A C    5  
ATOM 6513  O O    . VAL A 1 40 ? -2.902  -12.077 5.484   1.00 0.00 ? 40  VAL A O    5  
ATOM 6514  C CB   . VAL A 1 40 ? 0.097   -12.301 5.542   1.00 0.00 ? 40  VAL A CB   5  
ATOM 6515  C CG1  . VAL A 1 40 ? 0.233   -13.498 6.474   1.00 0.00 ? 40  VAL A CG1  5  
ATOM 6516  C CG2  . VAL A 1 40 ? 1.462   -11.857 5.031   1.00 0.00 ? 40  VAL A CG2  5  
ATOM 6517  H H    . VAL A 1 40 ? -0.608  -10.627 3.680   1.00 0.00 ? 40  VAL A H    5  
ATOM 6518  H HA   . VAL A 1 40 ? -0.469  -13.492 3.849   1.00 0.00 ? 40  VAL A HA   5  
ATOM 6519  H HB   . VAL A 1 40 ? -0.331  -11.486 6.107   1.00 0.00 ? 40  VAL A HB   5  
ATOM 6520  H HG11 . VAL A 1 40 ? 0.209   -13.158 7.499   1.00 0.00 ? 40  VAL A HG11 5  
ATOM 6521  H HG12 . VAL A 1 40 ? 1.171   -13.999 6.283   1.00 0.00 ? 40  VAL A HG12 5  
ATOM 6522  H HG13 . VAL A 1 40 ? -0.583  -14.184 6.303   1.00 0.00 ? 40  VAL A HG13 5  
ATOM 6523  H HG21 . VAL A 1 40 ? 1.404   -10.833 4.693   1.00 0.00 ? 40  VAL A HG21 5  
ATOM 6524  H HG22 . VAL A 1 40 ? 1.764   -12.490 4.210   1.00 0.00 ? 40  VAL A HG22 5  
ATOM 6525  H HG23 . VAL A 1 40 ? 2.186   -11.931 5.829   1.00 0.00 ? 40  VAL A HG23 5  
ATOM 6526  N N    . LYS A 1 41 ? -2.668  -14.185 4.717   1.00 0.00 ? 41  LYS A N    5  
ATOM 6527  C CA   . LYS A 1 41 ? -3.979  -14.632 5.185   1.00 0.00 ? 41  LYS A CA   5  
ATOM 6528  C C    . LYS A 1 41 ? -4.067  -14.584 6.709   1.00 0.00 ? 41  LYS A C    5  
ATOM 6529  O O    . LYS A 1 41 ? -3.050  -14.670 7.402   1.00 0.00 ? 41  LYS A O    5  
ATOM 6530  C CB   . LYS A 1 41 ? -4.263  -16.057 4.705   1.00 0.00 ? 41  LYS A CB   5  
ATOM 6531  C CG   . LYS A 1 41 ? -4.253  -16.210 3.193   1.00 0.00 ? 41  LYS A CG   5  
ATOM 6532  C CD   . LYS A 1 41 ? -5.650  -16.075 2.610   1.00 0.00 ? 41  LYS A CD   5  
ATOM 6533  C CE   . LYS A 1 41 ? -5.670  -16.423 1.129   1.00 0.00 ? 41  LYS A CE   5  
ATOM 6534  N NZ   . LYS A 1 41 ? -5.954  -17.868 0.897   1.00 0.00 ? 41  LYS A NZ   5  
ATOM 6535  H H    . LYS A 1 41 ? -2.088  -14.821 4.250   1.00 0.00 ? 41  LYS A H    5  
ATOM 6536  H HA   . LYS A 1 41 ? -4.721  -13.966 4.771   1.00 0.00 ? 41  LYS A HA   5  
ATOM 6537  H HB2  . LYS A 1 41 ? -3.515  -16.718 5.118   1.00 0.00 ? 41  LYS A HB2  5  
ATOM 6538  H HB3  . LYS A 1 41 ? -5.234  -16.357 5.070   1.00 0.00 ? 41  LYS A HB3  5  
ATOM 6539  H HG2  . LYS A 1 41 ? -3.621  -15.445 2.767   1.00 0.00 ? 41  LYS A HG2  5  
ATOM 6540  H HG3  . LYS A 1 41 ? -3.860  -17.185 2.944   1.00 0.00 ? 41  LYS A HG3  5  
ATOM 6541  H HD2  . LYS A 1 41 ? -6.315  -16.743 3.136   1.00 0.00 ? 41  LYS A HD2  5  
ATOM 6542  H HD3  . LYS A 1 41 ? -5.986  -15.056 2.736   1.00 0.00 ? 41  LYS A HD3  5  
ATOM 6543  H HE2  . LYS A 1 41 ? -6.433  -15.833 0.644   1.00 0.00 ? 41  LYS A HE2  5  
ATOM 6544  H HE3  . LYS A 1 41 ? -4.706  -16.181 0.704   1.00 0.00 ? 41  LYS A HE3  5  
ATOM 6545  H HZ1  . LYS A 1 41 ? -6.494  -17.990 0.016   1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 6546  H HZ2  . LYS A 1 41 ? -6.509  -18.258 1.685   1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 6547  H HZ3  . LYS A 1 41 ? -5.063  -18.399 0.820   1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 6548  N N    . GLY A 1 42 ? -5.289  -14.442 7.222   1.00 0.00 ? 42  GLY A N    5  
ATOM 6549  C CA   . GLY A 1 42 ? -5.499  -14.381 8.658   1.00 0.00 ? 42  GLY A CA   5  
ATOM 6550  C C    . GLY A 1 42 ? -5.715  -12.964 9.159   1.00 0.00 ? 42  GLY A C    5  
ATOM 6551  O O    . GLY A 1 42 ? -6.521  -12.741 10.062  1.00 0.00 ? 42  GLY A O    5  
ATOM 6552  H H    . GLY A 1 42 ? -6.058  -14.375 6.616   1.00 0.00 ? 42  GLY A H    5  
ATOM 6553  H HA2  . GLY A 1 42 ? -6.368  -14.975 8.904   1.00 0.00 ? 42  GLY A HA2  5  
ATOM 6554  H HA3  . GLY A 1 42 ? -4.638  -14.795 9.157   1.00 0.00 ? 42  GLY A HA3  5  
ATOM 6555  N N    . GLY A 1 43 ? -4.999  -12.005 8.566   1.00 0.00 ? 43  GLY A N    5  
ATOM 6556  C CA   . GLY A 1 43 ? -5.137  -10.612 8.961   1.00 0.00 ? 43  GLY A CA   5  
ATOM 6557  C C    . GLY A 1 43 ? -6.524  -10.050 8.668   1.00 0.00 ? 43  GLY A C    5  
ATOM 6558  O O    . GLY A 1 43 ? -7.405  -10.763 8.189   1.00 0.00 ? 43  GLY A O    5  
ATOM 6559  H H    . GLY A 1 43 ? -4.378  -12.245 7.846   1.00 0.00 ? 43  GLY A H    5  
ATOM 6560  H HA2  . GLY A 1 43 ? -4.946  -10.532 10.021  1.00 0.00 ? 43  GLY A HA2  5  
ATOM 6561  H HA3  . GLY A 1 43 ? -4.402  -10.026 8.429   1.00 0.00 ? 43  GLY A HA3  5  
ATOM 6562  N N    . ALA A 1 44 ? -6.719  -8.765  8.959   1.00 0.00 ? 44  ALA A N    5  
ATOM 6563  C CA   . ALA A 1 44 ? -8.010  -8.112  8.732   1.00 0.00 ? 44  ALA A CA   5  
ATOM 6564  C C    . ALA A 1 44 ? -8.156  -7.548  7.309   1.00 0.00 ? 44  ALA A C    5  
ATOM 6565  O O    . ALA A 1 44 ? -9.209  -7.003  6.966   1.00 0.00 ? 44  ALA A O    5  
ATOM 6566  C CB   . ALA A 1 44 ? -8.211  -7.005  9.755   1.00 0.00 ? 44  ALA A CB   5  
ATOM 6567  H H    . ALA A 1 44 ? -5.981  -8.243  9.339   1.00 0.00 ? 44  ALA A H    5  
ATOM 6568  H HA   . ALA A 1 44 ? -8.785  -8.849  8.893   1.00 0.00 ? 44  ALA A HA   5  
ATOM 6569  H HB1  . ALA A 1 44 ? -7.961  -6.054  9.309   1.00 0.00 ? 44  ALA A HB1  5  
ATOM 6570  H HB2  . ALA A 1 44 ? -7.571  -7.183  10.606  1.00 0.00 ? 44  ALA A HB2  5  
ATOM 6571  H HB3  . ALA A 1 44 ? -9.242  -6.993  10.075  1.00 0.00 ? 44  ALA A HB3  5  
ATOM 6572  N N    . ALA A 1 45 ? -7.113  -7.667  6.485   1.00 0.00 ? 45  ALA A N    5  
ATOM 6573  C CA   . ALA A 1 45 ? -7.163  -7.152  5.115   1.00 0.00 ? 45  ALA A CA   5  
ATOM 6574  C C    . ALA A 1 45 ? -7.605  -8.228  4.122   1.00 0.00 ? 45  ALA A C    5  
ATOM 6575  O O    . ALA A 1 45 ? -8.345  -7.944  3.176   1.00 0.00 ? 45  ALA A O    5  
ATOM 6576  C CB   . ALA A 1 45 ? -5.810  -6.580  4.713   1.00 0.00 ? 45  ALA A CB   5  
ATOM 6577  H H    . ALA A 1 45 ? -6.294  -8.103  6.801   1.00 0.00 ? 45  ALA A H    5  
ATOM 6578  H HA   . ALA A 1 45 ? -7.884  -6.347  5.093   1.00 0.00 ? 45  ALA A HA   5  
ATOM 6579  H HB1  . ALA A 1 45 ? -5.027  -7.092  5.251   1.00 0.00 ? 45  ALA A HB1  5  
ATOM 6580  H HB2  . ALA A 1 45 ? -5.781  -5.526  4.950   1.00 0.00 ? 45  ALA A HB2  5  
ATOM 6581  H HB3  . ALA A 1 45 ? -5.664  -6.712  3.651   1.00 0.00 ? 45  ALA A HB3  5  
ATOM 6582  N N    . ASP A 1 46 ? -7.145  -9.459  4.336   1.00 0.00 ? 46  ASP A N    5  
ATOM 6583  C CA   . ASP A 1 46 ? -7.494  -10.569 3.451   1.00 0.00 ? 46  ASP A CA   5  
ATOM 6584  C C    . ASP A 1 46 ? -8.914  -11.070 3.724   1.00 0.00 ? 46  ASP A C    5  
ATOM 6585  O O    . ASP A 1 46 ? -9.637  -11.431 2.795   1.00 0.00 ? 46  ASP A O    5  
ATOM 6586  C CB   . ASP A 1 46 ? -6.486  -11.715 3.602   1.00 0.00 ? 46  ASP A CB   5  
ATOM 6587  C CG   . ASP A 1 46 ? -6.487  -12.317 4.996   1.00 0.00 ? 46  ASP A CG   5  
ATOM 6588  O OD1  . ASP A 1 46 ? -5.873  -11.718 5.898   1.00 0.00 ? 46  ASP A OD1  5  
ATOM 6589  O OD2  . ASP A 1 46 ? -7.102  -13.390 5.180   1.00 0.00 ? 46  ASP A OD2  5  
ATOM 6590  H H    . ASP A 1 46 ? -6.557  -9.626  5.102   1.00 0.00 ? 46  ASP A H    5  
ATOM 6591  H HA   . ASP A 1 46 ? -7.450  -10.199 2.437   1.00 0.00 ? 46  ASP A HA   5  
ATOM 6592  H HB2  . ASP A 1 46 ? -6.727  -12.495 2.895   1.00 0.00 ? 46  ASP A HB2  5  
ATOM 6593  H HB3  . ASP A 1 46 ? -5.494  -11.337 3.390   1.00 0.00 ? 46  ASP A HB3  5  
ATOM 6594  N N    . VAL A 1 47 ? -9.312  -11.085 4.999   1.00 0.00 ? 47  VAL A N    5  
ATOM 6595  C CA   . VAL A 1 47 ? -10.652 -11.539 5.378   1.00 0.00 ? 47  VAL A CA   5  
ATOM 6596  C C    . VAL A 1 47 ? -11.726 -10.610 4.808   1.00 0.00 ? 47  VAL A C    5  
ATOM 6597  O O    . VAL A 1 47 ? -12.819 -11.056 4.455   1.00 0.00 ? 47  VAL A O    5  
ATOM 6598  C CB   . VAL A 1 47 ? -10.817 -11.629 6.913   1.00 0.00 ? 47  VAL A CB   5  
ATOM 6599  C CG1  . VAL A 1 47 ? -12.185 -12.201 7.276   1.00 0.00 ? 47  VAL A CG1  5  
ATOM 6600  C CG2  . VAL A 1 47 ? -9.700  -12.469 7.522   1.00 0.00 ? 47  VAL A CG2  5  
ATOM 6601  H H    . VAL A 1 47 ? -8.694  -10.781 5.698   1.00 0.00 ? 47  VAL A H    5  
ATOM 6602  H HA   . VAL A 1 47 ? -10.795 -12.528 4.965   1.00 0.00 ? 47  VAL A HA   5  
ATOM 6603  H HB   . VAL A 1 47 ? -10.752 -10.630 7.321   1.00 0.00 ? 47  VAL A HB   5  
ATOM 6604  H HG11 . VAL A 1 47 ? -12.535 -12.836 6.475   1.00 0.00 ? 47  VAL A HG11 5  
ATOM 6605  H HG12 . VAL A 1 47 ? -12.886 -11.392 7.424   1.00 0.00 ? 47  VAL A HG12 5  
ATOM 6606  H HG13 . VAL A 1 47 ? -12.106 -12.778 8.185   1.00 0.00 ? 47  VAL A HG13 5  
ATOM 6607  H HG21 . VAL A 1 47 ? -8.790  -12.322 6.958   1.00 0.00 ? 47  VAL A HG21 5  
ATOM 6608  H HG22 . VAL A 1 47 ? -9.974  -13.512 7.494   1.00 0.00 ? 47  VAL A HG22 5  
ATOM 6609  H HG23 . VAL A 1 47 ? -9.539  -12.166 8.546   1.00 0.00 ? 47  VAL A HG23 5  
ATOM 6610  N N    . ASP A 1 48 ? -11.402 -9.321  4.711   1.00 0.00 ? 48  ASP A N    5  
ATOM 6611  C CA   . ASP A 1 48 ? -12.331 -8.331  4.174   1.00 0.00 ? 48  ASP A CA   5  
ATOM 6612  C C    . ASP A 1 48 ? -12.513 -8.508  2.665   1.00 0.00 ? 48  ASP A C    5  
ATOM 6613  O O    . ASP A 1 48 ? -13.636 -8.469  2.160   1.00 0.00 ? 48  ASP A O    5  
ATOM 6614  C CB   . ASP A 1 48 ? -11.828 -6.915  4.472   1.00 0.00 ? 48  ASP A CB   5  
ATOM 6615  C CG   . ASP A 1 48 ? -12.841 -6.093  5.241   1.00 0.00 ? 48  ASP A CG   5  
ATOM 6616  O OD1  . ASP A 1 48 ? -12.875 -6.203  6.485   1.00 0.00 ? 48  ASP A OD1  5  
ATOM 6617  O OD2  . ASP A 1 48 ? -13.602 -5.338  4.599   1.00 0.00 ? 48  ASP A OD2  5  
ATOM 6618  H H    . ASP A 1 48 ? -10.513 -9.028  5.003   1.00 0.00 ? 48  ASP A H    5  
ATOM 6619  H HA   . ASP A 1 48 ? -13.285 -8.474  4.659   1.00 0.00 ? 48  ASP A HA   5  
ATOM 6620  H HB2  . ASP A 1 48 ? -10.924 -6.978  5.060   1.00 0.00 ? 48  ASP A HB2  5  
ATOM 6621  H HB3  . ASP A 1 48 ? -11.613 -6.411  3.541   1.00 0.00 ? 48  ASP A HB3  5  
ATOM 6622  N N    . GLY A 1 49 ? -11.401 -8.696  1.953   1.00 0.00 ? 49  GLY A N    5  
ATOM 6623  C CA   . GLY A 1 49 ? -11.455 -8.869  0.509   1.00 0.00 ? 49  GLY A CA   5  
ATOM 6624  C C    . GLY A 1 49 ? -11.578 -7.550  -0.238  1.00 0.00 ? 49  GLY A C    5  
ATOM 6625  O O    . GLY A 1 49 ? -12.147 -7.502  -1.330  1.00 0.00 ? 49  GLY A O    5  
ATOM 6626  H H    . GLY A 1 49 ? -10.534 -8.714  2.411   1.00 0.00 ? 49  GLY A H    5  
ATOM 6627  H HA2  . GLY A 1 49 ? -10.555 -9.371  0.185   1.00 0.00 ? 49  GLY A HA2  5  
ATOM 6628  H HA3  . GLY A 1 49 ? -12.305 -9.489  0.263   1.00 0.00 ? 49  GLY A HA3  5  
ATOM 6629  N N    . ARG A 1 50 ? -11.039 -6.479  0.348   1.00 0.00 ? 50  ARG A N    5  
ATOM 6630  C CA   . ARG A 1 50 ? -11.087 -5.155  -0.273  1.00 0.00 ? 50  ARG A CA   5  
ATOM 6631  C C    . ARG A 1 50 ? -9.871  -4.922  -1.172  1.00 0.00 ? 50  ARG A C    5  
ATOM 6632  O O    . ARG A 1 50 ? -9.969  -4.238  -2.192  1.00 0.00 ? 50  ARG A O    5  
ATOM 6633  C CB   . ARG A 1 50 ? -11.161 -4.061  0.798   1.00 0.00 ? 50  ARG A CB   5  
ATOM 6634  C CG   . ARG A 1 50 ? -12.562 -3.511  1.014   1.00 0.00 ? 50  ARG A CG   5  
ATOM 6635  C CD   . ARG A 1 50 ? -12.987 -2.592  -0.123  1.00 0.00 ? 50  ARG A CD   5  
ATOM 6636  N NE   . ARG A 1 50 ? -14.405 -2.745  -0.454  1.00 0.00 ? 50  ARG A NE   5  
ATOM 6637  C CZ   . ARG A 1 50 ? -15.405 -2.198  0.248   1.00 0.00 ? 50  ARG A CZ   5  
ATOM 6638  N NH1  . ARG A 1 50 ? -15.150 -1.464  1.331   1.00 0.00 ? 50  ARG A NH1  5  
ATOM 6639  N NH2  . ARG A 1 50 ? -16.664 -2.388  -0.133  1.00 0.00 ? 50  ARG A NH2  5  
ATOM 6640  H H    . ARG A 1 50 ? -10.595 -6.581  1.216   1.00 0.00 ? 50  ARG A H    5  
ATOM 6641  H HA   . ARG A 1 50 ? -11.979 -5.109  -0.880  1.00 0.00 ? 50  ARG A HA   5  
ATOM 6642  H HB2  . ARG A 1 50 ? -10.809 -4.466  1.736   1.00 0.00 ? 50  ARG A HB2  5  
ATOM 6643  H HB3  . ARG A 1 50 ? -10.518 -3.243  0.506   1.00 0.00 ? 50  ARG A HB3  5  
ATOM 6644  H HG2  . ARG A 1 50 ? -13.257 -4.336  1.076   1.00 0.00 ? 50  ARG A HG2  5  
ATOM 6645  H HG3  . ARG A 1 50 ? -12.579 -2.955  1.939   1.00 0.00 ? 50  ARG A HG3  5  
ATOM 6646  H HD2  . ARG A 1 50 ? -12.803 -1.570  0.170   1.00 0.00 ? 50  ARG A HD2  5  
ATOM 6647  H HD3  . ARG A 1 50 ? -12.396 -2.826  -0.997  1.00 0.00 ? 50  ARG A HD3  5  
ATOM 6648  H HE   . ARG A 1 50 ? -14.626 -3.282  -1.245  1.00 0.00 ? 50  ARG A HE   5  
ATOM 6649  H HH11 . ARG A 1 50 ? -14.206 -1.317  1.628   1.00 0.00 ? 50  ARG A HH11 5  
ATOM 6650  H HH12 . ARG A 1 50 ? -15.904 -1.058  1.849   1.00 0.00 ? 50  ARG A HH12 5  
ATOM 6651  H HH21 . ARG A 1 50 ? -16.865 -2.939  -0.944  1.00 0.00 ? 50  ARG A HH21 5  
ATOM 6652  H HH22 . ARG A 1 50 ? -17.414 -1.980  0.390   1.00 0.00 ? 50  ARG A HH22 5  
ATOM 6653  N N    . LEU A 1 51 ? -8.728  -5.494  -0.785  1.00 0.00 ? 51  LEU A N    5  
ATOM 6654  C CA   . LEU A 1 51 ? -7.492  -5.349  -1.552  1.00 0.00 ? 51  LEU A CA   5  
ATOM 6655  C C    . LEU A 1 51 ? -6.884  -6.716  -1.878  1.00 0.00 ? 51  LEU A C    5  
ATOM 6656  O O    . LEU A 1 51 ? -7.340  -7.744  -1.369  1.00 0.00 ? 51  LEU A O    5  
ATOM 6657  C CB   . LEU A 1 51 ? -6.483  -4.499  -0.774  1.00 0.00 ? 51  LEU A CB   5  
ATOM 6658  C CG   . LEU A 1 51 ? -6.110  -5.034  0.614   1.00 0.00 ? 51  LEU A CG   5  
ATOM 6659  C CD1  . LEU A 1 51 ? -4.873  -5.917  0.536   1.00 0.00 ? 51  LEU A CD1  5  
ATOM 6660  C CD2  . LEU A 1 51 ? -5.891  -3.884  1.587   1.00 0.00 ? 51  LEU A CD2  5  
ATOM 6661  H H    . LEU A 1 51 ? -8.716  -6.024  0.038   1.00 0.00 ? 51  LEU A H    5  
ATOM 6662  H HA   . LEU A 1 51 ? -7.733  -4.848  -2.478  1.00 0.00 ? 51  LEU A HA   5  
ATOM 6663  H HB2  . LEU A 1 51 ? -5.580  -4.421  -1.362  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 6664  H HB3  . LEU A 1 51 ? -6.898  -3.509  -0.652  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 6665  H HG   . LEU A 1 51 ? -6.925  -5.637  0.988   1.00 0.00 ? 51  LEU A HG   5  
ATOM 6666  H HD11 . LEU A 1 51 ? -4.157  -5.478  -0.142  1.00 0.00 ? 51  LEU A HD11 5  
ATOM 6667  H HD12 . LEU A 1 51 ? -5.153  -6.897  0.178   1.00 0.00 ? 51  LEU A HD12 5  
ATOM 6668  H HD13 . LEU A 1 51 ? -4.432  -6.007  1.518   1.00 0.00 ? 51  LEU A HD13 5  
ATOM 6669  H HD21 . LEU A 1 51 ? -6.817  -3.662  2.095   1.00 0.00 ? 51  LEU A HD21 5  
ATOM 6670  H HD22 . LEU A 1 51 ? -5.559  -3.011  1.044   1.00 0.00 ? 51  LEU A HD22 5  
ATOM 6671  H HD23 . LEU A 1 51 ? -5.140  -4.163  2.312   1.00 0.00 ? 51  LEU A HD23 5  
ATOM 6672  N N    . ALA A 1 52 ? -5.854  -6.719  -2.728  1.00 0.00 ? 52  ALA A N    5  
ATOM 6673  C CA   . ALA A 1 52 ? -5.182  -7.956  -3.124  1.00 0.00 ? 52  ALA A CA   5  
ATOM 6674  C C    . ALA A 1 52 ? -3.772  -7.685  -3.656  1.00 0.00 ? 52  ALA A C    5  
ATOM 6675  O O    . ALA A 1 52 ? -3.301  -6.546  -3.642  1.00 0.00 ? 52  ALA A O    5  
ATOM 6676  C CB   . ALA A 1 52 ? -6.010  -8.691  -4.170  1.00 0.00 ? 52  ALA A CB   5  
ATOM 6677  H H    . ALA A 1 52 ? -5.537  -5.867  -3.098  1.00 0.00 ? 52  ALA A H    5  
ATOM 6678  H HA   . ALA A 1 52 ? -5.109  -8.588  -2.251  1.00 0.00 ? 52  ALA A HA   5  
ATOM 6679  H HB1  . ALA A 1 52 ? -7.039  -8.372  -4.104  1.00 0.00 ? 52  ALA A HB1  5  
ATOM 6680  H HB2  . ALA A 1 52 ? -5.950  -9.754  -3.995  1.00 0.00 ? 52  ALA A HB2  5  
ATOM 6681  H HB3  . ALA A 1 52 ? -5.626  -8.467  -5.156  1.00 0.00 ? 52  ALA A HB3  5  
ATOM 6682  N N    . ALA A 1 53 ? -3.106  -8.743  -4.128  1.00 0.00 ? 53  ALA A N    5  
ATOM 6683  C CA   . ALA A 1 53 ? -1.752  -8.626  -4.669  1.00 0.00 ? 53  ALA A CA   5  
ATOM 6684  C C    . ALA A 1 53 ? -1.762  -7.962  -6.045  1.00 0.00 ? 53  ALA A C    5  
ATOM 6685  O O    . ALA A 1 53 ? -2.801  -7.893  -6.705  1.00 0.00 ? 53  ALA A O    5  
ATOM 6686  C CB   . ALA A 1 53 ? -1.092  -9.996  -4.750  1.00 0.00 ? 53  ALA A CB   5  
ATOM 6687  H H    . ALA A 1 53 ? -3.537  -9.623  -4.112  1.00 0.00 ? 53  ALA A H    5  
ATOM 6688  H HA   . ALA A 1 53 ? -1.175  -8.015  -3.990  1.00 0.00 ? 53  ALA A HA   5  
ATOM 6689  H HB1  . ALA A 1 53 ? -1.450  -10.619 -3.944  1.00 0.00 ? 53  ALA A HB1  5  
ATOM 6690  H HB2  . ALA A 1 53 ? -0.020  -9.884  -4.668  1.00 0.00 ? 53  ALA A HB2  5  
ATOM 6691  H HB3  . ALA A 1 53 ? -1.333  -10.458 -5.696  1.00 0.00 ? 53  ALA A HB3  5  
ATOM 6692  N N    . GLY A 1 54 ? -0.596  -7.472  -6.469  1.00 0.00 ? 54  GLY A N    5  
ATOM 6693  C CA   . GLY A 1 54 ? -0.485  -6.812  -7.760  1.00 0.00 ? 54  GLY A CA   5  
ATOM 6694  C C    . GLY A 1 54 ? -1.251  -5.502  -7.806  1.00 0.00 ? 54  GLY A C    5  
ATOM 6695  O O    . GLY A 1 54 ? -1.888  -5.185  -8.812  1.00 0.00 ? 54  GLY A O    5  
ATOM 6696  H H    . GLY A 1 54 ? 0.197   -7.555  -5.897  1.00 0.00 ? 54  GLY A H    5  
ATOM 6697  H HA2  . GLY A 1 54 ? 0.557   -6.614  -7.963  1.00 0.00 ? 54  GLY A HA2  5  
ATOM 6698  H HA3  . GLY A 1 54 ? -0.871  -7.470  -8.524  1.00 0.00 ? 54  GLY A HA3  5  
ATOM 6699  N N    . ASP A 1 55 ? -1.193  -4.744  -6.710  1.00 0.00 ? 55  ASP A N    5  
ATOM 6700  C CA   . ASP A 1 55 ? -1.890  -3.464  -6.621  1.00 0.00 ? 55  ASP A CA   5  
ATOM 6701  C C    . ASP A 1 55 ? -0.936  -2.348  -6.204  1.00 0.00 ? 55  ASP A C    5  
ATOM 6702  O O    . ASP A 1 55 ? -0.045  -2.559  -5.380  1.00 0.00 ? 55  ASP A O    5  
ATOM 6703  C CB   . ASP A 1 55 ? -3.048  -3.561  -5.622  1.00 0.00 ? 55  ASP A CB   5  
ATOM 6704  C CG   . ASP A 1 55 ? -4.363  -3.916  -6.291  1.00 0.00 ? 55  ASP A CG   5  
ATOM 6705  O OD1  . ASP A 1 55 ? -4.493  -5.060  -6.774  1.00 0.00 ? 55  ASP A OD1  5  
ATOM 6706  O OD2  . ASP A 1 55 ? -5.261  -3.048  -6.330  1.00 0.00 ? 55  ASP A OD2  5  
ATOM 6707  H H    . ASP A 1 55 ? -0.671  -5.055  -5.941  1.00 0.00 ? 55  ASP A H    5  
ATOM 6708  H HA   . ASP A 1 55 ? -2.289  -3.235  -7.598  1.00 0.00 ? 55  ASP A HA   5  
ATOM 6709  H HB2  . ASP A 1 55 ? -2.823  -4.322  -4.889  1.00 0.00 ? 55  ASP A HB2  5  
ATOM 6710  H HB3  . ASP A 1 55 ? -3.164  -2.610  -5.121  1.00 0.00 ? 55  ASP A HB3  5  
ATOM 6711  N N    . GLN A 1 56 ? -1.132  -1.161  -6.775  1.00 0.00 ? 56  GLN A N    5  
ATOM 6712  C CA   . GLN A 1 56 ? -0.293  -0.005  -6.461  1.00 0.00 ? 56  GLN A CA   5  
ATOM 6713  C C    . GLN A 1 56 ? -0.871  0.783   -5.284  1.00 0.00 ? 56  GLN A C    5  
ATOM 6714  O O    . GLN A 1 56 ? -2.054  0.655   -4.966  1.00 0.00 ? 56  GLN A O    5  
ATOM 6715  C CB   . GLN A 1 56 ? -0.163  0.906   -7.686  1.00 0.00 ? 56  GLN A CB   5  
ATOM 6716  C CG   . GLN A 1 56 ? 1.104   1.749   -7.691  1.00 0.00 ? 56  GLN A CG   5  
ATOM 6717  C CD   . GLN A 1 56 ? 0.833   3.231   -7.489  1.00 0.00 ? 56  GLN A CD   5  
ATOM 6718  O OE1  . GLN A 1 56 ? -0.281  3.709   -7.707  1.00 0.00 ? 56  GLN A OE1  5  
ATOM 6719  N NE2  . GLN A 1 56 ? 1.855   3.970   -7.069  1.00 0.00 ? 56  GLN A NE2  5  
ATOM 6720  H H    . GLN A 1 56 ? -1.863  -1.058  -7.421  1.00 0.00 ? 56  GLN A H    5  
ATOM 6721  H HA   . GLN A 1 56 ? 0.688   -0.371  -6.188  1.00 0.00 ? 56  GLN A HA   5  
ATOM 6722  H HB2  . GLN A 1 56 ? -0.165  0.295   -8.575  1.00 0.00 ? 56  GLN A HB2  5  
ATOM 6723  H HB3  . GLN A 1 56 ? -1.015  1.571   -7.716  1.00 0.00 ? 56  GLN A HB3  5  
ATOM 6724  H HG2  . GLN A 1 56 ? 1.750   1.408   -6.897  1.00 0.00 ? 56  GLN A HG2  5  
ATOM 6725  H HG3  . GLN A 1 56 ? 1.603   1.617   -8.640  1.00 0.00 ? 56  GLN A HG3  5  
ATOM 6726  H HE21 . GLN A 1 56 ? 2.715   3.527   -6.915  1.00 0.00 ? 56  GLN A HE21 5  
ATOM 6727  H HE22 . GLN A 1 56 ? 1.706   4.928   -6.930  1.00 0.00 ? 56  GLN A HE22 5  
ATOM 6728  N N    . LEU A 1 57 ? -0.032  1.596   -4.639  1.00 0.00 ? 57  LEU A N    5  
ATOM 6729  C CA   . LEU A 1 57 ? -0.466  2.401   -3.497  1.00 0.00 ? 57  LEU A CA   5  
ATOM 6730  C C    . LEU A 1 57 ? -0.181  3.884   -3.714  1.00 0.00 ? 57  LEU A C    5  
ATOM 6731  O O    . LEU A 1 57 ? 0.719   4.251   -4.472  1.00 0.00 ? 57  LEU A O    5  
ATOM 6732  C CB   . LEU A 1 57 ? 0.233   1.938   -2.216  1.00 0.00 ? 57  LEU A CB   5  
ATOM 6733  C CG   . LEU A 1 57 ? -0.248  0.600   -1.654  1.00 0.00 ? 57  LEU A CG   5  
ATOM 6734  C CD1  . LEU A 1 57 ? 0.854   -0.057  -0.836  1.00 0.00 ? 57  LEU A CD1  5  
ATOM 6735  C CD2  . LEU A 1 57 ? -1.498  0.797   -0.809  1.00 0.00 ? 57  LEU A CD2  5  
ATOM 6736  H H    . LEU A 1 57 ? 0.900   1.656   -4.938  1.00 0.00 ? 57  LEU A H    5  
ATOM 6737  H HA   . LEU A 1 57 ? -1.531  2.266   -3.381  1.00 0.00 ? 57  LEU A HA   5  
ATOM 6738  H HB2  . LEU A 1 57 ? 1.291   1.862   -2.419  1.00 0.00 ? 57  LEU A HB2  5  
ATOM 6739  H HB3  . LEU A 1 57 ? 0.085   2.694   -1.459  1.00 0.00 ? 57  LEU A HB3  5  
ATOM 6740  H HG   . LEU A 1 57 ? -0.495  -0.060  -2.473  1.00 0.00 ? 57  LEU A HG   5  
ATOM 6741  H HD11 . LEU A 1 57 ? 0.766   -1.130  -0.907  1.00 0.00 ? 57  LEU A HD11 5  
ATOM 6742  H HD12 . LEU A 1 57 ? 0.763   0.244   0.198   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 6743  H HD13 . LEU A 1 57 ? 1.817   0.251   -1.216  1.00 0.00 ? 57  LEU A HD13 5  
ATOM 6744  H HD21 . LEU A 1 57 ? -1.305  1.540   -0.050  1.00 0.00 ? 57  LEU A HD21 5  
ATOM 6745  H HD22 . LEU A 1 57 ? -1.765  -0.137  -0.338  1.00 0.00 ? 57  LEU A HD22 5  
ATOM 6746  H HD23 . LEU A 1 57 ? -2.310  1.128   -1.439  1.00 0.00 ? 57  LEU A HD23 5  
ATOM 6747  N N    . LEU A 1 58 ? -0.950  4.731   -3.030  1.00 0.00 ? 58  LEU A N    5  
ATOM 6748  C CA   . LEU A 1 58 ? -0.782  6.178   -3.129  1.00 0.00 ? 58  LEU A CA   5  
ATOM 6749  C C    . LEU A 1 58 ? -0.623  6.810   -1.743  1.00 0.00 ? 58  LEU A C    5  
ATOM 6750  O O    . LEU A 1 58 ? 0.361   7.506   -1.483  1.00 0.00 ? 58  LEU A O    5  
ATOM 6751  C CB   . LEU A 1 58 ? -1.973  6.806   -3.864  1.00 0.00 ? 58  LEU A CB   5  
ATOM 6752  C CG   . LEU A 1 58 ? -1.606  7.682   -5.068  1.00 0.00 ? 58  LEU A CG   5  
ATOM 6753  C CD1  . LEU A 1 58 ? -2.810  7.869   -5.979  1.00 0.00 ? 58  LEU A CD1  5  
ATOM 6754  C CD2  . LEU A 1 58 ? -1.070  9.033   -4.612  1.00 0.00 ? 58  LEU A CD2  5  
ATOM 6755  H H    . LEU A 1 58 ? -1.643  4.371   -2.436  1.00 0.00 ? 58  LEU A H    5  
ATOM 6756  H HA   . LEU A 1 58 ? 0.116   6.365   -3.700  1.00 0.00 ? 58  LEU A HA   5  
ATOM 6757  H HB2  . LEU A 1 58 ? -2.617  6.009   -4.208  1.00 0.00 ? 58  LEU A HB2  5  
ATOM 6758  H HB3  . LEU A 1 58 ? -2.524  7.412   -3.161  1.00 0.00 ? 58  LEU A HB3  5  
ATOM 6759  H HG   . LEU A 1 58 ? -0.832  7.190   -5.640  1.00 0.00 ? 58  LEU A HG   5  
ATOM 6760  H HD11 . LEU A 1 58 ? -3.033  6.937   -6.477  1.00 0.00 ? 58  LEU A HD11 5  
ATOM 6761  H HD12 . LEU A 1 58 ? -2.589  8.627   -6.716  1.00 0.00 ? 58  LEU A HD12 5  
ATOM 6762  H HD13 . LEU A 1 58 ? -3.663  8.176   -5.391  1.00 0.00 ? 58  LEU A HD13 5  
ATOM 6763  H HD21 . LEU A 1 58 ? -1.873  9.756   -4.607  1.00 0.00 ? 58  LEU A HD21 5  
ATOM 6764  H HD22 . LEU A 1 58 ? -0.297  9.360   -5.291  1.00 0.00 ? 58  LEU A HD22 5  
ATOM 6765  H HD23 . LEU A 1 58 ? -0.660  8.943   -3.617  1.00 0.00 ? 58  LEU A HD23 5  
ATOM 6766  N N    . SER A 1 59 ? -1.598  6.571   -0.860  1.00 0.00 ? 59  SER A N    5  
ATOM 6767  C CA   . SER A 1 59 ? -1.568  7.124   0.494   1.00 0.00 ? 59  SER A CA   5  
ATOM 6768  C C    . SER A 1 59 ? -1.968  6.077   1.534   1.00 0.00 ? 59  SER A C    5  
ATOM 6769  O O    . SER A 1 59 ? -2.866  5.265   1.297   1.00 0.00 ? 59  SER A O    5  
ATOM 6770  C CB   . SER A 1 59 ? -2.508  8.331   0.584   1.00 0.00 ? 59  SER A CB   5  
ATOM 6771  O OG   . SER A 1 59 ? -2.047  9.404   -0.221  1.00 0.00 ? 59  SER A OG   5  
ATOM 6772  H H    . SER A 1 59 ? -2.359  6.013   -1.127  1.00 0.00 ? 59  SER A H    5  
ATOM 6773  H HA   . SER A 1 59 ? -0.559  7.449   0.699   1.00 0.00 ? 59  SER A HA   5  
ATOM 6774  H HB2  . SER A 1 59 ? -3.492  8.043   0.245   1.00 0.00 ? 59  SER A HB2  5  
ATOM 6775  H HB3  . SER A 1 59 ? -2.566  8.665   1.610   1.00 0.00 ? 59  SER A HB3  5  
ATOM 6776  H HG   . SER A 1 59 ? -1.139  9.613   0.009   1.00 0.00 ? 59  SER A HG   5  
ATOM 6777  N N    . VAL A 1 60 ? -1.302  6.105   2.690   1.00 0.00 ? 60  VAL A N    5  
ATOM 6778  C CA   . VAL A 1 60 ? -1.589  5.164   3.769   1.00 0.00 ? 60  VAL A CA   5  
ATOM 6779  C C    . VAL A 1 60 ? -1.645  5.878   5.117   1.00 0.00 ? 60  VAL A C    5  
ATOM 6780  O O    . VAL A 1 60 ? -0.848  6.780   5.378   1.00 0.00 ? 60  VAL A O    5  
ATOM 6781  C CB   . VAL A 1 60 ? -0.529  4.043   3.838   1.00 0.00 ? 60  VAL A CB   5  
ATOM 6782  C CG1  . VAL A 1 60 ? -0.955  2.946   4.808   1.00 0.00 ? 60  VAL A CG1  5  
ATOM 6783  C CG2  . VAL A 1 60 ? -0.271  3.466   2.454   1.00 0.00 ? 60  VAL A CG2  5  
ATOM 6784  H H    . VAL A 1 60 ? -0.599  6.777   2.821   1.00 0.00 ? 60  VAL A H    5  
ATOM 6785  H HA   . VAL A 1 60 ? -2.549  4.712   3.570   1.00 0.00 ? 60  VAL A HA   5  
ATOM 6786  H HB   . VAL A 1 60 ? 0.392   4.474   4.201   1.00 0.00 ? 60  VAL A HB   5  
ATOM 6787  H HG11 . VAL A 1 60 ? -0.695  1.982   4.396   1.00 0.00 ? 60  VAL A HG11 5  
ATOM 6788  H HG12 . VAL A 1 60 ? -2.021  2.994   4.965   1.00 0.00 ? 60  VAL A HG12 5  
ATOM 6789  H HG13 . VAL A 1 60 ? -0.446  3.081   5.752   1.00 0.00 ? 60  VAL A HG13 5  
ATOM 6790  H HG21 . VAL A 1 60 ? 0.242   2.521   2.549   1.00 0.00 ? 60  VAL A HG21 5  
ATOM 6791  H HG22 . VAL A 1 60 ? 0.340   4.152   1.885   1.00 0.00 ? 60  VAL A HG22 5  
ATOM 6792  H HG23 . VAL A 1 60 ? -1.212  3.316   1.946   1.00 0.00 ? 60  VAL A HG23 5  
ATOM 6793  N N    . ASP A 1 61 ? -2.592  5.461   5.964   1.00 0.00 ? 61  ASP A N    5  
ATOM 6794  C CA   . ASP A 1 61 ? -2.777  6.042   7.301   1.00 0.00 ? 61  ASP A CA   5  
ATOM 6795  C C    . ASP A 1 61 ? -2.689  7.574   7.275   1.00 0.00 ? 61  ASP A C    5  
ATOM 6796  O O    . ASP A 1 61 ? -2.038  8.184   8.126   1.00 0.00 ? 61  ASP A O    5  
ATOM 6797  C CB   . ASP A 1 61 ? -1.766  5.442   8.308   1.00 0.00 ? 61  ASP A CB   5  
ATOM 6798  C CG   . ASP A 1 61 ? -0.301  5.673   7.951   1.00 0.00 ? 61  ASP A CG   5  
ATOM 6799  O OD1  . ASP A 1 61 ? 0.243   4.897   7.136   1.00 0.00 ? 61  ASP A OD1  5  
ATOM 6800  O OD2  . ASP A 1 61 ? 0.310   6.611   8.510   1.00 0.00 ? 61  ASP A OD2  5  
ATOM 6801  H H    . ASP A 1 61 ? -3.188  4.736   5.682   1.00 0.00 ? 61  ASP A H    5  
ATOM 6802  H HA   . ASP A 1 61 ? -3.774  5.773   7.622   1.00 0.00 ? 61  ASP A HA   5  
ATOM 6803  H HB2  . ASP A 1 61 ? -1.943  5.876   9.280   1.00 0.00 ? 61  ASP A HB2  5  
ATOM 6804  H HB3  . ASP A 1 61 ? -1.930  4.377   8.369   1.00 0.00 ? 61  ASP A HB3  5  
ATOM 6805  N N    . GLY A 1 62 ? -3.351  8.194   6.295   1.00 0.00 ? 62  GLY A N    5  
ATOM 6806  C CA   . GLY A 1 62 ? -3.325  9.643   6.181   1.00 0.00 ? 62  GLY A CA   5  
ATOM 6807  C C    . GLY A 1 62 ? -1.939  10.181  5.833   1.00 0.00 ? 62  GLY A C    5  
ATOM 6808  O O    . GLY A 1 62 ? -1.576  11.280  6.254   1.00 0.00 ? 62  GLY A O    5  
ATOM 6809  H H    . GLY A 1 62 ? -3.857  7.665   5.644   1.00 0.00 ? 62  GLY A H    5  
ATOM 6810  H HA2  . GLY A 1 62 ? -4.019  9.945   5.410   1.00 0.00 ? 62  GLY A HA2  5  
ATOM 6811  H HA3  . GLY A 1 62 ? -3.641  10.074  7.120   1.00 0.00 ? 62  GLY A HA3  5  
ATOM 6812  N N    . ARG A 1 63 ? -1.166  9.407   5.059   1.00 0.00 ? 63  ARG A N    5  
ATOM 6813  C CA   . ARG A 1 63 ? 0.182   9.817   4.649   1.00 0.00 ? 63  ARG A CA   5  
ATOM 6814  C C    . ARG A 1 63 ? 0.430   9.459   3.185   1.00 0.00 ? 63  ARG A C    5  
ATOM 6815  O O    . ARG A 1 63 ? -0.280  8.628   2.618   1.00 0.00 ? 63  ARG A O    5  
ATOM 6816  C CB   . ARG A 1 63 ? 1.252   9.159   5.531   1.00 0.00 ? 63  ARG A CB   5  
ATOM 6817  C CG   . ARG A 1 63 ? 1.768   10.065  6.640   1.00 0.00 ? 63  ARG A CG   5  
ATOM 6818  C CD   . ARG A 1 63 ? 1.812   9.339   7.975   1.00 0.00 ? 63  ARG A CD   5  
ATOM 6819  N NE   . ARG A 1 63 ? 2.309   10.189  9.058   1.00 0.00 ? 63  ARG A NE   5  
ATOM 6820  C CZ   . ARG A 1 63 ? 2.441   9.779   10.322  1.00 0.00 ? 63  ARG A CZ   5  
ATOM 6821  N NH1  . ARG A 1 63 ? 2.113   8.534   10.661  1.00 0.00 ? 63  ARG A NH1  5  
ATOM 6822  N NH2  . ARG A 1 63 ? 2.901   10.613  11.250  1.00 0.00 ? 63  ARG A NH2  5  
ATOM 6823  H H    . ARG A 1 63 ? -1.510  8.541   4.752   1.00 0.00 ? 63  ARG A H    5  
ATOM 6824  H HA   . ARG A 1 63 ? 0.249   10.889  4.760   1.00 0.00 ? 63  ARG A HA   5  
ATOM 6825  H HB2  . ARG A 1 63 ? 0.838   8.270   5.983   1.00 0.00 ? 63  ARG A HB2  5  
ATOM 6826  H HB3  . ARG A 1 63 ? 2.090   8.877   4.909   1.00 0.00 ? 63  ARG A HB3  5  
ATOM 6827  H HG2  . ARG A 1 63 ? 2.765   10.395  6.387   1.00 0.00 ? 63  ARG A HG2  5  
ATOM 6828  H HG3  . ARG A 1 63 ? 1.114   10.920  6.725   1.00 0.00 ? 63  ARG A HG3  5  
ATOM 6829  H HD2  . ARG A 1 63 ? 0.814   9.009   8.222   1.00 0.00 ? 63  ARG A HD2  5  
ATOM 6830  H HD3  . ARG A 1 63 ? 2.460   8.479   7.880   1.00 0.00 ? 63  ARG A HD3  5  
ATOM 6831  H HE   . ARG A 1 63 ? 2.556   11.112  8.834   1.00 0.00 ? 63  ARG A HE   5  
ATOM 6832  H HH11 . ARG A 1 63 ? 1.764   7.900   9.969   1.00 0.00 ? 63  ARG A HH11 5  
ATOM 6833  H HH12 . ARG A 1 63 ? 2.216   8.229   11.608  1.00 0.00 ? 63  ARG A HH12 5  
ATOM 6834  H HH21 . ARG A 1 63 ? 3.148   11.550  11.003  1.00 0.00 ? 63  ARG A HH21 5  
ATOM 6835  H HH22 . ARG A 1 63 ? 3.001   10.304  12.196  1.00 0.00 ? 63  ARG A HH22 5  
ATOM 6836  N N    . SER A 1 64 ? 1.439   10.087  2.579   1.00 0.00 ? 64  SER A N    5  
ATOM 6837  C CA   . SER A 1 64 ? 1.774   9.830   1.179   1.00 0.00 ? 64  SER A CA   5  
ATOM 6838  C C    . SER A 1 64 ? 3.129   9.142   1.056   1.00 0.00 ? 64  SER A C    5  
ATOM 6839  O O    . SER A 1 64 ? 4.087   9.510   1.738   1.00 0.00 ? 64  SER A O    5  
ATOM 6840  C CB   . SER A 1 64 ? 1.777   11.135  0.371   1.00 0.00 ? 64  SER A CB   5  
ATOM 6841  O OG   . SER A 1 64 ? 2.380   12.197  1.095   1.00 0.00 ? 64  SER A OG   5  
ATOM 6842  H H    . SER A 1 64 ? 1.970   10.737  3.085   1.00 0.00 ? 64  SER A H    5  
ATOM 6843  H HA   . SER A 1 64 ? 1.017   9.173   0.776   1.00 0.00 ? 64  SER A HA   5  
ATOM 6844  H HB2  . SER A 1 64 ? 2.326   10.985  -0.547  1.00 0.00 ? 64  SER A HB2  5  
ATOM 6845  H HB3  . SER A 1 64 ? 0.758   11.409  0.137   1.00 0.00 ? 64  SER A HB3  5  
ATOM 6846  H HG   . SER A 1 64 ? 3.305   11.993  1.259   1.00 0.00 ? 64  SER A HG   5  
ATOM 6847  N N    . LEU A 1 65 ? 3.201   8.142   0.180   1.00 0.00 ? 65  LEU A N    5  
ATOM 6848  C CA   . LEU A 1 65 ? 4.442   7.402   -0.038  1.00 0.00 ? 65  LEU A CA   5  
ATOM 6849  C C    . LEU A 1 65 ? 4.931   7.572   -1.474  1.00 0.00 ? 65  LEU A C    5  
ATOM 6850  O O    . LEU A 1 65 ? 5.323   6.603   -2.129  1.00 0.00 ? 65  LEU A O    5  
ATOM 6851  C CB   . LEU A 1 65 ? 4.246   5.915   0.284   1.00 0.00 ? 65  LEU A CB   5  
ATOM 6852  C CG   . LEU A 1 65 ? 3.479   5.613   1.574   1.00 0.00 ? 65  LEU A CG   5  
ATOM 6853  C CD1  . LEU A 1 65 ? 3.303   4.113   1.742   1.00 0.00 ? 65  LEU A CD1  5  
ATOM 6854  C CD2  . LEU A 1 65 ? 4.195   6.205   2.781   1.00 0.00 ? 65  LEU A CD2  5  
ATOM 6855  H H    . LEU A 1 65 ? 2.403   7.898   -0.335  1.00 0.00 ? 65  LEU A H    5  
ATOM 6856  H HA   . LEU A 1 65 ? 5.188   7.808   0.627   1.00 0.00 ? 65  LEU A HA   5  
ATOM 6857  H HB2  . LEU A 1 65 ? 3.714   5.459   -0.540  1.00 0.00 ? 65  LEU A HB2  5  
ATOM 6858  H HB3  . LEU A 1 65 ? 5.220   5.456   0.356   1.00 0.00 ? 65  LEU A HB3  5  
ATOM 6859  H HG   . LEU A 1 65 ? 2.496   6.059   1.515   1.00 0.00 ? 65  LEU A HG   5  
ATOM 6860  H HD11 . LEU A 1 65 ? 3.246   3.646   0.770   1.00 0.00 ? 65  LEU A HD11 5  
ATOM 6861  H HD12 . LEU A 1 65 ? 2.394   3.916   2.290   1.00 0.00 ? 65  LEU A HD12 5  
ATOM 6862  H HD13 . LEU A 1 65 ? 4.145   3.709   2.285   1.00 0.00 ? 65  LEU A HD13 5  
ATOM 6863  H HD21 . LEU A 1 65 ? 4.206   7.282   2.701   1.00 0.00 ? 65  LEU A HD21 5  
ATOM 6864  H HD22 . LEU A 1 65 ? 5.210   5.836   2.815   1.00 0.00 ? 65  LEU A HD22 5  
ATOM 6865  H HD23 . LEU A 1 65 ? 3.678   5.917   3.684   1.00 0.00 ? 65  LEU A HD23 5  
ATOM 6866  N N    . VAL A 1 66 ? 4.908   8.812   -1.959  1.00 0.00 ? 66  VAL A N    5  
ATOM 6867  C CA   . VAL A 1 66 ? 5.350   9.111   -3.313  1.00 0.00 ? 66  VAL A CA   5  
ATOM 6868  C C    . VAL A 1 66 ? 6.666   9.879   -3.298  1.00 0.00 ? 66  VAL A C    5  
ATOM 6869  O O    . VAL A 1 66 ? 6.697   11.089  -3.058  1.00 0.00 ? 66  VAL A O    5  
ATOM 6870  C CB   . VAL A 1 66 ? 4.282   9.905   -4.093  1.00 0.00 ? 66  VAL A CB   5  
ATOM 6871  C CG1  . VAL A 1 66 ? 4.827   10.379  -5.432  1.00 0.00 ? 66  VAL A CG1  5  
ATOM 6872  C CG2  . VAL A 1 66 ? 3.040   9.053   -4.292  1.00 0.00 ? 66  VAL A CG2  5  
ATOM 6873  H H    . VAL A 1 66 ? 4.586   9.543   -1.391  1.00 0.00 ? 66  VAL A H    5  
ATOM 6874  H HA   . VAL A 1 66 ? 5.509   8.170   -3.819  1.00 0.00 ? 66  VAL A HA   5  
ATOM 6875  H HB   . VAL A 1 66 ? 4.008   10.773  -3.511  1.00 0.00 ? 66  VAL A HB   5  
ATOM 6876  H HG11 . VAL A 1 66 ? 5.649   11.061  -5.266  1.00 0.00 ? 66  VAL A HG11 5  
ATOM 6877  H HG12 . VAL A 1 66 ? 4.047   10.885  -5.979  1.00 0.00 ? 66  VAL A HG12 5  
ATOM 6878  H HG13 . VAL A 1 66 ? 5.174   9.529   -6.001  1.00 0.00 ? 66  VAL A HG13 5  
ATOM 6879  H HG21 . VAL A 1 66 ? 2.566   9.318   -5.225  1.00 0.00 ? 66  VAL A HG21 5  
ATOM 6880  H HG22 . VAL A 1 66 ? 2.352   9.223   -3.477  1.00 0.00 ? 66  VAL A HG22 5  
ATOM 6881  H HG23 . VAL A 1 66 ? 3.322   8.010   -4.314  1.00 0.00 ? 66  VAL A HG23 5  
ATOM 6882  N N    . GLY A 1 67 ? 7.751   9.155   -3.550  1.00 0.00 ? 67  GLY A N    5  
ATOM 6883  C CA   . GLY A 1 67 ? 9.075   9.756   -3.563  1.00 0.00 ? 67  GLY A CA   5  
ATOM 6884  C C    . GLY A 1 67 ? 10.012  9.107   -2.565  1.00 0.00 ? 67  GLY A C    5  
ATOM 6885  O O    . GLY A 1 67 ? 11.200  8.934   -2.840  1.00 0.00 ? 67  GLY A O    5  
ATOM 6886  H H    . GLY A 1 67 ? 7.650   8.194   -3.724  1.00 0.00 ? 67  GLY A H    5  
ATOM 6887  H HA2  . GLY A 1 67 ? 9.495   9.656   -4.552  1.00 0.00 ? 67  GLY A HA2  5  
ATOM 6888  H HA3  . GLY A 1 67 ? 8.987   10.806  -3.324  1.00 0.00 ? 67  GLY A HA3  5  
ATOM 6889  N N    . LEU A 1 68 ? 9.472   8.745   -1.404  1.00 0.00 ? 68  LEU A N    5  
ATOM 6890  C CA   . LEU A 1 68 ? 10.260  8.107   -0.354  1.00 0.00 ? 68  LEU A CA   5  
ATOM 6891  C C    . LEU A 1 68 ? 10.586  6.658   -0.719  1.00 0.00 ? 68  LEU A C    5  
ATOM 6892  O O    . LEU A 1 68 ? 9.796   5.981   -1.381  1.00 0.00 ? 68  LEU A O    5  
ATOM 6893  C CB   . LEU A 1 68 ? 9.512   8.159   0.986   1.00 0.00 ? 68  LEU A CB   5  
ATOM 6894  C CG   . LEU A 1 68 ? 8.072   7.631   0.959   1.00 0.00 ? 68  LEU A CG   5  
ATOM 6895  C CD1  . LEU A 1 68 ? 8.050   6.123   1.148   1.00 0.00 ? 68  LEU A CD1  5  
ATOM 6896  C CD2  . LEU A 1 68 ? 7.231   8.317   2.025   1.00 0.00 ? 68  LEU A CD2  5  
ATOM 6897  H H    . LEU A 1 68 ? 8.518   8.910   -1.252  1.00 0.00 ? 68  LEU A H    5  
ATOM 6898  H HA   . LEU A 1 68 ? 11.185  8.655   -0.259  1.00 0.00 ? 68  LEU A HA   5  
ATOM 6899  H HB2  . LEU A 1 68 ? 10.072  7.581   1.707   1.00 0.00 ? 68  LEU A HB2  5  
ATOM 6900  H HB3  . LEU A 1 68 ? 9.487   9.186   1.316   1.00 0.00 ? 68  LEU A HB3  5  
ATOM 6901  H HG   . LEU A 1 68 ? 7.634   7.848   -0.003  1.00 0.00 ? 68  LEU A HG   5  
ATOM 6902  H HD11 . LEU A 1 68 ? 9.012   5.790   1.507   1.00 0.00 ? 68  LEU A HD11 5  
ATOM 6903  H HD12 . LEU A 1 68 ? 7.835   5.646   0.203   1.00 0.00 ? 68  LEU A HD12 5  
ATOM 6904  H HD13 . LEU A 1 68 ? 7.287   5.861   1.865   1.00 0.00 ? 68  LEU A HD13 5  
ATOM 6905  H HD21 . LEU A 1 68 ? 7.869   8.643   2.834   1.00 0.00 ? 68  LEU A HD21 5  
ATOM 6906  H HD22 . LEU A 1 68 ? 6.495   7.624   2.405   1.00 0.00 ? 68  LEU A HD22 5  
ATOM 6907  H HD23 . LEU A 1 68 ? 6.732   9.171   1.594   1.00 0.00 ? 68  LEU A HD23 5  
ATOM 6908  N N    . SER A 1 69 ? 11.755  6.191   -0.282  1.00 0.00 ? 69  SER A N    5  
ATOM 6909  C CA   . SER A 1 69 ? 12.191  4.822   -0.557  1.00 0.00 ? 69  SER A CA   5  
ATOM 6910  C C    . SER A 1 69 ? 11.260  3.816   0.113   1.00 0.00 ? 69  SER A C    5  
ATOM 6911  O O    . SER A 1 69 ? 10.579  4.145   1.087   1.00 0.00 ? 69  SER A O    5  
ATOM 6912  C CB   . SER A 1 69 ? 13.629  4.611   -0.073  1.00 0.00 ? 69  SER A CB   5  
ATOM 6913  O OG   . SER A 1 69 ? 14.452  5.713   -0.420  1.00 0.00 ? 69  SER A OG   5  
ATOM 6914  H H    . SER A 1 69 ? 12.339  6.780   0.241   1.00 0.00 ? 69  SER A H    5  
ATOM 6915  H HA   . SER A 1 69 ? 12.154  4.672   -1.626  1.00 0.00 ? 69  SER A HA   5  
ATOM 6916  H HB2  . SER A 1 69 ? 13.633  4.499   1.002   1.00 0.00 ? 69  SER A HB2  5  
ATOM 6917  H HB3  . SER A 1 69 ? 14.033  3.719   -0.529  1.00 0.00 ? 69  SER A HB3  5  
ATOM 6918  H HG   . SER A 1 69 ? 15.092  5.868   0.278   1.00 0.00 ? 69  SER A HG   5  
ATOM 6919  N N    . GLN A 1 70 ? 11.228  2.592   -0.412  1.00 0.00 ? 70  GLN A N    5  
ATOM 6920  C CA   . GLN A 1 70 ? 10.369  1.545   0.142   1.00 0.00 ? 70  GLN A CA   5  
ATOM 6921  C C    . GLN A 1 70 ? 10.586  1.375   1.643   1.00 0.00 ? 70  GLN A C    5  
ATOM 6922  O O    . GLN A 1 70 ? 9.629   1.166   2.388   1.00 0.00 ? 70  GLN A O    5  
ATOM 6923  C CB   . GLN A 1 70 ? 10.602  0.212   -0.559  1.00 0.00 ? 70  GLN A CB   5  
ATOM 6924  C CG   . GLN A 1 70 ? 9.608   -0.855  -0.135  1.00 0.00 ? 70  GLN A CG   5  
ATOM 6925  C CD   . GLN A 1 70 ? 8.174   -0.437  -0.396  1.00 0.00 ? 70  GLN A CD   5  
ATOM 6926  O OE1  . GLN A 1 70 ? 7.463   -0.017  0.517   1.00 0.00 ? 70  GLN A OE1  5  
ATOM 6927  N NE2  . GLN A 1 70 ? 7.743   -0.544  -1.646  1.00 0.00 ? 70  GLN A NE2  5  
ATOM 6928  H H    . GLN A 1 70 ? 11.790  2.389   -1.189  1.00 0.00 ? 70  GLN A H    5  
ATOM 6929  H HA   . GLN A 1 70 ? 9.345   1.847   -0.024  1.00 0.00 ? 70  GLN A HA   5  
ATOM 6930  H HB2  . GLN A 1 70 ? 10.518  0.355   -1.627  1.00 0.00 ? 70  GLN A HB2  5  
ATOM 6931  H HB3  . GLN A 1 70 ? 11.596  -0.137  -0.325  1.00 0.00 ? 70  GLN A HB3  5  
ATOM 6932  H HG2  . GLN A 1 70 ? 9.809   -1.760  -0.683  1.00 0.00 ? 70  GLN A HG2  5  
ATOM 6933  H HG3  . GLN A 1 70 ? 9.727   -1.040  0.923   1.00 0.00 ? 70  GLN A HG3  5  
ATOM 6934  H HE21 . GLN A 1 70 ? 8.366   -0.880  -2.321  1.00 0.00 ? 70  GLN A HE21 5  
ATOM 6935  H HE22 . GLN A 1 70 ? 6.820   -0.281  -1.843  1.00 0.00 ? 70  GLN A HE22 5  
ATOM 6936  N N    . GLU A 1 71 ? 11.844  1.469   2.081   1.00 0.00 ? 71  GLU A N    5  
ATOM 6937  C CA   . GLU A 1 71 ? 12.167  1.335   3.501   1.00 0.00 ? 71  GLU A CA   5  
ATOM 6938  C C    . GLU A 1 71 ? 11.290  2.272   4.326   1.00 0.00 ? 71  GLU A C    5  
ATOM 6939  O O    . GLU A 1 71 ? 10.741  1.879   5.353   1.00 0.00 ? 71  GLU A O    5  
ATOM 6940  C CB   . GLU A 1 71 ? 13.646  1.644   3.750   1.00 0.00 ? 71  GLU A CB   5  
ATOM 6941  C CG   . GLU A 1 71 ? 14.286  0.745   4.801   1.00 0.00 ? 71  GLU A CG   5  
ATOM 6942  C CD   . GLU A 1 71 ? 15.796  0.629   4.664   1.00 0.00 ? 71  GLU A CD   5  
ATOM 6943  O OE1  . GLU A 1 71 ? 16.318  0.825   3.545   1.00 0.00 ? 71  GLU A OE1  5  
ATOM 6944  O OE2  . GLU A 1 71 ? 16.459  0.336   5.682   1.00 0.00 ? 71  GLU A OE2  5  
ATOM 6945  H H    . GLU A 1 71 ? 12.565  1.640   1.439   1.00 0.00 ? 71  GLU A H    5  
ATOM 6946  H HA   . GLU A 1 71 ? 11.959  0.316   3.794   1.00 0.00 ? 71  GLU A HA   5  
ATOM 6947  H HB2  . GLU A 1 71 ? 14.189  1.527   2.824   1.00 0.00 ? 71  GLU A HB2  5  
ATOM 6948  H HB3  . GLU A 1 71 ? 13.736  2.668   4.083   1.00 0.00 ? 71  GLU A HB3  5  
ATOM 6949  H HG2  . GLU A 1 71 ? 14.065  1.147   5.777   1.00 0.00 ? 71  GLU A HG2  5  
ATOM 6950  H HG3  . GLU A 1 71 ? 13.857  -0.242  4.716   1.00 0.00 ? 71  GLU A HG3  5  
ATOM 6951  N N    . ARG A 1 72 ? 11.145  3.507   3.845   1.00 0.00 ? 72  ARG A N    5  
ATOM 6952  C CA   . ARG A 1 72 ? 10.311  4.500   4.513   1.00 0.00 ? 72  ARG A CA   5  
ATOM 6953  C C    . ARG A 1 72 ? 8.834   4.186   4.287   1.00 0.00 ? 72  ARG A C    5  
ATOM 6954  O O    . ARG A 1 72 ? 8.023   4.300   5.204   1.00 0.00 ? 72  ARG A O    5  
ATOM 6955  C CB   . ARG A 1 72 ? 10.630  5.908   3.998   1.00 0.00 ? 72  ARG A CB   5  
ATOM 6956  C CG   . ARG A 1 72 ? 12.099  6.284   4.114   1.00 0.00 ? 72  ARG A CG   5  
ATOM 6957  C CD   . ARG A 1 72 ? 12.379  7.011   5.419   1.00 0.00 ? 72  ARG A CD   5  
ATOM 6958  N NE   . ARG A 1 72 ? 11.882  8.389   5.396   1.00 0.00 ? 72  ARG A NE   5  
ATOM 6959  C CZ   . ARG A 1 72 ? 11.660  9.122   6.491   1.00 0.00 ? 72  ARG A CZ   5  
ATOM 6960  N NH1  . ARG A 1 72 ? 11.893  8.618   7.699   1.00 0.00 ? 72  ARG A NH1  5  
ATOM 6961  N NH2  . ARG A 1 72 ? 11.201  10.365  6.376   1.00 0.00 ? 72  ARG A NH2  5  
ATOM 6962  H H    . ARG A 1 72 ? 11.594  3.749   3.008   1.00 0.00 ? 72  ARG A H    5  
ATOM 6963  H HA   . ARG A 1 72 ? 10.520  4.451   5.573   1.00 0.00 ? 72  ARG A HA   5  
ATOM 6964  H HB2  . ARG A 1 72 ? 10.346  5.973   2.958   1.00 0.00 ? 72  ARG A HB2  5  
ATOM 6965  H HB3  . ARG A 1 72 ? 10.053  6.624   4.566   1.00 0.00 ? 72  ARG A HB3  5  
ATOM 6966  H HG2  . ARG A 1 72 ? 12.697  5.385   4.079   1.00 0.00 ? 72  ARG A HG2  5  
ATOM 6967  H HG3  . ARG A 1 72 ? 12.363  6.928   3.288   1.00 0.00 ? 72  ARG A HG3  5  
ATOM 6968  H HD2  . ARG A 1 72 ? 11.893  6.476   6.222   1.00 0.00 ? 72  ARG A HD2  5  
ATOM 6969  H HD3  . ARG A 1 72 ? 13.445  7.023   5.589   1.00 0.00 ? 72  ARG A HD3  5  
ATOM 6970  H HE   . ARG A 1 72 ? 11.703  8.789   4.519   1.00 0.00 ? 72  ARG A HE   5  
ATOM 6971  H HH11 . ARG A 1 72 ? 12.238  7.685   7.796   1.00 0.00 ? 72  ARG A HH11 5  
ATOM 6972  H HH12 . ARG A 1 72 ? 11.724  9.173   8.514   1.00 0.00 ? 72  ARG A HH12 5  
ATOM 6973  H HH21 . ARG A 1 72 ? 11.023  10.753  5.472   1.00 0.00 ? 72  ARG A HH21 5  
ATOM 6974  H HH22 . ARG A 1 72 ? 11.034  10.914  7.196   1.00 0.00 ? 72  ARG A HH22 5  
ATOM 6975  N N    . ALA A 1 73 ? 8.498   3.778   3.060   1.00 0.00 ? 73  ALA A N    5  
ATOM 6976  C CA   . ALA A 1 73 ? 7.123   3.435   2.711   1.00 0.00 ? 73  ALA A CA   5  
ATOM 6977  C C    . ALA A 1 73 ? 6.581   2.355   3.639   1.00 0.00 ? 73  ALA A C    5  
ATOM 6978  O O    . ALA A 1 73 ? 5.581   2.566   4.327   1.00 0.00 ? 73  ALA A O    5  
ATOM 6979  C CB   . ALA A 1 73 ? 7.038   2.977   1.264   1.00 0.00 ? 73  ALA A CB   5  
ATOM 6980  H H    . ALA A 1 73 ? 9.197   3.700   2.374   1.00 0.00 ? 73  ALA A H    5  
ATOM 6981  H HA   . ALA A 1 73 ? 6.521   4.325   2.820   1.00 0.00 ? 73  ALA A HA   5  
ATOM 6982  H HB1  . ALA A 1 73 ? 6.044   2.610   1.060   1.00 0.00 ? 73  ALA A HB1  5  
ATOM 6983  H HB2  . ALA A 1 73 ? 7.754   2.187   1.097   1.00 0.00 ? 73  ALA A HB2  5  
ATOM 6984  H HB3  . ALA A 1 73 ? 7.258   3.806   0.609   1.00 0.00 ? 73  ALA A HB3  5  
ATOM 6985  N N    . ALA A 1 74 ? 7.257   1.203   3.669   1.00 0.00 ? 74  ALA A N    5  
ATOM 6986  C CA   . ALA A 1 74 ? 6.838   0.108   4.536   1.00 0.00 ? 74  ALA A CA   5  
ATOM 6987  C C    . ALA A 1 74 ? 6.829   0.566   5.989   1.00 0.00 ? 74  ALA A C    5  
ATOM 6988  O O    . ALA A 1 74 ? 5.774   0.627   6.609   1.00 0.00 ? 74  ALA A O    5  
ATOM 6989  C CB   . ALA A 1 74 ? 7.742   -1.102  4.362   1.00 0.00 ? 74  ALA A CB   5  
ATOM 6990  H H    . ALA A 1 74 ? 8.059   1.095   3.105   1.00 0.00 ? 74  ALA A H    5  
ATOM 6991  H HA   . ALA A 1 74 ? 5.833   -0.173  4.251   1.00 0.00 ? 74  ALA A HA   5  
ATOM 6992  H HB1  . ALA A 1 74 ? 7.166   -1.999  4.525   1.00 0.00 ? 74  ALA A HB1  5  
ATOM 6993  H HB2  . ALA A 1 74 ? 8.547   -1.055  5.080   1.00 0.00 ? 74  ALA A HB2  5  
ATOM 6994  H HB3  . ALA A 1 74 ? 8.148   -1.110  3.362   1.00 0.00 ? 74  ALA A HB3  5  
ATOM 6995  N N    . GLU A 1 75 ? 8.017   0.905   6.512   1.00 0.00 ? 75  GLU A N    5  
ATOM 6996  C CA   . GLU A 1 75 ? 8.174   1.386   7.890   1.00 0.00 ? 75  GLU A CA   5  
ATOM 6997  C C    . GLU A 1 75 ? 7.016   2.297   8.309   1.00 0.00 ? 75  GLU A C    5  
ATOM 6998  O O    . GLU A 1 75 ? 6.456   2.136   9.392   1.00 0.00 ? 75  GLU A O    5  
ATOM 6999  C CB   . GLU A 1 75 ? 9.503   2.140   8.034   1.00 0.00 ? 75  GLU A CB   5  
ATOM 7000  C CG   . GLU A 1 75 ? 9.995   2.256   9.473   1.00 0.00 ? 75  GLU A CG   5  
ATOM 7001  C CD   . GLU A 1 75 ? 9.648   3.581   10.144  1.00 0.00 ? 75  GLU A CD   5  
ATOM 7002  O OE1  . GLU A 1 75 ? 8.963   4.420   9.518   1.00 0.00 ? 75  GLU A OE1  5  
ATOM 7003  O OE2  . GLU A 1 75 ? 10.065  3.778   11.306  1.00 0.00 ? 75  GLU A OE2  5  
ATOM 7004  H H    . GLU A 1 75 ? 8.812   0.836   5.948   1.00 0.00 ? 75  GLU A H    5  
ATOM 7005  H HA   . GLU A 1 75 ? 8.190   0.526   8.539   1.00 0.00 ? 75  GLU A HA   5  
ATOM 7006  H HB2  . GLU A 1 75 ? 10.262  1.621   7.465   1.00 0.00 ? 75  GLU A HB2  5  
ATOM 7007  H HB3  . GLU A 1 75 ? 9.382   3.134   7.631   1.00 0.00 ? 75  GLU A HB3  5  
ATOM 7008  H HG2  . GLU A 1 75 ? 9.555   1.460   10.049  1.00 0.00 ? 75  GLU A HG2  5  
ATOM 7009  H HG3  . GLU A 1 75 ? 11.069  2.144   9.472   1.00 0.00 ? 75  GLU A HG3  5  
ATOM 7010  N N    . LEU A 1 76 ? 6.664   3.250   7.443   1.00 0.00 ? 76  LEU A N    5  
ATOM 7011  C CA   . LEU A 1 76 ? 5.572   4.182   7.725   1.00 0.00 ? 76  LEU A CA   5  
ATOM 7012  C C    . LEU A 1 76 ? 4.250   3.434   7.928   1.00 0.00 ? 76  LEU A C    5  
ATOM 7013  O O    . LEU A 1 76 ? 3.491   3.736   8.850   1.00 0.00 ? 76  LEU A O    5  
ATOM 7014  C CB   . LEU A 1 76 ? 5.432   5.197   6.584   1.00 0.00 ? 76  LEU A CB   5  
ATOM 7015  C CG   . LEU A 1 76 ? 6.405   6.382   6.633   1.00 0.00 ? 76  LEU A CG   5  
ATOM 7016  C CD1  . LEU A 1 76 ? 6.293   7.217   5.364   1.00 0.00 ? 76  LEU A CD1  5  
ATOM 7017  C CD2  . LEU A 1 76 ? 6.145   7.240   7.863   1.00 0.00 ? 76  LEU A CD2  5  
ATOM 7018  H H    . LEU A 1 76 ? 7.151   3.327   6.594   1.00 0.00 ? 76  LEU A H    5  
ATOM 7019  H HA   . LEU A 1 76 ? 5.815   4.708   8.636   1.00 0.00 ? 76  LEU A HA   5  
ATOM 7020  H HB2  . LEU A 1 76 ? 5.584   4.676   5.650   1.00 0.00 ? 76  LEU A HB2  5  
ATOM 7021  H HB3  . LEU A 1 76 ? 4.427   5.586   6.599   1.00 0.00 ? 76  LEU A HB3  5  
ATOM 7022  H HG   . LEU A 1 76 ? 7.417   6.007   6.694   1.00 0.00 ? 76  LEU A HG   5  
ATOM 7023  H HD11 . LEU A 1 76 ? 7.189   7.806   5.238   1.00 0.00 ? 76  LEU A HD11 5  
ATOM 7024  H HD12 . LEU A 1 76 ? 5.438   7.873   5.438   1.00 0.00 ? 76  LEU A HD12 5  
ATOM 7025  H HD13 . LEU A 1 76 ? 6.170   6.563   4.513   1.00 0.00 ? 76  LEU A HD13 5  
ATOM 7026  H HD21 . LEU A 1 76 ? 6.415   6.688   8.750   1.00 0.00 ? 76  LEU A HD21 5  
ATOM 7027  H HD22 . LEU A 1 76 ? 5.098   7.501   7.904   1.00 0.00 ? 76  LEU A HD22 5  
ATOM 7028  H HD23 . LEU A 1 76 ? 6.738   8.142   7.805   1.00 0.00 ? 76  LEU A HD23 5  
ATOM 7029  N N    . MET A 1 77 ? 3.992   2.452   7.064   1.00 0.00 ? 77  MET A N    5  
ATOM 7030  C CA   . MET A 1 77 ? 2.776   1.642   7.139   1.00 0.00 ? 77  MET A CA   5  
ATOM 7031  C C    . MET A 1 77 ? 2.869   0.603   8.261   1.00 0.00 ? 77  MET A C    5  
ATOM 7032  O O    . MET A 1 77 ? 1.856   0.226   8.848   1.00 0.00 ? 77  MET A O    5  
ATOM 7033  C CB   . MET A 1 77 ? 2.530   0.935   5.804   1.00 0.00 ? 77  MET A CB   5  
ATOM 7034  C CG   . MET A 1 77 ? 2.344   1.884   4.631   1.00 0.00 ? 77  MET A CG   5  
ATOM 7035  S SD   . MET A 1 77 ? 3.130   1.289   3.120   1.00 0.00 ? 77  MET A SD   5  
ATOM 7036  C CE   . MET A 1 77 ? 2.497   -0.384  3.040   1.00 0.00 ? 77  MET A CE   5  
ATOM 7037  H H    . MET A 1 77 ? 4.644   2.260   6.358   1.00 0.00 ? 77  MET A H    5  
ATOM 7038  H HA   . MET A 1 77 ? 1.946   2.304   7.344   1.00 0.00 ? 77  MET A HA   5  
ATOM 7039  H HB2  . MET A 1 77 ? 3.374   0.297   5.590   1.00 0.00 ? 77  MET A HB2  5  
ATOM 7040  H HB3  . MET A 1 77 ? 1.642   0.325   5.892   1.00 0.00 ? 77  MET A HB3  5  
ATOM 7041  H HG2  . MET A 1 77 ? 1.289   2.001   4.446   1.00 0.00 ? 77  MET A HG2  5  
ATOM 7042  H HG3  . MET A 1 77 ? 2.771   2.843   4.888   1.00 0.00 ? 77  MET A HG3  5  
ATOM 7043  H HE1  . MET A 1 77 ? 1.430   -0.374  3.205   1.00 0.00 ? 77  MET A HE1  5  
ATOM 7044  H HE2  . MET A 1 77 ? 2.973   -0.985  3.801   1.00 0.00 ? 77  MET A HE2  5  
ATOM 7045  H HE3  . MET A 1 77 ? 2.707   -0.802  2.067   1.00 0.00 ? 77  MET A HE3  5  
ATOM 7046  N N    . THR A 1 78 ? 4.089   0.140   8.553   1.00 0.00 ? 78  THR A N    5  
ATOM 7047  C CA   . THR A 1 78 ? 4.305   -0.852  9.603   1.00 0.00 ? 78  THR A CA   5  
ATOM 7048  C C    . THR A 1 78 ? 3.868   -0.306  10.966  1.00 0.00 ? 78  THR A C    5  
ATOM 7049  O O    . THR A 1 78 ? 3.475   -1.069  11.849  1.00 0.00 ? 78  THR A O    5  
ATOM 7050  C CB   . THR A 1 78 ? 5.779   -1.279  9.653   1.00 0.00 ? 78  THR A CB   5  
ATOM 7051  O OG1  . THR A 1 78 ? 6.447   -0.963  8.448   1.00 0.00 ? 78  THR A OG1  5  
ATOM 7052  C CG2  . THR A 1 78 ? 5.973   -2.760  9.884   1.00 0.00 ? 78  THR A CG2  5  
ATOM 7053  H H    . THR A 1 78 ? 4.862   0.473   8.050   1.00 0.00 ? 78  THR A H    5  
ATOM 7054  H HA   . THR A 1 78 ? 3.699   -1.716  9.369   1.00 0.00 ? 78  THR A HA   5  
ATOM 7055  H HB   . THR A 1 78 ? 6.268   -0.751  10.457  1.00 0.00 ? 78  THR A HB   5  
ATOM 7056  H HG1  . THR A 1 78 ? 7.373   -1.208  8.521   1.00 0.00 ? 78  THR A HG1  5  
ATOM 7057  H HG21 . THR A 1 78 ? 6.841   -3.093  9.333   1.00 0.00 ? 78  THR A HG21 5  
ATOM 7058  H HG22 . THR A 1 78 ? 5.100   -3.295  9.541   1.00 0.00 ? 78  THR A HG22 5  
ATOM 7059  H HG23 . THR A 1 78 ? 6.122   -2.945  10.937  1.00 0.00 ? 78  THR A HG23 5  
ATOM 7060  N N    . ARG A 1 79 ? 3.930   1.019   11.128  1.00 0.00 ? 79  ARG A N    5  
ATOM 7061  C CA   . ARG A 1 79 ? 3.532   1.664   12.379  1.00 0.00 ? 79  ARG A CA   5  
ATOM 7062  C C    . ARG A 1 79 ? 2.085   2.175   12.305  1.00 0.00 ? 79  ARG A C    5  
ATOM 7063  O O    . ARG A 1 79 ? 1.750   3.198   12.913  1.00 0.00 ? 79  ARG A O    5  
ATOM 7064  C CB   . ARG A 1 79 ? 4.479   2.830   12.701  1.00 0.00 ? 79  ARG A CB   5  
ATOM 7065  C CG   . ARG A 1 79 ? 5.958   2.505   12.524  1.00 0.00 ? 79  ARG A CG   5  
ATOM 7066  C CD   . ARG A 1 79 ? 6.780   3.769   12.306  1.00 0.00 ? 79  ARG A CD   5  
ATOM 7067  N NE   . ARG A 1 79 ? 7.753   3.994   13.377  1.00 0.00 ? 79  ARG A NE   5  
ATOM 7068  C CZ   . ARG A 1 79 ? 8.476   5.110   13.510  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 7069  N NH1  . ARG A 1 79 ? 8.352   6.106   12.635  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 7070  N NH2  . ARG A 1 79 ? 9.332   5.228   14.520  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 7071  H H    . ARG A 1 79 ? 4.246   1.578   10.387  1.00 0.00 ? 79  ARG A H    5  
ATOM 7072  H HA   . ARG A 1 79 ? 3.601   0.929   13.168  1.00 0.00 ? 79  ARG A HA   5  
ATOM 7073  H HB2  . ARG A 1 79 ? 4.238   3.658   12.051  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 7074  H HB3  . ARG A 1 79 ? 4.320   3.134   13.726  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 7075  H HG2  . ARG A 1 79 ? 6.315   1.999   13.409  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 7076  H HG3  . ARG A 1 79 ? 6.075   1.860   11.667  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 7077  H HD2  . ARG A 1 79 ? 7.307   3.682   11.368  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 7078  H HD3  . ARG A 1 79 ? 6.109   4.614   12.261  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 7079  H HE   . ARG A 1 79 ? 7.872   3.278   14.035  1.00 0.00 ? 79  ARG A HE   5  
ATOM 7080  H HH11 . ARG A 1 79 ? 7.716   6.024   11.867  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 7081  H HH12 . ARG A 1 79 ? 8.896   6.939   12.744  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 7082  H HH21 . ARG A 1 79 ? 9.435   4.482   15.178  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 7083  H HH22 . ARG A 1 79 ? 9.874   6.062   14.622  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 7084  N N    . THR A 1 80 ? 1.229   1.463   11.562  1.00 0.00 ? 80  THR A N    5  
ATOM 7085  C CA   . THR A 1 80 ? -0.177  1.852   11.416  1.00 0.00 ? 80  THR A CA   5  
ATOM 7086  C C    . THR A 1 80 ? -0.891  1.878   12.765  1.00 0.00 ? 80  THR A C    5  
ATOM 7087  O O    . THR A 1 80 ? -0.596  1.076   13.652  1.00 0.00 ? 80  THR A O    5  
ATOM 7088  C CB   . THR A 1 80 ? -0.918  0.901   10.464  1.00 0.00 ? 80  THR A CB   5  
ATOM 7089  O OG1  . THR A 1 80 ? -0.445  -0.434  10.589  1.00 0.00 ? 80  THR A OG1  5  
ATOM 7090  C CG2  . THR A 1 80 ? -0.792  1.299   9.008   1.00 0.00 ? 80  THR A CG2  5  
ATOM 7091  H H    . THR A 1 80 ? 1.549   0.661   11.101  1.00 0.00 ? 80  THR A H    5  
ATOM 7092  H HA   . THR A 1 80 ? -0.197  2.848   10.997  1.00 0.00 ? 80  THR A HA   5  
ATOM 7093  H HB   . THR A 1 80 ? -1.969  0.910   10.715  1.00 0.00 ? 80  THR A HB   5  
ATOM 7094  H HG1  . THR A 1 80 ? -0.219  -0.615  11.504  1.00 0.00 ? 80  THR A HG1  5  
ATOM 7095  H HG21 . THR A 1 80 ? -1.647  1.894   8.723   1.00 0.00 ? 80  THR A HG21 5  
ATOM 7096  H HG22 . THR A 1 80 ? -0.750  0.412   8.394   1.00 0.00 ? 80  THR A HG22 5  
ATOM 7097  H HG23 . THR A 1 80 ? 0.111   1.876   8.870   1.00 0.00 ? 80  THR A HG23 5  
ATOM 7098  N N    . SER A 1 81 ? -1.840  2.803   12.906  1.00 0.00 ? 81  SER A N    5  
ATOM 7099  C CA   . SER A 1 81 ? -2.609  2.938   14.140  1.00 0.00 ? 81  SER A CA   5  
ATOM 7100  C C    . SER A 1 81 ? -3.813  1.991   14.133  1.00 0.00 ? 81  SER A C    5  
ATOM 7101  O O    . SER A 1 81 ? -3.891  1.080   13.304  1.00 0.00 ? 81  SER A O    5  
ATOM 7102  C CB   . SER A 1 81 ? -3.076  4.391   14.315  1.00 0.00 ? 81  SER A CB   5  
ATOM 7103  O OG   . SER A 1 81 ? -2.060  5.308   13.943  1.00 0.00 ? 81  SER A OG   5  
ATOM 7104  H H    . SER A 1 81 ? -2.032  3.408   12.158  1.00 0.00 ? 81  SER A H    5  
ATOM 7105  H HA   . SER A 1 81 ? -1.963  2.674   14.964  1.00 0.00 ? 81  SER A HA   5  
ATOM 7106  H HB2  . SER A 1 81 ? -3.945  4.566   13.696  1.00 0.00 ? 81  SER A HB2  5  
ATOM 7107  H HB3  . SER A 1 81 ? -3.336  4.561   15.350  1.00 0.00 ? 81  SER A HB3  5  
ATOM 7108  H HG   . SER A 1 81 ? -2.240  5.649   13.063  1.00 0.00 ? 81  SER A HG   5  
ATOM 7109  N N    . SER A 1 82 ? -4.753  2.213   15.055  1.00 0.00 ? 82  SER A N    5  
ATOM 7110  C CA   . SER A 1 82 ? -5.957  1.386   15.148  1.00 0.00 ? 82  SER A CA   5  
ATOM 7111  C C    . SER A 1 82 ? -6.722  1.378   13.822  1.00 0.00 ? 82  SER A C    5  
ATOM 7112  O O    . SER A 1 82 ? -7.365  0.386   13.478  1.00 0.00 ? 82  SER A O    5  
ATOM 7113  C CB   . SER A 1 82 ? -6.869  1.889   16.273  1.00 0.00 ? 82  SER A CB   5  
ATOM 7114  O OG   . SER A 1 82 ? -6.113  2.358   17.377  1.00 0.00 ? 82  SER A OG   5  
ATOM 7115  H H    . SER A 1 82 ? -4.637  2.955   15.686  1.00 0.00 ? 82  SER A H    5  
ATOM 7116  H HA   . SER A 1 82 ? -5.647  0.376   15.376  1.00 0.00 ? 82  SER A HA   5  
ATOM 7117  H HB2  . SER A 1 82 ? -7.481  2.698   15.903  1.00 0.00 ? 82  SER A HB2  5  
ATOM 7118  H HB3  . SER A 1 82 ? -7.505  1.082   16.606  1.00 0.00 ? 82  SER A HB3  5  
ATOM 7119  H HG   . SER A 1 82 ? -5.612  1.630   17.755  1.00 0.00 ? 82  SER A HG   5  
ATOM 7120  N N    . VAL A 1 83 ? -6.644  2.487   13.079  1.00 0.00 ? 83  VAL A N    5  
ATOM 7121  C CA   . VAL A 1 83 ? -7.323  2.598   11.790  1.00 0.00 ? 83  VAL A CA   5  
ATOM 7122  C C    . VAL A 1 83 ? -6.331  2.467   10.637  1.00 0.00 ? 83  VAL A C    5  
ATOM 7123  O O    . VAL A 1 83 ? -5.208  2.971   10.709  1.00 0.00 ? 83  VAL A O    5  
ATOM 7124  C CB   . VAL A 1 83 ? -8.081  3.936   11.651  1.00 0.00 ? 83  VAL A CB   5  
ATOM 7125  C CG1  . VAL A 1 83 ? -8.946  3.936   10.397  1.00 0.00 ? 83  VAL A CG1  5  
ATOM 7126  C CG2  . VAL A 1 83 ? -8.924  4.208   12.889  1.00 0.00 ? 83  VAL A CG2  5  
ATOM 7127  H H    . VAL A 1 83 ? -6.114  3.244   13.404  1.00 0.00 ? 83  VAL A H    5  
ATOM 7128  H HA   . VAL A 1 83 ? -8.041  1.793   11.724  1.00 0.00 ? 83  VAL A HA   5  
ATOM 7129  H HB   . VAL A 1 83 ? -7.354  4.731   11.556  1.00 0.00 ? 83  VAL A HB   5  
ATOM 7130  H HG11 . VAL A 1 83 ? -9.565  3.050   10.386  1.00 0.00 ? 83  VAL A HG11 5  
ATOM 7131  H HG12 . VAL A 1 83 ? -8.312  3.942   9.523   1.00 0.00 ? 83  VAL A HG12 5  
ATOM 7132  H HG13 . VAL A 1 83 ? -9.575  4.814   10.392  1.00 0.00 ? 83  VAL A HG13 5  
ATOM 7133  H HG21 . VAL A 1 83 ? -8.277  4.469   13.714  1.00 0.00 ? 83  VAL A HG21 5  
ATOM 7134  H HG22 . VAL A 1 83 ? -9.490  3.323   13.140  1.00 0.00 ? 83  VAL A HG22 5  
ATOM 7135  H HG23 . VAL A 1 83 ? -9.601  5.025   12.691  1.00 0.00 ? 83  VAL A HG23 5  
ATOM 7136  N N    . VAL A 1 84 ? -6.760  1.788   9.576   1.00 0.00 ? 84  VAL A N    5  
ATOM 7137  C CA   . VAL A 1 84 ? -5.926  1.584   8.398   1.00 0.00 ? 84  VAL A CA   5  
ATOM 7138  C C    . VAL A 1 84 ? -6.602  2.155   7.156   1.00 0.00 ? 84  VAL A C    5  
ATOM 7139  O O    . VAL A 1 84 ? -7.655  1.673   6.739   1.00 0.00 ? 84  VAL A O    5  
ATOM 7140  C CB   . VAL A 1 84 ? -5.623  0.087   8.164   1.00 0.00 ? 84  VAL A CB   5  
ATOM 7141  C CG1  . VAL A 1 84 ? -4.588  -0.081  7.061   1.00 0.00 ? 84  VAL A CG1  5  
ATOM 7142  C CG2  . VAL A 1 84 ? -5.154  -0.579  9.452   1.00 0.00 ? 84  VAL A CG2  5  
ATOM 7143  H H    . VAL A 1 84 ? -7.667  1.414   9.586   1.00 0.00 ? 84  VAL A H    5  
ATOM 7144  H HA   . VAL A 1 84 ? -4.989  2.099   8.557   1.00 0.00 ? 84  VAL A HA   5  
ATOM 7145  H HB   . VAL A 1 84 ? -6.536  -0.398  7.845   1.00 0.00 ? 84  VAL A HB   5  
ATOM 7146  H HG11 . VAL A 1 84 ? -4.463  -1.131  6.839   1.00 0.00 ? 84  VAL A HG11 5  
ATOM 7147  H HG12 . VAL A 1 84 ? -3.645  0.333   7.385   1.00 0.00 ? 84  VAL A HG12 5  
ATOM 7148  H HG13 . VAL A 1 84 ? -4.921  0.436   6.172   1.00 0.00 ? 84  VAL A HG13 5  
ATOM 7149  H HG21 . VAL A 1 84 ? -4.170  -0.216  9.707   1.00 0.00 ? 84  VAL A HG21 5  
ATOM 7150  H HG22 . VAL A 1 84 ? -5.119  -1.649  9.312   1.00 0.00 ? 84  VAL A HG22 5  
ATOM 7151  H HG23 . VAL A 1 84 ? -5.843  -0.344  10.251  1.00 0.00 ? 84  VAL A HG23 5  
ATOM 7152  N N    . THR A 1 85 ? -5.990  3.188   6.576   1.00 0.00 ? 85  THR A N    5  
ATOM 7153  C CA   . THR A 1 85 ? -6.531  3.834   5.382   1.00 0.00 ? 85  THR A CA   5  
ATOM 7154  C C    . THR A 1 85 ? -5.576  3.674   4.196   1.00 0.00 ? 85  THR A C    5  
ATOM 7155  O O    . THR A 1 85 ? -4.711  4.520   3.965   1.00 0.00 ? 85  THR A O    5  
ATOM 7156  C CB   . THR A 1 85 ? -6.806  5.320   5.653   1.00 0.00 ? 85  THR A CB   5  
ATOM 7157  O OG1  . THR A 1 85 ? -7.023  5.554   7.036   1.00 0.00 ? 85  THR A OG1  5  
ATOM 7158  C CG2  . THR A 1 85 ? -8.014  5.847   4.906   1.00 0.00 ? 85  THR A CG2  5  
ATOM 7159  H H    . THR A 1 85 ? -5.156  3.526   6.963   1.00 0.00 ? 85  THR A H    5  
ATOM 7160  H HA   . THR A 1 85 ? -7.463  3.346   5.139   1.00 0.00 ? 85  THR A HA   5  
ATOM 7161  H HB   . THR A 1 85 ? -5.948  5.899   5.341   1.00 0.00 ? 85  THR A HB   5  
ATOM 7162  H HG1  . THR A 1 85 ? -6.183  5.725   7.470   1.00 0.00 ? 85  THR A HG1  5  
ATOM 7163  H HG21 . THR A 1 85 ? -7.693  6.311   3.987   1.00 0.00 ? 85  THR A HG21 5  
ATOM 7164  H HG22 . THR A 1 85 ? -8.528  6.574   5.517   1.00 0.00 ? 85  THR A HG22 5  
ATOM 7165  H HG23 . THR A 1 85 ? -8.683  5.028   4.682   1.00 0.00 ? 85  THR A HG23 5  
ATOM 7166  N N    . LEU A 1 86 ? -5.738  2.576   3.454   1.00 0.00 ? 86  LEU A N    5  
ATOM 7167  C CA   . LEU A 1 86 ? -4.892  2.288   2.293   1.00 0.00 ? 86  LEU A CA   5  
ATOM 7168  C C    . LEU A 1 86 ? -5.611  2.619   0.986   1.00 0.00 ? 86  LEU A C    5  
ATOM 7169  O O    . LEU A 1 86 ? -6.767  2.242   0.794   1.00 0.00 ? 86  LEU A O    5  
ATOM 7170  C CB   . LEU A 1 86 ? -4.482  0.812   2.287   1.00 0.00 ? 86  LEU A CB   5  
ATOM 7171  C CG   . LEU A 1 86 ? -3.516  0.398   3.399   1.00 0.00 ? 86  LEU A CG   5  
ATOM 7172  C CD1  . LEU A 1 86 ? -3.824  -1.014  3.873   1.00 0.00 ? 86  LEU A CD1  5  
ATOM 7173  C CD2  . LEU A 1 86 ? -2.076  0.501   2.918   1.00 0.00 ? 86  LEU A CD2  5  
ATOM 7174  H H    . LEU A 1 86 ? -6.443  1.938   3.697   1.00 0.00 ? 86  LEU A H    5  
ATOM 7175  H HA   . LEU A 1 86 ? -4.004  2.898   2.368   1.00 0.00 ? 86  LEU A HA   5  
ATOM 7176  H HB2  . LEU A 1 86 ? -5.377  0.212   2.376   1.00 0.00 ? 86  LEU A HB2  5  
ATOM 7177  H HB3  . LEU A 1 86 ? -4.017  0.593   1.338   1.00 0.00 ? 86  LEU A HB3  5  
ATOM 7178  H HG   . LEU A 1 86 ? -3.638  1.065   4.240   1.00 0.00 ? 86  LEU A HG   5  
ATOM 7179  H HD11 . LEU A 1 86 ? -3.621  -1.091  4.931   1.00 0.00 ? 86  LEU A HD11 5  
ATOM 7180  H HD12 . LEU A 1 86 ? -3.206  -1.718  3.337   1.00 0.00 ? 86  LEU A HD12 5  
ATOM 7181  H HD13 . LEU A 1 86 ? -4.865  -1.237  3.690   1.00 0.00 ? 86  LEU A HD13 5  
ATOM 7182  H HD21 . LEU A 1 86 ? -1.960  -0.061  2.003   1.00 0.00 ? 86  LEU A HD21 5  
ATOM 7183  H HD22 . LEU A 1 86 ? -1.414  0.101   3.672   1.00 0.00 ? 86  LEU A HD22 5  
ATOM 7184  H HD23 . LEU A 1 86 ? -1.831  1.537   2.738   1.00 0.00 ? 86  LEU A HD23 5  
ATOM 7185  N N    . GLU A 1 87 ? -4.913  3.314   0.087   1.00 0.00 ? 87  GLU A N    5  
ATOM 7186  C CA   . GLU A 1 87 ? -5.481  3.685   -1.208  1.00 0.00 ? 87  GLU A CA   5  
ATOM 7187  C C    . GLU A 1 87 ? -4.725  3.010   -2.348  1.00 0.00 ? 87  GLU A C    5  
ATOM 7188  O O    . GLU A 1 87 ? -3.499  3.111   -2.437  1.00 0.00 ? 87  GLU A O    5  
ATOM 7189  C CB   . GLU A 1 87 ? -5.453  5.204   -1.392  1.00 0.00 ? 87  GLU A CB   5  
ATOM 7190  C CG   . GLU A 1 87 ? -6.056  5.678   -2.707  1.00 0.00 ? 87  GLU A CG   5  
ATOM 7191  C CD   . GLU A 1 87 ? -6.049  7.189   -2.843  1.00 0.00 ? 87  GLU A CD   5  
ATOM 7192  O OE1  . GLU A 1 87 ? -4.947  7.779   -2.870  1.00 0.00 ? 87  GLU A OE1  5  
ATOM 7193  O OE2  . GLU A 1 87 ? -7.145  7.783   -2.926  1.00 0.00 ? 87  GLU A OE2  5  
ATOM 7194  H H    . GLU A 1 87 ? -3.992  3.577   0.296   1.00 0.00 ? 87  GLU A H    5  
ATOM 7195  H HA   . GLU A 1 87 ? -6.507  3.349   -1.227  1.00 0.00 ? 87  GLU A HA   5  
ATOM 7196  H HB2  . GLU A 1 87 ? -6.004  5.663   -0.586  1.00 0.00 ? 87  GLU A HB2  5  
ATOM 7197  H HB3  . GLU A 1 87 ? -4.427  5.539   -1.352  1.00 0.00 ? 87  GLU A HB3  5  
ATOM 7198  H HG2  . GLU A 1 87 ? -5.488  5.257   -3.523  1.00 0.00 ? 87  GLU A HG2  5  
ATOM 7199  H HG3  . GLU A 1 87 ? -7.078  5.331   -2.765  1.00 0.00 ? 87  GLU A HG3  5  
ATOM 7200  N N    . VAL A 1 88 ? -5.467  2.328   -3.219  1.00 0.00 ? 88  VAL A N    5  
ATOM 7201  C CA   . VAL A 1 88 ? -4.874  1.639   -4.363  1.00 0.00 ? 88  VAL A CA   5  
ATOM 7202  C C    . VAL A 1 88 ? -5.492  2.112   -5.678  1.00 0.00 ? 88  VAL A C    5  
ATOM 7203  O O    . VAL A 1 88 ? -6.491  2.835   -5.685  1.00 0.00 ? 88  VAL A O    5  
ATOM 7204  C CB   . VAL A 1 88 ? -5.036  0.106   -4.259  1.00 0.00 ? 88  VAL A CB   5  
ATOM 7205  C CG1  . VAL A 1 88 ? -4.264  -0.440  -3.067  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 7206  C CG2  . VAL A 1 88 ? -6.507  -0.280  -4.178  1.00 0.00 ? 88  VAL A CG2  5  
ATOM 7207  H H    . VAL A 1 88 ? -6.440  2.292   -3.093  1.00 0.00 ? 88  VAL A H    5  
ATOM 7208  H HA   . VAL A 1 88 ? -3.818  1.866   -4.374  1.00 0.00 ? 88  VAL A HA   5  
ATOM 7209  H HB   . VAL A 1 88 ? -4.623  -0.336  -5.154  1.00 0.00 ? 88  VAL A HB   5  
ATOM 7210  H HG11 . VAL A 1 88 ? -3.469  0.244   -2.811  1.00 0.00 ? 88  VAL A HG11 5  
ATOM 7211  H HG12 . VAL A 1 88 ? -3.843  -1.401  -3.323  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 7212  H HG13 . VAL A 1 88 ? -4.929  -0.551  -2.224  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 7213  H HG21 . VAL A 1 88 ? -6.595  -1.355  -4.133  1.00 0.00 ? 88  VAL A HG21 5  
ATOM 7214  H HG22 . VAL A 1 88 ? -7.022  0.086   -5.055  1.00 0.00 ? 88  VAL A HG22 5  
ATOM 7215  H HG23 . VAL A 1 88 ? -6.947  0.156   -3.294  1.00 0.00 ? 88  VAL A HG23 5  
ATOM 7216  N N    . ALA A 1 89 ? -4.890  1.690   -6.789  1.00 0.00 ? 89  ALA A N    5  
ATOM 7217  C CA   . ALA A 1 89 ? -5.372  2.057   -8.118  1.00 0.00 ? 89  ALA A CA   5  
ATOM 7218  C C    . ALA A 1 89 ? -5.601  0.816   -8.976  1.00 0.00 ? 89  ALA A C    5  
ATOM 7219  O O    . ALA A 1 89 ? -4.746  -0.071  -9.034  1.00 0.00 ? 89  ALA A O    5  
ATOM 7220  C CB   . ALA A 1 89 ? -4.383  2.994   -8.801  1.00 0.00 ? 89  ALA A CB   5  
ATOM 7221  H H    . ALA A 1 89 ? -4.103  1.112   -6.712  1.00 0.00 ? 89  ALA A H    5  
ATOM 7222  H HA   . ALA A 1 89 ? -6.309  2.582   -8.001  1.00 0.00 ? 89  ALA A HA   5  
ATOM 7223  H HB1  . ALA A 1 89 ? -4.421  2.840   -9.870  1.00 0.00 ? 89  ALA A HB1  5  
ATOM 7224  H HB2  . ALA A 1 89 ? -3.384  2.788   -8.444  1.00 0.00 ? 89  ALA A HB2  5  
ATOM 7225  H HB3  . ALA A 1 89 ? -4.642  4.017   -8.576  1.00 0.00 ? 89  ALA A HB3  5  
ATOM 7226  N N    . LYS A 1 90 ? -6.755  0.763   -9.645  1.00 0.00 ? 90  LYS A N    5  
ATOM 7227  C CA   . LYS A 1 90 ? -7.092  -0.370  -10.508 1.00 0.00 ? 90  LYS A CA   5  
ATOM 7228  C C    . LYS A 1 90 ? -6.213  -0.369  -11.756 1.00 0.00 ? 90  LYS A C    5  
ATOM 7229  O O    . LYS A 1 90 ? -6.533  0.281   -12.754 1.00 0.00 ? 90  LYS A O    5  
ATOM 7230  C CB   . LYS A 1 90 ? -8.571  -0.329  -10.911 1.00 0.00 ? 90  LYS A CB   5  
ATOM 7231  C CG   . LYS A 1 90 ? -9.532  -0.520  -9.748  1.00 0.00 ? 90  LYS A CG   5  
ATOM 7232  C CD   . LYS A 1 90 ? -9.386  -1.895  -9.114  1.00 0.00 ? 90  LYS A CD   5  
ATOM 7233  C CE   . LYS A 1 90 ? -10.342 -2.073  -7.943  1.00 0.00 ? 90  LYS A CE   5  
ATOM 7234  N NZ   . LYS A 1 90 ? -10.006 -1.171  -6.805  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 7235  H H    . LYS A 1 90 ? -7.392  1.504   -9.558  1.00 0.00 ? 90  LYS A H    5  
ATOM 7236  H HA   . LYS A 1 90 ? -6.904  -1.277  -9.952  1.00 0.00 ? 90  LYS A HA   5  
ATOM 7237  H HB2  . LYS A 1 90 ? -8.782  0.626   -11.370 1.00 0.00 ? 90  LYS A HB2  5  
ATOM 7238  H HB3  . LYS A 1 90 ? -8.756  -1.111  -11.634 1.00 0.00 ? 90  LYS A HB3  5  
ATOM 7239  H HG2  . LYS A 1 90 ? -9.329  0.231   -9.001  1.00 0.00 ? 90  LYS A HG2  5  
ATOM 7240  H HG3  . LYS A 1 90 ? -10.544 -0.406  -10.110 1.00 0.00 ? 90  LYS A HG3  5  
ATOM 7241  H HD2  . LYS A 1 90 ? -9.600  -2.649  -9.857  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 7242  H HD3  . LYS A 1 90 ? -8.372  -2.012  -8.761  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 7243  H HE2  . LYS A 1 90 ? -11.345 -1.856  -8.278  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 7244  H HE3  . LYS A 1 90 ? -10.290 -3.098  -7.607  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 7245  H HZ1  . LYS A 1 90 ? -9.035  -1.352  -6.479  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 7246  H HZ2  . LYS A 1 90 ? -10.661 -1.333  -6.014  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 7247  H HZ3  . LYS A 1 90 ? -10.080 -0.176  -7.103  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 7248  N N    . GLN A 1 91 ? -5.099  -1.094  -11.684 1.00 0.00 ? 91  GLN A N    5  
ATOM 7249  C CA   . GLN A 1 91 ? -4.156  -1.181  -12.796 1.00 0.00 ? 91  GLN A CA   5  
ATOM 7250  C C    . GLN A 1 91 ? -3.325  -2.461  -12.708 1.00 0.00 ? 91  GLN A C    5  
ATOM 7251  O O    . GLN A 1 91 ? -3.419  -3.209  -11.732 1.00 0.00 ? 91  GLN A O    5  
ATOM 7252  C CB   . GLN A 1 91 ? -3.231  0.042   -12.812 1.00 0.00 ? 91  GLN A CB   5  
ATOM 7253  C CG   . GLN A 1 91 ? -2.674  0.408   -11.443 1.00 0.00 ? 91  GLN A CG   5  
ATOM 7254  C CD   . GLN A 1 91 ? -1.162  0.304   -11.380 1.00 0.00 ? 91  GLN A CD   5  
ATOM 7255  O OE1  . GLN A 1 91 ? -0.448  1.099   -11.991 1.00 0.00 ? 91  GLN A OE1  5  
ATOM 7256  N NE2  . GLN A 1 91 ? -0.664  -0.678  -10.638 1.00 0.00 ? 91  GLN A NE2  5  
ATOM 7257  H H    . GLN A 1 91 ? -4.902  -1.582  -10.858 1.00 0.00 ? 91  GLN A H    5  
ATOM 7258  H HA   . GLN A 1 91 ? -4.727  -1.200  -13.713 1.00 0.00 ? 91  GLN A HA   5  
ATOM 7259  H HB2  . GLN A 1 91 ? -2.400  -0.159  -13.471 1.00 0.00 ? 91  GLN A HB2  5  
ATOM 7260  H HB3  . GLN A 1 91 ? -3.781  0.892   -13.190 1.00 0.00 ? 91  GLN A HB3  5  
ATOM 7261  H HG2  . GLN A 1 91 ? -2.959  1.423   -11.212 1.00 0.00 ? 91  GLN A HG2  5  
ATOM 7262  H HG3  . GLN A 1 91 ? -3.097  -0.259  -10.706 1.00 0.00 ? 91  GLN A HG3  5  
ATOM 7263  H HE21 . GLN A 1 91 ? -1.289  -1.276  -10.179 1.00 0.00 ? 91  GLN A HE21 5  
ATOM 7264  H HE22 . GLN A 1 91 ? 0.310   -0.764  -10.579 1.00 0.00 ? 91  GLN A HE22 5  
ATOM 7265  N N    . GLY A 1 92 ? -2.512  -2.703  -13.735 1.00 0.00 ? 92  GLY A N    5  
ATOM 7266  C CA   . GLY A 1 92 ? -1.675  -3.891  -13.763 1.00 0.00 ? 92  GLY A CA   5  
ATOM 7267  C C    . GLY A 1 92 ? -2.298  -5.056  -14.500 1.00 0.00 ? 92  GLY A C    5  
ATOM 7268  O O    . GLY A 1 92 ? -1.706  -6.131  -14.603 1.00 0.00 ? 92  GLY A O    5  
ATOM 7269  H H    . GLY A 1 92 ? -2.479  -2.069  -14.483 1.00 0.00 ? 92  GLY A H    5  
ATOM 7270  H HA2  . GLY A 1 92 ? -0.755  -3.642  -14.245 1.00 0.00 ? 92  GLY A HA2  5  
ATOM 7271  H HA3  . GLY A 1 92 ? -1.481  -4.191  -12.757 1.00 0.00 ? 92  GLY A HA3  5  
ATOM 7272  N N    . ALA A 1 93 ? -3.487  -4.825  -15.007 1.00 0.00 ? 93  ALA A N    5  
ATOM 7273  C CA   . ALA A 1 93 ? -4.239  -5.830  -15.754 1.00 0.00 ? 93  ALA A CA   5  
ATOM 7274  C C    . ALA A 1 93 ? -4.653  -5.307  -17.131 1.00 0.00 ? 93  ALA A C    5  
ATOM 7275  O O    . ALA A 1 93 ? -4.828  -4.077  -17.274 1.00 0.00 ? 93  ALA A O    5  
ATOM 7276  C CB   . ALA A 1 93 ? -5.466  -6.261  -14.964 1.00 0.00 ? 93  ALA A CB   5  
ATOM 7277  O OXT  . ALA A 1 93 ? -4.801  -6.134  -18.057 1.00 0.00 ? 93  ALA A OXT  5  
ATOM 7278  H H    . ALA A 1 93 ? -3.868  -3.943  -14.875 1.00 0.00 ? 93  ALA A H    5  
ATOM 7279  H HA   . ALA A 1 93 ? -3.604  -6.694  -15.886 1.00 0.00 ? 93  ALA A HA   5  
ATOM 7280  H HB1  . ALA A 1 93 ? -6.061  -5.393  -14.723 1.00 0.00 ? 93  ALA A HB1  5  
ATOM 7281  H HB2  . ALA A 1 93 ? -5.154  -6.747  -14.052 1.00 0.00 ? 93  ALA A HB2  5  
ATOM 7282  H HB3  . ALA A 1 93 ? -6.053  -6.948  -15.556 1.00 0.00 ? 93  ALA A HB3  5  
ATOM 7283  N N    . LEU B 2 1  ? 12.560  -2.675  1.338   1.00 0.00 ? 99  LEU B N    5  
ATOM 7284  C CA   . LEU B 2 1  ? 13.323  -2.105  0.187   1.00 0.00 ? 99  LEU B CA   5  
ATOM 7285  C C    . LEU B 2 1  ? 12.585  -2.330  -1.133  1.00 0.00 ? 99  LEU B C    5  
ATOM 7286  O O    . LEU B 2 1  ? 12.462  -1.413  -1.948  1.00 0.00 ? 99  LEU B O    5  
ATOM 7287  C CB   . LEU B 2 1  ? 14.717  -2.749  0.133   1.00 0.00 ? 99  LEU B CB   5  
ATOM 7288  C CG   . LEU B 2 1  ? 15.806  -2.023  0.932   1.00 0.00 ? 99  LEU B CG   5  
ATOM 7289  C CD1  . LEU B 2 1  ? 16.057  -0.635  0.359   1.00 0.00 ? 99  LEU B CD1  5  
ATOM 7290  C CD2  . LEU B 2 1  ? 15.423  -1.937  2.402   1.00 0.00 ? 99  LEU B CD2  5  
ATOM 7291  H H1   . LEU B 2 1  ? 12.872  -2.187  2.201   1.00 0.00 ? 99  LEU B H1   5  
ATOM 7292  H H2   . LEU B 2 1  ? 12.765  -3.694  1.388   1.00 0.00 ? 99  LEU B H2   5  
ATOM 7293  H H3   . LEU B 2 1  ? 11.548  -2.506  1.163   1.00 0.00 ? 99  LEU B H3   5  
ATOM 7294  H HA   . LEU B 2 1  ? 13.432  -1.041  0.347   1.00 0.00 ? 99  LEU B HA   5  
ATOM 7295  H HB2  . LEU B 2 1  ? 14.641  -3.760  0.505   1.00 0.00 ? 99  LEU B HB2  5  
ATOM 7296  H HB3  . LEU B 2 1  ? 15.031  -2.788  -0.900  1.00 0.00 ? 99  LEU B HB3  5  
ATOM 7297  H HG   . LEU B 2 1  ? 16.728  -2.582  0.859   1.00 0.00 ? 99  LEU B HG   5  
ATOM 7298  H HD11 . LEU B 2 1  ? 16.308  0.046   1.160   1.00 0.00 ? 99  LEU B HD11 5  
ATOM 7299  H HD12 . LEU B 2 1  ? 15.169  -0.285  -0.145  1.00 0.00 ? 99  LEU B HD12 5  
ATOM 7300  H HD13 . LEU B 2 1  ? 16.876  -0.679  -0.344  1.00 0.00 ? 99  LEU B HD13 5  
ATOM 7301  H HD21 . LEU B 2 1  ? 14.950  -2.859  2.705   1.00 0.00 ? 99  LEU B HD21 5  
ATOM 7302  H HD22 . LEU B 2 1  ? 14.737  -1.115  2.548   1.00 0.00 ? 99  LEU B HD22 5  
ATOM 7303  H HD23 . LEU B 2 1  ? 16.310  -1.775  2.997   1.00 0.00 ? 99  LEU B HD23 5  
ATOM 7304  N N    . PHE B 2 2  ? 12.095  -3.554  -1.336  1.00 0.00 ? 100 PHE B N    5  
ATOM 7305  C CA   . PHE B 2 2  ? 11.363  -3.901  -2.557  1.00 0.00 ? 100 PHE B CA   5  
ATOM 7306  C C    . PHE B 2 2  ? 10.706  -5.286  -2.451  1.00 0.00 ? 100 PHE B C    5  
ATOM 7307  O O    . PHE B 2 2  ? 10.564  -5.990  -3.453  1.00 0.00 ? 100 PHE B O    5  
ATOM 7308  C CB   . PHE B 2 2  ? 12.302  -3.850  -3.770  1.00 0.00 ? 100 PHE B CB   5  
ATOM 7309  C CG   . PHE B 2 2  ? 13.346  -4.937  -3.782  1.00 0.00 ? 100 PHE B CG   5  
ATOM 7310  C CD1  . PHE B 2 2  ? 14.297  -5.025  -2.775  1.00 0.00 ? 100 PHE B CD1  5  
ATOM 7311  C CD2  . PHE B 2 2  ? 13.373  -5.870  -4.805  1.00 0.00 ? 100 PHE B CD2  5  
ATOM 7312  C CE1  . PHE B 2 2  ? 15.251  -6.026  -2.790  1.00 0.00 ? 100 PHE B CE1  5  
ATOM 7313  C CE2  . PHE B 2 2  ? 14.324  -6.871  -4.825  1.00 0.00 ? 100 PHE B CE2  5  
ATOM 7314  C CZ   . PHE B 2 2  ? 15.264  -6.949  -3.816  1.00 0.00 ? 100 PHE B CZ   5  
ATOM 7315  H H    . PHE B 2 2  ? 12.229  -4.240  -0.650  1.00 0.00 ? 100 PHE B H    5  
ATOM 7316  H HA   . PHE B 2 2  ? 10.586  -3.163  -2.690  1.00 0.00 ? 100 PHE B HA   5  
ATOM 7317  H HB2  . PHE B 2 2  ? 11.715  -3.946  -4.670  1.00 0.00 ? 100 PHE B HB2  5  
ATOM 7318  H HB3  . PHE B 2 2  ? 12.812  -2.897  -3.781  1.00 0.00 ? 100 PHE B HB3  5  
ATOM 7319  H HD1  . PHE B 2 2  ? 14.288  -4.304  -1.972  1.00 0.00 ? 100 PHE B HD1  5  
ATOM 7320  H HD2  . PHE B 2 2  ? 12.639  -5.811  -5.594  1.00 0.00 ? 100 PHE B HD2  5  
ATOM 7321  H HE1  . PHE B 2 2  ? 15.985  -6.084  -2.000  1.00 0.00 ? 100 PHE B HE1  5  
ATOM 7322  H HE2  . PHE B 2 2  ? 14.332  -7.592  -5.629  1.00 0.00 ? 100 PHE B HE2  5  
ATOM 7323  H HZ   . PHE B 2 2  ? 16.008  -7.732  -3.830  1.00 0.00 ? 100 PHE B HZ   5  
ATOM 7324  N N    . SER B 2 3  ? 10.307  -5.668  -1.232  1.00 0.00 ? 101 SER B N    5  
ATOM 7325  C CA   . SER B 2 3  ? 9.667   -6.967  -0.986  1.00 0.00 ? 101 SER B CA   5  
ATOM 7326  C C    . SER B 2 3  ? 9.567   -7.249  0.518   1.00 0.00 ? 101 SER B C    5  
ATOM 7327  O O    . SER B 2 3  ? 9.840   -8.364  0.969   1.00 0.00 ? 101 SER B O    5  
ATOM 7328  C CB   . SER B 2 3  ? 10.448  -8.096  -1.676  1.00 0.00 ? 101 SER B CB   5  
ATOM 7329  O OG   . SER B 2 3  ? 11.846  -7.922  -1.514  1.00 0.00 ? 101 SER B OG   5  
ATOM 7330  H H    . SER B 2 3  ? 10.446  -5.061  -0.478  1.00 0.00 ? 101 SER B H    5  
ATOM 7331  H HA   . SER B 2 3  ? 8.668   -6.928  -1.399  1.00 0.00 ? 101 SER B HA   5  
ATOM 7332  H HB2  . SER B 2 3  ? 10.164  -9.044  -1.245  1.00 0.00 ? 101 SER B HB2  5  
ATOM 7333  H HB3  . SER B 2 3  ? 10.218  -8.099  -2.732  1.00 0.00 ? 101 SER B HB3  5  
ATOM 7334  H HG   . SER B 2 3  ? 12.274  -8.781  -1.472  1.00 0.00 ? 101 SER B HG   5  
ATOM 7335  N N    . THR B 2 4  ? 9.176   -6.234  1.291   1.00 0.00 ? 102 THR B N    5  
ATOM 7336  C CA   . THR B 2 4  ? 9.045   -6.380  2.739   1.00 0.00 ? 102 THR B CA   5  
ATOM 7337  C C    . THR B 2 4  ? 7.680   -6.958  3.104   1.00 0.00 ? 102 THR B C    5  
ATOM 7338  O O    . THR B 2 4  ? 6.895   -7.322  2.225   1.00 0.00 ? 102 THR B O    5  
ATOM 7339  C CB   . THR B 2 4  ? 9.256   -5.027  3.433   1.00 0.00 ? 102 THR B CB   5  
ATOM 7340  O OG1  . THR B 2 4  ? 9.680   -5.211  4.774   1.00 0.00 ? 102 THR B OG1  5  
ATOM 7341  C CG2  . THR B 2 4  ? 8.016   -4.157  3.459   1.00 0.00 ? 102 THR B CG2  5  
ATOM 7342  H H    . THR B 2 4  ? 8.969   -5.370  0.879   1.00 0.00 ? 102 THR B H    5  
ATOM 7343  H HA   . THR B 2 4  ? 9.809   -7.066  3.071   1.00 0.00 ? 102 THR B HA   5  
ATOM 7344  H HB   . THR B 2 4  ? 10.028  -4.484  2.906   1.00 0.00 ? 102 THR B HB   5  
ATOM 7345  H HG1  . THR B 2 4  ? 9.882   -4.358  5.168   1.00 0.00 ? 102 THR B HG1  5  
ATOM 7346  H HG21 . THR B 2 4  ? 7.243   -4.611  2.856   1.00 0.00 ? 102 THR B HG21 5  
ATOM 7347  H HG22 . THR B 2 4  ? 8.254   -3.184  3.063   1.00 0.00 ? 102 THR B HG22 5  
ATOM 7348  H HG23 . THR B 2 4  ? 7.667   -4.058  4.477   1.00 0.00 ? 102 THR B HG23 5  
ATOM 7349  N N    . GLU B 2 5  ? 7.404   -7.035  4.404   1.00 0.00 ? 103 GLU B N    5  
ATOM 7350  C CA   . GLU B 2 5  ? 6.136   -7.564  4.888   1.00 0.00 ? 103 GLU B CA   5  
ATOM 7351  C C    . GLU B 2 5  ? 5.510   -6.614  5.908   1.00 0.00 ? 103 GLU B C    5  
ATOM 7352  O O    . GLU B 2 5  ? 5.616   -6.824  7.119   1.00 0.00 ? 103 GLU B O    5  
ATOM 7353  C CB   . GLU B 2 5  ? 6.332   -8.955  5.504   1.00 0.00 ? 103 GLU B CB   5  
ATOM 7354  C CG   . GLU B 2 5  ? 7.327   -9.830  4.752   1.00 0.00 ? 103 GLU B CG   5  
ATOM 7355  C CD   . GLU B 2 5  ? 8.715   -9.799  5.365   1.00 0.00 ? 103 GLU B CD   5  
ATOM 7356  O OE1  . GLU B 2 5  ? 8.942   -10.523 6.357   1.00 0.00 ? 103 GLU B OE1  5  
ATOM 7357  O OE2  . GLU B 2 5  ? 9.574   -9.050  4.853   1.00 0.00 ? 103 GLU B OE2  5  
ATOM 7358  H H    . GLU B 2 5  ? 8.071   -6.726  5.053   1.00 0.00 ? 103 GLU B H    5  
ATOM 7359  H HA   . GLU B 2 5  ? 5.472   -7.646  4.041   1.00 0.00 ? 103 GLU B HA   5  
ATOM 7360  H HB2  . GLU B 2 5  ? 6.683   -8.841  6.518   1.00 0.00 ? 103 GLU B HB2  5  
ATOM 7361  H HB3  . GLU B 2 5  ? 5.380   -9.463  5.517   1.00 0.00 ? 103 GLU B HB3  5  
ATOM 7362  H HG2  . GLU B 2 5  ? 6.970   -10.849 4.762   1.00 0.00 ? 103 GLU B HG2  5  
ATOM 7363  H HG3  . GLU B 2 5  ? 7.393   -9.484  3.730   1.00 0.00 ? 103 GLU B HG3  5  
ATOM 7364  N N    . VAL B 2 6  ? 4.865   -5.563  5.405   1.00 0.00 ? 104 VAL B N    5  
ATOM 7365  C CA   . VAL B 2 6  ? 4.222   -4.566  6.259   1.00 0.00 ? 104 VAL B CA   5  
ATOM 7366  C C    . VAL B 2 6  ? 2.945   -5.119  6.909   1.00 0.00 ? 104 VAL B C    5  
ATOM 7367  O O    . VAL B 2 6  ? 2.670   -4.753  8.071   1.00 0.00 ? 104 VAL B O    5  
ATOM 7368  C CB   . VAL B 2 6  ? 3.898   -3.276  5.465   1.00 0.00 ? 104 VAL B CB   5  
ATOM 7369  C CG1  . VAL B 2 6  ? 2.885   -3.553  4.362   1.00 0.00 ? 104 VAL B CG1  5  
ATOM 7370  C CG2  . VAL B 2 6  ? 3.405   -2.178  6.396   1.00 0.00 ? 104 VAL B CG2  5  
ATOM 7371  O OXT  . VAL B 2 6  ? 2.240   -5.923  6.259   1.00 0.00 ? 104 VAL B OXT  5  
ATOM 7372  H H    . VAL B 2 6  ? 4.822   -5.452  4.433   1.00 0.00 ? 104 VAL B H    5  
ATOM 7373  H HA   . VAL B 2 6  ? 4.921   -4.309  7.042   1.00 0.00 ? 104 VAL B HA   5  
ATOM 7374  H HB   . VAL B 2 6  ? 4.811   -2.932  4.998   1.00 0.00 ? 104 VAL B HB   5  
ATOM 7375  H HG11 . VAL B 2 6  ? 2.497   -4.553  4.473   1.00 0.00 ? 104 VAL B HG11 5  
ATOM 7376  H HG12 . VAL B 2 6  ? 3.365   -3.460  3.400   1.00 0.00 ? 104 VAL B HG12 5  
ATOM 7377  H HG13 . VAL B 2 6  ? 2.074   -2.842  4.430   1.00 0.00 ? 104 VAL B HG13 5  
ATOM 7378  H HG21 . VAL B 2 6  ? 2.613   -1.625  5.915   1.00 0.00 ? 104 VAL B HG21 5  
ATOM 7379  H HG22 . VAL B 2 6  ? 4.221   -1.509  6.628   1.00 0.00 ? 104 VAL B HG22 5  
ATOM 7380  H HG23 . VAL B 2 6  ? 3.033   -2.618  7.308   1.00 0.00 ? 104 VAL B HG23 5  
ATOM 7381  N N    . MET A 1 1  ? -7.256  12.526  -20.782 1.00 0.00 ? 1   MET A N    6  
ATOM 7382  C CA   . MET A 1 1  ? -5.992  11.811  -20.447 1.00 0.00 ? 1   MET A CA   6  
ATOM 7383  C C    . MET A 1 1  ? -6.275  10.538  -19.648 1.00 0.00 ? 1   MET A C    6  
ATOM 7384  O O    . MET A 1 1  ? -7.381  10.348  -19.139 1.00 0.00 ? 1   MET A O    6  
ATOM 7385  C CB   . MET A 1 1  ? -5.088  12.755  -19.644 1.00 0.00 ? 1   MET A CB   6  
ATOM 7386  C CG   . MET A 1 1  ? -3.606  12.600  -19.955 1.00 0.00 ? 1   MET A CG   6  
ATOM 7387  S SD   . MET A 1 1  ? -2.552  13.219  -18.630 1.00 0.00 ? 1   MET A SD   6  
ATOM 7388  C CE   . MET A 1 1  ? -2.247  14.894  -19.188 1.00 0.00 ? 1   MET A CE   6  
ATOM 7389  H H1   . MET A 1 1  ? -7.931  11.824  -21.146 1.00 0.00 ? 1   MET A H1   6  
ATOM 7390  H H2   . MET A 1 1  ? -7.033  13.242  -21.504 1.00 0.00 ? 1   MET A H2   6  
ATOM 7391  H H3   . MET A 1 1  ? -7.612  12.969  -19.911 1.00 0.00 ? 1   MET A H3   6  
ATOM 7392  H HA   . MET A 1 1  ? -5.498  11.543  -21.369 1.00 0.00 ? 1   MET A HA   6  
ATOM 7393  H HB2  . MET A 1 1  ? -5.371  13.775  -19.858 1.00 0.00 ? 1   MET A HB2  6  
ATOM 7394  H HB3  . MET A 1 1  ? -5.234  12.565  -18.590 1.00 0.00 ? 1   MET A HB3  6  
ATOM 7395  H HG2  . MET A 1 1  ? -3.390  11.553  -20.106 1.00 0.00 ? 1   MET A HG2  6  
ATOM 7396  H HG3  . MET A 1 1  ? -3.382  13.147  -20.860 1.00 0.00 ? 1   MET A HG3  6  
ATOM 7397  H HE1  . MET A 1 1  ? -2.645  15.592  -18.467 1.00 0.00 ? 1   MET A HE1  6  
ATOM 7398  H HE2  . MET A 1 1  ? -2.727  15.049  -20.143 1.00 0.00 ? 1   MET A HE2  6  
ATOM 7399  H HE3  . MET A 1 1  ? -1.183  15.051  -19.291 1.00 0.00 ? 1   MET A HE3  6  
ATOM 7400  N N    . LYS A 1 2  ? -5.270  9.667   -19.546 1.00 0.00 ? 2   LYS A N    6  
ATOM 7401  C CA   . LYS A 1 2  ? -5.411  8.409   -18.811 1.00 0.00 ? 2   LYS A CA   6  
ATOM 7402  C C    . LYS A 1 2  ? -5.653  8.665   -17.325 1.00 0.00 ? 2   LYS A C    6  
ATOM 7403  O O    . LYS A 1 2  ? -4.891  9.386   -16.680 1.00 0.00 ? 2   LYS A O    6  
ATOM 7404  C CB   . LYS A 1 2  ? -4.163  7.540   -18.992 1.00 0.00 ? 2   LYS A CB   6  
ATOM 7405  C CG   . LYS A 1 2  ? -4.431  6.239   -19.732 1.00 0.00 ? 2   LYS A CG   6  
ATOM 7406  C CD   . LYS A 1 2  ? -4.211  6.391   -21.230 1.00 0.00 ? 2   LYS A CD   6  
ATOM 7407  C CE   . LYS A 1 2  ? -5.492  6.142   -22.013 1.00 0.00 ? 2   LYS A CE   6  
ATOM 7408  N NZ   . LYS A 1 2  ? -6.588  7.065   -21.601 1.00 0.00 ? 2   LYS A NZ   6  
ATOM 7409  H H    . LYS A 1 2  ? -4.415  9.873   -19.977 1.00 0.00 ? 2   LYS A H    6  
ATOM 7410  H HA   . LYS A 1 2  ? -6.264  7.886   -19.216 1.00 0.00 ? 2   LYS A HA   6  
ATOM 7411  H HB2  . LYS A 1 2  ? -3.424  8.100   -19.545 1.00 0.00 ? 2   LYS A HB2  6  
ATOM 7412  H HB3  . LYS A 1 2  ? -3.763  7.299   -18.018 1.00 0.00 ? 2   LYS A HB3  6  
ATOM 7413  H HG2  . LYS A 1 2  ? -3.763  5.479   -19.356 1.00 0.00 ? 2   LYS A HG2  6  
ATOM 7414  H HG3  . LYS A 1 2  ? -5.454  5.941   -19.554 1.00 0.00 ? 2   LYS A HG3  6  
ATOM 7415  H HD2  . LYS A 1 2  ? -3.866  7.394   -21.435 1.00 0.00 ? 2   LYS A HD2  6  
ATOM 7416  H HD3  . LYS A 1 2  ? -3.462  5.680   -21.547 1.00 0.00 ? 2   LYS A HD3  6  
ATOM 7417  H HE2  . LYS A 1 2  ? -5.290  6.285   -23.065 1.00 0.00 ? 2   LYS A HE2  6  
ATOM 7418  H HE3  . LYS A 1 2  ? -5.810  5.123   -21.845 1.00 0.00 ? 2   LYS A HE3  6  
ATOM 7419  H HZ1  . LYS A 1 2  ? -6.208  8.019   -21.431 1.00 0.00 ? 2   LYS A HZ1  6  
ATOM 7420  H HZ2  . LYS A 1 2  ? -7.036  6.722   -20.728 1.00 0.00 ? 2   LYS A HZ2  6  
ATOM 7421  H HZ3  . LYS A 1 2  ? -7.310  7.120   -22.348 1.00 0.00 ? 2   LYS A HZ3  6  
ATOM 7422  N N    . GLU A 1 3  ? -6.718  8.068   -16.790 1.00 0.00 ? 3   GLU A N    6  
ATOM 7423  C CA   . GLU A 1 3  ? -7.059  8.231   -15.380 1.00 0.00 ? 3   GLU A CA   6  
ATOM 7424  C C    . GLU A 1 3  ? -7.399  6.888   -14.735 1.00 0.00 ? 3   GLU A C    6  
ATOM 7425  O O    . GLU A 1 3  ? -8.426  6.282   -15.050 1.00 0.00 ? 3   GLU A O    6  
ATOM 7426  C CB   . GLU A 1 3  ? -8.236  9.197   -15.226 1.00 0.00 ? 3   GLU A CB   6  
ATOM 7427  C CG   . GLU A 1 3  ? -7.817  10.656  -15.166 1.00 0.00 ? 3   GLU A CG   6  
ATOM 7428  C CD   . GLU A 1 3  ? -7.002  10.977  -13.929 1.00 0.00 ? 3   GLU A CD   6  
ATOM 7429  O OE1  . GLU A 1 3  ? -7.607  11.333  -12.896 1.00 0.00 ? 3   GLU A OE1  6  
ATOM 7430  O OE2  . GLU A 1 3  ? -5.759  10.868  -13.991 1.00 0.00 ? 3   GLU A OE2  6  
ATOM 7431  H H    . GLU A 1 3  ? -7.286  7.504   -17.355 1.00 0.00 ? 3   GLU A H    6  
ATOM 7432  H HA   . GLU A 1 3  ? -6.199  8.647   -14.880 1.00 0.00 ? 3   GLU A HA   6  
ATOM 7433  H HB2  . GLU A 1 3  ? -8.905  9.070   -16.064 1.00 0.00 ? 3   GLU A HB2  6  
ATOM 7434  H HB3  . GLU A 1 3  ? -8.765  8.959   -14.315 1.00 0.00 ? 3   GLU A HB3  6  
ATOM 7435  H HG2  . GLU A 1 3  ? -7.222  10.883  -16.039 1.00 0.00 ? 3   GLU A HG2  6  
ATOM 7436  H HG3  . GLU A 1 3  ? -8.704  11.273  -15.166 1.00 0.00 ? 3   GLU A HG3  6  
ATOM 7437  N N    . PRO A 1 4  ? -6.536  6.406   -13.817 1.00 0.00 ? 4   PRO A N    6  
ATOM 7438  C CA   . PRO A 1 4  ? -6.747  5.129   -13.122 1.00 0.00 ? 4   PRO A CA   6  
ATOM 7439  C C    . PRO A 1 4  ? -7.899  5.190   -12.116 1.00 0.00 ? 4   PRO A C    6  
ATOM 7440  O O    . PRO A 1 4  ? -8.643  6.172   -12.069 1.00 0.00 ? 4   PRO A O    6  
ATOM 7441  C CB   . PRO A 1 4  ? -5.415  4.894   -12.404 1.00 0.00 ? 4   PRO A CB   6  
ATOM 7442  C CG   . PRO A 1 4  ? -4.847  6.256   -12.202 1.00 0.00 ? 4   PRO A CG   6  
ATOM 7443  C CD   . PRO A 1 4  ? -5.287  7.070   -13.387 1.00 0.00 ? 4   PRO A CD   6  
ATOM 7444  H HA   . PRO A 1 4  ? -6.927  4.326   -13.822 1.00 0.00 ? 4   PRO A HA   6  
ATOM 7445  H HB2  . PRO A 1 4  ? -5.593  4.397   -11.461 1.00 0.00 ? 4   PRO A HB2  6  
ATOM 7446  H HB3  . PRO A 1 4  ? -4.771  4.287   -13.022 1.00 0.00 ? 4   PRO A HB3  6  
ATOM 7447  H HG2  . PRO A 1 4  ? -5.235  6.684   -11.290 1.00 0.00 ? 4   PRO A HG2  6  
ATOM 7448  H HG3  . PRO A 1 4  ? -3.769  6.202   -12.164 1.00 0.00 ? 4   PRO A HG3  6  
ATOM 7449  H HD2  . PRO A 1 4  ? -5.476  8.092   -13.092 1.00 0.00 ? 4   PRO A HD2  6  
ATOM 7450  H HD3  . PRO A 1 4  ? -4.543  7.032   -14.169 1.00 0.00 ? 4   PRO A HD3  6  
ATOM 7451  N N    . GLU A 1 5  ? -8.037  4.136   -11.310 1.00 0.00 ? 5   GLU A N    6  
ATOM 7452  C CA   . GLU A 1 5  ? -9.094  4.071   -10.307 1.00 0.00 ? 5   GLU A CA   6  
ATOM 7453  C C    . GLU A 1 5  ? -8.503  3.895   -8.913  1.00 0.00 ? 5   GLU A C    6  
ATOM 7454  O O    . GLU A 1 5  ? -8.152  2.785   -8.507  1.00 0.00 ? 5   GLU A O    6  
ATOM 7455  C CB   . GLU A 1 5  ? -10.061 2.928   -10.621 1.00 0.00 ? 5   GLU A CB   6  
ATOM 7456  C CG   . GLU A 1 5  ? -11.340 2.970   -9.798  1.00 0.00 ? 5   GLU A CG   6  
ATOM 7457  C CD   . GLU A 1 5  ? -12.287 1.832   -10.124 1.00 0.00 ? 5   GLU A CD   6  
ATOM 7458  O OE1  . GLU A 1 5  ? -11.943 0.667   -9.829  1.00 0.00 ? 5   GLU A OE1  6  
ATOM 7459  O OE2  . GLU A 1 5  ? -13.376 2.104   -10.672 1.00 0.00 ? 5   GLU A OE2  6  
ATOM 7460  H H    . GLU A 1 5  ? -7.413  3.387   -11.389 1.00 0.00 ? 5   GLU A H    6  
ATOM 7461  H HA   . GLU A 1 5  ? -9.634  5.005   -10.337 1.00 0.00 ? 5   GLU A HA   6  
ATOM 7462  H HB2  . GLU A 1 5  ? -10.329 2.980   -11.665 1.00 0.00 ? 5   GLU A HB2  6  
ATOM 7463  H HB3  . GLU A 1 5  ? -9.566  1.988   -10.431 1.00 0.00 ? 5   GLU A HB3  6  
ATOM 7464  H HG2  . GLU A 1 5  ? -11.080 2.912   -8.751  1.00 0.00 ? 5   GLU A HG2  6  
ATOM 7465  H HG3  . GLU A 1 5  ? -11.844 3.906   -9.990  1.00 0.00 ? 5   GLU A HG3  6  
ATOM 7466  N N    . ILE A 1 6  ? -8.392  5.004   -8.190  1.00 0.00 ? 6   ILE A N    6  
ATOM 7467  C CA   . ILE A 1 6  ? -7.841  4.993   -6.840  1.00 0.00 ? 6   ILE A CA   6  
ATOM 7468  C C    . ILE A 1 6  ? -8.950  4.918   -5.791  1.00 0.00 ? 6   ILE A C    6  
ATOM 7469  O O    . ILE A 1 6  ? -9.899  5.703   -5.821  1.00 0.00 ? 6   ILE A O    6  
ATOM 7470  C CB   . ILE A 1 6  ? -6.985  6.250   -6.579  1.00 0.00 ? 6   ILE A CB   6  
ATOM 7471  C CG1  . ILE A 1 6  ? -5.899  6.399   -7.651  1.00 0.00 ? 6   ILE A CG1  6  
ATOM 7472  C CG2  . ILE A 1 6  ? -6.368  6.198   -5.188  1.00 0.00 ? 6   ILE A CG2  6  
ATOM 7473  C CD1  . ILE A 1 6  ? -4.990  5.195   -7.776  1.00 0.00 ? 6   ILE A CD1  6  
ATOM 7474  H H    . ILE A 1 6  ? -8.688  5.854   -8.578  1.00 0.00 ? 6   ILE A H    6  
ATOM 7475  H HA   . ILE A 1 6  ? -7.206  4.124   -6.745  1.00 0.00 ? 6   ILE A HA   6  
ATOM 7476  H HB   . ILE A 1 6  ? -7.637  7.108   -6.624  1.00 0.00 ? 6   ILE A HB   6  
ATOM 7477  H HG12 . ILE A 1 6  ? -6.369  6.557   -8.610  1.00 0.00 ? 6   ILE A HG12 6  
ATOM 7478  H HG13 . ILE A 1 6  ? -5.285  7.255   -7.412  1.00 0.00 ? 6   ILE A HG13 6  
ATOM 7479  H HG21 . ILE A 1 6  ? -5.629  6.980   -5.092  1.00 0.00 ? 6   ILE A HG21 6  
ATOM 7480  H HG22 . ILE A 1 6  ? -5.898  5.238   -5.037  1.00 0.00 ? 6   ILE A HG22 6  
ATOM 7481  H HG23 . ILE A 1 6  ? -7.141  6.341   -4.446  1.00 0.00 ? 6   ILE A HG23 6  
ATOM 7482  H HD11 . ILE A 1 6  ? -5.560  4.348   -8.127  1.00 0.00 ? 6   ILE A HD11 6  
ATOM 7483  H HD12 . ILE A 1 6  ? -4.560  4.965   -6.812  1.00 0.00 ? 6   ILE A HD12 6  
ATOM 7484  H HD13 . ILE A 1 6  ? -4.199  5.413   -8.480  1.00 0.00 ? 6   ILE A HD13 6  
ATOM 7485  N N    . ILE A 1 7  ? -8.817  3.967   -4.865  1.00 0.00 ? 7   ILE A N    6  
ATOM 7486  C CA   . ILE A 1 7  ? -9.802  3.782   -3.799  1.00 0.00 ? 7   ILE A CA   6  
ATOM 7487  C C    . ILE A 1 7  ? -9.130  3.340   -2.498  1.00 0.00 ? 7   ILE A C    6  
ATOM 7488  O O    . ILE A 1 7  ? -8.195  2.539   -2.515  1.00 0.00 ? 7   ILE A O    6  
ATOM 7489  C CB   . ILE A 1 7  ? -10.870 2.733   -4.186  1.00 0.00 ? 7   ILE A CB   6  
ATOM 7490  C CG1  . ILE A 1 7  ? -10.210 1.390   -4.516  1.00 0.00 ? 7   ILE A CG1  6  
ATOM 7491  C CG2  . ILE A 1 7  ? -11.706 3.222   -5.363  1.00 0.00 ? 7   ILE A CG2  6  
ATOM 7492  C CD1  . ILE A 1 7  ? -10.705 0.244   -3.661  1.00 0.00 ? 7   ILE A CD1  6  
ATOM 7493  H H    . ILE A 1 7  ? -8.035  3.377   -4.898  1.00 0.00 ? 7   ILE A H    6  
ATOM 7494  H HA   . ILE A 1 7  ? -10.298 4.727   -3.634  1.00 0.00 ? 7   ILE A HA   6  
ATOM 7495  H HB   . ILE A 1 7  ? -11.532 2.601   -3.342  1.00 0.00 ? 7   ILE A HB   6  
ATOM 7496  H HG12 . ILE A 1 7  ? -10.406 1.142   -5.547  1.00 0.00 ? 7   ILE A HG12 6  
ATOM 7497  H HG13 . ILE A 1 7  ? -9.143  1.475   -4.370  1.00 0.00 ? 7   ILE A HG13 6  
ATOM 7498  H HG21 . ILE A 1 7  ? -11.133 3.129   -6.274  1.00 0.00 ? 7   ILE A HG21 6  
ATOM 7499  H HG22 . ILE A 1 7  ? -11.974 4.257   -5.210  1.00 0.00 ? 7   ILE A HG22 6  
ATOM 7500  H HG23 . ILE A 1 7  ? -12.603 2.626   -5.439  1.00 0.00 ? 7   ILE A HG23 6  
ATOM 7501  H HD11 . ILE A 1 7  ? -11.491 -0.282  -4.183  1.00 0.00 ? 7   ILE A HD11 6  
ATOM 7502  H HD12 . ILE A 1 7  ? -11.089 0.629   -2.727  1.00 0.00 ? 7   ILE A HD12 6  
ATOM 7503  H HD13 . ILE A 1 7  ? -9.888  -0.435  -3.462  1.00 0.00 ? 7   ILE A HD13 6  
ATOM 7504  N N    . THR A 1 8  ? -9.618  3.856   -1.370  1.00 0.00 ? 8   THR A N    6  
ATOM 7505  C CA   . THR A 1 8  ? -9.063  3.498   -0.065  1.00 0.00 ? 8   THR A CA   6  
ATOM 7506  C C    . THR A 1 8  ? -10.065 2.684   0.752   1.00 0.00 ? 8   THR A C    6  
ATOM 7507  O O    . THR A 1 8  ? -11.279 2.848   0.608   1.00 0.00 ? 8   THR A O    6  
ATOM 7508  C CB   . THR A 1 8  ? -8.642  4.754   0.707   1.00 0.00 ? 8   THR A CB   6  
ATOM 7509  O OG1  . THR A 1 8  ? -8.020  4.406   1.934   1.00 0.00 ? 8   THR A OG1  6  
ATOM 7510  C CG2  . THR A 1 8  ? -9.792  5.690   1.021   1.00 0.00 ? 8   THR A CG2  6  
ATOM 7511  H H    . THR A 1 8  ? -10.370 4.484   -1.414  1.00 0.00 ? 8   THR A H    6  
ATOM 7512  H HA   . THR A 1 8  ? -8.189  2.889   -0.239  1.00 0.00 ? 8   THR A HA   6  
ATOM 7513  H HB   . THR A 1 8  ? -7.927  5.303   0.112   1.00 0.00 ? 8   THR A HB   6  
ATOM 7514  H HG1  . THR A 1 8  ? -8.671  4.038   2.534   1.00 0.00 ? 8   THR A HG1  6  
ATOM 7515  H HG21 . THR A 1 8  ? -10.632 5.120   1.388   1.00 0.00 ? 8   THR A HG21 6  
ATOM 7516  H HG22 . THR A 1 8  ? -10.080 6.219   0.124   1.00 0.00 ? 8   THR A HG22 6  
ATOM 7517  H HG23 . THR A 1 8  ? -9.483  6.401   1.773   1.00 0.00 ? 8   THR A HG23 6  
ATOM 7518  N N    . VAL A 1 9  ? -9.546  1.803   1.606   1.00 0.00 ? 9   VAL A N    6  
ATOM 7519  C CA   . VAL A 1 9  ? -10.388 0.955   2.447   1.00 0.00 ? 9   VAL A CA   6  
ATOM 7520  C C    . VAL A 1 9  ? -10.216 1.298   3.925   1.00 0.00 ? 9   VAL A C    6  
ATOM 7521  O O    . VAL A 1 9  ? -9.122  1.173   4.476   1.00 0.00 ? 9   VAL A O    6  
ATOM 7522  C CB   . VAL A 1 9  ? -10.077 -0.543  2.235   1.00 0.00 ? 9   VAL A CB   6  
ATOM 7523  C CG1  . VAL A 1 9  ? -10.625 -1.017  0.898   1.00 0.00 ? 9   VAL A CG1  6  
ATOM 7524  C CG2  . VAL A 1 9  ? -8.577  -0.808  2.332   1.00 0.00 ? 9   VAL A CG2  6  
ATOM 7525  H H    . VAL A 1 9  ? -8.571  1.720   1.672   1.00 0.00 ? 9   VAL A H    6  
ATOM 7526  H HA   . VAL A 1 9  ? -11.418 1.128   2.168   1.00 0.00 ? 9   VAL A HA   6  
ATOM 7527  H HB   . VAL A 1 9  ? -10.569 -1.105  3.017   1.00 0.00 ? 9   VAL A HB   6  
ATOM 7528  H HG11 . VAL A 1 9  ? -9.952  -1.744  0.468   1.00 0.00 ? 9   VAL A HG11 6  
ATOM 7529  H HG12 . VAL A 1 9  ? -10.719 -0.174  0.229   1.00 0.00 ? 9   VAL A HG12 6  
ATOM 7530  H HG13 . VAL A 1 9  ? -11.594 -1.469  1.046   1.00 0.00 ? 9   VAL A HG13 6  
ATOM 7531  H HG21 . VAL A 1 9  ? -8.061  -0.241  1.571   1.00 0.00 ? 9   VAL A HG21 6  
ATOM 7532  H HG22 . VAL A 1 9  ? -8.386  -1.861  2.188   1.00 0.00 ? 9   VAL A HG22 6  
ATOM 7533  H HG23 . VAL A 1 9  ? -8.220  -0.509  3.307   1.00 0.00 ? 9   VAL A HG23 6  
ATOM 7534  N N    . THR A 1 10 ? -11.305 1.729   4.558   1.00 0.00 ? 10  THR A N    6  
ATOM 7535  C CA   . THR A 1 10 ? -11.280 2.087   5.973   1.00 0.00 ? 10  THR A CA   6  
ATOM 7536  C C    . THR A 1 10 ? -11.706 0.897   6.833   1.00 0.00 ? 10  THR A C    6  
ATOM 7537  O O    . THR A 1 10 ? -12.896 0.598   6.947   1.00 0.00 ? 10  THR A O    6  
ATOM 7538  C CB   . THR A 1 10 ? -12.198 3.285   6.236   1.00 0.00 ? 10  THR A CB   6  
ATOM 7539  O OG1  . THR A 1 10 ? -11.998 4.297   5.263   1.00 0.00 ? 10  THR A OG1  6  
ATOM 7540  C CG2  . THR A 1 10 ? -11.992 3.911   7.599   1.00 0.00 ? 10  THR A CG2  6  
ATOM 7541  H H    . THR A 1 10 ? -12.146 1.806   4.062   1.00 0.00 ? 10  THR A H    6  
ATOM 7542  H HA   . THR A 1 10 ? -10.267 2.358   6.228   1.00 0.00 ? 10  THR A HA   6  
ATOM 7543  H HB   . THR A 1 10 ? -13.226 2.957   6.176   1.00 0.00 ? 10  THR A HB   6  
ATOM 7544  H HG1  . THR A 1 10 ? -12.785 4.843   5.198   1.00 0.00 ? 10  THR A HG1  6  
ATOM 7545  H HG21 . THR A 1 10 ? -11.900 4.983   7.494   1.00 0.00 ? 10  THR A HG21 6  
ATOM 7546  H HG22 . THR A 1 10 ? -11.092 3.515   8.045   1.00 0.00 ? 10  THR A HG22 6  
ATOM 7547  H HG23 . THR A 1 10 ? -12.838 3.683   8.230   1.00 0.00 ? 10  THR A HG23 6  
ATOM 7548  N N    . LEU A 1 11 ? -10.724 0.215   7.424   1.00 0.00 ? 11  LEU A N    6  
ATOM 7549  C CA   . LEU A 1 11 ? -10.993 -0.953  8.264   1.00 0.00 ? 11  LEU A CA   6  
ATOM 7550  C C    . LEU A 1 11 ? -10.247 -0.858  9.596   1.00 0.00 ? 11  LEU A C    6  
ATOM 7551  O O    . LEU A 1 11 ? -9.307  -0.074  9.736   1.00 0.00 ? 11  LEU A O    6  
ATOM 7552  C CB   . LEU A 1 11 ? -10.589 -2.236  7.529   1.00 0.00 ? 11  LEU A CB   6  
ATOM 7553  C CG   . LEU A 1 11 ? -10.975 -2.285  6.047   1.00 0.00 ? 11  LEU A CG   6  
ATOM 7554  C CD1  . LEU A 1 11 ? -10.198 -3.375  5.323   1.00 0.00 ? 11  LEU A CD1  6  
ATOM 7555  C CD2  . LEU A 1 11 ? -12.474 -2.501  5.894   1.00 0.00 ? 11  LEU A CD2  6  
ATOM 7556  H H    . LEU A 1 11 ? -9.794  0.498   7.285   1.00 0.00 ? 11  LEU A H    6  
ATOM 7557  H HA   . LEU A 1 11 ? -12.054 -0.982  8.461   1.00 0.00 ? 11  LEU A HA   6  
ATOM 7558  H HB2  . LEU A 1 11 ? -9.516  -2.345  7.603   1.00 0.00 ? 11  LEU A HB2  6  
ATOM 7559  H HB3  . LEU A 1 11 ? -11.053 -3.074  8.027   1.00 0.00 ? 11  LEU A HB3  6  
ATOM 7560  H HG   . LEU A 1 11 ? -10.726 -1.340  5.587   1.00 0.00 ? 11  LEU A HG   6  
ATOM 7561  H HD11 . LEU A 1 11 ? -10.826 -3.824  4.567   1.00 0.00 ? 11  LEU A HD11 6  
ATOM 7562  H HD12 . LEU A 1 11 ? -9.892  -4.131  6.031   1.00 0.00 ? 11  LEU A HD12 6  
ATOM 7563  H HD13 . LEU A 1 11 ? -9.326  -2.944  4.855   1.00 0.00 ? 11  LEU A HD13 6  
ATOM 7564  H HD21 . LEU A 1 11 ? -12.734 -2.494  4.846   1.00 0.00 ? 11  LEU A HD21 6  
ATOM 7565  H HD22 . LEU A 1 11 ? -13.006 -1.710  6.401   1.00 0.00 ? 11  LEU A HD22 6  
ATOM 7566  H HD23 . LEU A 1 11 ? -12.747 -3.452  6.327   1.00 0.00 ? 11  LEU A HD23 6  
ATOM 7567  N N    . LYS A 1 12 ? -10.672 -1.663  10.571  1.00 0.00 ? 12  LYS A N    6  
ATOM 7568  C CA   . LYS A 1 12 ? -10.041 -1.672  11.890  1.00 0.00 ? 12  LYS A CA   6  
ATOM 7569  C C    . LYS A 1 12 ? -8.935  -2.725  11.959  1.00 0.00 ? 12  LYS A C    6  
ATOM 7570  O O    . LYS A 1 12 ? -9.143  -3.884  11.596  1.00 0.00 ? 12  LYS A O    6  
ATOM 7571  C CB   . LYS A 1 12 ? -11.085 -1.935  12.981  1.00 0.00 ? 12  LYS A CB   6  
ATOM 7572  C CG   . LYS A 1 12 ? -12.040 -0.771  13.206  1.00 0.00 ? 12  LYS A CG   6  
ATOM 7573  C CD   . LYS A 1 12 ? -12.094 -0.359  14.672  1.00 0.00 ? 12  LYS A CD   6  
ATOM 7574  C CE   . LYS A 1 12 ? -12.659 1.045   14.839  1.00 0.00 ? 12  LYS A CE   6  
ATOM 7575  N NZ   . LYS A 1 12 ? -13.520 1.165   16.052  1.00 0.00 ? 12  LYS A NZ   6  
ATOM 7576  H H    . LYS A 1 12 ? -11.424 -2.268  10.398  1.00 0.00 ? 12  LYS A H    6  
ATOM 7577  H HA   . LYS A 1 12 ? -9.603  -0.697  12.052  1.00 0.00 ? 12  LYS A HA   6  
ATOM 7578  H HB2  . LYS A 1 12 ? -11.668 -2.802  12.703  1.00 0.00 ? 12  LYS A HB2  6  
ATOM 7579  H HB3  . LYS A 1 12 ? -10.574 -2.140  13.910  1.00 0.00 ? 12  LYS A HB3  6  
ATOM 7580  H HG2  . LYS A 1 12 ? -11.710 0.073   12.619  1.00 0.00 ? 12  LYS A HG2  6  
ATOM 7581  H HG3  . LYS A 1 12 ? -13.030 -1.066  12.889  1.00 0.00 ? 12  LYS A HG3  6  
ATOM 7582  H HD2  . LYS A 1 12 ? -12.722 -1.055  15.207  1.00 0.00 ? 12  LYS A HD2  6  
ATOM 7583  H HD3  . LYS A 1 12 ? -11.094 -0.387  15.081  1.00 0.00 ? 12  LYS A HD3  6  
ATOM 7584  H HE2  . LYS A 1 12 ? -11.837 1.741   14.924  1.00 0.00 ? 12  LYS A HE2  6  
ATOM 7585  H HE3  . LYS A 1 12 ? -13.247 1.289   13.966  1.00 0.00 ? 12  LYS A HE3  6  
ATOM 7586  H HZ1  . LYS A 1 12 ? -13.937 0.242   16.289  1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 7587  H HZ2  . LYS A 1 12 ? -14.288 1.845   15.879  1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 7588  H HZ3  . LYS A 1 12 ? -12.955 1.497   16.860  1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 7589  N N    . LYS A 1 13 ? -7.758  -2.310  12.426  1.00 0.00 ? 13  LYS A N    6  
ATOM 7590  C CA   . LYS A 1 13 ? -6.610  -3.208  12.545  1.00 0.00 ? 13  LYS A CA   6  
ATOM 7591  C C    . LYS A 1 13 ? -6.673  -4.016  13.840  1.00 0.00 ? 13  LYS A C    6  
ATOM 7592  O O    . LYS A 1 13 ? -7.026  -3.486  14.895  1.00 0.00 ? 13  LYS A O    6  
ATOM 7593  C CB   . LYS A 1 13 ? -5.309  -2.403  12.500  1.00 0.00 ? 13  LYS A CB   6  
ATOM 7594  C CG   . LYS A 1 13 ? -4.063  -3.258  12.335  1.00 0.00 ? 13  LYS A CG   6  
ATOM 7595  C CD   . LYS A 1 13 ? -3.000  -2.545  11.512  1.00 0.00 ? 13  LYS A CD   6  
ATOM 7596  C CE   . LYS A 1 13 ? -2.414  -1.358  12.263  1.00 0.00 ? 13  LYS A CE   6  
ATOM 7597  N NZ   . LYS A 1 13 ? -1.125  -1.698  12.931  1.00 0.00 ? 13  LYS A NZ   6  
ATOM 7598  H H    . LYS A 1 13 ? -7.656  -1.372  12.698  1.00 0.00 ? 13  LYS A H    6  
ATOM 7599  H HA   . LYS A 1 13 ? -6.632  -3.888  11.706  1.00 0.00 ? 13  LYS A HA   6  
ATOM 7600  H HB2  . LYS A 1 13 ? -5.358  -1.711  11.673  1.00 0.00 ? 13  LYS A HB2  6  
ATOM 7601  H HB3  . LYS A 1 13 ? -5.216  -1.843  13.420  1.00 0.00 ? 13  LYS A HB3  6  
ATOM 7602  H HG2  . LYS A 1 13 ? -3.659  -3.478  13.312  1.00 0.00 ? 13  LYS A HG2  6  
ATOM 7603  H HG3  . LYS A 1 13 ? -4.332  -4.179  11.839  1.00 0.00 ? 13  LYS A HG3  6  
ATOM 7604  H HD2  . LYS A 1 13 ? -2.208  -3.242  11.285  1.00 0.00 ? 13  LYS A HD2  6  
ATOM 7605  H HD3  . LYS A 1 13 ? -3.446  -2.193  10.593  1.00 0.00 ? 13  LYS A HD3  6  
ATOM 7606  H HE2  . LYS A 1 13 ? -2.244  -0.555  11.563  1.00 0.00 ? 13  LYS A HE2  6  
ATOM 7607  H HE3  . LYS A 1 13 ? -3.123  -1.037  13.012  1.00 0.00 ? 13  LYS A HE3  6  
ATOM 7608  H HZ1  . LYS A 1 13 ? -0.343  -1.644  12.247  1.00 0.00 ? 13  LYS A HZ1  6  
ATOM 7609  H HZ2  . LYS A 1 13 ? -1.165  -2.660  13.322  1.00 0.00 ? 13  LYS A HZ2  6  
ATOM 7610  H HZ3  . LYS A 1 13 ? -0.939  -1.029  13.707  1.00 0.00 ? 13  LYS A HZ3  6  
ATOM 7611  N N    . GLN A 1 14 ? -6.317  -5.299  13.754  1.00 0.00 ? 14  GLN A N    6  
ATOM 7612  C CA   . GLN A 1 14 ? -6.323  -6.179  14.924  1.00 0.00 ? 14  GLN A CA   6  
ATOM 7613  C C    . GLN A 1 14 ? -4.943  -6.207  15.580  1.00 0.00 ? 14  GLN A C    6  
ATOM 7614  O O    . GLN A 1 14 ? -4.799  -5.878  16.758  1.00 0.00 ? 14  GLN A O    6  
ATOM 7615  C CB   . GLN A 1 14 ? -6.755  -7.604  14.542  1.00 0.00 ? 14  GLN A CB   6  
ATOM 7616  C CG   . GLN A 1 14 ? -7.835  -7.661  13.469  1.00 0.00 ? 14  GLN A CG   6  
ATOM 7617  C CD   . GLN A 1 14 ? -9.123  -6.971  13.889  1.00 0.00 ? 14  GLN A CD   6  
ATOM 7618  O OE1  . GLN A 1 14 ? -9.391  -6.796  15.078  1.00 0.00 ? 14  GLN A OE1  6  
ATOM 7619  N NE2  . GLN A 1 14 ? -9.931  -6.575  12.910  1.00 0.00 ? 14  GLN A NE2  6  
ATOM 7620  H H    . GLN A 1 14 ? -6.036  -5.660  12.886  1.00 0.00 ? 14  GLN A H    6  
ATOM 7621  H HA   . GLN A 1 14 ? -7.033  -5.778  15.633  1.00 0.00 ? 14  GLN A HA   6  
ATOM 7622  H HB2  . GLN A 1 14 ? -5.893  -8.145  14.181  1.00 0.00 ? 14  GLN A HB2  6  
ATOM 7623  H HB3  . GLN A 1 14 ? -7.132  -8.098  15.425  1.00 0.00 ? 14  GLN A HB3  6  
ATOM 7624  H HG2  . GLN A 1 14 ? -7.463  -7.179  12.578  1.00 0.00 ? 14  GLN A HG2  6  
ATOM 7625  H HG3  . GLN A 1 14 ? -8.053  -8.696  13.252  1.00 0.00 ? 14  GLN A HG3  6  
ATOM 7626  H HE21 . GLN A 1 14 ? -9.658  -6.745  11.984  1.00 0.00 ? 14  GLN A HE21 6  
ATOM 7627  H HE22 . GLN A 1 14 ? -10.766 -6.126  13.156  1.00 0.00 ? 14  GLN A HE22 6  
ATOM 7628  N N    . ASN A 1 15 ? -3.930  -6.595  14.803  1.00 0.00 ? 15  ASN A N    6  
ATOM 7629  C CA   . ASN A 1 15 ? -2.553  -6.661  15.293  1.00 0.00 ? 15  ASN A CA   6  
ATOM 7630  C C    . ASN A 1 15 ? -1.561  -6.620  14.128  1.00 0.00 ? 15  ASN A C    6  
ATOM 7631  O O    . ASN A 1 15 ? -0.537  -7.308  14.141  1.00 0.00 ? 15  ASN A O    6  
ATOM 7632  C CB   . ASN A 1 15 ? -2.340  -7.929  16.127  1.00 0.00 ? 15  ASN A CB   6  
ATOM 7633  C CG   . ASN A 1 15 ? -1.343  -7.717  17.250  1.00 0.00 ? 15  ASN A CG   6  
ATOM 7634  O OD1  . ASN A 1 15 ? -0.284  -8.344  17.283  1.00 0.00 ? 15  ASN A OD1  6  
ATOM 7635  N ND2  . ASN A 1 15 ? -1.677  -6.827  18.179  1.00 0.00 ? 15  ASN A ND2  6  
ATOM 7636  H H    . ASN A 1 15 ? -4.113  -6.840  13.871  1.00 0.00 ? 15  ASN A H    6  
ATOM 7637  H HA   . ASN A 1 15 ? -2.385  -5.797  15.920  1.00 0.00 ? 15  ASN A HA   6  
ATOM 7638  H HB2  . ASN A 1 15 ? -3.282  -8.232  16.559  1.00 0.00 ? 15  ASN A HB2  6  
ATOM 7639  H HB3  . ASN A 1 15 ? -1.971  -8.717  15.486  1.00 0.00 ? 15  ASN A HB3  6  
ATOM 7640  H HD21 . ASN A 1 15 ? -2.536  -6.363  18.088  1.00 0.00 ? 15  ASN A HD21 6  
ATOM 7641  H HD22 . ASN A 1 15 ? -1.051  -6.669  18.915  1.00 0.00 ? 15  ASN A HD22 6  
ATOM 7642  N N    . GLY A 1 16 ? -1.880  -5.811  13.117  1.00 0.00 ? 16  GLY A N    6  
ATOM 7643  C CA   . GLY A 1 16 ? -1.026  -5.690  11.949  1.00 0.00 ? 16  GLY A CA   6  
ATOM 7644  C C    . GLY A 1 16 ? -1.810  -5.817  10.656  1.00 0.00 ? 16  GLY A C    6  
ATOM 7645  O O    . GLY A 1 16 ? -3.042  -5.773  10.667  1.00 0.00 ? 16  GLY A O    6  
ATOM 7646  H H    . GLY A 1 16 ? -2.710  -5.294  13.163  1.00 0.00 ? 16  GLY A H    6  
ATOM 7647  H HA2  . GLY A 1 16 ? -0.538  -4.727  11.971  1.00 0.00 ? 16  GLY A HA2  6  
ATOM 7648  H HA3  . GLY A 1 16 ? -0.274  -6.466  11.980  1.00 0.00 ? 16  GLY A HA3  6  
ATOM 7649  N N    . MET A 1 17 ? -1.101  -5.968  9.539   1.00 0.00 ? 17  MET A N    6  
ATOM 7650  C CA   . MET A 1 17 ? -1.747  -6.095  8.233   1.00 0.00 ? 17  MET A CA   6  
ATOM 7651  C C    . MET A 1 17 ? -1.478  -7.467  7.608   1.00 0.00 ? 17  MET A C    6  
ATOM 7652  O O    . MET A 1 17 ? -2.385  -8.089  7.054   1.00 0.00 ? 17  MET A O    6  
ATOM 7653  C CB   . MET A 1 17 ? -1.273  -4.980  7.292   1.00 0.00 ? 17  MET A CB   6  
ATOM 7654  C CG   . MET A 1 17 ? -1.522  -3.579  7.835   1.00 0.00 ? 17  MET A CG   6  
ATOM 7655  S SD   . MET A 1 17 ? -2.078  -2.428  6.563   1.00 0.00 ? 17  MET A SD   6  
ATOM 7656  C CE   . MET A 1 17 ? -0.546  -2.122  5.685   1.00 0.00 ? 17  MET A CE   6  
ATOM 7657  H H    . MET A 1 17 ? -0.121  -5.992  9.592   1.00 0.00 ? 17  MET A H    6  
ATOM 7658  H HA   . MET A 1 17 ? -2.811  -5.992  8.385   1.00 0.00 ? 17  MET A HA   6  
ATOM 7659  H HB2  . MET A 1 17 ? -0.213  -5.094  7.119   1.00 0.00 ? 17  MET A HB2  6  
ATOM 7660  H HB3  . MET A 1 17 ? -1.794  -5.074  6.350   1.00 0.00 ? 17  MET A HB3  6  
ATOM 7661  H HG2  . MET A 1 17 ? -2.281  -3.635  8.600   1.00 0.00 ? 17  MET A HG2  6  
ATOM 7662  H HG3  . MET A 1 17 ? -0.604  -3.204  8.265   1.00 0.00 ? 17  MET A HG3  6  
ATOM 7663  H HE1  . MET A 1 17 ? 0.076   -3.005  5.724   1.00 0.00 ? 17  MET A HE1  6  
ATOM 7664  H HE2  . MET A 1 17 ? -0.025  -1.295  6.145   1.00 0.00 ? 17  MET A HE2  6  
ATOM 7665  H HE3  . MET A 1 17 ? -0.764  -1.883  4.654   1.00 0.00 ? 17  MET A HE3  6  
ATOM 7666  N N    . GLY A 1 18 ? -0.233  -7.937  7.706   1.00 0.00 ? 18  GLY A N    6  
ATOM 7667  C CA   . GLY A 1 18 ? 0.124   -9.232  7.153   1.00 0.00 ? 18  GLY A CA   6  
ATOM 7668  C C    . GLY A 1 18 ? 0.079   -9.263  5.635   1.00 0.00 ? 18  GLY A C    6  
ATOM 7669  O O    . GLY A 1 18 ? -0.832  -9.846  5.049   1.00 0.00 ? 18  GLY A O    6  
ATOM 7670  H H    . GLY A 1 18 ? 0.449   -7.400  8.162   1.00 0.00 ? 18  GLY A H    6  
ATOM 7671  H HA2  . GLY A 1 18 ? 1.123   -9.484  7.477   1.00 0.00 ? 18  GLY A HA2  6  
ATOM 7672  H HA3  . GLY A 1 18 ? -0.562  -9.974  7.537   1.00 0.00 ? 18  GLY A HA3  6  
ATOM 7673  N N    . LEU A 1 19 ? 1.069   -8.639  4.996   1.00 0.00 ? 19  LEU A N    6  
ATOM 7674  C CA   . LEU A 1 19 ? 1.147   -8.606  3.534   1.00 0.00 ? 19  LEU A CA   6  
ATOM 7675  C C    . LEU A 1 19 ? 2.564   -8.265  3.066   1.00 0.00 ? 19  LEU A C    6  
ATOM 7676  O O    . LEU A 1 19 ? 3.455   -8.027  3.883   1.00 0.00 ? 19  LEU A O    6  
ATOM 7677  C CB   . LEU A 1 19 ? 0.144   -7.600  2.960   1.00 0.00 ? 19  LEU A CB   6  
ATOM 7678  C CG   . LEU A 1 19 ? 0.432   -6.138  3.297   1.00 0.00 ? 19  LEU A CG   6  
ATOM 7679  C CD1  . LEU A 1 19 ? 1.327   -5.512  2.237   1.00 0.00 ? 19  LEU A CD1  6  
ATOM 7680  C CD2  . LEU A 1 19 ? -0.865  -5.354  3.440   1.00 0.00 ? 19  LEU A CD2  6  
ATOM 7681  H H    . LEU A 1 19 ? 1.770   -8.195  5.522   1.00 0.00 ? 19  LEU A H    6  
ATOM 7682  H HA   . LEU A 1 19 ? 0.896   -9.591  3.172   1.00 0.00 ? 19  LEU A HA   6  
ATOM 7683  H HB2  . LEU A 1 19 ? 0.137   -7.705  1.884   1.00 0.00 ? 19  LEU A HB2  6  
ATOM 7684  H HB3  . LEU A 1 19 ? -0.837  -7.847  3.334   1.00 0.00 ? 19  LEU A HB3  6  
ATOM 7685  H HG   . LEU A 1 19 ? 0.952   -6.099  4.241   1.00 0.00 ? 19  LEU A HG   6  
ATOM 7686  H HD11 . LEU A 1 19 ? 1.166   -4.445  2.212   1.00 0.00 ? 19  LEU A HD11 6  
ATOM 7687  H HD12 . LEU A 1 19 ? 1.091   -5.935  1.271   1.00 0.00 ? 19  LEU A HD12 6  
ATOM 7688  H HD13 . LEU A 1 19 ? 2.361   -5.715  2.474   1.00 0.00 ? 19  LEU A HD13 6  
ATOM 7689  H HD21 . LEU A 1 19 ? -0.654  -4.297  3.373   1.00 0.00 ? 19  LEU A HD21 6  
ATOM 7690  H HD22 . LEU A 1 19 ? -1.314  -5.573  4.397   1.00 0.00 ? 19  LEU A HD22 6  
ATOM 7691  H HD23 . LEU A 1 19 ? -1.544  -5.636  2.649   1.00 0.00 ? 19  LEU A HD23 6  
ATOM 7692  N N    . SER A 1 20 ? 2.766   -8.248  1.749   1.00 0.00 ? 20  SER A N    6  
ATOM 7693  C CA   . SER A 1 20 ? 4.075   -7.943  1.177   1.00 0.00 ? 20  SER A CA   6  
ATOM 7694  C C    . SER A 1 20 ? 3.973   -6.881  0.083   1.00 0.00 ? 20  SER A C    6  
ATOM 7695  O O    . SER A 1 20 ? 2.949   -6.770  -0.594  1.00 0.00 ? 20  SER A O    6  
ATOM 7696  C CB   . SER A 1 20 ? 4.708   -9.216  0.613   1.00 0.00 ? 20  SER A CB   6  
ATOM 7697  O OG   . SER A 1 20 ? 5.010   -10.134 1.650   1.00 0.00 ? 20  SER A OG   6  
ATOM 7698  H H    . SER A 1 20 ? 2.018   -8.449  1.149   1.00 0.00 ? 20  SER A H    6  
ATOM 7699  H HA   . SER A 1 20 ? 4.701   -7.565  1.970   1.00 0.00 ? 20  SER A HA   6  
ATOM 7700  H HB2  . SER A 1 20 ? 4.019   -9.684  -0.074  1.00 0.00 ? 20  SER A HB2  6  
ATOM 7701  H HB3  . SER A 1 20 ? 5.621   -8.962  0.094   1.00 0.00 ? 20  SER A HB3  6  
ATOM 7702  H HG   . SER A 1 20 ? 5.958   -10.147 1.803   1.00 0.00 ? 20  SER A HG   6  
ATOM 7703  N N    . ILE A 1 21 ? 5.046   -6.101  -0.083  1.00 0.00 ? 21  ILE A N    6  
ATOM 7704  C CA   . ILE A 1 21 ? 5.078   -5.043  -1.094  1.00 0.00 ? 21  ILE A CA   6  
ATOM 7705  C C    . ILE A 1 21 ? 6.456   -4.921  -1.745  1.00 0.00 ? 21  ILE A C    6  
ATOM 7706  O O    . ILE A 1 21 ? 7.476   -5.245  -1.132  1.00 0.00 ? 21  ILE A O    6  
ATOM 7707  C CB   . ILE A 1 21 ? 4.688   -3.673  -0.495  1.00 0.00 ? 21  ILE A CB   6  
ATOM 7708  C CG1  . ILE A 1 21 ? 5.486   -3.388  0.782   1.00 0.00 ? 21  ILE A CG1  6  
ATOM 7709  C CG2  . ILE A 1 21 ? 3.194   -3.625  -0.213  1.00 0.00 ? 21  ILE A CG2  6  
ATOM 7710  C CD1  . ILE A 1 21 ? 6.838   -2.763  0.519   1.00 0.00 ? 21  ILE A CD1  6  
ATOM 7711  H H    . ILE A 1 21 ? 5.831   -6.239  0.489   1.00 0.00 ? 21  ILE A H    6  
ATOM 7712  H HA   . ILE A 1 21 ? 4.357   -5.294  -1.857  1.00 0.00 ? 21  ILE A HA   6  
ATOM 7713  H HB   . ILE A 1 21 ? 4.913   -2.910  -1.226  1.00 0.00 ? 21  ILE A HB   6  
ATOM 7714  H HG12 . ILE A 1 21 ? 4.925   -2.710  1.407   1.00 0.00 ? 21  ILE A HG12 6  
ATOM 7715  H HG13 . ILE A 1 21 ? 5.646   -4.314  1.314   1.00 0.00 ? 21  ILE A HG13 6  
ATOM 7716  H HG21 . ILE A 1 21 ? 2.863   -2.597  -0.202  1.00 0.00 ? 21  ILE A HG21 6  
ATOM 7717  H HG22 . ILE A 1 21 ? 2.993   -4.079  0.746   1.00 0.00 ? 21  ILE A HG22 6  
ATOM 7718  H HG23 . ILE A 1 21 ? 2.666   -4.165  -0.984  1.00 0.00 ? 21  ILE A HG23 6  
ATOM 7719  H HD11 . ILE A 1 21 ? 7.607   -3.513  0.632   1.00 0.00 ? 21  ILE A HD11 6  
ATOM 7720  H HD12 . ILE A 1 21 ? 7.008   -1.963  1.223   1.00 0.00 ? 21  ILE A HD12 6  
ATOM 7721  H HD13 . ILE A 1 21 ? 6.864   -2.370  -0.487  1.00 0.00 ? 21  ILE A HD13 6  
ATOM 7722  N N    . VAL A 1 22 ? 6.474   -4.445  -2.992  1.00 0.00 ? 22  VAL A N    6  
ATOM 7723  C CA   . VAL A 1 22 ? 7.721   -4.269  -3.736  1.00 0.00 ? 22  VAL A CA   6  
ATOM 7724  C C    . VAL A 1 22 ? 7.764   -2.902  -4.420  1.00 0.00 ? 22  VAL A C    6  
ATOM 7725  O O    . VAL A 1 22 ? 6.780   -2.466  -5.024  1.00 0.00 ? 22  VAL A O    6  
ATOM 7726  C CB   . VAL A 1 22 ? 7.911   -5.372  -4.804  1.00 0.00 ? 22  VAL A CB   6  
ATOM 7727  C CG1  . VAL A 1 22 ? 9.253   -5.222  -5.512  1.00 0.00 ? 22  VAL A CG1  6  
ATOM 7728  C CG2  . VAL A 1 22 ? 7.786   -6.757  -4.183  1.00 0.00 ? 22  VAL A CG2  6  
ATOM 7729  H H    . VAL A 1 22 ? 5.626   -4.201  -3.421  1.00 0.00 ? 22  VAL A H    6  
ATOM 7730  H HA   . VAL A 1 22 ? 8.539   -4.330  -3.029  1.00 0.00 ? 22  VAL A HA   6  
ATOM 7731  H HB   . VAL A 1 22 ? 7.131   -5.262  -5.542  1.00 0.00 ? 22  VAL A HB   6  
ATOM 7732  H HG11 . VAL A 1 22 ? 9.100   -5.247  -6.582  1.00 0.00 ? 22  VAL A HG11 6  
ATOM 7733  H HG12 . VAL A 1 22 ? 9.906   -6.032  -5.224  1.00 0.00 ? 22  VAL A HG12 6  
ATOM 7734  H HG13 . VAL A 1 22 ? 9.705   -4.281  -5.236  1.00 0.00 ? 22  VAL A HG13 6  
ATOM 7735  H HG21 . VAL A 1 22 ? 7.327   -6.676  -3.209  1.00 0.00 ? 22  VAL A HG21 6  
ATOM 7736  H HG22 . VAL A 1 22 ? 8.766   -7.197  -4.083  1.00 0.00 ? 22  VAL A HG22 6  
ATOM 7737  H HG23 . VAL A 1 22 ? 7.174   -7.381  -4.818  1.00 0.00 ? 22  VAL A HG23 6  
ATOM 7738  N N    . ALA A 1 23 ? 8.913   -2.236  -4.321  1.00 0.00 ? 23  ALA A N    6  
ATOM 7739  C CA   . ALA A 1 23 ? 9.102   -0.919  -4.924  1.00 0.00 ? 23  ALA A CA   6  
ATOM 7740  C C    . ALA A 1 23 ? 9.579   -1.038  -6.372  1.00 0.00 ? 23  ALA A C    6  
ATOM 7741  O O    . ALA A 1 23 ? 10.475  -1.829  -6.675  1.00 0.00 ? 23  ALA A O    6  
ATOM 7742  C CB   . ALA A 1 23 ? 10.094  -0.104  -4.106  1.00 0.00 ? 23  ALA A CB   6  
ATOM 7743  H H    . ALA A 1 23 ? 9.654   -2.643  -3.827  1.00 0.00 ? 23  ALA A H    6  
ATOM 7744  H HA   . ALA A 1 23 ? 8.151   -0.405  -4.909  1.00 0.00 ? 23  ALA A HA   6  
ATOM 7745  H HB1  . ALA A 1 23 ? 9.771   0.926   -4.073  1.00 0.00 ? 23  ALA A HB1  6  
ATOM 7746  H HB2  . ALA A 1 23 ? 11.071  -0.161  -4.561  1.00 0.00 ? 23  ALA A HB2  6  
ATOM 7747  H HB3  . ALA A 1 23 ? 10.143  -0.498  -3.101  1.00 0.00 ? 23  ALA A HB3  6  
ATOM 7748  N N    . ALA A 1 24 ? 8.978   -0.244  -7.260  1.00 0.00 ? 24  ALA A N    6  
ATOM 7749  C CA   . ALA A 1 24 ? 9.342   -0.256  -8.676  1.00 0.00 ? 24  ALA A CA   6  
ATOM 7750  C C    . ALA A 1 24 ? 9.248   1.143   -9.287  1.00 0.00 ? 24  ALA A C    6  
ATOM 7751  O O    . ALA A 1 24 ? 8.467   1.980   -8.828  1.00 0.00 ? 24  ALA A O    6  
ATOM 7752  C CB   . ALA A 1 24 ? 8.457   -1.229  -9.443  1.00 0.00 ? 24  ALA A CB   6  
ATOM 7753  H H    . ALA A 1 24 ? 8.273   0.367   -6.955  1.00 0.00 ? 24  ALA A H    6  
ATOM 7754  H HA   . ALA A 1 24 ? 10.364  -0.601  -8.753  1.00 0.00 ? 24  ALA A HA   6  
ATOM 7755  H HB1  . ALA A 1 24 ? 8.168   -0.787  -10.386 1.00 0.00 ? 24  ALA A HB1  6  
ATOM 7756  H HB2  . ALA A 1 24 ? 7.573   -1.448  -8.863  1.00 0.00 ? 24  ALA A HB2  6  
ATOM 7757  H HB3  . ALA A 1 24 ? 9.001   -2.143  -9.627  1.00 0.00 ? 24  ALA A HB3  6  
ATOM 7758  N N    . LYS A 1 25 ? 10.049  1.383   -10.326 1.00 0.00 ? 25  LYS A N    6  
ATOM 7759  C CA   . LYS A 1 25 ? 10.064  2.675   -11.012 1.00 0.00 ? 25  LYS A CA   6  
ATOM 7760  C C    . LYS A 1 25 ? 9.792   2.503   -12.508 1.00 0.00 ? 25  LYS A C    6  
ATOM 7761  O O    . LYS A 1 25 ? 9.592   1.385   -12.988 1.00 0.00 ? 25  LYS A O    6  
ATOM 7762  C CB   . LYS A 1 25 ? 11.413  3.372   -10.801 1.00 0.00 ? 25  LYS A CB   6  
ATOM 7763  C CG   . LYS A 1 25 ? 11.288  4.804   -10.306 1.00 0.00 ? 25  LYS A CG   6  
ATOM 7764  C CD   . LYS A 1 25 ? 12.594  5.304   -9.706  1.00 0.00 ? 25  LYS A CD   6  
ATOM 7765  C CE   . LYS A 1 25 ? 12.553  6.803   -9.449  1.00 0.00 ? 25  LYS A CE   6  
ATOM 7766  N NZ   . LYS A 1 25 ? 13.842  7.309   -8.899  1.00 0.00 ? 25  LYS A NZ   6  
ATOM 7767  H H    . LYS A 1 25 ? 10.645  0.673   -10.642 1.00 0.00 ? 25  LYS A H    6  
ATOM 7768  H HA   . LYS A 1 25 ? 9.282   3.286   -10.585 1.00 0.00 ? 25  LYS A HA   6  
ATOM 7769  H HB2  . LYS A 1 25 ? 11.986  2.812   -10.076 1.00 0.00 ? 25  LYS A HB2  6  
ATOM 7770  H HB3  . LYS A 1 25 ? 11.949  3.384   -11.738 1.00 0.00 ? 25  LYS A HB3  6  
ATOM 7771  H HG2  . LYS A 1 25 ? 11.020  5.438   -11.137 1.00 0.00 ? 25  LYS A HG2  6  
ATOM 7772  H HG3  . LYS A 1 25 ? 10.516  4.847   -9.553  1.00 0.00 ? 25  LYS A HG3  6  
ATOM 7773  H HD2  . LYS A 1 25 ? 12.768  4.793   -8.771  1.00 0.00 ? 25  LYS A HD2  6  
ATOM 7774  H HD3  . LYS A 1 25 ? 13.399  5.087   -10.392 1.00 0.00 ? 25  LYS A HD3  6  
ATOM 7775  H HE2  . LYS A 1 25 ? 12.347  7.309   -10.380 1.00 0.00 ? 25  LYS A HE2  6  
ATOM 7776  H HE3  . LYS A 1 25 ? 11.762  7.013   -8.744  1.00 0.00 ? 25  LYS A HE3  6  
ATOM 7777  H HZ1  . LYS A 1 25 ? 14.625  7.065   -9.538  1.00 0.00 ? 25  LYS A HZ1  6  
ATOM 7778  H HZ2  . LYS A 1 25 ? 14.025  6.886   -7.967  1.00 0.00 ? 25  LYS A HZ2  6  
ATOM 7779  H HZ3  . LYS A 1 25 ? 13.804  8.344   -8.795  1.00 0.00 ? 25  LYS A HZ3  6  
ATOM 7780  N N    . GLY A 1 26 ? 9.791   3.619   -13.240 1.00 0.00 ? 26  GLY A N    6  
ATOM 7781  C CA   . GLY A 1 26 ? 9.549   3.579   -14.669 1.00 0.00 ? 26  GLY A CA   6  
ATOM 7782  C C    . GLY A 1 26 ? 10.149  4.775   -15.370 1.00 0.00 ? 26  GLY A C    6  
ATOM 7783  O O    . GLY A 1 26 ? 11.248  5.218   -15.022 1.00 0.00 ? 26  GLY A O    6  
ATOM 7784  H H    . GLY A 1 26 ? 9.963   4.485   -12.807 1.00 0.00 ? 26  GLY A H    6  
ATOM 7785  H HA2  . GLY A 1 26 ? 9.981   2.680   -15.077 1.00 0.00 ? 26  GLY A HA2  6  
ATOM 7786  H HA3  . GLY A 1 26 ? 8.484   3.568   -14.844 1.00 0.00 ? 26  GLY A HA3  6  
ATOM 7787  N N    . ALA A 1 27 ? 9.429   5.308   -16.346 1.00 0.00 ? 27  ALA A N    6  
ATOM 7788  C CA   . ALA A 1 27 ? 9.900   6.472   -17.081 1.00 0.00 ? 27  ALA A CA   6  
ATOM 7789  C C    . ALA A 1 27 ? 9.058   7.698   -16.747 1.00 0.00 ? 27  ALA A C    6  
ATOM 7790  O O    . ALA A 1 27 ? 7.840   7.599   -16.582 1.00 0.00 ? 27  ALA A O    6  
ATOM 7791  C CB   . ALA A 1 27 ? 9.890   6.205   -18.580 1.00 0.00 ? 27  ALA A CB   6  
ATOM 7792  H H    . ALA A 1 27 ? 8.560   4.917   -16.569 1.00 0.00 ? 27  ALA A H    6  
ATOM 7793  H HA   . ALA A 1 27 ? 10.919  6.654   -16.772 1.00 0.00 ? 27  ALA A HA   6  
ATOM 7794  H HB1  . ALA A 1 27 ? 9.677   7.124   -19.107 1.00 0.00 ? 27  ALA A HB1  6  
ATOM 7795  H HB2  . ALA A 1 27 ? 9.131   5.473   -18.812 1.00 0.00 ? 27  ALA A HB2  6  
ATOM 7796  H HB3  . ALA A 1 27 ? 10.857  5.832   -18.885 1.00 0.00 ? 27  ALA A HB3  6  
ATOM 7797  N N    . GLY A 1 28 ? 9.718   8.852   -16.631 1.00 0.00 ? 28  GLY A N    6  
ATOM 7798  C CA   . GLY A 1 28 ? 9.016   10.079  -16.296 1.00 0.00 ? 28  GLY A CA   6  
ATOM 7799  C C    . GLY A 1 28 ? 8.344   9.985   -14.941 1.00 0.00 ? 28  GLY A C    6  
ATOM 7800  O O    . GLY A 1 28 ? 7.176   10.349  -14.789 1.00 0.00 ? 28  GLY A O    6  
ATOM 7801  H H    . GLY A 1 28 ? 10.689  8.865   -16.760 1.00 0.00 ? 28  GLY A H    6  
ATOM 7802  H HA2  . GLY A 1 28 ? 9.722   10.896  -16.283 1.00 0.00 ? 28  GLY A HA2  6  
ATOM 7803  H HA3  . GLY A 1 28 ? 8.265   10.272  -17.048 1.00 0.00 ? 28  GLY A HA3  6  
ATOM 7804  N N    . GLN A 1 29 ? 9.085   9.474   -13.959 1.00 0.00 ? 29  GLN A N    6  
ATOM 7805  C CA   . GLN A 1 29 ? 8.564   9.305   -12.612 1.00 0.00 ? 29  GLN A CA   6  
ATOM 7806  C C    . GLN A 1 29 ? 9.563   9.796   -11.571 1.00 0.00 ? 29  GLN A C    6  
ATOM 7807  O O    . GLN A 1 29 ? 10.586  9.151   -11.326 1.00 0.00 ? 29  GLN A O    6  
ATOM 7808  C CB   . GLN A 1 29 ? 8.237   7.834   -12.359 1.00 0.00 ? 29  GLN A CB   6  
ATOM 7809  C CG   . GLN A 1 29 ? 7.326   7.608   -11.163 1.00 0.00 ? 29  GLN A CG   6  
ATOM 7810  C CD   . GLN A 1 29 ? 6.013   6.952   -11.547 1.00 0.00 ? 29  GLN A CD   6  
ATOM 7811  O OE1  . GLN A 1 29 ? 4.943   7.387   -11.122 1.00 0.00 ? 29  GLN A OE1  6  
ATOM 7812  N NE2  . GLN A 1 29 ? 6.087   5.900   -12.356 1.00 0.00 ? 29  GLN A NE2  6  
ATOM 7813  H H    . GLN A 1 29 ? 10.003  9.191   -14.150 1.00 0.00 ? 29  GLN A H    6  
ATOM 7814  H HA   . GLN A 1 29 ? 7.656   9.884   -12.530 1.00 0.00 ? 29  GLN A HA   6  
ATOM 7815  H HB2  . GLN A 1 29 ? 7.751   7.431   -13.235 1.00 0.00 ? 29  GLN A HB2  6  
ATOM 7816  H HB3  . GLN A 1 29 ? 9.158   7.297   -12.189 1.00 0.00 ? 29  GLN A HB3  6  
ATOM 7817  H HG2  . GLN A 1 29 ? 7.834   6.971   -10.456 1.00 0.00 ? 29  GLN A HG2  6  
ATOM 7818  H HG3  . GLN A 1 29 ? 7.114   8.561   -10.702 1.00 0.00 ? 29  GLN A HG3  6  
ATOM 7819  H HE21 . GLN A 1 29 ? 6.972   5.606   -12.658 1.00 0.00 ? 29  GLN A HE21 6  
ATOM 7820  H HE22 . GLN A 1 29 ? 5.254   5.462   -12.620 1.00 0.00 ? 29  GLN A HE22 6  
ATOM 7821  N N    . ASP A 1 30 ? 9.253   10.931  -10.951 1.00 0.00 ? 30  ASP A N    6  
ATOM 7822  C CA   . ASP A 1 30 ? 10.114  11.503  -9.920  1.00 0.00 ? 30  ASP A CA   6  
ATOM 7823  C C    . ASP A 1 30 ? 9.729   10.980  -8.532  1.00 0.00 ? 30  ASP A C    6  
ATOM 7824  O O    . ASP A 1 30 ? 10.050  11.598  -7.515  1.00 0.00 ? 30  ASP A O    6  
ATOM 7825  C CB   . ASP A 1 30 ? 10.029  13.033  -9.954  1.00 0.00 ? 30  ASP A CB   6  
ATOM 7826  C CG   . ASP A 1 30 ? 11.199  13.696  -9.256  1.00 0.00 ? 30  ASP A CG   6  
ATOM 7827  O OD1  . ASP A 1 30 ? 12.336  13.571  -9.755  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 7828  O OD2  . ASP A 1 30 ? 10.975  14.341  -8.209  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 7829  H H    . ASP A 1 30 ? 8.420   11.390  -11.186 1.00 0.00 ? 30  ASP A H    6  
ATOM 7830  H HA   . ASP A 1 30 ? 11.127  11.201  -10.133 1.00 0.00 ? 30  ASP A HA   6  
ATOM 7831  H HB2  . ASP A 1 30 ? 10.015  13.363  -10.982 1.00 0.00 ? 30  ASP A HB2  6  
ATOM 7832  H HB3  . ASP A 1 30 ? 9.117   13.348  -9.468  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 7833  N N    . LYS A 1 31 ? 9.040   9.835   -8.499  1.00 0.00 ? 31  LYS A N    6  
ATOM 7834  C CA   . LYS A 1 31 ? 8.606   9.225   -7.246  1.00 0.00 ? 31  LYS A CA   6  
ATOM 7835  C C    . LYS A 1 31 ? 8.677   7.697   -7.335  1.00 0.00 ? 31  LYS A C    6  
ATOM 7836  O O    . LYS A 1 31 ? 9.248   7.148   -8.281  1.00 0.00 ? 31  LYS A O    6  
ATOM 7837  C CB   . LYS A 1 31 ? 7.175   9.671   -6.914  1.00 0.00 ? 31  LYS A CB   6  
ATOM 7838  C CG   . LYS A 1 31 ? 6.947   11.171  -7.052  1.00 0.00 ? 31  LYS A CG   6  
ATOM 7839  C CD   . LYS A 1 31 ? 7.482   11.935  -5.850  1.00 0.00 ? 31  LYS A CD   6  
ATOM 7840  C CE   . LYS A 1 31 ? 6.969   13.368  -5.822  1.00 0.00 ? 31  LYS A CE   6  
ATOM 7841  N NZ   . LYS A 1 31 ? 7.912   14.319  -6.479  1.00 0.00 ? 31  LYS A NZ   6  
ATOM 7842  H H    . LYS A 1 31 ? 8.818   9.390   -9.339  1.00 0.00 ? 31  LYS A H    6  
ATOM 7843  H HA   . LYS A 1 31 ? 9.270   9.561   -6.465  1.00 0.00 ? 31  LYS A HA   6  
ATOM 7844  H HB2  . LYS A 1 31 ? 6.490   9.164   -7.578  1.00 0.00 ? 31  LYS A HB2  6  
ATOM 7845  H HB3  . LYS A 1 31 ? 6.949   9.387   -5.897  1.00 0.00 ? 31  LYS A HB3  6  
ATOM 7846  H HG2  . LYS A 1 31 ? 7.449   11.521  -7.941  1.00 0.00 ? 31  LYS A HG2  6  
ATOM 7847  H HG3  . LYS A 1 31 ? 5.886   11.355  -7.142  1.00 0.00 ? 31  LYS A HG3  6  
ATOM 7848  H HD2  . LYS A 1 31 ? 7.167   11.435  -4.948  1.00 0.00 ? 31  LYS A HD2  6  
ATOM 7849  H HD3  . LYS A 1 31 ? 8.561   11.949  -5.897  1.00 0.00 ? 31  LYS A HD3  6  
ATOM 7850  H HE2  . LYS A 1 31 ? 6.020   13.406  -6.336  1.00 0.00 ? 31  LYS A HE2  6  
ATOM 7851  H HE3  . LYS A 1 31 ? 6.830   13.665  -4.792  1.00 0.00 ? 31  LYS A HE3  6  
ATOM 7852  H HZ1  . LYS A 1 31 ? 8.888   13.963  -6.412  1.00 0.00 ? 31  LYS A HZ1  6  
ATOM 7853  H HZ2  . LYS A 1 31 ? 7.863   15.249  -6.014  1.00 0.00 ? 31  LYS A HZ2  6  
ATOM 7854  H HZ3  . LYS A 1 31 ? 7.664   14.434  -7.482  1.00 0.00 ? 31  LYS A HZ3  6  
ATOM 7855  N N    . LEU A 1 32 ? 8.095   7.014   -6.346  1.00 0.00 ? 32  LEU A N    6  
ATOM 7856  C CA   . LEU A 1 32 ? 8.091   5.552   -6.317  1.00 0.00 ? 32  LEU A CA   6  
ATOM 7857  C C    . LEU A 1 32 ? 6.719   5.018   -5.909  1.00 0.00 ? 32  LEU A C    6  
ATOM 7858  O O    . LEU A 1 32 ? 6.013   5.639   -5.111  1.00 0.00 ? 32  LEU A O    6  
ATOM 7859  C CB   . LEU A 1 32 ? 9.160   5.034   -5.349  1.00 0.00 ? 32  LEU A CB   6  
ATOM 7860  C CG   . LEU A 1 32 ? 10.003  3.869   -5.876  1.00 0.00 ? 32  LEU A CG   6  
ATOM 7861  C CD1  . LEU A 1 32 ? 10.850  4.309   -7.062  1.00 0.00 ? 32  LEU A CD1  6  
ATOM 7862  C CD2  . LEU A 1 32 ? 10.882  3.308   -4.768  1.00 0.00 ? 32  LEU A CD2  6  
ATOM 7863  H H    . LEU A 1 32 ? 7.656   7.504   -5.621  1.00 0.00 ? 32  LEU A H    6  
ATOM 7864  H HA   . LEU A 1 32 ? 8.319   5.201   -7.312  1.00 0.00 ? 32  LEU A HA   6  
ATOM 7865  H HB2  . LEU A 1 32 ? 9.822   5.851   -5.105  1.00 0.00 ? 32  LEU A HB2  6  
ATOM 7866  H HB3  . LEU A 1 32 ? 8.667   4.710   -4.443  1.00 0.00 ? 32  LEU A HB3  6  
ATOM 7867  H HG   . LEU A 1 32 ? 9.344   3.081   -6.212  1.00 0.00 ? 32  LEU A HG   6  
ATOM 7868  H HD11 . LEU A 1 32 ? 10.948  3.488   -7.759  1.00 0.00 ? 32  LEU A HD11 6  
ATOM 7869  H HD12 . LEU A 1 32 ? 11.829  4.606   -6.717  1.00 0.00 ? 32  LEU A HD12 6  
ATOM 7870  H HD13 . LEU A 1 32 ? 10.374  5.143   -7.556  1.00 0.00 ? 32  LEU A HD13 6  
ATOM 7871  H HD21 . LEU A 1 32 ? 11.580  4.065   -4.442  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 7872  H HD22 . LEU A 1 32 ? 11.428  2.452   -5.138  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 7873  H HD23 . LEU A 1 32 ? 10.264  3.007   -3.935  1.00 0.00 ? 32  LEU A HD23 6  
ATOM 7874  N N    . GLY A 1 33 ? 6.350   3.862   -6.464  1.00 0.00 ? 33  GLY A N    6  
ATOM 7875  C CA   . GLY A 1 33 ? 5.066   3.260   -6.150  1.00 0.00 ? 33  GLY A CA   6  
ATOM 7876  C C    . GLY A 1 33 ? 5.194   2.007   -5.300  1.00 0.00 ? 33  GLY A C    6  
ATOM 7877  O O    . GLY A 1 33 ? 5.952   1.097   -5.640  1.00 0.00 ? 33  GLY A O    6  
ATOM 7878  H H    . GLY A 1 33 ? 6.957   3.415   -7.092  1.00 0.00 ? 33  GLY A H    6  
ATOM 7879  H HA2  . GLY A 1 33 ? 4.463   3.983   -5.619  1.00 0.00 ? 33  GLY A HA2  6  
ATOM 7880  H HA3  . GLY A 1 33 ? 4.569   3.004   -7.075  1.00 0.00 ? 33  GLY A HA3  6  
ATOM 7881  N N    . ILE A 1 34 ? 4.447   1.959   -4.196  1.00 0.00 ? 34  ILE A N    6  
ATOM 7882  C CA   . ILE A 1 34 ? 4.477   0.806   -3.295  1.00 0.00 ? 34  ILE A CA   6  
ATOM 7883  C C    . ILE A 1 34 ? 3.478   -0.263  -3.744  1.00 0.00 ? 34  ILE A C    6  
ATOM 7884  O O    . ILE A 1 34 ? 2.329   -0.284  -3.300  1.00 0.00 ? 34  ILE A O    6  
ATOM 7885  C CB   . ILE A 1 34 ? 4.168   1.218   -1.836  1.00 0.00 ? 34  ILE A CB   6  
ATOM 7886  C CG1  . ILE A 1 34 ? 5.014   2.430   -1.429  1.00 0.00 ? 34  ILE A CG1  6  
ATOM 7887  C CG2  . ILE A 1 34 ? 4.412   0.055   -0.882  1.00 0.00 ? 34  ILE A CG2  6  
ATOM 7888  C CD1  . ILE A 1 34 ? 6.506   2.223   -1.598  1.00 0.00 ? 34  ILE A CD1  6  
ATOM 7889  H H    . ILE A 1 34 ? 3.860   2.715   -3.982  1.00 0.00 ? 34  ILE A H    6  
ATOM 7890  H HA   . ILE A 1 34 ? 5.473   0.387   -3.325  1.00 0.00 ? 34  ILE A HA   6  
ATOM 7891  H HB   . ILE A 1 34 ? 3.124   1.484   -1.777  1.00 0.00 ? 34  ILE A HB   6  
ATOM 7892  H HG12 . ILE A 1 34 ? 4.729   3.278   -2.034  1.00 0.00 ? 34  ILE A HG12 6  
ATOM 7893  H HG13 . ILE A 1 34 ? 4.825   2.657   -0.390  1.00 0.00 ? 34  ILE A HG13 6  
ATOM 7894  H HG21 . ILE A 1 34 ? 4.253   -0.878  -1.402  1.00 0.00 ? 34  ILE A HG21 6  
ATOM 7895  H HG22 . ILE A 1 34 ? 3.727   0.124   -0.050  1.00 0.00 ? 34  ILE A HG22 6  
ATOM 7896  H HG23 . ILE A 1 34 ? 5.427   0.096   -0.516  1.00 0.00 ? 34  ILE A HG23 6  
ATOM 7897  H HD11 . ILE A 1 34 ? 7.039   2.975   -1.033  1.00 0.00 ? 34  ILE A HD11 6  
ATOM 7898  H HD12 . ILE A 1 34 ? 6.766   2.307   -2.642  1.00 0.00 ? 34  ILE A HD12 6  
ATOM 7899  H HD13 . ILE A 1 34 ? 6.777   1.242   -1.237  1.00 0.00 ? 34  ILE A HD13 6  
ATOM 7900  N N    . TYR A 1 35 ? 3.928   -1.144  -4.636  1.00 0.00 ? 35  TYR A N    6  
ATOM 7901  C CA   . TYR A 1 35 ? 3.086   -2.218  -5.165  1.00 0.00 ? 35  TYR A CA   6  
ATOM 7902  C C    . TYR A 1 35 ? 2.975   -3.384  -4.180  1.00 0.00 ? 35  TYR A C    6  
ATOM 7903  O O    . TYR A 1 35 ? 3.718   -3.452  -3.201  1.00 0.00 ? 35  TYR A O    6  
ATOM 7904  C CB   . TYR A 1 35 ? 3.647   -2.712  -6.500  1.00 0.00 ? 35  TYR A CB   6  
ATOM 7905  C CG   . TYR A 1 35 ? 3.849   -1.609  -7.516  1.00 0.00 ? 35  TYR A CG   6  
ATOM 7906  C CD1  . TYR A 1 35 ? 2.771   -1.066  -8.202  1.00 0.00 ? 35  TYR A CD1  6  
ATOM 7907  C CD2  . TYR A 1 35 ? 5.119   -1.111  -7.788  1.00 0.00 ? 35  TYR A CD2  6  
ATOM 7908  C CE1  . TYR A 1 35 ? 2.949   -0.061  -9.130  1.00 0.00 ? 35  TYR A CE1  6  
ATOM 7909  C CE2  . TYR A 1 35 ? 5.304   -0.103  -8.716  1.00 0.00 ? 35  TYR A CE2  6  
ATOM 7910  C CZ   . TYR A 1 35 ? 4.217   0.418   -9.385  1.00 0.00 ? 35  TYR A CZ   6  
ATOM 7911  O OH   . TYR A 1 35 ? 4.398   1.421   -10.312 1.00 0.00 ? 35  TYR A OH   6  
ATOM 7912  H H    . TYR A 1 35 ? 4.850   -1.066  -4.956  1.00 0.00 ? 35  TYR A H    6  
ATOM 7913  H HA   . TYR A 1 35 ? 2.100   -1.810  -5.331  1.00 0.00 ? 35  TYR A HA   6  
ATOM 7914  H HB2  . TYR A 1 35 ? 4.603   -3.183  -6.328  1.00 0.00 ? 35  TYR A HB2  6  
ATOM 7915  H HB3  . TYR A 1 35 ? 2.966   -3.434  -6.924  1.00 0.00 ? 35  TYR A HB3  6  
ATOM 7916  H HD1  . TYR A 1 35 ? 1.779   -1.441  -8.001  1.00 0.00 ? 35  TYR A HD1  6  
ATOM 7917  H HD2  . TYR A 1 35 ? 5.968   -1.520  -7.263  1.00 0.00 ? 35  TYR A HD2  6  
ATOM 7918  H HE1  . TYR A 1 35 ? 2.096   0.346   -9.651  1.00 0.00 ? 35  TYR A HE1  6  
ATOM 7919  H HE2  . TYR A 1 35 ? 6.298   0.272   -8.914  1.00 0.00 ? 35  TYR A HE2  6  
ATOM 7920  H HH   . TYR A 1 35 ? 4.069   1.130   -11.167 1.00 0.00 ? 35  TYR A HH   6  
ATOM 7921  N N    . VAL A 1 36 ? 2.041   -4.300  -4.452  1.00 0.00 ? 36  VAL A N    6  
ATOM 7922  C CA   . VAL A 1 36 ? 1.826   -5.468  -3.591  1.00 0.00 ? 36  VAL A CA   6  
ATOM 7923  C C    . VAL A 1 36 ? 2.512   -6.714  -4.151  1.00 0.00 ? 36  VAL A C    6  
ATOM 7924  O O    . VAL A 1 36 ? 2.431   -6.997  -5.347  1.00 0.00 ? 36  VAL A O    6  
ATOM 7925  C CB   . VAL A 1 36 ? 0.321   -5.769  -3.405  1.00 0.00 ? 36  VAL A CB   6  
ATOM 7926  C CG1  . VAL A 1 36 ? 0.107   -6.839  -2.343  1.00 0.00 ? 36  VAL A CG1  6  
ATOM 7927  C CG2  . VAL A 1 36 ? -0.444  -4.504  -3.047  1.00 0.00 ? 36  VAL A CG2  6  
ATOM 7928  H H    . VAL A 1 36 ? 1.483   -4.188  -5.252  1.00 0.00 ? 36  VAL A H    6  
ATOM 7929  H HA   . VAL A 1 36 ? 2.248   -5.246  -2.621  1.00 0.00 ? 36  VAL A HA   6  
ATOM 7930  H HB   . VAL A 1 36 ? -0.067  -6.144  -4.341  1.00 0.00 ? 36  VAL A HB   6  
ATOM 7931  H HG11 . VAL A 1 36 ? 1.020   -7.399  -2.203  1.00 0.00 ? 36  VAL A HG11 6  
ATOM 7932  H HG12 . VAL A 1 36 ? -0.680  -7.507  -2.659  1.00 0.00 ? 36  VAL A HG12 6  
ATOM 7933  H HG13 . VAL A 1 36 ? -0.173  -6.370  -1.411  1.00 0.00 ? 36  VAL A HG13 6  
ATOM 7934  H HG21 . VAL A 1 36 ? -1.502  -4.674  -3.182  1.00 0.00 ? 36  VAL A HG21 6  
ATOM 7935  H HG22 . VAL A 1 36 ? -0.126  -3.695  -3.687  1.00 0.00 ? 36  VAL A HG22 6  
ATOM 7936  H HG23 . VAL A 1 36 ? -0.249  -4.246  -2.016  1.00 0.00 ? 36  VAL A HG23 6  
ATOM 7937  N N    . LYS A 1 37 ? 3.178   -7.457  -3.269  1.00 0.00 ? 37  LYS A N    6  
ATOM 7938  C CA   . LYS A 1 37 ? 3.878   -8.680  -3.653  1.00 0.00 ? 37  LYS A CA   6  
ATOM 7939  C C    . LYS A 1 37 ? 3.058   -9.924  -3.300  1.00 0.00 ? 37  LYS A C    6  
ATOM 7940  O O    . LYS A 1 37 ? 3.000   -10.874 -4.082  1.00 0.00 ? 37  LYS A O    6  
ATOM 7941  C CB   . LYS A 1 37 ? 5.244   -8.742  -2.960  1.00 0.00 ? 37  LYS A CB   6  
ATOM 7942  C CG   . LYS A 1 37 ? 6.045   -9.997  -3.280  1.00 0.00 ? 37  LYS A CG   6  
ATOM 7943  C CD   . LYS A 1 37 ? 6.376   -10.093 -4.763  1.00 0.00 ? 37  LYS A CD   6  
ATOM 7944  C CE   . LYS A 1 37 ? 5.971   -11.441 -5.343  1.00 0.00 ? 37  LYS A CE   6  
ATOM 7945  N NZ   . LYS A 1 37 ? 5.376   -11.310 -6.703  1.00 0.00 ? 37  LYS A NZ   6  
ATOM 7946  H H    . LYS A 1 37 ? 3.196   -7.175  -2.329  1.00 0.00 ? 37  LYS A H    6  
ATOM 7947  H HA   . LYS A 1 37 ? 4.029   -8.655  -4.722  1.00 0.00 ? 37  LYS A HA   6  
ATOM 7948  H HB2  . LYS A 1 37 ? 5.824   -7.884  -3.260  1.00 0.00 ? 37  LYS A HB2  6  
ATOM 7949  H HB3  . LYS A 1 37 ? 5.091   -8.704  -1.892  1.00 0.00 ? 37  LYS A HB3  6  
ATOM 7950  H HG2  . LYS A 1 37 ? 6.967   -9.974  -2.719  1.00 0.00 ? 37  LYS A HG2  6  
ATOM 7951  H HG3  . LYS A 1 37 ? 5.468   -10.864 -2.991  1.00 0.00 ? 37  LYS A HG3  6  
ATOM 7952  H HD2  . LYS A 1 37 ? 5.851   -9.313  -5.292  1.00 0.00 ? 37  LYS A HD2  6  
ATOM 7953  H HD3  . LYS A 1 37 ? 7.441   -9.962  -4.891  1.00 0.00 ? 37  LYS A HD3  6  
ATOM 7954  H HE2  . LYS A 1 37 ? 6.847   -12.070 -5.405  1.00 0.00 ? 37  LYS A HE2  6  
ATOM 7955  H HE3  . LYS A 1 37 ? 5.247   -11.899 -4.686  1.00 0.00 ? 37  LYS A HE3  6  
ATOM 7956  H HZ1  . LYS A 1 37 ? 5.363   -12.235 -7.179  1.00 0.00 ? 37  LYS A HZ1  6  
ATOM 7957  H HZ2  . LYS A 1 37 ? 5.935   -10.647 -7.278  1.00 0.00 ? 37  LYS A HZ2  6  
ATOM 7958  H HZ3  . LYS A 1 37 ? 4.401   -10.954 -6.635  1.00 0.00 ? 37  LYS A HZ3  6  
ATOM 7959  N N    . SER A 1 38 ? 2.432   -9.915  -2.118  1.00 0.00 ? 38  SER A N    6  
ATOM 7960  C CA   . SER A 1 38 ? 1.620   -11.046 -1.661  1.00 0.00 ? 38  SER A CA   6  
ATOM 7961  C C    . SER A 1 38 ? 0.982   -10.751 -0.303  1.00 0.00 ? 38  SER A C    6  
ATOM 7962  O O    . SER A 1 38 ? 1.678   -10.414 0.654   1.00 0.00 ? 38  SER A O    6  
ATOM 7963  C CB   . SER A 1 38 ? 2.475   -12.315 -1.565  1.00 0.00 ? 38  SER A CB   6  
ATOM 7964  O OG   . SER A 1 38 ? 1.694   -13.474 -1.799  1.00 0.00 ? 38  SER A OG   6  
ATOM 7965  H H    . SER A 1 38 ? 2.521   -9.129  -1.538  1.00 0.00 ? 38  SER A H    6  
ATOM 7966  H HA   . SER A 1 38 ? 0.837   -11.206 -2.387  1.00 0.00 ? 38  SER A HA   6  
ATOM 7967  H HB2  . SER A 1 38 ? 3.263   -12.274 -2.302  1.00 0.00 ? 38  SER A HB2  6  
ATOM 7968  H HB3  . SER A 1 38 ? 2.908   -12.381 -0.578  1.00 0.00 ? 38  SER A HB3  6  
ATOM 7969  H HG   . SER A 1 38 ? 1.991   -14.183 -1.223  1.00 0.00 ? 38  SER A HG   6  
ATOM 7970  N N    . VAL A 1 39 ? -0.343  -10.884 -0.223  1.00 0.00 ? 39  VAL A N    6  
ATOM 7971  C CA   . VAL A 1 39 ? -1.064  -10.632 1.026   1.00 0.00 ? 39  VAL A CA   6  
ATOM 7972  C C    . VAL A 1 39 ? -1.125  -11.888 1.893   1.00 0.00 ? 39  VAL A C    6  
ATOM 7973  O O    . VAL A 1 39 ? -1.385  -12.986 1.397   1.00 0.00 ? 39  VAL A O    6  
ATOM 7974  C CB   . VAL A 1 39 ? -2.499  -10.119 0.767   1.00 0.00 ? 39  VAL A CB   6  
ATOM 7975  C CG1  . VAL A 1 39 ? -2.466  -8.754  0.096   1.00 0.00 ? 39  VAL A CG1  6  
ATOM 7976  C CG2  . VAL A 1 39 ? -3.294  -11.112 -0.070  1.00 0.00 ? 39  VAL A CG2  6  
ATOM 7977  H H    . VAL A 1 39 ? -0.845  -11.160 -1.018  1.00 0.00 ? 39  VAL A H    6  
ATOM 7978  H HA   . VAL A 1 39 ? -0.526  -9.868  1.566   1.00 0.00 ? 39  VAL A HA   6  
ATOM 7979  H HB   . VAL A 1 39 ? -2.996  -10.010 1.721   1.00 0.00 ? 39  VAL A HB   6  
ATOM 7980  H HG11 . VAL A 1 39 ? -1.512  -8.615  -0.390  1.00 0.00 ? 39  VAL A HG11 6  
ATOM 7981  H HG12 . VAL A 1 39 ? -2.607  -7.984  0.841   1.00 0.00 ? 39  VAL A HG12 6  
ATOM 7982  H HG13 . VAL A 1 39 ? -3.256  -8.694  -0.638  1.00 0.00 ? 39  VAL A HG13 6  
ATOM 7983  H HG21 . VAL A 1 39 ? -3.272  -12.082 0.405   1.00 0.00 ? 39  VAL A HG21 6  
ATOM 7984  H HG22 . VAL A 1 39 ? -2.858  -11.185 -1.055  1.00 0.00 ? 39  VAL A HG22 6  
ATOM 7985  H HG23 . VAL A 1 39 ? -4.317  -10.776 -0.153  1.00 0.00 ? 39  VAL A HG23 6  
ATOM 7986  N N    . VAL A 1 40 ? -0.881  -11.716 3.191   1.00 0.00 ? 40  VAL A N    6  
ATOM 7987  C CA   . VAL A 1 40 ? -0.905  -12.833 4.133   1.00 0.00 ? 40  VAL A CA   6  
ATOM 7988  C C    . VAL A 1 40 ? -2.290  -12.991 4.760   1.00 0.00 ? 40  VAL A C    6  
ATOM 7989  O O    . VAL A 1 40 ? -2.858  -12.033 5.288   1.00 0.00 ? 40  VAL A O    6  
ATOM 7990  C CB   . VAL A 1 40 ? 0.141   -12.653 5.256   1.00 0.00 ? 40  VAL A CB   6  
ATOM 7991  C CG1  . VAL A 1 40 ? 0.262   -13.920 6.089   1.00 0.00 ? 40  VAL A CG1  6  
ATOM 7992  C CG2  . VAL A 1 40 ? 1.494   -12.258 4.678   1.00 0.00 ? 40  VAL A CG2  6  
ATOM 7993  H H    . VAL A 1 40 ? -0.678  -10.814 3.525   1.00 0.00 ? 40  VAL A H    6  
ATOM 7994  H HA   . VAL A 1 40 ? -0.664  -13.733 3.586   1.00 0.00 ? 40  VAL A HA   6  
ATOM 7995  H HB   . VAL A 1 40 ? -0.193  -11.856 5.905   1.00 0.00 ? 40  VAL A HB   6  
ATOM 7996  H HG11 . VAL A 1 40 ? 1.117   -13.840 6.743   1.00 0.00 ? 40  VAL A HG11 6  
ATOM 7997  H HG12 . VAL A 1 40 ? 0.386   -14.771 5.436   1.00 0.00 ? 40  VAL A HG12 6  
ATOM 7998  H HG13 . VAL A 1 40 ? -0.633  -14.048 6.682   1.00 0.00 ? 40  VAL A HG13 6  
ATOM 7999  H HG21 . VAL A 1 40 ? 1.878   -13.067 4.074   1.00 0.00 ? 40  VAL A HG21 6  
ATOM 8000  H HG22 . VAL A 1 40 ? 2.183   -12.052 5.483   1.00 0.00 ? 40  VAL A HG22 6  
ATOM 8001  H HG23 . VAL A 1 40 ? 1.382   -11.374 4.067   1.00 0.00 ? 40  VAL A HG23 6  
ATOM 8002  N N    . LYS A 1 41 ? -2.827  -14.209 4.695   1.00 0.00 ? 41  LYS A N    6  
ATOM 8003  C CA   . LYS A 1 41 ? -4.145  -14.504 5.252   1.00 0.00 ? 41  LYS A CA   6  
ATOM 8004  C C    . LYS A 1 41 ? -4.171  -14.285 6.761   1.00 0.00 ? 41  LYS A C    6  
ATOM 8005  O O    . LYS A 1 41 ? -3.161  -14.474 7.444   1.00 0.00 ? 41  LYS A O    6  
ATOM 8006  C CB   . LYS A 1 41 ? -4.543  -15.945 4.936   1.00 0.00 ? 41  LYS A CB   6  
ATOM 8007  C CG   . LYS A 1 41 ? -5.278  -16.096 3.615   1.00 0.00 ? 41  LYS A CG   6  
ATOM 8008  C CD   . LYS A 1 41 ? -6.783  -15.963 3.796   1.00 0.00 ? 41  LYS A CD   6  
ATOM 8009  C CE   . LYS A 1 41 ? -7.538  -17.008 2.987   1.00 0.00 ? 41  LYS A CE   6  
ATOM 8010  N NZ   . LYS A 1 41 ? -7.352  -18.382 3.535   1.00 0.00 ? 41  LYS A NZ   6  
ATOM 8011  H H    . LYS A 1 41 ? -2.323  -14.928 4.260   1.00 0.00 ? 41  LYS A H    6  
ATOM 8012  H HA   . LYS A 1 41 ? -4.857  -13.834 4.792   1.00 0.00 ? 41  LYS A HA   6  
ATOM 8013  H HB2  . LYS A 1 41 ? -3.651  -16.553 4.899   1.00 0.00 ? 41  LYS A HB2  6  
ATOM 8014  H HB3  . LYS A 1 41 ? -5.184  -16.310 5.725   1.00 0.00 ? 41  LYS A HB3  6  
ATOM 8015  H HG2  . LYS A 1 41 ? -4.938  -15.330 2.936   1.00 0.00 ? 41  LYS A HG2  6  
ATOM 8016  H HG3  . LYS A 1 41 ? -5.057  -17.070 3.203   1.00 0.00 ? 41  LYS A HG3  6  
ATOM 8017  H HD2  . LYS A 1 41 ? -7.024  -16.088 4.841   1.00 0.00 ? 41  LYS A HD2  6  
ATOM 8018  H HD3  . LYS A 1 41 ? -7.089  -14.980 3.470   1.00 0.00 ? 41  LYS A HD3  6  
ATOM 8019  H HE2  . LYS A 1 41 ? -8.590  -16.764 3.002   1.00 0.00 ? 41  LYS A HE2  6  
ATOM 8020  H HE3  . LYS A 1 41 ? -7.178  -16.984 1.969   1.00 0.00 ? 41  LYS A HE3  6  
ATOM 8021  H HZ1  . LYS A 1 41 ? -6.404  -18.477 3.953   1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 8022  H HZ2  . LYS A 1 41 ? -7.455  -19.086 2.778   1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 8023  H HZ3  . LYS A 1 41 ? -8.063  -18.573 4.270   1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 8024  N N    . GLY A 1 42 ? -5.332  -13.885 7.274   1.00 0.00 ? 42  GLY A N    6  
ATOM 8025  C CA   . GLY A 1 42 ? -5.473  -13.641 8.699   1.00 0.00 ? 42  GLY A CA   6  
ATOM 8026  C C    . GLY A 1 42 ? -5.406  -12.165 9.047   1.00 0.00 ? 42  GLY A C    6  
ATOM 8027  O O    . GLY A 1 42 ? -6.027  -11.723 10.014  1.00 0.00 ? 42  GLY A O    6  
ATOM 8028  H H    . GLY A 1 42 ? -6.100  -13.750 6.679   1.00 0.00 ? 42  GLY A H    6  
ATOM 8029  H HA2  . GLY A 1 42 ? -6.424  -14.035 9.026   1.00 0.00 ? 42  GLY A HA2  6  
ATOM 8030  H HA3  . GLY A 1 42 ? -4.682  -14.158 9.223   1.00 0.00 ? 42  GLY A HA3  6  
ATOM 8031  N N    . GLY A 1 43 ? -4.654  -11.400 8.253   1.00 0.00 ? 43  GLY A N    6  
ATOM 8032  C CA   . GLY A 1 43 ? -4.528  -9.976  8.493   1.00 0.00 ? 43  GLY A CA   6  
ATOM 8033  C C    . GLY A 1 43 ? -5.840  -9.235  8.289   1.00 0.00 ? 43  GLY A C    6  
ATOM 8034  O O    . GLY A 1 43 ? -6.694  -9.674  7.516   1.00 0.00 ? 43  GLY A O    6  
ATOM 8035  H H    . GLY A 1 43 ? -4.185  -11.807 7.494   1.00 0.00 ? 43  GLY A H    6  
ATOM 8036  H HA2  . GLY A 1 43 ? -4.193  -9.821  9.507   1.00 0.00 ? 43  GLY A HA2  6  
ATOM 8037  H HA3  . GLY A 1 43 ? -3.789  -9.574  7.816   1.00 0.00 ? 43  GLY A HA3  6  
ATOM 8038  N N    . ALA A 1 44 ? -5.999  -8.111  8.991   1.00 0.00 ? 44  ALA A N    6  
ATOM 8039  C CA   . ALA A 1 44 ? -7.214  -7.294  8.900   1.00 0.00 ? 44  ALA A CA   6  
ATOM 8040  C C    . ALA A 1 44 ? -7.600  -6.996  7.448   1.00 0.00 ? 44  ALA A C    6  
ATOM 8041  O O    . ALA A 1 44 ? -8.786  -6.952  7.113   1.00 0.00 ? 44  ALA A O    6  
ATOM 8042  C CB   . ALA A 1 44 ? -7.029  -5.994  9.670   1.00 0.00 ? 44  ALA A CB   6  
ATOM 8043  H H    . ALA A 1 44 ? -5.280  -7.822  9.590   1.00 0.00 ? 44  ALA A H    6  
ATOM 8044  H HA   . ALA A 1 44 ? -8.018  -7.846  9.367   1.00 0.00 ? 44  ALA A HA   6  
ATOM 8045  H HB1  . ALA A 1 44 ? -6.772  -5.202  8.981   1.00 0.00 ? 44  ALA A HB1  6  
ATOM 8046  H HB2  . ALA A 1 44 ? -6.236  -6.112  10.392  1.00 0.00 ? 44  ALA A HB2  6  
ATOM 8047  H HB3  . ALA A 1 44 ? -7.947  -5.743  10.181  1.00 0.00 ? 44  ALA A HB3  6  
ATOM 8048  N N    . ALA A 1 45 ? -6.599  -6.790  6.592   1.00 0.00 ? 45  ALA A N    6  
ATOM 8049  C CA   . ALA A 1 45 ? -6.842  -6.497  5.181   1.00 0.00 ? 45  ALA A CA   6  
ATOM 8050  C C    . ALA A 1 45 ? -7.339  -7.733  4.433   1.00 0.00 ? 45  ALA A C    6  
ATOM 8051  O O    . ALA A 1 45 ? -8.279  -7.652  3.641   1.00 0.00 ? 45  ALA A O    6  
ATOM 8052  C CB   . ALA A 1 45 ? -5.578  -5.958  4.524   1.00 0.00 ? 45  ALA A CB   6  
ATOM 8053  H H    . ALA A 1 45 ? -5.675  -6.836  6.916   1.00 0.00 ? 45  ALA A H    6  
ATOM 8054  H HA   . ALA A 1 45 ? -7.601  -5.729  5.127   1.00 0.00 ? 45  ALA A HA   6  
ATOM 8055  H HB1  . ALA A 1 45 ? -5.386  -4.956  4.878   1.00 0.00 ? 45  ALA A HB1  6  
ATOM 8056  H HB2  . ALA A 1 45 ? -5.707  -5.943  3.452   1.00 0.00 ? 45  ALA A HB2  6  
ATOM 8057  H HB3  . ALA A 1 45 ? -4.742  -6.595  4.776   1.00 0.00 ? 45  ALA A HB3  6  
ATOM 8058  N N    . ASP A 1 46 ? -6.701  -8.876  4.687   1.00 0.00 ? 46  ASP A N    6  
ATOM 8059  C CA   . ASP A 1 46 ? -7.080  -10.127 4.032   1.00 0.00 ? 46  ASP A CA   6  
ATOM 8060  C C    . ASP A 1 46 ? -8.488  -10.564 4.434   1.00 0.00 ? 46  ASP A C    6  
ATOM 8061  O O    . ASP A 1 46 ? -9.248  -11.062 3.603   1.00 0.00 ? 46  ASP A O    6  
ATOM 8062  C CB   . ASP A 1 46 ? -6.077  -11.236 4.364   1.00 0.00 ? 46  ASP A CB   6  
ATOM 8063  C CG   . ASP A 1 46 ? -5.771  -12.113 3.165   1.00 0.00 ? 46  ASP A CG   6  
ATOM 8064  O OD1  . ASP A 1 46 ? -6.681  -12.840 2.713   1.00 0.00 ? 46  ASP A OD1  6  
ATOM 8065  O OD2  . ASP A 1 46 ? -4.622  -12.073 2.680   1.00 0.00 ? 46  ASP A OD2  6  
ATOM 8066  H H    . ASP A 1 46 ? -5.958  -8.877  5.326   1.00 0.00 ? 46  ASP A H    6  
ATOM 8067  H HA   . ASP A 1 46 ? -7.065  -9.954  2.965   1.00 0.00 ? 46  ASP A HA   6  
ATOM 8068  H HB2  . ASP A 1 46 ? -5.155  -10.790 4.705   1.00 0.00 ? 46  ASP A HB2  6  
ATOM 8069  H HB3  . ASP A 1 46 ? -6.484  -11.859 5.148   1.00 0.00 ? 46  ASP A HB3  6  
ATOM 8070  N N    . VAL A 1 47 ? -8.830  -10.375 5.709   1.00 0.00 ? 47  VAL A N    6  
ATOM 8071  C CA   . VAL A 1 47 ? -10.151 -10.752 6.212   1.00 0.00 ? 47  VAL A CA   6  
ATOM 8072  C C    . VAL A 1 47 ? -11.262 -10.042 5.433   1.00 0.00 ? 47  VAL A C    6  
ATOM 8073  O O    . VAL A 1 47 ? -12.299 -10.636 5.140   1.00 0.00 ? 47  VAL A O    6  
ATOM 8074  C CB   . VAL A 1 47 ? -10.307 -10.431 7.717   1.00 0.00 ? 47  VAL A CB   6  
ATOM 8075  C CG1  . VAL A 1 47 ? -11.648 -10.930 8.241   1.00 0.00 ? 47  VAL A CG1  6  
ATOM 8076  C CG2  . VAL A 1 47 ? -9.162  -11.032 8.524   1.00 0.00 ? 47  VAL A CG2  6  
ATOM 8077  H H    . VAL A 1 47 ? -8.179  -9.972  6.325   1.00 0.00 ? 47  VAL A H    6  
ATOM 8078  H HA   . VAL A 1 47 ? -10.263 -11.819 6.079   1.00 0.00 ? 47  VAL A HA   6  
ATOM 8079  H HB   . VAL A 1 47 ? -10.278 -9.358  7.838   1.00 0.00 ? 47  VAL A HB   6  
ATOM 8080  H HG11 . VAL A 1 47 ? -11.510 -11.874 8.747   1.00 0.00 ? 47  VAL A HG11 6  
ATOM 8081  H HG12 . VAL A 1 47 ? -12.334 -11.060 7.417   1.00 0.00 ? 47  VAL A HG12 6  
ATOM 8082  H HG13 . VAL A 1 47 ? -12.053 -10.208 8.934   1.00 0.00 ? 47  VAL A HG13 6  
ATOM 8083  H HG21 . VAL A 1 47 ? -9.545  -11.806 9.173   1.00 0.00 ? 47  VAL A HG21 6  
ATOM 8084  H HG22 . VAL A 1 47 ? -8.700  -10.259 9.120   1.00 0.00 ? 47  VAL A HG22 6  
ATOM 8085  H HG23 . VAL A 1 47 ? -8.428  -11.455 7.854   1.00 0.00 ? 47  VAL A HG23 6  
ATOM 8086  N N    . ASP A 1 48 ? -11.037 -8.771  5.100   1.00 0.00 ? 48  ASP A N    6  
ATOM 8087  C CA   . ASP A 1 48 ? -12.020 -7.989  4.353   1.00 0.00 ? 48  ASP A CA   6  
ATOM 8088  C C    . ASP A 1 48 ? -11.987 -8.341  2.868   1.00 0.00 ? 48  ASP A C    6  
ATOM 8089  O O    . ASP A 1 48 ? -13.026 -8.614  2.264   1.00 0.00 ? 48  ASP A O    6  
ATOM 8090  C CB   . ASP A 1 48 ? -11.764 -6.493  4.545   1.00 0.00 ? 48  ASP A CB   6  
ATOM 8091  C CG   . ASP A 1 48 ? -12.386 -5.966  5.823   1.00 0.00 ? 48  ASP A CG   6  
ATOM 8092  O OD1  . ASP A 1 48 ? -13.587 -5.625  5.802   1.00 0.00 ? 48  ASP A OD1  6  
ATOM 8093  O OD2  . ASP A 1 48 ? -11.672 -5.897  6.845   1.00 0.00 ? 48  ASP A OD2  6  
ATOM 8094  H H    . ASP A 1 48 ? -10.189 -8.349  5.359   1.00 0.00 ? 48  ASP A H    6  
ATOM 8095  H HA   . ASP A 1 48 ? -12.997 -8.230  4.745   1.00 0.00 ? 48  ASP A HA   6  
ATOM 8096  H HB2  . ASP A 1 48 ? -10.700 -6.318  4.584   1.00 0.00 ? 48  ASP A HB2  6  
ATOM 8097  H HB3  . ASP A 1 48 ? -12.185 -5.952  3.710   1.00 0.00 ? 48  ASP A HB3  6  
ATOM 8098  N N    . GLY A 1 49 ? -10.787 -8.342  2.286   1.00 0.00 ? 49  GLY A N    6  
ATOM 8099  C CA   . GLY A 1 49 ? -10.639 -8.673  0.879   1.00 0.00 ? 49  GLY A CA   6  
ATOM 8100  C C    . GLY A 1 49 ? -10.934 -7.504  -0.044  1.00 0.00 ? 49  GLY A C    6  
ATOM 8101  O O    . GLY A 1 49 ? -11.999 -7.451  -0.661  1.00 0.00 ? 49  GLY A O    6  
ATOM 8102  H H    . GLY A 1 49 ? -9.993  -8.122  2.819   1.00 0.00 ? 49  GLY A H    6  
ATOM 8103  H HA2  . GLY A 1 49 ? -9.628  -9.007  0.706   1.00 0.00 ? 49  GLY A HA2  6  
ATOM 8104  H HA3  . GLY A 1 49 ? -11.315 -9.481  0.642   1.00 0.00 ? 49  GLY A HA3  6  
ATOM 8105  N N    . ARG A 1 50 ? -9.986  -6.572  -0.150  1.00 0.00 ? 50  ARG A N    6  
ATOM 8106  C CA   . ARG A 1 50 ? -10.151 -5.405  -1.020  1.00 0.00 ? 50  ARG A CA   6  
ATOM 8107  C C    . ARG A 1 50 ? -8.855  -5.067  -1.770  1.00 0.00 ? 50  ARG A C    6  
ATOM 8108  O O    . ARG A 1 50 ? -8.667  -3.933  -2.216  1.00 0.00 ? 50  ARG A O    6  
ATOM 8109  C CB   . ARG A 1 50 ? -10.622 -4.193  -0.209  1.00 0.00 ? 50  ARG A CB   6  
ATOM 8110  C CG   . ARG A 1 50 ? -12.135 -4.095  -0.084  1.00 0.00 ? 50  ARG A CG   6  
ATOM 8111  C CD   . ARG A 1 50 ? -12.774 -3.590  -1.370  1.00 0.00 ? 50  ARG A CD   6  
ATOM 8112  N NE   . ARG A 1 50 ? -12.854 -2.127  -1.410  1.00 0.00 ? 50  ARG A NE   6  
ATOM 8113  C CZ   . ARG A 1 50 ? -13.784 -1.409  -0.772  1.00 0.00 ? 50  ARG A CZ   6  
ATOM 8114  N NH1  . ARG A 1 50 ? -14.711 -2.009  -0.030  1.00 0.00 ? 50  ARG A NH1  6  
ATOM 8115  N NH2  . ARG A 1 50 ? -13.779 -0.082  -0.870  1.00 0.00 ? 50  ARG A NH2  6  
ATOM 8116  H H    . ARG A 1 50 ? -9.156  -6.675  0.362   1.00 0.00 ? 50  ARG A H    6  
ATOM 8117  H HA   . ARG A 1 50 ? -10.910 -5.648  -1.748  1.00 0.00 ? 50  ARG A HA   6  
ATOM 8118  H HB2  . ARG A 1 50 ? -10.202 -4.253  0.785   1.00 0.00 ? 50  ARG A HB2  6  
ATOM 8119  H HB3  . ARG A 1 50 ? -10.262 -3.293  -0.687  1.00 0.00 ? 50  ARG A HB3  6  
ATOM 8120  H HG2  . ARG A 1 50 ? -12.530 -5.075  0.140   1.00 0.00 ? 50  ARG A HG2  6  
ATOM 8121  H HG3  . ARG A 1 50 ? -12.376 -3.416  0.720   1.00 0.00 ? 50  ARG A HG3  6  
ATOM 8122  H HD2  . ARG A 1 50 ? -12.181 -3.930  -2.208  1.00 0.00 ? 50  ARG A HD2  6  
ATOM 8123  H HD3  . ARG A 1 50 ? -13.769 -4.000  -1.447  1.00 0.00 ? 50  ARG A HD3  6  
ATOM 8124  H HE   . ARG A 1 50 ? -12.182 -1.655  -1.946  1.00 0.00 ? 50  ARG A HE   6  
ATOM 8125  H HH11 . ARG A 1 50 ? -14.723 -3.006  0.050   1.00 0.00 ? 50  ARG A HH11 6  
ATOM 8126  H HH12 . ARG A 1 50 ? -15.402 -1.464  0.447   1.00 0.00 ? 50  ARG A HH12 6  
ATOM 8127  H HH21 . ARG A 1 50 ? -13.085 0.377   -1.427  1.00 0.00 ? 50  ARG A HH21 6  
ATOM 8128  H HH22 . ARG A 1 50 ? -14.472 0.459   -0.391  1.00 0.00 ? 50  ARG A HH22 6  
ATOM 8129  N N    . LEU A 1 51 ? -7.970  -6.060  -1.915  1.00 0.00 ? 51  LEU A N    6  
ATOM 8130  C CA   . LEU A 1 51 ? -6.698  -5.874  -2.618  1.00 0.00 ? 51  LEU A CA   6  
ATOM 8131  C C    . LEU A 1 51 ? -5.948  -7.201  -2.736  1.00 0.00 ? 51  LEU A C    6  
ATOM 8132  O O    . LEU A 1 51 ? -6.134  -8.103  -1.915  1.00 0.00 ? 51  LEU A O    6  
ATOM 8133  C CB   . LEU A 1 51 ? -5.821  -4.842  -1.897  1.00 0.00 ? 51  LEU A CB   6  
ATOM 8134  C CG   . LEU A 1 51 ? -5.409  -5.214  -0.470  1.00 0.00 ? 51  LEU A CG   6  
ATOM 8135  C CD1  . LEU A 1 51 ? -4.062  -5.922  -0.466  1.00 0.00 ? 51  LEU A CD1  6  
ATOM 8136  C CD2  . LEU A 1 51 ? -5.364  -3.974  0.411   1.00 0.00 ? 51  LEU A CD2  6  
ATOM 8137  H H    . LEU A 1 51 ? -8.180  -6.943  -1.546  1.00 0.00 ? 51  LEU A H    6  
ATOM 8138  H HA   . LEU A 1 51 ? -6.920  -5.513  -3.612  1.00 0.00 ? 51  LEU A HA   6  
ATOM 8139  H HB2  . LEU A 1 51 ? -4.924  -4.696  -2.482  1.00 0.00 ? 51  LEU A HB2  6  
ATOM 8140  H HB3  . LEU A 1 51 ? -6.360  -3.908  -1.860  1.00 0.00 ? 51  LEU A HB3  6  
ATOM 8141  H HG   . LEU A 1 51 ? -6.142  -5.891  -0.056  1.00 0.00 ? 51  LEU A HG   6  
ATOM 8142  H HD11 . LEU A 1 51 ? -3.611  -5.832  0.510   1.00 0.00 ? 51  LEU A HD11 6  
ATOM 8143  H HD12 . LEU A 1 51 ? -3.415  -5.472  -1.206  1.00 0.00 ? 51  LEU A HD12 6  
ATOM 8144  H HD13 . LEU A 1 51 ? -4.205  -6.966  -0.701  1.00 0.00 ? 51  LEU A HD13 6  
ATOM 8145  H HD21 . LEU A 1 51 ? -4.798  -4.188  1.305   1.00 0.00 ? 51  LEU A HD21 6  
ATOM 8146  H HD22 . LEU A 1 51 ? -6.369  -3.687  0.681   1.00 0.00 ? 51  LEU A HD22 6  
ATOM 8147  H HD23 . LEU A 1 51 ? -4.892  -3.166  -0.129  1.00 0.00 ? 51  LEU A HD23 6  
ATOM 8148  N N    . ALA A 1 52 ? -5.104  -7.314  -3.762  1.00 0.00 ? 52  ALA A N    6  
ATOM 8149  C CA   . ALA A 1 52 ? -4.329  -8.533  -3.989  1.00 0.00 ? 52  ALA A CA   6  
ATOM 8150  C C    . ALA A 1 52 ? -2.923  -8.216  -4.496  1.00 0.00 ? 52  ALA A C    6  
ATOM 8151  O O    . ALA A 1 52 ? -2.563  -7.049  -4.668  1.00 0.00 ? 52  ALA A O    6  
ATOM 8152  C CB   . ALA A 1 52 ? -5.053  -9.440  -4.974  1.00 0.00 ? 52  ALA A CB   6  
ATOM 8153  H H    . ALA A 1 52 ? -5.000  -6.561  -4.382  1.00 0.00 ? 52  ALA A H    6  
ATOM 8154  H HA   . ALA A 1 52 ? -4.250  -9.057  -3.046  1.00 0.00 ? 52  ALA A HA   6  
ATOM 8155  H HB1  . ALA A 1 52 ? -6.116  -9.262  -4.914  1.00 0.00 ? 52  ALA A HB1  6  
ATOM 8156  H HB2  . ALA A 1 52 ? -4.846  -10.472 -4.730  1.00 0.00 ? 52  ALA A HB2  6  
ATOM 8157  H HB3  . ALA A 1 52 ? -4.708  -9.231  -5.976  1.00 0.00 ? 52  ALA A HB3  6  
ATOM 8158  N N    . ALA A 1 53 ? -2.133  -9.264  -4.735  1.00 0.00 ? 53  ALA A N    6  
ATOM 8159  C CA   . ALA A 1 53 ? -0.768  -9.098  -5.225  1.00 0.00 ? 53  ALA A CA   6  
ATOM 8160  C C    . ALA A 1 53 ? -0.759  -8.501  -6.631  1.00 0.00 ? 53  ALA A C    6  
ATOM 8161  O O    . ALA A 1 53 ? -1.579  -8.866  -7.474  1.00 0.00 ? 53  ALA A O    6  
ATOM 8162  C CB   . ALA A 1 53 ? -0.032  -10.430 -5.213  1.00 0.00 ? 53  ALA A CB   6  
ATOM 8163  H H    . ALA A 1 53 ? -2.478  -10.168 -4.579  1.00 0.00 ? 53  ALA A H    6  
ATOM 8164  H HA   . ALA A 1 53 ? -0.254  -8.424  -4.555  1.00 0.00 ? 53  ALA A HA   6  
ATOM 8165  H HB1  . ALA A 1 53 ? 1.002   -10.265 -4.950  1.00 0.00 ? 53  ALA A HB1  6  
ATOM 8166  H HB2  . ALA A 1 53 ? -0.086  -10.880 -6.194  1.00 0.00 ? 53  ALA A HB2  6  
ATOM 8167  H HB3  . ALA A 1 53 ? -0.488  -11.089 -4.489  1.00 0.00 ? 53  ALA A HB3  6  
ATOM 8168  N N    . GLY A 1 54 ? 0.174   -7.582  -6.874  1.00 0.00 ? 54  GLY A N    6  
ATOM 8169  C CA   . GLY A 1 54 ? 0.272   -6.944  -8.177  1.00 0.00 ? 54  GLY A CA   6  
ATOM 8170  C C    . GLY A 1 54 ? -0.534  -5.657  -8.267  1.00 0.00 ? 54  GLY A C    6  
ATOM 8171  O O    . GLY A 1 54 ? -0.883  -5.216  -9.362  1.00 0.00 ? 54  GLY A O    6  
ATOM 8172  H H    . GLY A 1 54 ? 0.800   -7.332  -6.162  1.00 0.00 ? 54  GLY A H    6  
ATOM 8173  H HA2  . GLY A 1 54 ? 1.310   -6.720  -8.376  1.00 0.00 ? 54  GLY A HA2  6  
ATOM 8174  H HA3  . GLY A 1 54 ? -0.086  -7.632  -8.929  1.00 0.00 ? 54  GLY A HA3  6  
ATOM 8175  N N    . ASP A 1 55 ? -0.823  -5.050  -7.114  1.00 0.00 ? 55  ASP A N    6  
ATOM 8176  C CA   . ASP A 1 55 ? -1.584  -3.804  -7.068  1.00 0.00 ? 55  ASP A CA   6  
ATOM 8177  C C    . ASP A 1 55 ? -0.658  -2.617  -6.794  1.00 0.00 ? 55  ASP A C    6  
ATOM 8178  O O    . ASP A 1 55 ? 0.539   -2.797  -6.568  1.00 0.00 ? 55  ASP A O    6  
ATOM 8179  C CB   . ASP A 1 55 ? -2.670  -3.885  -5.986  1.00 0.00 ? 55  ASP A CB   6  
ATOM 8180  C CG   . ASP A 1 55 ? -4.017  -4.335  -6.529  1.00 0.00 ? 55  ASP A CG   6  
ATOM 8181  O OD1  . ASP A 1 55 ? -4.349  -3.977  -7.680  1.00 0.00 ? 55  ASP A OD1  6  
ATOM 8182  O OD2  . ASP A 1 55 ? -4.743  -5.042  -5.798  1.00 0.00 ? 55  ASP A OD2  6  
ATOM 8183  H H    . ASP A 1 55 ? -0.512  -5.445  -6.274  1.00 0.00 ? 55  ASP A H    6  
ATOM 8184  H HA   . ASP A 1 55 ? -2.054  -3.665  -8.030  1.00 0.00 ? 55  ASP A HA   6  
ATOM 8185  H HB2  . ASP A 1 55 ? -2.361  -4.588  -5.228  1.00 0.00 ? 55  ASP A HB2  6  
ATOM 8186  H HB3  . ASP A 1 55 ? -2.792  -2.911  -5.536  1.00 0.00 ? 55  ASP A HB3  6  
ATOM 8187  N N    . GLN A 1 56 ? -1.220  -1.405  -6.816  1.00 0.00 ? 56  GLN A N    6  
ATOM 8188  C CA   . GLN A 1 56 ? -0.444  -0.187  -6.570  1.00 0.00 ? 56  GLN A CA   6  
ATOM 8189  C C    . GLN A 1 56 ? -1.060  0.638   -5.438  1.00 0.00 ? 56  GLN A C    6  
ATOM 8190  O O    . GLN A 1 56 ? -2.283  0.724   -5.317  1.00 0.00 ? 56  GLN A O    6  
ATOM 8191  C CB   . GLN A 1 56 ? -0.367  0.659   -7.847  1.00 0.00 ? 56  GLN A CB   6  
ATOM 8192  C CG   . GLN A 1 56 ? 0.572   1.854   -7.736  1.00 0.00 ? 56  GLN A CG   6  
ATOM 8193  C CD   . GLN A 1 56 ? -0.124  3.186   -7.963  1.00 0.00 ? 56  GLN A CD   6  
ATOM 8194  O OE1  . GLN A 1 56 ? -1.214  3.247   -8.536  1.00 0.00 ? 56  GLN A OE1  6  
ATOM 8195  N NE2  . GLN A 1 56 ? 0.509   4.264   -7.516  1.00 0.00 ? 56  GLN A NE2  6  
ATOM 8196  H H    . GLN A 1 56 ? -2.179  -1.328  -7.001  1.00 0.00 ? 56  GLN A H    6  
ATOM 8197  H HA   . GLN A 1 56 ? 0.557   -0.483  -6.284  1.00 0.00 ? 56  GLN A HA   6  
ATOM 8198  H HB2  . GLN A 1 56 ? -0.021  0.033   -8.657  1.00 0.00 ? 56  GLN A HB2  6  
ATOM 8199  H HB3  . GLN A 1 56 ? -1.356  1.024   -8.084  1.00 0.00 ? 56  GLN A HB3  6  
ATOM 8200  H HG2  . GLN A 1 56 ? 1.007   1.863   -6.749  1.00 0.00 ? 56  GLN A HG2  6  
ATOM 8201  H HG3  . GLN A 1 56 ? 1.356   1.747   -8.471  1.00 0.00 ? 56  GLN A HG3  6  
ATOM 8202  H HE21 . GLN A 1 56 ? 1.375   4.142   -7.071  1.00 0.00 ? 56  GLN A HE21 6  
ATOM 8203  H HE22 . GLN A 1 56 ? 0.086   5.137   -7.650  1.00 0.00 ? 56  GLN A HE22 6  
ATOM 8204  N N    . LEU A 1 57 ? -0.202  1.244   -4.615  1.00 0.00 ? 57  LEU A N    6  
ATOM 8205  C CA   . LEU A 1 57 ? -0.658  2.064   -3.492  1.00 0.00 ? 57  LEU A CA   6  
ATOM 8206  C C    . LEU A 1 57 ? -0.419  3.552   -3.756  1.00 0.00 ? 57  LEU A C    6  
ATOM 8207  O O    . LEU A 1 57 ? 0.342   3.919   -4.653  1.00 0.00 ? 57  LEU A O    6  
ATOM 8208  C CB   . LEU A 1 57 ? 0.056   1.642   -2.204  1.00 0.00 ? 57  LEU A CB   6  
ATOM 8209  C CG   . LEU A 1 57 ? -0.844  1.532   -0.971  1.00 0.00 ? 57  LEU A CG   6  
ATOM 8210  C CD1  . LEU A 1 57 ? -1.409  0.126   -0.843  1.00 0.00 ? 57  LEU A CD1  6  
ATOM 8211  C CD2  . LEU A 1 57 ? -0.077  1.918   0.284   1.00 0.00 ? 57  LEU A CD2  6  
ATOM 8212  H H    . LEU A 1 57 ? 0.761   1.138   -4.765  1.00 0.00 ? 57  LEU A H    6  
ATOM 8213  H HA   . LEU A 1 57 ? -1.718  1.900   -3.371  1.00 0.00 ? 57  LEU A HA   6  
ATOM 8214  H HB2  . LEU A 1 57 ? 0.519   0.680   -2.373  1.00 0.00 ? 57  LEU A HB2  6  
ATOM 8215  H HB3  . LEU A 1 57 ? 0.833   2.364   -1.993  1.00 0.00 ? 57  LEU A HB3  6  
ATOM 8216  H HG   . LEU A 1 57 ? -1.674  2.215   -1.079  1.00 0.00 ? 57  LEU A HG   6  
ATOM 8217  H HD11 . LEU A 1 57 ? -0.622  -0.553  -0.549  1.00 0.00 ? 57  LEU A HD11 6  
ATOM 8218  H HD12 . LEU A 1 57 ? -1.817  -0.187  -1.793  1.00 0.00 ? 57  LEU A HD12 6  
ATOM 8219  H HD13 . LEU A 1 57 ? -2.189  0.118   -0.096  1.00 0.00 ? 57  LEU A HD13 6  
ATOM 8220  H HD21 . LEU A 1 57 ? -0.499  1.406   1.136   1.00 0.00 ? 57  LEU A HD21 6  
ATOM 8221  H HD22 . LEU A 1 57 ? -0.148  2.986   0.435   1.00 0.00 ? 57  LEU A HD22 6  
ATOM 8222  H HD23 . LEU A 1 57 ? 0.960   1.639   0.174   1.00 0.00 ? 57  LEU A HD23 6  
ATOM 8223  N N    . LEU A 1 58 ? -1.079  4.403   -2.967  1.00 0.00 ? 58  LEU A N    6  
ATOM 8224  C CA   . LEU A 1 58 ? -0.944  5.853   -3.112  1.00 0.00 ? 58  LEU A CA   6  
ATOM 8225  C C    . LEU A 1 58 ? -0.896  6.547   -1.750  1.00 0.00 ? 58  LEU A C    6  
ATOM 8226  O O    . LEU A 1 58 ? 0.041   7.295   -1.461  1.00 0.00 ? 58  LEU A O    6  
ATOM 8227  C CB   . LEU A 1 58 ? -2.109  6.417   -3.936  1.00 0.00 ? 58  LEU A CB   6  
ATOM 8228  C CG   . LEU A 1 58 ? -1.729  6.973   -5.311  1.00 0.00 ? 58  LEU A CG   6  
ATOM 8229  C CD1  . LEU A 1 58 ? -2.973  7.197   -6.157  1.00 0.00 ? 58  LEU A CD1  6  
ATOM 8230  C CD2  . LEU A 1 58 ? -0.942  8.269   -5.168  1.00 0.00 ? 58  LEU A CD2  6  
ATOM 8231  H H    . LEU A 1 58 ? -1.671  4.047   -2.271  1.00 0.00 ? 58  LEU A H    6  
ATOM 8232  H HA   . LEU A 1 58 ? -0.020  6.049   -3.635  1.00 0.00 ? 58  LEU A HA   6  
ATOM 8233  H HB2  . LEU A 1 58 ? -2.835  5.631   -4.076  1.00 0.00 ? 58  LEU A HB2  6  
ATOM 8234  H HB3  . LEU A 1 58 ? -2.571  7.212   -3.368  1.00 0.00 ? 58  LEU A HB3  6  
ATOM 8235  H HG   . LEU A 1 58 ? -1.103  6.255   -5.823  1.00 0.00 ? 58  LEU A HG   6  
ATOM 8236  H HD11 . LEU A 1 58 ? -3.774  6.571   -5.793  1.00 0.00 ? 58  LEU A HD11 6  
ATOM 8237  H HD12 . LEU A 1 58 ? -2.759  6.946   -7.185  1.00 0.00 ? 58  LEU A HD12 6  
ATOM 8238  H HD13 . LEU A 1 58 ? -3.271  8.233   -6.094  1.00 0.00 ? 58  LEU A HD13 6  
ATOM 8239  H HD21 . LEU A 1 58 ? 0.079   8.043   -4.898  1.00 0.00 ? 58  LEU A HD21 6  
ATOM 8240  H HD22 . LEU A 1 58 ? -1.391  8.881   -4.399  1.00 0.00 ? 58  LEU A HD22 6  
ATOM 8241  H HD23 . LEU A 1 58 ? -0.957  8.804   -6.107  1.00 0.00 ? 58  LEU A HD23 6  
ATOM 8242  N N    . SER A 1 59 ? -1.917  6.308   -0.923  1.00 0.00 ? 59  SER A N    6  
ATOM 8243  C CA   . SER A 1 59 ? -1.996  6.924   0.400   1.00 0.00 ? 59  SER A CA   6  
ATOM 8244  C C    . SER A 1 59 ? -2.204  5.881   1.497   1.00 0.00 ? 59  SER A C    6  
ATOM 8245  O O    . SER A 1 59 ? -2.738  4.797   1.248   1.00 0.00 ? 59  SER A O    6  
ATOM 8246  C CB   . SER A 1 59 ? -3.130  7.952   0.436   1.00 0.00 ? 59  SER A CB   6  
ATOM 8247  O OG   . SER A 1 59 ? -2.866  9.032   -0.442  1.00 0.00 ? 59  SER A OG   6  
ATOM 8248  H H    . SER A 1 59 ? -2.637  5.712   -1.215  1.00 0.00 ? 59  SER A H    6  
ATOM 8249  H HA   . SER A 1 59 ? -1.062  7.432   0.582   1.00 0.00 ? 59  SER A HA   6  
ATOM 8250  H HB2  . SER A 1 59 ? -4.054  7.478   0.136   1.00 0.00 ? 59  SER A HB2  6  
ATOM 8251  H HB3  . SER A 1 59 ? -3.232  8.336   1.440   1.00 0.00 ? 59  SER A HB3  6  
ATOM 8252  H HG   . SER A 1 59 ? -3.117  9.857   -0.021  1.00 0.00 ? 59  SER A HG   6  
ATOM 8253  N N    . VAL A 1 60 ? -1.778  6.222   2.716   1.00 0.00 ? 60  VAL A N    6  
ATOM 8254  C CA   . VAL A 1 60 ? -1.913  5.326   3.862   1.00 0.00 ? 60  VAL A CA   6  
ATOM 8255  C C    . VAL A 1 60 ? -2.265  6.104   5.128   1.00 0.00 ? 60  VAL A C    6  
ATOM 8256  O O    . VAL A 1 60 ? -1.422  6.805   5.686   1.00 0.00 ? 60  VAL A O    6  
ATOM 8257  C CB   . VAL A 1 60 ? -0.616  4.530   4.114   1.00 0.00 ? 60  VAL A CB   6  
ATOM 8258  C CG1  . VAL A 1 60 ? -0.834  3.476   5.192   1.00 0.00 ? 60  VAL A CG1  6  
ATOM 8259  C CG2  . VAL A 1 60 ? -0.122  3.891   2.825   1.00 0.00 ? 60  VAL A CG2  6  
ATOM 8260  H H    . VAL A 1 60 ? -1.363  7.101   2.847   1.00 0.00 ? 60  VAL A H    6  
ATOM 8261  H HA   . VAL A 1 60 ? -2.706  4.624   3.647   1.00 0.00 ? 60  VAL A HA   6  
ATOM 8262  H HB   . VAL A 1 60 ? 0.142   5.216   4.463   1.00 0.00 ? 60  VAL A HB   6  
ATOM 8263  H HG11 . VAL A 1 60 ? -1.736  3.703   5.742   1.00 0.00 ? 60  VAL A HG11 6  
ATOM 8264  H HG12 . VAL A 1 60 ? 0.007   3.475   5.869   1.00 0.00 ? 60  VAL A HG12 6  
ATOM 8265  H HG13 . VAL A 1 60 ? -0.927  2.505   4.732   1.00 0.00 ? 60  VAL A HG13 6  
ATOM 8266  H HG21 . VAL A 1 60 ? -0.840  3.157   2.490   1.00 0.00 ? 60  VAL A HG21 6  
ATOM 8267  H HG22 . VAL A 1 60 ? 0.828   3.412   3.002   1.00 0.00 ? 60  VAL A HG22 6  
ATOM 8268  H HG23 . VAL A 1 60 ? -0.006  4.652   2.067   1.00 0.00 ? 60  VAL A HG23 6  
ATOM 8269  N N    . ASP A 1 61 ? -3.513  5.968   5.580   1.00 0.00 ? 61  ASP A N    6  
ATOM 8270  C CA   . ASP A 1 61 ? -3.980  6.653   6.786   1.00 0.00 ? 61  ASP A CA   6  
ATOM 8271  C C    . ASP A 1 61 ? -3.811  8.169   6.657   1.00 0.00 ? 61  ASP A C    6  
ATOM 8272  O O    . ASP A 1 61 ? -3.241  8.821   7.535   1.00 0.00 ? 61  ASP A O    6  
ATOM 8273  C CB   . ASP A 1 61 ? -3.221  6.135   8.014   1.00 0.00 ? 61  ASP A CB   6  
ATOM 8274  C CG   . ASP A 1 61 ? -3.843  4.880   8.595   1.00 0.00 ? 61  ASP A CG   6  
ATOM 8275  O OD1  . ASP A 1 61 ? -3.978  3.883   7.852   1.00 0.00 ? 61  ASP A OD1  6  
ATOM 8276  O OD2  . ASP A 1 61 ? -4.196  4.894   9.791   1.00 0.00 ? 61  ASP A OD2  6  
ATOM 8277  H H    . ASP A 1 61 ? -4.137  5.389   5.091   1.00 0.00 ? 61  ASP A H    6  
ATOM 8278  H HA   . ASP A 1 61 ? -5.030  6.431   6.906   1.00 0.00 ? 61  ASP A HA   6  
ATOM 8279  H HB2  . ASP A 1 61 ? -2.202  5.912   7.733   1.00 0.00 ? 61  ASP A HB2  6  
ATOM 8280  H HB3  . ASP A 1 61 ? -3.218  6.900   8.777   1.00 0.00 ? 61  ASP A HB3  6  
ATOM 8281  N N    . GLY A 1 62 ? -4.304  8.722   5.549   1.00 0.00 ? 62  GLY A N    6  
ATOM 8282  C CA   . GLY A 1 62 ? -4.193  10.152  5.313   1.00 0.00 ? 62  GLY A CA   6  
ATOM 8283  C C    . GLY A 1 62 ? -2.764  10.596  5.033   1.00 0.00 ? 62  GLY A C    6  
ATOM 8284  O O    . GLY A 1 62 ? -2.434  11.772  5.194   1.00 0.00 ? 62  GLY A O    6  
ATOM 8285  H H    . GLY A 1 62 ? -4.742  8.152   4.883   1.00 0.00 ? 62  GLY A H    6  
ATOM 8286  H HA2  . GLY A 1 62 ? -4.809  10.411  4.465   1.00 0.00 ? 62  GLY A HA2  6  
ATOM 8287  H HA3  . GLY A 1 62 ? -4.559  10.679  6.182   1.00 0.00 ? 62  GLY A HA3  6  
ATOM 8288  N N    . ARG A 1 63 ? -1.915  9.656   4.606   1.00 0.00 ? 63  ARG A N    6  
ATOM 8289  C CA   . ARG A 1 63 ? -0.519  9.957   4.296   1.00 0.00 ? 63  ARG A CA   6  
ATOM 8290  C C    . ARG A 1 63 ? -0.256  9.778   2.805   1.00 0.00 ? 63  ARG A C    6  
ATOM 8291  O O    . ARG A 1 63 ? -1.017  9.102   2.112   1.00 0.00 ? 63  ARG A O    6  
ATOM 8292  C CB   . ARG A 1 63 ? 0.423   9.051   5.095   1.00 0.00 ? 63  ARG A CB   6  
ATOM 8293  C CG   . ARG A 1 63 ? 0.193   9.091   6.598   1.00 0.00 ? 63  ARG A CG   6  
ATOM 8294  C CD   . ARG A 1 63 ? 1.063   8.074   7.322   1.00 0.00 ? 63  ARG A CD   6  
ATOM 8295  N NE   . ARG A 1 63 ? 1.631   8.617   8.556   1.00 0.00 ? 63  ARG A NE   6  
ATOM 8296  C CZ   . ARG A 1 63 ? 2.560   9.577   8.593   1.00 0.00 ? 63  ARG A CZ   6  
ATOM 8297  N NH1  . ARG A 1 63 ? 3.029   10.109  7.466   1.00 0.00 ? 63  ARG A NH1  6  
ATOM 8298  N NH2  . ARG A 1 63 ? 3.020   10.007  9.764   1.00 0.00 ? 63  ARG A NH2  6  
ATOM 8299  H H    . ARG A 1 63 ? -2.236  8.738   4.491   1.00 0.00 ? 63  ARG A H    6  
ATOM 8300  H HA   . ARG A 1 63 ? -0.332  10.986  4.564   1.00 0.00 ? 63  ARG A HA   6  
ATOM 8301  H HB2  . ARG A 1 63 ? 0.292   8.033   4.760   1.00 0.00 ? 63  ARG A HB2  6  
ATOM 8302  H HB3  . ARG A 1 63 ? 1.441   9.354   4.901   1.00 0.00 ? 63  ARG A HB3  6  
ATOM 8303  H HG2  . ARG A 1 63 ? 0.431   10.078  6.963   1.00 0.00 ? 63  ARG A HG2  6  
ATOM 8304  H HG3  . ARG A 1 63 ? -0.845  8.871   6.800   1.00 0.00 ? 63  ARG A HG3  6  
ATOM 8305  H HD2  . ARG A 1 63 ? 0.459   7.211   7.564   1.00 0.00 ? 63  ARG A HD2  6  
ATOM 8306  H HD3  . ARG A 1 63 ? 1.869   7.775   6.667   1.00 0.00 ? 63  ARG A HD3  6  
ATOM 8307  H HE   . ARG A 1 63 ? 1.302   8.247   9.403   1.00 0.00 ? 63  ARG A HE   6  
ATOM 8308  H HH11 . ARG A 1 63 ? 2.688   9.791   6.581   1.00 0.00 ? 63  ARG A HH11 6  
ATOM 8309  H HH12 . ARG A 1 63 ? 3.723   10.829  7.502   1.00 0.00 ? 63  ARG A HH12 6  
ATOM 8310  H HH21 . ARG A 1 63 ? 2.672   9.613   10.614  1.00 0.00 ? 63  ARG A HH21 6  
ATOM 8311  H HH22 . ARG A 1 63 ? 3.715   10.727  9.795   1.00 0.00 ? 63  ARG A HH22 6  
ATOM 8312  N N    . SER A 1 64 ? 0.826   10.380  2.318   1.00 0.00 ? 64  SER A N    6  
ATOM 8313  C CA   . SER A 1 64 ? 1.186   10.280  0.907   1.00 0.00 ? 64  SER A CA   6  
ATOM 8314  C C    . SER A 1 64 ? 2.497   9.521   0.729   1.00 0.00 ? 64  SER A C    6  
ATOM 8315  O O    . SER A 1 64 ? 3.567   10.018  1.088   1.00 0.00 ? 64  SER A O    6  
ATOM 8316  C CB   . SER A 1 64 ? 1.304   11.675  0.284   1.00 0.00 ? 64  SER A CB   6  
ATOM 8317  O OG   . SER A 1 64 ? 0.246   12.518  0.708   1.00 0.00 ? 64  SER A OG   6  
ATOM 8318  H H    . SER A 1 64 ? 1.396   10.902  2.920   1.00 0.00 ? 64  SER A H    6  
ATOM 8319  H HA   . SER A 1 64 ? 0.401   9.737   0.403   1.00 0.00 ? 64  SER A HA   6  
ATOM 8320  H HB2  . SER A 1 64 ? 2.242   12.121  0.579   1.00 0.00 ? 64  SER A HB2  6  
ATOM 8321  H HB3  . SER A 1 64 ? 1.269   11.588  -0.792  1.00 0.00 ? 64  SER A HB3  6  
ATOM 8322  H HG   . SER A 1 64 ? 0.597   13.381  0.940   1.00 0.00 ? 64  SER A HG   6  
ATOM 8323  N N    . LEU A 1 65 ? 2.411   8.319   0.161   1.00 0.00 ? 65  LEU A N    6  
ATOM 8324  C CA   . LEU A 1 65 ? 3.597   7.499   -0.077  1.00 0.00 ? 65  LEU A CA   6  
ATOM 8325  C C    . LEU A 1 65 ? 4.100   7.677   -1.510  1.00 0.00 ? 65  LEU A C    6  
ATOM 8326  O O    . LEU A 1 65 ? 4.454   6.704   -2.182  1.00 0.00 ? 65  LEU A O    6  
ATOM 8327  C CB   . LEU A 1 65 ? 3.294   6.022   0.197   1.00 0.00 ? 65  LEU A CB   6  
ATOM 8328  C CG   . LEU A 1 65 ? 3.203   5.635   1.676   1.00 0.00 ? 65  LEU A CG   6  
ATOM 8329  C CD1  . LEU A 1 65 ? 3.002   4.136   1.815   1.00 0.00 ? 65  LEU A CD1  6  
ATOM 8330  C CD2  . LEU A 1 65 ? 4.450   6.081   2.430   1.00 0.00 ? 65  LEU A CD2  6  
ATOM 8331  H H    . LEU A 1 65 ? 1.532   7.979   -0.112  1.00 0.00 ? 65  LEU A H    6  
ATOM 8332  H HA   . LEU A 1 65 ? 4.368   7.830   0.604   1.00 0.00 ? 65  LEU A HA   6  
ATOM 8333  H HB2  . LEU A 1 65 ? 2.356   5.774   -0.276  1.00 0.00 ? 65  LEU A HB2  6  
ATOM 8334  H HB3  . LEU A 1 65 ? 4.073   5.428   -0.258  1.00 0.00 ? 65  LEU A HB3  6  
ATOM 8335  H HG   . LEU A 1 65 ? 2.349   6.129   2.117   1.00 0.00 ? 65  LEU A HG   6  
ATOM 8336  H HD11 . LEU A 1 65 ? 3.878   3.619   1.451   1.00 0.00 ? 65  LEU A HD11 6  
ATOM 8337  H HD12 . LEU A 1 65 ? 2.141   3.834   1.238   1.00 0.00 ? 65  LEU A HD12 6  
ATOM 8338  H HD13 . LEU A 1 65 ? 2.844   3.889   2.854   1.00 0.00 ? 65  LEU A HD13 6  
ATOM 8339  H HD21 . LEU A 1 65 ? 4.353   7.121   2.702   1.00 0.00 ? 65  LEU A HD21 6  
ATOM 8340  H HD22 . LEU A 1 65 ? 5.319   5.953   1.800   1.00 0.00 ? 65  LEU A HD22 6  
ATOM 8341  H HD23 . LEU A 1 65 ? 4.562   5.485   3.323   1.00 0.00 ? 65  LEU A HD23 6  
ATOM 8342  N N    . VAL A 1 66 ? 4.132   8.927   -1.972  1.00 0.00 ? 66  VAL A N    6  
ATOM 8343  C CA   . VAL A 1 66 ? 4.593   9.238   -3.318  1.00 0.00 ? 66  VAL A CA   6  
ATOM 8344  C C    . VAL A 1 66 ? 5.981   9.865   -3.277  1.00 0.00 ? 66  VAL A C    6  
ATOM 8345  O O    . VAL A 1 66 ? 6.136   11.057  -2.995  1.00 0.00 ? 66  VAL A O    6  
ATOM 8346  C CB   . VAL A 1 66 ? 3.609   10.177  -4.046  1.00 0.00 ? 66  VAL A CB   6  
ATOM 8347  C CG1  . VAL A 1 66 ? 4.190   10.662  -5.367  1.00 0.00 ? 66  VAL A CG1  6  
ATOM 8348  C CG2  . VAL A 1 66 ? 2.285   9.466   -4.269  1.00 0.00 ? 66  VAL A CG2  6  
ATOM 8349  H H    . VAL A 1 66 ? 3.841   9.660   -1.390  1.00 0.00 ? 66  VAL A H    6  
ATOM 8350  H HA   . VAL A 1 66 ? 4.647   8.311   -3.871  1.00 0.00 ? 66  VAL A HA   6  
ATOM 8351  H HB   . VAL A 1 66 ? 3.429   11.037  -3.418  1.00 0.00 ? 66  VAL A HB   6  
ATOM 8352  H HG11 . VAL A 1 66 ? 5.061   11.271  -5.175  1.00 0.00 ? 66  VAL A HG11 6  
ATOM 8353  H HG12 . VAL A 1 66 ? 3.449   11.248  -5.891  1.00 0.00 ? 66  VAL A HG12 6  
ATOM 8354  H HG13 . VAL A 1 66 ? 4.470   9.813   -5.972  1.00 0.00 ? 66  VAL A HG13 6  
ATOM 8355  H HG21 . VAL A 1 66 ? 1.833   9.823   -5.182  1.00 0.00 ? 66  VAL A HG21 6  
ATOM 8356  H HG22 . VAL A 1 66 ? 1.625   9.663   -3.437  1.00 0.00 ? 66  VAL A HG22 6  
ATOM 8357  H HG23 . VAL A 1 66 ? 2.460   8.402   -4.346  1.00 0.00 ? 66  VAL A HG23 6  
ATOM 8358  N N    . GLY A 1 67 ? 6.986   9.043   -3.552  1.00 0.00 ? 67  GLY A N    6  
ATOM 8359  C CA   . GLY A 1 67 ? 8.364   9.505   -3.540  1.00 0.00 ? 67  GLY A CA   6  
ATOM 8360  C C    . GLY A 1 67 ? 9.118   9.058   -2.298  1.00 0.00 ? 67  GLY A C    6  
ATOM 8361  O O    . GLY A 1 67 ? 10.026  9.750   -1.835  1.00 0.00 ? 67  GLY A O    6  
ATOM 8362  H H    . GLY A 1 67 ? 6.787   8.106   -3.762  1.00 0.00 ? 67  GLY A H    6  
ATOM 8363  H HA2  . GLY A 1 67 ? 8.870   9.119   -4.411  1.00 0.00 ? 67  GLY A HA2  6  
ATOM 8364  H HA3  . GLY A 1 67 ? 8.372   10.585  -3.581  1.00 0.00 ? 67  GLY A HA3  6  
ATOM 8365  N N    . LEU A 1 68 ? 8.740   7.897   -1.758  1.00 0.00 ? 68  LEU A N    6  
ATOM 8366  C CA   . LEU A 1 68 ? 9.383   7.356   -0.566  1.00 0.00 ? 68  LEU A CA   6  
ATOM 8367  C C    . LEU A 1 68 ? 9.962   5.971   -0.840  1.00 0.00 ? 68  LEU A C    6  
ATOM 8368  O O    . LEU A 1 68 ? 9.534   5.280   -1.767  1.00 0.00 ? 68  LEU A O    6  
ATOM 8369  C CB   . LEU A 1 68 ? 8.381   7.279   0.590   1.00 0.00 ? 68  LEU A CB   6  
ATOM 8370  C CG   . LEU A 1 68 ? 8.038   8.617   1.249   1.00 0.00 ? 68  LEU A CG   6  
ATOM 8371  C CD1  . LEU A 1 68 ? 7.015   8.416   2.357   1.00 0.00 ? 68  LEU A CD1  6  
ATOM 8372  C CD2  . LEU A 1 68 ? 9.294   9.284   1.793   1.00 0.00 ? 68  LEU A CD2  6  
ATOM 8373  H H    . LEU A 1 68 ? 8.012   7.391   -2.174  1.00 0.00 ? 68  LEU A H    6  
ATOM 8374  H HA   . LEU A 1 68 ? 10.187  8.022   -0.291  1.00 0.00 ? 68  LEU A HA   6  
ATOM 8375  H HB2  . LEU A 1 68 ? 7.467   6.841   0.215   1.00 0.00 ? 68  LEU A HB2  6  
ATOM 8376  H HB3  . LEU A 1 68 ? 8.789   6.626   1.347   1.00 0.00 ? 68  LEU A HB3  6  
ATOM 8377  H HG   . LEU A 1 68 ? 7.603   9.273   0.508   1.00 0.00 ? 68  LEU A HG   6  
ATOM 8378  H HD11 . LEU A 1 68 ? 6.027   8.346   1.926   1.00 0.00 ? 68  LEU A HD11 6  
ATOM 8379  H HD12 . LEU A 1 68 ? 7.052   9.253   3.038   1.00 0.00 ? 68  LEU A HD12 6  
ATOM 8380  H HD13 . LEU A 1 68 ? 7.240   7.506   2.893   1.00 0.00 ? 68  LEU A HD13 6  
ATOM 8381  H HD21 . LEU A 1 68 ? 9.787   9.824   0.998   1.00 0.00 ? 68  LEU A HD21 6  
ATOM 8382  H HD22 . LEU A 1 68 ? 9.962   8.529   2.184   1.00 0.00 ? 68  LEU A HD22 6  
ATOM 8383  H HD23 . LEU A 1 68 ? 9.024   9.971   2.581   1.00 0.00 ? 68  LEU A HD23 6  
ATOM 8384  N N    . SER A 1 69 ? 10.933  5.572   -0.022  1.00 0.00 ? 69  SER A N    6  
ATOM 8385  C CA   . SER A 1 69 ? 11.570  4.268   -0.166  1.00 0.00 ? 69  SER A CA   6  
ATOM 8386  C C    . SER A 1 69 ? 10.702  3.172   0.446   1.00 0.00 ? 69  SER A C    6  
ATOM 8387  O O    . SER A 1 69 ? 9.812   3.452   1.252   1.00 0.00 ? 69  SER A O    6  
ATOM 8388  C CB   . SER A 1 69 ? 12.950  4.274   0.499   1.00 0.00 ? 69  SER A CB   6  
ATOM 8389  O OG   . SER A 1 69 ? 12.845  4.505   1.895   1.00 0.00 ? 69  SER A OG   6  
ATOM 8390  H H    . SER A 1 69 ? 11.225  6.167   0.701   1.00 0.00 ? 69  SER A H    6  
ATOM 8391  H HA   . SER A 1 69 ? 11.688  4.070   -1.221  1.00 0.00 ? 69  SER A HA   6  
ATOM 8392  H HB2  . SER A 1 69 ? 13.429  3.319   0.341   1.00 0.00 ? 69  SER A HB2  6  
ATOM 8393  H HB3  . SER A 1 69 ? 13.554  5.055   0.062   1.00 0.00 ? 69  SER A HB3  6  
ATOM 8394  H HG   . SER A 1 69 ? 13.611  4.998   2.197   1.00 0.00 ? 69  SER A HG   6  
ATOM 8395  N N    . GLN A 1 70 ? 10.973  1.924   0.068   1.00 0.00 ? 70  GLN A N    6  
ATOM 8396  C CA   . GLN A 1 70 ? 10.221  0.783   0.589   1.00 0.00 ? 70  GLN A CA   6  
ATOM 8397  C C    . GLN A 1 70 ? 10.235  0.777   2.119   1.00 0.00 ? 70  GLN A C    6  
ATOM 8398  O O    . GLN A 1 70 ? 9.244   0.413   2.753   1.00 0.00 ? 70  GLN A O    6  
ATOM 8399  C CB   . GLN A 1 70 ? 10.804  -0.528  0.058   1.00 0.00 ? 70  GLN A CB   6  
ATOM 8400  C CG   . GLN A 1 70 ? 9.995   -1.754  0.449   1.00 0.00 ? 70  GLN A CG   6  
ATOM 8401  C CD   . GLN A 1 70 ? 9.639   -2.619  -0.740  1.00 0.00 ? 70  GLN A CD   6  
ATOM 8402  O OE1  . GLN A 1 70 ? 8.899   -2.199  -1.627  1.00 0.00 ? 70  GLN A OE1  6  
ATOM 8403  N NE2  . GLN A 1 70 ? 10.162  -3.837  -0.760  1.00 0.00 ? 70  GLN A NE2  6  
ATOM 8404  H H    . GLN A 1 70 ? 11.699  1.766   -0.572  1.00 0.00 ? 70  GLN A H    6  
ATOM 8405  H HA   . GLN A 1 70 ? 9.199   0.877   0.251   1.00 0.00 ? 70  GLN A HA   6  
ATOM 8406  H HB2  . GLN A 1 70 ? 10.848  -0.479  -1.019  1.00 0.00 ? 70  GLN A HB2  6  
ATOM 8407  H HB3  . GLN A 1 70 ? 11.806  -0.646  0.445   1.00 0.00 ? 70  GLN A HB3  6  
ATOM 8408  H HG2  . GLN A 1 70 ? 10.574  -2.346  1.139   1.00 0.00 ? 70  GLN A HG2  6  
ATOM 8409  H HG3  . GLN A 1 70 ? 9.084   -1.432  0.930   1.00 0.00 ? 70  GLN A HG3  6  
ATOM 8410  H HE21 . GLN A 1 70 ? 10.742  -4.107  -0.017  1.00 0.00 ? 70  GLN A HE21 6  
ATOM 8411  H HE22 . GLN A 1 70 ? 9.947   -4.418  -1.519  1.00 0.00 ? 70  GLN A HE22 6  
ATOM 8412  N N    . GLU A 1 71 ? 11.366  1.184   2.700   1.00 0.00 ? 71  GLU A N    6  
ATOM 8413  C CA   . GLU A 1 71 ? 11.515  1.229   4.151   1.00 0.00 ? 71  GLU A CA   6  
ATOM 8414  C C    . GLU A 1 71 ? 10.547  2.234   4.772   1.00 0.00 ? 71  GLU A C    6  
ATOM 8415  O O    . GLU A 1 71 ? 9.707   1.867   5.594   1.00 0.00 ? 71  GLU A O    6  
ATOM 8416  C CB   . GLU A 1 71 ? 12.956  1.592   4.527   1.00 0.00 ? 71  GLU A CB   6  
ATOM 8417  C CG   . GLU A 1 71 ? 13.604  0.605   5.486   1.00 0.00 ? 71  GLU A CG   6  
ATOM 8418  C CD   . GLU A 1 71 ? 14.659  1.246   6.368   1.00 0.00 ? 71  GLU A CD   6  
ATOM 8419  O OE1  . GLU A 1 71 ? 14.355  2.271   7.017   1.00 0.00 ? 71  GLU A OE1  6  
ATOM 8420  O OE2  . GLU A 1 71 ? 15.791  0.720   6.413   1.00 0.00 ? 71  GLU A OE2  6  
ATOM 8421  H H    . GLU A 1 71 ? 12.119  1.460   2.136   1.00 0.00 ? 71  GLU A H    6  
ATOM 8422  H HA   . GLU A 1 71 ? 11.288  0.247   4.536   1.00 0.00 ? 71  GLU A HA   6  
ATOM 8423  H HB2  . GLU A 1 71 ? 13.552  1.631   3.627   1.00 0.00 ? 71  GLU A HB2  6  
ATOM 8424  H HB3  . GLU A 1 71 ? 12.959  2.568   4.991   1.00 0.00 ? 71  GLU A HB3  6  
ATOM 8425  H HG2  . GLU A 1 71 ? 12.838  0.182   6.118   1.00 0.00 ? 71  GLU A HG2  6  
ATOM 8426  H HG3  . GLU A 1 71 ? 14.068  -0.182  4.910   1.00 0.00 ? 71  GLU A HG3  6  
ATOM 8427  N N    . ARG A 1 72 ? 10.665  3.501   4.371   1.00 0.00 ? 72  ARG A N    6  
ATOM 8428  C CA   . ARG A 1 72 ? 9.794   4.555   4.892   1.00 0.00 ? 72  ARG A CA   6  
ATOM 8429  C C    . ARG A 1 72 ? 8.326   4.255   4.590   1.00 0.00 ? 72  ARG A C    6  
ATOM 8430  O O    . ARG A 1 72 ? 7.448   4.543   5.403   1.00 0.00 ? 72  ARG A O    6  
ATOM 8431  C CB   . ARG A 1 72 ? 10.179  5.917   4.303   1.00 0.00 ? 72  ARG A CB   6  
ATOM 8432  C CG   . ARG A 1 72 ? 11.613  6.336   4.597   1.00 0.00 ? 72  ARG A CG   6  
ATOM 8433  C CD   . ARG A 1 72 ? 11.727  7.057   5.932   1.00 0.00 ? 72  ARG A CD   6  
ATOM 8434  N NE   . ARG A 1 72 ? 11.143  8.400   5.888   1.00 0.00 ? 72  ARG A NE   6  
ATOM 8435  C CZ   . ARG A 1 72 ? 11.404  9.357   6.784   1.00 0.00 ? 72  ARG A CZ   6  
ATOM 8436  N NH1  . ARG A 1 72 ? 12.239  9.125   7.791   1.00 0.00 ? 72  ARG A NH1  6  
ATOM 8437  N NH2  . ARG A 1 72 ? 10.824  10.548  6.675   1.00 0.00 ? 72  ARG A NH2  6  
ATOM 8438  H H    . ARG A 1 72 ? 11.351  3.732   3.709   1.00 0.00 ? 72  ARG A H    6  
ATOM 8439  H HA   . ARG A 1 72 ? 9.925   4.587   5.965   1.00 0.00 ? 72  ARG A HA   6  
ATOM 8440  H HB2  . ARG A 1 72 ? 10.051  5.882   3.232   1.00 0.00 ? 72  ARG A HB2  6  
ATOM 8441  H HB3  . ARG A 1 72 ? 9.518   6.668   4.710   1.00 0.00 ? 72  ARG A HB3  6  
ATOM 8442  H HG2  . ARG A 1 72 ? 12.239  5.455   4.622   1.00 0.00 ? 72  ARG A HG2  6  
ATOM 8443  H HG3  . ARG A 1 72 ? 11.951  6.997   3.812   1.00 0.00 ? 72  ARG A HG3  6  
ATOM 8444  H HD2  . ARG A 1 72 ? 11.214  6.477   6.685   1.00 0.00 ? 72  ARG A HD2  6  
ATOM 8445  H HD3  . ARG A 1 72 ? 12.774  7.137   6.192   1.00 0.00 ? 72  ARG A HD3  6  
ATOM 8446  H HE   . ARG A 1 72 ? 10.524  8.600   5.154   1.00 0.00 ? 72  ARG A HE   6  
ATOM 8447  H HH11 . ARG A 1 72 ? 12.680  8.232   7.884   1.00 0.00 ? 72  ARG A HH11 6  
ATOM 8448  H HH12 . ARG A 1 72 ? 12.432  9.847   8.456   1.00 0.00 ? 72  ARG A HH12 6  
ATOM 8449  H HH21 . ARG A 1 72 ? 10.192  10.731  5.922   1.00 0.00 ? 72  ARG A HH21 6  
ATOM 8450  H HH22 . ARG A 1 72 ? 11.021  11.264  7.346   1.00 0.00 ? 72  ARG A HH22 6  
ATOM 8451  N N    . ALA A 1 73 ? 8.066   3.676   3.416   1.00 0.00 ? 73  ALA A N    6  
ATOM 8452  C CA   . ALA A 1 73 ? 6.704   3.341   3.009   1.00 0.00 ? 73  ALA A CA   6  
ATOM 8453  C C    . ALA A 1 73 ? 6.099   2.265   3.910   1.00 0.00 ? 73  ALA A C    6  
ATOM 8454  O O    . ALA A 1 73 ? 5.096   2.507   4.585   1.00 0.00 ? 73  ALA A O    6  
ATOM 8455  C CB   . ALA A 1 73 ? 6.680   2.889   1.556   1.00 0.00 ? 73  ALA A CB   6  
ATOM 8456  H H    . ALA A 1 73 ? 8.809   3.471   2.808   1.00 0.00 ? 73  ALA A H    6  
ATOM 8457  H HA   . ALA A 1 73 ? 6.108   4.238   3.091   1.00 0.00 ? 73  ALA A HA   6  
ATOM 8458  H HB1  . ALA A 1 73 ? 6.593   3.751   0.911   1.00 0.00 ? 73  ALA A HB1  6  
ATOM 8459  H HB2  . ALA A 1 73 ? 5.835   2.234   1.397   1.00 0.00 ? 73  ALA A HB2  6  
ATOM 8460  H HB3  . ALA A 1 73 ? 7.592   2.359   1.327   1.00 0.00 ? 73  ALA A HB3  6  
ATOM 8461  N N    . ALA A 1 74 ? 6.714   1.078   3.918   1.00 0.00 ? 74  ALA A N    6  
ATOM 8462  C CA   . ALA A 1 74 ? 6.227   -0.032  4.738   1.00 0.00 ? 74  ALA A CA   6  
ATOM 8463  C C    . ALA A 1 74 ? 6.136   0.361   6.211   1.00 0.00 ? 74  ALA A C    6  
ATOM 8464  O O    . ALA A 1 74 ? 5.125   0.105   6.865   1.00 0.00 ? 74  ALA A O    6  
ATOM 8465  C CB   . ALA A 1 74 ? 7.117   -1.258  4.572   1.00 0.00 ? 74  ALA A CB   6  
ATOM 8466  H H    . ALA A 1 74 ? 7.513   0.948   3.360   1.00 0.00 ? 74  ALA A H    6  
ATOM 8467  H HA   . ALA A 1 74 ? 5.237   -0.288  4.389   1.00 0.00 ? 74  ALA A HA   6  
ATOM 8468  H HB1  . ALA A 1 74 ? 7.767   -1.121  3.721   1.00 0.00 ? 74  ALA A HB1  6  
ATOM 8469  H HB2  . ALA A 1 74 ? 6.500   -2.131  4.416   1.00 0.00 ? 74  ALA A HB2  6  
ATOM 8470  H HB3  . ALA A 1 74 ? 7.713   -1.395  5.463   1.00 0.00 ? 74  ALA A HB3  6  
ATOM 8471  N N    . GLU A 1 75 ? 7.195   0.989   6.726   1.00 0.00 ? 75  GLU A N    6  
ATOM 8472  C CA   . GLU A 1 75 ? 7.223   1.419   8.119   1.00 0.00 ? 75  GLU A CA   6  
ATOM 8473  C C    . GLU A 1 75 ? 6.039   2.331   8.433   1.00 0.00 ? 75  GLU A C    6  
ATOM 8474  O O    . GLU A 1 75 ? 5.272   2.059   9.354   1.00 0.00 ? 75  GLU A O    6  
ATOM 8475  C CB   . GLU A 1 75 ? 8.536   2.138   8.438   1.00 0.00 ? 75  GLU A CB   6  
ATOM 8476  C CG   . GLU A 1 75 ? 8.958   2.010   9.892   1.00 0.00 ? 75  GLU A CG   6  
ATOM 8477  C CD   . GLU A 1 75 ? 9.873   0.825   10.134  1.00 0.00 ? 75  GLU A CD   6  
ATOM 8478  O OE1  . GLU A 1 75 ? 9.413   -0.325  9.968   1.00 0.00 ? 75  GLU A OE1  6  
ATOM 8479  O OE2  . GLU A 1 75 ? 11.049  1.047   10.491  1.00 0.00 ? 75  GLU A OE2  6  
ATOM 8480  H H    . GLU A 1 75 ? 7.972   1.168   6.154   1.00 0.00 ? 75  GLU A H    6  
ATOM 8481  H HA   . GLU A 1 75 ? 7.150   0.534   8.735   1.00 0.00 ? 75  GLU A HA   6  
ATOM 8482  H HB2  . GLU A 1 75 ? 9.320   1.725   7.820   1.00 0.00 ? 75  GLU A HB2  6  
ATOM 8483  H HB3  . GLU A 1 75 ? 8.425   3.187   8.209   1.00 0.00 ? 75  GLU A HB3  6  
ATOM 8484  H HG2  . GLU A 1 75 ? 9.475   2.911   10.183  1.00 0.00 ? 75  GLU A HG2  6  
ATOM 8485  H HG3  . GLU A 1 75 ? 8.073   1.891   10.500  1.00 0.00 ? 75  GLU A HG3  6  
ATOM 8486  N N    . LEU A 1 76 ? 5.891   3.407   7.655   1.00 0.00 ? 76  LEU A N    6  
ATOM 8487  C CA   . LEU A 1 76 ? 4.790   4.353   7.852   1.00 0.00 ? 76  LEU A CA   6  
ATOM 8488  C C    . LEU A 1 76 ? 3.435   3.638   7.854   1.00 0.00 ? 76  LEU A C    6  
ATOM 8489  O O    . LEU A 1 76 ? 2.512   4.050   8.558   1.00 0.00 ? 76  LEU A O    6  
ATOM 8490  C CB   . LEU A 1 76 ? 4.807   5.432   6.762   1.00 0.00 ? 76  LEU A CB   6  
ATOM 8491  C CG   . LEU A 1 76 ? 5.704   6.642   7.051   1.00 0.00 ? 76  LEU A CG   6  
ATOM 8492  C CD1  . LEU A 1 76 ? 5.930   7.457   5.784   1.00 0.00 ? 76  LEU A CD1  6  
ATOM 8493  C CD2  . LEU A 1 76 ? 5.093   7.510   8.142   1.00 0.00 ? 76  LEU A CD2  6  
ATOM 8494  H H    . LEU A 1 76 ? 6.533   3.564   6.928   1.00 0.00 ? 76  LEU A H    6  
ATOM 8495  H HA   . LEU A 1 76 ? 4.932   4.824   8.813   1.00 0.00 ? 76  LEU A HA   6  
ATOM 8496  H HB2  . LEU A 1 76 ? 5.139   4.977   5.840   1.00 0.00 ? 76  LEU A HB2  6  
ATOM 8497  H HB3  . LEU A 1 76 ? 3.797   5.788   6.623   1.00 0.00 ? 76  LEU A HB3  6  
ATOM 8498  H HG   . LEU A 1 76 ? 6.666   6.294   7.399   1.00 0.00 ? 76  LEU A HG   6  
ATOM 8499  H HD11 . LEU A 1 76 ? 4.997   7.901   5.467   1.00 0.00 ? 76  LEU A HD11 6  
ATOM 8500  H HD12 . LEU A 1 76 ? 6.304   6.812   5.003   1.00 0.00 ? 76  LEU A HD12 6  
ATOM 8501  H HD13 . LEU A 1 76 ? 6.650   8.237   5.981   1.00 0.00 ? 76  LEU A HD13 6  
ATOM 8502  H HD21 . LEU A 1 76 ? 5.876   7.884   8.785   1.00 0.00 ? 76  LEU A HD21 6  
ATOM 8503  H HD22 . LEU A 1 76 ? 4.400   6.921   8.725   1.00 0.00 ? 76  LEU A HD22 6  
ATOM 8504  H HD23 . LEU A 1 76 ? 4.570   8.339   7.691   1.00 0.00 ? 76  LEU A HD23 6  
ATOM 8505  N N    . MET A 1 77 ? 3.320   2.573   7.060   1.00 0.00 ? 77  MET A N    6  
ATOM 8506  C CA   . MET A 1 77 ? 2.077   1.811   6.970   1.00 0.00 ? 77  MET A CA   6  
ATOM 8507  C C    . MET A 1 77 ? 1.855   0.936   8.204   1.00 0.00 ? 77  MET A C    6  
ATOM 8508  O O    . MET A 1 77 ? 0.786   0.978   8.811   1.00 0.00 ? 77  MET A O    6  
ATOM 8509  C CB   . MET A 1 77 ? 2.083   0.942   5.713   1.00 0.00 ? 77  MET A CB   6  
ATOM 8510  C CG   . MET A 1 77 ? 1.937   1.734   4.424   1.00 0.00 ? 77  MET A CG   6  
ATOM 8511  S SD   . MET A 1 77 ? 2.966   1.091   3.092   1.00 0.00 ? 77  MET A SD   6  
ATOM 8512  C CE   . MET A 1 77 ? 2.320   -0.571  2.945   1.00 0.00 ? 77  MET A CE   6  
ATOM 8513  H H    . MET A 1 77 ? 4.086   2.297   6.515   1.00 0.00 ? 77  MET A H    6  
ATOM 8514  H HA   . MET A 1 77 ? 1.264   2.519   6.901   1.00 0.00 ? 77  MET A HA   6  
ATOM 8515  H HB2  . MET A 1 77 ? 3.014   0.396   5.671   1.00 0.00 ? 77  MET A HB2  6  
ATOM 8516  H HB3  . MET A 1 77 ? 1.266   0.239   5.773   1.00 0.00 ? 77  MET A HB3  6  
ATOM 8517  H HG2  . MET A 1 77 ? 0.907   1.694   4.114   1.00 0.00 ? 77  MET A HG2  6  
ATOM 8518  H HG3  . MET A 1 77 ? 2.216   2.761   4.612   1.00 0.00 ? 77  MET A HG3  6  
ATOM 8519  H HE1  . MET A 1 77 ? 2.753   -1.194  3.712   1.00 0.00 ? 77  MET A HE1  6  
ATOM 8520  H HE2  . MET A 1 77 ? 2.570   -0.970  1.972   1.00 0.00 ? 77  MET A HE2  6  
ATOM 8521  H HE3  . MET A 1 77 ? 1.246   -0.549  3.061   1.00 0.00 ? 77  MET A HE3  6  
ATOM 8522  N N    . THR A 1 78 ? 2.860   0.140   8.571   1.00 0.00 ? 78  THR A N    6  
ATOM 8523  C CA   . THR A 1 78 ? 2.745   -0.740  9.736   1.00 0.00 ? 78  THR A CA   6  
ATOM 8524  C C    . THR A 1 78 ? 2.565   0.068   11.023  1.00 0.00 ? 78  THR A C    6  
ATOM 8525  O O    . THR A 1 78 ? 1.872   -0.368  11.945  1.00 0.00 ? 78  THR A O    6  
ATOM 8526  C CB   . THR A 1 78 ? 3.967   -1.664  9.848   1.00 0.00 ? 78  THR A CB   6  
ATOM 8527  O OG1  . THR A 1 78 ? 3.855   -2.511  10.978  1.00 0.00 ? 78  THR A OG1  6  
ATOM 8528  C CG2  . THR A 1 78 ? 5.289   -0.931  9.954   1.00 0.00 ? 78  THR A CG2  6  
ATOM 8529  H H    . THR A 1 78 ? 3.691   0.141   8.048   1.00 0.00 ? 78  THR A H    6  
ATOM 8530  H HA   . THR A 1 78 ? 1.865   -1.349  9.593   1.00 0.00 ? 78  THR A HA   6  
ATOM 8531  H HB   . THR A 1 78 ? 4.007   -2.283  8.968   1.00 0.00 ? 78  THR A HB   6  
ATOM 8532  H HG1  . THR A 1 78 ? 3.080   -3.073  10.884  1.00 0.00 ? 78  THR A HG1  6  
ATOM 8533  H HG21 . THR A 1 78 ? 5.666   -0.725  8.964   1.00 0.00 ? 78  THR A HG21 6  
ATOM 8534  H HG22 . THR A 1 78 ? 6.000   -1.546  10.487  1.00 0.00 ? 78  THR A HG22 6  
ATOM 8535  H HG23 . THR A 1 78 ? 5.147   -0.003  10.486  1.00 0.00 ? 78  THR A HG23 6  
ATOM 8536  N N    . ARG A 1 79 ? 3.189   1.246   11.078  1.00 0.00 ? 79  ARG A N    6  
ATOM 8537  C CA   . ARG A 1 79 ? 3.098   2.115   12.253  1.00 0.00 ? 79  ARG A CA   6  
ATOM 8538  C C    . ARG A 1 79 ? 1.834   2.990   12.222  1.00 0.00 ? 79  ARG A C    6  
ATOM 8539  O O    . ARG A 1 79 ? 1.903   4.198   12.462  1.00 0.00 ? 79  ARG A O    6  
ATOM 8540  C CB   . ARG A 1 79 ? 4.353   2.994   12.365  1.00 0.00 ? 79  ARG A CB   6  
ATOM 8541  C CG   . ARG A 1 79 ? 4.516   3.997   11.231  1.00 0.00 ? 79  ARG A CG   6  
ATOM 8542  C CD   . ARG A 1 79 ? 4.624   5.421   11.750  1.00 0.00 ? 79  ARG A CD   6  
ATOM 8543  N NE   . ARG A 1 79 ? 5.982   5.743   12.184  1.00 0.00 ? 79  ARG A NE   6  
ATOM 8544  C CZ   . ARG A 1 79 ? 6.446   6.987   12.322  1.00 0.00 ? 79  ARG A CZ   6  
ATOM 8545  N NH1  . ARG A 1 79 ? 5.657   8.030   12.076  1.00 0.00 ? 79  ARG A NH1  6  
ATOM 8546  N NH2  . ARG A 1 79 ? 7.701   7.191   12.707  1.00 0.00 ? 79  ARG A NH2  6  
ATOM 8547  H H    . ARG A 1 79 ? 3.724   1.536   10.309  1.00 0.00 ? 79  ARG A H    6  
ATOM 8548  H HA   . ARG A 1 79 ? 3.050   1.478   13.123  1.00 0.00 ? 79  ARG A HA   6  
ATOM 8549  H HB2  . ARG A 1 79 ? 4.310   3.542   13.294  1.00 0.00 ? 79  ARG A HB2  6  
ATOM 8550  H HB3  . ARG A 1 79 ? 5.223   2.355   12.377  1.00 0.00 ? 79  ARG A HB3  6  
ATOM 8551  H HG2  . ARG A 1 79 ? 5.414   3.759   10.681  1.00 0.00 ? 79  ARG A HG2  6  
ATOM 8552  H HG3  . ARG A 1 79 ? 3.662   3.926   10.575  1.00 0.00 ? 79  ARG A HG3  6  
ATOM 8553  H HD2  . ARG A 1 79 ? 4.339   6.100   10.960  1.00 0.00 ? 79  ARG A HD2  6  
ATOM 8554  H HD3  . ARG A 1 79 ? 3.950   5.540   12.586  1.00 0.00 ? 79  ARG A HD3  6  
ATOM 8555  H HE   . ARG A 1 79 ? 6.581   4.990   12.382  1.00 0.00 ? 79  ARG A HE   6  
ATOM 8556  H HH11 . ARG A 1 79 ? 4.710   7.886   11.790  1.00 0.00 ? 79  ARG A HH11 6  
ATOM 8557  H HH12 . ARG A 1 79 ? 6.011   8.960   12.180  1.00 0.00 ? 79  ARG A HH12 6  
ATOM 8558  H HH21 . ARG A 1 79 ? 8.299   6.412   12.898  1.00 0.00 ? 79  ARG A HH21 6  
ATOM 8559  H HH22 . ARG A 1 79 ? 8.049   8.124   12.809  1.00 0.00 ? 79  ARG A HH22 6  
ATOM 8560  N N    . THR A 1 80 ? 0.680   2.378   11.935  1.00 0.00 ? 80  THR A N    6  
ATOM 8561  C CA   . THR A 1 80 ? -0.587  3.113   11.887  1.00 0.00 ? 80  THR A CA   6  
ATOM 8562  C C    . THR A 1 80 ? -1.367  2.958   13.195  1.00 0.00 ? 80  THR A C    6  
ATOM 8563  O O    . THR A 1 80 ? -0.921  2.275   14.121  1.00 0.00 ? 80  THR A O    6  
ATOM 8564  C CB   . THR A 1 80 ? -1.448  2.640   10.709  1.00 0.00 ? 80  THR A CB   6  
ATOM 8565  O OG1  . THR A 1 80 ? -1.345  1.237   10.531  1.00 0.00 ? 80  THR A OG1  6  
ATOM 8566  C CG2  . THR A 1 80 ? -1.082  3.305   9.401   1.00 0.00 ? 80  THR A CG2  6  
ATOM 8567  H H    . THR A 1 80 ? 0.679   1.414   11.758  1.00 0.00 ? 80  THR A H    6  
ATOM 8568  H HA   . THR A 1 80 ? -0.352  4.157   11.749  1.00 0.00 ? 80  THR A HA   6  
ATOM 8569  H HB   . THR A 1 80 ? -2.482  2.877   10.918  1.00 0.00 ? 80  THR A HB   6  
ATOM 8570  H HG1  . THR A 1 80 ? -2.003  0.944   9.892   1.00 0.00 ? 80  THR A HG1  6  
ATOM 8571  H HG21 . THR A 1 80 ? -0.064  3.058   9.145   1.00 0.00 ? 80  THR A HG21 6  
ATOM 8572  H HG22 . THR A 1 80 ? -1.176  4.377   9.505   1.00 0.00 ? 80  THR A HG22 6  
ATOM 8573  H HG23 . THR A 1 80 ? -1.746  2.961   8.621   1.00 0.00 ? 80  THR A HG23 6  
ATOM 8574  N N    . SER A 1 81 ? -2.537  3.598   13.262  1.00 0.00 ? 81  SER A N    6  
ATOM 8575  C CA   . SER A 1 81 ? -3.389  3.537   14.450  1.00 0.00 ? 81  SER A CA   6  
ATOM 8576  C C    . SER A 1 81 ? -4.429  2.420   14.315  1.00 0.00 ? 81  SER A C    6  
ATOM 8577  O O    . SER A 1 81 ? -4.311  1.557   13.443  1.00 0.00 ? 81  SER A O    6  
ATOM 8578  C CB   . SER A 1 81 ? -4.083  4.888   14.669  1.00 0.00 ? 81  SER A CB   6  
ATOM 8579  O OG   . SER A 1 81 ? -3.164  5.962   14.551  1.00 0.00 ? 81  SER A OG   6  
ATOM 8580  H H    . SER A 1 81 ? -2.838  4.124   12.490  1.00 0.00 ? 81  SER A H    6  
ATOM 8581  H HA   . SER A 1 81 ? -2.758  3.325   15.301  1.00 0.00 ? 81  SER A HA   6  
ATOM 8582  H HB2  . SER A 1 81 ? -4.863  5.014   13.932  1.00 0.00 ? 81  SER A HB2  6  
ATOM 8583  H HB3  . SER A 1 81 ? -4.518  4.912   15.659  1.00 0.00 ? 81  SER A HB3  6  
ATOM 8584  H HG   . SER A 1 81 ? -3.632  6.758   14.288  1.00 0.00 ? 81  SER A HG   6  
ATOM 8585  N N    . SER A 1 82 ? -5.449  2.441   15.180  1.00 0.00 ? 82  SER A N    6  
ATOM 8586  C CA   . SER A 1 82 ? -6.508  1.430   15.147  1.00 0.00 ? 82  SER A CA   6  
ATOM 8587  C C    . SER A 1 82 ? -7.162  1.369   13.766  1.00 0.00 ? 82  SER A C    6  
ATOM 8588  O O    . SER A 1 82 ? -7.400  0.286   13.231  1.00 0.00 ? 82  SER A O    6  
ATOM 8589  C CB   . SER A 1 82 ? -7.570  1.728   16.212  1.00 0.00 ? 82  SER A CB   6  
ATOM 8590  O OG   . SER A 1 82 ? -8.250  0.546   16.603  1.00 0.00 ? 82  SER A OG   6  
ATOM 8591  H H    . SER A 1 82 ? -5.491  3.153   15.852  1.00 0.00 ? 82  SER A H    6  
ATOM 8592  H HA   . SER A 1 82 ? -6.057  0.472   15.361  1.00 0.00 ? 82  SER A HA   6  
ATOM 8593  H HB2  . SER A 1 82 ? -7.096  2.157   17.081  1.00 0.00 ? 82  SER A HB2  6  
ATOM 8594  H HB3  . SER A 1 82 ? -8.290  2.427   15.813  1.00 0.00 ? 82  SER A HB3  6  
ATOM 8595  H HG   . SER A 1 82 ? -8.914  0.760   17.263  1.00 0.00 ? 82  SER A HG   6  
ATOM 8596  N N    . VAL A 1 83 ? -7.446  2.539   13.191  1.00 0.00 ? 83  VAL A N    6  
ATOM 8597  C CA   . VAL A 1 83 ? -8.066  2.612   11.870  1.00 0.00 ? 83  VAL A CA   6  
ATOM 8598  C C    . VAL A 1 83 ? -7.013  2.510   10.769  1.00 0.00 ? 83  VAL A C    6  
ATOM 8599  O O    . VAL A 1 83 ? -5.893  2.992   10.925  1.00 0.00 ? 83  VAL A O    6  
ATOM 8600  C CB   . VAL A 1 83 ? -8.860  3.925   11.683  1.00 0.00 ? 83  VAL A CB   6  
ATOM 8601  C CG1  . VAL A 1 83 ? -9.658  3.894   10.385  1.00 0.00 ? 83  VAL A CG1  6  
ATOM 8602  C CG2  . VAL A 1 83 ? -9.777  4.175   12.872  1.00 0.00 ? 83  VAL A CG2  6  
ATOM 8603  H H    . VAL A 1 83 ? -7.230  3.370   13.664  1.00 0.00 ? 83  VAL A H    6  
ATOM 8604  H HA   . VAL A 1 83 ? -8.752  1.782   11.778  1.00 0.00 ? 83  VAL A HA   6  
ATOM 8605  H HB   . VAL A 1 83 ? -8.156  4.742   11.623  1.00 0.00 ? 83  VAL A HB   6  
ATOM 8606  H HG11 . VAL A 1 83 ? -9.975  2.882   10.181  1.00 0.00 ? 83  VAL A HG11 6  
ATOM 8607  H HG12 . VAL A 1 83 ? -9.038  4.247   9.573   1.00 0.00 ? 83  VAL A HG12 6  
ATOM 8608  H HG13 . VAL A 1 83 ? -10.525 4.531   10.479  1.00 0.00 ? 83  VAL A HG13 6  
ATOM 8609  H HG21 . VAL A 1 83 ? -10.112 3.231   13.275  1.00 0.00 ? 83  VAL A HG21 6  
ATOM 8610  H HG22 . VAL A 1 83 ? -10.632 4.752   12.552  1.00 0.00 ? 83  VAL A HG22 6  
ATOM 8611  H HG23 . VAL A 1 83 ? -9.239  4.722   13.632  1.00 0.00 ? 83  VAL A HG23 6  
ATOM 8612  N N    . VAL A 1 84 ? -7.385  1.883   9.655   1.00 0.00 ? 84  VAL A N    6  
ATOM 8613  C CA   . VAL A 1 84 ? -6.479  1.726   8.523   1.00 0.00 ? 84  VAL A CA   6  
ATOM 8614  C C    . VAL A 1 84 ? -7.142  2.206   7.237   1.00 0.00 ? 84  VAL A C    6  
ATOM 8615  O O    . VAL A 1 84 ? -8.246  1.775   6.905   1.00 0.00 ? 84  VAL A O    6  
ATOM 8616  C CB   . VAL A 1 84 ? -6.032  0.260   8.343   1.00 0.00 ? 84  VAL A CB   6  
ATOM 8617  C CG1  . VAL A 1 84 ? -4.952  0.160   7.275   1.00 0.00 ? 84  VAL A CG1  6  
ATOM 8618  C CG2  . VAL A 1 84 ? -5.542  -0.320  9.662   1.00 0.00 ? 84  VAL A CG2  6  
ATOM 8619  H H    . VAL A 1 84 ? -8.296  1.521   9.592   1.00 0.00 ? 84  VAL A H    6  
ATOM 8620  H HA   . VAL A 1 84 ? -5.603  2.329   8.715   1.00 0.00 ? 84  VAL A HA   6  
ATOM 8621  H HB   . VAL A 1 84 ? -6.885  -0.318  8.015   1.00 0.00 ? 84  VAL A HB   6  
ATOM 8622  H HG11 . VAL A 1 84 ? -5.375  0.404   6.311   1.00 0.00 ? 84  VAL A HG11 6  
ATOM 8623  H HG12 . VAL A 1 84 ? -4.559  -0.845  7.252   1.00 0.00 ? 84  VAL A HG12 6  
ATOM 8624  H HG13 . VAL A 1 84 ? -4.155  0.853   7.503   1.00 0.00 ? 84  VAL A HG13 6  
ATOM 8625  H HG21 . VAL A 1 84 ? -6.247  -0.083  10.445  1.00 0.00 ? 84  VAL A HG21 6  
ATOM 8626  H HG22 . VAL A 1 84 ? -4.578  0.102   9.905   1.00 0.00 ? 84  VAL A HG22 6  
ATOM 8627  H HG23 . VAL A 1 84 ? -5.453  -1.392  9.572   1.00 0.00 ? 84  VAL A HG23 6  
ATOM 8628  N N    . THR A 1 85 ? -6.465  3.105   6.526   1.00 0.00 ? 85  THR A N    6  
ATOM 8629  C CA   . THR A 1 85 ? -6.990  3.652   5.278   1.00 0.00 ? 85  THR A CA   6  
ATOM 8630  C C    . THR A 1 85 ? -5.946  3.557   4.162   1.00 0.00 ? 85  THR A C    6  
ATOM 8631  O O    . THR A 1 85 ? -5.219  4.515   3.895   1.00 0.00 ? 85  THR A O    6  
ATOM 8632  C CB   . THR A 1 85 ? -7.432  5.109   5.482   1.00 0.00 ? 85  THR A CB   6  
ATOM 8633  O OG1  . THR A 1 85 ? -7.697  5.372   6.851   1.00 0.00 ? 85  THR A OG1  6  
ATOM 8634  C CG2  . THR A 1 85 ? -8.679  5.471   4.702   1.00 0.00 ? 85  THR A CG2  6  
ATOM 8635  H H    . THR A 1 85 ? -5.592  3.412   6.852   1.00 0.00 ? 85  THR A H    6  
ATOM 8636  H HA   . THR A 1 85 ? -7.850  3.061   4.997   1.00 0.00 ? 85  THR A HA   6  
ATOM 8637  H HB   . THR A 1 85 ? -6.637  5.767   5.157   1.00 0.00 ? 85  THR A HB   6  
ATOM 8638  H HG1  . THR A 1 85 ? -6.873  5.545   7.311   1.00 0.00 ? 85  THR A HG1  6  
ATOM 8639  H HG21 . THR A 1 85 ? -9.278  6.160   5.279   1.00 0.00 ? 85  THR A HG21 6  
ATOM 8640  H HG22 . THR A 1 85 ? -9.252  4.578   4.502   1.00 0.00 ? 85  THR A HG22 6  
ATOM 8641  H HG23 . THR A 1 85 ? -8.398  5.935   3.767   1.00 0.00 ? 85  THR A HG23 6  
ATOM 8642  N N    . LEU A 1 86 ? -5.873  2.387   3.523   1.00 0.00 ? 86  LEU A N    6  
ATOM 8643  C CA   . LEU A 1 86 ? -4.911  2.155   2.443   1.00 0.00 ? 86  LEU A CA   6  
ATOM 8644  C C    . LEU A 1 86 ? -5.527  2.439   1.074   1.00 0.00 ? 86  LEU A C    6  
ATOM 8645  O O    . LEU A 1 86 ? -6.491  1.786   0.670   1.00 0.00 ? 86  LEU A O    6  
ATOM 8646  C CB   . LEU A 1 86 ? -4.401  0.711   2.487   1.00 0.00 ? 86  LEU A CB   6  
ATOM 8647  C CG   . LEU A 1 86 ? -3.650  0.324   3.762   1.00 0.00 ? 86  LEU A CG   6  
ATOM 8648  C CD1  . LEU A 1 86 ? -3.863  -1.148  4.081   1.00 0.00 ? 86  LEU A CD1  6  
ATOM 8649  C CD2  . LEU A 1 86 ? -2.167  0.638   3.623   1.00 0.00 ? 86  LEU A CD2  6  
ATOM 8650  H H    . LEU A 1 86 ? -6.474  1.659   3.790   1.00 0.00 ? 86  LEU A H    6  
ATOM 8651  H HA   . LEU A 1 86 ? -4.077  2.824   2.595   1.00 0.00 ? 86  LEU A HA   6  
ATOM 8652  H HB2  . LEU A 1 86 ? -5.249  0.049   2.378   1.00 0.00 ? 86  LEU A HB2  6  
ATOM 8653  H HB3  . LEU A 1 86 ? -3.740  0.561   1.646   1.00 0.00 ? 86  LEU A HB3  6  
ATOM 8654  H HG   . LEU A 1 86 ? -4.038  0.902   4.588   1.00 0.00 ? 86  LEU A HG   6  
ATOM 8655  H HD11 . LEU A 1 86 ? -3.037  -1.726  3.693   1.00 0.00 ? 86  LEU A HD11 6  
ATOM 8656  H HD12 . LEU A 1 86 ? -4.783  -1.486  3.627   1.00 0.00 ? 86  LEU A HD12 6  
ATOM 8657  H HD13 . LEU A 1 86 ? -3.921  -1.280  5.151   1.00 0.00 ? 86  LEU A HD13 6  
ATOM 8658  H HD21 . LEU A 1 86 ? -1.684  0.532   4.584   1.00 0.00 ? 86  LEU A HD21 6  
ATOM 8659  H HD22 . LEU A 1 86 ? -2.045  1.652   3.270   1.00 0.00 ? 86  LEU A HD22 6  
ATOM 8660  H HD23 . LEU A 1 86 ? -1.718  -0.044  2.917   1.00 0.00 ? 86  LEU A HD23 6  
ATOM 8661  N N    . GLU A 1 87 ? -4.950  3.408   0.359   1.00 0.00 ? 87  GLU A N    6  
ATOM 8662  C CA   . GLU A 1 87 ? -5.427  3.775   -0.974  1.00 0.00 ? 87  GLU A CA   6  
ATOM 8663  C C    . GLU A 1 87 ? -4.780  2.889   -2.038  1.00 0.00 ? 87  GLU A C    6  
ATOM 8664  O O    . GLU A 1 87 ? -3.566  2.946   -2.250  1.00 0.00 ? 87  GLU A O    6  
ATOM 8665  C CB   . GLU A 1 87 ? -5.123  5.251   -1.265  1.00 0.00 ? 87  GLU A CB   6  
ATOM 8666  C CG   . GLU A 1 87 ? -6.349  6.066   -1.655  1.00 0.00 ? 87  GLU A CG   6  
ATOM 8667  C CD   . GLU A 1 87 ? -6.558  7.283   -0.769  1.00 0.00 ? 87  GLU A CD   6  
ATOM 8668  O OE1  . GLU A 1 87 ? -6.440  7.150   0.469   1.00 0.00 ? 87  GLU A OE1  6  
ATOM 8669  O OE2  . GLU A 1 87 ? -6.841  8.371   -1.314  1.00 0.00 ? 87  GLU A OE2  6  
ATOM 8670  H H    . GLU A 1 87 ? -4.178  3.882   0.736   1.00 0.00 ? 87  GLU A H    6  
ATOM 8671  H HA   . GLU A 1 87 ? -6.496  3.624   -0.998  1.00 0.00 ? 87  GLU A HA   6  
ATOM 8672  H HB2  . GLU A 1 87 ? -4.687  5.695   -0.383  1.00 0.00 ? 87  GLU A HB2  6  
ATOM 8673  H HB3  . GLU A 1 87 ? -4.409  5.307   -2.074  1.00 0.00 ? 87  GLU A HB3  6  
ATOM 8674  H HG2  . GLU A 1 87 ? -6.228  6.405   -2.673  1.00 0.00 ? 87  GLU A HG2  6  
ATOM 8675  H HG3  . GLU A 1 87 ? -7.223  5.436   -1.589  1.00 0.00 ? 87  GLU A HG3  6  
ATOM 8676  N N    . VAL A 1 88 ? -5.594  2.067   -2.696  1.00 0.00 ? 88  VAL A N    6  
ATOM 8677  C CA   . VAL A 1 88 ? -5.103  1.161   -3.731  1.00 0.00 ? 88  VAL A CA   6  
ATOM 8678  C C    . VAL A 1 88 ? -5.668  1.522   -5.109  1.00 0.00 ? 88  VAL A C    6  
ATOM 8679  O O    . VAL A 1 88 ? -6.774  2.055   -5.218  1.00 0.00 ? 88  VAL A O    6  
ATOM 8680  C CB   . VAL A 1 88 ? -5.460  -0.306  -3.394  1.00 0.00 ? 88  VAL A CB   6  
ATOM 8681  C CG1  . VAL A 1 88 ? -6.967  -0.517  -3.407  1.00 0.00 ? 88  VAL A CG1  6  
ATOM 8682  C CG2  . VAL A 1 88 ? -4.772  -1.266  -4.355  1.00 0.00 ? 88  VAL A CG2  6  
ATOM 8683  H H    . VAL A 1 88 ? -6.551  2.066   -2.477  1.00 0.00 ? 88  VAL A H    6  
ATOM 8684  H HA   . VAL A 1 88 ? -4.026  1.248   -3.763  1.00 0.00 ? 88  VAL A HA   6  
ATOM 8685  H HB   . VAL A 1 88 ? -5.102  -0.518  -2.396  1.00 0.00 ? 88  VAL A HB   6  
ATOM 8686  H HG11 . VAL A 1 88 ? -7.453  0.330   -2.946  1.00 0.00 ? 88  VAL A HG11 6  
ATOM 8687  H HG12 . VAL A 1 88 ? -7.211  -1.415  -2.859  1.00 0.00 ? 88  VAL A HG12 6  
ATOM 8688  H HG13 . VAL A 1 88 ? -7.307  -0.614  -4.427  1.00 0.00 ? 88  VAL A HG13 6  
ATOM 8689  H HG21 . VAL A 1 88 ? -4.905  -2.280  -4.008  1.00 0.00 ? 88  VAL A HG21 6  
ATOM 8690  H HG22 . VAL A 1 88 ? -3.718  -1.037  -4.402  1.00 0.00 ? 88  VAL A HG22 6  
ATOM 8691  H HG23 . VAL A 1 88 ? -5.207  -1.163  -5.339  1.00 0.00 ? 88  VAL A HG23 6  
ATOM 8692  N N    . ALA A 1 89 ? -4.898  1.225   -6.157  1.00 0.00 ? 89  ALA A N    6  
ATOM 8693  C CA   . ALA A 1 89 ? -5.311  1.512   -7.530  1.00 0.00 ? 89  ALA A CA   6  
ATOM 8694  C C    . ALA A 1 89 ? -5.717  0.235   -8.265  1.00 0.00 ? 89  ALA A C    6  
ATOM 8695  O O    . ALA A 1 89 ? -5.346  -0.870  -7.860  1.00 0.00 ? 89  ALA A O    6  
ATOM 8696  C CB   . ALA A 1 89 ? -4.190  2.215   -8.282  1.00 0.00 ? 89  ALA A CB   6  
ATOM 8697  H H    . ALA A 1 89 ? -4.026  0.799   -6.003  1.00 0.00 ? 89  ALA A H    6  
ATOM 8698  H HA   . ALA A 1 89 ? -6.160  2.179   -7.491  1.00 0.00 ? 89  ALA A HA   6  
ATOM 8699  H HB1  . ALA A 1 89 ? -3.468  1.485   -8.620  1.00 0.00 ? 89  ALA A HB1  6  
ATOM 8700  H HB2  . ALA A 1 89 ? -3.705  2.924   -7.627  1.00 0.00 ? 89  ALA A HB2  6  
ATOM 8701  H HB3  . ALA A 1 89 ? -4.600  2.736   -9.134  1.00 0.00 ? 89  ALA A HB3  6  
ATOM 8702  N N    . LYS A 1 90 ? -6.477  0.395   -9.349  1.00 0.00 ? 90  LYS A N    6  
ATOM 8703  C CA   . LYS A 1 90 ? -6.933  -0.740  -10.148 1.00 0.00 ? 90  LYS A CA   6  
ATOM 8704  C C    . LYS A 1 90 ? -6.314  -0.703  -11.544 1.00 0.00 ? 90  LYS A C    6  
ATOM 8705  O O    . LYS A 1 90 ? -6.729  0.085   -12.397 1.00 0.00 ? 90  LYS A O    6  
ATOM 8706  C CB   . LYS A 1 90 ? -8.461  -0.739  -10.251 1.00 0.00 ? 90  LYS A CB   6  
ATOM 8707  C CG   . LYS A 1 90 ? -9.157  -0.959  -8.918  1.00 0.00 ? 90  LYS A CG   6  
ATOM 8708  C CD   . LYS A 1 90 ? -9.084  -2.416  -8.484  1.00 0.00 ? 90  LYS A CD   6  
ATOM 8709  C CE   . LYS A 1 90 ? -8.915  -2.543  -6.977  1.00 0.00 ? 90  LYS A CE   6  
ATOM 8710  N NZ   . LYS A 1 90 ? -8.031  -3.685  -6.607  1.00 0.00 ? 90  LYS A NZ   6  
ATOM 8711  H H    . LYS A 1 90 ? -6.736  1.301   -9.620  1.00 0.00 ? 90  LYS A H    6  
ATOM 8712  H HA   . LYS A 1 90 ? -6.615  -1.645  -9.651  1.00 0.00 ? 90  LYS A HA   6  
ATOM 8713  H HB2  . LYS A 1 90 ? -8.784  0.213   -10.649 1.00 0.00 ? 90  LYS A HB2  6  
ATOM 8714  H HB3  . LYS A 1 90 ? -8.765  -1.524  -10.926 1.00 0.00 ? 90  LYS A HB3  6  
ATOM 8715  H HG2  . LYS A 1 90 ? -8.680  -0.345  -8.169  1.00 0.00 ? 90  LYS A HG2  6  
ATOM 8716  H HG3  . LYS A 1 90 ? -10.193 -0.672  -9.013  1.00 0.00 ? 90  LYS A HG3  6  
ATOM 8717  H HD2  . LYS A 1 90 ? -9.997  -2.914  -8.776  1.00 0.00 ? 90  LYS A HD2  6  
ATOM 8718  H HD3  . LYS A 1 90 ? -8.244  -2.885  -8.973  1.00 0.00 ? 90  LYS A HD3  6  
ATOM 8719  H HE2  . LYS A 1 90 ? -8.483  -1.629  -6.596  1.00 0.00 ? 90  LYS A HE2  6  
ATOM 8720  H HE3  . LYS A 1 90 ? -9.888  -2.693  -6.531  1.00 0.00 ? 90  LYS A HE3  6  
ATOM 8721  H HZ1  . LYS A 1 90 ? -8.393  -4.568  -7.022  1.00 0.00 ? 90  LYS A HZ1  6  
ATOM 8722  H HZ2  . LYS A 1 90 ? -7.996  -3.790  -5.573  1.00 0.00 ? 90  LYS A HZ2  6  
ATOM 8723  H HZ3  . LYS A 1 90 ? -7.065  -3.520  -6.959  1.00 0.00 ? 90  LYS A HZ3  6  
ATOM 8724  N N    . GLN A 1 91 ? -5.318  -1.559  -11.765 1.00 0.00 ? 91  GLN A N    6  
ATOM 8725  C CA   . GLN A 1 91 ? -4.631  -1.630  -13.051 1.00 0.00 ? 91  GLN A CA   6  
ATOM 8726  C C    . GLN A 1 91 ? -5.400  -2.502  -14.042 1.00 0.00 ? 91  GLN A C    6  
ATOM 8727  O O    . GLN A 1 91 ? -6.439  -3.076  -13.708 1.00 0.00 ? 91  GLN A O    6  
ATOM 8728  C CB   . GLN A 1 91 ? -3.214  -2.186  -12.864 1.00 0.00 ? 91  GLN A CB   6  
ATOM 8729  C CG   . GLN A 1 91 ? -2.298  -1.267  -12.070 1.00 0.00 ? 91  GLN A CG   6  
ATOM 8730  C CD   . GLN A 1 91 ? -1.136  -2.007  -11.433 1.00 0.00 ? 91  GLN A CD   6  
ATOM 8731  O OE1  . GLN A 1 91 ? -0.297  -2.584  -12.126 1.00 0.00 ? 91  GLN A OE1  6  
ATOM 8732  N NE2  . GLN A 1 91 ? -1.081  -1.998  -10.105 1.00 0.00 ? 91  GLN A NE2  6  
ATOM 8733  H H    . GLN A 1 91 ? -5.034  -2.157  -11.044 1.00 0.00 ? 91  GLN A H    6  
ATOM 8734  H HA   . GLN A 1 91 ? -4.565  -0.628  -13.448 1.00 0.00 ? 91  GLN A HA   6  
ATOM 8735  H HB2  . GLN A 1 91 ? -3.275  -3.133  -12.346 1.00 0.00 ? 91  GLN A HB2  6  
ATOM 8736  H HB3  . GLN A 1 91 ? -2.771  -2.348  -13.836 1.00 0.00 ? 91  GLN A HB3  6  
ATOM 8737  H HG2  . GLN A 1 91 ? -1.902  -0.512  -12.734 1.00 0.00 ? 91  GLN A HG2  6  
ATOM 8738  H HG3  . GLN A 1 91 ? -2.874  -0.791  -11.291 1.00 0.00 ? 91  GLN A HG3  6  
ATOM 8739  H HE21 . GLN A 1 91 ? -1.782  -1.521  -9.614  1.00 0.00 ? 91  GLN A HE21 6  
ATOM 8740  H HE22 . GLN A 1 91 ? -0.339  -2.468  -9.670  1.00 0.00 ? 91  GLN A HE22 6  
ATOM 8741  N N    . GLY A 1 92 ? -4.877  -2.593  -15.265 1.00 0.00 ? 92  GLY A N    6  
ATOM 8742  C CA   . GLY A 1 92 ? -5.515  -3.395  -16.298 1.00 0.00 ? 92  GLY A CA   6  
ATOM 8743  C C    . GLY A 1 92 ? -5.015  -4.822  -16.361 1.00 0.00 ? 92  GLY A C    6  
ATOM 8744  O O    . GLY A 1 92 ? -5.479  -5.621  -17.175 1.00 0.00 ? 92  GLY A O    6  
ATOM 8745  H H    . GLY A 1 92 ? -4.049  -2.111  -15.467 1.00 0.00 ? 92  GLY A H    6  
ATOM 8746  H HA2  . GLY A 1 92 ? -6.566  -3.417  -16.107 1.00 0.00 ? 92  GLY A HA2  6  
ATOM 8747  H HA3  . GLY A 1 92 ? -5.335  -2.931  -17.244 1.00 0.00 ? 92  GLY A HA3  6  
ATOM 8748  N N    . ALA A 1 93 ? -4.078  -5.125  -15.497 1.00 0.00 ? 93  ALA A N    6  
ATOM 8749  C CA   . ALA A 1 93 ? -3.485  -6.458  -15.413 1.00 0.00 ? 93  ALA A CA   6  
ATOM 8750  C C    . ALA A 1 93 ? -3.597  -7.033  -13.998 1.00 0.00 ? 93  ALA A C    6  
ATOM 8751  O O    . ALA A 1 93 ? -4.284  -6.415  -13.155 1.00 0.00 ? 93  ALA A O    6  
ATOM 8752  C CB   . ALA A 1 93 ? -2.031  -6.415  -15.852 1.00 0.00 ? 93  ALA A CB   6  
ATOM 8753  O OXT  . ALA A 1 93 ? -3.000  -8.102  -13.747 1.00 0.00 ? 93  ALA A OXT  6  
ATOM 8754  H H    . ALA A 1 93 ? -3.779  -4.427  -14.894 1.00 0.00 ? 93  ALA A H    6  
ATOM 8755  H HA   . ALA A 1 93 ? -4.021  -7.104  -16.094 1.00 0.00 ? 93  ALA A HA   6  
ATOM 8756  H HB1  . ALA A 1 93 ? -1.533  -5.588  -15.366 1.00 0.00 ? 93  ALA A HB1  6  
ATOM 8757  H HB2  . ALA A 1 93 ? -1.984  -6.287  -16.921 1.00 0.00 ? 93  ALA A HB2  6  
ATOM 8758  H HB3  . ALA A 1 93 ? -1.545  -7.339  -15.577 1.00 0.00 ? 93  ALA A HB3  6  
ATOM 8759  N N    . LEU B 2 1  ? 13.379  -3.010  -5.272  1.00 0.00 ? 99  LEU B N    6  
ATOM 8760  C CA   . LEU B 2 1  ? 13.469  -4.366  -5.888  1.00 0.00 ? 99  LEU B CA   6  
ATOM 8761  C C    . LEU B 2 1  ? 13.458  -5.478  -4.829  1.00 0.00 ? 99  LEU B C    6  
ATOM 8762  O O    . LEU B 2 1  ? 14.101  -6.514  -5.001  1.00 0.00 ? 99  LEU B O    6  
ATOM 8763  C CB   . LEU B 2 1  ? 14.758  -4.438  -6.720  1.00 0.00 ? 99  LEU B CB   6  
ATOM 8764  C CG   . LEU B 2 1  ? 14.574  -4.854  -8.185  1.00 0.00 ? 99  LEU B CG   6  
ATOM 8765  C CD1  . LEU B 2 1  ? 13.953  -6.242  -8.278  1.00 0.00 ? 99  LEU B CD1  6  
ATOM 8766  C CD2  . LEU B 2 1  ? 13.723  -3.833  -8.929  1.00 0.00 ? 99  LEU B CD2  6  
ATOM 8767  H H1   . LEU B 2 1  ? 13.676  -2.315  -5.987  1.00 0.00 ? 99  LEU B H1   6  
ATOM 8768  H H2   . LEU B 2 1  ? 14.010  -2.991  -4.445  1.00 0.00 ? 99  LEU B H2   6  
ATOM 8769  H H3   . LEU B 2 1  ? 12.389  -2.855  -4.993  1.00 0.00 ? 99  LEU B H3   6  
ATOM 8770  H HA   . LEU B 2 1  ? 12.620  -4.498  -6.542  1.00 0.00 ? 99  LEU B HA   6  
ATOM 8771  H HB2  . LEU B 2 1  ? 15.227  -3.464  -6.702  1.00 0.00 ? 99  LEU B HB2  6  
ATOM 8772  H HB3  . LEU B 2 1  ? 15.425  -5.146  -6.252  1.00 0.00 ? 99  LEU B HB3  6  
ATOM 8773  H HG   . LEU B 2 1  ? 15.542  -4.893  -8.664  1.00 0.00 ? 99  LEU B HG   6  
ATOM 8774  H HD11 . LEU B 2 1  ? 13.326  -6.416  -7.416  1.00 0.00 ? 99  LEU B HD11 6  
ATOM 8775  H HD12 . LEU B 2 1  ? 14.736  -6.985  -8.308  1.00 0.00 ? 99  LEU B HD12 6  
ATOM 8776  H HD13 . LEU B 2 1  ? 13.357  -6.312  -9.176  1.00 0.00 ? 99  LEU B HD13 6  
ATOM 8777  H HD21 . LEU B 2 1  ? 12.965  -3.442  -8.267  1.00 0.00 ? 99  LEU B HD21 6  
ATOM 8778  H HD22 . LEU B 2 1  ? 13.249  -4.307  -9.777  1.00 0.00 ? 99  LEU B HD22 6  
ATOM 8779  H HD23 . LEU B 2 1  ? 14.350  -3.025  -9.275  1.00 0.00 ? 99  LEU B HD23 6  
ATOM 8780  N N    . PHE B 2 2  ? 12.717  -5.261  -3.739  1.00 0.00 ? 100 PHE B N    6  
ATOM 8781  C CA   . PHE B 2 2  ? 12.618  -6.245  -2.660  1.00 0.00 ? 100 PHE B CA   6  
ATOM 8782  C C    . PHE B 2 2  ? 11.158  -6.444  -2.254  1.00 0.00 ? 100 PHE B C    6  
ATOM 8783  O O    . PHE B 2 2  ? 10.285  -5.684  -2.674  1.00 0.00 ? 100 PHE B O    6  
ATOM 8784  C CB   . PHE B 2 2  ? 13.437  -5.797  -1.441  1.00 0.00 ? 100 PHE B CB   6  
ATOM 8785  C CG   . PHE B 2 2  ? 14.807  -5.266  -1.774  1.00 0.00 ? 100 PHE B CG   6  
ATOM 8786  C CD1  . PHE B 2 2  ? 14.997  -3.918  -2.041  1.00 0.00 ? 100 PHE B CD1  6  
ATOM 8787  C CD2  . PHE B 2 2  ? 15.903  -6.112  -1.812  1.00 0.00 ? 100 PHE B CD2  6  
ATOM 8788  C CE1  . PHE B 2 2  ? 16.254  -3.425  -2.339  1.00 0.00 ? 100 PHE B CE1  6  
ATOM 8789  C CE2  . PHE B 2 2  ? 17.162  -5.625  -2.110  1.00 0.00 ? 100 PHE B CE2  6  
ATOM 8790  C CZ   . PHE B 2 2  ? 17.338  -4.281  -2.373  1.00 0.00 ? 100 PHE B CZ   6  
ATOM 8791  H H    . PHE B 2 2  ? 12.220  -4.420  -3.657  1.00 0.00 ? 100 PHE B H    6  
ATOM 8792  H HA   . PHE B 2 2  ? 13.010  -7.183  -3.027  1.00 0.00 ? 100 PHE B HA   6  
ATOM 8793  H HB2  . PHE B 2 2  ? 12.900  -5.017  -0.923  1.00 0.00 ? 100 PHE B HB2  6  
ATOM 8794  H HB3  . PHE B 2 2  ? 13.562  -6.639  -0.776  1.00 0.00 ? 100 PHE B HB3  6  
ATOM 8795  H HD1  . PHE B 2 2  ? 14.151  -3.248  -2.014  1.00 0.00 ? 100 PHE B HD1  6  
ATOM 8796  H HD2  . PHE B 2 2  ? 15.770  -7.163  -1.605  1.00 0.00 ? 100 PHE B HD2  6  
ATOM 8797  H HE1  . PHE B 2 2  ? 16.389  -2.373  -2.544  1.00 0.00 ? 100 PHE B HE1  6  
ATOM 8798  H HE2  . PHE B 2 2  ? 18.008  -6.297  -2.135  1.00 0.00 ? 100 PHE B HE2  6  
ATOM 8799  H HZ   . PHE B 2 2  ? 18.322  -3.900  -2.604  1.00 0.00 ? 100 PHE B HZ   6  
ATOM 8800  N N    . SER B 2 3  ? 10.894  -7.458  -1.429  1.00 0.00 ? 101 SER B N    6  
ATOM 8801  C CA   . SER B 2 3  ? 9.534   -7.733  -0.967  1.00 0.00 ? 101 SER B CA   6  
ATOM 8802  C C    . SER B 2 3  ? 9.456   -7.668  0.558   1.00 0.00 ? 101 SER B C    6  
ATOM 8803  O O    . SER B 2 3  ? 9.669   -8.669  1.246   1.00 0.00 ? 101 SER B O    6  
ATOM 8804  C CB   . SER B 2 3  ? 9.059   -9.101  -1.464  1.00 0.00 ? 101 SER B CB   6  
ATOM 8805  O OG   . SER B 2 3  ? 10.077  -10.079 -1.335  1.00 0.00 ? 101 SER B OG   6  
ATOM 8806  H H    . SER B 2 3  ? 11.627  -8.030  -1.120  1.00 0.00 ? 101 SER B H    6  
ATOM 8807  H HA   . SER B 2 3  ? 8.889   -6.970  -1.377  1.00 0.00 ? 101 SER B HA   6  
ATOM 8808  H HB2  . SER B 2 3  ? 8.202   -9.413  -0.885  1.00 0.00 ? 101 SER B HB2  6  
ATOM 8809  H HB3  . SER B 2 3  ? 8.781   -9.025  -2.505  1.00 0.00 ? 101 SER B HB3  6  
ATOM 8810  H HG   . SER B 2 3  ? 9.679   -10.935 -1.163  1.00 0.00 ? 101 SER B HG   6  
ATOM 8811  N N    . THR B 2 4  ? 9.149   -6.482  1.079   1.00 0.00 ? 102 THR B N    6  
ATOM 8812  C CA   . THR B 2 4  ? 9.040   -6.279  2.522   1.00 0.00 ? 102 THR B CA   6  
ATOM 8813  C C    . THR B 2 4  ? 7.680   -6.762  3.035   1.00 0.00 ? 102 THR B C    6  
ATOM 8814  O O    . THR B 2 4  ? 6.820   -7.162  2.248   1.00 0.00 ? 102 THR B O    6  
ATOM 8815  C CB   . THR B 2 4  ? 9.270   -4.795  2.858   1.00 0.00 ? 102 THR B CB   6  
ATOM 8816  O OG1  . THR B 2 4  ? 10.144  -4.659  3.968   1.00 0.00 ? 102 THR B OG1  6  
ATOM 8817  C CG2  . THR B 2 4  ? 8.001   -4.023  3.168   1.00 0.00 ? 102 THR B CG2  6  
ATOM 8818  H H    . THR B 2 4  ? 8.989   -5.725  0.479   1.00 0.00 ? 102 THR B H    6  
ATOM 8819  H HA   . THR B 2 4  ? 9.813   -6.866  2.993   1.00 0.00 ? 102 THR B HA   6  
ATOM 8820  H HB   . THR B 2 4  ? 9.739   -4.320  2.006   1.00 0.00 ? 102 THR B HB   6  
ATOM 8821  H HG1  . THR B 2 4  ? 9.655   -4.783  4.785   1.00 0.00 ? 102 THR B HG1  6  
ATOM 8822  H HG21 . THR B 2 4  ? 8.120   -2.996  2.860   1.00 0.00 ? 102 THR B HG21 6  
ATOM 8823  H HG22 . THR B 2 4  ? 7.806   -4.061  4.230   1.00 0.00 ? 102 THR B HG22 6  
ATOM 8824  H HG23 . THR B 2 4  ? 7.173   -4.464  2.634   1.00 0.00 ? 102 THR B HG23 6  
ATOM 8825  N N    . GLU B 2 5  ? 7.489   -6.719  4.354   1.00 0.00 ? 103 GLU B N    6  
ATOM 8826  C CA   . GLU B 2 5  ? 6.231   -7.148  4.959   1.00 0.00 ? 103 GLU B CA   6  
ATOM 8827  C C    . GLU B 2 5  ? 5.686   -6.074  5.899   1.00 0.00 ? 103 GLU B C    6  
ATOM 8828  O O    . GLU B 2 5  ? 6.404   -5.570  6.766   1.00 0.00 ? 103 GLU B O    6  
ATOM 8829  C CB   . GLU B 2 5  ? 6.412   -8.474  5.710   1.00 0.00 ? 103 GLU B CB   6  
ATOM 8830  C CG   . GLU B 2 5  ? 7.630   -8.513  6.621   1.00 0.00 ? 103 GLU B CG   6  
ATOM 8831  C CD   . GLU B 2 5  ? 7.341   -9.175  7.956   1.00 0.00 ? 103 GLU B CD   6  
ATOM 8832  O OE1  . GLU B 2 5  ? 6.909   -8.467  8.889   1.00 0.00 ? 103 GLU B OE1  6  
ATOM 8833  O OE2  . GLU B 2 5  ? 7.551   -10.402 8.068   1.00 0.00 ? 103 GLU B OE2  6  
ATOM 8834  H H    . GLU B 2 5  ? 8.206   -6.384  4.932   1.00 0.00 ? 103 GLU B H    6  
ATOM 8835  H HA   . GLU B 2 5  ? 5.520   -7.296  4.160   1.00 0.00 ? 103 GLU B HA   6  
ATOM 8836  H HB2  . GLU B 2 5  ? 5.534   -8.654  6.312   1.00 0.00 ? 103 GLU B HB2  6  
ATOM 8837  H HB3  . GLU B 2 5  ? 6.507   -9.270  4.986   1.00 0.00 ? 103 GLU B HB3  6  
ATOM 8838  H HG2  . GLU B 2 5  ? 8.416   -9.064  6.127   1.00 0.00 ? 103 GLU B HG2  6  
ATOM 8839  H HG3  . GLU B 2 5  ? 7.961   -7.502  6.803   1.00 0.00 ? 103 GLU B HG3  6  
ATOM 8840  N N    . VAL B 2 6  ? 4.412   -5.725  5.714   1.00 0.00 ? 104 VAL B N    6  
ATOM 8841  C CA   . VAL B 2 6  ? 3.759   -4.706  6.535   1.00 0.00 ? 104 VAL B CA   6  
ATOM 8842  C C    . VAL B 2 6  ? 2.441   -5.227  7.121   1.00 0.00 ? 104 VAL B C    6  
ATOM 8843  O O    . VAL B 2 6  ? 1.780   -6.058  6.460   1.00 0.00 ? 104 VAL B O    6  
ATOM 8844  C CB   . VAL B 2 6  ? 3.503   -3.415  5.717   1.00 0.00 ? 104 VAL B CB   6  
ATOM 8845  C CG1  . VAL B 2 6  ? 2.610   -3.700  4.518   1.00 0.00 ? 104 VAL B CG1  6  
ATOM 8846  C CG2  . VAL B 2 6  ? 2.900   -2.320  6.591   1.00 0.00 ? 104 VAL B CG2  6  
ATOM 8847  O OXT  . VAL B 2 6  ? 2.086   -4.807  8.245   1.00 0.00 ? 104 VAL B OXT  6  
ATOM 8848  H H    . VAL B 2 6  ? 3.898   -6.162  5.002   1.00 0.00 ? 104 VAL B H    6  
ATOM 8849  H HA   . VAL B 2 6  ? 4.428   -4.462  7.349   1.00 0.00 ? 104 VAL B HA   6  
ATOM 8850  H HB   . VAL B 2 6  ? 4.455   -3.061  5.346   1.00 0.00 ? 104 VAL B HB   6  
ATOM 8851  H HG11 . VAL B 2 6  ? 1.847   -2.938  4.445   1.00 0.00 ? 104 VAL B HG11 6  
ATOM 8852  H HG12 . VAL B 2 6  ? 2.145   -4.665  4.640   1.00 0.00 ? 104 VAL B HG12 6  
ATOM 8853  H HG13 . VAL B 2 6  ? 3.206   -3.700  3.618   1.00 0.00 ? 104 VAL B HG13 6  
ATOM 8854  H HG21 . VAL B 2 6  ? 3.675   -1.879  7.199   1.00 0.00 ? 104 VAL B HG21 6  
ATOM 8855  H HG22 . VAL B 2 6  ? 2.141   -2.745  7.229   1.00 0.00 ? 104 VAL B HG22 6  
ATOM 8856  H HG23 . VAL B 2 6  ? 2.457   -1.559  5.963   1.00 0.00 ? 104 VAL B HG23 6  
ATOM 8857  N N    . MET A 1 1  ? -8.010  12.093  -20.169 1.00 0.00 ? 1   MET A N    7  
ATOM 8858  C CA   . MET A 1 1  ? -7.726  11.710  -18.760 1.00 0.00 ? 1   MET A CA   7  
ATOM 8859  C C    . MET A 1 1  ? -7.572  10.196  -18.620 1.00 0.00 ? 1   MET A C    7  
ATOM 8860  O O    . MET A 1 1  ? -8.561  9.461   -18.618 1.00 0.00 ? 1   MET A O    7  
ATOM 8861  C CB   . MET A 1 1  ? -8.874  12.210  -17.872 1.00 0.00 ? 1   MET A CB   7  
ATOM 8862  C CG   . MET A 1 1  ? -8.414  13.082  -16.713 1.00 0.00 ? 1   MET A CG   7  
ATOM 8863  S SD   . MET A 1 1  ? -8.476  14.842  -17.098 1.00 0.00 ? 1   MET A SD   7  
ATOM 8864  C CE   . MET A 1 1  ? -7.865  15.547  -15.568 1.00 0.00 ? 1   MET A CE   7  
ATOM 8865  H H1   . MET A 1 1  ? -7.246  11.712  -20.761 1.00 0.00 ? 1   MET A H1   7  
ATOM 8866  H H2   . MET A 1 1  ? -8.038  13.132  -20.215 1.00 0.00 ? 1   MET A H2   7  
ATOM 8867  H H3   . MET A 1 1  ? -8.928  11.680  -20.433 1.00 0.00 ? 1   MET A H3   7  
ATOM 8868  H HA   . MET A 1 1  ? -6.807  12.187  -18.454 1.00 0.00 ? 1   MET A HA   7  
ATOM 8869  H HB2  . MET A 1 1  ? -9.559  12.785  -18.477 1.00 0.00 ? 1   MET A HB2  7  
ATOM 8870  H HB3  . MET A 1 1  ? -9.398  11.357  -17.465 1.00 0.00 ? 1   MET A HB3  7  
ATOM 8871  H HG2  . MET A 1 1  ? -9.052  12.892  -15.863 1.00 0.00 ? 1   MET A HG2  7  
ATOM 8872  H HG3  . MET A 1 1  ? -7.397  12.818  -16.463 1.00 0.00 ? 1   MET A HG3  7  
ATOM 8873  H HE1  . MET A 1 1  ? -7.470  14.761  -14.942 1.00 0.00 ? 1   MET A HE1  7  
ATOM 8874  H HE2  . MET A 1 1  ? -8.674  16.045  -15.053 1.00 0.00 ? 1   MET A HE2  7  
ATOM 8875  H HE3  . MET A 1 1  ? -7.085  16.260  -15.786 1.00 0.00 ? 1   MET A HE3  7  
ATOM 8876  N N    . LYS A 1 2  ? -6.326  9.738   -18.496 1.00 0.00 ? 2   LYS A N    7  
ATOM 8877  C CA   . LYS A 1 2  ? -6.045  8.311   -18.346 1.00 0.00 ? 2   LYS A CA   7  
ATOM 8878  C C    . LYS A 1 2  ? -5.768  7.959   -16.881 1.00 0.00 ? 2   LYS A C    7  
ATOM 8879  O O    . LYS A 1 2  ? -4.924  7.111   -16.585 1.00 0.00 ? 2   LYS A O    7  
ATOM 8880  C CB   . LYS A 1 2  ? -4.852  7.908   -19.221 1.00 0.00 ? 2   LYS A CB   7  
ATOM 8881  C CG   . LYS A 1 2  ? -5.139  6.724   -20.132 1.00 0.00 ? 2   LYS A CG   7  
ATOM 8882  C CD   . LYS A 1 2  ? -3.900  5.866   -20.339 1.00 0.00 ? 2   LYS A CD   7  
ATOM 8883  C CE   . LYS A 1 2  ? -3.931  4.618   -19.468 1.00 0.00 ? 2   LYS A CE   7  
ATOM 8884  N NZ   . LYS A 1 2  ? -2.584  3.994   -19.335 1.00 0.00 ? 2   LYS A NZ   7  
ATOM 8885  H H    . LYS A 1 2  ? -5.580  10.373  -18.501 1.00 0.00 ? 2   LYS A H    7  
ATOM 8886  H HA   . LYS A 1 2  ? -6.919  7.766   -18.673 1.00 0.00 ? 2   LYS A HA   7  
ATOM 8887  H HB2  . LYS A 1 2  ? -4.571  8.749   -19.837 1.00 0.00 ? 2   LYS A HB2  7  
ATOM 8888  H HB3  . LYS A 1 2  ? -4.021  7.649   -18.581 1.00 0.00 ? 2   LYS A HB3  7  
ATOM 8889  H HG2  . LYS A 1 2  ? -5.914  6.119   -19.687 1.00 0.00 ? 2   LYS A HG2  7  
ATOM 8890  H HG3  . LYS A 1 2  ? -5.474  7.094   -21.090 1.00 0.00 ? 2   LYS A HG3  7  
ATOM 8891  H HD2  . LYS A 1 2  ? -3.850  5.568   -21.375 1.00 0.00 ? 2   LYS A HD2  7  
ATOM 8892  H HD3  . LYS A 1 2  ? -3.025  6.448   -20.088 1.00 0.00 ? 2   LYS A HD3  7  
ATOM 8893  H HE2  . LYS A 1 2  ? -4.289  4.889   -18.486 1.00 0.00 ? 2   LYS A HE2  7  
ATOM 8894  H HE3  . LYS A 1 2  ? -4.607  3.903   -19.913 1.00 0.00 ? 2   LYS A HE3  7  
ATOM 8895  H HZ1  . LYS A 1 2  ? -1.844  4.725   -19.368 1.00 0.00 ? 2   LYS A HZ1  7  
ATOM 8896  H HZ2  . LYS A 1 2  ? -2.423  3.320   -20.111 1.00 0.00 ? 2   LYS A HZ2  7  
ATOM 8897  H HZ3  . LYS A 1 2  ? -2.513  3.485   -18.430 1.00 0.00 ? 2   LYS A HZ3  7  
ATOM 8898  N N    . GLU A 1 3  ? -6.487  8.616   -15.970 1.00 0.00 ? 3   GLU A N    7  
ATOM 8899  C CA   . GLU A 1 3  ? -6.325  8.376   -14.539 1.00 0.00 ? 3   GLU A CA   7  
ATOM 8900  C C    . GLU A 1 3  ? -7.128  7.153   -14.098 1.00 0.00 ? 3   GLU A C    7  
ATOM 8901  O O    . GLU A 1 3  ? -8.341  7.091   -14.315 1.00 0.00 ? 3   GLU A O    7  
ATOM 8902  C CB   . GLU A 1 3  ? -6.768  9.606   -13.742 1.00 0.00 ? 3   GLU A CB   7  
ATOM 8903  C CG   . GLU A 1 3  ? -5.757  10.049  -12.696 1.00 0.00 ? 3   GLU A CG   7  
ATOM 8904  C CD   . GLU A 1 3  ? -6.275  11.172  -11.817 1.00 0.00 ? 3   GLU A CD   7  
ATOM 8905  O OE1  . GLU A 1 3  ? -7.337  10.991  -11.183 1.00 0.00 ? 3   GLU A OE1  7  
ATOM 8906  O OE2  . GLU A 1 3  ? -5.618  12.232  -11.762 1.00 0.00 ? 3   GLU A OE2  7  
ATOM 8907  H H    . GLU A 1 3  ? -7.145  9.277   -16.267 1.00 0.00 ? 3   GLU A H    7  
ATOM 8908  H HA   . GLU A 1 3  ? -5.278  8.194   -14.350 1.00 0.00 ? 3   GLU A HA   7  
ATOM 8909  H HB2  . GLU A 1 3  ? -6.928  10.425  -14.427 1.00 0.00 ? 3   GLU A HB2  7  
ATOM 8910  H HB3  . GLU A 1 3  ? -7.699  9.381   -13.240 1.00 0.00 ? 3   GLU A HB3  7  
ATOM 8911  H HG2  . GLU A 1 3  ? -5.511  9.205   -12.068 1.00 0.00 ? 3   GLU A HG2  7  
ATOM 8912  H HG3  . GLU A 1 3  ? -4.864  10.391  -13.201 1.00 0.00 ? 3   GLU A HG3  7  
ATOM 8913  N N    . PRO A 1 4  ? -6.458  6.157   -13.477 1.00 0.00 ? 4   PRO A N    7  
ATOM 8914  C CA   . PRO A 1 4  ? -7.113  4.925   -13.008 1.00 0.00 ? 4   PRO A CA   7  
ATOM 8915  C C    . PRO A 1 4  ? -8.169  5.187   -11.930 1.00 0.00 ? 4   PRO A C    7  
ATOM 8916  O O    . PRO A 1 4  ? -8.586  6.327   -11.717 1.00 0.00 ? 4   PRO A O    7  
ATOM 8917  C CB   . PRO A 1 4  ? -5.955  4.094   -12.433 1.00 0.00 ? 4   PRO A CB   7  
ATOM 8918  C CG   . PRO A 1 4  ? -4.722  4.682   -13.026 1.00 0.00 ? 4   PRO A CG   7  
ATOM 8919  C CD   . PRO A 1 4  ? -5.013  6.144   -13.191 1.00 0.00 ? 4   PRO A CD   7  
ATOM 8920  H HA   . PRO A 1 4  ? -7.569  4.389   -13.828 1.00 0.00 ? 4   PRO A HA   7  
ATOM 8921  H HB2  . PRO A 1 4  ? -5.952  4.176   -11.356 1.00 0.00 ? 4   PRO A HB2  7  
ATOM 8922  H HB3  . PRO A 1 4  ? -6.074  3.059   -12.720 1.00 0.00 ? 4   PRO A HB3  7  
ATOM 8923  H HG2  . PRO A 1 4  ? -3.887  4.538   -12.356 1.00 0.00 ? 4   PRO A HG2  7  
ATOM 8924  H HG3  . PRO A 1 4  ? -4.520  4.229   -13.984 1.00 0.00 ? 4   PRO A HG3  7  
ATOM 8925  H HD2  . PRO A 1 4  ? -4.790  6.678   -12.279 1.00 0.00 ? 4   PRO A HD2  7  
ATOM 8926  H HD3  . PRO A 1 4  ? -4.451  6.551   -14.019 1.00 0.00 ? 4   PRO A HD3  7  
ATOM 8927  N N    . GLU A 1 5  ? -8.597  4.121   -11.253 1.00 0.00 ? 5   GLU A N    7  
ATOM 8928  C CA   . GLU A 1 5  ? -9.603  4.229   -10.202 1.00 0.00 ? 5   GLU A CA   7  
ATOM 8929  C C    . GLU A 1 5  ? -8.981  4.012   -8.828  1.00 0.00 ? 5   GLU A C    7  
ATOM 8930  O O    . GLU A 1 5  ? -8.897  2.886   -8.335  1.00 0.00 ? 5   GLU A O    7  
ATOM 8931  C CB   . GLU A 1 5  ? -10.730 3.222   -10.439 1.00 0.00 ? 5   GLU A CB   7  
ATOM 8932  C CG   . GLU A 1 5  ? -11.885 3.350   -9.456  1.00 0.00 ? 5   GLU A CG   7  
ATOM 8933  C CD   . GLU A 1 5  ? -13.020 2.393   -9.764  1.00 0.00 ? 5   GLU A CD   7  
ATOM 8934  O OE1  . GLU A 1 5  ? -13.695 2.584   -10.798 1.00 0.00 ? 5   GLU A OE1  7  
ATOM 8935  O OE2  . GLU A 1 5  ? -13.234 1.452   -8.971  1.00 0.00 ? 5   GLU A OE2  7  
ATOM 8936  H H    . GLU A 1 5  ? -8.226  3.242   -11.463 1.00 0.00 ? 5   GLU A H    7  
ATOM 8937  H HA   . GLU A 1 5  ? -10.013 5.227   -10.241 1.00 0.00 ? 5   GLU A HA   7  
ATOM 8938  H HB2  . GLU A 1 5  ? -11.117 3.367   -11.435 1.00 0.00 ? 5   GLU A HB2  7  
ATOM 8939  H HB3  . GLU A 1 5  ? -10.328 2.223   -10.360 1.00 0.00 ? 5   GLU A HB3  7  
ATOM 8940  H HG2  . GLU A 1 5  ? -11.519 3.142   -8.462  1.00 0.00 ? 5   GLU A HG2  7  
ATOM 8941  H HG3  . GLU A 1 5  ? -12.264 4.361   -9.495  1.00 0.00 ? 5   GLU A HG3  7  
ATOM 8942  N N    . ILE A 1 6  ? -8.545  5.104   -8.219  1.00 0.00 ? 6   ILE A N    7  
ATOM 8943  C CA   . ILE A 1 6  ? -7.925  5.060   -6.901  1.00 0.00 ? 6   ILE A CA   7  
ATOM 8944  C C    . ILE A 1 6  ? -8.963  5.298   -5.803  1.00 0.00 ? 6   ILE A C    7  
ATOM 8945  O O    . ILE A 1 6  ? -9.815  6.180   -5.925  1.00 0.00 ? 6   ILE A O    7  
ATOM 8946  C CB   . ILE A 1 6  ? -6.806  6.113   -6.788  1.00 0.00 ? 6   ILE A CB   7  
ATOM 8947  C CG1  . ILE A 1 6  ? -5.787  5.934   -7.917  1.00 0.00 ? 6   ILE A CG1  7  
ATOM 8948  C CG2  . ILE A 1 6  ? -6.119  6.030   -5.433  1.00 0.00 ? 6   ILE A CG2  7  
ATOM 8949  C CD1  . ILE A 1 6  ? -5.512  7.208   -8.685  1.00 0.00 ? 6   ILE A CD1  7  
ATOM 8950  H H    . ILE A 1 6  ? -8.643  5.969   -8.671  1.00 0.00 ? 6   ILE A H    7  
ATOM 8951  H HA   . ILE A 1 6  ? -7.488  4.081   -6.766  1.00 0.00 ? 6   ILE A HA   7  
ATOM 8952  H HB   . ILE A 1 6  ? -7.257  7.088   -6.879  1.00 0.00 ? 6   ILE A HB   7  
ATOM 8953  H HG12 . ILE A 1 6  ? -4.852  5.591   -7.499  1.00 0.00 ? 6   ILE A HG12 7  
ATOM 8954  H HG13 . ILE A 1 6  ? -6.155  5.197   -8.615  1.00 0.00 ? 6   ILE A HG13 7  
ATOM 8955  H HG21 . ILE A 1 6  ? -5.429  6.855   -5.328  1.00 0.00 ? 6   ILE A HG21 7  
ATOM 8956  H HG22 . ILE A 1 6  ? -5.578  5.098   -5.359  1.00 0.00 ? 6   ILE A HG22 7  
ATOM 8957  H HG23 . ILE A 1 6  ? -6.860  6.079   -4.649  1.00 0.00 ? 6   ILE A HG23 7  
ATOM 8958  H HD11 . ILE A 1 6  ? -5.568  8.052   -8.014  1.00 0.00 ? 6   ILE A HD11 7  
ATOM 8959  H HD12 . ILE A 1 6  ? -6.247  7.322   -9.468  1.00 0.00 ? 6   ILE A HD12 7  
ATOM 8960  H HD13 . ILE A 1 6  ? -4.525  7.160   -9.121  1.00 0.00 ? 6   ILE A HD13 7  
ATOM 8961  N N    . ILE A 1 7  ? -8.885  4.503   -4.735  1.00 0.00 ? 7   ILE A N    7  
ATOM 8962  C CA   . ILE A 1 7  ? -9.820  4.622   -3.616  1.00 0.00 ? 7   ILE A CA   7  
ATOM 8963  C C    . ILE A 1 7  ? -9.139  4.314   -2.284  1.00 0.00 ? 7   ILE A C    7  
ATOM 8964  O O    . ILE A 1 7  ? -8.163  3.561   -2.231  1.00 0.00 ? 7   ILE A O    7  
ATOM 8965  C CB   . ILE A 1 7  ? -11.033 3.678   -3.783  1.00 0.00 ? 7   ILE A CB   7  
ATOM 8966  C CG1  . ILE A 1 7  ? -10.570 2.222   -3.926  1.00 0.00 ? 7   ILE A CG1  7  
ATOM 8967  C CG2  . ILE A 1 7  ? -11.877 4.094   -4.980  1.00 0.00 ? 7   ILE A CG2  7  
ATOM 8968  C CD1  . ILE A 1 7  ? -11.466 1.228   -3.216  1.00 0.00 ? 7   ILE A CD1  7  
ATOM 8969  H H    . ILE A 1 7  ? -8.182  3.819   -4.698  1.00 0.00 ? 7   ILE A H    7  
ATOM 8970  H HA   . ILE A 1 7  ? -10.184 5.639   -3.594  1.00 0.00 ? 7   ILE A HA   7  
ATOM 8971  H HB   . ILE A 1 7  ? -11.647 3.765   -2.899  1.00 0.00 ? 7   ILE A HB   7  
ATOM 8972  H HG12 . ILE A 1 7  ? -10.548 1.958   -4.972  1.00 0.00 ? 7   ILE A HG12 7  
ATOM 8973  H HG13 . ILE A 1 7  ? -9.576  2.125   -3.515  1.00 0.00 ? 7   ILE A HG13 7  
ATOM 8974  H HG21 . ILE A 1 7  ? -12.778 3.499   -5.010  1.00 0.00 ? 7   ILE A HG21 7  
ATOM 8975  H HG22 . ILE A 1 7  ? -11.314 3.940   -5.889  1.00 0.00 ? 7   ILE A HG22 7  
ATOM 8976  H HG23 . ILE A 1 7  ? -12.138 5.138   -4.891  1.00 0.00 ? 7   ILE A HG23 7  
ATOM 8977  H HD11 . ILE A 1 7  ? -11.201 0.226   -3.518  1.00 0.00 ? 7   ILE A HD11 7  
ATOM 8978  H HD12 . ILE A 1 7  ? -12.495 1.422   -3.475  1.00 0.00 ? 7   ILE A HD12 7  
ATOM 8979  H HD13 . ILE A 1 7  ? -11.338 1.328   -2.147  1.00 0.00 ? 7   ILE A HD13 7  
ATOM 8980  N N    . THR A 1 8  ? -9.667  4.895   -1.207  1.00 0.00 ? 8   THR A N    7  
ATOM 8981  C CA   . THR A 1 8  ? -9.119  4.682   0.130   1.00 0.00 ? 8   THR A CA   7  
ATOM 8982  C C    . THR A 1 8  ? -10.084 3.873   0.994   1.00 0.00 ? 8   THR A C    7  
ATOM 8983  O O    . THR A 1 8  ? -11.300 4.066   0.931   1.00 0.00 ? 8   THR A O    7  
ATOM 8984  C CB   . THR A 1 8  ? -8.813  6.023   0.804   1.00 0.00 ? 8   THR A CB   7  
ATOM 8985  O OG1  . THR A 1 8  ? -8.191  6.915   -0.106  1.00 0.00 ? 8   THR A OG1  7  
ATOM 8986  C CG2  . THR A 1 8  ? -7.908  5.894   2.013   1.00 0.00 ? 8   THR A CG2  7  
ATOM 8987  H H    . THR A 1 8  ? -10.447 5.480   -1.314  1.00 0.00 ? 8   THR A H    7  
ATOM 8988  H HA   . THR A 1 8  ? -8.199  4.125   0.025   1.00 0.00 ? 8   THR A HA   7  
ATOM 8989  H HB   . THR A 1 8  ? -9.742  6.468   1.134   1.00 0.00 ? 8   THR A HB   7  
ATOM 8990  H HG1  . THR A 1 8  ? -8.848  7.267   -0.711  1.00 0.00 ? 8   THR A HG1  7  
ATOM 8991  H HG21 . THR A 1 8  ? -6.881  5.829   1.688   1.00 0.00 ? 8   THR A HG21 7  
ATOM 8992  H HG22 . THR A 1 8  ? -8.169  5.002   2.564   1.00 0.00 ? 8   THR A HG22 7  
ATOM 8993  H HG23 . THR A 1 8  ? -8.031  6.758   2.648   1.00 0.00 ? 8   THR A HG23 7  
ATOM 8994  N N    . VAL A 1 9  ? -9.531  2.970   1.804   1.00 0.00 ? 9   VAL A N    7  
ATOM 8995  C CA   . VAL A 1 9  ? -10.333 2.130   2.689   1.00 0.00 ? 9   VAL A CA   7  
ATOM 8996  C C    . VAL A 1 9  ? -9.941  2.340   4.148   1.00 0.00 ? 9   VAL A C    7  
ATOM 8997  O O    . VAL A 1 9  ? -8.757  2.354   4.485   1.00 0.00 ? 9   VAL A O    7  
ATOM 8998  C CB   . VAL A 1 9  ? -10.189 0.632   2.343   1.00 0.00 ? 9   VAL A CB   7  
ATOM 8999  C CG1  . VAL A 1 9  ? -10.915 0.314   1.046   1.00 0.00 ? 9   VAL A CG1  7  
ATOM 9000  C CG2  . VAL A 1 9  ? -8.721  0.231   2.257   1.00 0.00 ? 9   VAL A CG2  7  
ATOM 9001  H H    . VAL A 1 9  ? -8.555  2.869   1.808   1.00 0.00 ? 9   VAL A H    7  
ATOM 9002  H HA   . VAL A 1 9  ? -11.370 2.407   2.564   1.00 0.00 ? 9   VAL A HA   7  
ATOM 9003  H HB   . VAL A 1 9  ? -10.648 0.057   3.135   1.00 0.00 ? 9   VAL A HB   7  
ATOM 9004  H HG11 . VAL A 1 9  ? -11.976 0.250   1.234   1.00 0.00 ? 9   VAL A HG11 7  
ATOM 9005  H HG12 . VAL A 1 9  ? -10.561 -0.629  0.656   1.00 0.00 ? 9   VAL A HG12 7  
ATOM 9006  H HG13 . VAL A 1 9  ? -10.725 1.096   0.325   1.00 0.00 ? 9   VAL A HG13 7  
ATOM 9007  H HG21 . VAL A 1 9  ? -8.217  0.859   1.538   1.00 0.00 ? 9   VAL A HG21 7  
ATOM 9008  H HG22 . VAL A 1 9  ? -8.647  -0.801  1.947   1.00 0.00 ? 9   VAL A HG22 7  
ATOM 9009  H HG23 . VAL A 1 9  ? -8.257  0.348   3.226   1.00 0.00 ? 9   VAL A HG23 7  
ATOM 9010  N N    . THR A 1 10 ? -10.942 2.502   5.009   1.00 0.00 ? 10  THR A N    7  
ATOM 9011  C CA   . THR A 1 10 ? -10.703 2.709   6.433   1.00 0.00 ? 10  THR A CA   7  
ATOM 9012  C C    . THR A 1 10 ? -11.132 1.482   7.237   1.00 0.00 ? 10  THR A C    7  
ATOM 9013  O O    . THR A 1 10 ? -12.305 1.335   7.588   1.00 0.00 ? 10  THR A O    7  
ATOM 9014  C CB   . THR A 1 10 ? -11.450 3.954   6.923   1.00 0.00 ? 10  THR A CB   7  
ATOM 9015  O OG1  . THR A 1 10 ? -11.291 5.029   6.012   1.00 0.00 ? 10  THR A OG1  7  
ATOM 9016  C CG2  . THR A 1 10 ? -10.988 4.434   8.282   1.00 0.00 ? 10  THR A CG2  7  
ATOM 9017  H H    . THR A 1 10 ? -11.865 2.480   4.679   1.00 0.00 ? 10  THR A H    7  
ATOM 9018  H HA   . THR A 1 10 ? -9.642  2.860   6.571   1.00 0.00 ? 10  THR A HA   7  
ATOM 9019  H HB   . THR A 1 10 ? -12.504 3.724   6.994   1.00 0.00 ? 10  THR A HB   7  
ATOM 9020  H HG1  . THR A 1 10 ? -12.000 5.665   6.137   1.00 0.00 ? 10  THR A HG1  7  
ATOM 9021  H HG21 . THR A 1 10 ? -10.085 3.912   8.560   1.00 0.00 ? 10  THR A HG21 7  
ATOM 9022  H HG22 . THR A 1 10 ? -11.758 4.236   9.013   1.00 0.00 ? 10  THR A HG22 7  
ATOM 9023  H HG23 . THR A 1 10 ? -10.793 5.495   8.243   1.00 0.00 ? 10  THR A HG23 7  
ATOM 9024  N N    . LEU A 1 11 ? -10.173 0.601   7.520   1.00 0.00 ? 11  LEU A N    7  
ATOM 9025  C CA   . LEU A 1 11 ? -10.443 -0.620  8.279   1.00 0.00 ? 11  LEU A CA   7  
ATOM 9026  C C    . LEU A 1 11 ? -9.680  -0.619  9.605   1.00 0.00 ? 11  LEU A C    7  
ATOM 9027  O O    . LEU A 1 11 ? -8.862  0.267   9.858   1.00 0.00 ? 11  LEU A O    7  
ATOM 9028  C CB   . LEU A 1 11 ? -10.054 -1.851  7.452   1.00 0.00 ? 11  LEU A CB   7  
ATOM 9029  C CG   . LEU A 1 11 ? -10.727 -1.955  6.080   1.00 0.00 ? 11  LEU A CG   7  
ATOM 9030  C CD1  . LEU A 1 11 ? -10.154 -3.121  5.289   1.00 0.00 ? 11  LEU A CD1  7  
ATOM 9031  C CD2  . LEU A 1 11 ? -12.235 -2.102  6.234   1.00 0.00 ? 11  LEU A CD2  7  
ATOM 9032  H H    . LEU A 1 11 ? -9.260  0.775   7.209   1.00 0.00 ? 11  LEU A H    7  
ATOM 9033  H HA   . LEU A 1 11 ? -11.502 -0.656  8.486   1.00 0.00 ? 11  LEU A HA   7  
ATOM 9034  H HB2  . LEU A 1 11 ? -8.983  -1.834  7.304   1.00 0.00 ? 11  LEU A HB2  7  
ATOM 9035  H HB3  . LEU A 1 11 ? -10.307 -2.734  8.020   1.00 0.00 ? 11  LEU A HB3  7  
ATOM 9036  H HG   . LEU A 1 11 ? -10.535 -1.048  5.524   1.00 0.00 ? 11  LEU A HG   7  
ATOM 9037  H HD11 . LEU A 1 11 ? -10.169 -4.012  5.899   1.00 0.00 ? 11  LEU A HD11 7  
ATOM 9038  H HD12 . LEU A 1 11 ? -9.136  -2.897  5.005   1.00 0.00 ? 11  LEU A HD12 7  
ATOM 9039  H HD13 . LEU A 1 11 ? -10.748 -3.282  4.401   1.00 0.00 ? 11  LEU A HD13 7  
ATOM 9040  H HD21 . LEU A 1 11 ? -12.624 -2.696  5.420   1.00 0.00 ? 11  LEU A HD21 7  
ATOM 9041  H HD22 . LEU A 1 11 ? -12.696 -1.125  6.218   1.00 0.00 ? 11  LEU A HD22 7  
ATOM 9042  H HD23 . LEU A 1 11 ? -12.456 -2.589  7.172   1.00 0.00 ? 11  LEU A HD23 7  
ATOM 9043  N N    . LYS A 1 12 ? -9.952  -1.616  10.448  1.00 0.00 ? 12  LYS A N    7  
ATOM 9044  C CA   . LYS A 1 12 ? -9.288  -1.727  11.746  1.00 0.00 ? 12  LYS A CA   7  
ATOM 9045  C C    . LYS A 1 12 ? -8.144  -2.740  11.693  1.00 0.00 ? 12  LYS A C    7  
ATOM 9046  O O    . LYS A 1 12 ? -8.067  -3.557  10.773  1.00 0.00 ? 12  LYS A O    7  
ATOM 9047  C CB   . LYS A 1 12 ? -10.292 -2.131  12.830  1.00 0.00 ? 12  LYS A CB   7  
ATOM 9048  C CG   . LYS A 1 12 ? -10.985 -0.948  13.492  1.00 0.00 ? 12  LYS A CG   7  
ATOM 9049  C CD   . LYS A 1 12 ? -11.093 -1.130  15.000  1.00 0.00 ? 12  LYS A CD   7  
ATOM 9050  C CE   . LYS A 1 12 ? -11.251 0.205   15.715  1.00 0.00 ? 12  LYS A CE   7  
ATOM 9051  N NZ   . LYS A 1 12 ? -10.774 0.146   17.126  1.00 0.00 ? 12  LYS A NZ   7  
ATOM 9052  H H    . LYS A 1 12 ? -10.612 -2.294  10.191  1.00 0.00 ? 12  LYS A H    7  
ATOM 9053  H HA   . LYS A 1 12 ? -8.879  -0.758  11.990  1.00 0.00 ? 12  LYS A HA   7  
ATOM 9054  H HB2  . LYS A 1 12 ? -11.048 -2.761  12.387  1.00 0.00 ? 12  LYS A HB2  7  
ATOM 9055  H HB3  . LYS A 1 12 ? -9.772  -2.690  13.595  1.00 0.00 ? 12  LYS A HB3  7  
ATOM 9056  H HG2  . LYS A 1 12 ? -10.420 -0.051  13.288  1.00 0.00 ? 12  LYS A HG2  7  
ATOM 9057  H HG3  . LYS A 1 12 ? -11.979 -0.851  13.078  1.00 0.00 ? 12  LYS A HG3  7  
ATOM 9058  H HD2  . LYS A 1 12 ? -11.954 -1.745  15.217  1.00 0.00 ? 12  LYS A HD2  7  
ATOM 9059  H HD3  . LYS A 1 12 ? -10.200 -1.618  15.359  1.00 0.00 ? 12  LYS A HD3  7  
ATOM 9060  H HE2  . LYS A 1 12 ? -10.681 0.953   15.184  1.00 0.00 ? 12  LYS A HE2  7  
ATOM 9061  H HE3  . LYS A 1 12 ? -12.296 0.480   15.709  1.00 0.00 ? 12  LYS A HE3  7  
ATOM 9062  H HZ1  . LYS A 1 12 ? -11.350 0.773   17.724  1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 9063  H HZ2  . LYS A 1 12 ? -9.781  0.449   17.181  1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 9064  H HZ3  . LYS A 1 12 ? -10.849 -0.826  17.491  1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 9065  N N    . LYS A 1 13 ? -7.256  -2.676  12.685  1.00 0.00 ? 13  LYS A N    7  
ATOM 9066  C CA   . LYS A 1 13 ? -6.111  -3.580  12.758  1.00 0.00 ? 13  LYS A CA   7  
ATOM 9067  C C    . LYS A 1 13 ? -6.531  -4.961  13.262  1.00 0.00 ? 13  LYS A C    7  
ATOM 9068  O O    . LYS A 1 13 ? -6.703  -5.170  14.464  1.00 0.00 ? 13  LYS A O    7  
ATOM 9069  C CB   . LYS A 1 13 ? -5.028  -2.990  13.669  1.00 0.00 ? 13  LYS A CB   7  
ATOM 9070  C CG   . LYS A 1 13 ? -3.775  -3.848  13.772  1.00 0.00 ? 13  LYS A CG   7  
ATOM 9071  C CD   . LYS A 1 13 ? -2.775  -3.260  14.756  1.00 0.00 ? 13  LYS A CD   7  
ATOM 9072  C CE   . LYS A 1 13 ? -1.603  -2.606  14.041  1.00 0.00 ? 13  LYS A CE   7  
ATOM 9073  N NZ   . LYS A 1 13 ? -1.024  -1.479  14.827  1.00 0.00 ? 13  LYS A NZ   7  
ATOM 9074  H H    . LYS A 1 13 ? -7.374  -1.998  13.385  1.00 0.00 ? 13  LYS A H    7  
ATOM 9075  H HA   . LYS A 1 13 ? -5.710  -3.683  11.760  1.00 0.00 ? 13  LYS A HA   7  
ATOM 9076  H HB2  . LYS A 1 13 ? -4.741  -2.021  13.286  1.00 0.00 ? 13  LYS A HB2  7  
ATOM 9077  H HB3  . LYS A 1 13 ? -5.436  -2.867  14.662  1.00 0.00 ? 13  LYS A HB3  7  
ATOM 9078  H HG2  . LYS A 1 13 ? -4.055  -4.836  14.106  1.00 0.00 ? 13  LYS A HG2  7  
ATOM 9079  H HG3  . LYS A 1 13 ? -3.314  -3.913  12.797  1.00 0.00 ? 13  LYS A HG3  7  
ATOM 9080  H HD2  . LYS A 1 13 ? -3.274  -2.519  15.363  1.00 0.00 ? 13  LYS A HD2  7  
ATOM 9081  H HD3  . LYS A 1 13 ? -2.402  -4.053  15.390  1.00 0.00 ? 13  LYS A HD3  7  
ATOM 9082  H HE2  . LYS A 1 13 ? -0.836  -3.349  13.880  1.00 0.00 ? 13  LYS A HE2  7  
ATOM 9083  H HE3  . LYS A 1 13 ? -1.944  -2.230  13.087  1.00 0.00 ? 13  LYS A HE3  7  
ATOM 9084  H HZ1  . LYS A 1 13 ? 0.007   -1.443  14.693  1.00 0.00 ? 13  LYS A HZ1  7  
ATOM 9085  H HZ2  . LYS A 1 13 ? -1.226  -1.604  15.839  1.00 0.00 ? 13  LYS A HZ2  7  
ATOM 9086  H HZ3  . LYS A 1 13 ? -1.435  -0.575  14.512  1.00 0.00 ? 13  LYS A HZ3  7  
ATOM 9087  N N    . GLN A 1 14 ? -6.690  -5.901  12.331  1.00 0.00 ? 14  GLN A N    7  
ATOM 9088  C CA   . GLN A 1 14 ? -7.083  -7.266  12.672  1.00 0.00 ? 14  GLN A CA   7  
ATOM 9089  C C    . GLN A 1 14 ? -5.848  -8.140  12.887  1.00 0.00 ? 14  GLN A C    7  
ATOM 9090  O O    . GLN A 1 14 ? -5.435  -8.882  11.993  1.00 0.00 ? 14  GLN A O    7  
ATOM 9091  C CB   . GLN A 1 14 ? -7.963  -7.855  11.565  1.00 0.00 ? 14  GLN A CB   7  
ATOM 9092  C CG   . GLN A 1 14 ? -8.960  -8.891  12.060  1.00 0.00 ? 14  GLN A CG   7  
ATOM 9093  C CD   . GLN A 1 14 ? -10.348 -8.315  12.266  1.00 0.00 ? 14  GLN A CD   7  
ATOM 9094  O OE1  . GLN A 1 14 ? -10.860 -8.286  13.385  1.00 0.00 ? 14  GLN A OE1  7  
ATOM 9095  N NE2  . GLN A 1 14 ? -10.967 -7.852  11.184  1.00 0.00 ? 14  GLN A NE2  7  
ATOM 9096  H H    . GLN A 1 14 ? -6.536  -5.672  11.390  1.00 0.00 ? 14  GLN A H    7  
ATOM 9097  H HA   . GLN A 1 14 ? -7.650  -7.228  13.592  1.00 0.00 ? 14  GLN A HA   7  
ATOM 9098  H HB2  . GLN A 1 14 ? -8.512  -7.054  11.094  1.00 0.00 ? 14  GLN A HB2  7  
ATOM 9099  H HB3  . GLN A 1 14 ? -7.327  -8.324  10.828  1.00 0.00 ? 14  GLN A HB3  7  
ATOM 9100  H HG2  . GLN A 1 14 ? -9.023  -9.686  11.332  1.00 0.00 ? 14  GLN A HG2  7  
ATOM 9101  H HG3  . GLN A 1 14 ? -8.608  -9.292  13.000  1.00 0.00 ? 14  GLN A HG3  7  
ATOM 9102  H HE21 . GLN A 1 14 ? -10.501 -7.907  10.323  1.00 0.00 ? 14  GLN A HE21 7  
ATOM 9103  H HE22 . GLN A 1 14 ? -11.865 -7.475  11.292  1.00 0.00 ? 14  GLN A HE22 7  
ATOM 9104  N N    . ASN A 1 15 ? -5.253  -8.035  14.078  1.00 0.00 ? 15  ASN A N    7  
ATOM 9105  C CA   . ASN A 1 15 ? -4.053  -8.802  14.419  1.00 0.00 ? 15  ASN A CA   7  
ATOM 9106  C C    . ASN A 1 15 ? -2.907  -8.489  13.448  1.00 0.00 ? 15  ASN A C    7  
ATOM 9107  O O    . ASN A 1 15 ? -2.103  -9.363  13.116  1.00 0.00 ? 15  ASN A O    7  
ATOM 9108  C CB   . ASN A 1 15 ? -4.358  -10.307 14.415  1.00 0.00 ? 15  ASN A CB   7  
ATOM 9109  C CG   . ASN A 1 15 ? -3.773  -11.018 15.622  1.00 0.00 ? 15  ASN A CG   7  
ATOM 9110  O OD1  . ASN A 1 15 ? -2.896  -11.872 15.489  1.00 0.00 ? 15  ASN A OD1  7  
ATOM 9111  N ND2  . ASN A 1 15 ? -4.256  -10.670 16.811  1.00 0.00 ? 15  ASN A ND2  7  
ATOM 9112  H H    . ASN A 1 15 ? -5.626  -7.418  14.742  1.00 0.00 ? 15  ASN A H    7  
ATOM 9113  H HA   . ASN A 1 15 ? -3.749  -8.511  15.414  1.00 0.00 ? 15  ASN A HA   7  
ATOM 9114  H HB2  . ASN A 1 15 ? -5.428  -10.451 14.419  1.00 0.00 ? 15  ASN A HB2  7  
ATOM 9115  H HB3  . ASN A 1 15 ? -3.944  -10.752 13.523  1.00 0.00 ? 15  ASN A HB3  7  
ATOM 9116  H HD21 . ASN A 1 15 ? -4.954  -9.983  16.845  1.00 0.00 ? 15  ASN A HD21 7  
ATOM 9117  H HD22 . ASN A 1 15 ? -3.893  -11.114 17.606  1.00 0.00 ? 15  ASN A HD22 7  
ATOM 9118  N N    . GLY A 1 16 ? -2.844  -7.234  12.996  1.00 0.00 ? 16  GLY A N    7  
ATOM 9119  C CA   . GLY A 1 16 ? -1.805  -6.821  12.067  1.00 0.00 ? 16  GLY A CA   7  
ATOM 9120  C C    . GLY A 1 16 ? -2.280  -6.845  10.627  1.00 0.00 ? 16  GLY A C    7  
ATOM 9121  O O    . GLY A 1 16 ? -3.180  -7.613  10.279  1.00 0.00 ? 16  GLY A O    7  
ATOM 9122  H H    . GLY A 1 16 ? -3.513  -6.583  13.292  1.00 0.00 ? 16  GLY A H    7  
ATOM 9123  H HA2  . GLY A 1 16 ? -1.492  -5.819  12.316  1.00 0.00 ? 16  GLY A HA2  7  
ATOM 9124  H HA3  . GLY A 1 16 ? -0.960  -7.487  12.167  1.00 0.00 ? 16  GLY A HA3  7  
ATOM 9125  N N    . MET A 1 17 ? -1.678  -6.005  9.785   1.00 0.00 ? 17  MET A N    7  
ATOM 9126  C CA   . MET A 1 17 ? -2.048  -5.938  8.372   1.00 0.00 ? 17  MET A CA   7  
ATOM 9127  C C    . MET A 1 17 ? -1.846  -7.291  7.698   1.00 0.00 ? 17  MET A C    7  
ATOM 9128  O O    . MET A 1 17 ? -2.780  -7.853  7.123   1.00 0.00 ? 17  MET A O    7  
ATOM 9129  C CB   . MET A 1 17 ? -1.226  -4.868  7.648   1.00 0.00 ? 17  MET A CB   7  
ATOM 9130  C CG   . MET A 1 17 ? -1.883  -3.498  7.639   1.00 0.00 ? 17  MET A CG   7  
ATOM 9131  S SD   . MET A 1 17 ? -1.043  -2.321  8.713   1.00 0.00 ? 17  MET A SD   7  
ATOM 9132  C CE   . MET A 1 17 ? 0.629   -2.412  8.076   1.00 0.00 ? 17  MET A CE   7  
ATOM 9133  H H    . MET A 1 17 ? -0.968  -5.417  10.121  1.00 0.00 ? 17  MET A H    7  
ATOM 9134  H HA   . MET A 1 17 ? -3.095  -5.677  8.316   1.00 0.00 ? 17  MET A HA   7  
ATOM 9135  H HB2  . MET A 1 17 ? -0.265  -4.781  8.133   1.00 0.00 ? 17  MET A HB2  7  
ATOM 9136  H HB3  . MET A 1 17 ? -1.075  -5.178  6.624   1.00 0.00 ? 17  MET A HB3  7  
ATOM 9137  H HG2  . MET A 1 17 ? -1.871  -3.114  6.630   1.00 0.00 ? 17  MET A HG2  7  
ATOM 9138  H HG3  . MET A 1 17 ? -2.906  -3.601  7.971   1.00 0.00 ? 17  MET A HG3  7  
ATOM 9139  H HE1  . MET A 1 17 ? 0.671   -3.135  7.275   1.00 0.00 ? 17  MET A HE1  7  
ATOM 9140  H HE2  . MET A 1 17 ? 1.300   -2.711  8.867   1.00 0.00 ? 17  MET A HE2  7  
ATOM 9141  H HE3  . MET A 1 17 ? 0.924   -1.443  7.702   1.00 0.00 ? 17  MET A HE3  7  
ATOM 9142  N N    . GLY A 1 18 ? -0.621  -7.811  7.779   1.00 0.00 ? 18  GLY A N    7  
ATOM 9143  C CA   . GLY A 1 18 ? -0.319  -9.095  7.179   1.00 0.00 ? 18  GLY A CA   7  
ATOM 9144  C C    . GLY A 1 18 ? -0.314  -9.045  5.664   1.00 0.00 ? 18  GLY A C    7  
ATOM 9145  O O    . GLY A 1 18 ? -1.228  -9.556  5.019   1.00 0.00 ? 18  GLY A O    7  
ATOM 9146  H H    . GLY A 1 18 ? 0.082   -7.318  8.254   1.00 0.00 ? 18  GLY A H    7  
ATOM 9147  H HA2  . GLY A 1 18 ? 0.652   -9.419  7.520   1.00 0.00 ? 18  GLY A HA2  7  
ATOM 9148  H HA3  . GLY A 1 18 ? -1.059  -9.813  7.501   1.00 0.00 ? 18  GLY A HA3  7  
ATOM 9149  N N    . LEU A 1 19 ? 0.718   -8.426  5.099   1.00 0.00 ? 19  LEU A N    7  
ATOM 9150  C CA   . LEU A 1 19 ? 0.854   -8.311  3.648   1.00 0.00 ? 19  LEU A CA   7  
ATOM 9151  C C    . LEU A 1 19 ? 2.299   -8.004  3.265   1.00 0.00 ? 19  LEU A C    7  
ATOM 9152  O O    . LEU A 1 19 ? 3.158   -7.845  4.130   1.00 0.00 ? 19  LEU A O    7  
ATOM 9153  C CB   . LEU A 1 19 ? -0.075  -7.224  3.103   1.00 0.00 ? 19  LEU A CB   7  
ATOM 9154  C CG   . LEU A 1 19 ? 0.303   -5.799  3.503   1.00 0.00 ? 19  LEU A CG   7  
ATOM 9155  C CD1  . LEU A 1 19 ? 1.191   -5.161  2.444   1.00 0.00 ? 19  LEU A CD1  7  
ATOM 9156  C CD2  . LEU A 1 19 ? -0.942  -4.958  3.738   1.00 0.00 ? 19  LEU A CD2  7  
ATOM 9157  H H    . LEU A 1 19 ? 1.413   -8.039  5.675   1.00 0.00 ? 19  LEU A H    7  
ATOM 9158  H HA   . LEU A 1 19 ? 0.577   -9.258  3.210   1.00 0.00 ? 19  LEU A HA   7  
ATOM 9159  H HB2  . LEU A 1 19 ? -0.078  -7.289  2.024   1.00 0.00 ? 19  LEU A HB2  7  
ATOM 9160  H HB3  . LEU A 1 19 ? -1.074  -7.422  3.461   1.00 0.00 ? 19  LEU A HB3  7  
ATOM 9161  H HG   . LEU A 1 19 ? 0.860   -5.837  4.426   1.00 0.00 ? 19  LEU A HG   7  
ATOM 9162  H HD11 . LEU A 1 19 ? 0.854   -5.458  1.462   1.00 0.00 ? 19  LEU A HD11 7  
ATOM 9163  H HD12 . LEU A 1 19 ? 2.211   -5.486  2.588   1.00 0.00 ? 19  LEU A HD12 7  
ATOM 9164  H HD13 . LEU A 1 19 ? 1.141   -4.086  2.532   1.00 0.00 ? 19  LEU A HD13 7  
ATOM 9165  H HD21 . LEU A 1 19 ? -1.243  -4.492  2.812   1.00 0.00 ? 19  LEU A HD21 7  
ATOM 9166  H HD22 . LEU A 1 19 ? -0.725  -4.195  4.471   1.00 0.00 ? 19  LEU A HD22 7  
ATOM 9167  H HD23 . LEU A 1 19 ? -1.740  -5.589  4.099   1.00 0.00 ? 19  LEU A HD23 7  
ATOM 9168  N N    . SER A 1 20 ? 2.557   -7.914  1.963   1.00 0.00 ? 20  SER A N    7  
ATOM 9169  C CA   . SER A 1 20 ? 3.892   -7.617  1.465   1.00 0.00 ? 20  SER A CA   7  
ATOM 9170  C C    . SER A 1 20 ? 3.826   -6.572  0.359   1.00 0.00 ? 20  SER A C    7  
ATOM 9171  O O    . SER A 1 20 ? 3.096   -6.739  -0.615  1.00 0.00 ? 20  SER A O    7  
ATOM 9172  C CB   . SER A 1 20 ? 4.561   -8.892  0.945   1.00 0.00 ? 20  SER A CB   7  
ATOM 9173  O OG   . SER A 1 20 ? 4.427   -9.954  1.874   1.00 0.00 ? 20  SER A OG   7  
ATOM 9174  H H    . SER A 1 20 ? 1.827   -8.045  1.321   1.00 0.00 ? 20  SER A H    7  
ATOM 9175  H HA   . SER A 1 20 ? 4.473   -7.223  2.285   1.00 0.00 ? 20  SER A HA   7  
ATOM 9176  H HB2  . SER A 1 20 ? 4.097   -9.184  0.015   1.00 0.00 ? 20  SER A HB2  7  
ATOM 9177  H HB3  . SER A 1 20 ? 5.612   -8.704  0.780   1.00 0.00 ? 20  SER A HB3  7  
ATOM 9178  H HG   . SER A 1 20 ? 4.924   -9.749  2.671   1.00 0.00 ? 20  SER A HG   7  
ATOM 9179  N N    . ILE A 1 21 ? 4.591   -5.494  0.518   1.00 0.00 ? 21  ILE A N    7  
ATOM 9180  C CA   . ILE A 1 21 ? 4.614   -4.419  -0.472  1.00 0.00 ? 21  ILE A CA   7  
ATOM 9181  C C    . ILE A 1 21 ? 6.005   -4.253  -1.079  1.00 0.00 ? 21  ILE A C    7  
ATOM 9182  O O    . ILE A 1 21 ? 6.997   -4.154  -0.359  1.00 0.00 ? 21  ILE A O    7  
ATOM 9183  C CB   . ILE A 1 21 ? 4.155   -3.072  0.129   1.00 0.00 ? 21  ILE A CB   7  
ATOM 9184  C CG1  . ILE A 1 21 ? 4.966   -2.726  1.386   1.00 0.00 ? 21  ILE A CG1  7  
ATOM 9185  C CG2  . ILE A 1 21 ? 2.666   -3.119  0.444   1.00 0.00 ? 21  ILE A CG2  7  
ATOM 9186  C CD1  . ILE A 1 21 ? 6.057   -1.706  1.140   1.00 0.00 ? 21  ILE A CD1  7  
ATOM 9187  H H    . ILE A 1 21 ? 5.151   -5.421  1.318   1.00 0.00 ? 21  ILE A H    7  
ATOM 9188  H HA   . ILE A 1 21 ? 3.925   -4.683  -1.258  1.00 0.00 ? 21  ILE A HA   7  
ATOM 9189  H HB   . ILE A 1 21 ? 4.311   -2.304  -0.612  1.00 0.00 ? 21  ILE A HB   7  
ATOM 9190  H HG12 . ILE A 1 21 ? 4.302   -2.325  2.137   1.00 0.00 ? 21  ILE A HG12 7  
ATOM 9191  H HG13 . ILE A 1 21 ? 5.431   -3.623  1.766   1.00 0.00 ? 21  ILE A HG13 7  
ATOM 9192  H HG21 . ILE A 1 21 ? 2.264   -4.071  0.132   1.00 0.00 ? 21  ILE A HG21 7  
ATOM 9193  H HG22 . ILE A 1 21 ? 2.161   -2.325  -0.085  1.00 0.00 ? 21  ILE A HG22 7  
ATOM 9194  H HG23 . ILE A 1 21 ? 2.517   -2.995  1.507   1.00 0.00 ? 21  ILE A HG23 7  
ATOM 9195  H HD11 . ILE A 1 21 ? 5.640   -0.712  1.195   1.00 0.00 ? 21  ILE A HD11 7  
ATOM 9196  H HD12 . ILE A 1 21 ? 6.484   -1.864  0.161   1.00 0.00 ? 21  ILE A HD12 7  
ATOM 9197  H HD13 . ILE A 1 21 ? 6.827   -1.815  1.890   1.00 0.00 ? 21  ILE A HD13 7  
ATOM 9198  N N    . VAL A 1 22 ? 6.067   -4.221  -2.409  1.00 0.00 ? 22  VAL A N    7  
ATOM 9199  C CA   . VAL A 1 22 ? 7.332   -4.065  -3.120  1.00 0.00 ? 22  VAL A CA   7  
ATOM 9200  C C    . VAL A 1 22 ? 7.397   -2.719  -3.840  1.00 0.00 ? 22  VAL A C    7  
ATOM 9201  O O    . VAL A 1 22 ? 6.433   -2.291  -4.478  1.00 0.00 ? 22  VAL A O    7  
ATOM 9202  C CB   . VAL A 1 22 ? 7.555   -5.198  -4.144  1.00 0.00 ? 22  VAL A CB   7  
ATOM 9203  C CG1  . VAL A 1 22 ? 8.856   -4.995  -4.909  1.00 0.00 ? 22  VAL A CG1  7  
ATOM 9204  C CG2  . VAL A 1 22 ? 7.545   -6.556  -3.456  1.00 0.00 ? 22  VAL A CG2  7  
ATOM 9205  H H    . VAL A 1 22 ? 5.240   -4.302  -2.926  1.00 0.00 ? 22  VAL A H    7  
ATOM 9206  H HA   . VAL A 1 22 ? 8.129   -4.108  -2.392  1.00 0.00 ? 22  VAL A HA   7  
ATOM 9207  H HB   . VAL A 1 22 ? 6.743   -5.174  -4.853  1.00 0.00 ? 22  VAL A HB   7  
ATOM 9208  H HG11 . VAL A 1 22 ? 8.663   -4.412  -5.798  1.00 0.00 ? 22  VAL A HG11 7  
ATOM 9209  H HG12 . VAL A 1 22 ? 9.264   -5.955  -5.189  1.00 0.00 ? 22  VAL A HG12 7  
ATOM 9210  H HG13 . VAL A 1 22 ? 9.562   -4.472  -4.283  1.00 0.00 ? 22  VAL A HG13 7  
ATOM 9211  H HG21 . VAL A 1 22 ? 7.190   -6.444  -2.443  1.00 0.00 ? 22  VAL A HG21 7  
ATOM 9212  H HG22 . VAL A 1 22 ? 8.547   -6.960  -3.444  1.00 0.00 ? 22  VAL A HG22 7  
ATOM 9213  H HG23 . VAL A 1 22 ? 6.893   -7.227  -3.994  1.00 0.00 ? 22  VAL A HG23 7  
ATOM 9214  N N    . ALA A 1 23 ? 8.552   -2.070  -3.740  1.00 0.00 ? 23  ALA A N    7  
ATOM 9215  C CA   . ALA A 1 23 ? 8.782   -0.780  -4.382  1.00 0.00 ? 23  ALA A CA   7  
ATOM 9216  C C    . ALA A 1 23 ? 9.463   -0.978  -5.734  1.00 0.00 ? 23  ALA A C    7  
ATOM 9217  O O    . ALA A 1 23 ? 10.560  -1.538  -5.803  1.00 0.00 ? 23  ALA A O    7  
ATOM 9218  C CB   . ALA A 1 23 ? 9.628   0.117   -3.484  1.00 0.00 ? 23  ALA A CB   7  
ATOM 9219  H H    . ALA A 1 23 ? 9.277   -2.478  -3.226  1.00 0.00 ? 23  ALA A H    7  
ATOM 9220  H HA   . ALA A 1 23 ? 7.825   -0.302  -4.532  1.00 0.00 ? 23  ALA A HA   7  
ATOM 9221  H HB1  . ALA A 1 23 ? 10.275  0.730   -4.093  1.00 0.00 ? 23  ALA A HB1  7  
ATOM 9222  H HB2  . ALA A 1 23 ? 10.227  -0.493  -2.823  1.00 0.00 ? 23  ALA A HB2  7  
ATOM 9223  H HB3  . ALA A 1 23 ? 8.981   0.752   -2.897  1.00 0.00 ? 23  ALA A HB3  7  
ATOM 9224  N N    . ALA A 1 24 ? 8.812   -0.529  -6.808  1.00 0.00 ? 24  ALA A N    7  
ATOM 9225  C CA   . ALA A 1 24 ? 9.369   -0.676  -8.151  1.00 0.00 ? 24  ALA A CA   7  
ATOM 9226  C C    . ALA A 1 24 ? 9.285   0.625   -8.944  1.00 0.00 ? 24  ALA A C    7  
ATOM 9227  O O    . ALA A 1 24 ? 8.360   1.420   -8.762  1.00 0.00 ? 24  ALA A O    7  
ATOM 9228  C CB   . ALA A 1 24 ? 8.659   -1.794  -8.902  1.00 0.00 ? 24  ALA A CB   7  
ATOM 9229  H H    . ALA A 1 24 ? 7.939   -0.095  -6.696  1.00 0.00 ? 24  ALA A H    7  
ATOM 9230  H HA   . ALA A 1 24 ? 10.408  -0.953  -8.049  1.00 0.00 ? 24  ALA A HA   7  
ATOM 9231  H HB1  . ALA A 1 24 ? 9.298   -2.155  -9.695  1.00 0.00 ? 24  ALA A HB1  7  
ATOM 9232  H HB2  . ALA A 1 24 ? 7.739   -1.418  -9.325  1.00 0.00 ? 24  ALA A HB2  7  
ATOM 9233  H HB3  . ALA A 1 24 ? 8.439   -2.603  -8.222  1.00 0.00 ? 24  ALA A HB3  7  
ATOM 9234  N N    . LYS A 1 25 ? 10.258  0.825   -9.831  1.00 0.00 ? 25  LYS A N    7  
ATOM 9235  C CA   . LYS A 1 25 ? 10.311  2.020   -10.668 1.00 0.00 ? 25  LYS A CA   7  
ATOM 9236  C C    . LYS A 1 25 ? 10.374  1.640   -12.148 1.00 0.00 ? 25  LYS A C    7  
ATOM 9237  O O    . LYS A 1 25 ? 10.375  0.457   -12.495 1.00 0.00 ? 25  LYS A O    7  
ATOM 9238  C CB   . LYS A 1 25 ? 11.524  2.877   -10.292 1.00 0.00 ? 25  LYS A CB   7  
ATOM 9239  C CG   . LYS A 1 25 ? 11.186  4.341   -10.052 1.00 0.00 ? 25  LYS A CG   7  
ATOM 9240  C CD   . LYS A 1 25 ? 12.441  5.197   -9.952  1.00 0.00 ? 25  LYS A CD   7  
ATOM 9241  C CE   . LYS A 1 25 ? 12.333  6.222   -8.831  1.00 0.00 ? 25  LYS A CE   7  
ATOM 9242  N NZ   . LYS A 1 25 ? 12.267  7.619   -9.348  1.00 0.00 ? 25  LYS A NZ   7  
ATOM 9243  H H    . LYS A 1 25 ? 10.960  0.148   -9.928  1.00 0.00 ? 25  LYS A H    7  
ATOM 9244  H HA   . LYS A 1 25 ? 9.409   2.589   -10.492 1.00 0.00 ? 25  LYS A HA   7  
ATOM 9245  H HB2  . LYS A 1 25 ? 11.965  2.480   -9.391  1.00 0.00 ? 25  LYS A HB2  7  
ATOM 9246  H HB3  . LYS A 1 25 ? 12.250  2.824   -11.091 1.00 0.00 ? 25  LYS A HB3  7  
ATOM 9247  H HG2  . LYS A 1 25 ? 10.583  4.700   -10.872 1.00 0.00 ? 25  LYS A HG2  7  
ATOM 9248  H HG3  . LYS A 1 25 ? 10.629  4.424   -9.130  1.00 0.00 ? 25  LYS A HG3  7  
ATOM 9249  H HD2  . LYS A 1 25 ? 13.288  4.555   -9.757  1.00 0.00 ? 25  LYS A HD2  7  
ATOM 9250  H HD3  . LYS A 1 25 ? 12.587  5.714   -10.890 1.00 0.00 ? 25  LYS A HD3  7  
ATOM 9251  H HE2  . LYS A 1 25 ? 11.439  6.019   -8.259  1.00 0.00 ? 25  LYS A HE2  7  
ATOM 9252  H HE3  . LYS A 1 25 ? 13.197  6.125   -8.189  1.00 0.00 ? 25  LYS A HE3  7  
ATOM 9253  H HZ1  . LYS A 1 25 ? 11.275  7.915   -9.454  1.00 0.00 ? 25  LYS A HZ1  7  
ATOM 9254  H HZ2  . LYS A 1 25 ? 12.736  7.683   -10.274 1.00 0.00 ? 25  LYS A HZ2  7  
ATOM 9255  H HZ3  . LYS A 1 25 ? 12.742  8.267   -8.687  1.00 0.00 ? 25  LYS A HZ3  7  
ATOM 9256  N N    . GLY A 1 26 ? 10.429  2.649   -13.015 1.00 0.00 ? 26  GLY A N    7  
ATOM 9257  C CA   . GLY A 1 26 ? 10.496  2.403   -14.441 1.00 0.00 ? 26  GLY A CA   7  
ATOM 9258  C C    . GLY A 1 26 ? 10.940  3.630   -15.199 1.00 0.00 ? 26  GLY A C    7  
ATOM 9259  O O    . GLY A 1 26 ? 11.801  4.379   -14.729 1.00 0.00 ? 26  GLY A O    7  
ATOM 9260  H H    . GLY A 1 26 ? 10.431  3.575   -12.686 1.00 0.00 ? 26  GLY A H    7  
ATOM 9261  H HA2  . GLY A 1 26 ? 11.193  1.603   -14.631 1.00 0.00 ? 26  GLY A HA2  7  
ATOM 9262  H HA3  . GLY A 1 26 ? 9.518   2.108   -14.792 1.00 0.00 ? 26  GLY A HA3  7  
ATOM 9263  N N    . ALA A 1 27 ? 10.347  3.851   -16.364 1.00 0.00 ? 27  ALA A N    7  
ATOM 9264  C CA   . ALA A 1 27 ? 10.686  5.011   -17.171 1.00 0.00 ? 27  ALA A CA   7  
ATOM 9265  C C    . ALA A 1 27 ? 9.572   6.050   -17.114 1.00 0.00 ? 27  ALA A C    7  
ATOM 9266  O O    . ALA A 1 27 ? 8.397   5.704   -16.963 1.00 0.00 ? 27  ALA A O    7  
ATOM 9267  C CB   . ALA A 1 27 ? 10.971  4.606   -18.610 1.00 0.00 ? 27  ALA A CB   7  
ATOM 9268  H H    . ALA A 1 27 ? 9.662   3.227   -16.680 1.00 0.00 ? 27  ALA A H    7  
ATOM 9269  H HA   . ALA A 1 27 ? 11.585  5.440   -16.751 1.00 0.00 ? 27  ALA A HA   7  
ATOM 9270  H HB1  . ALA A 1 27 ? 11.321  3.584   -18.635 1.00 0.00 ? 27  ALA A HB1  7  
ATOM 9271  H HB2  . ALA A 1 27 ? 11.728  5.256   -19.023 1.00 0.00 ? 27  ALA A HB2  7  
ATOM 9272  H HB3  . ALA A 1 27 ? 10.066  4.691   -19.194 1.00 0.00 ? 27  ALA A HB3  7  
ATOM 9273  N N    . GLY A 1 28 ? 9.948   7.324   -17.216 1.00 0.00 ? 28  GLY A N    7  
ATOM 9274  C CA   . GLY A 1 28 ? 8.966   8.395   -17.153 1.00 0.00 ? 28  GLY A CA   7  
ATOM 9275  C C    . GLY A 1 28 ? 8.225   8.401   -15.829 1.00 0.00 ? 28  GLY A C    7  
ATOM 9276  O O    . GLY A 1 28 ? 7.040   8.736   -15.771 1.00 0.00 ? 28  GLY A O    7  
ATOM 9277  H H    . GLY A 1 28 ? 10.898  7.538   -17.320 1.00 0.00 ? 28  GLY A H    7  
ATOM 9278  H HA2  . GLY A 1 28 ? 9.470   9.342   -17.278 1.00 0.00 ? 28  GLY A HA2  7  
ATOM 9279  H HA3  . GLY A 1 28 ? 8.254   8.267   -17.955 1.00 0.00 ? 28  GLY A HA3  7  
ATOM 9280  N N    . GLN A 1 29 ? 8.930   8.011   -14.766 1.00 0.00 ? 29  GLN A N    7  
ATOM 9281  C CA   . GLN A 1 29 ? 8.347   7.953   -13.434 1.00 0.00 ? 29  GLN A CA   7  
ATOM 9282  C C    . GLN A 1 29 ? 9.223   8.688   -12.423 1.00 0.00 ? 29  GLN A C    7  
ATOM 9283  O O    . GLN A 1 29 ? 10.256  8.170   -11.991 1.00 0.00 ? 29  GLN A O    7  
ATOM 9284  C CB   . GLN A 1 29 ? 8.175   6.497   -13.004 1.00 0.00 ? 29  GLN A CB   7  
ATOM 9285  C CG   . GLN A 1 29 ? 7.020   6.279   -12.041 1.00 0.00 ? 29  GLN A CG   7  
ATOM 9286  C CD   . GLN A 1 29 ? 5.932   5.401   -12.628 1.00 0.00 ? 29  GLN A CD   7  
ATOM 9287  O OE1  . GLN A 1 29 ? 4.748   5.733   -12.559 1.00 0.00 ? 29  GLN A OE1  7  
ATOM 9288  N NE2  . GLN A 1 29 ? 6.328   4.274   -13.211 1.00 0.00 ? 29  GLN A NE2  7  
ATOM 9289  H H    . GLN A 1 29 ? 9.866   7.748   -14.884 1.00 0.00 ? 29  GLN A H    7  
ATOM 9290  H HA   . GLN A 1 29 ? 7.377   8.422   -13.472 1.00 0.00 ? 29  GLN A HA   7  
ATOM 9291  H HB2  . GLN A 1 29 ? 8.003   5.892   -13.882 1.00 0.00 ? 29  GLN A HB2  7  
ATOM 9292  H HB3  . GLN A 1 29 ? 9.083   6.166   -12.523 1.00 0.00 ? 29  GLN A HB3  7  
ATOM 9293  H HG2  . GLN A 1 29 ? 7.398   5.808   -11.146 1.00 0.00 ? 29  GLN A HG2  7  
ATOM 9294  H HG3  . GLN A 1 29 ? 6.591   7.238   -11.789 1.00 0.00 ? 29  GLN A HG3  7  
ATOM 9295  H HE21 . GLN A 1 29 ? 7.286   4.073   -13.229 1.00 0.00 ? 29  GLN A HE21 7  
ATOM 9296  H HE22 . GLN A 1 29 ? 5.646   3.694   -13.601 1.00 0.00 ? 29  GLN A HE22 7  
ATOM 9297  N N    . ASP A 1 30 ? 8.803   9.892   -12.040 1.00 0.00 ? 30  ASP A N    7  
ATOM 9298  C CA   . ASP A 1 30 ? 9.551   10.687  -11.069 1.00 0.00 ? 30  ASP A CA   7  
ATOM 9299  C C    . ASP A 1 30 ? 9.080   10.403  -9.639  1.00 0.00 ? 30  ASP A C    7  
ATOM 9300  O O    . ASP A 1 30 ? 9.282   11.218  -8.736  1.00 0.00 ? 30  ASP A O    7  
ATOM 9301  C CB   . ASP A 1 30 ? 9.414   12.182  -11.385 1.00 0.00 ? 30  ASP A CB   7  
ATOM 9302  C CG   . ASP A 1 30 ? 10.663  12.977  -11.039 1.00 0.00 ? 30  ASP A CG   7  
ATOM 9303  O OD1  . ASP A 1 30 ? 11.483  12.483  -10.235 1.00 0.00 ? 30  ASP A OD1  7  
ATOM 9304  O OD2  . ASP A 1 30 ? 10.819  14.095  -11.573 1.00 0.00 ? 30  ASP A OD2  7  
ATOM 9305  H H    . ASP A 1 30 ? 7.969   10.250  -12.413 1.00 0.00 ? 30  ASP A H    7  
ATOM 9306  H HA   . ASP A 1 30 ? 10.589  10.406  -11.149 1.00 0.00 ? 30  ASP A HA   7  
ATOM 9307  H HB2  . ASP A 1 30 ? 9.219   12.302  -12.439 1.00 0.00 ? 30  ASP A HB2  7  
ATOM 9308  H HB3  . ASP A 1 30 ? 8.585   12.589  -10.823 1.00 0.00 ? 30  ASP A HB3  7  
ATOM 9309  N N    . LYS A 1 31 ? 8.452   9.241   -9.442  1.00 0.00 ? 31  LYS A N    7  
ATOM 9310  C CA   . LYS A 1 31 ? 7.951   8.839   -8.130  1.00 0.00 ? 31  LYS A CA   7  
ATOM 9311  C C    . LYS A 1 31 ? 8.156   7.338   -7.915  1.00 0.00 ? 31  LYS A C    7  
ATOM 9312  O O    . LYS A 1 31 ? 8.868   6.685   -8.682  1.00 0.00 ? 31  LYS A O    7  
ATOM 9313  C CB   . LYS A 1 31 ? 6.463   9.194   -7.997  1.00 0.00 ? 31  LYS A CB   7  
ATOM 9314  C CG   . LYS A 1 31 ? 6.088   10.528  -8.630  1.00 0.00 ? 31  LYS A CG   7  
ATOM 9315  C CD   . LYS A 1 31 ? 5.289   10.338  -9.911  1.00 0.00 ? 31  LYS A CD   7  
ATOM 9316  C CE   . LYS A 1 31 ? 4.760   11.662  -10.446 1.00 0.00 ? 31  LYS A CE   7  
ATOM 9317  N NZ   . LYS A 1 31 ? 4.603   11.643  -11.928 1.00 0.00 ? 31  LYS A NZ   7  
ATOM 9318  H H    . LYS A 1 31 ? 8.322   8.637   -10.197 1.00 0.00 ? 31  LYS A H    7  
ATOM 9319  H HA   . LYS A 1 31 ? 8.511   9.379   -7.382  1.00 0.00 ? 31  LYS A HA   7  
ATOM 9320  H HB2  . LYS A 1 31 ? 5.877   8.419   -8.468  1.00 0.00 ? 31  LYS A HB2  7  
ATOM 9321  H HB3  . LYS A 1 31 ? 6.210   9.236   -6.949  1.00 0.00 ? 31  LYS A HB3  7  
ATOM 9322  H HG2  . LYS A 1 31 ? 5.496   11.095  -7.928  1.00 0.00 ? 31  LYS A HG2  7  
ATOM 9323  H HG3  . LYS A 1 31 ? 6.992   11.072  -8.859  1.00 0.00 ? 31  LYS A HG3  7  
ATOM 9324  H HD2  . LYS A 1 31 ? 5.928   9.891   -10.657 1.00 0.00 ? 31  LYS A HD2  7  
ATOM 9325  H HD3  . LYS A 1 31 ? 4.454   9.682   -9.709  1.00 0.00 ? 31  LYS A HD3  7  
ATOM 9326  H HE2  . LYS A 1 31 ? 3.798   11.859  -9.995  1.00 0.00 ? 31  LYS A HE2  7  
ATOM 9327  H HE3  . LYS A 1 31 ? 5.451   12.447  -10.176 1.00 0.00 ? 31  LYS A HE3  7  
ATOM 9328  H HZ1  . LYS A 1 31 ? 5.462   12.012  -12.384 1.00 0.00 ? 31  LYS A HZ1  7  
ATOM 9329  H HZ2  . LYS A 1 31 ? 3.795   12.233  -12.210 1.00 0.00 ? 31  LYS A HZ2  7  
ATOM 9330  H HZ3  . LYS A 1 31 ? 4.438   10.670  -12.260 1.00 0.00 ? 31  LYS A HZ3  7  
ATOM 9331  N N    . LEU A 1 32 ? 7.530   6.794   -6.871  1.00 0.00 ? 32  LEU A N    7  
ATOM 9332  C CA   . LEU A 1 32 ? 7.646   5.371   -6.566  1.00 0.00 ? 32  LEU A CA   7  
ATOM 9333  C C    . LEU A 1 32 ? 6.318   4.812   -6.066  1.00 0.00 ? 32  LEU A C    7  
ATOM 9334  O O    . LEU A 1 32 ? 5.751   5.311   -5.092  1.00 0.00 ? 32  LEU A O    7  
ATOM 9335  C CB   . LEU A 1 32 ? 8.740   5.133   -5.522  1.00 0.00 ? 32  LEU A CB   7  
ATOM 9336  C CG   . LEU A 1 32 ? 9.357   3.732   -5.546  1.00 0.00 ? 32  LEU A CG   7  
ATOM 9337  C CD1  . LEU A 1 32 ? 10.052  3.474   -6.877  1.00 0.00 ? 32  LEU A CD1  7  
ATOM 9338  C CD2  . LEU A 1 32 ? 10.330  3.558   -4.388  1.00 0.00 ? 32  LEU A CD2  7  
ATOM 9339  H H    . LEU A 1 32 ? 6.977   7.362   -6.295  1.00 0.00 ? 32  LEU A H    7  
ATOM 9340  H HA   . LEU A 1 32 ? 7.915   4.858   -7.478  1.00 0.00 ? 32  LEU A HA   7  
ATOM 9341  H HB2  . LEU A 1 32 ? 9.526   5.856   -5.682  1.00 0.00 ? 32  LEU A HB2  7  
ATOM 9342  H HB3  . LEU A 1 32 ? 8.317   5.298   -4.542  1.00 0.00 ? 32  LEU A HB3  7  
ATOM 9343  H HG   . LEU A 1 32 ? 8.571   2.999   -5.435  1.00 0.00 ? 32  LEU A HG   7  
ATOM 9344  H HD11 . LEU A 1 32 ? 9.322   3.483   -7.673  1.00 0.00 ? 32  LEU A HD11 7  
ATOM 9345  H HD12 . LEU A 1 32 ? 10.540  2.511   -6.848  1.00 0.00 ? 32  LEU A HD12 7  
ATOM 9346  H HD13 . LEU A 1 32 ? 10.787  4.244   -7.056  1.00 0.00 ? 32  LEU A HD13 7  
ATOM 9347  H HD21 . LEU A 1 32 ? 10.845  2.614   -4.488  1.00 0.00 ? 32  LEU A HD21 7  
ATOM 9348  H HD22 . LEU A 1 32 ? 9.785   3.573   -3.455  1.00 0.00 ? 32  LEU A HD22 7  
ATOM 9349  H HD23 . LEU A 1 32 ? 11.049  4.364   -4.396  1.00 0.00 ? 32  LEU A HD23 7  
ATOM 9350  N N    . GLY A 1 33 ? 5.829   3.774   -6.741  1.00 0.00 ? 33  GLY A N    7  
ATOM 9351  C CA   . GLY A 1 33 ? 4.574   3.162   -6.353  1.00 0.00 ? 33  GLY A CA   7  
ATOM 9352  C C    . GLY A 1 33 ? 4.773   1.939   -5.480  1.00 0.00 ? 33  GLY A C    7  
ATOM 9353  O O    . GLY A 1 33 ? 5.358   0.949   -5.919  1.00 0.00 ? 33  GLY A O    7  
ATOM 9354  H H    . GLY A 1 33 ? 6.326   3.419   -7.509  1.00 0.00 ? 33  GLY A H    7  
ATOM 9355  H HA2  . GLY A 1 33 ? 3.985   3.888   -5.812  1.00 0.00 ? 33  GLY A HA2  7  
ATOM 9356  H HA3  . GLY A 1 33 ? 4.038   2.871   -7.244  1.00 0.00 ? 33  GLY A HA3  7  
ATOM 9357  N N    . ILE A 1 34 ? 4.285   2.004   -4.241  1.00 0.00 ? 34  ILE A N    7  
ATOM 9358  C CA   . ILE A 1 34 ? 4.412   0.886   -3.310  1.00 0.00 ? 34  ILE A CA   7  
ATOM 9359  C C    . ILE A 1 34 ? 3.385   -0.196  -3.634  1.00 0.00 ? 34  ILE A C    7  
ATOM 9360  O O    . ILE A 1 34 ? 2.281   -0.203  -3.092  1.00 0.00 ? 34  ILE A O    7  
ATOM 9361  C CB   . ILE A 1 34 ? 4.239   1.342   -1.844  1.00 0.00 ? 34  ILE A CB   7  
ATOM 9362  C CG1  . ILE A 1 34 ? 5.129   2.553   -1.548  1.00 0.00 ? 34  ILE A CG1  7  
ATOM 9363  C CG2  . ILE A 1 34 ? 4.558   0.202   -0.888  1.00 0.00 ? 34  ILE A CG2  7  
ATOM 9364  C CD1  . ILE A 1 34 ? 6.612   2.281   -1.709  1.00 0.00 ? 34  ILE A CD1  7  
ATOM 9365  H H    . ILE A 1 34 ? 3.826   2.820   -3.950  1.00 0.00 ? 34  ILE A H    7  
ATOM 9366  H HA   . ILE A 1 34 ? 5.404   0.471   -3.423  1.00 0.00 ? 34  ILE A HA   7  
ATOM 9367  H HB   . ILE A 1 34 ? 3.207   1.620   -1.699  1.00 0.00 ? 34  ILE A HB   7  
ATOM 9368  H HG12 . ILE A 1 34 ? 4.867   3.356   -2.221  1.00 0.00 ? 34  ILE A HG12 7  
ATOM 9369  H HG13 . ILE A 1 34 ? 4.959   2.874   -0.531  1.00 0.00 ? 34  ILE A HG13 7  
ATOM 9370  H HG21 . ILE A 1 34 ? 5.288   -0.454  -1.340  1.00 0.00 ? 34  ILE A HG21 7  
ATOM 9371  H HG22 . ILE A 1 34 ? 3.657   -0.353  -0.676  1.00 0.00 ? 34  ILE A HG22 7  
ATOM 9372  H HG23 . ILE A 1 34 ? 4.957   0.606   0.031   1.00 0.00 ? 34  ILE A HG23 7  
ATOM 9373  H HD11 . ILE A 1 34 ? 6.807   1.930   -2.712  1.00 0.00 ? 34  ILE A HD11 7  
ATOM 9374  H HD12 . ILE A 1 34 ? 6.919   1.528   -0.999  1.00 0.00 ? 34  ILE A HD12 7  
ATOM 9375  H HD13 . ILE A 1 34 ? 7.166   3.191   -1.532  1.00 0.00 ? 34  ILE A HD13 7  
ATOM 9376  N N    . TYR A 1 35 ? 3.756   -1.098  -4.536  1.00 0.00 ? 35  TYR A N    7  
ATOM 9377  C CA   . TYR A 1 35 ? 2.869   -2.180  -4.956  1.00 0.00 ? 35  TYR A CA   7  
ATOM 9378  C C    . TYR A 1 35 ? 2.763   -3.267  -3.890  1.00 0.00 ? 35  TYR A C    7  
ATOM 9379  O O    . TYR A 1 35 ? 3.601   -3.355  -2.994  1.00 0.00 ? 35  TYR A O    7  
ATOM 9380  C CB   . TYR A 1 35 ? 3.367   -2.785  -6.270  1.00 0.00 ? 35  TYR A CB   7  
ATOM 9381  C CG   . TYR A 1 35 ? 3.527   -1.771  -7.381  1.00 0.00 ? 35  TYR A CG   7  
ATOM 9382  C CD1  . TYR A 1 35 ? 2.421   -1.282  -8.063  1.00 0.00 ? 35  TYR A CD1  7  
ATOM 9383  C CD2  . TYR A 1 35 ? 4.783   -1.301  -7.746  1.00 0.00 ? 35  TYR A CD2  7  
ATOM 9384  C CE1  . TYR A 1 35 ? 2.560   -0.356  -9.077  1.00 0.00 ? 35  TYR A CE1  7  
ATOM 9385  C CE2  . TYR A 1 35 ? 4.931   -0.374  -8.760  1.00 0.00 ? 35  TYR A CE2  7  
ATOM 9386  C CZ   . TYR A 1 35 ? 3.816   0.095   -9.422  1.00 0.00 ? 35  TYR A CZ   7  
ATOM 9387  O OH   . TYR A 1 35 ? 3.959   1.016   -10.436 1.00 0.00 ? 35  TYR A OH   7  
ATOM 9388  H H    . TYR A 1 35 ? 4.647   -1.029  -4.940  1.00 0.00 ? 35  TYR A H    7  
ATOM 9389  H HA   . TYR A 1 35 ? 1.890   -1.758  -5.117  1.00 0.00 ? 35  TYR A HA   7  
ATOM 9390  H HB2  . TYR A 1 35 ? 4.328   -3.248  -6.103  1.00 0.00 ? 35  TYR A HB2  7  
ATOM 9391  H HB3  . TYR A 1 35 ? 2.664   -3.536  -6.602  1.00 0.00 ? 35  TYR A HB3  7  
ATOM 9392  H HD1  . TYR A 1 35 ? 1.438   -1.636  -7.790  1.00 0.00 ? 35  TYR A HD1  7  
ATOM 9393  H HD2  . TYR A 1 35 ? 5.654   -1.667  -7.225  1.00 0.00 ? 35  TYR A HD2  7  
ATOM 9394  H HE1  . TYR A 1 35 ? 1.686   0.012   -9.592  1.00 0.00 ? 35  TYR A HE1  7  
ATOM 9395  H HE2  . TYR A 1 35 ? 5.915   -0.020  -9.029  1.00 0.00 ? 35  TYR A HE2  7  
ATOM 9396  H HH   . TYR A 1 35 ? 3.760   1.895   -10.104 1.00 0.00 ? 35  TYR A HH   7  
ATOM 9397  N N    . VAL A 1 36 ? 1.726   -4.097  -4.001  1.00 0.00 ? 36  VAL A N    7  
ATOM 9398  C CA   . VAL A 1 36 ? 1.505   -5.187  -3.054  1.00 0.00 ? 36  VAL A CA   7  
ATOM 9399  C C    . VAL A 1 36 ? 1.891   -6.529  -3.671  1.00 0.00 ? 36  VAL A C    7  
ATOM 9400  O O    . VAL A 1 36 ? 1.192   -7.046  -4.545  1.00 0.00 ? 36  VAL A O    7  
ATOM 9401  C CB   . VAL A 1 36 ? 0.033   -5.251  -2.591  1.00 0.00 ? 36  VAL A CB   7  
ATOM 9402  C CG1  . VAL A 1 36 ? -0.149  -6.320  -1.522  1.00 0.00 ? 36  VAL A CG1  7  
ATOM 9403  C CG2  . VAL A 1 36 ? -0.431  -3.894  -2.079  1.00 0.00 ? 36  VAL A CG2  7  
ATOM 9404  H H    . VAL A 1 36 ? 1.095   -3.974  -4.743  1.00 0.00 ? 36  VAL A H    7  
ATOM 9405  H HA   . VAL A 1 36 ? 2.126   -5.009  -2.188  1.00 0.00 ? 36  VAL A HA   7  
ATOM 9406  H HB   . VAL A 1 36 ? -0.579  -5.519  -3.441  1.00 0.00 ? 36  VAL A HB   7  
ATOM 9407  H HG11 . VAL A 1 36 ? -0.915  -6.008  -0.827  1.00 0.00 ? 36  VAL A HG11 7  
ATOM 9408  H HG12 . VAL A 1 36 ? 0.781   -6.463  -0.992  1.00 0.00 ? 36  VAL A HG12 7  
ATOM 9409  H HG13 . VAL A 1 36 ? -0.444  -7.249  -1.988  1.00 0.00 ? 36  VAL A HG13 7  
ATOM 9410  H HG21 . VAL A 1 36 ? -1.449  -3.720  -2.397  1.00 0.00 ? 36  VAL A HG21 7  
ATOM 9411  H HG22 . VAL A 1 36 ? 0.207   -3.120  -2.478  1.00 0.00 ? 36  VAL A HG22 7  
ATOM 9412  H HG23 . VAL A 1 36 ? -0.383  -3.881  -1.000  1.00 0.00 ? 36  VAL A HG23 7  
ATOM 9413  N N    . LYS A 1 37 ? 3.004   -7.089  -3.202  1.00 0.00 ? 37  LYS A N    7  
ATOM 9414  C CA   . LYS A 1 37 ? 3.489   -8.376  -3.694  1.00 0.00 ? 37  LYS A CA   7  
ATOM 9415  C C    . LYS A 1 37 ? 2.482   -9.486  -3.398  1.00 0.00 ? 37  LYS A C    7  
ATOM 9416  O O    . LYS A 1 37 ? 2.162   -10.292 -4.274  1.00 0.00 ? 37  LYS A O    7  
ATOM 9417  C CB   . LYS A 1 37 ? 4.838   -8.716  -3.053  1.00 0.00 ? 37  LYS A CB   7  
ATOM 9418  C CG   . LYS A 1 37 ? 5.704   -9.633  -3.903  1.00 0.00 ? 37  LYS A CG   7  
ATOM 9419  C CD   . LYS A 1 37 ? 7.110   -9.764  -3.335  1.00 0.00 ? 37  LYS A CD   7  
ATOM 9420  C CE   . LYS A 1 37 ? 7.628   -11.191 -3.446  1.00 0.00 ? 37  LYS A CE   7  
ATOM 9421  N NZ   . LYS A 1 37 ? 8.951   -11.363 -2.780  1.00 0.00 ? 37  LYS A NZ   7  
ATOM 9422  H H    . LYS A 1 37 ? 3.510   -6.626  -2.502  1.00 0.00 ? 37  LYS A H    7  
ATOM 9423  H HA   . LYS A 1 37 ? 3.616   -8.297  -4.763  1.00 0.00 ? 37  LYS A HA   7  
ATOM 9424  H HB2  . LYS A 1 37 ? 5.383   -7.800  -2.880  1.00 0.00 ? 37  LYS A HB2  7  
ATOM 9425  H HB3  . LYS A 1 37 ? 4.659   -9.202  -2.105  1.00 0.00 ? 37  LYS A HB3  7  
ATOM 9426  H HG2  . LYS A 1 37 ? 5.248   -10.611 -3.938  1.00 0.00 ? 37  LYS A HG2  7  
ATOM 9427  H HG3  . LYS A 1 37 ? 5.765   -9.227  -4.902  1.00 0.00 ? 37  LYS A HG3  7  
ATOM 9428  H HD2  . LYS A 1 37 ? 7.770   -9.110  -3.884  1.00 0.00 ? 37  LYS A HD2  7  
ATOM 9429  H HD3  . LYS A 1 37 ? 7.097   -9.473  -2.294  1.00 0.00 ? 37  LYS A HD3  7  
ATOM 9430  H HE2  . LYS A 1 37 ? 6.915   -11.856 -2.984  1.00 0.00 ? 37  LYS A HE2  7  
ATOM 9431  H HE3  . LYS A 1 37 ? 7.726   -11.442 -4.492  1.00 0.00 ? 37  LYS A HE3  7  
ATOM 9432  H HZ1  . LYS A 1 37 ? 9.028   -12.321 -2.381  1.00 0.00 ? 37  LYS A HZ1  7  
ATOM 9433  H HZ2  . LYS A 1 37 ? 9.061   -10.671 -2.012  1.00 0.00 ? 37  LYS A HZ2  7  
ATOM 9434  H HZ3  . LYS A 1 37 ? 9.719   -11.224 -3.468  1.00 0.00 ? 37  LYS A HZ3  7  
ATOM 9435  N N    . SER A 1 38 ? 1.985   -9.522  -2.159  1.00 0.00 ? 38  SER A N    7  
ATOM 9436  C CA   . SER A 1 38 ? 1.014   -10.535 -1.752  1.00 0.00 ? 38  SER A CA   7  
ATOM 9437  C C    . SER A 1 38 ? 0.522   -10.286 -0.328  1.00 0.00 ? 38  SER A C    7  
ATOM 9438  O O    . SER A 1 38 ? 1.309   -9.966  0.564   1.00 0.00 ? 38  SER A O    7  
ATOM 9439  C CB   . SER A 1 38 ? 1.623   -11.941 -1.852  1.00 0.00 ? 38  SER A CB   7  
ATOM 9440  O OG   . SER A 1 38 ? 3.018   -11.922 -1.597  1.00 0.00 ? 38  SER A OG   7  
ATOM 9441  H H    . SER A 1 38 ? 2.279   -8.851  -1.505  1.00 0.00 ? 38  SER A H    7  
ATOM 9442  H HA   . SER A 1 38 ? 0.173   -10.471 -2.426  1.00 0.00 ? 38  SER A HA   7  
ATOM 9443  H HB2  . SER A 1 38 ? 1.148   -12.586 -1.127  1.00 0.00 ? 38  SER A HB2  7  
ATOM 9444  H HB3  . SER A 1 38 ? 1.455   -12.333 -2.845  1.00 0.00 ? 38  SER A HB3  7  
ATOM 9445  H HG   . SER A 1 38 ? 3.252   -12.668 -1.040  1.00 0.00 ? 38  SER A HG   7  
ATOM 9446  N N    . VAL A 1 39 ? -0.784  -10.449 -0.122  1.00 0.00 ? 39  VAL A N    7  
ATOM 9447  C CA   . VAL A 1 39 ? -1.383  -10.258 1.196   1.00 0.00 ? 39  VAL A CA   7  
ATOM 9448  C C    . VAL A 1 39 ? -1.322  -11.552 2.004   1.00 0.00 ? 39  VAL A C    7  
ATOM 9449  O O    . VAL A 1 39 ? -1.571  -12.636 1.474   1.00 0.00 ? 39  VAL A O    7  
ATOM 9450  C CB   . VAL A 1 39 ? -2.851  -9.785  1.092   1.00 0.00 ? 39  VAL A CB   7  
ATOM 9451  C CG1  . VAL A 1 39 ? -3.390  -9.395  2.461   1.00 0.00 ? 39  VAL A CG1  7  
ATOM 9452  C CG2  . VAL A 1 39 ? -2.974  -8.619  0.120   1.00 0.00 ? 39  VAL A CG2  7  
ATOM 9453  H H    . VAL A 1 39 ? -1.357  -10.714 -0.872  1.00 0.00 ? 39  VAL A H    7  
ATOM 9454  H HA   . VAL A 1 39 ? -0.815  -9.497  1.713   1.00 0.00 ? 39  VAL A HA   7  
ATOM 9455  H HB   . VAL A 1 39 ? -3.447  -10.603 0.715   1.00 0.00 ? 39  VAL A HB   7  
ATOM 9456  H HG11 . VAL A 1 39 ? -3.413  -10.264 3.101   1.00 0.00 ? 39  VAL A HG11 7  
ATOM 9457  H HG12 . VAL A 1 39 ? -4.391  -9.002  2.354   1.00 0.00 ? 39  VAL A HG12 7  
ATOM 9458  H HG13 . VAL A 1 39 ? -2.752  -8.641  2.899   1.00 0.00 ? 39  VAL A HG13 7  
ATOM 9459  H HG21 . VAL A 1 39 ? -4.012  -8.476  -0.141  1.00 0.00 ? 39  VAL A HG21 7  
ATOM 9460  H HG22 . VAL A 1 39 ? -2.404  -8.831  -0.772  1.00 0.00 ? 39  VAL A HG22 7  
ATOM 9461  H HG23 . VAL A 1 39 ? -2.594  -7.721  0.585   1.00 0.00 ? 39  VAL A HG23 7  
ATOM 9462  N N    . VAL A 1 40 ? -0.985  -11.432 3.285   1.00 0.00 ? 40  VAL A N    7  
ATOM 9463  C CA   . VAL A 1 40 ? -0.887  -12.593 4.166   1.00 0.00 ? 40  VAL A CA   7  
ATOM 9464  C C    . VAL A 1 40 ? -2.274  -13.087 4.571   1.00 0.00 ? 40  VAL A C    7  
ATOM 9465  O O    . VAL A 1 40 ? -3.185  -12.291 4.806   1.00 0.00 ? 40  VAL A O    7  
ATOM 9466  C CB   . VAL A 1 40 ? -0.063  -12.275 5.437   1.00 0.00 ? 40  VAL A CB   7  
ATOM 9467  C CG1  . VAL A 1 40 ? 0.111   -13.519 6.295   1.00 0.00 ? 40  VAL A CG1  7  
ATOM 9468  C CG2  . VAL A 1 40 ? 1.294   -11.690 5.069   1.00 0.00 ? 40  VAL A CG2  7  
ATOM 9469  H H    . VAL A 1 40 ? -0.796  -10.539 3.648   1.00 0.00 ? 40  VAL A H    7  
ATOM 9470  H HA   . VAL A 1 40 ? -0.382  -13.379 3.623   1.00 0.00 ? 40  VAL A HA   7  
ATOM 9471  H HB   . VAL A 1 40 ? -0.603  -11.540 6.015   1.00 0.00 ? 40  VAL A HB   7  
ATOM 9472  H HG11 . VAL A 1 40 ? 0.520   -13.238 7.254   1.00 0.00 ? 40  VAL A HG11 7  
ATOM 9473  H HG12 . VAL A 1 40 ? 0.784   -14.204 5.802   1.00 0.00 ? 40  VAL A HG12 7  
ATOM 9474  H HG13 . VAL A 1 40 ? -0.847  -13.996 6.439   1.00 0.00 ? 40  VAL A HG13 7  
ATOM 9475  H HG21 . VAL A 1 40 ? 1.913   -12.461 4.635   1.00 0.00 ? 40  VAL A HG21 7  
ATOM 9476  H HG22 . VAL A 1 40 ? 1.772   -11.303 5.957   1.00 0.00 ? 40  VAL A HG22 7  
ATOM 9477  H HG23 . VAL A 1 40 ? 1.162   -10.891 4.354   1.00 0.00 ? 40  VAL A HG23 7  
ATOM 9478  N N    . LYS A 1 41 ? -2.426  -14.408 4.647   1.00 0.00 ? 41  LYS A N    7  
ATOM 9479  C CA   . LYS A 1 41 ? -3.700  -15.017 5.019   1.00 0.00 ? 41  LYS A CA   7  
ATOM 9480  C C    . LYS A 1 41 ? -4.104  -14.630 6.439   1.00 0.00 ? 41  LYS A C    7  
ATOM 9481  O O    . LYS A 1 41 ? -3.252  -14.338 7.281   1.00 0.00 ? 41  LYS A O    7  
ATOM 9482  C CB   . LYS A 1 41 ? -3.618  -16.539 4.901   1.00 0.00 ? 41  LYS A CB   7  
ATOM 9483  C CG   . LYS A 1 41 ? -4.413  -17.102 3.734   1.00 0.00 ? 41  LYS A CG   7  
ATOM 9484  C CD   . LYS A 1 41 ? -5.878  -17.306 4.098   1.00 0.00 ? 41  LYS A CD   7  
ATOM 9485  C CE   . LYS A 1 41 ? -6.806  -16.709 3.048   1.00 0.00 ? 41  LYS A CE   7  
ATOM 9486  N NZ   . LYS A 1 41 ? -7.220  -15.320 3.392   1.00 0.00 ? 41  LYS A NZ   7  
ATOM 9487  H H    . LYS A 1 41 ? -1.662  -14.987 4.446   1.00 0.00 ? 41  LYS A H    7  
ATOM 9488  H HA   . LYS A 1 41 ? -4.451  -14.652 4.334   1.00 0.00 ? 41  LYS A HA   7  
ATOM 9489  H HB2  . LYS A 1 41 ? -2.584  -16.824 4.776   1.00 0.00 ? 41  LYS A HB2  7  
ATOM 9490  H HB3  . LYS A 1 41 ? -3.995  -16.980 5.813   1.00 0.00 ? 41  LYS A HB3  7  
ATOM 9491  H HG2  . LYS A 1 41 ? -4.351  -16.415 2.904   1.00 0.00 ? 41  LYS A HG2  7  
ATOM 9492  H HG3  . LYS A 1 41 ? -3.986  -18.052 3.449   1.00 0.00 ? 41  LYS A HG3  7  
ATOM 9493  H HD2  . LYS A 1 41 ? -6.074  -18.366 4.174   1.00 0.00 ? 41  LYS A HD2  7  
ATOM 9494  H HD3  . LYS A 1 41 ? -6.073  -16.834 5.049   1.00 0.00 ? 41  LYS A HD3  7  
ATOM 9495  H HE2  . LYS A 1 41 ? -6.293  -16.697 2.098   1.00 0.00 ? 41  LYS A HE2  7  
ATOM 9496  H HE3  . LYS A 1 41 ? -7.686  -17.330 2.972   1.00 0.00 ? 41  LYS A HE3  7  
ATOM 9497  H HZ1  . LYS A 1 41 ? -6.391  -14.757 3.671   1.00 0.00 ? 41  LYS A HZ1  7  
ATOM 9498  H HZ2  . LYS A 1 41 ? -7.898  -15.332 4.180   1.00 0.00 ? 41  LYS A HZ2  7  
ATOM 9499  H HZ3  . LYS A 1 41 ? -7.669  -14.867 2.569   1.00 0.00 ? 41  LYS A HZ3  7  
ATOM 9500  N N    . GLY A 1 42 ? -5.411  -14.631 6.693   1.00 0.00 ? 42  GLY A N    7  
ATOM 9501  C CA   . GLY A 1 42 ? -5.918  -14.277 8.008   1.00 0.00 ? 42  GLY A CA   7  
ATOM 9502  C C    . GLY A 1 42 ? -5.684  -12.816 8.362   1.00 0.00 ? 42  GLY A C    7  
ATOM 9503  O O    . GLY A 1 42 ? -5.728  -12.447 9.536   1.00 0.00 ? 42  GLY A O    7  
ATOM 9504  H H    . GLY A 1 42 ? -6.037  -14.873 5.980   1.00 0.00 ? 42  GLY A H    7  
ATOM 9505  H HA2  . GLY A 1 42 ? -6.979  -14.473 8.033   1.00 0.00 ? 42  GLY A HA2  7  
ATOM 9506  H HA3  . GLY A 1 42 ? -5.433  -14.898 8.748   1.00 0.00 ? 42  GLY A HA3  7  
ATOM 9507  N N    . GLY A 1 43 ? -5.438  -11.983 7.348   1.00 0.00 ? 43  GLY A N    7  
ATOM 9508  C CA   . GLY A 1 43 ? -5.204  -10.570 7.585   1.00 0.00 ? 43  GLY A CA   7  
ATOM 9509  C C    . GLY A 1 43 ? -6.488  -9.759  7.569   1.00 0.00 ? 43  GLY A C    7  
ATOM 9510  O O    . GLY A 1 43 ? -7.575  -10.302 7.776   1.00 0.00 ? 43  GLY A O    7  
ATOM 9511  H H    . GLY A 1 43 ? -5.417  -12.330 6.432   1.00 0.00 ? 43  GLY A H    7  
ATOM 9512  H HA2  . GLY A 1 43 ? -4.728  -10.451 8.547   1.00 0.00 ? 43  GLY A HA2  7  
ATOM 9513  H HA3  . GLY A 1 43 ? -4.541  -10.193 6.819   1.00 0.00 ? 43  GLY A HA3  7  
ATOM 9514  N N    . ALA A 1 44 ? -6.363  -8.455  7.324   1.00 0.00 ? 44  ALA A N    7  
ATOM 9515  C CA   . ALA A 1 44 ? -7.523  -7.566  7.286   1.00 0.00 ? 44  ALA A CA   7  
ATOM 9516  C C    . ALA A 1 44 ? -8.009  -7.330  5.855   1.00 0.00 ? 44  ALA A C    7  
ATOM 9517  O O    . ALA A 1 44 ? -9.209  -7.202  5.617   1.00 0.00 ? 44  ALA A O    7  
ATOM 9518  C CB   . ALA A 1 44 ? -7.192  -6.241  7.957   1.00 0.00 ? 44  ALA A CB   7  
ATOM 9519  H H    . ALA A 1 44 ? -5.469  -8.082  7.168   1.00 0.00 ? 44  ALA A H    7  
ATOM 9520  H HA   . ALA A 1 44 ? -8.319  -8.035  7.848   1.00 0.00 ? 44  ALA A HA   7  
ATOM 9521  H HB1  . ALA A 1 44 ? -6.210  -5.916  7.646   1.00 0.00 ? 44  ALA A HB1  7  
ATOM 9522  H HB2  . ALA A 1 44 ? -7.207  -6.366  9.029   1.00 0.00 ? 44  ALA A HB2  7  
ATOM 9523  H HB3  . ALA A 1 44 ? -7.923  -5.500  7.670   1.00 0.00 ? 44  ALA A HB3  7  
ATOM 9524  N N    . ALA A 1 45 ? -7.072  -7.273  4.908   1.00 0.00 ? 45  ALA A N    7  
ATOM 9525  C CA   . ALA A 1 45 ? -7.413  -7.052  3.502   1.00 0.00 ? 45  ALA A CA   7  
ATOM 9526  C C    . ALA A 1 45 ? -7.744  -8.366  2.796   1.00 0.00 ? 45  ALA A C    7  
ATOM 9527  O O    . ALA A 1 45 ? -8.587  -8.401  1.898   1.00 0.00 ? 45  ALA A O    7  
ATOM 9528  C CB   . ALA A 1 45 ? -6.273  -6.340  2.784   1.00 0.00 ? 45  ALA A CB   7  
ATOM 9529  H H    . ALA A 1 45 ? -6.131  -7.380  5.158   1.00 0.00 ? 45  ALA A H    7  
ATOM 9530  H HA   . ALA A 1 45 ? -8.282  -6.411  3.468   1.00 0.00 ? 45  ALA A HA   7  
ATOM 9531  H HB1  . ALA A 1 45 ? -5.340  -6.568  3.276   1.00 0.00 ? 45  ALA A HB1  7  
ATOM 9532  H HB2  . ALA A 1 45 ? -6.443  -5.273  2.809   1.00 0.00 ? 45  ALA A HB2  7  
ATOM 9533  H HB3  . ALA A 1 45 ? -6.229  -6.673  1.757   1.00 0.00 ? 45  ALA A HB3  7  
ATOM 9534  N N    . ASP A 1 46 ? -7.073  -9.444  3.202   1.00 0.00 ? 46  ASP A N    7  
ATOM 9535  C CA   . ASP A 1 46 ? -7.293  -10.758 2.603   1.00 0.00 ? 46  ASP A CA   7  
ATOM 9536  C C    . ASP A 1 46 ? -8.705  -11.272 2.881   1.00 0.00 ? 46  ASP A C    7  
ATOM 9537  O O    . ASP A 1 46 ? -9.343  -11.852 2.002   1.00 0.00 ? 46  ASP A O    7  
ATOM 9538  C CB   . ASP A 1 46 ? -6.263  -11.761 3.130   1.00 0.00 ? 46  ASP A CB   7  
ATOM 9539  C CG   . ASP A 1 46 ? -5.703  -12.645 2.033   1.00 0.00 ? 46  ASP A CG   7  
ATOM 9540  O OD1  . ASP A 1 46 ? -6.491  -13.380 1.400   1.00 0.00 ? 46  ASP A OD1  7  
ATOM 9541  O OD2  . ASP A 1 46 ? -4.476  -12.607 1.811   1.00 0.00 ? 46  ASP A OD2  7  
ATOM 9542  H H    . ASP A 1 46 ? -6.411  -9.352  3.920   1.00 0.00 ? 46  ASP A H    7  
ATOM 9543  H HA   . ASP A 1 46 ? -7.165  -10.657 1.535   1.00 0.00 ? 46  ASP A HA   7  
ATOM 9544  H HB2  . ASP A 1 46 ? -5.445  -11.222 3.585   1.00 0.00 ? 46  ASP A HB2  7  
ATOM 9545  H HB3  . ASP A 1 46 ? -6.730  -12.391 3.873   1.00 0.00 ? 46  ASP A HB3  7  
ATOM 9546  N N    . VAL A 1 47 ? -9.186  -11.063 4.105   1.00 0.00 ? 47  VAL A N    7  
ATOM 9547  C CA   . VAL A 1 47 ? -10.522 -11.517 4.487   1.00 0.00 ? 47  VAL A CA   7  
ATOM 9548  C C    . VAL A 1 47 ? -11.605 -10.559 3.986   1.00 0.00 ? 47  VAL A C    7  
ATOM 9549  O O    . VAL A 1 47 ? -12.652 -10.996 3.506   1.00 0.00 ? 47  VAL A O    7  
ATOM 9550  C CB   . VAL A 1 47 ? -10.651 -11.673 6.018   1.00 0.00 ? 47  VAL A CB   7  
ATOM 9551  C CG1  . VAL A 1 47 ? -11.981 -12.319 6.385   1.00 0.00 ? 47  VAL A CG1  7  
ATOM 9552  C CG2  . VAL A 1 47 ? -9.488  -12.483 6.578   1.00 0.00 ? 47  VAL A CG2  7  
ATOM 9553  H H    . VAL A 1 47 ? -8.629  -10.597 4.767   1.00 0.00 ? 47  VAL A H    7  
ATOM 9554  H HA   . VAL A 1 47 ? -10.681 -12.485 4.036   1.00 0.00 ? 47  VAL A HA   7  
ATOM 9555  H HB   . VAL A 1 47 ? -10.621 -10.688 6.462   1.00 0.00 ? 47  VAL A HB   7  
ATOM 9556  H HG11 . VAL A 1 47 ? -12.365 -11.863 7.285   1.00 0.00 ? 47  VAL A HG11 7  
ATOM 9557  H HG12 . VAL A 1 47 ? -11.835 -13.376 6.552   1.00 0.00 ? 47  VAL A HG12 7  
ATOM 9558  H HG13 . VAL A 1 47 ? -12.687 -12.177 5.580   1.00 0.00 ? 47  VAL A HG13 7  
ATOM 9559  H HG21 . VAL A 1 47 ? -9.665  -12.691 7.622   1.00 0.00 ? 47  VAL A HG21 7  
ATOM 9560  H HG22 . VAL A 1 47 ? -8.573  -11.918 6.474   1.00 0.00 ? 47  VAL A HG22 7  
ATOM 9561  H HG23 . VAL A 1 47 ? -9.400  -13.412 6.035   1.00 0.00 ? 47  VAL A HG23 7  
ATOM 9562  N N    . ASP A 1 48 ? -11.351 -9.256  4.103   1.00 0.00 ? 48  ASP A N    7  
ATOM 9563  C CA   . ASP A 1 48 ? -12.311 -8.243  3.664   1.00 0.00 ? 48  ASP A CA   7  
ATOM 9564  C C    . ASP A 1 48 ? -12.583 -8.347  2.164   1.00 0.00 ? 48  ASP A C    7  
ATOM 9565  O O    . ASP A 1 48 ? -13.735 -8.467  1.742   1.00 0.00 ? 48  ASP A O    7  
ATOM 9566  C CB   . ASP A 1 48 ? -11.797 -6.837  3.993   1.00 0.00 ? 48  ASP A CB   7  
ATOM 9567  C CG   . ASP A 1 48 ? -12.333 -6.313  5.311   1.00 0.00 ? 48  ASP A CG   7  
ATOM 9568  O OD1  . ASP A 1 48 ? -12.108 -6.971  6.349   1.00 0.00 ? 48  ASP A OD1  7  
ATOM 9569  O OD2  . ASP A 1 48 ? -12.974 -5.241  5.306   1.00 0.00 ? 48  ASP A OD2  7  
ATOM 9570  H H    . ASP A 1 48 ? -10.500 -8.968  4.496   1.00 0.00 ? 48  ASP A H    7  
ATOM 9571  H HA   . ASP A 1 48 ? -13.235 -8.411  4.196   1.00 0.00 ? 48  ASP A HA   7  
ATOM 9572  H HB2  . ASP A 1 48 ? -10.719 -6.858  4.047   1.00 0.00 ? 48  ASP A HB2  7  
ATOM 9573  H HB3  . ASP A 1 48 ? -12.100 -6.160  3.208   1.00 0.00 ? 48  ASP A HB3  7  
ATOM 9574  N N    . GLY A 1 49 ? -11.518 -8.292  1.367   1.00 0.00 ? 49  GLY A N    7  
ATOM 9575  C CA   . GLY A 1 49 ? -11.660 -8.373  -0.076  1.00 0.00 ? 49  GLY A CA   7  
ATOM 9576  C C    . GLY A 1 49 ? -11.646 -7.007  -0.737  1.00 0.00 ? 49  GLY A C    7  
ATOM 9577  O O    . GLY A 1 49 ? -12.520 -6.696  -1.547  1.00 0.00 ? 49  GLY A O    7  
ATOM 9578  H H    . GLY A 1 49 ? -10.625 -8.191  1.763   1.00 0.00 ? 49  GLY A H    7  
ATOM 9579  H HA2  . GLY A 1 49 ? -10.846 -8.962  -0.474  1.00 0.00 ? 49  GLY A HA2  7  
ATOM 9580  H HA3  . GLY A 1 49 ? -12.593 -8.865  -0.308  1.00 0.00 ? 49  GLY A HA3  7  
ATOM 9581  N N    . ARG A 1 50 ? -10.650 -6.192  -0.393  1.00 0.00 ? 50  ARG A N    7  
ATOM 9582  C CA   . ARG A 1 50 ? -10.522 -4.852  -0.963  1.00 0.00 ? 50  ARG A CA   7  
ATOM 9583  C C    . ARG A 1 50 ? -9.387  -4.807  -1.982  1.00 0.00 ? 50  ARG A C    7  
ATOM 9584  O O    . ARG A 1 50 ? -9.603  -4.474  -3.149  1.00 0.00 ? 50  ARG A O    7  
ATOM 9585  C CB   . ARG A 1 50 ? -10.276 -3.813  0.138   1.00 0.00 ? 50  ARG A CB   7  
ATOM 9586  C CG   . ARG A 1 50 ? -11.398 -3.719  1.159   1.00 0.00 ? 50  ARG A CG   7  
ATOM 9587  C CD   . ARG A 1 50 ? -12.538 -2.847  0.659   1.00 0.00 ? 50  ARG A CD   7  
ATOM 9588  N NE   . ARG A 1 50 ? -13.649 -2.803  1.609   1.00 0.00 ? 50  ARG A NE   7  
ATOM 9589  C CZ   . ARG A 1 50 ? -14.557 -3.773  1.744   1.00 0.00 ? 50  ARG A CZ   7  
ATOM 9590  N NH1  . ARG A 1 50 ? -14.491 -4.869  0.991   1.00 0.00 ? 50  ARG A NH1  7  
ATOM 9591  N NH2  . ARG A 1 50 ? -15.532 -3.647  2.638   1.00 0.00 ? 50  ARG A NH2  7  
ATOM 9592  H H    . ARG A 1 50 ? -9.982  -6.500  0.257   1.00 0.00 ? 50  ARG A H    7  
ATOM 9593  H HA   . ARG A 1 50 ? -11.449 -4.618  -1.465  1.00 0.00 ? 50  ARG A HA   7  
ATOM 9594  H HB2  . ARG A 1 50 ? -9.365  -4.067  0.660   1.00 0.00 ? 50  ARG A HB2  7  
ATOM 9595  H HB3  . ARG A 1 50 ? -10.156 -2.843  -0.323  1.00 0.00 ? 50  ARG A HB3  7  
ATOM 9596  H HG2  . ARG A 1 50 ? -11.777 -4.710  1.357   1.00 0.00 ? 50  ARG A HG2  7  
ATOM 9597  H HG3  . ARG A 1 50 ? -11.005 -3.294  2.072   1.00 0.00 ? 50  ARG A HG3  7  
ATOM 9598  H HD2  . ARG A 1 50 ? -12.167 -1.844  0.506   1.00 0.00 ? 50  ARG A HD2  7  
ATOM 9599  H HD3  . ARG A 1 50 ? -12.894 -3.246  -0.280  1.00 0.00 ? 50  ARG A HD3  7  
ATOM 9600  H HE   . ARG A 1 50 ? -13.722 -2.009  2.179   1.00 0.00 ? 50  ARG A HE   7  
ATOM 9601  H HH11 . ARG A 1 50 ? -13.759 -4.973  0.318   1.00 0.00 ? 50  ARG A HH11 7  
ATOM 9602  H HH12 . ARG A 1 50 ? -15.175 -5.591  1.099   1.00 0.00 ? 50  ARG A HH12 7  
ATOM 9603  H HH21 . ARG A 1 50 ? -15.586 -2.827  3.208   1.00 0.00 ? 50  ARG A HH21 7  
ATOM 9604  H HH22 . ARG A 1 50 ? -16.214 -4.372  2.741   1.00 0.00 ? 50  ARG A HH22 7  
ATOM 9605  N N    . LEU A 1 51 ? -8.180  -5.149  -1.534  1.00 0.00 ? 51  LEU A N    7  
ATOM 9606  C CA   . LEU A 1 51 ? -7.009  -5.155  -2.406  1.00 0.00 ? 51  LEU A CA   7  
ATOM 9607  C C    . LEU A 1 51 ? -6.437  -6.566  -2.531  1.00 0.00 ? 51  LEU A C    7  
ATOM 9608  O O    . LEU A 1 51 ? -6.545  -7.373  -1.605  1.00 0.00 ? 51  LEU A O    7  
ATOM 9609  C CB   . LEU A 1 51 ? -5.937  -4.197  -1.872  1.00 0.00 ? 51  LEU A CB   7  
ATOM 9610  C CG   . LEU A 1 51 ? -5.422  -4.510  -0.464  1.00 0.00 ? 51  LEU A CG   7  
ATOM 9611  C CD1  . LEU A 1 51 ? -4.154  -5.349  -0.529  1.00 0.00 ? 51  LEU A CD1  7  
ATOM 9612  C CD2  . LEU A 1 51 ? -5.172  -3.224  0.311   1.00 0.00 ? 51  LEU A CD2  7  
ATOM 9613  H H    . LEU A 1 51 ? -8.075  -5.408  -0.595  1.00 0.00 ? 51  LEU A H    7  
ATOM 9614  H HA   . LEU A 1 51 ? -7.323  -4.820  -3.384  1.00 0.00 ? 51  LEU A HA   7  
ATOM 9615  H HB2  . LEU A 1 51 ? -5.099  -4.216  -2.553  1.00 0.00 ? 51  LEU A HB2  7  
ATOM 9616  H HB3  . LEU A 1 51 ? -6.350  -3.199  -1.866  1.00 0.00 ? 51  LEU A HB3  7  
ATOM 9617  H HG   . LEU A 1 51 ? -6.170  -5.080  0.066   1.00 0.00 ? 51  LEU A HG   7  
ATOM 9618  H HD11 . LEU A 1 51 ? -3.563  -5.179  0.358   1.00 0.00 ? 51  LEU A HD11 7  
ATOM 9619  H HD12 . LEU A 1 51 ? -3.582  -5.071  -1.402  1.00 0.00 ? 51  LEU A HD12 7  
ATOM 9620  H HD13 . LEU A 1 51 ? -4.418  -6.394  -0.590  1.00 0.00 ? 51  LEU A HD13 7  
ATOM 9621  H HD21 . LEU A 1 51 ? -4.152  -2.903  0.159   1.00 0.00 ? 51  LEU A HD21 7  
ATOM 9622  H HD22 . LEU A 1 51 ? -5.342  -3.399  1.363   1.00 0.00 ? 51  LEU A HD22 7  
ATOM 9623  H HD23 . LEU A 1 51 ? -5.847  -2.456  -0.038  1.00 0.00 ? 51  LEU A HD23 7  
ATOM 9624  N N    . ALA A 1 52 ? -5.833  -6.857  -3.681  1.00 0.00 ? 52  ALA A N    7  
ATOM 9625  C CA   . ALA A 1 52 ? -5.246  -8.170  -3.931  1.00 0.00 ? 52  ALA A CA   7  
ATOM 9626  C C    . ALA A 1 52 ? -3.767  -8.053  -4.297  1.00 0.00 ? 52  ALA A C    7  
ATOM 9627  O O    . ALA A 1 52 ? -3.196  -6.962  -4.269  1.00 0.00 ? 52  ALA A O    7  
ATOM 9628  C CB   . ALA A 1 52 ? -6.012  -8.884  -5.038  1.00 0.00 ? 52  ALA A CB   7  
ATOM 9629  H H    . ALA A 1 52 ? -5.780  -6.171  -4.380  1.00 0.00 ? 52  ALA A H    7  
ATOM 9630  H HA   . ALA A 1 52 ? -5.338  -8.755  -3.026  1.00 0.00 ? 52  ALA A HA   7  
ATOM 9631  H HB1  . ALA A 1 52 ? -6.554  -9.719  -4.620  1.00 0.00 ? 52  ALA A HB1  7  
ATOM 9632  H HB2  . ALA A 1 52 ? -5.317  -9.243  -5.783  1.00 0.00 ? 52  ALA A HB2  7  
ATOM 9633  H HB3  . ALA A 1 52 ? -6.707  -8.198  -5.496  1.00 0.00 ? 52  ALA A HB3  7  
ATOM 9634  N N    . ALA A 1 53 ? -3.153  -9.185  -4.643  1.00 0.00 ? 53  ALA A N    7  
ATOM 9635  C CA   . ALA A 1 53 ? -1.742  -9.208  -5.019  1.00 0.00 ? 53  ALA A CA   7  
ATOM 9636  C C    . ALA A 1 53 ? -1.531  -8.575  -6.394  1.00 0.00 ? 53  ALA A C    7  
ATOM 9637  O O    . ALA A 1 53 ? -2.234  -8.903  -7.352  1.00 0.00 ? 53  ALA A O    7  
ATOM 9638  C CB   . ALA A 1 53 ? -1.211  -10.633 -5.005  1.00 0.00 ? 53  ALA A CB   7  
ATOM 9639  H H    . ALA A 1 53 ? -3.662  -10.024 -4.648  1.00 0.00 ? 53  ALA A H    7  
ATOM 9640  H HA   . ALA A 1 53 ? -1.194  -8.637  -4.283  1.00 0.00 ? 53  ALA A HA   7  
ATOM 9641  H HB1  . ALA A 1 53 ? -0.296  -10.681 -5.577  1.00 0.00 ? 53  ALA A HB1  7  
ATOM 9642  H HB2  . ALA A 1 53 ? -1.944  -11.297 -5.442  1.00 0.00 ? 53  ALA A HB2  7  
ATOM 9643  H HB3  . ALA A 1 53 ? -1.014  -10.934 -3.987  1.00 0.00 ? 53  ALA A HB3  7  
ATOM 9644  N N    . GLY A 1 54 ? -0.563  -7.666  -6.482  1.00 0.00 ? 54  GLY A N    7  
ATOM 9645  C CA   . GLY A 1 54 ? -0.276  -6.997  -7.740  1.00 0.00 ? 54  GLY A CA   7  
ATOM 9646  C C    . GLY A 1 54 ? -0.978  -5.654  -7.865  1.00 0.00 ? 54  GLY A C    7  
ATOM 9647  O O    . GLY A 1 54 ? -1.267  -5.202  -8.974  1.00 0.00 ? 54  GLY A O    7  
ATOM 9648  H H    . GLY A 1 54 ? -0.036  -7.446  -5.683  1.00 0.00 ? 54  GLY A H    7  
ATOM 9649  H HA2  . GLY A 1 54 ? 0.790   -6.840  -7.815  1.00 0.00 ? 54  GLY A HA2  7  
ATOM 9650  H HA3  . GLY A 1 54 ? -0.592  -7.633  -8.555  1.00 0.00 ? 54  GLY A HA3  7  
ATOM 9651  N N    . ASP A 1 55 ? -1.249  -5.014  -6.727  1.00 0.00 ? 55  ASP A N    7  
ATOM 9652  C CA   . ASP A 1 55 ? -1.916  -3.715  -6.714  1.00 0.00 ? 55  ASP A CA   7  
ATOM 9653  C C    . ASP A 1 55 ? -0.908  -2.590  -6.471  1.00 0.00 ? 55  ASP A C    7  
ATOM 9654  O O    . ASP A 1 55 ? 0.256   -2.850  -6.164  1.00 0.00 ? 55  ASP A O    7  
ATOM 9655  C CB   . ASP A 1 55 ? -3.005  -3.692  -5.637  1.00 0.00 ? 55  ASP A CB   7  
ATOM 9656  C CG   . ASP A 1 55 ? -4.341  -4.199  -6.150  1.00 0.00 ? 55  ASP A CG   7  
ATOM 9657  O OD1  . ASP A 1 55 ? -4.384  -5.333  -6.674  1.00 0.00 ? 55  ASP A OD1  7  
ATOM 9658  O OD2  . ASP A 1 55 ? -5.344  -3.466  -6.024  1.00 0.00 ? 55  ASP A OD2  7  
ATOM 9659  H H    . ASP A 1 55 ? -0.991  -5.423  -5.874  1.00 0.00 ? 55  ASP A H    7  
ATOM 9660  H HA   . ASP A 1 55 ? -2.375  -3.569  -7.681  1.00 0.00 ? 55  ASP A HA   7  
ATOM 9661  H HB2  . ASP A 1 55 ? -2.700  -4.317  -4.811  1.00 0.00 ? 55  ASP A HB2  7  
ATOM 9662  H HB3  . ASP A 1 55 ? -3.136  -2.679  -5.287  1.00 0.00 ? 55  ASP A HB3  7  
ATOM 9663  N N    . GLN A 1 56 ? -1.361  -1.341  -6.613  1.00 0.00 ? 56  GLN A N    7  
ATOM 9664  C CA   . GLN A 1 56 ? -0.493  -0.178  -6.410  1.00 0.00 ? 56  GLN A CA   7  
ATOM 9665  C C    . GLN A 1 56 ? -1.023  0.723   -5.293  1.00 0.00 ? 56  GLN A C    7  
ATOM 9666  O O    . GLN A 1 56 ? -2.225  0.978   -5.208  1.00 0.00 ? 56  GLN A O    7  
ATOM 9667  C CB   . GLN A 1 56 ? -0.370  0.625   -7.709  1.00 0.00 ? 56  GLN A CB   7  
ATOM 9668  C CG   . GLN A 1 56 ? 0.636   1.766   -7.631  1.00 0.00 ? 56  GLN A CG   7  
ATOM 9669  C CD   . GLN A 1 56 ? -0.018  3.131   -7.509  1.00 0.00 ? 56  GLN A CD   7  
ATOM 9670  O OE1  . GLN A 1 56 ? -1.243  3.248   -7.449  1.00 0.00 ? 56  GLN A OE1  7  
ATOM 9671  N NE2  . GLN A 1 56 ? 0.802   4.175   -7.472  1.00 0.00 ? 56  GLN A NE2  7  
ATOM 9672  H H    . GLN A 1 56 ? -2.299  -1.197  -6.860  1.00 0.00 ? 56  GLN A H    7  
ATOM 9673  H HA   . GLN A 1 56 ? 0.484   -0.541  -6.129  1.00 0.00 ? 56  GLN A HA   7  
ATOM 9674  H HB2  . GLN A 1 56 ? -0.063  -0.041  -8.501  1.00 0.00 ? 56  GLN A HB2  7  
ATOM 9675  H HB3  . GLN A 1 56 ? -1.336  1.041   -7.955  1.00 0.00 ? 56  GLN A HB3  7  
ATOM 9676  H HG2  . GLN A 1 56 ? 1.268   1.612   -6.769  1.00 0.00 ? 56  GLN A HG2  7  
ATOM 9677  H HG3  . GLN A 1 56 ? 1.243   1.754   -8.525  1.00 0.00 ? 56  GLN A HG3  7  
ATOM 9678  H HE21 . GLN A 1 56 ? 1.767   4.009   -7.524  1.00 0.00 ? 56  GLN A HE21 7  
ATOM 9679  H HE22 . GLN A 1 56 ? 0.408   5.068   -7.396  1.00 0.00 ? 56  GLN A HE22 7  
ATOM 9680  N N    . LEU A 1 57 ? -0.114  1.209   -4.446  1.00 0.00 ? 57  LEU A N    7  
ATOM 9681  C CA   . LEU A 1 57 ? -0.486  2.090   -3.337  1.00 0.00 ? 57  LEU A CA   7  
ATOM 9682  C C    . LEU A 1 57 ? -0.183  3.551   -3.667  1.00 0.00 ? 57  LEU A C    7  
ATOM 9683  O O    . LEU A 1 57 ? 0.599   3.845   -4.575  1.00 0.00 ? 57  LEU A O    7  
ATOM 9684  C CB   . LEU A 1 57 ? 0.258   1.697   -2.056  1.00 0.00 ? 57  LEU A CB   7  
ATOM 9685  C CG   . LEU A 1 57 ? -0.135  0.347   -1.449  1.00 0.00 ? 57  LEU A CG   7  
ATOM 9686  C CD1  . LEU A 1 57 ? 0.860   -0.052  -0.368  1.00 0.00 ? 57  LEU A CD1  7  
ATOM 9687  C CD2  . LEU A 1 57 ? -1.546  0.405   -0.882  1.00 0.00 ? 57  LEU A CD2  7  
ATOM 9688  H H    . LEU A 1 57 ? 0.830   0.975   -4.574  1.00 0.00 ? 57  LEU A H    7  
ATOM 9689  H HA   . LEU A 1 57 ? -1.549  1.985   -3.172  1.00 0.00 ? 57  LEU A HA   7  
ATOM 9690  H HB2  . LEU A 1 57 ? 1.316   1.674   -2.273  1.00 0.00 ? 57  LEU A HB2  7  
ATOM 9691  H HB3  . LEU A 1 57 ? 0.079   2.462   -1.315  1.00 0.00 ? 57  LEU A HB3  7  
ATOM 9692  H HG   . LEU A 1 57 ? -0.112  -0.409  -2.221  1.00 0.00 ? 57  LEU A HG   7  
ATOM 9693  H HD11 . LEU A 1 57 ? 1.653   -0.637  -0.808  1.00 0.00 ? 57  LEU A HD11 7  
ATOM 9694  H HD12 . LEU A 1 57 ? 0.357   -0.637  0.388   1.00 0.00 ? 57  LEU A HD12 7  
ATOM 9695  H HD13 . LEU A 1 57 ? 1.277   0.836   0.082   1.00 0.00 ? 57  LEU A HD13 7  
ATOM 9696  H HD21 . LEU A 1 57 ? -2.191  0.928   -1.572  1.00 0.00 ? 57  LEU A HD21 7  
ATOM 9697  H HD22 . LEU A 1 57 ? -1.532  0.927   0.064   1.00 0.00 ? 57  LEU A HD22 7  
ATOM 9698  H HD23 . LEU A 1 57 ? -1.916  -0.598  -0.733  1.00 0.00 ? 57  LEU A HD23 7  
ATOM 9699  N N    . LEU A 1 58 ? -0.800  4.462   -2.915  1.00 0.00 ? 58  LEU A N    7  
ATOM 9700  C CA   . LEU A 1 58 ? -0.596  5.896   -3.114  1.00 0.00 ? 58  LEU A CA   7  
ATOM 9701  C C    . LEU A 1 58 ? -0.548  6.638   -1.778  1.00 0.00 ? 58  LEU A C    7  
ATOM 9702  O O    . LEU A 1 58 ? 0.398   7.380   -1.508  1.00 0.00 ? 58  LEU A O    7  
ATOM 9703  C CB   . LEU A 1 58 ? -1.705  6.478   -3.995  1.00 0.00 ? 58  LEU A CB   7  
ATOM 9704  C CG   . LEU A 1 58 ? -1.340  6.637   -5.474  1.00 0.00 ? 58  LEU A CG   7  
ATOM 9705  C CD1  . LEU A 1 58 ? -2.472  6.143   -6.361  1.00 0.00 ? 58  LEU A CD1  7  
ATOM 9706  C CD2  . LEU A 1 58 ? -1.008  8.089   -5.789  1.00 0.00 ? 58  LEU A CD2  7  
ATOM 9707  H H    . LEU A 1 58 ? -1.406  4.162   -2.204  1.00 0.00 ? 58  LEU A H    7  
ATOM 9708  H HA   . LEU A 1 58 ? 0.352   6.027   -3.615  1.00 0.00 ? 58  LEU A HA   7  
ATOM 9709  H HB2  . LEU A 1 58 ? -2.568  5.833   -3.923  1.00 0.00 ? 58  LEU A HB2  7  
ATOM 9710  H HB3  . LEU A 1 58 ? -1.971  7.450   -3.606  1.00 0.00 ? 58  LEU A HB3  7  
ATOM 9711  H HG   . LEU A 1 58 ? -0.465  6.040   -5.687  1.00 0.00 ? 58  LEU A HG   7  
ATOM 9712  H HD11 . LEU A 1 58 ? -3.134  6.964   -6.591  1.00 0.00 ? 58  LEU A HD11 7  
ATOM 9713  H HD12 . LEU A 1 58 ? -3.022  5.369   -5.846  1.00 0.00 ? 58  LEU A HD12 7  
ATOM 9714  H HD13 . LEU A 1 58 ? -2.062  5.743   -7.277  1.00 0.00 ? 58  LEU A HD13 7  
ATOM 9715  H HD21 . LEU A 1 58 ? -0.704  8.595   -4.884  1.00 0.00 ? 58  LEU A HD21 7  
ATOM 9716  H HD22 . LEU A 1 58 ? -1.879  8.578   -6.199  1.00 0.00 ? 58  LEU A HD22 7  
ATOM 9717  H HD23 . LEU A 1 58 ? -0.203  8.126   -6.509  1.00 0.00 ? 58  LEU A HD23 7  
ATOM 9718  N N    . SER A 1 59 ? -1.575  6.440   -0.948  1.00 0.00 ? 59  SER A N    7  
ATOM 9719  C CA   . SER A 1 59 ? -1.645  7.100   0.354   1.00 0.00 ? 59  SER A CA   7  
ATOM 9720  C C    . SER A 1 59 ? -1.796  6.091   1.492   1.00 0.00 ? 59  SER A C    7  
ATOM 9721  O O    . SER A 1 59 ? -2.361  5.010   1.311   1.00 0.00 ? 59  SER A O    7  
ATOM 9722  C CB   . SER A 1 59 ? -2.805  8.096   0.384   1.00 0.00 ? 59  SER A CB   7  
ATOM 9723  O OG   . SER A 1 59 ? -2.472  9.284   -0.313  1.00 0.00 ? 59  SER A OG   7  
ATOM 9724  H H    . SER A 1 59 ? -2.303  5.842   -1.220  1.00 0.00 ? 59  SER A H    7  
ATOM 9725  H HA   . SER A 1 59 ? -0.721  7.641   0.495   1.00 0.00 ? 59  SER A HA   7  
ATOM 9726  H HB2  . SER A 1 59 ? -3.674  7.652   -0.079  1.00 0.00 ? 59  SER A HB2  7  
ATOM 9727  H HB3  . SER A 1 59 ? -3.032  8.347   1.410   1.00 0.00 ? 59  SER A HB3  7  
ATOM 9728  H HG   . SER A 1 59 ? -2.554  10.036  0.279   1.00 0.00 ? 59  SER A HG   7  
ATOM 9729  N N    . VAL A 1 60 ? -1.287  6.463   2.668   1.00 0.00 ? 60  VAL A N    7  
ATOM 9730  C CA   . VAL A 1 60 ? -1.357  5.608   3.850   1.00 0.00 ? 60  VAL A CA   7  
ATOM 9731  C C    . VAL A 1 60 ? -1.677  6.431   5.095   1.00 0.00 ? 60  VAL A C    7  
ATOM 9732  O O    . VAL A 1 60 ? -1.073  7.482   5.326   1.00 0.00 ? 60  VAL A O    7  
ATOM 9733  C CB   . VAL A 1 60 ? -0.033  4.853   4.078   1.00 0.00 ? 60  VAL A CB   7  
ATOM 9734  C CG1  . VAL A 1 60 ? -0.183  3.825   5.192   1.00 0.00 ? 60  VAL A CG1  7  
ATOM 9735  C CG2  . VAL A 1 60 ? 0.435   4.189   2.791   1.00 0.00 ? 60  VAL A CG2  7  
ATOM 9736  H H    . VAL A 1 60 ? -0.854  7.340   2.743   1.00 0.00 ? 60  VAL A H    7  
ATOM 9737  H HA   . VAL A 1 60 ? -2.143  4.883   3.694   1.00 0.00 ? 60  VAL A HA   7  
ATOM 9738  H HB   . VAL A 1 60 ? 0.716   5.570   4.381   1.00 0.00 ? 60  VAL A HB   7  
ATOM 9739  H HG11 . VAL A 1 60 ? -1.061  3.223   5.011   1.00 0.00 ? 60  VAL A HG11 7  
ATOM 9740  H HG12 . VAL A 1 60 ? -0.283  4.332   6.140   1.00 0.00 ? 60  VAL A HG12 7  
ATOM 9741  H HG13 . VAL A 1 60 ? 0.691   3.190   5.214   1.00 0.00 ? 60  VAL A HG13 7  
ATOM 9742  H HG21 . VAL A 1 60 ? 1.133   3.400   3.026   1.00 0.00 ? 60  VAL A HG21 7  
ATOM 9743  H HG22 . VAL A 1 60 ? 0.919   4.922   2.164   1.00 0.00 ? 60  VAL A HG22 7  
ATOM 9744  H HG23 . VAL A 1 60 ? -0.415  3.775   2.270   1.00 0.00 ? 60  VAL A HG23 7  
ATOM 9745  N N    . ASP A 1 61 ? -2.629  5.945   5.891   1.00 0.00 ? 61  ASP A N    7  
ATOM 9746  C CA   . ASP A 1 61 ? -3.044  6.628   7.118   1.00 0.00 ? 61  ASP A CA   7  
ATOM 9747  C C    . ASP A 1 61 ? -3.432  8.086   6.836   1.00 0.00 ? 61  ASP A C    7  
ATOM 9748  O O    . ASP A 1 61 ? -3.149  8.982   7.634   1.00 0.00 ? 61  ASP A O    7  
ATOM 9749  C CB   . ASP A 1 61 ? -1.923  6.564   8.167   1.00 0.00 ? 61  ASP A CB   7  
ATOM 9750  C CG   . ASP A 1 61 ? -1.982  5.307   9.022   1.00 0.00 ? 61  ASP A CG   7  
ATOM 9751  O OD1  . ASP A 1 61 ? -2.604  4.313   8.585   1.00 0.00 ? 61  ASP A OD1  7  
ATOM 9752  O OD2  . ASP A 1 61 ? -1.403  5.317   10.128  1.00 0.00 ? 61  ASP A OD2  7  
ATOM 9753  H H    . ASP A 1 61 ? -3.068  5.103   5.646   1.00 0.00 ? 61  ASP A H    7  
ATOM 9754  H HA   . ASP A 1 61 ? -3.910  6.111   7.503   1.00 0.00 ? 61  ASP A HA   7  
ATOM 9755  H HB2  . ASP A 1 61 ? -0.967  6.587   7.665   1.00 0.00 ? 61  ASP A HB2  7  
ATOM 9756  H HB3  . ASP A 1 61 ? -2.000  7.422   8.818   1.00 0.00 ? 61  ASP A HB3  7  
ATOM 9757  N N    . GLY A 1 62 ? -4.084  8.311   5.692   1.00 0.00 ? 62  GLY A N    7  
ATOM 9758  C CA   . GLY A 1 62 ? -4.506  9.653   5.317   1.00 0.00 ? 62  GLY A CA   7  
ATOM 9759  C C    . GLY A 1 62 ? -3.349  10.560  4.918   1.00 0.00 ? 62  GLY A C    7  
ATOM 9760  O O    . GLY A 1 62 ? -3.443  11.781  5.049   1.00 0.00 ? 62  GLY A O    7  
ATOM 9761  H H    . GLY A 1 62 ? -4.282  7.558   5.097   1.00 0.00 ? 62  GLY A H    7  
ATOM 9762  H HA2  . GLY A 1 62 ? -5.189  9.579   4.483   1.00 0.00 ? 62  GLY A HA2  7  
ATOM 9763  H HA3  . GLY A 1 62 ? -5.027  10.100  6.151   1.00 0.00 ? 62  GLY A HA3  7  
ATOM 9764  N N    . ARG A 1 63 ? -2.259  9.967   4.424   1.00 0.00 ? 63  ARG A N    7  
ATOM 9765  C CA   . ARG A 1 63 ? -1.090  10.738  4.000   1.00 0.00 ? 63  ARG A CA   7  
ATOM 9766  C C    . ARG A 1 63 ? -0.664  10.341  2.591   1.00 0.00 ? 63  ARG A C    7  
ATOM 9767  O O    . ARG A 1 63 ? -0.824  9.189   2.191   1.00 0.00 ? 63  ARG A O    7  
ATOM 9768  C CB   . ARG A 1 63 ? 0.078   10.528  4.968   1.00 0.00 ? 63  ARG A CB   7  
ATOM 9769  C CG   . ARG A 1 63 ? -0.119  11.198  6.319   1.00 0.00 ? 63  ARG A CG   7  
ATOM 9770  C CD   . ARG A 1 63 ? 0.715   10.533  7.406   1.00 0.00 ? 63  ARG A CD   7  
ATOM 9771  N NE   . ARG A 1 63 ? 1.994   11.214  7.612   1.00 0.00 ? 63  ARG A NE   7  
ATOM 9772  C CZ   . ARG A 1 63 ? 3.093   10.986  6.886   1.00 0.00 ? 63  ARG A CZ   7  
ATOM 9773  N NH1  . ARG A 1 63 ? 3.084   10.082  5.910   1.00 0.00 ? 63  ARG A NH1  7  
ATOM 9774  N NH2  . ARG A 1 63 ? 4.208   11.661  7.143   1.00 0.00 ? 63  ARG A NH2  7  
ATOM 9775  H H    . ARG A 1 63 ? -2.242  8.990   4.337   1.00 0.00 ? 63  ARG A H    7  
ATOM 9776  H HA   . ARG A 1 63 ? -1.363  11.782  4.000   1.00 0.00 ? 63  ARG A HA   7  
ATOM 9777  H HB2  . ARG A 1 63 ? 0.212   9.469   5.130   1.00 0.00 ? 63  ARG A HB2  7  
ATOM 9778  H HB3  . ARG A 1 63 ? 0.975   10.931  4.520   1.00 0.00 ? 63  ARG A HB3  7  
ATOM 9779  H HG2  . ARG A 1 63 ? 0.172   12.234  6.240   1.00 0.00 ? 63  ARG A HG2  7  
ATOM 9780  H HG3  . ARG A 1 63 ? -1.163  11.135  6.591   1.00 0.00 ? 63  ARG A HG3  7  
ATOM 9781  H HD2  . ARG A 1 63 ? 0.157   10.555  8.330   1.00 0.00 ? 63  ARG A HD2  7  
ATOM 9782  H HD3  . ARG A 1 63 ? 0.902   9.508   7.125   1.00 0.00 ? 63  ARG A HD3  7  
ATOM 9783  H HE   . ARG A 1 63 ? 2.036   11.883  8.328   1.00 0.00 ? 63  ARG A HE   7  
ATOM 9784  H HH11 . ARG A 1 63 ? 2.253   9.565   5.711   1.00 0.00 ? 63  ARG A HH11 7  
ATOM 9785  H HH12 . ARG A 1 63 ? 3.911   9.921   5.370   1.00 0.00 ? 63  ARG A HH12 7  
ATOM 9786  H HH21 . ARG A 1 63 ? 4.224   12.339  7.879   1.00 0.00 ? 63  ARG A HH21 7  
ATOM 9787  H HH22 . ARG A 1 63 ? 5.033   11.493  6.602   1.00 0.00 ? 63  ARG A HH22 7  
ATOM 9788  N N    . SER A 1 64 ? -0.117  11.300  1.846   1.00 0.00 ? 64  SER A N    7  
ATOM 9789  C CA   . SER A 1 64 ? 0.334   11.047  0.480   1.00 0.00 ? 64  SER A CA   7  
ATOM 9790  C C    . SER A 1 64 ? 1.791   10.590  0.461   1.00 0.00 ? 64  SER A C    7  
ATOM 9791  O O    . SER A 1 64 ? 2.641   11.163  1.144   1.00 0.00 ? 64  SER A O    7  
ATOM 9792  C CB   . SER A 1 64 ? 0.169   12.302  -0.382  1.00 0.00 ? 64  SER A CB   7  
ATOM 9793  O OG   . SER A 1 64 ? -1.167  12.775  -0.345  1.00 0.00 ? 64  SER A OG   7  
ATOM 9794  H H    . SER A 1 64 ? -0.014  12.199  2.223   1.00 0.00 ? 64  SER A H    7  
ATOM 9795  H HA   . SER A 1 64 ? -0.281  10.259  0.071   1.00 0.00 ? 64  SER A HA   7  
ATOM 9796  H HB2  . SER A 1 64 ? 0.823   13.079  -0.012  1.00 0.00 ? 64  SER A HB2  7  
ATOM 9797  H HB3  . SER A 1 64 ? 0.429   12.070  -1.405  1.00 0.00 ? 64  SER A HB3  7  
ATOM 9798  H HG   . SER A 1 64 ? -1.562  12.690  -1.216  1.00 0.00 ? 64  SER A HG   7  
ATOM 9799  N N    . LEU A 1 65 ? 2.070   9.553   -0.327  1.00 0.00 ? 65  LEU A N    7  
ATOM 9800  C CA   . LEU A 1 65 ? 3.424   9.016   -0.438  1.00 0.00 ? 65  LEU A CA   7  
ATOM 9801  C C    . LEU A 1 65 ? 3.835   8.868   -1.901  1.00 0.00 ? 65  LEU A C    7  
ATOM 9802  O O    . LEU A 1 65 ? 4.315   7.812   -2.321  1.00 0.00 ? 65  LEU A O    7  
ATOM 9803  C CB   . LEU A 1 65 ? 3.525   7.668   0.282   1.00 0.00 ? 65  LEU A CB   7  
ATOM 9804  C CG   . LEU A 1 65 ? 3.185   7.699   1.774   1.00 0.00 ? 65  LEU A CG   7  
ATOM 9805  C CD1  . LEU A 1 65 ? 1.747   7.259   2.004   1.00 0.00 ? 65  LEU A CD1  7  
ATOM 9806  C CD2  . LEU A 1 65 ? 4.149   6.821   2.559   1.00 0.00 ? 65  LEU A CD2  7  
ATOM 9807  H H    . LEU A 1 65 ? 1.348   9.138   -0.846  1.00 0.00 ? 65  LEU A H    7  
ATOM 9808  H HA   . LEU A 1 65 ? 4.095   9.715   0.036   1.00 0.00 ? 65  LEU A HA   7  
ATOM 9809  H HB2  . LEU A 1 65 ? 2.856   6.972   -0.206  1.00 0.00 ? 65  LEU A HB2  7  
ATOM 9810  H HB3  . LEU A 1 65 ? 4.534   7.303   0.174   1.00 0.00 ? 65  LEU A HB3  7  
ATOM 9811  H HG   . LEU A 1 65 ? 3.282   8.713   2.137   1.00 0.00 ? 65  LEU A HG   7  
ATOM 9812  H HD11 . LEU A 1 65 ? 1.440   6.600   1.205   1.00 0.00 ? 65  LEU A HD11 7  
ATOM 9813  H HD12 . LEU A 1 65 ? 1.105   8.125   2.022   1.00 0.00 ? 65  LEU A HD12 7  
ATOM 9814  H HD13 . LEU A 1 65 ? 1.676   6.739   2.948   1.00 0.00 ? 65  LEU A HD13 7  
ATOM 9815  H HD21 . LEU A 1 65 ? 4.339   7.269   3.522   1.00 0.00 ? 65  LEU A HD21 7  
ATOM 9816  H HD22 . LEU A 1 65 ? 5.078   6.730   2.015   1.00 0.00 ? 65  LEU A HD22 7  
ATOM 9817  H HD23 . LEU A 1 65 ? 3.715   5.842   2.695   1.00 0.00 ? 65  LEU A HD23 7  
ATOM 9818  N N    . VAL A 1 66 ? 3.648   9.937   -2.675  1.00 0.00 ? 66  VAL A N    7  
ATOM 9819  C CA   . VAL A 1 66 ? 4.003   9.929   -4.088  1.00 0.00 ? 66  VAL A CA   7  
ATOM 9820  C C    . VAL A 1 66 ? 5.408   10.487  -4.299  1.00 0.00 ? 66  VAL A C    7  
ATOM 9821  O O    . VAL A 1 66 ? 5.616   11.702  -4.313  1.00 0.00 ? 66  VAL A O    7  
ATOM 9822  C CB   . VAL A 1 66 ? 2.990   10.730  -4.931  1.00 0.00 ? 66  VAL A CB   7  
ATOM 9823  C CG1  . VAL A 1 66 ? 3.488   10.903  -6.360  1.00 0.00 ? 66  VAL A CG1  7  
ATOM 9824  C CG2  . VAL A 1 66 ? 1.636   10.039  -4.912  1.00 0.00 ? 66  VAL A CG2  7  
ATOM 9825  H H    . VAL A 1 66 ? 3.265   10.750  -2.284  1.00 0.00 ? 66  VAL A H    7  
ATOM 9826  H HA   . VAL A 1 66 ? 3.985   8.902   -4.425  1.00 0.00 ? 66  VAL A HA   7  
ATOM 9827  H HB   . VAL A 1 66 ? 2.877   11.710  -4.491  1.00 0.00 ? 66  VAL A HB   7  
ATOM 9828  H HG11 . VAL A 1 66 ? 4.035   11.831  -6.441  1.00 0.00 ? 66  VAL A HG11 7  
ATOM 9829  H HG12 . VAL A 1 66 ? 2.646   10.922  -7.035  1.00 0.00 ? 66  VAL A HG12 7  
ATOM 9830  H HG13 . VAL A 1 66 ? 4.138   10.079  -6.618  1.00 0.00 ? 66  VAL A HG13 7  
ATOM 9831  H HG21 . VAL A 1 66 ? 1.780   8.978   -4.766  1.00 0.00 ? 66  VAL A HG21 7  
ATOM 9832  H HG22 . VAL A 1 66 ? 1.132   10.209  -5.850  1.00 0.00 ? 66  VAL A HG22 7  
ATOM 9833  H HG23 . VAL A 1 66 ? 1.040   10.437  -4.104  1.00 0.00 ? 66  VAL A HG23 7  
ATOM 9834  N N    . GLY A 1 67 ? 6.363   9.579   -4.456  1.00 0.00 ? 67  GLY A N    7  
ATOM 9835  C CA   . GLY A 1 67 ? 7.748   9.971   -4.662  1.00 0.00 ? 67  GLY A CA   7  
ATOM 9836  C C    . GLY A 1 67 ? 8.608   9.750   -3.429  1.00 0.00 ? 67  GLY A C    7  
ATOM 9837  O O    . GLY A 1 67 ? 9.521   10.531  -3.154  1.00 0.00 ? 67  GLY A O    7  
ATOM 9838  H H    . GLY A 1 67 ? 6.123   8.629   -4.429  1.00 0.00 ? 67  GLY A H    7  
ATOM 9839  H HA2  . GLY A 1 67 ? 8.156   9.392   -5.477  1.00 0.00 ? 67  GLY A HA2  7  
ATOM 9840  H HA3  . GLY A 1 67 ? 7.781   11.017  -4.928  1.00 0.00 ? 67  GLY A HA3  7  
ATOM 9841  N N    . LEU A 1 68 ? 8.315   8.682   -2.689  1.00 0.00 ? 68  LEU A N    7  
ATOM 9842  C CA   . LEU A 1 68 ? 9.061   8.351   -1.480  1.00 0.00 ? 68  LEU A CA   7  
ATOM 9843  C C    . LEU A 1 68 ? 9.666   6.954   -1.583  1.00 0.00 ? 68  LEU A C    7  
ATOM 9844  O O    . LEU A 1 68 ? 9.146   6.093   -2.295  1.00 0.00 ? 68  LEU A O    7  
ATOM 9845  C CB   . LEU A 1 68 ? 8.147   8.423   -0.253  1.00 0.00 ? 68  LEU A CB   7  
ATOM 9846  C CG   . LEU A 1 68 ? 7.865   9.830   0.277   1.00 0.00 ? 68  LEU A CG   7  
ATOM 9847  C CD1  . LEU A 1 68 ? 7.020   9.758   1.540   1.00 0.00 ? 68  LEU A CD1  7  
ATOM 9848  C CD2  . LEU A 1 68 ? 9.165   10.578  0.544   1.00 0.00 ? 68  LEU A CD2  7  
ATOM 9849  H H    . LEU A 1 68 ? 7.578   8.098   -2.964  1.00 0.00 ? 68  LEU A H    7  
ATOM 9850  H HA   . LEU A 1 68 ? 9.858   9.070   -1.370  1.00 0.00 ? 68  LEU A HA   7  
ATOM 9851  H HB2  . LEU A 1 68 ? 7.203   7.963   -0.508  1.00 0.00 ? 68  LEU A HB2  7  
ATOM 9852  H HB3  . LEU A 1 68 ? 8.602   7.850   0.541   1.00 0.00 ? 68  LEU A HB3  7  
ATOM 9853  H HG   . LEU A 1 68 ? 7.306   10.382  -0.466  1.00 0.00 ? 68  LEU A HG   7  
ATOM 9854  H HD11 . LEU A 1 68 ? 7.296   10.563  2.205   1.00 0.00 ? 68  LEU A HD11 7  
ATOM 9855  H HD12 . LEU A 1 68 ? 7.189   8.811   2.032   1.00 0.00 ? 68  LEU A HD12 7  
ATOM 9856  H HD13 . LEU A 1 68 ? 5.976   9.847   1.280   1.00 0.00 ? 68  LEU A HD13 7  
ATOM 9857  H HD21 . LEU A 1 68 ? 9.858   9.926   1.054   1.00 0.00 ? 68  LEU A HD21 7  
ATOM 9858  H HD22 . LEU A 1 68 ? 8.963   11.442  1.160   1.00 0.00 ? 68  LEU A HD22 7  
ATOM 9859  H HD23 . LEU A 1 68 ? 9.595   10.898  -0.394  1.00 0.00 ? 68  LEU A HD23 7  
ATOM 9860  N N    . SER A 1 69 ? 10.761  6.733   -0.859  1.00 0.00 ? 69  SER A N    7  
ATOM 9861  C CA   . SER A 1 69 ? 11.430  5.436   -0.859  1.00 0.00 ? 69  SER A CA   7  
ATOM 9862  C C    . SER A 1 69 ? 10.642  4.428   -0.026  1.00 0.00 ? 69  SER A C    7  
ATOM 9863  O O    . SER A 1 69 ? 9.848   4.812   0.837   1.00 0.00 ? 69  SER A O    7  
ATOM 9864  C CB   . SER A 1 69 ? 12.851  5.570   -0.307  1.00 0.00 ? 69  SER A CB   7  
ATOM 9865  O OG   . SER A 1 69 ? 13.680  6.288   -1.205  1.00 0.00 ? 69  SER A OG   7  
ATOM 9866  H H    . SER A 1 69 ? 11.123  7.457   -0.306  1.00 0.00 ? 69  SER A H    7  
ATOM 9867  H HA   . SER A 1 69 ? 11.478  5.085   -1.879  1.00 0.00 ? 69  SER A HA   7  
ATOM 9868  H HB2  . SER A 1 69 ? 12.821  6.097   0.635   1.00 0.00 ? 69  SER A HB2  7  
ATOM 9869  H HB3  . SER A 1 69 ? 13.271  4.586   -0.155  1.00 0.00 ? 69  SER A HB3  7  
ATOM 9870  H HG   . SER A 1 69 ? 14.491  6.542   -0.760  1.00 0.00 ? 69  SER A HG   7  
ATOM 9871  N N    . GLN A 1 70 ? 10.862  3.141   -0.288  1.00 0.00 ? 70  GLN A N    7  
ATOM 9872  C CA   . GLN A 1 70 ? 10.168  2.079   0.442   1.00 0.00 ? 70  GLN A CA   7  
ATOM 9873  C C    . GLN A 1 70 ? 10.403  2.182   1.952   1.00 0.00 ? 70  GLN A C    7  
ATOM 9874  O O    . GLN A 1 70 ? 9.580   1.718   2.738   1.00 0.00 ? 70  GLN A O    7  
ATOM 9875  C CB   . GLN A 1 70 ? 10.615  0.703   -0.055  1.00 0.00 ? 70  GLN A CB   7  
ATOM 9876  C CG   . GLN A 1 70 ? 9.476   -0.300  -0.171  1.00 0.00 ? 70  GLN A CG   7  
ATOM 9877  C CD   . GLN A 1 70 ? 9.962   -1.733  -0.258  1.00 0.00 ? 70  GLN A CD   7  
ATOM 9878  O OE1  . GLN A 1 70 ? 11.055  -2.064  0.204   1.00 0.00 ? 70  GLN A OE1  7  
ATOM 9879  N NE2  . GLN A 1 70 ? 9.146   -2.598  -0.845  1.00 0.00 ? 70  GLN A NE2  7  
ATOM 9880  H H    . GLN A 1 70 ? 11.504  2.898   -0.989  1.00 0.00 ? 70  GLN A H    7  
ATOM 9881  H HA   . GLN A 1 70 ? 9.110   2.190   0.250   1.00 0.00 ? 70  GLN A HA   7  
ATOM 9882  H HB2  . GLN A 1 70 ? 11.071  0.813   -1.028  1.00 0.00 ? 70  GLN A HB2  7  
ATOM 9883  H HB3  . GLN A 1 70 ? 11.347  0.305   0.632   1.00 0.00 ? 70  GLN A HB3  7  
ATOM 9884  H HG2  . GLN A 1 70 ? 8.839   -0.206  0.696   1.00 0.00 ? 70  GLN A HG2  7  
ATOM 9885  H HG3  . GLN A 1 70 ? 8.905   -0.076  -1.060  1.00 0.00 ? 70  GLN A HG3  7  
ATOM 9886  H HE21 . GLN A 1 70 ? 8.286   -2.270  -1.184  1.00 0.00 ? 70  GLN A HE21 7  
ATOM 9887  H HE22 . GLN A 1 70 ? 9.435   -3.531  -0.915  1.00 0.00 ? 70  GLN A HE22 7  
ATOM 9888  N N    . GLU A 1 71 ? 11.523  2.790   2.354   1.00 0.00 ? 71  GLU A N    7  
ATOM 9889  C CA   . GLU A 1 71 ? 11.842  2.947   3.773   1.00 0.00 ? 71  GLU A CA   7  
ATOM 9890  C C    . GLU A 1 71 ? 10.736  3.717   4.493   1.00 0.00 ? 71  GLU A C    7  
ATOM 9891  O O    . GLU A 1 71 ? 10.244  3.287   5.535   1.00 0.00 ? 71  GLU A O    7  
ATOM 9892  C CB   . GLU A 1 71 ? 13.181  3.672   3.946   1.00 0.00 ? 71  GLU A CB   7  
ATOM 9893  C CG   . GLU A 1 71 ? 14.384  2.740   3.955   1.00 0.00 ? 71  GLU A CG   7  
ATOM 9894  C CD   . GLU A 1 71 ? 15.296  2.964   5.148   1.00 0.00 ? 71  GLU A CD   7  
ATOM 9895  O OE1  . GLU A 1 71 ? 14.797  2.941   6.293   1.00 0.00 ? 71  GLU A OE1  7  
ATOM 9896  O OE2  . GLU A 1 71 ? 16.510  3.162   4.935   1.00 0.00 ? 71  GLU A OE2  7  
ATOM 9897  H H    . GLU A 1 71 ? 12.145  3.143   1.684   1.00 0.00 ? 71  GLU A H    7  
ATOM 9898  H HA   . GLU A 1 71 ? 11.916  1.961   4.207   1.00 0.00 ? 71  GLU A HA   7  
ATOM 9899  H HB2  . GLU A 1 71 ? 13.303  4.375   3.137   1.00 0.00 ? 71  GLU A HB2  7  
ATOM 9900  H HB3  . GLU A 1 71 ? 13.165  4.212   4.881   1.00 0.00 ? 71  GLU A HB3  7  
ATOM 9901  H HG2  . GLU A 1 71 ? 14.034  1.719   3.978   1.00 0.00 ? 71  GLU A HG2  7  
ATOM 9902  H HG3  . GLU A 1 71 ? 14.954  2.902   3.051   1.00 0.00 ? 71  GLU A HG3  7  
ATOM 9903  N N    . ARG A 1 72 ? 10.344  4.854   3.923   1.00 0.00 ? 72  ARG A N    7  
ATOM 9904  C CA   . ARG A 1 72 ? 9.293   5.682   4.504   1.00 0.00 ? 72  ARG A CA   7  
ATOM 9905  C C    . ARG A 1 72 ? 7.943   4.965   4.461   1.00 0.00 ? 72  ARG A C    7  
ATOM 9906  O O    . ARG A 1 72 ? 7.258   4.853   5.480   1.00 0.00 ? 72  ARG A O    7  
ATOM 9907  C CB   . ARG A 1 72 ? 9.205   7.019   3.762   1.00 0.00 ? 72  ARG A CB   7  
ATOM 9908  C CG   . ARG A 1 72 ? 9.967   8.146   4.441   1.00 0.00 ? 72  ARG A CG   7  
ATOM 9909  C CD   . ARG A 1 72 ? 11.417  7.769   4.713   1.00 0.00 ? 72  ARG A CD   7  
ATOM 9910  N NE   . ARG A 1 72 ? 12.219  7.744   3.488   1.00 0.00 ? 72  ARG A NE   7  
ATOM 9911  C CZ   . ARG A 1 72 ? 12.691  8.836   2.878   1.00 0.00 ? 72  ARG A CZ   7  
ATOM 9912  N NH1  . ARG A 1 72 ? 12.438  10.047  3.367   1.00 0.00 ? 72  ARG A NH1  7  
ATOM 9913  N NH2  . ARG A 1 72 ? 13.420  8.715   1.772   1.00 0.00 ? 72  ARG A NH2  7  
ATOM 9914  H H    . ARG A 1 72 ? 10.769  5.140   3.087   1.00 0.00 ? 72  ARG A H    7  
ATOM 9915  H HA   . ARG A 1 72 ? 9.553   5.869   5.536   1.00 0.00 ? 72  ARG A HA   7  
ATOM 9916  H HB2  . ARG A 1 72 ? 9.607   6.891   2.767   1.00 0.00 ? 72  ARG A HB2  7  
ATOM 9917  H HB3  . ARG A 1 72 ? 8.168   7.309   3.686   1.00 0.00 ? 72  ARG A HB3  7  
ATOM 9918  H HG2  . ARG A 1 72 ? 9.948   9.015   3.802   1.00 0.00 ? 72  ARG A HG2  7  
ATOM 9919  H HG3  . ARG A 1 72 ? 9.484   8.377   5.379   1.00 0.00 ? 72  ARG A HG3  7  
ATOM 9920  H HD2  . ARG A 1 72 ? 11.842  8.490   5.396   1.00 0.00 ? 72  ARG A HD2  7  
ATOM 9921  H HD3  . ARG A 1 72 ? 11.442  6.789   5.169   1.00 0.00 ? 72  ARG A HD3  7  
ATOM 9922  H HE   . ARG A 1 72 ? 12.419  6.866   3.101   1.00 0.00 ? 72  ARG A HE   7  
ATOM 9923  H HH11 . ARG A 1 72 ? 11.892  10.148  4.200   1.00 0.00 ? 72  ARG A HH11 7  
ATOM 9924  H HH12 . ARG A 1 72 ? 12.794  10.859  2.904   1.00 0.00 ? 72  ARG A HH12 7  
ATOM 9925  H HH21 . ARG A 1 72 ? 13.616  7.809   1.398   1.00 0.00 ? 72  ARG A HH21 7  
ATOM 9926  H HH22 . ARG A 1 72 ? 13.772  9.531   1.312   1.00 0.00 ? 72  ARG A HH22 7  
ATOM 9927  N N    . ALA A 1 73 ? 7.570   4.482   3.277   1.00 0.00 ? 73  ALA A N    7  
ATOM 9928  C CA   . ALA A 1 73 ? 6.302   3.776   3.099   1.00 0.00 ? 73  ALA A CA   7  
ATOM 9929  C C    . ALA A 1 73 ? 6.218   2.539   3.990   1.00 0.00 ? 73  ALA A C    7  
ATOM 9930  O O    . ALA A 1 73 ? 5.220   2.330   4.677   1.00 0.00 ? 73  ALA A O    7  
ATOM 9931  C CB   . ALA A 1 73 ? 6.111   3.386   1.640   1.00 0.00 ? 73  ALA A CB   7  
ATOM 9932  H H    . ALA A 1 73 ? 8.162   4.605   2.505   1.00 0.00 ? 73  ALA A H    7  
ATOM 9933  H HA   . ALA A 1 73 ? 5.506   4.454   3.372   1.00 0.00 ? 73  ALA A HA   7  
ATOM 9934  H HB1  . ALA A 1 73 ? 5.613   2.429   1.585   1.00 0.00 ? 73  ALA A HB1  7  
ATOM 9935  H HB2  . ALA A 1 73 ? 7.074   3.318   1.155   1.00 0.00 ? 73  ALA A HB2  7  
ATOM 9936  H HB3  . ALA A 1 73 ? 5.510   4.132   1.143   1.00 0.00 ? 73  ALA A HB3  7  
ATOM 9937  N N    . ALA A 1 74 ? 7.272   1.724   3.972   1.00 0.00 ? 74  ALA A N    7  
ATOM 9938  C CA   . ALA A 1 74 ? 7.319   0.507   4.778   1.00 0.00 ? 74  ALA A CA   7  
ATOM 9939  C C    . ALA A 1 74 ? 7.165   0.819   6.264   1.00 0.00 ? 74  ALA A C    7  
ATOM 9940  O O    . ALA A 1 74 ? 6.265   0.298   6.923   1.00 0.00 ? 74  ALA A O    7  
ATOM 9941  C CB   . ALA A 1 74 ? 8.621   -0.243  4.531   1.00 0.00 ? 74  ALA A CB   7  
ATOM 9942  H H    . ALA A 1 74 ? 8.038   1.949   3.402   1.00 0.00 ? 74  ALA A H    7  
ATOM 9943  H HA   . ALA A 1 74 ? 6.501   -0.127  4.467   1.00 0.00 ? 74  ALA A HA   7  
ATOM 9944  H HB1  . ALA A 1 74 ? 8.648   -1.131  5.144   1.00 0.00 ? 74  ALA A HB1  7  
ATOM 9945  H HB2  . ALA A 1 74 ? 9.456   0.395   4.786   1.00 0.00 ? 74  ALA A HB2  7  
ATOM 9946  H HB3  . ALA A 1 74 ? 8.686   -0.521  3.489   1.00 0.00 ? 74  ALA A HB3  7  
ATOM 9947  N N    . GLU A 1 75 ? 8.050   1.669   6.783   1.00 0.00 ? 75  GLU A N    7  
ATOM 9948  C CA   . GLU A 1 75 ? 8.019   2.050   8.195   1.00 0.00 ? 75  GLU A CA   7  
ATOM 9949  C C    . GLU A 1 75 ? 6.658   2.620   8.586   1.00 0.00 ? 75  GLU A C    7  
ATOM 9950  O O    . GLU A 1 75 ? 6.038   2.155   9.541   1.00 0.00 ? 75  GLU A O    7  
ATOM 9951  C CB   . GLU A 1 75 ? 9.118   3.072   8.497   1.00 0.00 ? 75  GLU A CB   7  
ATOM 9952  C CG   . GLU A 1 75 ? 10.397  2.449   9.034   1.00 0.00 ? 75  GLU A CG   7  
ATOM 9953  C CD   . GLU A 1 75 ? 11.057  1.523   8.031   1.00 0.00 ? 75  GLU A CD   7  
ATOM 9954  O OE1  . GLU A 1 75 ? 10.601  0.367   7.901   1.00 0.00 ? 75  GLU A OE1  7  
ATOM 9955  O OE2  . GLU A 1 75 ? 12.029  1.953   7.377   1.00 0.00 ? 75  GLU A OE2  7  
ATOM 9956  H H    . GLU A 1 75 ? 8.745   2.048   6.202   1.00 0.00 ? 75  GLU A H    7  
ATOM 9957  H HA   . GLU A 1 75 ? 8.200   1.159   8.777   1.00 0.00 ? 75  GLU A HA   7  
ATOM 9958  H HB2  . GLU A 1 75 ? 9.358   3.605   7.589   1.00 0.00 ? 75  GLU A HB2  7  
ATOM 9959  H HB3  . GLU A 1 75 ? 8.750   3.773   9.229   1.00 0.00 ? 75  GLU A HB3  7  
ATOM 9960  H HG2  . GLU A 1 75 ? 11.089  3.239   9.282   1.00 0.00 ? 75  GLU A HG2  7  
ATOM 9961  H HG3  . GLU A 1 75 ? 10.162  1.883   9.923   1.00 0.00 ? 75  GLU A HG3  7  
ATOM 9962  N N    . LEU A 1 76 ? 6.194   3.622   7.841   1.00 0.00 ? 76  LEU A N    7  
ATOM 9963  C CA   . LEU A 1 76 ? 4.900   4.241   8.119   1.00 0.00 ? 76  LEU A CA   7  
ATOM 9964  C C    . LEU A 1 76 ? 3.768   3.217   8.010   1.00 0.00 ? 76  LEU A C    7  
ATOM 9965  O O    . LEU A 1 76 ? 2.771   3.309   8.728   1.00 0.00 ? 76  LEU A O    7  
ATOM 9966  C CB   . LEU A 1 76 ? 4.649   5.412   7.166   1.00 0.00 ? 76  LEU A CB   7  
ATOM 9967  C CG   . LEU A 1 76 ? 5.539   6.638   7.395   1.00 0.00 ? 76  LEU A CG   7  
ATOM 9968  C CD1  . LEU A 1 76 ? 5.272   7.694   6.334   1.00 0.00 ? 76  LEU A CD1  7  
ATOM 9969  C CD2  . LEU A 1 76 ? 5.318   7.211   8.789   1.00 0.00 ? 76  LEU A CD2  7  
ATOM 9970  H H    . LEU A 1 76 ? 6.730   3.947   7.086   1.00 0.00 ? 76  LEU A H    7  
ATOM 9971  H HA   . LEU A 1 76 ? 4.928   4.614   9.133   1.00 0.00 ? 76  LEU A HA   7  
ATOM 9972  H HB2  . LEU A 1 76 ? 4.804   5.064   6.155   1.00 0.00 ? 76  LEU A HB2  7  
ATOM 9973  H HB3  . LEU A 1 76 ? 3.620   5.719   7.269   1.00 0.00 ? 76  LEU A HB3  7  
ATOM 9974  H HG   . LEU A 1 76 ? 6.575   6.341   7.315   1.00 0.00 ? 76  LEU A HG   7  
ATOM 9975  H HD11 . LEU A 1 76 ? 4.566   8.417   6.715   1.00 0.00 ? 76  LEU A HD11 7  
ATOM 9976  H HD12 . LEU A 1 76 ? 4.864   7.223   5.452   1.00 0.00 ? 76  LEU A HD12 7  
ATOM 9977  H HD13 . LEU A 1 76 ? 6.195   8.193   6.081   1.00 0.00 ? 76  LEU A HD13 7  
ATOM 9978  H HD21 . LEU A 1 76 ? 5.651   8.238   8.814   1.00 0.00 ? 76  LEU A HD21 7  
ATOM 9979  H HD22 . LEU A 1 76 ? 5.880   6.633   9.509   1.00 0.00 ? 76  LEU A HD22 7  
ATOM 9980  H HD23 . LEU A 1 76 ? 4.267   7.167   9.035   1.00 0.00 ? 76  LEU A HD23 7  
ATOM 9981  N N    . MET A 1 77 ? 3.931   2.239   7.115   1.00 0.00 ? 77  MET A N    7  
ATOM 9982  C CA   . MET A 1 77 ? 2.923   1.198   6.925   1.00 0.00 ? 77  MET A CA   7  
ATOM 9983  C C    . MET A 1 77 ? 2.864   0.269   8.135   1.00 0.00 ? 77  MET A C    7  
ATOM 9984  O O    . MET A 1 77 ? 1.852   0.214   8.830   1.00 0.00 ? 77  MET A O    7  
ATOM 9985  C CB   . MET A 1 77 ? 3.212   0.382   5.661   1.00 0.00 ? 77  MET A CB   7  
ATOM 9986  C CG   . MET A 1 77 ? 2.510   0.909   4.419   1.00 0.00 ? 77  MET A CG   7  
ATOM 9987  S SD   . MET A 1 77 ? 0.725   0.662   4.470   1.00 0.00 ? 77  MET A SD   7  
ATOM 9988  C CE   . MET A 1 77 ? 0.624   -1.123  4.562   1.00 0.00 ? 77  MET A CE   7  
ATOM 9989  H H    . MET A 1 77 ? 4.748   2.215   6.574   1.00 0.00 ? 77  MET A H    7  
ATOM 9990  H HA   . MET A 1 77 ? 1.965   1.685   6.818   1.00 0.00 ? 77  MET A HA   7  
ATOM 9991  H HB2  . MET A 1 77 ? 4.276   0.386   5.476   1.00 0.00 ? 77  MET A HB2  7  
ATOM 9992  H HB3  . MET A 1 77 ? 2.890   -0.635  5.824   1.00 0.00 ? 77  MET A HB3  7  
ATOM 9993  H HG2  . MET A 1 77 ? 2.709   1.967   4.332   1.00 0.00 ? 77  MET A HG2  7  
ATOM 9994  H HG3  . MET A 1 77 ? 2.906   0.398   3.554   1.00 0.00 ? 77  MET A HG3  7  
ATOM 9995  H HE1  . MET A 1 77 ? 1.053   -1.557  3.669   1.00 0.00 ? 77  MET A HE1  7  
ATOM 9996  H HE2  . MET A 1 77 ? -0.410  -1.421  4.645   1.00 0.00 ? 77  MET A HE2  7  
ATOM 9997  H HE3  . MET A 1 77 ? 1.167   -1.469  5.428   1.00 0.00 ? 77  MET A HE3  7  
ATOM 9998  N N    . THR A 1 78 ? 3.955   -0.457  8.388   1.00 0.00 ? 78  THR A N    7  
ATOM 9999  C CA   . THR A 1 78 ? 4.011   -1.378  9.522   1.00 0.00 ? 78  THR A CA   7  
ATOM 10000 C C    . THR A 1 78 ? 3.706   -0.653  10.833  1.00 0.00 ? 78  THR A C    7  
ATOM 10001 O O    . THR A 1 78 ? 3.066   -1.211  11.726  1.00 0.00 ? 78  THR A O    7  
ATOM 10002 C CB   . THR A 1 78 ? 5.380   -2.065  9.600   1.00 0.00 ? 78  THR A CB   7  
ATOM 10003 O OG1  . THR A 1 78 ? 5.471   -2.872  10.762  1.00 0.00 ? 78  THR A OG1  7  
ATOM 10004 C CG2  . THR A 1 78 ? 6.553   -1.104  9.617   1.00 0.00 ? 78  THR A CG2  7  
ATOM 10005 H H    . THR A 1 78 ? 4.736   -0.369  7.801   1.00 0.00 ? 78  THR A H    7  
ATOM 10006 H HA   . THR A 1 78 ? 3.254   -2.132  9.365   1.00 0.00 ? 78  THR A HA   7  
ATOM 10007 H HB   . THR A 1 78 ? 5.491   -2.703  8.738   1.00 0.00 ? 78  THR A HB   7  
ATOM 10008 H HG1  . THR A 1 78 ? 6.198   -3.493  10.667  1.00 0.00 ? 78  THR A HG1  7  
ATOM 10009 H HG21 . THR A 1 78 ? 6.222   -0.132  9.949   1.00 0.00 ? 78  THR A HG21 7  
ATOM 10010 H HG22 . THR A 1 78 ? 6.966   -1.023  8.623   1.00 0.00 ? 78  THR A HG22 7  
ATOM 10011 H HG23 . THR A 1 78 ? 7.312   -1.474  10.291  1.00 0.00 ? 78  THR A HG23 7  
ATOM 10012 N N    . ARG A 1 79 ? 4.161   0.594   10.938  1.00 0.00 ? 79  ARG A N    7  
ATOM 10013 C CA   . ARG A 1 79 ? 3.933   1.395   12.136  1.00 0.00 ? 79  ARG A CA   7  
ATOM 10014 C C    . ARG A 1 79 ? 2.590   2.132   12.065  1.00 0.00 ? 79  ARG A C    7  
ATOM 10015 O O    . ARG A 1 79 ? 2.528   3.349   12.255  1.00 0.00 ? 79  ARG A O    7  
ATOM 10016 C CB   . ARG A 1 79 ? 5.074   2.400   12.334  1.00 0.00 ? 79  ARG A CB   7  
ATOM 10017 C CG   . ARG A 1 79 ? 6.410   1.755   12.676  1.00 0.00 ? 79  ARG A CG   7  
ATOM 10018 C CD   . ARG A 1 79 ? 7.367   2.758   13.303  1.00 0.00 ? 79  ARG A CD   7  
ATOM 10019 N NE   . ARG A 1 79 ? 8.076   3.546   12.295  1.00 0.00 ? 79  ARG A NE   7  
ATOM 10020 C CZ   . ARG A 1 79 ? 8.975   4.492   12.583  1.00 0.00 ? 79  ARG A CZ   7  
ATOM 10021 N NH1  . ARG A 1 79 ? 9.276   4.770   13.848  1.00 0.00 ? 79  ARG A NH1  7  
ATOM 10022 N NH2  . ARG A 1 79 ? 9.571   5.164   11.605  1.00 0.00 ? 79  ARG A NH2  7  
ATOM 10023 H H    . ARG A 1 79 ? 4.660   0.984   10.189  1.00 0.00 ? 79  ARG A H    7  
ATOM 10024 H HA   . ARG A 1 79 ? 3.913   0.723   12.979  1.00 0.00 ? 79  ARG A HA   7  
ATOM 10025 H HB2  . ARG A 1 79 ? 5.196   2.971   11.426  1.00 0.00 ? 79  ARG A HB2  7  
ATOM 10026 H HB3  . ARG A 1 79 ? 4.807   3.071   13.136  1.00 0.00 ? 79  ARG A HB3  7  
ATOM 10027 H HG2  . ARG A 1 79 ? 6.243   0.947   13.374  1.00 0.00 ? 79  ARG A HG2  7  
ATOM 10028 H HG3  . ARG A 1 79 ? 6.852   1.365   11.771  1.00 0.00 ? 79  ARG A HG3  7  
ATOM 10029 H HD2  . ARG A 1 79 ? 6.804   3.427   13.935  1.00 0.00 ? 79  ARG A HD2  7  
ATOM 10030 H HD3  . ARG A 1 79 ? 8.090   2.221   13.900  1.00 0.00 ? 79  ARG A HD3  7  
ATOM 10031 H HE   . ARG A 1 79 ? 7.872   3.362   11.353  1.00 0.00 ? 79  ARG A HE   7  
ATOM 10032 H HH11 . ARG A 1 79 ? 8.831   4.270   14.591  1.00 0.00 ? 79  ARG A HH11 7  
ATOM 10033 H HH12 . ARG A 1 79 ? 9.950   5.479   14.057  1.00 0.00 ? 79  ARG A HH12 7  
ATOM 10034 H HH21 . ARG A 1 79 ? 9.350   4.963   10.651  1.00 0.00 ? 79  ARG A HH21 7  
ATOM 10035 H HH22 . ARG A 1 79 ? 10.244  5.871   11.823  1.00 0.00 ? 79  ARG A HH22 7  
ATOM 10036 N N    . THR A 1 80 ? 1.516   1.388   11.798  1.00 0.00 ? 80  THR A N    7  
ATOM 10037 C CA   . THR A 1 80 ? 0.177   1.972   11.713  1.00 0.00 ? 80  THR A CA   7  
ATOM 10038 C C    . THR A 1 80 ? -0.546  1.865   13.054  1.00 0.00 ? 80  THR A C    7  
ATOM 10039 O O    . THR A 1 80 ? -0.097  1.157   13.958  1.00 0.00 ? 80  THR A O    7  
ATOM 10040 C CB   . THR A 1 80 ? -0.648  1.277   10.624  1.00 0.00 ? 80  THR A CB   7  
ATOM 10041 O OG1  . THR A 1 80 ? -0.333  -0.104  10.557  1.00 0.00 ? 80  THR A OG1  7  
ATOM 10042 C CG2  . THR A 1 80 ? -0.440  1.866   9.245   1.00 0.00 ? 80  THR A CG2  7  
ATOM 10043 H H    . THR A 1 80 ? 1.622   0.424   11.659  1.00 0.00 ? 80  THR A H    7  
ATOM 10044 H HA   . THR A 1 80 ? 0.287   3.017   11.458  1.00 0.00 ? 80  THR A HA   7  
ATOM 10045 H HB   . THR A 1 80 ? -1.696  1.372   10.868  1.00 0.00 ? 80  THR A HB   7  
ATOM 10046 H HG1  . THR A 1 80 ? -0.555  -0.524  11.391  1.00 0.00 ? 80  THR A HG1  7  
ATOM 10047 H HG21 . THR A 1 80 ? -0.244  1.071   8.540   1.00 0.00 ? 80  THR A HG21 7  
ATOM 10048 H HG22 . THR A 1 80 ? 0.400   2.544   9.266   1.00 0.00 ? 80  THR A HG22 7  
ATOM 10049 H HG23 . THR A 1 80 ? -1.328  2.402   8.945   1.00 0.00 ? 80  THR A HG23 7  
ATOM 10050 N N    . SER A 1 81 ? -1.672  2.566   13.175  1.00 0.00 ? 81  SER A N    7  
ATOM 10051 C CA   . SER A 1 81 ? -2.462  2.544   14.404  1.00 0.00 ? 81  SER A CA   7  
ATOM 10052 C C    . SER A 1 81 ? -3.620  1.550   14.282  1.00 0.00 ? 81  SER A C    7  
ATOM 10053 O O    . SER A 1 81 ? -3.617  0.689   13.400  1.00 0.00 ? 81  SER A O    7  
ATOM 10054 C CB   . SER A 1 81 ? -2.993  3.951   14.713  1.00 0.00 ? 81  SER A CB   7  
ATOM 10055 O OG   . SER A 1 81 ? -1.999  4.937   14.485  1.00 0.00 ? 81  SER A OG   7  
ATOM 10056 H H    . SER A 1 81 ? -1.984  3.106   12.418  1.00 0.00 ? 81  SER A H    7  
ATOM 10057 H HA   . SER A 1 81 ? -1.815  2.228   15.209  1.00 0.00 ? 81  SER A HA   7  
ATOM 10058 H HB2  . SER A 1 81 ? -3.841  4.162   14.079  1.00 0.00 ? 81  SER A HB2  7  
ATOM 10059 H HB3  . SER A 1 81 ? -3.298  3.999   15.748  1.00 0.00 ? 81  SER A HB3  7  
ATOM 10060 H HG   . SER A 1 81 ? -1.270  4.805   15.095  1.00 0.00 ? 81  SER A HG   7  
ATOM 10061 N N    . SER A 1 82 ? -4.611  1.673   15.168  1.00 0.00 ? 82  SER A N    7  
ATOM 10062 C CA   . SER A 1 82 ? -5.774  0.786   15.147  1.00 0.00 ? 82  SER A CA   7  
ATOM 10063 C C    . SER A 1 82 ? -6.510  0.871   13.807  1.00 0.00 ? 82  SER A C    7  
ATOM 10064 O O    . SER A 1 82 ? -7.168  -0.082  13.393  1.00 0.00 ? 82  SER A O    7  
ATOM 10065 C CB   . SER A 1 82 ? -6.730  1.132   16.292  1.00 0.00 ? 82  SER A CB   7  
ATOM 10066 O OG   . SER A 1 82 ? -6.136  0.865   17.551  1.00 0.00 ? 82  SER A OG   7  
ATOM 10067 H H    . SER A 1 82 ? -4.561  2.378   15.847  1.00 0.00 ? 82  SER A H    7  
ATOM 10068 H HA   . SER A 1 82 ? -5.418  -0.225  15.283  1.00 0.00 ? 82  SER A HA   7  
ATOM 10069 H HB2  . SER A 1 82 ? -6.982  2.181   16.243  1.00 0.00 ? 82  SER A HB2  7  
ATOM 10070 H HB3  . SER A 1 82 ? -7.629  0.541   16.198  1.00 0.00 ? 82  SER A HB3  7  
ATOM 10071 H HG   . SER A 1 82 ? -6.783  0.457   18.131  1.00 0.00 ? 82  SER A HG   7  
ATOM 10072 N N    . VAL A 1 83 ? -6.392  2.018   13.135  1.00 0.00 ? 83  VAL A N    7  
ATOM 10073 C CA   . VAL A 1 83 ? -7.041  2.223   11.843  1.00 0.00 ? 83  VAL A CA   7  
ATOM 10074 C C    . VAL A 1 83 ? -6.051  2.025   10.697  1.00 0.00 ? 83  VAL A C    7  
ATOM 10075 O O    . VAL A 1 83 ? -4.855  2.287   10.843  1.00 0.00 ? 83  VAL A O    7  
ATOM 10076 C CB   . VAL A 1 83 ? -7.662  3.632   11.734  1.00 0.00 ? 83  VAL A CB   7  
ATOM 10077 C CG1  . VAL A 1 83 ? -8.497  3.753   10.467  1.00 0.00 ? 83  VAL A CG1  7  
ATOM 10078 C CG2  . VAL A 1 83 ? -8.502  3.950   12.963  1.00 0.00 ? 83  VAL A CG2  7  
ATOM 10079 H H    . VAL A 1 83 ? -5.853  2.743   13.515  1.00 0.00 ? 83  VAL A H    7  
ATOM 10080 H HA   . VAL A 1 83 ? -7.833  1.495   11.750  1.00 0.00 ? 83  VAL A HA   7  
ATOM 10081 H HB   . VAL A 1 83 ? -6.859  4.353   11.677  1.00 0.00 ? 83  VAL A HB   7  
ATOM 10082 H HG11 . VAL A 1 83 ? -7.846  3.913   9.621   1.00 0.00 ? 83  VAL A HG11 7  
ATOM 10083 H HG12 . VAL A 1 83 ? -9.177  4.587   10.561  1.00 0.00 ? 83  VAL A HG12 7  
ATOM 10084 H HG13 . VAL A 1 83 ? -9.061  2.844   10.319  1.00 0.00 ? 83  VAL A HG13 7  
ATOM 10085 H HG21 . VAL A 1 83 ? -8.689  5.013   13.004  1.00 0.00 ? 83  VAL A HG21 7  
ATOM 10086 H HG22 . VAL A 1 83 ? -7.971  3.643   13.852  1.00 0.00 ? 83  VAL A HG22 7  
ATOM 10087 H HG23 . VAL A 1 83 ? -9.441  3.421   12.904  1.00 0.00 ? 83  VAL A HG23 7  
ATOM 10088 N N    . VAL A 1 84 ? -6.560  1.560   9.558   1.00 0.00 ? 84  VAL A N    7  
ATOM 10089 C CA   . VAL A 1 84 ? -5.731  1.324   8.382   1.00 0.00 ? 84  VAL A CA   7  
ATOM 10090 C C    . VAL A 1 84 ? -6.308  2.038   7.159   1.00 0.00 ? 84  VAL A C    7  
ATOM 10091 O O    . VAL A 1 84 ? -7.087  1.460   6.400   1.00 0.00 ? 84  VAL A O    7  
ATOM 10092 C CB   . VAL A 1 84 ? -5.601  -0.186  8.080   1.00 0.00 ? 84  VAL A CB   7  
ATOM 10093 C CG1  . VAL A 1 84 ? -4.562  -0.429  6.993   1.00 0.00 ? 84  VAL A CG1  7  
ATOM 10094 C CG2  . VAL A 1 84 ? -5.249  -0.956  9.347   1.00 0.00 ? 84  VAL A CG2  7  
ATOM 10095 H H    . VAL A 1 84 ? -7.522  1.369   9.508   1.00 0.00 ? 84  VAL A H    7  
ATOM 10096 H HA   . VAL A 1 84 ? -4.745  1.717   8.584   1.00 0.00 ? 84  VAL A HA   7  
ATOM 10097 H HB   . VAL A 1 84 ? -6.555  -0.545  7.720   1.00 0.00 ? 84  VAL A HB   7  
ATOM 10098 H HG11 . VAL A 1 84 ? -4.536  -1.481  6.749   1.00 0.00 ? 84  VAL A HG11 7  
ATOM 10099 H HG12 . VAL A 1 84 ? -3.591  -0.117  7.347   1.00 0.00 ? 84  VAL A HG12 7  
ATOM 10100 H HG13 . VAL A 1 84 ? -4.824  0.140   6.113   1.00 0.00 ? 84  VAL A HG13 7  
ATOM 10101 H HG21 . VAL A 1 84 ? -4.631  -0.340  9.984   1.00 0.00 ? 84  VAL A HG21 7  
ATOM 10102 H HG22 . VAL A 1 84 ? -4.712  -1.855  9.085   1.00 0.00 ? 84  VAL A HG22 7  
ATOM 10103 H HG23 . VAL A 1 84 ? -6.156  -1.219  9.871   1.00 0.00 ? 84  VAL A HG23 7  
ATOM 10104 N N    . THR A 1 85 ? -5.923  3.302   6.983   1.00 0.00 ? 85  THR A N    7  
ATOM 10105 C CA   . THR A 1 85 ? -6.400  4.106   5.859   1.00 0.00 ? 85  THR A CA   7  
ATOM 10106 C C    . THR A 1 85 ? -5.448  3.996   4.667   1.00 0.00 ? 85  THR A C    7  
ATOM 10107 O O    . THR A 1 85 ? -4.612  4.873   4.445   1.00 0.00 ? 85  THR A O    7  
ATOM 10108 C CB   . THR A 1 85 ? -6.551  5.573   6.285   1.00 0.00 ? 85  THR A CB   7  
ATOM 10109 O OG1  . THR A 1 85 ? -7.040  5.668   7.613   1.00 0.00 ? 85  THR A OG1  7  
ATOM 10110 C CG2  . THR A 1 85 ? -7.486  6.364   5.395   1.00 0.00 ? 85  THR A CG2  7  
ATOM 10111 H H    . THR A 1 85 ? -5.304  3.706   7.628   1.00 0.00 ? 85  THR A H    7  
ATOM 10112 H HA   . THR A 1 85 ? -7.367  3.725   5.568   1.00 0.00 ? 85  THR A HA   7  
ATOM 10113 H HB   . THR A 1 85 ? -5.580  6.048   6.248   1.00 0.00 ? 85  THR A HB   7  
ATOM 10114 H HG1  . THR A 1 85 ? -7.872  5.194   7.685   1.00 0.00 ? 85  THR A HG1  7  
ATOM 10115 H HG21 . THR A 1 85 ? -8.453  5.883   5.372   1.00 0.00 ? 85  THR A HG21 7  
ATOM 10116 H HG22 . THR A 1 85 ? -7.081  6.406   4.395   1.00 0.00 ? 85  THR A HG22 7  
ATOM 10117 H HG23 . THR A 1 85 ? -7.591  7.366   5.783   1.00 0.00 ? 85  THR A HG23 7  
ATOM 10118 N N    . LEU A 1 86 ? -5.578  2.909   3.906   1.00 0.00 ? 86  LEU A N    7  
ATOM 10119 C CA   . LEU A 1 86 ? -4.725  2.683   2.742   1.00 0.00 ? 86  LEU A CA   7  
ATOM 10120 C C    . LEU A 1 86 ? -5.470  2.967   1.441   1.00 0.00 ? 86  LEU A C    7  
ATOM 10121 O O    . LEU A 1 86 ? -6.607  2.528   1.256   1.00 0.00 ? 86  LEU A O    7  
ATOM 10122 C CB   . LEU A 1 86 ? -4.205  1.244   2.737   1.00 0.00 ? 86  LEU A CB   7  
ATOM 10123 C CG   . LEU A 1 86 ? -2.862  1.038   3.439   1.00 0.00 ? 86  LEU A CG   7  
ATOM 10124 C CD1  . LEU A 1 86 ? -2.624  -0.440  3.706   1.00 0.00 ? 86  LEU A CD1  7  
ATOM 10125 C CD2  . LEU A 1 86 ? -1.727  1.624   2.608   1.00 0.00 ? 86  LEU A CD2  7  
ATOM 10126 H H    . LEU A 1 86 ? -6.259  2.242   4.135   1.00 0.00 ? 86  LEU A H    7  
ATOM 10127 H HA   . LEU A 1 86 ? -3.884  3.357   2.812   1.00 0.00 ? 86  LEU A HA   7  
ATOM 10128 H HB2  . LEU A 1 86 ? -4.940  0.617   3.221   1.00 0.00 ? 86  LEU A HB2  7  
ATOM 10129 H HB3  . LEU A 1 86 ? -4.103  0.922   1.711   1.00 0.00 ? 86  LEU A HB3  7  
ATOM 10130 H HG   . LEU A 1 86 ? -2.878  1.549   4.390   1.00 0.00 ? 86  LEU A HG   7  
ATOM 10131 H HD11 . LEU A 1 86 ? -2.001  -0.853  2.927   1.00 0.00 ? 86  LEU A HD11 7  
ATOM 10132 H HD12 . LEU A 1 86 ? -3.572  -0.959  3.722   1.00 0.00 ? 86  LEU A HD12 7  
ATOM 10133 H HD13 . LEU A 1 86 ? -2.134  -0.559  4.660   1.00 0.00 ? 86  LEU A HD13 7  
ATOM 10134 H HD21 . LEU A 1 86 ? -1.012  2.100   3.262   1.00 0.00 ? 86  LEU A HD21 7  
ATOM 10135 H HD22 . LEU A 1 86 ? -2.124  2.355   1.918   1.00 0.00 ? 86  LEU A HD22 7  
ATOM 10136 H HD23 . LEU A 1 86 ? -1.239  0.835   2.055   1.00 0.00 ? 86  LEU A HD23 7  
ATOM 10137 N N    . GLU A 1 87 ? -4.814  3.698   0.541   1.00 0.00 ? 87  GLU A N    7  
ATOM 10138 C CA   . GLU A 1 87 ? -5.401  4.038   -0.750  1.00 0.00 ? 87  GLU A CA   7  
ATOM 10139 C C    . GLU A 1 87 ? -4.739  3.237   -1.869  1.00 0.00 ? 87  GLU A C    7  
ATOM 10140 O O    . GLU A 1 87 ? -3.561  3.434   -2.176  1.00 0.00 ? 87  GLU A O    7  
ATOM 10141 C CB   . GLU A 1 87 ? -5.260  5.539   -1.017  1.00 0.00 ? 87  GLU A CB   7  
ATOM 10142 C CG   . GLU A 1 87 ? -5.793  5.972   -2.372  1.00 0.00 ? 87  GLU A CG   7  
ATOM 10143 C CD   . GLU A 1 87 ? -6.042  7.466   -2.454  1.00 0.00 ? 87  GLU A CD   7  
ATOM 10144 O OE1  . GLU A 1 87 ? -5.081  8.241   -2.262  1.00 0.00 ? 87  GLU A OE1  7  
ATOM 10145 O OE2  . GLU A 1 87 ? -7.199  7.860   -2.710  1.00 0.00 ? 87  GLU A OE2  7  
ATOM 10146 H H    . GLU A 1 87 ? -3.908  4.011   0.749   1.00 0.00 ? 87  GLU A H    7  
ATOM 10147 H HA   . GLU A 1 87 ? -6.450  3.784   -0.714  1.00 0.00 ? 87  GLU A HA   7  
ATOM 10148 H HB2  . GLU A 1 87 ? -5.800  6.079   -0.255  1.00 0.00 ? 87  GLU A HB2  7  
ATOM 10149 H HB3  . GLU A 1 87 ? -4.217  5.806   -0.964  1.00 0.00 ? 87  GLU A HB3  7  
ATOM 10150 H HG2  . GLU A 1 87 ? -5.074  5.702   -3.130  1.00 0.00 ? 87  GLU A HG2  7  
ATOM 10151 H HG3  . GLU A 1 87 ? -6.724  5.456   -2.560  1.00 0.00 ? 87  GLU A HG3  7  
ATOM 10152 N N    . VAL A 1 88 ? -5.506  2.329   -2.467  1.00 0.00 ? 88  VAL A N    7  
ATOM 10153 C CA   . VAL A 1 88 ? -5.003  1.486   -3.548  1.00 0.00 ? 88  VAL A CA   7  
ATOM 10154 C C    . VAL A 1 88 ? -5.648  1.855   -4.882  1.00 0.00 ? 88  VAL A C    7  
ATOM 10155 O O    . VAL A 1 88 ? -6.810  2.264   -4.930  1.00 0.00 ? 88  VAL A O    7  
ATOM 10156 C CB   . VAL A 1 88 ? -5.264  -0.009  -3.258  1.00 0.00 ? 88  VAL A CB   7  
ATOM 10157 C CG1  . VAL A 1 88 ? -4.550  -0.889  -4.273  1.00 0.00 ? 88  VAL A CG1  7  
ATOM 10158 C CG2  . VAL A 1 88 ? -4.834  -0.368  -1.844  1.00 0.00 ? 88  VAL A CG2  7  
ATOM 10159 H H    . VAL A 1 88 ? -6.434  2.218   -2.171  1.00 0.00 ? 88  VAL A H    7  
ATOM 10160 H HA   . VAL A 1 88 ? -3.934  1.637   -3.620  1.00 0.00 ? 88  VAL A HA   7  
ATOM 10161 H HB   . VAL A 1 88 ? -6.326  -0.191  -3.344  1.00 0.00 ? 88  VAL A HB   7  
ATOM 10162 H HG11 . VAL A 1 88 ? -3.488  -0.699  -4.230  1.00 0.00 ? 88  VAL A HG11 7  
ATOM 10163 H HG12 . VAL A 1 88 ? -4.916  -0.668  -5.265  1.00 0.00 ? 88  VAL A HG12 7  
ATOM 10164 H HG13 . VAL A 1 88 ? -4.739  -1.928  -4.043  1.00 0.00 ? 88  VAL A HG13 7  
ATOM 10165 H HG21 . VAL A 1 88 ? -3.758  -0.314  -1.771  1.00 0.00 ? 88  VAL A HG21 7  
ATOM 10166 H HG22 . VAL A 1 88 ? -5.160  -1.372  -1.613  1.00 0.00 ? 88  VAL A HG22 7  
ATOM 10167 H HG23 . VAL A 1 88 ? -5.277  0.324   -1.144  1.00 0.00 ? 88  VAL A HG23 7  
ATOM 10168 N N    . ALA A 1 89 ? -4.886  1.699   -5.965  1.00 0.00 ? 89  ALA A N    7  
ATOM 10169 C CA   . ALA A 1 89 ? -5.380  2.006   -7.303  1.00 0.00 ? 89  ALA A CA   7  
ATOM 10170 C C    . ALA A 1 89 ? -5.865  0.741   -8.005  1.00 0.00 ? 89  ALA A C    7  
ATOM 10171 O O    . ALA A 1 89 ? -5.176  -0.281  -8.002  1.00 0.00 ? 89  ALA A O    7  
ATOM 10172 C CB   . ALA A 1 89 ? -4.295  2.684   -8.127  1.00 0.00 ? 89  ALA A CB   7  
ATOM 10173 H H    . ALA A 1 89 ? -3.970  1.364   -5.861  1.00 0.00 ? 89  ALA A H    7  
ATOM 10174 H HA   . ALA A 1 89 ? -6.209  2.693   -7.205  1.00 0.00 ? 89  ALA A HA   7  
ATOM 10175 H HB1  . ALA A 1 89 ? -3.416  2.055   -8.155  1.00 0.00 ? 89  ALA A HB1  7  
ATOM 10176 H HB2  . ALA A 1 89 ? -4.044  3.634   -7.680  1.00 0.00 ? 89  ALA A HB2  7  
ATOM 10177 H HB3  . ALA A 1 89 ? -4.655  2.844   -9.133  1.00 0.00 ? 89  ALA A HB3  7  
ATOM 10178 N N    . LYS A 1 90 ? -7.051  0.817   -8.606  1.00 0.00 ? 90  LYS A N    7  
ATOM 10179 C CA   . LYS A 1 90 ? -7.626  -0.323  -9.316  1.00 0.00 ? 90  LYS A CA   7  
ATOM 10180 C C    . LYS A 1 90 ? -6.830  -0.622  -10.584 1.00 0.00 ? 90  LYS A C    7  
ATOM 10181 O O    . LYS A 1 90 ? -7.103  -0.065  -11.648 1.00 0.00 ? 90  LYS A O    7  
ATOM 10182 C CB   . LYS A 1 90 ? -9.094  -0.052  -9.664  1.00 0.00 ? 90  LYS A CB   7  
ATOM 10183 C CG   . LYS A 1 90 ? -10.062 -1.041  -9.036  1.00 0.00 ? 90  LYS A CG   7  
ATOM 10184 C CD   . LYS A 1 90 ? -10.202 -0.814  -7.538  1.00 0.00 ? 90  LYS A CD   7  
ATOM 10185 C CE   . LYS A 1 90 ? -9.998  -2.103  -6.754  1.00 0.00 ? 90  LYS A CE   7  
ATOM 10186 N NZ   . LYS A 1 90 ? -8.602  -2.239  -6.247  1.00 0.00 ? 90  LYS A NZ   7  
ATOM 10187 H H    . LYS A 1 90 ? -7.550  1.661   -8.574  1.00 0.00 ? 90  LYS A H    7  
ATOM 10188 H HA   . LYS A 1 90 ? -7.573  -1.181  -8.661  1.00 0.00 ? 90  LYS A HA   7  
ATOM 10189 H HB2  . LYS A 1 90 ? -9.355  0.939   -9.323  1.00 0.00 ? 90  LYS A HB2  7  
ATOM 10190 H HB3  . LYS A 1 90 ? -9.212  -0.096  -10.736 1.00 0.00 ? 90  LYS A HB3  7  
ATOM 10191 H HG2  . LYS A 1 90 ? -11.030 -0.922  -9.499  1.00 0.00 ? 90  LYS A HG2  7  
ATOM 10192 H HG3  . LYS A 1 90 ? -9.699  -2.044  -9.209  1.00 0.00 ? 90  LYS A HG3  7  
ATOM 10193 H HD2  . LYS A 1 90 ? -9.465  -0.091  -7.222  1.00 0.00 ? 90  LYS A HD2  7  
ATOM 10194 H HD3  . LYS A 1 90 ? -11.192 -0.433  -7.334  1.00 0.00 ? 90  LYS A HD3  7  
ATOM 10195 H HE2  . LYS A 1 90 ? -10.676 -2.108  -5.914  1.00 0.00 ? 90  LYS A HE2  7  
ATOM 10196 H HE3  . LYS A 1 90 ? -10.221 -2.940  -7.399  1.00 0.00 ? 90  LYS A HE3  7  
ATOM 10197 H HZ1  . LYS A 1 90 ? -8.222  -1.307  -5.983  1.00 0.00 ? 90  LYS A HZ1  7  
ATOM 10198 H HZ2  . LYS A 1 90 ? -7.992  -2.654  -6.981  1.00 0.00 ? 90  LYS A HZ2  7  
ATOM 10199 H HZ3  . LYS A 1 90 ? -8.585  -2.857  -5.410  1.00 0.00 ? 90  LYS A HZ3  7  
ATOM 10200 N N    . GLN A 1 91 ? -5.837  -1.500  -10.454 1.00 0.00 ? 91  GLN A N    7  
ATOM 10201 C CA   . GLN A 1 91 ? -4.984  -1.874  -11.580 1.00 0.00 ? 91  GLN A CA   7  
ATOM 10202 C C    . GLN A 1 91 ? -4.179  -3.135  -11.260 1.00 0.00 ? 91  GLN A C    7  
ATOM 10203 O O    . GLN A 1 91 ? -4.323  -3.718  -10.182 1.00 0.00 ? 91  GLN A O    7  
ATOM 10204 C CB   . GLN A 1 91 ? -4.034  -0.721  -11.929 1.00 0.00 ? 91  GLN A CB   7  
ATOM 10205 C CG   . GLN A 1 91 ? -3.114  -0.318  -10.783 1.00 0.00 ? 91  GLN A CG   7  
ATOM 10206 C CD   . GLN A 1 91 ? -1.645  -0.405  -11.153 1.00 0.00 ? 91  GLN A CD   7  
ATOM 10207 O OE1  . GLN A 1 91 ? -1.195  0.232   -12.106 1.00 0.00 ? 91  GLN A OE1  7  
ATOM 10208 N NE2  . GLN A 1 91 ? -0.888  -1.195  -10.401 1.00 0.00 ? 91  GLN A NE2  7  
ATOM 10209 H H    . GLN A 1 91 ? -5.668  -1.902  -9.575  1.00 0.00 ? 91  GLN A H    7  
ATOM 10210 H HA   . GLN A 1 91 ? -5.621  -2.074  -12.428 1.00 0.00 ? 91  GLN A HA   7  
ATOM 10211 H HB2  . GLN A 1 91 ? -3.422  -1.015  -12.768 1.00 0.00 ? 91  GLN A HB2  7  
ATOM 10212 H HB3  . GLN A 1 91 ? -4.622  0.140   -12.209 1.00 0.00 ? 91  GLN A HB3  7  
ATOM 10213 H HG2  . GLN A 1 91 ? -3.338  0.699   -10.499 1.00 0.00 ? 91  GLN A HG2  7  
ATOM 10214 H HG3  . GLN A 1 91 ? -3.298  -0.974  -9.944  1.00 0.00 ? 91  GLN A HG3  7  
ATOM 10215 H HE21 . GLN A 1 91 ? -1.311  -1.674  -9.658  1.00 0.00 ? 91  GLN A HE21 7  
ATOM 10216 H HE22 . GLN A 1 91 ? 0.065   -1.265  -10.618 1.00 0.00 ? 91  GLN A HE22 7  
ATOM 10217 N N    . GLY A 1 92 ? -3.329  -3.546  -12.201 1.00 0.00 ? 92  GLY A N    7  
ATOM 10218 C CA   . GLY A 1 92 ? -2.510  -4.726  -12.005 1.00 0.00 ? 92  GLY A CA   7  
ATOM 10219 C C    . GLY A 1 92 ? -2.254  -5.478  -13.297 1.00 0.00 ? 92  GLY A C    7  
ATOM 10220 O O    . GLY A 1 92 ? -3.147  -5.608  -14.138 1.00 0.00 ? 92  GLY A O    7  
ATOM 10221 H H    . GLY A 1 92 ? -3.255  -3.040  -13.036 1.00 0.00 ? 92  GLY A H    7  
ATOM 10222 H HA2  . GLY A 1 92 ? -1.562  -4.424  -11.584 1.00 0.00 ? 92  GLY A HA2  7  
ATOM 10223 H HA3  . GLY A 1 92 ? -3.004  -5.386  -11.309 1.00 0.00 ? 92  GLY A HA3  7  
ATOM 10224 N N    . ALA A 1 93 ? -1.031  -5.973  -13.450 1.00 0.00 ? 93  ALA A N    7  
ATOM 10225 C CA   . ALA A 1 93 ? -0.647  -6.723  -14.645 1.00 0.00 ? 93  ALA A CA   7  
ATOM 10226 C C    . ALA A 1 93 ? -0.775  -8.231  -14.426 1.00 0.00 ? 93  ALA A C    7  
ATOM 10227 O O    . ALA A 1 93 ? -1.098  -8.646  -13.291 1.00 0.00 ? 93  ALA A O    7  
ATOM 10228 C CB   . ALA A 1 93 ? 0.774   -6.366  -15.060 1.00 0.00 ? 93  ALA A CB   7  
ATOM 10229 O OXT  . ALA A 1 93 ? -0.555  -8.987  -15.396 1.00 0.00 ? 93  ALA A OXT  7  
ATOM 10230 H H    . ALA A 1 93 ? -0.372  -5.833  -12.740 1.00 0.00 ? 93  ALA A H    7  
ATOM 10231 H HA   . ALA A 1 93 ? -1.312  -6.433  -15.446 1.00 0.00 ? 93  ALA A HA   7  
ATOM 10232 H HB1  . ALA A 1 93 ? 1.038   -5.401  -14.652 1.00 0.00 ? 93  ALA A HB1  7  
ATOM 10233 H HB2  . ALA A 1 93 ? 0.834   -6.330  -16.138 1.00 0.00 ? 93  ALA A HB2  7  
ATOM 10234 H HB3  . ALA A 1 93 ? 1.458   -7.114  -14.687 1.00 0.00 ? 93  ALA A HB3  7  
ATOM 10235 N N    . LEU B 2 1  ? 16.222  -4.822  -1.749  1.00 0.00 ? 99  LEU B N    7  
ATOM 10236 C CA   . LEU B 2 1  ? 15.595  -5.765  -2.718  1.00 0.00 ? 99  LEU B CA   7  
ATOM 10237 C C    . LEU B 2 1  ? 14.142  -5.388  -3.021  1.00 0.00 ? 99  LEU B C    7  
ATOM 10238 O O    . LEU B 2 1  ? 13.606  -5.768  -4.062  1.00 0.00 ? 99  LEU B O    7  
ATOM 10239 C CB   . LEU B 2 1  ? 15.661  -7.181  -2.138  1.00 0.00 ? 99  LEU B CB   7  
ATOM 10240 C CG   . LEU B 2 1  ? 15.656  -8.304  -3.179  1.00 0.00 ? 99  LEU B CG   7  
ATOM 10241 C CD1  . LEU B 2 1  ? 16.954  -8.303  -3.975  1.00 0.00 ? 99  LEU B CD1  7  
ATOM 10242 C CD2  . LEU B 2 1  ? 15.435  -9.654  -2.509  1.00 0.00 ? 99  LEU B CD2  7  
ATOM 10243 H H1   . LEU B 2 1  ? 15.831  -5.026  -0.807  1.00 0.00 ? 99  LEU B H1   7  
ATOM 10244 H H2   . LEU B 2 1  ? 15.988  -3.855  -2.053  1.00 0.00 ? 99  LEU B H2   7  
ATOM 10245 H H3   . LEU B 2 1  ? 17.249  -4.983  -1.767  1.00 0.00 ? 99  LEU B H3   7  
ATOM 10246 H HA   . LEU B 2 1  ? 16.161  -5.734  -3.638  1.00 0.00 ? 99  LEU B HA   7  
ATOM 10247 H HB2  . LEU B 2 1  ? 16.562  -7.266  -1.549  1.00 0.00 ? 99  LEU B HB2  7  
ATOM 10248 H HB3  . LEU B 2 1  ? 14.810  -7.320  -1.487  1.00 0.00 ? 99  LEU B HB3  7  
ATOM 10249 H HG   . LEU B 2 1  ? 14.842  -8.138  -3.872  1.00 0.00 ? 99  LEU B HG   7  
ATOM 10250 H HD11 . LEU B 2 1  ? 17.368  -7.305  -3.988  1.00 0.00 ? 99  LEU B HD11 7  
ATOM 10251 H HD12 . LEU B 2 1  ? 16.757  -8.623  -4.988  1.00 0.00 ? 99  LEU B HD12 7  
ATOM 10252 H HD13 . LEU B 2 1  ? 17.661  -8.978  -3.516  1.00 0.00 ? 99  LEU B HD13 7  
ATOM 10253 H HD21 . LEU B 2 1  ? 15.634  -10.444 -3.218  1.00 0.00 ? 99  LEU B HD21 7  
ATOM 10254 H HD22 . LEU B 2 1  ? 14.412  -9.724  -2.170  1.00 0.00 ? 99  LEU B HD22 7  
ATOM 10255 H HD23 . LEU B 2 1  ? 16.102  -9.752  -1.666  1.00 0.00 ? 99  LEU B HD23 7  
ATOM 10256 N N    . PHE B 2 2  ? 13.510  -4.641  -2.108  1.00 0.00 ? 100 PHE B N    7  
ATOM 10257 C CA   . PHE B 2 2  ? 12.121  -4.214  -2.279  1.00 0.00 ? 100 PHE B CA   7  
ATOM 10258 C C    . PHE B 2 2  ? 11.171  -5.402  -2.149  1.00 0.00 ? 100 PHE B C    7  
ATOM 10259 O O    . PHE B 2 2  ? 10.914  -6.114  -3.122  1.00 0.00 ? 100 PHE B O    7  
ATOM 10260 C CB   . PHE B 2 2  ? 11.919  -3.526  -3.638  1.00 0.00 ? 100 PHE B CB   7  
ATOM 10261 C CG   . PHE B 2 2  ? 13.061  -2.637  -4.056  1.00 0.00 ? 100 PHE B CG   7  
ATOM 10262 C CD1  . PHE B 2 2  ? 13.476  -1.587  -3.250  1.00 0.00 ? 100 PHE B CD1  7  
ATOM 10263 C CD2  . PHE B 2 2  ? 13.720  -2.856  -5.256  1.00 0.00 ? 100 PHE B CD2  7  
ATOM 10264 C CE1  . PHE B 2 2  ? 14.526  -0.773  -3.635  1.00 0.00 ? 100 PHE B CE1  7  
ATOM 10265 C CE2  . PHE B 2 2  ? 14.769  -2.046  -5.645  1.00 0.00 ? 100 PHE B CE2  7  
ATOM 10266 C CZ   . PHE B 2 2  ? 15.173  -1.003  -4.834  1.00 0.00 ? 100 PHE B CZ   7  
ATOM 10267 H H    . PHE B 2 2  ? 13.987  -4.371  -1.299  1.00 0.00 ? 100 PHE B H    7  
ATOM 10268 H HA   . PHE B 2 2  ? 11.899  -3.508  -1.493  1.00 0.00 ? 100 PHE B HA   7  
ATOM 10269 H HB2  . PHE B 2 2  ? 11.799  -4.283  -4.398  1.00 0.00 ? 100 PHE B HB2  7  
ATOM 10270 H HB3  . PHE B 2 2  ? 11.026  -2.922  -3.596  1.00 0.00 ? 100 PHE B HB3  7  
ATOM 10271 H HD1  . PHE B 2 2  ? 12.972  -1.406  -2.313  1.00 0.00 ? 100 PHE B HD1  7  
ATOM 10272 H HD2  . PHE B 2 2  ? 13.405  -3.670  -5.892  1.00 0.00 ? 100 PHE B HD2  7  
ATOM 10273 H HE1  . PHE B 2 2  ? 14.841  0.042   -2.999  1.00 0.00 ? 100 PHE B HE1  7  
ATOM 10274 H HE2  . PHE B 2 2  ? 15.274  -2.228  -6.582  1.00 0.00 ? 100 PHE B HE2  7  
ATOM 10275 H HZ   . PHE B 2 2  ? 15.993  -0.369  -5.137  1.00 0.00 ? 100 PHE B HZ   7  
ATOM 10276 N N    . SER B 2 3  ? 10.656  -5.612  -0.939  1.00 0.00 ? 101 SER B N    7  
ATOM 10277 C CA   . SER B 2 3  ? 9.736   -6.717  -0.671  1.00 0.00 ? 101 SER B CA   7  
ATOM 10278 C C    . SER B 2 3  ? 8.827   -6.396  0.521   1.00 0.00 ? 101 SER B C    7  
ATOM 10279 O O    . SER B 2 3  ? 7.605   -6.522  0.427   1.00 0.00 ? 101 SER B O    7  
ATOM 10280 C CB   . SER B 2 3  ? 10.527  -8.002  -0.410  1.00 0.00 ? 101 SER B CB   7  
ATOM 10281 O OG   . SER B 2 3  ? 9.730   -8.992  0.223   1.00 0.00 ? 101 SER B OG   7  
ATOM 10282 H H    . SER B 2 3  ? 10.907  -5.011  -0.205  1.00 0.00 ? 101 SER B H    7  
ATOM 10283 H HA   . SER B 2 3  ? 9.121   -6.857  -1.548  1.00 0.00 ? 101 SER B HA   7  
ATOM 10284 H HB2  . SER B 2 3  ? 10.885  -8.397  -1.350  1.00 0.00 ? 101 SER B HB2  7  
ATOM 10285 H HB3  . SER B 2 3  ? 11.370  -7.775  0.226   1.00 0.00 ? 101 SER B HB3  7  
ATOM 10286 H HG   . SER B 2 3  ? 8.847   -8.989  -0.155  1.00 0.00 ? 101 SER B HG   7  
ATOM 10287 N N    . THR B 2 4  ? 9.437   -5.978  1.638   1.00 0.00 ? 102 THR B N    7  
ATOM 10288 C CA   . THR B 2 4  ? 8.701   -5.625  2.858   1.00 0.00 ? 102 THR B CA   7  
ATOM 10289 C C    . THR B 2 4  ? 7.766   -6.757  3.309   1.00 0.00 ? 102 THR B C    7  
ATOM 10290 O O    . THR B 2 4  ? 7.791   -7.860  2.757   1.00 0.00 ? 102 THR B O    7  
ATOM 10291 C CB   . THR B 2 4  ? 7.908   -4.326  2.641   1.00 0.00 ? 102 THR B CB   7  
ATOM 10292 O OG1  . THR B 2 4  ? 8.586   -3.465  1.739   1.00 0.00 ? 102 THR B OG1  7  
ATOM 10293 C CG2  . THR B 2 4  ? 7.665   -3.541  3.918   1.00 0.00 ? 102 THR B CG2  7  
ATOM 10294 H H    . THR B 2 4  ? 10.413  -5.900  1.641   1.00 0.00 ? 102 THR B H    7  
ATOM 10295 H HA   . THR B 2 4  ? 9.430   -5.457  3.637   1.00 0.00 ? 102 THR B HA   7  
ATOM 10296 H HB   . THR B 2 4  ? 6.946   -4.573  2.218   1.00 0.00 ? 102 THR B HB   7  
ATOM 10297 H HG1  . THR B 2 4  ? 9.445   -3.232  2.101   1.00 0.00 ? 102 THR B HG1  7  
ATOM 10298 H HG21 . THR B 2 4  ? 8.128   -2.569  3.839   1.00 0.00 ? 102 THR B HG21 7  
ATOM 10299 H HG22 . THR B 2 4  ? 8.088   -4.072  4.757   1.00 0.00 ? 102 THR B HG22 7  
ATOM 10300 H HG23 . THR B 2 4  ? 6.601   -3.421  4.068   1.00 0.00 ? 102 THR B HG23 7  
ATOM 10301 N N    . GLU B 2 5  ? 6.942   -6.474  4.324   1.00 0.00 ? 103 GLU B N    7  
ATOM 10302 C CA   . GLU B 2 5  ? 6.001   -7.446  4.863   1.00 0.00 ? 103 GLU B CA   7  
ATOM 10303 C C    . GLU B 2 5  ? 5.237   -6.804  6.011   1.00 0.00 ? 103 GLU B C    7  
ATOM 10304 O O    . GLU B 2 5  ? 5.179   -7.331  7.123   1.00 0.00 ? 103 GLU B O    7  
ATOM 10305 C CB   . GLU B 2 5  ? 6.722   -8.709  5.341   1.00 0.00 ? 103 GLU B CB   7  
ATOM 10306 C CG   . GLU B 2 5  ? 8.002   -8.431  6.116   1.00 0.00 ? 103 GLU B CG   7  
ATOM 10307 C CD   . GLU B 2 5  ? 9.244   -8.898  5.382   1.00 0.00 ? 103 GLU B CD   7  
ATOM 10308 O OE1  . GLU B 2 5  ? 9.326   -10.102 5.057   1.00 0.00 ? 103 GLU B OE1  7  
ATOM 10309 O OE2  . GLU B 2 5  ? 10.135  -8.059  5.131   1.00 0.00 ? 103 GLU B OE2  7  
ATOM 10310 H H    . GLU B 2 5  ? 6.962   -5.578  4.728   1.00 0.00 ? 103 GLU B H    7  
ATOM 10311 H HA   . GLU B 2 5  ? 5.305   -7.704  4.080   1.00 0.00 ? 103 GLU B HA   7  
ATOM 10312 H HB2  . GLU B 2 5  ? 6.054   -9.266  5.980   1.00 0.00 ? 103 GLU B HB2  7  
ATOM 10313 H HB3  . GLU B 2 5  ? 6.970   -9.313  4.482   1.00 0.00 ? 103 GLU B HB3  7  
ATOM 10314 H HG2  . GLU B 2 5  ? 8.082   -7.368  6.286   1.00 0.00 ? 103 GLU B HG2  7  
ATOM 10315 H HG3  . GLU B 2 5  ? 7.949   -8.943  7.066   1.00 0.00 ? 103 GLU B HG3  7  
ATOM 10316 N N    . VAL B 2 6  ? 4.678   -5.640  5.723   1.00 0.00 ? 104 VAL B N    7  
ATOM 10317 C CA   . VAL B 2 6  ? 3.932   -4.874  6.704   1.00 0.00 ? 104 VAL B CA   7  
ATOM 10318 C C    . VAL B 2 6  ? 2.673   -5.613  7.165   1.00 0.00 ? 104 VAL B C    7  
ATOM 10319 O O    . VAL B 2 6  ? 2.112   -6.392  6.363   1.00 0.00 ? 104 VAL B O    7  
ATOM 10320 C CB   . VAL B 2 6  ? 3.546   -3.498  6.133   1.00 0.00 ? 104 VAL B CB   7  
ATOM 10321 C CG1  . VAL B 2 6  ? 4.784   -2.710  5.730   1.00 0.00 ? 104 VAL B CG1  7  
ATOM 10322 C CG2  . VAL B 2 6  ? 2.597   -3.648  4.951   1.00 0.00 ? 104 VAL B CG2  7  
ATOM 10323 O OXT  . VAL B 2 6  ? 2.263   -5.408  8.328   1.00 0.00 ? 104 VAL B OXT  7  
ATOM 10324 H H    . VAL B 2 6  ? 4.783   -5.274  4.819   1.00 0.00 ? 104 VAL B H    7  
ATOM 10325 H HA   . VAL B 2 6  ? 4.577   -4.715  7.558   1.00 0.00 ? 104 VAL B HA   7  
ATOM 10326 H HB   . VAL B 2 6  ? 3.047   -2.953  6.901   1.00 0.00 ? 104 VAL B HB   7  
ATOM 10327 H HG11 . VAL B 2 6  ? 4.643   -2.301  4.741   1.00 0.00 ? 104 VAL B HG11 7  
ATOM 10328 H HG12 . VAL B 2 6  ? 5.644   -3.363  5.731   1.00 0.00 ? 104 VAL B HG12 7  
ATOM 10329 H HG13 . VAL B 2 6  ? 4.941   -1.906  6.433   1.00 0.00 ? 104 VAL B HG13 7  
ATOM 10330 H HG21 . VAL B 2 6  ? 2.791   -2.866  4.232   1.00 0.00 ? 104 VAL B HG21 7  
ATOM 10331 H HG22 . VAL B 2 6  ? 1.578   -3.574  5.296   1.00 0.00 ? 104 VAL B HG22 7  
ATOM 10332 H HG23 . VAL B 2 6  ? 2.752   -4.611  4.486   1.00 0.00 ? 104 VAL B HG23 7  
ATOM 10333 N N    . MET A 1 1  ? -4.025  9.992   -20.884 1.00 0.00 ? 1   MET A N    8  
ATOM 10334 C CA   . MET A 1 1  ? -5.494  9.845   -21.087 1.00 0.00 ? 1   MET A CA   8  
ATOM 10335 C C    . MET A 1 1  ? -6.065  8.675   -20.281 1.00 0.00 ? 1   MET A C    8  
ATOM 10336 O O    . MET A 1 1  ? -7.201  8.744   -19.810 1.00 0.00 ? 1   MET A O    8  
ATOM 10337 C CB   . MET A 1 1  ? -5.771  9.647   -22.581 1.00 0.00 ? 1   MET A CB   8  
ATOM 10338 C CG   . MET A 1 1  ? -7.102  10.228  -23.035 1.00 0.00 ? 1   MET A CG   8  
ATOM 10339 S SD   . MET A 1 1  ? -6.917  11.794  -23.909 1.00 0.00 ? 1   MET A SD   8  
ATOM 10340 C CE   . MET A 1 1  ? -6.247  11.234  -25.472 1.00 0.00 ? 1   MET A CE   8  
ATOM 10341 H H1   . MET A 1 1  ? -3.758  10.952  -21.183 1.00 0.00 ? 1   MET A H1   8  
ATOM 10342 H H2   . MET A 1 1  ? -3.548  9.271   -21.464 1.00 0.00 ? 1   MET A H2   8  
ATOM 10343 H H3   . MET A 1 1  ? -3.829  9.850   -19.872 1.00 0.00 ? 1   MET A H3   8  
ATOM 10344 H HA   . MET A 1 1  ? -5.973  10.758  -20.760 1.00 0.00 ? 1   MET A HA   8  
ATOM 10345 H HB2  . MET A 1 1  ? -4.984  10.121  -23.149 1.00 0.00 ? 1   MET A HB2  8  
ATOM 10346 H HB3  . MET A 1 1  ? -5.773  8.588   -22.798 1.00 0.00 ? 1   MET A HB3  8  
ATOM 10347 H HG2  . MET A 1 1  ? -7.581  9.521   -23.695 1.00 0.00 ? 1   MET A HG2  8  
ATOM 10348 H HG3  . MET A 1 1  ? -7.726  10.387  -22.167 1.00 0.00 ? 1   MET A HG3  8  
ATOM 10349 H HE1  . MET A 1 1  ? -7.055  10.929  -26.121 1.00 0.00 ? 1   MET A HE1  8  
ATOM 10350 H HE2  . MET A 1 1  ? -5.586  10.397  -25.301 1.00 0.00 ? 1   MET A HE2  8  
ATOM 10351 H HE3  . MET A 1 1  ? -5.696  12.038  -25.937 1.00 0.00 ? 1   MET A HE3  8  
ATOM 10352 N N    . LYS A 1 2  ? -5.280  7.602   -20.125 1.00 0.00 ? 2   LYS A N    8  
ATOM 10353 C CA   . LYS A 1 2  ? -5.725  6.425   -19.374 1.00 0.00 ? 2   LYS A CA   8  
ATOM 10354 C C    . LYS A 1 2  ? -6.118  6.805   -17.946 1.00 0.00 ? 2   LYS A C    8  
ATOM 10355 O O    . LYS A 1 2  ? -5.276  7.239   -17.156 1.00 0.00 ? 2   LYS A O    8  
ATOM 10356 C CB   . LYS A 1 2  ? -4.628  5.353   -19.346 1.00 0.00 ? 2   LYS A CB   8  
ATOM 10357 C CG   . LYS A 1 2  ? -5.152  3.931   -19.494 1.00 0.00 ? 2   LYS A CG   8  
ATOM 10358 C CD   . LYS A 1 2  ? -4.742  3.319   -20.825 1.00 0.00 ? 2   LYS A CD   8  
ATOM 10359 C CE   . LYS A 1 2  ? -4.426  1.836   -20.690 1.00 0.00 ? 2   LYS A CE   8  
ATOM 10360 N NZ   . LYS A 1 2  ? -5.627  1.039   -20.306 1.00 0.00 ? 2   LYS A NZ   8  
ATOM 10361 H H    . LYS A 1 2  ? -4.384  7.601   -20.525 1.00 0.00 ? 2   LYS A H    8  
ATOM 10362 H HA   . LYS A 1 2  ? -6.593  6.025   -19.877 1.00 0.00 ? 2   LYS A HA   8  
ATOM 10363 H HB2  . LYS A 1 2  ? -3.933  5.542   -20.151 1.00 0.00 ? 2   LYS A HB2  8  
ATOM 10364 H HB3  . LYS A 1 2  ? -4.099  5.421   -18.406 1.00 0.00 ? 2   LYS A HB3  8  
ATOM 10365 H HG2  . LYS A 1 2  ? -4.752  3.326   -18.694 1.00 0.00 ? 2   LYS A HG2  8  
ATOM 10366 H HG3  . LYS A 1 2  ? -6.231  3.945   -19.431 1.00 0.00 ? 2   LYS A HG3  8  
ATOM 10367 H HD2  . LYS A 1 2  ? -5.549  3.442   -21.532 1.00 0.00 ? 2   LYS A HD2  8  
ATOM 10368 H HD3  . LYS A 1 2  ? -3.863  3.831   -21.187 1.00 0.00 ? 2   LYS A HD3  8  
ATOM 10369 H HE2  . LYS A 1 2  ? -4.054  1.473   -21.636 1.00 0.00 ? 2   LYS A HE2  8  
ATOM 10370 H HE3  . LYS A 1 2  ? -3.664  1.711   -19.934 1.00 0.00 ? 2   LYS A HE3  8  
ATOM 10371 H HZ1  . LYS A 1 2  ? -6.474  1.415   -20.779 1.00 0.00 ? 2   LYS A HZ1  8  
ATOM 10372 H HZ2  . LYS A 1 2  ? -5.770  1.082   -19.277 1.00 0.00 ? 2   LYS A HZ2  8  
ATOM 10373 H HZ3  . LYS A 1 2  ? -5.499  0.045   -20.585 1.00 0.00 ? 2   LYS A HZ3  8  
ATOM 10374 N N    . GLU A 1 3  ? -7.401  6.641   -17.624 1.00 0.00 ? 3   GLU A N    8  
ATOM 10375 C CA   . GLU A 1 3  ? -7.910  6.965   -16.295 1.00 0.00 ? 3   GLU A CA   8  
ATOM 10376 C C    . GLU A 1 3  ? -8.094  5.700   -15.458 1.00 0.00 ? 3   GLU A C    8  
ATOM 10377 O O    . GLU A 1 3  ? -9.064  4.961   -15.641 1.00 0.00 ? 3   GLU A O    8  
ATOM 10378 C CB   . GLU A 1 3  ? -9.237  7.725   -16.399 1.00 0.00 ? 3   GLU A CB   8  
ATOM 10379 C CG   . GLU A 1 3  ? -9.248  9.034   -15.621 1.00 0.00 ? 3   GLU A CG   8  
ATOM 10380 C CD   . GLU A 1 3  ? -10.095 10.109  -16.277 1.00 0.00 ? 3   GLU A CD   8  
ATOM 10381 O OE1  . GLU A 1 3  ? -10.030 10.249  -17.518 1.00 0.00 ? 3   GLU A OE1  8  
ATOM 10382 O OE2  . GLU A 1 3  ? -10.822 10.816  -15.547 1.00 0.00 ? 3   GLU A OE2  8  
ATOM 10383 H H    . GLU A 1 3  ? -8.022  6.294   -18.299 1.00 0.00 ? 3   GLU A H    8  
ATOM 10384 H HA   . GLU A 1 3  ? -7.184  7.600   -15.810 1.00 0.00 ? 3   GLU A HA   8  
ATOM 10385 H HB2  . GLU A 1 3  ? -9.433  7.945   -17.438 1.00 0.00 ? 3   GLU A HB2  8  
ATOM 10386 H HB3  . GLU A 1 3  ? -10.032 7.100   -16.018 1.00 0.00 ? 3   GLU A HB3  8  
ATOM 10387 H HG2  . GLU A 1 3  ? -9.640  8.846   -14.633 1.00 0.00 ? 3   GLU A HG2  8  
ATOM 10388 H HG3  . GLU A 1 3  ? -8.233  9.394   -15.541 1.00 0.00 ? 3   GLU A HG3  8  
ATOM 10389 N N    . PRO A 1 4  ? -7.154  5.434   -14.527 1.00 0.00 ? 4   PRO A N    8  
ATOM 10390 C CA   . PRO A 1 4  ? -7.207  4.250   -13.656 1.00 0.00 ? 4   PRO A CA   8  
ATOM 10391 C C    . PRO A 1 4  ? -8.334  4.328   -12.621 1.00 0.00 ? 4   PRO A C    8  
ATOM 10392 O O    . PRO A 1 4  ? -9.169  5.234   -12.667 1.00 0.00 ? 4   PRO A O    8  
ATOM 10393 C CB   . PRO A 1 4  ? -5.838  4.258   -12.967 1.00 0.00 ? 4   PRO A CB   8  
ATOM 10394 C CG   . PRO A 1 4  ? -5.411  5.684   -12.986 1.00 0.00 ? 4   PRO A CG   8  
ATOM 10395 C CD   . PRO A 1 4  ? -5.962  6.264   -14.257 1.00 0.00 ? 4   PRO A CD   8  
ATOM 10396 H HA   . PRO A 1 4  ? -7.317  3.343   -14.233 1.00 0.00 ? 4   PRO A HA   8  
ATOM 10397 H HB2  . PRO A 1 4  ? -5.937  3.889   -11.956 1.00 0.00 ? 4   PRO A HB2  8  
ATOM 10398 H HB3  . PRO A 1 4  ? -5.152  3.634   -13.519 1.00 0.00 ? 4   PRO A HB3  8  
ATOM 10399 H HG2  . PRO A 1 4  ? -5.819  6.203   -12.131 1.00 0.00 ? 4   PRO A HG2  8  
ATOM 10400 H HG3  . PRO A 1 4  ? -4.333  5.745   -12.984 1.00 0.00 ? 4   PRO A HG3  8  
ATOM 10401 H HD2  . PRO A 1 4  ? -6.237  7.299   -14.111 1.00 0.00 ? 4   PRO A HD2  8  
ATOM 10402 H HD3  . PRO A 1 4  ? -5.242  6.173   -15.057 1.00 0.00 ? 4   PRO A HD3  8  
ATOM 10403 N N    . GLU A 1 5  ? -8.352  3.371   -11.688 1.00 0.00 ? 5   GLU A N    8  
ATOM 10404 C CA   . GLU A 1 5  ? -9.375  3.329   -10.647 1.00 0.00 ? 5   GLU A CA   8  
ATOM 10405 C C    . GLU A 1 5  ? -8.745  3.218   -9.261  1.00 0.00 ? 5   GLU A C    8  
ATOM 10406 O O    . GLU A 1 5  ? -8.274  2.150   -8.860  1.00 0.00 ? 5   GLU A O    8  
ATOM 10407 C CB   . GLU A 1 5  ? -10.327 2.155   -10.887 1.00 0.00 ? 5   GLU A CB   8  
ATOM 10408 C CG   . GLU A 1 5  ? -11.641 2.270   -10.126 1.00 0.00 ? 5   GLU A CG   8  
ATOM 10409 C CD   . GLU A 1 5  ? -12.599 1.133   -10.429 1.00 0.00 ? 5   GLU A CD   8  
ATOM 10410 O OE1  . GLU A 1 5  ? -12.205 -0.041  -10.255 1.00 0.00 ? 5   GLU A OE1  8  
ATOM 10411 O OE2  . GLU A 1 5  ? -13.745 1.416   -10.837 1.00 0.00 ? 5   GLU A OE2  8  
ATOM 10412 H H    . GLU A 1 5  ? -7.661  2.677   -11.701 1.00 0.00 ? 5   GLU A H    8  
ATOM 10413 H HA   . GLU A 1 5  ? -9.937  4.250   -10.697 1.00 0.00 ? 5   GLU A HA   8  
ATOM 10414 H HB2  . GLU A 1 5  ? -10.550 2.100   -11.942 1.00 0.00 ? 5   GLU A HB2  8  
ATOM 10415 H HB3  . GLU A 1 5  ? -9.839  1.241   -10.583 1.00 0.00 ? 5   GLU A HB3  8  
ATOM 10416 H HG2  . GLU A 1 5  ? -11.430 2.268   -9.067  1.00 0.00 ? 5   GLU A HG2  8  
ATOM 10417 H HG3  . GLU A 1 5  ? -12.115 3.202   -10.396 1.00 0.00 ? 5   GLU A HG3  8  
ATOM 10418 N N    . ILE A 1 6  ? -8.745  4.333   -8.537  1.00 0.00 ? 6   ILE A N    8  
ATOM 10419 C CA   . ILE A 1 6  ? -8.179  4.389   -7.193  1.00 0.00 ? 6   ILE A CA   8  
ATOM 10420 C C    . ILE A 1 6  ? -9.287  4.369   -6.137  1.00 0.00 ? 6   ILE A C    8  
ATOM 10421 O O    . ILE A 1 6  ? -10.336 4.992   -6.319  1.00 0.00 ? 6   ILE A O    8  
ATOM 10422 C CB   . ILE A 1 6  ? -7.322  5.661   -7.008  1.00 0.00 ? 6   ILE A CB   8  
ATOM 10423 C CG1  . ILE A 1 6  ? -6.289  5.784   -8.133  1.00 0.00 ? 6   ILE A CG1  8  
ATOM 10424 C CG2  . ILE A 1 6  ? -6.631  5.659   -5.651  1.00 0.00 ? 6   ILE A CG2  8  
ATOM 10425 C CD1  . ILE A 1 6  ? -6.057  7.209   -8.587  1.00 0.00 ? 6   ILE A CD1  8  
ATOM 10426 H H    . ILE A 1 6  ? -9.137  5.146   -8.920  1.00 0.00 ? 6   ILE A H    8  
ATOM 10427 H HA   . ILE A 1 6  ? -7.544  3.525   -7.057  1.00 0.00 ? 6   ILE A HA   8  
ATOM 10428 H HB   . ILE A 1 6  ? -7.981  6.515   -7.046  1.00 0.00 ? 6   ILE A HB   8  
ATOM 10429 H HG12 . ILE A 1 6  ? -5.345  5.388   -7.792  1.00 0.00 ? 6   ILE A HG12 8  
ATOM 10430 H HG13 . ILE A 1 6  ? -6.625  5.214   -8.988  1.00 0.00 ? 6   ILE A HG13 8  
ATOM 10431 H HG21 . ILE A 1 6  ? -6.119  6.599   -5.507  1.00 0.00 ? 6   ILE A HG21 8  
ATOM 10432 H HG22 . ILE A 1 6  ? -5.917  4.850   -5.611  1.00 0.00 ? 6   ILE A HG22 8  
ATOM 10433 H HG23 . ILE A 1 6  ? -7.368  5.526   -4.871  1.00 0.00 ? 6   ILE A HG23 8  
ATOM 10434 H HD11 . ILE A 1 6  ? -6.338  7.306   -9.625  1.00 0.00 ? 6   ILE A HD11 8  
ATOM 10435 H HD12 . ILE A 1 6  ? -5.013  7.458   -8.472  1.00 0.00 ? 6   ILE A HD12 8  
ATOM 10436 H HD13 . ILE A 1 6  ? -6.656  7.880   -7.989  1.00 0.00 ? 6   ILE A HD13 8  
ATOM 10437 N N    . ILE A 1 7  ? -9.048  3.655   -5.032  1.00 0.00 ? 7   ILE A N    8  
ATOM 10438 C CA   . ILE A 1 7  ? -10.029 3.562   -3.947  1.00 0.00 ? 7   ILE A CA   8  
ATOM 10439 C C    . ILE A 1 7  ? -9.344  3.467   -2.583  1.00 0.00 ? 7   ILE A C    8  
ATOM 10440 O O    . ILE A 1 7  ? -8.224  2.964   -2.473  1.00 0.00 ? 7   ILE A O    8  
ATOM 10441 C CB   . ILE A 1 7  ? -10.969 2.344   -4.118  1.00 0.00 ? 7   ILE A CB   8  
ATOM 10442 C CG1  . ILE A 1 7  ? -10.163 1.044   -4.220  1.00 0.00 ? 7   ILE A CG1  8  
ATOM 10443 C CG2  . ILE A 1 7  ? -11.863 2.519   -5.338  1.00 0.00 ? 7   ILE A CG2  8  
ATOM 10444 C CD1  . ILE A 1 7  ? -10.809 -0.124  -3.505  1.00 0.00 ? 7   ILE A CD1  8  
ATOM 10445 H H    . ILE A 1 7  ? -8.190  3.185   -4.942  1.00 0.00 ? 7   ILE A H    8  
ATOM 10446 H HA   . ILE A 1 7  ? -10.631 4.458   -3.970  1.00 0.00 ? 7   ILE A HA   8  
ATOM 10447 H HB   . ILE A 1 7  ? -11.606 2.293   -3.247  1.00 0.00 ? 7   ILE A HB   8  
ATOM 10448 H HG12 . ILE A 1 7  ? -10.053 0.776   -5.260  1.00 0.00 ? 7   ILE A HG12 8  
ATOM 10449 H HG13 . ILE A 1 7  ? -9.186  1.199   -3.787  1.00 0.00 ? 7   ILE A HG13 8  
ATOM 10450 H HG21 . ILE A 1 7  ? -11.252 2.589   -6.227  1.00 0.00 ? 7   ILE A HG21 8  
ATOM 10451 H HG22 . ILE A 1 7  ? -12.446 3.421   -5.231  1.00 0.00 ? 7   ILE A HG22 8  
ATOM 10452 H HG23 . ILE A 1 7  ? -12.526 1.671   -5.423  1.00 0.00 ? 7   ILE A HG23 8  
ATOM 10453 H HD11 . ILE A 1 7  ? -11.774 -0.326  -3.945  1.00 0.00 ? 7   ILE A HD11 8  
ATOM 10454 H HD12 . ILE A 1 7  ? -10.933 0.117   -2.459  1.00 0.00 ? 7   ILE A HD12 8  
ATOM 10455 H HD13 . ILE A 1 7  ? -10.181 -0.997  -3.602  1.00 0.00 ? 7   ILE A HD13 8  
ATOM 10456 N N    . THR A 1 8  ? -10.032 3.948   -1.546  1.00 0.00 ? 8   THR A N    8  
ATOM 10457 C CA   . THR A 1 8  ? -9.501  3.918   -0.182  1.00 0.00 ? 8   THR A CA   8  
ATOM 10458 C C    . THR A 1 8  ? -10.312 2.967   0.700   1.00 0.00 ? 8   THR A C    8  
ATOM 10459 O O    . THR A 1 8  ? -11.541 2.918   0.607   1.00 0.00 ? 8   THR A O    8  
ATOM 10460 C CB   . THR A 1 8  ? -9.509  5.326   0.429   1.00 0.00 ? 8   THR A CB   8  
ATOM 10461 O OG1  . THR A 1 8  ? -9.259  6.313   -0.558  1.00 0.00 ? 8   THR A OG1  8  
ATOM 10462 C CG2  . THR A 1 8  ? -8.487  5.509   1.532   1.00 0.00 ? 8   THR A CG2  8  
ATOM 10463 H H    . THR A 1 8  ? -10.921 4.331   -1.701  1.00 0.00 ? 8   THR A H    8  
ATOM 10464 H HA   . THR A 1 8  ? -8.482  3.563   -0.232  1.00 0.00 ? 8   THR A HA   8  
ATOM 10465 H HB   . THR A 1 8  ? -10.484 5.514   0.853   1.00 0.00 ? 8   THR A HB   8  
ATOM 10466 H HG1  . THR A 1 8  ? -8.390  6.174   -0.942  1.00 0.00 ? 8   THR A HG1  8  
ATOM 10467 H HG21 . THR A 1 8  ? -8.942  6.034   2.359   1.00 0.00 ? 8   THR A HG21 8  
ATOM 10468 H HG22 . THR A 1 8  ? -7.653  6.083   1.157   1.00 0.00 ? 8   THR A HG22 8  
ATOM 10469 H HG23 . THR A 1 8  ? -8.140  4.544   1.867   1.00 0.00 ? 8   THR A HG23 8  
ATOM 10470 N N    . VAL A 1 9  ? -9.615  2.219   1.558   1.00 0.00 ? 9   VAL A N    8  
ATOM 10471 C CA   . VAL A 1 9  ? -10.266 1.273   2.465   1.00 0.00 ? 9   VAL A CA   8  
ATOM 10472 C C    . VAL A 1 9  ? -9.912  1.571   3.920   1.00 0.00 ? 9   VAL A C    8  
ATOM 10473 O O    . VAL A 1 9  ? -8.736  1.685   4.273   1.00 0.00 ? 9   VAL A O    8  
ATOM 10474 C CB   . VAL A 1 9  ? -9.883  -0.188  2.141   1.00 0.00 ? 9   VAL A CB   8  
ATOM 10475 C CG1  . VAL A 1 9  ? -10.558 -0.642  0.856   1.00 0.00 ? 9   VAL A CG1  8  
ATOM 10476 C CG2  . VAL A 1 9  ? -8.371  -0.349  2.041   1.00 0.00 ? 9   VAL A CG2  8  
ATOM 10477 H H    . VAL A 1 9  ? -8.639  2.309   1.585   1.00 0.00 ? 9   VAL A H    8  
ATOM 10478 H HA   . VAL A 1 9  ? -11.334 1.376   2.340   1.00 0.00 ? 9   VAL A HA   8  
ATOM 10479 H HB   . VAL A 1 9  ? -10.237 -0.817  2.945   1.00 0.00 ? 9   VAL A HB   8  
ATOM 10480 H HG11 . VAL A 1 9  ? -11.624 -0.710  1.016   1.00 0.00 ? 9   VAL A HG11 8  
ATOM 10481 H HG12 . VAL A 1 9  ? -10.173 -1.608  0.567   1.00 0.00 ? 9   VAL A HG12 8  
ATOM 10482 H HG13 . VAL A 1 9  ? -10.358 0.075   0.073   1.00 0.00 ? 9   VAL A HG13 8  
ATOM 10483 H HG21 . VAL A 1 9  ? -7.907  0.050   2.931   1.00 0.00 ? 9   VAL A HG21 8  
ATOM 10484 H HG22 . VAL A 1 9  ? -8.008  0.186   1.176   1.00 0.00 ? 9   VAL A HG22 8  
ATOM 10485 H HG23 . VAL A 1 9  ? -8.125  -1.397  1.946   1.00 0.00 ? 9   VAL A HG23 8  
ATOM 10486 N N    . THR A 1 10 ? -10.938 1.695   4.761   1.00 0.00 ? 10  THR A N    8  
ATOM 10487 C CA   . THR A 1 10 ? -10.739 1.980   6.179   1.00 0.00 ? 10  THR A CA   8  
ATOM 10488 C C    . THR A 1 10 ? -11.065 0.753   7.033   1.00 0.00 ? 10  THR A C    8  
ATOM 10489 O O    . THR A 1 10 ? -12.221 0.335   7.118   1.00 0.00 ? 10  THR A O    8  
ATOM 10490 C CB   . THR A 1 10 ? -11.604 3.170   6.609   1.00 0.00 ? 10  THR A CB   8  
ATOM 10491 O OG1  . THR A 1 10 ? -11.464 4.250   5.701   1.00 0.00 ? 10  THR A OG1  8  
ATOM 10492 C CG2  . THR A 1 10 ? -11.266 3.687   7.991   1.00 0.00 ? 10  THR A CG2  8  
ATOM 10493 H H    . THR A 1 10 ? -11.852 1.593   4.419   1.00 0.00 ? 10  THR A H    8  
ATOM 10494 H HA   . THR A 1 10 ? -9.700  2.235   6.318   1.00 0.00 ? 10  THR A HA   8  
ATOM 10495 H HB   . THR A 1 10 ? -12.641 2.865   6.615   1.00 0.00 ? 10  THR A HB   8  
ATOM 10496 H HG1  . THR A 1 10 ? -12.194 4.864   5.815   1.00 0.00 ? 10  THR A HG1  8  
ATOM 10497 H HG21 . THR A 1 10 ? -10.247 4.047   8.002   1.00 0.00 ? 10  THR A HG21 8  
ATOM 10498 H HG22 . THR A 1 10 ? -11.373 2.888   8.711   1.00 0.00 ? 10  THR A HG22 8  
ATOM 10499 H HG23 . THR A 1 10 ? -11.936 4.494   8.247   1.00 0.00 ? 10  THR A HG23 8  
ATOM 10500 N N    . LEU A 1 11 ? -10.036 0.179   7.659   1.00 0.00 ? 11  LEU A N    8  
ATOM 10501 C CA   . LEU A 1 11 ? -10.206 -1.006  8.503   1.00 0.00 ? 11  LEU A CA   8  
ATOM 10502 C C    . LEU A 1 11 ? -9.359  -0.905  9.774   1.00 0.00 ? 11  LEU A C    8  
ATOM 10503 O O    . LEU A 1 11 ? -8.421  -0.111  9.840   1.00 0.00 ? 11  LEU A O    8  
ATOM 10504 C CB   . LEU A 1 11 ? -9.820  -2.270  7.727   1.00 0.00 ? 11  LEU A CB   8  
ATOM 10505 C CG   . LEU A 1 11 ? -10.658 -2.552  6.476   1.00 0.00 ? 11  LEU A CG   8  
ATOM 10506 C CD1  . LEU A 1 11 ? -9.797  -3.164  5.380   1.00 0.00 ? 11  LEU A CD1  8  
ATOM 10507 C CD2  . LEU A 1 11 ? -11.828 -3.466  6.814   1.00 0.00 ? 11  LEU A CD2  8  
ATOM 10508 H H    . LEU A 1 11 ? -9.138  0.558   7.549   1.00 0.00 ? 11  LEU A H    8  
ATOM 10509 H HA   . LEU A 1 11 ? -11.248 -1.069  8.782   1.00 0.00 ? 11  LEU A HA   8  
ATOM 10510 H HB2  . LEU A 1 11 ? -8.785  -2.180  7.428   1.00 0.00 ? 11  LEU A HB2  8  
ATOM 10511 H HB3  . LEU A 1 11 ? -9.911  -3.116  8.391   1.00 0.00 ? 11  LEU A HB3  8  
ATOM 10512 H HG   . LEU A 1 11 ? -11.059 -1.621  6.102   1.00 0.00 ? 11  LEU A HG   8  
ATOM 10513 H HD11 . LEU A 1 11 ? -10.167 -2.852  4.414   1.00 0.00 ? 11  LEU A HD11 8  
ATOM 10514 H HD12 . LEU A 1 11 ? -9.836  -4.241  5.449   1.00 0.00 ? 11  LEU A HD12 8  
ATOM 10515 H HD13 . LEU A 1 11 ? -8.775  -2.833  5.497   1.00 0.00 ? 11  LEU A HD13 8  
ATOM 10516 H HD21 . LEU A 1 11 ? -12.423 -3.017  7.595   1.00 0.00 ? 11  LEU A HD21 8  
ATOM 10517 H HD22 . LEU A 1 11 ? -11.453 -4.421  7.151   1.00 0.00 ? 11  LEU A HD22 8  
ATOM 10518 H HD23 . LEU A 1 11 ? -12.439 -3.610  5.934   1.00 0.00 ? 11  LEU A HD23 8  
ATOM 10519 N N    . LYS A 1 12 ? -9.691  -1.719  10.777  1.00 0.00 ? 12  LYS A N    8  
ATOM 10520 C CA   . LYS A 1 12 ? -8.953  -1.724  12.042  1.00 0.00 ? 12  LYS A CA   8  
ATOM 10521 C C    . LYS A 1 12 ? -7.926  -2.859  12.070  1.00 0.00 ? 12  LYS A C    8  
ATOM 10522 O O    . LYS A 1 12 ? -7.846  -3.657  11.136  1.00 0.00 ? 12  LYS A O    8  
ATOM 10523 C CB   . LYS A 1 12 ? -9.920  -1.861  13.223  1.00 0.00 ? 12  LYS A CB   8  
ATOM 10524 C CG   . LYS A 1 12 ? -10.231 -0.542  13.917  1.00 0.00 ? 12  LYS A CG   8  
ATOM 10525 C CD   . LYS A 1 12 ? -11.281 0.256   13.157  1.00 0.00 ? 12  LYS A CD   8  
ATOM 10526 C CE   . LYS A 1 12 ? -12.128 1.106   14.094  1.00 0.00 ? 12  LYS A CE   8  
ATOM 10527 N NZ   . LYS A 1 12 ? -13.432 1.486   13.479  1.00 0.00 ? 12  LYS A NZ   8  
ATOM 10528 H H    . LYS A 1 12 ? -10.446 -2.335  10.663  1.00 0.00 ? 12  LYS A H    8  
ATOM 10529 H HA   . LYS A 1 12 ? -8.431  -0.782  12.123  1.00 0.00 ? 12  LYS A HA   8  
ATOM 10530 H HB2  . LYS A 1 12 ? -10.848 -2.285  12.867  1.00 0.00 ? 12  LYS A HB2  8  
ATOM 10531 H HB3  . LYS A 1 12 ? -9.487  -2.531  13.951  1.00 0.00 ? 12  LYS A HB3  8  
ATOM 10532 H HG2  . LYS A 1 12 ? -10.599 -0.749  14.910  1.00 0.00 ? 12  LYS A HG2  8  
ATOM 10533 H HG3  . LYS A 1 12 ? -9.325  0.041   13.981  1.00 0.00 ? 12  LYS A HG3  8  
ATOM 10534 H HD2  . LYS A 1 12 ? -10.784 0.905   12.451  1.00 0.00 ? 12  LYS A HD2  8  
ATOM 10535 H HD3  . LYS A 1 12 ? -11.925 -0.429  12.626  1.00 0.00 ? 12  LYS A HD3  8  
ATOM 10536 H HE2  . LYS A 1 12 ? -12.318 0.545   14.997  1.00 0.00 ? 12  LYS A HE2  8  
ATOM 10537 H HE3  . LYS A 1 12 ? -11.580 2.004   14.338  1.00 0.00 ? 12  LYS A HE3  8  
ATOM 10538 H HZ1  . LYS A 1 12 ? -14.035 0.646   13.372  1.00 0.00 ? 12  LYS A HZ1  8  
ATOM 10539 H HZ2  . LYS A 1 12 ? -13.276 1.909   12.541  1.00 0.00 ? 12  LYS A HZ2  8  
ATOM 10540 H HZ3  . LYS A 1 12 ? -13.923 2.178   14.080  1.00 0.00 ? 12  LYS A HZ3  8  
ATOM 10541 N N    . LYS A 1 13 ? -7.140  -2.925  13.146  1.00 0.00 ? 13  LYS A N    8  
ATOM 10542 C CA   . LYS A 1 13 ? -6.116  -3.963  13.290  1.00 0.00 ? 13  LYS A CA   8  
ATOM 10543 C C    . LYS A 1 13 ? -6.530  -5.017  14.319  1.00 0.00 ? 13  LYS A C    8  
ATOM 10544 O O    . LYS A 1 13 ? -7.253  -4.720  15.271  1.00 0.00 ? 13  LYS A O    8  
ATOM 10545 C CB   . LYS A 1 13 ? -4.779  -3.343  13.705  1.00 0.00 ? 13  LYS A CB   8  
ATOM 10546 C CG   . LYS A 1 13 ? -4.093  -2.556  12.598  1.00 0.00 ? 13  LYS A CG   8  
ATOM 10547 C CD   . LYS A 1 13 ? -3.846  -1.112  13.013  1.00 0.00 ? 13  LYS A CD   8  
ATOM 10548 C CE   . LYS A 1 13 ? -2.455  -0.927  13.607  1.00 0.00 ? 13  LYS A CE   8  
ATOM 10549 N NZ   . LYS A 1 13 ? -2.259  -1.739  14.842  1.00 0.00 ? 13  LYS A NZ   8  
ATOM 10550 H H    . LYS A 1 13 ? -7.249  -2.260  13.858  1.00 0.00 ? 13  LYS A H    8  
ATOM 10551 H HA   . LYS A 1 13 ? -5.995  -4.444  12.330  1.00 0.00 ? 13  LYS A HA   8  
ATOM 10552 H HB2  . LYS A 1 13 ? -4.948  -2.679  14.538  1.00 0.00 ? 13  LYS A HB2  8  
ATOM 10553 H HB3  . LYS A 1 13 ? -4.112  -4.132  14.021  1.00 0.00 ? 13  LYS A HB3  8  
ATOM 10554 H HG2  . LYS A 1 13 ? -3.145  -3.023  12.373  1.00 0.00 ? 13  LYS A HG2  8  
ATOM 10555 H HG3  . LYS A 1 13 ? -4.720  -2.567  11.719  1.00 0.00 ? 13  LYS A HG3  8  
ATOM 10556 H HD2  . LYS A 1 13 ? -3.942  -0.478  12.145  1.00 0.00 ? 13  LYS A HD2  8  
ATOM 10557 H HD3  . LYS A 1 13 ? -4.583  -0.830  13.750  1.00 0.00 ? 13  LYS A HD3  8  
ATOM 10558 H HE2  . LYS A 1 13 ? -1.722  -1.224  12.872  1.00 0.00 ? 13  LYS A HE2  8  
ATOM 10559 H HE3  . LYS A 1 13 ? -2.318  0.117   13.848  1.00 0.00 ? 13  LYS A HE3  8  
ATOM 10560 H HZ1  . LYS A 1 13 ? -3.061  -1.604  15.491  1.00 0.00 ? 13  LYS A HZ1  8  
ATOM 10561 H HZ2  . LYS A 1 13 ? -1.385  -1.450  15.325  1.00 0.00 ? 13  LYS A HZ2  8  
ATOM 10562 H HZ3  . LYS A 1 13 ? -2.189  -2.748  14.599  1.00 0.00 ? 13  LYS A HZ3  8  
ATOM 10563 N N    . GLN A 1 14 ? -6.055  -6.248  14.120  1.00 0.00 ? 14  GLN A N    8  
ATOM 10564 C CA   . GLN A 1 14 ? -6.359  -7.354  15.029  1.00 0.00 ? 14  GLN A CA   8  
ATOM 10565 C C    . GLN A 1 14 ? -5.081  -8.112  15.401  1.00 0.00 ? 14  GLN A C    8  
ATOM 10566 O O    . GLN A 1 14 ? -4.726  -8.208  16.576  1.00 0.00 ? 14  GLN A O    8  
ATOM 10567 C CB   . GLN A 1 14 ? -7.385  -8.313  14.400  1.00 0.00 ? 14  GLN A CB   8  
ATOM 10568 C CG   . GLN A 1 14 ? -7.210  -8.529  12.901  1.00 0.00 ? 14  GLN A CG   8  
ATOM 10569 C CD   . GLN A 1 14 ? -8.415  -8.074  12.095  1.00 0.00 ? 14  GLN A CD   8  
ATOM 10570 O OE1  . GLN A 1 14 ? -8.927  -8.814  11.254  1.00 0.00 ? 14  GLN A OE1  8  
ATOM 10571 N NE2  . GLN A 1 14 ? -8.875  -6.853  12.347  1.00 0.00 ? 14  GLN A NE2  8  
ATOM 10572 H H    . GLN A 1 14 ? -5.478  -6.414  13.346  1.00 0.00 ? 14  GLN A H    8  
ATOM 10573 H HA   . GLN A 1 14 ? -6.783  -6.932  15.929  1.00 0.00 ? 14  GLN A HA   8  
ATOM 10574 H HB2  . GLN A 1 14 ? -7.305  -9.273  14.887  1.00 0.00 ? 14  GLN A HB2  8  
ATOM 10575 H HB3  . GLN A 1 14 ? -8.377  -7.918  14.570  1.00 0.00 ? 14  GLN A HB3  8  
ATOM 10576 H HG2  . GLN A 1 14 ? -6.346  -7.977  12.566  1.00 0.00 ? 14  GLN A HG2  8  
ATOM 10577 H HG3  . GLN A 1 14 ? -7.053  -9.583  12.720  1.00 0.00 ? 14  GLN A HG3  8  
ATOM 10578 H HE21 . GLN A 1 14 ? -8.420  -6.318  13.030  1.00 0.00 ? 14  GLN A HE21 8  
ATOM 10579 H HE22 . GLN A 1 14 ? -9.651  -6.537  11.841  1.00 0.00 ? 14  GLN A HE22 8  
ATOM 10580 N N    . ASN A 1 15 ? -4.389  -8.639  14.389  1.00 0.00 ? 15  ASN A N    8  
ATOM 10581 C CA   . ASN A 1 15 ? -3.145  -9.378  14.600  1.00 0.00 ? 15  ASN A CA   8  
ATOM 10582 C C    . ASN A 1 15 ? -2.106  -8.993  13.543  1.00 0.00 ? 15  ASN A C    8  
ATOM 10583 O O    . ASN A 1 15 ? -1.323  -9.832  13.090  1.00 0.00 ? 15  ASN A O    8  
ATOM 10584 C CB   . ASN A 1 15 ? -3.409  -10.889 14.563  1.00 0.00 ? 15  ASN A CB   8  
ATOM 10585 C CG   . ASN A 1 15 ? -3.831  -11.433 15.915  1.00 0.00 ? 15  ASN A CG   8  
ATOM 10586 O OD1  . ASN A 1 15 ? -4.978  -11.270 16.330  1.00 0.00 ? 15  ASN A OD1  8  
ATOM 10587 N ND2  . ASN A 1 15 ? -2.903  -12.079 16.617  1.00 0.00 ? 15  ASN A ND2  8  
ATOM 10588 H H    . ASN A 1 15 ? -4.720  -8.522  13.475  1.00 0.00 ? 15  ASN A H    8  
ATOM 10589 H HA   . ASN A 1 15 ? -2.764  -9.112  15.575  1.00 0.00 ? 15  ASN A HA   8  
ATOM 10590 H HB2  . ASN A 1 15 ? -4.196  -11.094 13.852  1.00 0.00 ? 15  ASN A HB2  8  
ATOM 10591 H HB3  . ASN A 1 15 ? -2.509  -11.399 14.255  1.00 0.00 ? 15  ASN A HB3  8  
ATOM 10592 H HD21 . ASN A 1 15 ? -2.007  -12.168 16.230  1.00 0.00 ? 15  ASN A HD21 8  
ATOM 10593 H HD22 . ASN A 1 15 ? -3.155  -12.441 17.492  1.00 0.00 ? 15  ASN A HD22 8  
ATOM 10594 N N    . GLY A 1 16 ? -2.110  -7.716  13.150  1.00 0.00 ? 16  GLY A N    8  
ATOM 10595 C CA   . GLY A 1 16 ? -1.174  -7.238  12.146  1.00 0.00 ? 16  GLY A CA   8  
ATOM 10596 C C    . GLY A 1 16 ? -1.746  -7.328  10.743  1.00 0.00 ? 16  GLY A C    8  
ATOM 10597 O O    . GLY A 1 16 ? -2.603  -8.172  10.472  1.00 0.00 ? 16  GLY A O    8  
ATOM 10598 H H    . GLY A 1 16 ? -2.759  -7.092  13.543  1.00 0.00 ? 16  GLY A H    8  
ATOM 10599 H HA2  . GLY A 1 16 ? -0.927  -6.208  12.359  1.00 0.00 ? 16  GLY A HA2  8  
ATOM 10600 H HA3  . GLY A 1 16 ? -0.274  -7.832  12.195  1.00 0.00 ? 16  GLY A HA3  8  
ATOM 10601 N N    . MET A 1 17 ? -1.275  -6.459  9.849   1.00 0.00 ? 17  MET A N    8  
ATOM 10602 C CA   . MET A 1 17 ? -1.749  -6.451  8.467   1.00 0.00 ? 17  MET A CA   8  
ATOM 10603 C C    . MET A 1 17 ? -1.376  -7.753  7.760   1.00 0.00 ? 17  MET A C    8  
ATOM 10604 O O    . MET A 1 17 ? -2.223  -8.386  7.129   1.00 0.00 ? 17  MET A O    8  
ATOM 10605 C CB   . MET A 1 17 ? -1.170  -5.253  7.703   1.00 0.00 ? 17  MET A CB   8  
ATOM 10606 C CG   . MET A 1 17 ? -1.832  -3.929  8.058   1.00 0.00 ? 17  MET A CG   8  
ATOM 10607 S SD   . MET A 1 17 ? -2.198  -2.922  6.606   1.00 0.00 ? 17  MET A SD   8  
ATOM 10608 C CE   . MET A 1 17 ? -0.779  -1.829  6.575   1.00 0.00 ? 17  MET A CE   8  
ATOM 10609 H H    . MET A 1 17 ? -0.594  -5.810  10.125  1.00 0.00 ? 17  MET A H    8  
ATOM 10610 H HA   . MET A 1 17 ? -2.826  -6.367  8.489   1.00 0.00 ? 17  MET A HA   8  
ATOM 10611 H HB2  . MET A 1 17 ? -0.116  -5.176  7.926   1.00 0.00 ? 17  MET A HB2  8  
ATOM 10612 H HB3  . MET A 1 17 ? -1.290  -5.422  6.641   1.00 0.00 ? 17  MET A HB3  8  
ATOM 10613 H HG2  . MET A 1 17 ? -2.757  -4.132  8.578   1.00 0.00 ? 17  MET A HG2  8  
ATOM 10614 H HG3  . MET A 1 17 ? -1.171  -3.374  8.708   1.00 0.00 ? 17  MET A HG3  8  
ATOM 10615 H HE1  . MET A 1 17 ? -0.495  -1.639  5.551   1.00 0.00 ? 17  MET A HE1  8  
ATOM 10616 H HE2  . MET A 1 17 ? 0.046   -2.292  7.098   1.00 0.00 ? 17  MET A HE2  8  
ATOM 10617 H HE3  . MET A 1 17 ? -1.032  -0.896  7.057   1.00 0.00 ? 17  MET A HE3  8  
ATOM 10618 N N    . GLY A 1 18 ? -0.106  -8.149  7.879   1.00 0.00 ? 18  GLY A N    8  
ATOM 10619 C CA   . GLY A 1 18 ? 0.358   -9.377  7.257   1.00 0.00 ? 18  GLY A CA   8  
ATOM 10620 C C    . GLY A 1 18 ? 0.188   -9.377  5.748   1.00 0.00 ? 18  GLY A C    8  
ATOM 10621 O O    . GLY A 1 18 ? -0.785  -9.922  5.231   1.00 0.00 ? 18  GLY A O    8  
ATOM 10622 H H    . GLY A 1 18 ? 0.520   -7.602  8.401   1.00 0.00 ? 18  GLY A H    8  
ATOM 10623 H HA2  . GLY A 1 18 ? 1.405   -9.511  7.490   1.00 0.00 ? 18  GLY A HA2  8  
ATOM 10624 H HA3  . GLY A 1 18 ? -0.198  -10.206 7.671   1.00 0.00 ? 18  GLY A HA3  8  
ATOM 10625 N N    . LEU A 1 19 ? 1.139   -8.765  5.043   1.00 0.00 ? 19  LEU A N    8  
ATOM 10626 C CA   . LEU A 1 19 ? 1.100   -8.703  3.578   1.00 0.00 ? 19  LEU A CA   8  
ATOM 10627 C C    . LEU A 1 19 ? 2.488   -8.388  3.010   1.00 0.00 ? 19  LEU A C    8  
ATOM 10628 O O    . LEU A 1 19 ? 3.450   -8.219  3.761   1.00 0.00 ? 19  LEU A O    8  
ATOM 10629 C CB   . LEU A 1 19 ? 0.070   -7.670  3.105   1.00 0.00 ? 19  LEU A CB   8  
ATOM 10630 C CG   . LEU A 1 19 ? 0.344   -6.231  3.536   1.00 0.00 ? 19  LEU A CG   8  
ATOM 10631 C CD1  . LEU A 1 19 ? 1.101   -5.486  2.446   1.00 0.00 ? 19  LEU A CD1  8  
ATOM 10632 C CD2  . LEU A 1 19 ? -0.954  -5.512  3.878   1.00 0.00 ? 19  LEU A CD2  8  
ATOM 10633 H H    . LEU A 1 19 ? 1.892   -8.351  5.517   1.00 0.00 ? 19  LEU A H    8  
ATOM 10634 H HA   . LEU A 1 19 ? 0.803   -9.677  3.218   1.00 0.00 ? 19  LEU A HA   8  
ATOM 10635 H HB2  . LEU A 1 19 ? 0.033   -7.699  2.026   1.00 0.00 ? 19  LEU A HB2  8  
ATOM 10636 H HB3  . LEU A 1 19 ? -0.899  -7.958  3.487   1.00 0.00 ? 19  LEU A HB3  8  
ATOM 10637 H HG   . LEU A 1 19 ? 0.958   -6.249  4.423   1.00 0.00 ? 19  LEU A HG   8  
ATOM 10638 H HD11 . LEU A 1 19 ? 2.163   -5.568  2.624   1.00 0.00 ? 19  LEU A HD11 8  
ATOM 10639 H HD12 . LEU A 1 19 ? 0.815   -4.445  2.453   1.00 0.00 ? 19  LEU A HD12 8  
ATOM 10640 H HD13 . LEU A 1 19 ? 0.863   -5.918  1.484   1.00 0.00 ? 19  LEU A HD13 8  
ATOM 10641 H HD21 . LEU A 1 19 ? -1.301  -4.965  3.014   1.00 0.00 ? 19  LEU A HD21 8  
ATOM 10642 H HD22 . LEU A 1 19 ? -0.778  -4.824  4.693   1.00 0.00 ? 19  LEU A HD22 8  
ATOM 10643 H HD23 . LEU A 1 19 ? -1.701  -6.234  4.170   1.00 0.00 ? 19  LEU A HD23 8  
ATOM 10644 N N    . SER A 1 20 ? 2.584   -8.313  1.683   1.00 0.00 ? 20  SER A N    8  
ATOM 10645 C CA   . SER A 1 20 ? 3.856   -8.025  1.018   1.00 0.00 ? 20  SER A CA   8  
ATOM 10646 C C    . SER A 1 20 ? 3.708   -6.891  0.007   1.00 0.00 ? 20  SER A C    8  
ATOM 10647 O O    . SER A 1 20 ? 2.674   -6.769  -0.651  1.00 0.00 ? 20  SER A O    8  
ATOM 10648 C CB   . SER A 1 20 ? 4.382   -9.280  0.317   1.00 0.00 ? 20  SER A CB   8  
ATOM 10649 O OG   . SER A 1 20 ? 4.889   -10.211 1.257   1.00 0.00 ? 20  SER A OG   8  
ATOM 10650 H H    . SER A 1 20 ? 1.784   -8.459  1.138   1.00 0.00 ? 20  SER A H    8  
ATOM 10651 H HA   . SER A 1 20 ? 4.565   -7.725  1.775   1.00 0.00 ? 20  SER A HA   8  
ATOM 10652 H HB2  . SER A 1 20 ? 3.580   -9.745  -0.236  1.00 0.00 ? 20  SER A HB2  8  
ATOM 10653 H HB3  . SER A 1 20 ? 5.176   -9.004  -0.363  1.00 0.00 ? 20  SER A HB3  8  
ATOM 10654 H HG   . SER A 1 20 ? 5.456   -10.843 0.809   1.00 0.00 ? 20  SER A HG   8  
ATOM 10655 N N    . ILE A 1 21 ? 4.752   -6.066  -0.120  1.00 0.00 ? 21  ILE A N    8  
ATOM 10656 C CA   . ILE A 1 21 ? 4.730   -4.943  -1.060  1.00 0.00 ? 21  ILE A CA   8  
ATOM 10657 C C    . ILE A 1 21 ? 6.078   -4.761  -1.759  1.00 0.00 ? 21  ILE A C    8  
ATOM 10658 O O    . ILE A 1 21 ? 7.132   -5.005  -1.169  1.00 0.00 ? 21  ILE A O    8  
ATOM 10659 C CB   . ILE A 1 21 ? 4.342   -3.619  -0.367  1.00 0.00 ? 21  ILE A CB   8  
ATOM 10660 C CG1  . ILE A 1 21 ? 5.212   -3.373  0.869   1.00 0.00 ? 21  ILE A CG1  8  
ATOM 10661 C CG2  . ILE A 1 21 ? 2.867   -3.630  0.004   1.00 0.00 ? 21  ILE A CG2  8  
ATOM 10662 C CD1  . ILE A 1 21 ? 6.472   -2.596  0.565   1.00 0.00 ? 21  ILE A CD1  8  
ATOM 10663 H H    . ILE A 1 21 ? 5.552   -6.216  0.430   1.00 0.00 ? 21  ILE A H    8  
ATOM 10664 H HA   . ILE A 1 21 ? 3.984   -5.161  -1.809  1.00 0.00 ? 21  ILE A HA   8  
ATOM 10665 H HB   . ILE A 1 21 ? 4.501   -2.815  -1.071  1.00 0.00 ? 21  ILE A HB   8  
ATOM 10666 H HG12 . ILE A 1 21 ? 4.645   -2.813  1.599   1.00 0.00 ? 21  ILE A HG12 8  
ATOM 10667 H HG13 . ILE A 1 21 ? 5.500   -4.324  1.293   1.00 0.00 ? 21  ILE A HG13 8  
ATOM 10668 H HG21 . ILE A 1 21 ? 2.493   -2.617  0.023   1.00 0.00 ? 21  ILE A HG21 8  
ATOM 10669 H HG22 . ILE A 1 21 ? 2.742   -4.078  0.978   1.00 0.00 ? 21  ILE A HG22 8  
ATOM 10670 H HG23 . ILE A 1 21 ? 2.318   -4.202  -0.729  1.00 0.00 ? 21  ILE A HG23 8  
ATOM 10671 H HD11 . ILE A 1 21 ? 6.395   -2.161  -0.420  1.00 0.00 ? 21  ILE A HD11 8  
ATOM 10672 H HD12 . ILE A 1 21 ? 7.322   -3.262  0.598   1.00 0.00 ? 21  ILE A HD12 8  
ATOM 10673 H HD13 . ILE A 1 21 ? 6.600   -1.813  1.296   1.00 0.00 ? 21  ILE A HD13 8  
ATOM 10674 N N    . VAL A 1 22 ? 6.031   -4.328  -3.022  1.00 0.00 ? 22  VAL A N    8  
ATOM 10675 C CA   . VAL A 1 22 ? 7.244   -4.111  -3.811  1.00 0.00 ? 22  VAL A CA   8  
ATOM 10676 C C    . VAL A 1 22 ? 7.214   -2.760  -4.527  1.00 0.00 ? 22  VAL A C    8  
ATOM 10677 O O    . VAL A 1 22 ? 6.193   -2.369  -5.094  1.00 0.00 ? 22  VAL A O    8  
ATOM 10678 C CB   . VAL A 1 22 ? 7.438   -5.225  -4.869  1.00 0.00 ? 22  VAL A CB   8  
ATOM 10679 C CG1  . VAL A 1 22 ? 8.788   -5.096  -5.563  1.00 0.00 ? 22  VAL A CG1  8  
ATOM 10680 C CG2  . VAL A 1 22 ? 7.290   -6.603  -4.241  1.00 0.00 ? 22  VAL A CG2  8  
ATOM 10681 H H    . VAL A 1 22 ? 5.157   -4.152  -3.434  1.00 0.00 ? 22  VAL A H    8  
ATOM 10682 H HA   . VAL A 1 22 ? 8.085   -4.127  -3.135  1.00 0.00 ? 22  VAL A HA   8  
ATOM 10683 H HB   . VAL A 1 22 ? 6.668   -5.115  -5.618  1.00 0.00 ? 22  VAL A HB   8  
ATOM 10684 H HG11 . VAL A 1 22 ? 9.527   -5.670  -5.024  1.00 0.00 ? 22  VAL A HG11 8  
ATOM 10685 H HG12 . VAL A 1 22 ? 9.085   -4.059  -5.589  1.00 0.00 ? 22  VAL A HG12 8  
ATOM 10686 H HG13 . VAL A 1 22 ? 8.709   -5.472  -6.573  1.00 0.00 ? 22  VAL A HG13 8  
ATOM 10687 H HG21 . VAL A 1 22 ? 8.055   -7.259  -4.628  1.00 0.00 ? 22  VAL A HG21 8  
ATOM 10688 H HG22 . VAL A 1 22 ? 6.317   -7.005  -4.484  1.00 0.00 ? 22  VAL A HG22 8  
ATOM 10689 H HG23 . VAL A 1 22 ? 7.389   -6.524  -3.170  1.00 0.00 ? 22  VAL A HG23 8  
ATOM 10690 N N    . ALA A 1 23 ? 8.349   -2.060  -4.502  1.00 0.00 ? 23  ALA A N    8  
ATOM 10691 C CA   . ALA A 1 23 ? 8.472   -0.760  -5.159  1.00 0.00 ? 23  ALA A CA   8  
ATOM 10692 C C    . ALA A 1 23 ? 8.713   -0.933  -6.659  1.00 0.00 ? 23  ALA A C    8  
ATOM 10693 O O    . ALA A 1 23 ? 9.168   -1.992  -7.102  1.00 0.00 ? 23  ALA A O    8  
ATOM 10694 C CB   . ALA A 1 23 ? 9.598   0.049   -4.527  1.00 0.00 ? 23  ALA A CB   8  
ATOM 10695 H H    . ALA A 1 23 ? 9.129   -2.435  -4.041  1.00 0.00 ? 23  ALA A H    8  
ATOM 10696 H HA   . ALA A 1 23 ? 7.547   -0.222  -5.007  1.00 0.00 ? 23  ALA A HA   8  
ATOM 10697 H HB1  . ALA A 1 23 ? 9.187   0.932   -4.061  1.00 0.00 ? 23  ALA A HB1  8  
ATOM 10698 H HB2  . ALA A 1 23 ? 10.305  0.342   -5.290  1.00 0.00 ? 23  ALA A HB2  8  
ATOM 10699 H HB3  . ALA A 1 23 ? 10.101  -0.550  -3.782  1.00 0.00 ? 23  ALA A HB3  8  
ATOM 10700 N N    . ALA A 1 24 ? 8.418   0.106   -7.439  1.00 0.00 ? 24  ALA A N    8  
ATOM 10701 C CA   . ALA A 1 24 ? 8.614   0.055   -8.887  1.00 0.00 ? 24  ALA A CA   8  
ATOM 10702 C C    . ALA A 1 24 ? 8.696   1.456   -9.487  1.00 0.00 ? 24  ALA A C    8  
ATOM 10703 O O    . ALA A 1 24 ? 7.974   2.365   -9.069  1.00 0.00 ? 24  ALA A O    8  
ATOM 10704 C CB   . ALA A 1 24 ? 7.502   -0.742  -9.556  1.00 0.00 ? 24  ALA A CB   8  
ATOM 10705 H H    . ALA A 1 24 ? 8.061   0.925   -7.033  1.00 0.00 ? 24  ALA A H    8  
ATOM 10706 H HA   . ALA A 1 24 ? 9.549   -0.455  -9.074  1.00 0.00 ? 24  ALA A HA   8  
ATOM 10707 H HB1  . ALA A 1 24 ? 7.928   -1.399  -10.299 1.00 0.00 ? 24  ALA A HB1  8  
ATOM 10708 H HB2  . ALA A 1 24 ? 6.809   -0.064  -10.032 1.00 0.00 ? 24  ALA A HB2  8  
ATOM 10709 H HB3  . ALA A 1 24 ? 6.980   -1.327  -8.814  1.00 0.00 ? 24  ALA A HB3  8  
ATOM 10710 N N    . LYS A 1 25 ? 9.581   1.618   -10.469 1.00 0.00 ? 25  LYS A N    8  
ATOM 10711 C CA   . LYS A 1 25 ? 9.771   2.901   -11.141 1.00 0.00 ? 25  LYS A CA   8  
ATOM 10712 C C    . LYS A 1 25 ? 9.632   2.747   -12.655 1.00 0.00 ? 25  LYS A C    8  
ATOM 10713 O O    . LYS A 1 25 ? 9.388   1.647   -13.158 1.00 0.00 ? 25  LYS A O    8  
ATOM 10714 C CB   . LYS A 1 25 ? 11.147  3.482   -10.797 1.00 0.00 ? 25  LYS A CB   8  
ATOM 10715 C CG   . LYS A 1 25 ? 11.092  4.913   -10.288 1.00 0.00 ? 25  LYS A CG   8  
ATOM 10716 C CD   . LYS A 1 25 ? 12.410  5.331   -9.655  1.00 0.00 ? 25  LYS A CD   8  
ATOM 10717 C CE   . LYS A 1 25 ? 12.525  6.844   -9.552  1.00 0.00 ? 25  LYS A CE   8  
ATOM 10718 N NZ   . LYS A 1 25 ? 13.338  7.419   -10.661 1.00 0.00 ? 25  LYS A NZ   8  
ATOM 10719 H H    . LYS A 1 25 ? 10.122  0.851   -10.752 1.00 0.00 ? 25  LYS A H    8  
ATOM 10720 H HA   . LYS A 1 25 ? 9.005   3.576   -10.788 1.00 0.00 ? 25  LYS A HA   8  
ATOM 10721 H HB2  . LYS A 1 25 ? 11.605  2.869   -10.035 1.00 0.00 ? 25  LYS A HB2  8  
ATOM 10722 H HB3  . LYS A 1 25 ? 11.765  3.461   -11.682 1.00 0.00 ? 25  LYS A HB3  8  
ATOM 10723 H HG2  . LYS A 1 25 ? 10.877  5.571   -11.117 1.00 0.00 ? 25  LYS A HG2  8  
ATOM 10724 H HG3  . LYS A 1 25 ? 10.307  4.991   -9.550  1.00 0.00 ? 25  LYS A HG3  8  
ATOM 10725 H HD2  . LYS A 1 25 ? 12.472  4.907   -8.664  1.00 0.00 ? 25  LYS A HD2  8  
ATOM 10726 H HD3  . LYS A 1 25 ? 13.223  4.956   -10.260 1.00 0.00 ? 25  LYS A HD3  8  
ATOM 10727 H HE2  . LYS A 1 25 ? 11.534  7.271   -9.587  1.00 0.00 ? 25  LYS A HE2  8  
ATOM 10728 H HE3  . LYS A 1 25 ? 12.990  7.093   -8.609  1.00 0.00 ? 25  LYS A HE3  8  
ATOM 10729 H HZ1  . LYS A 1 25 ? 14.293  7.007   -10.656 1.00 0.00 ? 25  LYS A HZ1  8  
ATOM 10730 H HZ2  . LYS A 1 25 ? 13.417  8.450   -10.548 1.00 0.00 ? 25  LYS A HZ2  8  
ATOM 10731 H HZ3  . LYS A 1 25 ? 12.888  7.217   -11.577 1.00 0.00 ? 25  LYS A HZ3  8  
ATOM 10732 N N    . GLY A 1 26 ? 9.793   3.856   -13.377 1.00 0.00 ? 26  GLY A N    8  
ATOM 10733 C CA   . GLY A 1 26 ? 9.689   3.829   -14.821 1.00 0.00 ? 26  GLY A CA   8  
ATOM 10734 C C    . GLY A 1 26 ? 10.398  5.006   -15.448 1.00 0.00 ? 26  GLY A C    8  
ATOM 10735 O O    . GLY A 1 26 ? 11.463  5.417   -14.977 1.00 0.00 ? 26  GLY A O    8  
ATOM 10736 H H    . GLY A 1 26 ? 9.994   4.705   -12.926 1.00 0.00 ? 26  GLY A H    8  
ATOM 10737 H HA2  . GLY A 1 26 ? 10.126  2.917   -15.193 1.00 0.00 ? 26  GLY A HA2  8  
ATOM 10738 H HA3  . GLY A 1 26 ? 8.647   3.859   -15.099 1.00 0.00 ? 26  GLY A HA3  8  
ATOM 10739 N N    . ALA A 1 27 ? 9.808   5.561   -16.497 1.00 0.00 ? 27  ALA A N    8  
ATOM 10740 C CA   . ALA A 1 27 ? 10.395  6.711   -17.167 1.00 0.00 ? 27  ALA A CA   8  
ATOM 10741 C C    . ALA A 1 27 ? 9.621   7.981   -16.830 1.00 0.00 ? 27  ALA A C    8  
ATOM 10742 O O    . ALA A 1 27 ? 8.391   7.967   -16.757 1.00 0.00 ? 27  ALA A O    8  
ATOM 10743 C CB   . ALA A 1 27 ? 10.445  6.494   -18.673 1.00 0.00 ? 27  ALA A CB   8  
ATOM 10744 H H    . ALA A 1 27 ? 8.958   5.197   -16.818 1.00 0.00 ? 27  ALA A H    8  
ATOM 10745 H HA   . ALA A 1 27 ? 11.406  6.811   -16.800 1.00 0.00 ? 27  ALA A HA   8  
ATOM 10746 H HB1  . ALA A 1 27 ? 10.830  7.383   -19.150 1.00 0.00 ? 27  ALA A HB1  8  
ATOM 10747 H HB2  . ALA A 1 27 ? 9.450   6.290   -19.041 1.00 0.00 ? 27  ALA A HB2  8  
ATOM 10748 H HB3  . ALA A 1 27 ? 11.091  5.657   -18.895 1.00 0.00 ? 27  ALA A HB3  8  
ATOM 10749 N N    . GLY A 1 28 ? 10.353  9.074   -16.606 1.00 0.00 ? 28  GLY A N    8  
ATOM 10750 C CA   . GLY A 1 28 ? 9.719   10.335  -16.256 1.00 0.00 ? 28  GLY A CA   8  
ATOM 10751 C C    . GLY A 1 28 ? 8.963   10.238  -14.943 1.00 0.00 ? 28  GLY A C    8  
ATOM 10752 O O    . GLY A 1 28 ? 7.901   10.843  -14.781 1.00 0.00 ? 28  GLY A O    8  
ATOM 10753 H H    . GLY A 1 28 ? 11.330  9.019   -16.665 1.00 0.00 ? 28  GLY A H    8  
ATOM 10754 H HA2  . GLY A 1 28 ? 10.478  11.098  -16.168 1.00 0.00 ? 28  GLY A HA2  8  
ATOM 10755 H HA3  . GLY A 1 28 ? 9.031   10.613  -17.040 1.00 0.00 ? 28  GLY A HA3  8  
ATOM 10756 N N    . GLN A 1 29 ? 9.509   9.457   -14.009 1.00 0.00 ? 29  GLN A N    8  
ATOM 10757 C CA   . GLN A 1 29 ? 8.887   9.255   -12.710 1.00 0.00 ? 29  GLN A CA   8  
ATOM 10758 C C    . GLN A 1 29 ? 9.862   9.577   -11.585 1.00 0.00 ? 29  GLN A C    8  
ATOM 10759 O O    . GLN A 1 29 ? 10.758  8.785   -11.283 1.00 0.00 ? 29  GLN A O    8  
ATOM 10760 C CB   . GLN A 1 29 ? 8.405   7.810   -12.580 1.00 0.00 ? 29  GLN A CB   8  
ATOM 10761 C CG   . GLN A 1 29 ? 7.397   7.597   -11.461 1.00 0.00 ? 29  GLN A CG   8  
ATOM 10762 C CD   . GLN A 1 29 ? 6.055   7.108   -11.970 1.00 0.00 ? 29  GLN A CD   8  
ATOM 10763 O OE1  . GLN A 1 29 ? 5.006   7.630   -11.590 1.00 0.00 ? 29  GLN A OE1  8  
ATOM 10764 N NE2  . GLN A 1 29 ? 6.079   6.098   -12.834 1.00 0.00 ? 29  GLN A NE2  8  
ATOM 10765 H H    . GLN A 1 29 ? 10.351  8.995   -14.205 1.00 0.00 ? 29  GLN A H    8  
ATOM 10766 H HA   . GLN A 1 29 ? 8.035   9.914   -12.641 1.00 0.00 ? 29  GLN A HA   8  
ATOM 10767 H HB2  . GLN A 1 29 ? 7.946   7.512   -13.511 1.00 0.00 ? 29  GLN A HB2  8  
ATOM 10768 H HB3  . GLN A 1 29 ? 9.258   7.175   -12.390 1.00 0.00 ? 29  GLN A HB3  8  
ATOM 10769 H HG2  . GLN A 1 29 ? 7.791   6.865   -10.774 1.00 0.00 ? 29  GLN A HG2  8  
ATOM 10770 H HG3  . GLN A 1 29 ? 7.249   8.534   -10.942 1.00 0.00 ? 29  GLN A HG3  8  
ATOM 10771 H HE21 . GLN A 1 29 ? 6.948   5.727   -13.092 1.00 0.00 ? 29  GLN A HE21 8  
ATOM 10772 H HE22 . GLN A 1 29 ? 5.227   5.770   -13.182 1.00 0.00 ? 29  GLN A HE22 8  
ATOM 10773 N N    . ASP A 1 30 ? 9.677   10.737  -10.962 1.00 0.00 ? 30  ASP A N    8  
ATOM 10774 C CA   . ASP A 1 30 ? 10.535  11.161  -9.859  1.00 0.00 ? 30  ASP A CA   8  
ATOM 10775 C C    . ASP A 1 30 ? 9.952   10.728  -8.508  1.00 0.00 ? 30  ASP A C    8  
ATOM 10776 O O    . ASP A 1 30 ? 10.189  11.373  -7.483  1.00 0.00 ? 30  ASP A O    8  
ATOM 10777 C CB   . ASP A 1 30 ? 10.727  12.681  -9.894  1.00 0.00 ? 30  ASP A CB   8  
ATOM 10778 C CG   . ASP A 1 30 ? 12.012  13.116  -9.218  1.00 0.00 ? 30  ASP A CG   8  
ATOM 10779 O OD1  . ASP A 1 30 ? 13.097  12.763  -9.724  1.00 0.00 ? 30  ASP A OD1  8  
ATOM 10780 O OD2  . ASP A 1 30 ? 11.932  13.809  -8.182  1.00 0.00 ? 30  ASP A OD2  8  
ATOM 10781 H H    . ASP A 1 30 ? 8.941   11.319  -11.247 1.00 0.00 ? 30  ASP A H    8  
ATOM 10782 H HA   . ASP A 1 30 ? 11.496  10.685  -9.987  1.00 0.00 ? 30  ASP A HA   8  
ATOM 10783 H HB2  . ASP A 1 30 ? 10.757  13.009  -10.922 1.00 0.00 ? 30  ASP A HB2  8  
ATOM 10784 H HB3  . ASP A 1 30 ? 9.897   13.157  -9.392  1.00 0.00 ? 30  ASP A HB3  8  
ATOM 10785 N N    . LYS A 1 31 ? 9.195   9.627   -8.513  1.00 0.00 ? 31  LYS A N    8  
ATOM 10786 C CA   . LYS A 1 31 ? 8.583   9.100   -7.297  1.00 0.00 ? 31  LYS A CA   8  
ATOM 10787 C C    . LYS A 1 31 ? 8.737   7.579   -7.237  1.00 0.00 ? 31  LYS A C    8  
ATOM 10788 O O    . LYS A 1 31 ? 9.461   6.989   -8.043  1.00 0.00 ? 31  LYS A O    8  
ATOM 10789 C CB   . LYS A 1 31 ? 7.095   9.478   -7.232  1.00 0.00 ? 31  LYS A CB   8  
ATOM 10790 C CG   . LYS A 1 31 ? 6.765   10.844  -7.823  1.00 0.00 ? 31  LYS A CG   8  
ATOM 10791 C CD   . LYS A 1 31 ? 7.098   11.969  -6.855  1.00 0.00 ? 31  LYS A CD   8  
ATOM 10792 C CE   . LYS A 1 31 ? 6.655   13.321  -7.395  1.00 0.00 ? 31  LYS A CE   8  
ATOM 10793 N NZ   . LYS A 1 31 ? 7.549   14.424  -6.941  1.00 0.00 ? 31  LYS A NZ   8  
ATOM 10794 H H    . LYS A 1 31 ? 9.047   9.152   -9.355  1.00 0.00 ? 31  LYS A H    8  
ATOM 10795 H HA   . LYS A 1 31 ? 9.095   9.537   -6.452  1.00 0.00 ? 31  LYS A HA   8  
ATOM 10796 H HB2  . LYS A 1 31 ? 6.524   8.735   -7.768  1.00 0.00 ? 31  LYS A HB2  8  
ATOM 10797 H HB3  . LYS A 1 31 ? 6.783   9.476   -6.198  1.00 0.00 ? 31  LYS A HB3  8  
ATOM 10798 H HG2  . LYS A 1 31 ? 7.335   10.982  -8.730  1.00 0.00 ? 31  LYS A HG2  8  
ATOM 10799 H HG3  . LYS A 1 31 ? 5.710   10.878  -8.052  1.00 0.00 ? 31  LYS A HG3  8  
ATOM 10800 H HD2  . LYS A 1 31 ? 6.594   11.785  -5.919  1.00 0.00 ? 31  LYS A HD2  8  
ATOM 10801 H HD3  . LYS A 1 31 ? 8.166   11.988  -6.693  1.00 0.00 ? 31  LYS A HD3  8  
ATOM 10802 H HE2  . LYS A 1 31 ? 6.664   13.285  -8.474  1.00 0.00 ? 31  LYS A HE2  8  
ATOM 10803 H HE3  . LYS A 1 31 ? 5.650   13.518  -7.050  1.00 0.00 ? 31  LYS A HE3  8  
ATOM 10804 H HZ1  . LYS A 1 31 ? 8.531   14.230  -7.224  1.00 0.00 ? 31  LYS A HZ1  8  
ATOM 10805 H HZ2  . LYS A 1 31 ? 7.509   14.513  -5.906  1.00 0.00 ? 31  LYS A HZ2  8  
ATOM 10806 H HZ3  . LYS A 1 31 ? 7.248   15.325  -7.366  1.00 0.00 ? 31  LYS A HZ3  8  
ATOM 10807 N N    . LEU A 1 32 ? 8.049   6.946   -6.283  1.00 0.00 ? 32  LEU A N    8  
ATOM 10808 C CA   . LEU A 1 32 ? 8.106   5.494   -6.128  1.00 0.00 ? 32  LEU A CA   8  
ATOM 10809 C C    . LEU A 1 32 ? 6.811   4.966   -5.513  1.00 0.00 ? 32  LEU A C    8  
ATOM 10810 O O    . LEU A 1 32 ? 6.400   5.411   -4.441  1.00 0.00 ? 32  LEU A O    8  
ATOM 10811 C CB   . LEU A 1 32 ? 9.303   5.093   -5.259  1.00 0.00 ? 32  LEU A CB   8  
ATOM 10812 C CG   . LEU A 1 32 ? 10.054  3.841   -5.723  1.00 0.00 ? 32  LEU A CG   8  
ATOM 10813 C CD1  . LEU A 1 32 ? 10.530  4.000   -7.162  1.00 0.00 ? 32  LEU A CD1  8  
ATOM 10814 C CD2  . LEU A 1 32 ? 11.230  3.555   -4.799  1.00 0.00 ? 32  LEU A CD2  8  
ATOM 10815 H H    . LEU A 1 32 ? 7.486   7.467   -5.673  1.00 0.00 ? 32  LEU A H    8  
ATOM 10816 H HA   . LEU A 1 32 ? 8.225   5.063   -7.110  1.00 0.00 ? 32  LEU A HA   8  
ATOM 10817 H HB2  . LEU A 1 32 ? 9.998   5.920   -5.239  1.00 0.00 ? 32  LEU A HB2  8  
ATOM 10818 H HB3  . LEU A 1 32 ? 8.948   4.920   -4.253  1.00 0.00 ? 32  LEU A HB3  8  
ATOM 10819 H HG   . LEU A 1 32 ? 9.385   2.994   -5.685  1.00 0.00 ? 32  LEU A HG   8  
ATOM 10820 H HD11 . LEU A 1 32 ? 11.277  3.251   -7.379  1.00 0.00 ? 32  LEU A HD11 8  
ATOM 10821 H HD12 . LEU A 1 32 ? 10.957  4.982   -7.294  1.00 0.00 ? 32  LEU A HD12 8  
ATOM 10822 H HD13 . LEU A 1 32 ? 9.693   3.878   -7.835  1.00 0.00 ? 32  LEU A HD13 8  
ATOM 10823 H HD21 . LEU A 1 32 ? 12.112  4.054   -5.172  1.00 0.00 ? 32  LEU A HD21 8  
ATOM 10824 H HD22 . LEU A 1 32 ? 11.408  2.490   -4.762  1.00 0.00 ? 32  LEU A HD22 8  
ATOM 10825 H HD23 . LEU A 1 32 ? 11.005  3.917   -3.807  1.00 0.00 ? 32  LEU A HD23 8  
ATOM 10826 N N    . GLY A 1 33 ? 6.173   4.020   -6.204  1.00 0.00 ? 33  GLY A N    8  
ATOM 10827 C CA   . GLY A 1 33 ? 4.928   3.450   -5.716  1.00 0.00 ? 33  GLY A CA   8  
ATOM 10828 C C    . GLY A 1 33 ? 5.135   2.202   -4.877  1.00 0.00 ? 33  GLY A C    8  
ATOM 10829 O O    . GLY A 1 33 ? 6.099   1.462   -5.080  1.00 0.00 ? 33  GLY A O    8  
ATOM 10830 H H    . GLY A 1 33 ? 6.549   3.709   -7.054  1.00 0.00 ? 33  GLY A H    8  
ATOM 10831 H HA2  . GLY A 1 33 ? 4.419   4.192   -5.118  1.00 0.00 ? 33  GLY A HA2  8  
ATOM 10832 H HA3  . GLY A 1 33 ? 4.307   3.199   -6.563  1.00 0.00 ? 33  GLY A HA3  8  
ATOM 10833 N N    . ILE A 1 34 ? 4.224   1.970   -3.931  1.00 0.00 ? 34  ILE A N    8  
ATOM 10834 C CA   . ILE A 1 34 ? 4.304   0.804   -3.053  1.00 0.00 ? 34  ILE A CA   8  
ATOM 10835 C C    . ILE A 1 34 ? 3.277   -0.252  -3.459  1.00 0.00 ? 34  ILE A C    8  
ATOM 10836 O O    . ILE A 1 34 ? 2.198   -0.347  -2.873  1.00 0.00 ? 34  ILE A O    8  
ATOM 10837 C CB   . ILE A 1 34 ? 4.083   1.198   -1.574  1.00 0.00 ? 34  ILE A CB   8  
ATOM 10838 C CG1  . ILE A 1 34 ? 4.858   2.477   -1.242  1.00 0.00 ? 34  ILE A CG1  8  
ATOM 10839 C CG2  . ILE A 1 34 ? 4.498   0.062   -0.647  1.00 0.00 ? 34  ILE A CG2  8  
ATOM 10840 C CD1  . ILE A 1 34 ? 6.356   2.348   -1.423  1.00 0.00 ? 34  ILE A CD1  8  
ATOM 10841 H H    . ILE A 1 34 ? 3.478   2.597   -3.821  1.00 0.00 ? 34  ILE A H    8  
ATOM 10842 H HA   . ILE A 1 34 ? 5.294   0.383   -3.148  1.00 0.00 ? 34  ILE A HA   8  
ATOM 10843 H HB   . ILE A 1 34 ? 3.028   1.378   -1.428  1.00 0.00 ? 34  ILE A HB   8  
ATOM 10844 H HG12 . ILE A 1 34 ? 4.516   3.274   -1.886  1.00 0.00 ? 34  ILE A HG12 8  
ATOM 10845 H HG13 . ILE A 1 34 ? 4.669   2.747   -0.214  1.00 0.00 ? 34  ILE A HG13 8  
ATOM 10846 H HG21 . ILE A 1 34 ? 3.687   -0.645  -0.557  1.00 0.00 ? 34  ILE A HG21 8  
ATOM 10847 H HG22 . ILE A 1 34 ? 4.736   0.462   0.328   1.00 0.00 ? 34  ILE A HG22 8  
ATOM 10848 H HG23 . ILE A 1 34 ? 5.366   -0.436  -1.053  1.00 0.00 ? 34  ILE A HG23 8  
ATOM 10849 H HD11 . ILE A 1 34 ? 6.753   1.681   -0.673  1.00 0.00 ? 34  ILE A HD11 8  
ATOM 10850 H HD12 . ILE A 1 34 ? 6.816   3.319   -1.322  1.00 0.00 ? 34  ILE A HD12 8  
ATOM 10851 H HD13 . ILE A 1 34 ? 6.567   1.952   -2.406  1.00 0.00 ? 34  ILE A HD13 8  
ATOM 10852 N N    . TYR A 1 35 ? 3.622   -1.042  -4.472  1.00 0.00 ? 35  TYR A N    8  
ATOM 10853 C CA   . TYR A 1 35 ? 2.732   -2.091  -4.968  1.00 0.00 ? 35  TYR A CA   8  
ATOM 10854 C C    . TYR A 1 35 ? 2.635   -3.250  -3.979  1.00 0.00 ? 35  TYR A C    8  
ATOM 10855 O O    . TYR A 1 35 ? 3.439   -3.356  -3.056  1.00 0.00 ? 35  TYR A O    8  
ATOM 10856 C CB   . TYR A 1 35 ? 3.222   -2.608  -6.322  1.00 0.00 ? 35  TYR A CB   8  
ATOM 10857 C CG   . TYR A 1 35 ? 3.403   -1.522  -7.357  1.00 0.00 ? 35  TYR A CG   8  
ATOM 10858 C CD1  . TYR A 1 35 ? 4.607   -0.839  -7.474  1.00 0.00 ? 35  TYR A CD1  8  
ATOM 10859 C CD2  . TYR A 1 35 ? 2.370   -1.183  -8.220  1.00 0.00 ? 35  TYR A CD2  8  
ATOM 10860 C CE1  . TYR A 1 35 ? 4.773   0.154   -8.416  1.00 0.00 ? 35  TYR A CE1  8  
ATOM 10861 C CE2  . TYR A 1 35 ? 2.530   -0.192  -9.165  1.00 0.00 ? 35  TYR A CE2  8  
ATOM 10862 C CZ   . TYR A 1 35 ? 3.734   0.473   -9.263  1.00 0.00 ? 35  TYR A CZ   8  
ATOM 10863 O OH   . TYR A 1 35 ? 3.900   1.460   -10.208 1.00 0.00 ? 35  TYR A OH   8  
ATOM 10864 H H    . TYR A 1 35 ? 4.495   -0.914  -4.899  1.00 0.00 ? 35  TYR A H    8  
ATOM 10865 H HA   . TYR A 1 35 ? 1.752   -1.659  -5.094  1.00 0.00 ? 35  TYR A HA   8  
ATOM 10866 H HB2  . TYR A 1 35 ? 4.173   -3.101  -6.188  1.00 0.00 ? 35  TYR A HB2  8  
ATOM 10867 H HB3  . TYR A 1 35 ? 2.505   -3.319  -6.707  1.00 0.00 ? 35  TYR A HB3  8  
ATOM 10868 H HD1  . TYR A 1 35 ? 5.420   -1.090  -6.811  1.00 0.00 ? 35  TYR A HD1  8  
ATOM 10869 H HD2  . TYR A 1 35 ? 1.427   -1.704  -8.141  1.00 0.00 ? 35  TYR A HD2  8  
ATOM 10870 H HE1  . TYR A 1 35 ? 5.716   0.674   -8.489  1.00 0.00 ? 35  TYR A HE1  8  
ATOM 10871 H HE2  . TYR A 1 35 ? 1.713   0.058   -9.822  1.00 0.00 ? 35  TYR A HE2  8  
ATOM 10872 H HH   . TYR A 1 35 ? 3.221   2.130   -10.099 1.00 0.00 ? 35  TYR A HH   8  
ATOM 10873 N N    . VAL A 1 36 ? 1.650   -4.122  -4.187  1.00 0.00 ? 36  VAL A N    8  
ATOM 10874 C CA   . VAL A 1 36 ? 1.450   -5.281  -3.317  1.00 0.00 ? 36  VAL A CA   8  
ATOM 10875 C C    . VAL A 1 36 ? 1.884   -6.573  -4.012  1.00 0.00 ? 36  VAL A C    8  
ATOM 10876 O O    . VAL A 1 36 ? 1.464   -6.854  -5.134  1.00 0.00 ? 36  VAL A O    8  
ATOM 10877 C CB   . VAL A 1 36 ? -0.027  -5.413  -2.878  1.00 0.00 ? 36  VAL A CB   8  
ATOM 10878 C CG1  . VAL A 1 36 ? -0.192  -6.537  -1.863  1.00 0.00 ? 36  VAL A CG1  8  
ATOM 10879 C CG2  . VAL A 1 36 ? -0.545  -4.097  -2.311  1.00 0.00 ? 36  VAL A CG2  8  
ATOM 10880 H H    . VAL A 1 36 ? 1.045   -3.985  -4.948  1.00 0.00 ? 36  VAL A H    8  
ATOM 10881 H HA   . VAL A 1 36 ? 2.054   -5.142  -2.432  1.00 0.00 ? 36  VAL A HA   8  
ATOM 10882 H HB   . VAL A 1 36 ? -0.617  -5.661  -3.748  1.00 0.00 ? 36  VAL A HB   8  
ATOM 10883 H HG11 . VAL A 1 36 ? -1.237  -6.797  -1.781  1.00 0.00 ? 36  VAL A HG11 8  
ATOM 10884 H HG12 . VAL A 1 36 ? 0.173   -6.209  -0.901  1.00 0.00 ? 36  VAL A HG12 8  
ATOM 10885 H HG13 . VAL A 1 36 ? 0.369   -7.401  -2.186  1.00 0.00 ? 36  VAL A HG13 8  
ATOM 10886 H HG21 . VAL A 1 36 ? 0.090   -3.287  -2.638  1.00 0.00 ? 36  VAL A HG21 8  
ATOM 10887 H HG22 . VAL A 1 36 ? -0.543  -4.143  -1.232  1.00 0.00 ? 36  VAL A HG22 8  
ATOM 10888 H HG23 . VAL A 1 36 ? -1.553  -3.927  -2.661  1.00 0.00 ? 36  VAL A HG23 8  
ATOM 10889 N N    . LYS A 1 37 ? 2.717   -7.358  -3.330  1.00 0.00 ? 37  LYS A N    8  
ATOM 10890 C CA   . LYS A 1 37 ? 3.197   -8.628  -3.870  1.00 0.00 ? 37  LYS A CA   8  
ATOM 10891 C C    . LYS A 1 37 ? 2.275   -9.771  -3.450  1.00 0.00 ? 37  LYS A C    8  
ATOM 10892 O O    . LYS A 1 37 ? 1.951   -10.644 -4.257  1.00 0.00 ? 37  LYS A O    8  
ATOM 10893 C CB   . LYS A 1 37 ? 4.626   -8.912  -3.396  1.00 0.00 ? 37  LYS A CB   8  
ATOM 10894 C CG   . LYS A 1 37 ? 5.403   -9.829  -4.330  1.00 0.00 ? 37  LYS A CG   8  
ATOM 10895 C CD   . LYS A 1 37 ? 6.903   -9.750  -4.083  1.00 0.00 ? 37  LYS A CD   8  
ATOM 10896 C CE   . LYS A 1 37 ? 7.464   -11.078 -3.595  1.00 0.00 ? 37  LYS A CE   8  
ATOM 10897 N NZ   . LYS A 1 37 ? 8.945   -11.035 -3.429  1.00 0.00 ? 37  LYS A NZ   8  
ATOM 10898 H H    . LYS A 1 37 ? 3.007   -7.082  -2.436  1.00 0.00 ? 37  LYS A H    8  
ATOM 10899 H HA   . LYS A 1 37 ? 3.191   -8.555  -4.947  1.00 0.00 ? 37  LYS A HA   8  
ATOM 10900 H HB2  . LYS A 1 37 ? 5.161   -7.978  -3.314  1.00 0.00 ? 37  LYS A HB2  8  
ATOM 10901 H HB3  . LYS A 1 37 ? 4.584   -9.379  -2.423  1.00 0.00 ? 37  LYS A HB3  8  
ATOM 10902 H HG2  . LYS A 1 37 ? 5.076   -10.846 -4.171  1.00 0.00 ? 37  LYS A HG2  8  
ATOM 10903 H HG3  . LYS A 1 37 ? 5.200   -9.541  -5.351  1.00 0.00 ? 37  LYS A HG3  8  
ATOM 10904 H HD2  . LYS A 1 37 ? 7.394   -9.482  -5.006  1.00 0.00 ? 37  LYS A HD2  8  
ATOM 10905 H HD3  . LYS A 1 37 ? 7.096   -8.992  -3.339  1.00 0.00 ? 37  LYS A HD3  8  
ATOM 10906 H HE2  . LYS A 1 37 ? 7.012   -11.316 -2.643  1.00 0.00 ? 37  LYS A HE2  8  
ATOM 10907 H HE3  . LYS A 1 37 ? 7.213   -11.844 -4.313  1.00 0.00 ? 37  LYS A HE3  8  
ATOM 10908 H HZ1  . LYS A 1 37 ? 9.364   -10.364 -4.105  1.00 0.00 ? 37  LYS A HZ1  8  
ATOM 10909 H HZ2  . LYS A 1 37 ? 9.350   -11.977 -3.598  1.00 0.00 ? 37  LYS A HZ2  8  
ATOM 10910 H HZ3  . LYS A 1 37 ? 9.189   -10.735 -2.463  1.00 0.00 ? 37  LYS A HZ3  8  
ATOM 10911 N N    . SER A 1 38 ? 1.856   -9.756  -2.180  1.00 0.00 ? 38  SER A N    8  
ATOM 10912 C CA   . SER A 1 38 ? 0.969   -10.788 -1.646  1.00 0.00 ? 38  SER A CA   8  
ATOM 10913 C C    . SER A 1 38 ? 0.288   -10.306 -0.363  1.00 0.00 ? 38  SER A C    8  
ATOM 10914 O O    . SER A 1 38 ? 0.618   -9.243  0.166   1.00 0.00 ? 38  SER A O    8  
ATOM 10915 C CB   . SER A 1 38 ? 1.743   -12.088 -1.366  1.00 0.00 ? 38  SER A CB   8  
ATOM 10916 O OG   . SER A 1 38 ? 2.943   -12.166 -2.125  1.00 0.00 ? 38  SER A OG   8  
ATOM 10917 H H    . SER A 1 38 ? 2.149   -9.032  -1.588  1.00 0.00 ? 38  SER A H    8  
ATOM 10918 H HA   . SER A 1 38 ? 0.210   -10.984 -2.388  1.00 0.00 ? 38  SER A HA   8  
ATOM 10919 H HB2  . SER A 1 38 ? 1.995   -12.133 -0.317  1.00 0.00 ? 38  SER A HB2  8  
ATOM 10920 H HB3  . SER A 1 38 ? 1.118   -12.932 -1.618  1.00 0.00 ? 38  SER A HB3  8  
ATOM 10921 H HG   . SER A 1 38 ? 2.738   -12.424 -3.028  1.00 0.00 ? 38  SER A HG   8  
ATOM 10922 N N    . VAL A 1 39 ? -0.657  -11.101 0.139   1.00 0.00 ? 39  VAL A N    8  
ATOM 10923 C CA   . VAL A 1 39 ? -1.374  -10.764 1.366   1.00 0.00 ? 39  VAL A CA   8  
ATOM 10924 C C    . VAL A 1 39 ? -1.496  -11.986 2.267   1.00 0.00 ? 39  VAL A C    8  
ATOM 10925 O O    . VAL A 1 39 ? -2.046  -13.013 1.865   1.00 0.00 ? 39  VAL A O    8  
ATOM 10926 C CB   . VAL A 1 39 ? -2.784  -10.204 1.081   1.00 0.00 ? 39  VAL A CB   8  
ATOM 10927 C CG1  . VAL A 1 39 ? -3.424  -9.690  2.364   1.00 0.00 ? 39  VAL A CG1  8  
ATOM 10928 C CG2  . VAL A 1 39 ? -2.729  -9.101  0.032   1.00 0.00 ? 39  VAL A CG2  8  
ATOM 10929 H H    . VAL A 1 39 ? -0.872  -11.938 -0.322  1.00 0.00 ? 39  VAL A H    8  
ATOM 10930 H HA   . VAL A 1 39 ? -0.805  -10.005 1.885   1.00 0.00 ? 39  VAL A HA   8  
ATOM 10931 H HB   . VAL A 1 39 ? -3.397  -11.007 0.697   1.00 0.00 ? 39  VAL A HB   8  
ATOM 10932 H HG11 . VAL A 1 39 ? -2.772  -8.964  2.826   1.00 0.00 ? 39  VAL A HG11 8  
ATOM 10933 H HG12 . VAL A 1 39 ? -3.582  -10.516 3.043   1.00 0.00 ? 39  VAL A HG12 8  
ATOM 10934 H HG13 . VAL A 1 39 ? -4.372  -9.228  2.133   1.00 0.00 ? 39  VAL A HG13 8  
ATOM 10935 H HG21 . VAL A 1 39 ? -2.313  -8.207  0.472   1.00 0.00 ? 39  VAL A HG21 8  
ATOM 10936 H HG22 . VAL A 1 39 ? -3.726  -8.896  -0.327  1.00 0.00 ? 39  VAL A HG22 8  
ATOM 10937 H HG23 . VAL A 1 39 ? -2.108  -9.419  -0.793  1.00 0.00 ? 39  VAL A HG23 8  
ATOM 10938 N N    . VAL A 1 40 ? -0.979  -11.869 3.486   1.00 0.00 ? 40  VAL A N    8  
ATOM 10939 C CA   . VAL A 1 40 ? -1.032  -12.968 4.444   1.00 0.00 ? 40  VAL A CA   8  
ATOM 10940 C C    . VAL A 1 40 ? -2.453  -13.162 4.965   1.00 0.00 ? 40  VAL A C    8  
ATOM 10941 O O    . VAL A 1 40 ? -3.070  -12.228 5.480   1.00 0.00 ? 40  VAL A O    8  
ATOM 10942 C CB   . VAL A 1 40 ? -0.076  -12.740 5.637   1.00 0.00 ? 40  VAL A CB   8  
ATOM 10943 C CG1  . VAL A 1 40 ? -0.034  -13.969 6.532   1.00 0.00 ? 40  VAL A CG1  8  
ATOM 10944 C CG2  . VAL A 1 40 ? 1.323   -12.381 5.152   1.00 0.00 ? 40  VAL A CG2  8  
ATOM 10945 H H    . VAL A 1 40 ? -0.553  -11.022 3.749   1.00 0.00 ? 40  VAL A H    8  
ATOM 10946 H HA   . VAL A 1 40 ? -0.723  -13.868 3.931   1.00 0.00 ? 40  VAL A HA   8  
ATOM 10947 H HB   . VAL A 1 40 ? -0.454  -11.913 6.221   1.00 0.00 ? 40  VAL A HB   8  
ATOM 10948 H HG11 . VAL A 1 40 ? -0.225  -14.852 5.940   1.00 0.00 ? 40  VAL A HG11 8  
ATOM 10949 H HG12 . VAL A 1 40 ? -0.787  -13.881 7.301   1.00 0.00 ? 40  VAL A HG12 8  
ATOM 10950 H HG13 . VAL A 1 40 ? 0.941   -14.046 6.991   1.00 0.00 ? 40  VAL A HG13 8  
ATOM 10951 H HG21 . VAL A 1 40 ? 1.719   -11.576 5.756   1.00 0.00 ? 40  VAL A HG21 8  
ATOM 10952 H HG22 . VAL A 1 40 ? 1.280   -12.067 4.120   1.00 0.00 ? 40  VAL A HG22 8  
ATOM 10953 H HG23 . VAL A 1 40 ? 1.967   -13.243 5.238   1.00 0.00 ? 40  VAL A HG23 8  
ATOM 10954 N N    . LYS A 1 41 ? -2.963  -14.384 4.826   1.00 0.00 ? 41  LYS A N    8  
ATOM 10955 C CA   . LYS A 1 41 ? -4.311  -14.715 5.278   1.00 0.00 ? 41  LYS A CA   8  
ATOM 10956 C C    . LYS A 1 41 ? -4.417  -14.599 6.794   1.00 0.00 ? 41  LYS A C    8  
ATOM 10957 O O    . LYS A 1 41 ? -3.650  -15.222 7.528   1.00 0.00 ? 41  LYS A O    8  
ATOM 10958 C CB   . LYS A 1 41 ? -4.690  -16.130 4.834   1.00 0.00 ? 41  LYS A CB   8  
ATOM 10959 C CG   . LYS A 1 41 ? -5.457  -16.174 3.521   1.00 0.00 ? 41  LYS A CG   8  
ATOM 10960 C CD   . LYS A 1 41 ? -4.628  -15.636 2.363   1.00 0.00 ? 41  LYS A CD   8  
ATOM 10961 C CE   . LYS A 1 41 ? -3.762  -16.721 1.737   1.00 0.00 ? 41  LYS A CE   8  
ATOM 10962 N NZ   . LYS A 1 41 ? -4.576  -17.826 1.156   1.00 0.00 ? 41  LYS A NZ   8  
ATOM 10963 H H    . LYS A 1 41 ? -2.417  -15.082 4.406   1.00 0.00 ? 41  LYS A H    8  
ATOM 10964 H HA   . LYS A 1 41 ? -4.994  -14.010 4.826   1.00 0.00 ? 41  LYS A HA   8  
ATOM 10965 H HB2  . LYS A 1 41 ? -3.787  -16.712 4.719   1.00 0.00 ? 41  LYS A HB2  8  
ATOM 10966 H HB3  . LYS A 1 41 ? -5.302  -16.582 5.599   1.00 0.00 ? 41  LYS A HB3  8  
ATOM 10967 H HG2  . LYS A 1 41 ? -5.728  -17.198 3.310   1.00 0.00 ? 41  LYS A HG2  8  
ATOM 10968 H HG3  . LYS A 1 41 ? -6.353  -15.576 3.619   1.00 0.00 ? 41  LYS A HG3  8  
ATOM 10969 H HD2  . LYS A 1 41 ? -5.294  -15.242 1.610   1.00 0.00 ? 41  LYS A HD2  8  
ATOM 10970 H HD3  . LYS A 1 41 ? -3.989  -14.844 2.727   1.00 0.00 ? 41  LYS A HD3  8  
ATOM 10971 H HE2  . LYS A 1 41 ? -3.164  -16.278 0.954   1.00 0.00 ? 41  LYS A HE2  8  
ATOM 10972 H HE3  . LYS A 1 41 ? -3.111  -17.127 2.498   1.00 0.00 ? 41  LYS A HE3  8  
ATOM 10973 H HZ1  . LYS A 1 41 ? -5.525  -17.479 0.903   1.00 0.00 ? 41  LYS A HZ1  8  
ATOM 10974 H HZ2  . LYS A 1 41 ? -4.676  -18.597 1.846   1.00 0.00 ? 41  LYS A HZ2  8  
ATOM 10975 H HZ3  . LYS A 1 41 ? -4.115  -18.199 0.302   1.00 0.00 ? 41  LYS A HZ3  8  
ATOM 10976 N N    . GLY A 1 42 ? -5.366  -13.787 7.251   1.00 0.00 ? 42  GLY A N    8  
ATOM 10977 C CA   . GLY A 1 42 ? -5.557  -13.587 8.677   1.00 0.00 ? 42  GLY A CA   8  
ATOM 10978 C C    . GLY A 1 42 ? -5.550  -12.118 9.060   1.00 0.00 ? 42  GLY A C    8  
ATOM 10979 O O    . GLY A 1 42 ? -6.231  -11.714 10.004  1.00 0.00 ? 42  GLY A O    8  
ATOM 10980 H H    . GLY A 1 42 ? -5.940  -13.314 6.612   1.00 0.00 ? 42  GLY A H    8  
ATOM 10981 H HA2  . GLY A 1 42 ? -6.503  -14.021 8.965   1.00 0.00 ? 42  GLY A HA2  8  
ATOM 10982 H HA3  . GLY A 1 42 ? -4.763  -14.089 9.211   1.00 0.00 ? 42  GLY A HA3  8  
ATOM 10983 N N    . GLY A 1 43 ? -4.781  -11.314 8.322   1.00 0.00 ? 43  GLY A N    8  
ATOM 10984 C CA   . GLY A 1 43 ? -4.708  -9.891  8.599   1.00 0.00 ? 43  GLY A CA   8  
ATOM 10985 C C    . GLY A 1 43 ? -6.006  -9.167  8.284   1.00 0.00 ? 43  GLY A C    8  
ATOM 10986 O O    . GLY A 1 43 ? -6.815  -9.647  7.486   1.00 0.00 ? 43  GLY A O    8  
ATOM 10987 H H    . GLY A 1 43 ? -4.265  -11.691 7.579   1.00 0.00 ? 43  GLY A H    8  
ATOM 10988 H HA2  . GLY A 1 43 ? -4.476  -9.751  9.644   1.00 0.00 ? 43  GLY A HA2  8  
ATOM 10989 H HA3  . GLY A 1 43 ? -3.913  -9.463  8.006   1.00 0.00 ? 43  GLY A HA3  8  
ATOM 10990 N N    . ALA A 1 44 ? -6.203  -8.009  8.919   1.00 0.00 ? 44  ALA A N    8  
ATOM 10991 C CA   . ALA A 1 44 ? -7.409  -7.198  8.719   1.00 0.00 ? 44  ALA A CA   8  
ATOM 10992 C C    . ALA A 1 44 ? -7.726  -6.989  7.234   1.00 0.00 ? 44  ALA A C    8  
ATOM 10993 O O    . ALA A 1 44 ? -8.895  -6.977  6.841   1.00 0.00 ? 44  ALA A O    8  
ATOM 10994 C CB   . ALA A 1 44 ? -7.253  -5.853  9.410   1.00 0.00 ? 44  ALA A CB   8  
ATOM 10995 H H    . ALA A 1 44 ? -5.517  -7.690  9.541   1.00 0.00 ? 44  ALA A H    8  
ATOM 10996 H HA   . ALA A 1 44 ? -8.237  -7.717  9.184   1.00 0.00 ? 44  ALA A HA   8  
ATOM 10997 H HB1  . ALA A 1 44 ? -6.940  -6.007  10.432  1.00 0.00 ? 44  ALA A HB1  8  
ATOM 10998 H HB2  . ALA A 1 44 ? -8.197  -5.328  9.397   1.00 0.00 ? 44  ALA A HB2  8  
ATOM 10999 H HB3  . ALA A 1 44 ? -6.508  -5.267  8.892   1.00 0.00 ? 44  ALA A HB3  8  
ATOM 11000 N N    . ALA A 1 45 ? -6.685  -6.824  6.415   1.00 0.00 ? 45  ALA A N    8  
ATOM 11001 C CA   . ALA A 1 45 ? -6.863  -6.618  4.978   1.00 0.00 ? 45  ALA A CA   8  
ATOM 11002 C C    . ALA A 1 45 ? -7.500  -7.841  4.319   1.00 0.00 ? 45  ALA A C    8  
ATOM 11003 O O    . ALA A 1 45 ? -8.473  -7.718  3.573   1.00 0.00 ? 45  ALA A O    8  
ATOM 11004 C CB   . ALA A 1 45 ? -5.529  -6.302  4.314   1.00 0.00 ? 45  ALA A CB   8  
ATOM 11005 H H    . ALA A 1 45 ? -5.777  -6.843  6.785   1.00 0.00 ? 45  ALA A H    8  
ATOM 11006 H HA   . ALA A 1 45 ? -7.516  -5.768  4.843   1.00 0.00 ? 45  ALA A HA   8  
ATOM 11007 H HB1  . ALA A 1 45 ? -5.704  -5.940  3.311   1.00 0.00 ? 45  ALA A HB1  8  
ATOM 11008 H HB2  . ALA A 1 45 ? -4.926  -7.197  4.272   1.00 0.00 ? 45  ALA A HB2  8  
ATOM 11009 H HB3  . ALA A 1 45 ? -5.012  -5.545  4.884   1.00 0.00 ? 45  ALA A HB3  8  
ATOM 11010 N N    . ASP A 1 46 ? -6.942  -9.019  4.598   1.00 0.00 ? 46  ASP A N    8  
ATOM 11011 C CA   . ASP A 1 46 ? -7.453  -10.268 4.032   1.00 0.00 ? 46  ASP A CA   8  
ATOM 11012 C C    . ASP A 1 46 ? -8.869  -10.560 4.528   1.00 0.00 ? 46  ASP A C    8  
ATOM 11013 O O    . ASP A 1 46 ? -9.725  -10.999 3.759   1.00 0.00 ? 46  ASP A O    8  
ATOM 11014 C CB   . ASP A 1 46 ? -6.529  -11.435 4.388   1.00 0.00 ? 46  ASP A CB   8  
ATOM 11015 C CG   . ASP A 1 46 ? -6.397  -12.436 3.256   1.00 0.00 ? 46  ASP A CG   8  
ATOM 11016 O OD1  . ASP A 1 46 ? -7.363  -13.192 3.015   1.00 0.00 ? 46  ASP A OD1  8  
ATOM 11017 O OD2  . ASP A 1 46 ? -5.328  -12.465 2.612   1.00 0.00 ? 46  ASP A OD2  8  
ATOM 11018 H H    . ASP A 1 46 ? -6.168  -9.050  5.200   1.00 0.00 ? 46  ASP A H    8  
ATOM 11019 H HA   . ASP A 1 46 ? -7.479  -10.156 2.958   1.00 0.00 ? 46  ASP A HA   8  
ATOM 11020 H HB2  . ASP A 1 46 ? -5.547  -11.051 4.620   1.00 0.00 ? 46  ASP A HB2  8  
ATOM 11021 H HB3  . ASP A 1 46 ? -6.924  -11.947 5.253   1.00 0.00 ? 46  ASP A HB3  8  
ATOM 11022 N N    . VAL A 1 47 ? -9.107  -10.314 5.816   1.00 0.00 ? 47  VAL A N    8  
ATOM 11023 C CA   . VAL A 1 47 ? -10.421 -10.549 6.418   1.00 0.00 ? 47  VAL A CA   8  
ATOM 11024 C C    . VAL A 1 47 ? -11.498 -9.691  5.751   1.00 0.00 ? 47  VAL A C    8  
ATOM 11025 O O    . VAL A 1 47 ? -12.654 -10.106 5.643   1.00 0.00 ? 47  VAL A O    8  
ATOM 11026 C CB   . VAL A 1 47 ? -10.407 -10.252 7.934   1.00 0.00 ? 47  VAL A CB   8  
ATOM 11027 C CG1  . VAL A 1 47 ? -11.751 -10.587 8.569   1.00 0.00 ? 47  VAL A CG1  8  
ATOM 11028 C CG2  . VAL A 1 47 ? -9.281  -11.015 8.621   1.00 0.00 ? 47  VAL A CG2  8  
ATOM 11029 H H    . VAL A 1 47 ? -8.381  -9.963  6.377   1.00 0.00 ? 47  VAL A H    8  
ATOM 11030 H HA   . VAL A 1 47 ? -10.668 -11.592 6.279   1.00 0.00 ? 47  VAL A HA   8  
ATOM 11031 H HB   . VAL A 1 47 ? -10.227 -9.195  8.069   1.00 0.00 ? 47  VAL A HB   8  
ATOM 11032 H HG11 . VAL A 1 47 ? -12.528 -10.000 8.101   1.00 0.00 ? 47  VAL A HG11 8  
ATOM 11033 H HG12 . VAL A 1 47 ? -11.716 -10.360 9.624   1.00 0.00 ? 47  VAL A HG12 8  
ATOM 11034 H HG13 . VAL A 1 47 ? -11.963 -11.638 8.434   1.00 0.00 ? 47  VAL A HG13 8  
ATOM 11035 H HG21 . VAL A 1 47 ? -8.735  -10.343 9.266   1.00 0.00 ? 47  VAL A HG21 8  
ATOM 11036 H HG22 . VAL A 1 47 ? -8.611  -11.420 7.877   1.00 0.00 ? 47  VAL A HG22 8  
ATOM 11037 H HG23 . VAL A 1 47 ? -9.696  -11.820 9.208   1.00 0.00 ? 47  VAL A HG23 8  
ATOM 11038 N N    . ASP A 1 48 ? -11.112 -8.492  5.310   1.00 0.00 ? 48  ASP A N    8  
ATOM 11039 C CA   . ASP A 1 48 ? -12.043 -7.575  4.658   1.00 0.00 ? 48  ASP A CA   8  
ATOM 11040 C C    . ASP A 1 48 ? -12.483 -8.109  3.295   1.00 0.00 ? 48  ASP A C    8  
ATOM 11041 O O    . ASP A 1 48 ? -13.678 -8.263  3.038   1.00 0.00 ? 48  ASP A O    8  
ATOM 11042 C CB   . ASP A 1 48 ? -11.400 -6.192  4.503   1.00 0.00 ? 48  ASP A CB   8  
ATOM 11043 C CG   . ASP A 1 48 ? -12.340 -5.168  3.893   1.00 0.00 ? 48  ASP A CG   8  
ATOM 11044 O OD1  . ASP A 1 48 ? -13.547 -5.188  4.223   1.00 0.00 ? 48  ASP A OD1  8  
ATOM 11045 O OD2  . ASP A 1 48 ? -11.869 -4.341  3.085   1.00 0.00 ? 48  ASP A OD2  8  
ATOM 11046 H H    . ASP A 1 48 ? -10.178 -8.217  5.427   1.00 0.00 ? 48  ASP A H    8  
ATOM 11047 H HA   . ASP A 1 48 ? -12.912 -7.486  5.291   1.00 0.00 ? 48  ASP A HA   8  
ATOM 11048 H HB2  . ASP A 1 48 ? -11.096 -5.836  5.474   1.00 0.00 ? 48  ASP A HB2  8  
ATOM 11049 H HB3  . ASP A 1 48 ? -10.528 -6.277  3.868   1.00 0.00 ? 48  ASP A HB3  8  
ATOM 11050 N N    . GLY A 1 49 ? -11.512 -8.391  2.429   1.00 0.00 ? 49  GLY A N    8  
ATOM 11051 C CA   . GLY A 1 49 ? -11.822 -8.907  1.107   1.00 0.00 ? 49  GLY A CA   8  
ATOM 11052 C C    . GLY A 1 49 ? -12.024 -7.807  0.076   1.00 0.00 ? 49  GLY A C    8  
ATOM 11053 O O    . GLY A 1 49 ? -13.032 -7.798  -0.634  1.00 0.00 ? 49  GLY A O    8  
ATOM 11054 H H    . GLY A 1 49 ? -10.577 -8.251  2.690   1.00 0.00 ? 49  GLY A H    8  
ATOM 11055 H HA2  . GLY A 1 49 ? -11.015 -9.544  0.783   1.00 0.00 ? 49  GLY A HA2  8  
ATOM 11056 H HA3  . GLY A 1 49 ? -12.725 -9.496  1.167   1.00 0.00 ? 49  GLY A HA3  8  
ATOM 11057 N N    . ARG A 1 50 ? -11.064 -6.884  -0.013  1.00 0.00 ? 50  ARG A N    8  
ATOM 11058 C CA   . ARG A 1 50 ? -11.142 -5.780  -0.973  1.00 0.00 ? 50  ARG A CA   8  
ATOM 11059 C C    . ARG A 1 50 ? -9.862  -5.691  -1.803  1.00 0.00 ? 50  ARG A C    8  
ATOM 11060 O O    . ARG A 1 50 ? -9.880  -5.937  -3.009  1.00 0.00 ? 50  ARG A O    8  
ATOM 11061 C CB   . ARG A 1 50 ? -11.394 -4.450  -0.252  1.00 0.00 ? 50  ARG A CB   8  
ATOM 11062 C CG   . ARG A 1 50 ? -12.833 -4.263  0.203   1.00 0.00 ? 50  ARG A CG   8  
ATOM 11063 C CD   . ARG A 1 50 ? -13.751 -3.920  -0.959  1.00 0.00 ? 50  ARG A CD   8  
ATOM 11064 N NE   . ARG A 1 50 ? -15.158 -3.911  -0.560  1.00 0.00 ? 50  ARG A NE   8  
ATOM 11065 C CZ   . ARG A 1 50 ? -15.732 -2.931  0.146   1.00 0.00 ? 50  ARG A CZ   8  
ATOM 11066 N NH1  . ARG A 1 50 ? -15.024 -1.869  0.531   1.00 0.00 ? 50  ARG A NH1  8  
ATOM 11067 N NH2  . ARG A 1 50 ? -17.019 -3.015  0.469   1.00 0.00 ? 50  ARG A NH2  8  
ATOM 11068 H H    . ARG A 1 50 ? -10.283 -6.949  0.577   1.00 0.00 ? 50  ARG A H    8  
ATOM 11069 H HA   . ARG A 1 50 ? -11.969 -5.980  -1.636  1.00 0.00 ? 50  ARG A HA   8  
ATOM 11070 H HB2  . ARG A 1 50 ? -10.755 -4.396  0.618   1.00 0.00 ? 50  ARG A HB2  8  
ATOM 11071 H HB3  . ARG A 1 50 ? -11.143 -3.639  -0.921  1.00 0.00 ? 50  ARG A HB3  8  
ATOM 11072 H HG2  . ARG A 1 50 ? -13.176 -5.178  0.663   1.00 0.00 ? 50  ARG A HG2  8  
ATOM 11073 H HG3  . ARG A 1 50 ? -12.867 -3.461  0.926   1.00 0.00 ? 50  ARG A HG3  8  
ATOM 11074 H HD2  . ARG A 1 50 ? -13.486 -2.943  -1.337  1.00 0.00 ? 50  ARG A HD2  8  
ATOM 11075 H HD3  . ARG A 1 50 ? -13.612 -4.655  -1.740  1.00 0.00 ? 50  ARG A HD3  8  
ATOM 11076 H HE   . ARG A 1 50 ? -15.705 -4.680  -0.828  1.00 0.00 ? 50  ARG A HE   8  
ATOM 11077 H HH11 . ARG A 1 50 ? -14.055 -1.798  0.295   1.00 0.00 ? 50  ARG A HH11 8  
ATOM 11078 H HH12 . ARG A 1 50 ? -15.462 -1.140  1.058   1.00 0.00 ? 50  ARG A HH12 8  
ATOM 11079 H HH21 . ARG A 1 50 ? -17.555 -3.810  0.186   1.00 0.00 ? 50  ARG A HH21 8  
ATOM 11080 H HH22 . ARG A 1 50 ? -17.452 -2.283  0.998   1.00 0.00 ? 50  ARG A HH22 8  
ATOM 11081 N N    . LEU A 1 51 ? -8.754  -5.343  -1.148  1.00 0.00 ? 51  LEU A N    8  
ATOM 11082 C CA   . LEU A 1 51 ? -7.462  -5.228  -1.824  1.00 0.00 ? 51  LEU A CA   8  
ATOM 11083 C C    . LEU A 1 51 ? -6.932  -6.604  -2.230  1.00 0.00 ? 51  LEU A C    8  
ATOM 11084 O O    . LEU A 1 51 ? -7.376  -7.629  -1.707  1.00 0.00 ? 51  LEU A O    8  
ATOM 11085 C CB   . LEU A 1 51 ? -6.445  -4.519  -0.920  1.00 0.00 ? 51  LEU A CB   8  
ATOM 11086 C CG   . LEU A 1 51 ? -6.236  -5.156  0.460   1.00 0.00 ? 51  LEU A CG   8  
ATOM 11087 C CD1  . LEU A 1 51 ? -5.068  -6.131  0.435   1.00 0.00 ? 51  LEU A CD1  8  
ATOM 11088 C CD2  . LEU A 1 51 ? -6.015  -4.079  1.514   1.00 0.00 ? 51  LEU A CD2  8  
ATOM 11089 H H    . LEU A 1 51 ? -8.806  -5.163  -0.186  1.00 0.00 ? 51  LEU A H    8  
ATOM 11090 H HA   . LEU A 1 51 ? -7.609  -4.636  -2.716  1.00 0.00 ? 51  LEU A HA   8  
ATOM 11091 H HB2  . LEU A 1 51 ? -5.494  -4.499  -1.432  1.00 0.00 ? 51  LEU A HB2  8  
ATOM 11092 H HB3  . LEU A 1 51 ? -6.776  -3.501  -0.774  1.00 0.00 ? 51  LEU A HB3  8  
ATOM 11093 H HG   . LEU A 1 51 ? -7.124  -5.710  0.729   1.00 0.00 ? 51  LEU A HG   8  
ATOM 11094 H HD11 . LEU A 1 51 ? -4.919  -6.490  -0.573  1.00 0.00 ? 51  LEU A HD11 8  
ATOM 11095 H HD12 . LEU A 1 51 ? -5.281  -6.965  1.086   1.00 0.00 ? 51  LEU A HD12 8  
ATOM 11096 H HD13 . LEU A 1 51 ? -4.173  -5.629  0.774   1.00 0.00 ? 51  LEU A HD13 8  
ATOM 11097 H HD21 . LEU A 1 51 ? -6.527  -4.356  2.424   1.00 0.00 ? 51  LEU A HD21 8  
ATOM 11098 H HD22 . LEU A 1 51 ? -6.402  -3.137  1.155   1.00 0.00 ? 51  LEU A HD22 8  
ATOM 11099 H HD23 . LEU A 1 51 ? -4.958  -3.981  1.712   1.00 0.00 ? 51  LEU A HD23 8  
ATOM 11100 N N    . ALA A 1 52 ? -5.982  -6.616  -3.165  1.00 0.00 ? 52  ALA A N    8  
ATOM 11101 C CA   . ALA A 1 52 ? -5.391  -7.862  -3.647  1.00 0.00 ? 52  ALA A CA   8  
ATOM 11102 C C    . ALA A 1 52 ? -3.902  -7.692  -3.949  1.00 0.00 ? 52  ALA A C    8  
ATOM 11103 O O    . ALA A 1 52 ? -3.324  -6.633  -3.696  1.00 0.00 ? 52  ALA A O    8  
ATOM 11104 C CB   . ALA A 1 52 ? -6.126  -8.343  -4.890  1.00 0.00 ? 52  ALA A CB   8  
ATOM 11105 H H    . ALA A 1 52 ? -5.671  -5.766  -3.542  1.00 0.00 ? 52  ALA A H    8  
ATOM 11106 H HA   . ALA A 1 52 ? -5.510  -8.610  -2.876  1.00 0.00 ? 52  ALA A HA   8  
ATOM 11107 H HB1  . ALA A 1 52 ? -5.578  -8.042  -5.771  1.00 0.00 ? 52  ALA A HB1  8  
ATOM 11108 H HB2  . ALA A 1 52 ? -7.115  -7.909  -4.916  1.00 0.00 ? 52  ALA A HB2  8  
ATOM 11109 H HB3  . ALA A 1 52 ? -6.206  -9.419  -4.867  1.00 0.00 ? 52  ALA A HB3  8  
ATOM 11110 N N    . ALA A 1 53 ? -3.288  -8.742  -4.497  1.00 0.00 ? 53  ALA A N    8  
ATOM 11111 C CA   . ALA A 1 53 ? -1.870  -8.712  -4.841  1.00 0.00 ? 53  ALA A CA   8  
ATOM 11112 C C    . ALA A 1 53 ? -1.659  -8.141  -6.242  1.00 0.00 ? 53  ALA A C    8  
ATOM 11113 O O    . ALA A 1 53 ? -2.174  -8.677  -7.225  1.00 0.00 ? 53  ALA A O    8  
ATOM 11114 C CB   . ALA A 1 53 ? -1.271  -10.108 -4.740  1.00 0.00 ? 53  ALA A CB   8  
ATOM 11115 H H    . ALA A 1 53 ? -3.804  -9.556  -4.679  1.00 0.00 ? 53  ALA A H    8  
ATOM 11116 H HA   . ALA A 1 53 ? -1.368  -8.078  -4.123  1.00 0.00 ? 53  ALA A HA   8  
ATOM 11117 H HB1  . ALA A 1 53 ? -1.821  -10.685 -4.011  1.00 0.00 ? 53  ALA A HB1  8  
ATOM 11118 H HB2  . ALA A 1 53 ? -0.239  -10.034 -4.437  1.00 0.00 ? 53  ALA A HB2  8  
ATOM 11119 H HB3  . ALA A 1 53 ? -1.329  -10.596 -5.703  1.00 0.00 ? 53  ALA A HB3  8  
ATOM 11120 N N    . GLY A 1 54 ? -0.895  -7.052  -6.326  1.00 0.00 ? 54  GLY A N    8  
ATOM 11121 C CA   . GLY A 1 54 ? -0.622  -6.424  -7.609  1.00 0.00 ? 54  GLY A CA   8  
ATOM 11122 C C    . GLY A 1 54 ? -1.307  -5.076  -7.769  1.00 0.00 ? 54  GLY A C    8  
ATOM 11123 O O    . GLY A 1 54 ? -1.665  -4.687  -8.882  1.00 0.00 ? 54  GLY A O    8  
ATOM 11124 H H    . GLY A 1 54 ? -0.509  -6.673  -5.508  1.00 0.00 ? 54  GLY A H    8  
ATOM 11125 H HA2  . GLY A 1 54 ? 0.445   -6.284  -7.708  1.00 0.00 ? 54  GLY A HA2  8  
ATOM 11126 H HA3  . GLY A 1 54 ? -0.959  -7.082  -8.397  1.00 0.00 ? 54  GLY A HA3  8  
ATOM 11127 N N    . ASP A 1 55 ? -1.485  -4.358  -6.658  1.00 0.00 ? 55  ASP A N    8  
ATOM 11128 C CA   . ASP A 1 55 ? -2.125  -3.046  -6.686  1.00 0.00 ? 55  ASP A CA   8  
ATOM 11129 C C    . ASP A 1 55 ? -1.157  -1.957  -6.234  1.00 0.00 ? 55  ASP A C    8  
ATOM 11130 O O    . ASP A 1 55 ? -0.399  -2.148  -5.283  1.00 0.00 ? 55  ASP A O    8  
ATOM 11131 C CB   . ASP A 1 55 ? -3.371  -3.036  -5.794  1.00 0.00 ? 55  ASP A CB   8  
ATOM 11132 C CG   . ASP A 1 55 ? -4.443  -4.001  -6.266  1.00 0.00 ? 55  ASP A CG   8  
ATOM 11133 O OD1  . ASP A 1 55 ? -4.629  -4.134  -7.495  1.00 0.00 ? 55  ASP A OD1  8  
ATOM 11134 O OD2  . ASP A 1 55 ? -5.100  -4.624  -5.403  1.00 0.00 ? 55  ASP A OD2  8  
ATOM 11135 H H    . ASP A 1 55 ? -1.174  -4.716  -5.801  1.00 0.00 ? 55  ASP A H    8  
ATOM 11136 H HA   . ASP A 1 55 ? -2.423  -2.846  -7.704  1.00 0.00 ? 55  ASP A HA   8  
ATOM 11137 H HB2  . ASP A 1 55 ? -3.089  -3.310  -4.789  1.00 0.00 ? 55  ASP A HB2  8  
ATOM 11138 H HB3  . ASP A 1 55 ? -3.788  -2.040  -5.787  1.00 0.00 ? 55  ASP A HB3  8  
ATOM 11139 N N    . GLN A 1 56 ? -1.194  -0.814  -6.920  1.00 0.00 ? 56  GLN A N    8  
ATOM 11140 C CA   . GLN A 1 56 ? -0.323  0.316   -6.590  1.00 0.00 ? 56  GLN A CA   8  
ATOM 11141 C C    . GLN A 1 56 ? -0.905  1.128   -5.430  1.00 0.00 ? 56  GLN A C    8  
ATOM 11142 O O    . GLN A 1 56 ? -2.122  1.264   -5.311  1.00 0.00 ? 56  GLN A O    8  
ATOM 11143 C CB   . GLN A 1 56 ? -0.133  1.218   -7.816  1.00 0.00 ? 56  GLN A CB   8  
ATOM 11144 C CG   . GLN A 1 56 ? 0.934   2.290   -7.633  1.00 0.00 ? 56  GLN A CG   8  
ATOM 11145 C CD   . GLN A 1 56 ? 0.554   3.612   -8.276  1.00 0.00 ? 56  GLN A CD   8  
ATOM 11146 O OE1  . GLN A 1 56 ? 0.032   3.648   -9.391  1.00 0.00 ? 56  GLN A OE1  8  
ATOM 11147 N NE2  . GLN A 1 56 ? 0.816   4.708   -7.573  1.00 0.00 ? 56  GLN A NE2  8  
ATOM 11148 H H    . GLN A 1 56 ? -1.827  -0.726  -7.666  1.00 0.00 ? 56  GLN A H    8  
ATOM 11149 H HA   . GLN A 1 56 ? 0.636   -0.082  -6.292  1.00 0.00 ? 56  GLN A HA   8  
ATOM 11150 H HB2  . GLN A 1 56 ? 0.148   0.604   -8.659  1.00 0.00 ? 56  GLN A HB2  8  
ATOM 11151 H HB3  . GLN A 1 56 ? -1.070  1.707   -8.038  1.00 0.00 ? 56  GLN A HB3  8  
ATOM 11152 H HG2  . GLN A 1 56 ? 1.084   2.454   -6.577  1.00 0.00 ? 56  GLN A HG2  8  
ATOM 11153 H HG3  . GLN A 1 56 ? 1.856   1.943   -8.076  1.00 0.00 ? 56  GLN A HG3  8  
ATOM 11154 H HE21 . GLN A 1 56 ? 1.233   4.605   -6.691  1.00 0.00 ? 56  GLN A HE21 8  
ATOM 11155 H HE22 . GLN A 1 56 ? 0.584   5.574   -7.965  1.00 0.00 ? 56  GLN A HE22 8  
ATOM 11156 N N    . LEU A 1 57 ? -0.031  1.668   -4.581  1.00 0.00 ? 57  LEU A N    8  
ATOM 11157 C CA   . LEU A 1 57 ? -0.469  2.470   -3.434  1.00 0.00 ? 57  LEU A CA   8  
ATOM 11158 C C    . LEU A 1 57 ? -0.405  3.963   -3.744  1.00 0.00 ? 57  LEU A C    8  
ATOM 11159 O O    . LEU A 1 57 ? 0.166   4.378   -4.755  1.00 0.00 ? 57  LEU A O    8  
ATOM 11160 C CB   . LEU A 1 57 ? 0.388   2.164   -2.198  1.00 0.00 ? 57  LEU A CB   8  
ATOM 11161 C CG   . LEU A 1 57 ? -0.373  1.572   -1.007  1.00 0.00 ? 57  LEU A CG   8  
ATOM 11162 C CD1  . LEU A 1 57 ? 0.533   0.664   -0.190  1.00 0.00 ? 57  LEU A CD1  8  
ATOM 11163 C CD2  . LEU A 1 57 ? -0.946  2.680   -0.132  1.00 0.00 ? 57  LEU A CD2  8  
ATOM 11164 H H    . LEU A 1 57 ? 0.929   1.528   -4.730  1.00 0.00 ? 57  LEU A H    8  
ATOM 11165 H HA   . LEU A 1 57 ? -1.494  2.208   -3.220  1.00 0.00 ? 57  LEU A HA   8  
ATOM 11166 H HB2  . LEU A 1 57 ? 1.161   1.470   -2.486  1.00 0.00 ? 57  LEU A HB2  8  
ATOM 11167 H HB3  . LEU A 1 57 ? 0.856   3.082   -1.875  1.00 0.00 ? 57  LEU A HB3  8  
ATOM 11168 H HG   . LEU A 1 57 ? -1.197  0.977   -1.375  1.00 0.00 ? 57  LEU A HG   8  
ATOM 11169 H HD11 . LEU A 1 57 ? 1.340   0.305   -0.812  1.00 0.00 ? 57  LEU A HD11 8  
ATOM 11170 H HD12 . LEU A 1 57 ? -0.036  -0.176  0.180   1.00 0.00 ? 57  LEU A HD12 8  
ATOM 11171 H HD13 . LEU A 1 57 ? 0.940   1.217   0.645   1.00 0.00 ? 57  LEU A HD13 8  
ATOM 11172 H HD21 . LEU A 1 57 ? -0.289  3.537   -0.158  1.00 0.00 ? 57  LEU A HD21 8  
ATOM 11173 H HD22 . LEU A 1 57 ? -1.034  2.325   0.885   1.00 0.00 ? 57  LEU A HD22 8  
ATOM 11174 H HD23 . LEU A 1 57 ? -1.921  2.962   -0.500  1.00 0.00 ? 57  LEU A HD23 8  
ATOM 11175 N N    . LEU A 1 58 ? -0.994  4.767   -2.858  1.00 0.00 ? 58  LEU A N    8  
ATOM 11176 C CA   . LEU A 1 58 ? -1.005  6.215   -3.022  1.00 0.00 ? 58  LEU A CA   8  
ATOM 11177 C C    . LEU A 1 58 ? -0.989  6.921   -1.666  1.00 0.00 ? 58  LEU A C    8  
ATOM 11178 O O    . LEU A 1 58 ? -0.080  7.703   -1.381  1.00 0.00 ? 58  LEU A O    8  
ATOM 11179 C CB   . LEU A 1 58 ? -2.229  6.654   -3.832  1.00 0.00 ? 58  LEU A CB   8  
ATOM 11180 C CG   . LEU A 1 58 ? -1.912  7.264   -5.200  1.00 0.00 ? 58  LEU A CG   8  
ATOM 11181 C CD1  . LEU A 1 58 ? -2.857  6.724   -6.263  1.00 0.00 ? 58  LEU A CD1  8  
ATOM 11182 C CD2  . LEU A 1 58 ? -1.989  8.784   -5.138  1.00 0.00 ? 58  LEU A CD2  8  
ATOM 11183 H H    . LEU A 1 58 ? -1.428  4.373   -2.072  1.00 0.00 ? 58  LEU A H    8  
ATOM 11184 H HA   . LEU A 1 58 ? -0.112  6.489   -3.565  1.00 0.00 ? 58  LEU A HA   8  
ATOM 11185 H HB2  . LEU A 1 58 ? -2.864  5.792   -3.981  1.00 0.00 ? 58  LEU A HB2  8  
ATOM 11186 H HB3  . LEU A 1 58 ? -2.774  7.385   -3.254  1.00 0.00 ? 58  LEU A HB3  8  
ATOM 11187 H HG   . LEU A 1 58 ? -0.905  6.992   -5.483  1.00 0.00 ? 58  LEU A HG   8  
ATOM 11188 H HD11 . LEU A 1 58 ? -3.752  7.327   -6.291  1.00 0.00 ? 58  LEU A HD11 8  
ATOM 11189 H HD12 . LEU A 1 58 ? -3.118  5.703   -6.027  1.00 0.00 ? 58  LEU A HD12 8  
ATOM 11190 H HD13 . LEU A 1 58 ? -2.370  6.757   -7.227  1.00 0.00 ? 58  LEU A HD13 8  
ATOM 11191 H HD21 . LEU A 1 58 ? -1.478  9.135   -4.252  1.00 0.00 ? 58  LEU A HD21 8  
ATOM 11192 H HD22 . LEU A 1 58 ? -3.024  9.091   -5.101  1.00 0.00 ? 58  LEU A HD22 8  
ATOM 11193 H HD23 . LEU A 1 58 ? -1.521  9.204   -6.015  1.00 0.00 ? 58  LEU A HD23 8  
ATOM 11194 N N    . SER A 1 59 ? -2.000  6.646   -0.835  1.00 0.00 ? 59  SER A N    8  
ATOM 11195 C CA   . SER A 1 59 ? -2.094  7.267   0.487   1.00 0.00 ? 59  SER A CA   8  
ATOM 11196 C C    . SER A 1 59 ? -2.289  6.223   1.591   1.00 0.00 ? 59  SER A C    8  
ATOM 11197 O O    . SER A 1 59 ? -2.868  5.157   1.362   1.00 0.00 ? 59  SER A O    8  
ATOM 11198 C CB   . SER A 1 59 ? -3.238  8.287   0.512   1.00 0.00 ? 59  SER A CB   8  
ATOM 11199 O OG   . SER A 1 59 ? -4.503  7.651   0.426   1.00 0.00 ? 59  SER A OG   8  
ATOM 11200 H H    . SER A 1 59 ? -2.697  6.017   -1.120  1.00 0.00 ? 59  SER A H    8  
ATOM 11201 H HA   . SER A 1 59 ? -1.165  7.786   0.669   1.00 0.00 ? 59  SER A HA   8  
ATOM 11202 H HB2  . SER A 1 59 ? -3.194  8.850   1.433   1.00 0.00 ? 59  SER A HB2  8  
ATOM 11203 H HB3  . SER A 1 59 ? -3.133  8.962   -0.325  1.00 0.00 ? 59  SER A HB3  8  
ATOM 11204 H HG   . SER A 1 59 ? -4.948  7.931   -0.379  1.00 0.00 ? 59  SER A HG   8  
ATOM 11205 N N    . VAL A 1 60 ? -1.797  6.545   2.791   1.00 0.00 ? 60  VAL A N    8  
ATOM 11206 C CA   . VAL A 1 60 ? -1.904  5.652   3.946   1.00 0.00 ? 60  VAL A CA   8  
ATOM 11207 C C    . VAL A 1 60 ? -2.170  6.446   5.225   1.00 0.00 ? 60  VAL A C    8  
ATOM 11208 O O    . VAL A 1 60 ? -1.240  6.954   5.850   1.00 0.00 ? 60  VAL A O    8  
ATOM 11209 C CB   . VAL A 1 60 ? -0.619  4.817   4.137   1.00 0.00 ? 60  VAL A CB   8  
ATOM 11210 C CG1  . VAL A 1 60 ? -0.794  3.809   5.266   1.00 0.00 ? 60  VAL A CG1  8  
ATOM 11211 C CG2  . VAL A 1 60 ? -0.236  4.119   2.841   1.00 0.00 ? 60  VAL A CG2  8  
ATOM 11212 H H    . VAL A 1 60 ? -1.347  7.410   2.902   1.00 0.00 ? 60  VAL A H    8  
ATOM 11213 H HA   . VAL A 1 60 ? -2.728  4.974   3.772   1.00 0.00 ? 60  VAL A HA   8  
ATOM 11214 H HB   . VAL A 1 60 ? 0.183   5.488   4.409   1.00 0.00 ? 60  VAL A HB   8  
ATOM 11215 H HG11 . VAL A 1 60 ? -1.218  2.898   4.874   1.00 0.00 ? 60  VAL A HG11 8  
ATOM 11216 H HG12 . VAL A 1 60 ? -1.452  4.217   6.019   1.00 0.00 ? 60  VAL A HG12 8  
ATOM 11217 H HG13 . VAL A 1 60 ? 0.168   3.595   5.709   1.00 0.00 ? 60  VAL A HG13 8  
ATOM 11218 H HG21 . VAL A 1 60 ? 0.125   4.850   2.131   1.00 0.00 ? 60  VAL A HG21 8  
ATOM 11219 H HG22 . VAL A 1 60 ? -1.100  3.618   2.432   1.00 0.00 ? 60  VAL A HG22 8  
ATOM 11220 H HG23 . VAL A 1 60 ? 0.541   3.396   3.037   1.00 0.00 ? 60  VAL A HG23 8  
ATOM 11221 N N    . ASP A 1 61 ? -3.444  6.550   5.609   1.00 0.00 ? 61  ASP A N    8  
ATOM 11222 C CA   . ASP A 1 61 ? -3.833  7.286   6.816   1.00 0.00 ? 61  ASP A CA   8  
ATOM 11223 C C    . ASP A 1 61 ? -3.291  8.719   6.784   1.00 0.00 ? 61  ASP A C    8  
ATOM 11224 O O    . ASP A 1 61 ? -2.801  9.235   7.792   1.00 0.00 ? 61  ASP A O    8  
ATOM 11225 C CB   . ASP A 1 61 ? -3.327  6.563   8.071   1.00 0.00 ? 61  ASP A CB   8  
ATOM 11226 C CG   . ASP A 1 61 ? -4.017  5.232   8.295   1.00 0.00 ? 61  ASP A CG   8  
ATOM 11227 O OD1  . ASP A 1 61 ? -3.524  4.211   7.772   1.00 0.00 ? 61  ASP A OD1  8  
ATOM 11228 O OD2  . ASP A 1 61 ? -5.055  5.212   8.990   1.00 0.00 ? 61  ASP A OD2  8  
ATOM 11229 H H    . ASP A 1 61 ? -4.141  6.124   5.067   1.00 0.00 ? 61  ASP A H    8  
ATOM 11230 H HA   . ASP A 1 61 ? -4.912  7.325   6.846   1.00 0.00 ? 61  ASP A HA   8  
ATOM 11231 H HB2  . ASP A 1 61 ? -2.267  6.384   7.974   1.00 0.00 ? 61  ASP A HB2  8  
ATOM 11232 H HB3  . ASP A 1 61 ? -3.504  7.189   8.935   1.00 0.00 ? 61  ASP A HB3  8  
ATOM 11233 N N    . GLY A 1 62 ? -3.379  9.354   5.615   1.00 0.00 ? 62  GLY A N    8  
ATOM 11234 C CA   . GLY A 1 62 ? -2.892  10.717  5.466   1.00 0.00 ? 62  GLY A CA   8  
ATOM 11235 C C    . GLY A 1 62 ? -1.390  10.788  5.226   1.00 0.00 ? 62  GLY A C    8  
ATOM 11236 O O    . GLY A 1 62 ? -0.756  11.799  5.534   1.00 0.00 ? 62  GLY A O    8  
ATOM 11237 H H    . GLY A 1 62 ? -3.776  8.891   4.845   1.00 0.00 ? 62  GLY A H    8  
ATOM 11238 H HA2  . GLY A 1 62 ? -3.397  11.175  4.630   1.00 0.00 ? 62  GLY A HA2  8  
ATOM 11239 H HA3  . GLY A 1 62 ? -3.129  11.272  6.362   1.00 0.00 ? 62  GLY A HA3  8  
ATOM 11240 N N    . ARG A 1 63 ? -0.819  9.719   4.666   1.00 0.00 ? 63  ARG A N    8  
ATOM 11241 C CA   . ARG A 1 63 ? 0.613   9.673   4.374   1.00 0.00 ? 63  ARG A CA   8  
ATOM 11242 C C    . ARG A 1 63 ? 0.837   9.455   2.883   1.00 0.00 ? 63  ARG A C    8  
ATOM 11243 O O    . ARG A 1 63 ? 0.253   8.547   2.288   1.00 0.00 ? 63  ARG A O    8  
ATOM 11244 C CB   . ARG A 1 63 ? 1.305   8.561   5.170   1.00 0.00 ? 63  ARG A CB   8  
ATOM 11245 C CG   . ARG A 1 63 ? 0.920   8.519   6.641   1.00 0.00 ? 63  ARG A CG   8  
ATOM 11246 C CD   . ARG A 1 63 ? 1.795   9.443   7.472   1.00 0.00 ? 63  ARG A CD   8  
ATOM 11247 N NE   . ARG A 1 63 ? 1.510   10.854  7.209   1.00 0.00 ? 63  ARG A NE   8  
ATOM 11248 C CZ   . ARG A 1 63 ? 2.277   11.863  7.627   1.00 0.00 ? 63  ARG A CZ   8  
ATOM 11249 N NH1  . ARG A 1 63 ? 3.360   11.628  8.361   1.00 0.00 ? 63  ARG A NH1  8  
ATOM 11250 N NH2  . ARG A 1 63 ? 1.955   13.113  7.314   1.00 0.00 ? 63  ARG A NH2  8  
ATOM 11251 H H    . ARG A 1 63 ? -1.374  8.946   4.435   1.00 0.00 ? 63  ARG A H    8  
ATOM 11252 H HA   . ARG A 1 63 ? 1.039   10.625  4.656   1.00 0.00 ? 63  ARG A HA   8  
ATOM 11253 H HB2  . ARG A 1 63 ? 1.054   7.610   4.728   1.00 0.00 ? 63  ARG A HB2  8  
ATOM 11254 H HB3  . ARG A 1 63 ? 2.375   8.704   5.107   1.00 0.00 ? 63  ARG A HB3  8  
ATOM 11255 H HG2  . ARG A 1 63 ? -0.110  8.827   6.742   1.00 0.00 ? 63  ARG A HG2  8  
ATOM 11256 H HG3  . ARG A 1 63 ? 1.032   7.507   7.002   1.00 0.00 ? 63  ARG A HG3  8  
ATOM 11257 H HD2  . ARG A 1 63 ? 1.619   9.238   8.518   1.00 0.00 ? 63  ARG A HD2  8  
ATOM 11258 H HD3  . ARG A 1 63 ? 2.830   9.243   7.237   1.00 0.00 ? 63  ARG A HD3  8  
ATOM 11259 H HE   . ARG A 1 63 ? 0.708   11.062  6.684   1.00 0.00 ? 63  ARG A HE   8  
ATOM 11260 H HH11 . ARG A 1 63 ? 3.606   10.691  8.608   1.00 0.00 ? 63  ARG A HH11 8  
ATOM 11261 H HH12 . ARG A 1 63 ? 3.930   12.390  8.668   1.00 0.00 ? 63  ARG A HH12 8  
ATOM 11262 H HH21 . ARG A 1 63 ? 1.137   13.299  6.767   1.00 0.00 ? 63  ARG A HH21 8  
ATOM 11263 H HH22 . ARG A 1 63 ? 2.530   13.871  7.624   1.00 0.00 ? 63  ARG A HH22 8  
ATOM 11264 N N    . SER A 1 64 ? 1.680   10.291  2.284   1.00 0.00 ? 64  SER A N    8  
ATOM 11265 C CA   . SER A 1 64 ? 1.975   10.192  0.858   1.00 0.00 ? 64  SER A CA   8  
ATOM 11266 C C    . SER A 1 64 ? 3.152   9.255   0.608   1.00 0.00 ? 64  SER A C    8  
ATOM 11267 O O    . SER A 1 64 ? 4.293   9.573   0.949   1.00 0.00 ? 64  SER A O    8  
ATOM 11268 C CB   . SER A 1 64 ? 2.276   11.577  0.268   1.00 0.00 ? 64  SER A CB   8  
ATOM 11269 O OG   . SER A 1 64 ? 1.649   12.608  1.014   1.00 0.00 ? 64  SER A OG   8  
ATOM 11270 H H    . SER A 1 64 ? 2.111   10.994  2.813   1.00 0.00 ? 64  SER A H    8  
ATOM 11271 H HA   . SER A 1 64 ? 1.101   9.787   0.368   1.00 0.00 ? 64  SER A HA   8  
ATOM 11272 H HB2  . SER A 1 64 ? 3.344   11.746  0.275   1.00 0.00 ? 64  SER A HB2  8  
ATOM 11273 H HB3  . SER A 1 64 ? 1.914   11.618  -0.749  1.00 0.00 ? 64  SER A HB3  8  
ATOM 11274 H HG   . SER A 1 64 ? 2.005   13.459  0.746   1.00 0.00 ? 64  SER A HG   8  
ATOM 11275 N N    . LEU A 1 65 ? 2.869   8.103   0.002   1.00 0.00 ? 65  LEU A N    8  
ATOM 11276 C CA   . LEU A 1 65 ? 3.912   7.123   -0.304  1.00 0.00 ? 65  LEU A CA   8  
ATOM 11277 C C    . LEU A 1 65 ? 4.343   7.218   -1.770  1.00 0.00 ? 65  LEU A C    8  
ATOM 11278 O O    . LEU A 1 65 ? 4.806   6.235   -2.351  1.00 0.00 ? 65  LEU A O    8  
ATOM 11279 C CB   . LEU A 1 65 ? 3.428   5.700   -0.003  1.00 0.00 ? 65  LEU A CB   8  
ATOM 11280 C CG   . LEU A 1 65 ? 2.954   5.451   1.429   1.00 0.00 ? 65  LEU A CG   8  
ATOM 11281 C CD1  . LEU A 1 65 ? 2.686   3.970   1.642   1.00 0.00 ? 65  LEU A CD1  8  
ATOM 11282 C CD2  . LEU A 1 65 ? 3.979   5.960   2.434   1.00 0.00 ? 65  LEU A CD2  8  
ATOM 11283 H H    . LEU A 1 65 ? 1.942   7.909   -0.251  1.00 0.00 ? 65  LEU A H    8  
ATOM 11284 H HA   . LEU A 1 65 ? 4.764   7.341   0.323   1.00 0.00 ? 65  LEU A HA   8  
ATOM 11285 H HB2  . LEU A 1 65 ? 2.612   5.470   -0.674  1.00 0.00 ? 65  LEU A HB2  8  
ATOM 11286 H HB3  . LEU A 1 65 ? 4.241   5.019   -0.210  1.00 0.00 ? 65  LEU A HB3  8  
ATOM 11287 H HG   . LEU A 1 65 ? 2.029   5.985   1.593   1.00 0.00 ? 65  LEU A HG   8  
ATOM 11288 H HD11 . LEU A 1 65 ? 1.784   3.690   1.116   1.00 0.00 ? 65  LEU A HD11 8  
ATOM 11289 H HD12 . LEU A 1 65 ? 2.563   3.774   2.696   1.00 0.00 ? 65  LEU A HD12 8  
ATOM 11290 H HD13 . LEU A 1 65 ? 3.517   3.395   1.262   1.00 0.00 ? 65  LEU A HD13 8  
ATOM 11291 H HD21 . LEU A 1 65 ? 4.966   5.629   2.144   1.00 0.00 ? 65  LEU A HD21 8  
ATOM 11292 H HD22 . LEU A 1 65 ? 3.745   5.574   3.415   1.00 0.00 ? 65  LEU A HD22 8  
ATOM 11293 H HD23 . LEU A 1 65 ? 3.955   7.040   2.458   1.00 0.00 ? 65  LEU A HD23 8  
ATOM 11294 N N    . VAL A 1 66 ? 4.192   8.404   -2.364  1.00 0.00 ? 66  VAL A N    8  
ATOM 11295 C CA   . VAL A 1 66 ? 4.570   8.617   -3.756  1.00 0.00 ? 66  VAL A CA   8  
ATOM 11296 C C    . VAL A 1 66 ? 5.841   9.462   -3.846  1.00 0.00 ? 66  VAL A C    8  
ATOM 11297 O O    . VAL A 1 66 ? 5.809   10.644  -4.196  1.00 0.00 ? 66  VAL A O    8  
ATOM 11298 C CB   . VAL A 1 66 ? 3.425   9.276   -4.560  1.00 0.00 ? 66  VAL A CB   8  
ATOM 11299 C CG1  . VAL A 1 66 ? 3.036   10.614  -3.947  1.00 0.00 ? 66  VAL A CG1  8  
ATOM 11300 C CG2  . VAL A 1 66 ? 3.818   9.436   -6.023  1.00 0.00 ? 66  VAL A CG2  8  
ATOM 11301 H H    . VAL A 1 66 ? 3.821   9.152   -1.854  1.00 0.00 ? 66  VAL A H    8  
ATOM 11302 H HA   . VAL A 1 66 ? 4.776   7.648   -4.187  1.00 0.00 ? 66  VAL A HA   8  
ATOM 11303 H HB   . VAL A 1 66 ? 2.562   8.625   -4.514  1.00 0.00 ? 66  VAL A HB   8  
ATOM 11304 H HG11 . VAL A 1 66 ? 3.741   10.867  -3.169  1.00 0.00 ? 66  VAL A HG11 8  
ATOM 11305 H HG12 . VAL A 1 66 ? 2.044   10.543  -3.526  1.00 0.00 ? 66  VAL A HG12 8  
ATOM 11306 H HG13 . VAL A 1 66 ? 3.051   11.379  -4.709  1.00 0.00 ? 66  VAL A HG13 8  
ATOM 11307 H HG21 . VAL A 1 66 ? 2.958   9.257   -6.650  1.00 0.00 ? 66  VAL A HG21 8  
ATOM 11308 H HG22 . VAL A 1 66 ? 4.593   8.723   -6.265  1.00 0.00 ? 66  VAL A HG22 8  
ATOM 11309 H HG23 . VAL A 1 66 ? 4.185   10.437  -6.191  1.00 0.00 ? 66  VAL A HG23 8  
ATOM 11310 N N    . GLY A 1 67 ? 6.957   8.834   -3.511  1.00 0.00 ? 67  GLY A N    8  
ATOM 11311 C CA   . GLY A 1 67 ? 8.244   9.507   -3.535  1.00 0.00 ? 67  GLY A CA   8  
ATOM 11312 C C    . GLY A 1 67 ? 9.185   8.984   -2.464  1.00 0.00 ? 67  GLY A C    8  
ATOM 11313 O O    . GLY A 1 67 ? 10.403  9.114   -2.582  1.00 0.00 ? 67  GLY A O    8  
ATOM 11314 H H    . GLY A 1 67 ? 6.906   7.897   -3.232  1.00 0.00 ? 67  GLY A H    8  
ATOM 11315 H HA2  . GLY A 1 67 ? 8.699   9.358   -4.504  1.00 0.00 ? 67  GLY A HA2  8  
ATOM 11316 H HA3  . GLY A 1 67 ? 8.090   10.565  -3.379  1.00 0.00 ? 67  GLY A HA3  8  
ATOM 11317 N N    . LEU A 1 68 ? 8.613   8.384   -1.417  1.00 0.00 ? 68  LEU A N    8  
ATOM 11318 C CA   . LEU A 1 68 ? 9.397   7.830   -0.317  1.00 0.00 ? 68  LEU A CA   8  
ATOM 11319 C C    . LEU A 1 68 ? 9.942   6.449   -0.669  1.00 0.00 ? 68  LEU A C    8  
ATOM 11320 O O    . LEU A 1 68 ? 9.413   5.763   -1.546  1.00 0.00 ? 68  LEU A O    8  
ATOM 11321 C CB   . LEU A 1 68 ? 8.541   7.722   0.948   1.00 0.00 ? 68  LEU A CB   8  
ATOM 11322 C CG   . LEU A 1 68 ? 8.152   9.049   1.596   1.00 0.00 ? 68  LEU A CG   8  
ATOM 11323 C CD1  . LEU A 1 68 ? 7.337   8.799   2.855   1.00 0.00 ? 68  LEU A CD1  8  
ATOM 11324 C CD2  . LEU A 1 68 ? 9.393   9.872   1.916   1.00 0.00 ? 68  LEU A CD2  8  
ATOM 11325 H H    . LEU A 1 68 ? 7.634   8.307   -1.386  1.00 0.00 ? 68  LEU A H    8  
ATOM 11326 H HA   . LEU A 1 68 ? 10.224  8.495   -0.126  1.00 0.00 ? 68  LEU A HA   8  
ATOM 11327 H HB2  . LEU A 1 68 ? 7.634   7.190   0.697   1.00 0.00 ? 68  LEU A HB2  8  
ATOM 11328 H HB3  . LEU A 1 68 ? 9.087   7.140   1.675   1.00 0.00 ? 68  LEU A HB3  8  
ATOM 11329 H HG   . LEU A 1 68 ? 7.541   9.613   0.905   1.00 0.00 ? 68  LEU A HG   8  
ATOM 11330 H HD11 . LEU A 1 68 ? 7.608   9.522   3.609   1.00 0.00 ? 68  LEU A HD11 8  
ATOM 11331 H HD12 . LEU A 1 68 ? 7.540   7.802   3.222   1.00 0.00 ? 68  LEU A HD12 8  
ATOM 11332 H HD13 . LEU A 1 68 ? 6.285   8.893   2.628   1.00 0.00 ? 68  LEU A HD13 8  
ATOM 11333 H HD21 . LEU A 1 68 ? 9.147   10.624  2.650   1.00 0.00 ? 68  LEU A HD21 8  
ATOM 11334 H HD22 . LEU A 1 68 ? 9.750   10.351  1.015   1.00 0.00 ? 68  LEU A HD22 8  
ATOM 11335 H HD23 . LEU A 1 68 ? 10.165  9.224   2.309   1.00 0.00 ? 68  LEU A HD23 8  
ATOM 11336 N N    . SER A 1 69 ? 10.989  6.042   0.044   1.00 0.00 ? 69  SER A N    8  
ATOM 11337 C CA   . SER A 1 69 ? 11.600  4.734   -0.162  1.00 0.00 ? 69  SER A CA   8  
ATOM 11338 C C    . SER A 1 69 ? 10.715  3.645   0.433   1.00 0.00 ? 69  SER A C    8  
ATOM 11339 O O    . SER A 1 69 ? 10.043  3.873   1.443   1.00 0.00 ? 69  SER A O    8  
ATOM 11340 C CB   . SER A 1 69 ? 12.984  4.681   0.493   1.00 0.00 ? 69  SER A CB   8  
ATOM 11341 O OG   . SER A 1 69 ? 13.778  5.790   0.107   1.00 0.00 ? 69  SER A OG   8  
ATOM 11342 H H    . SER A 1 69 ? 11.351  6.632   0.739   1.00 0.00 ? 69  SER A H    8  
ATOM 11343 H HA   . SER A 1 69 ? 11.701  4.570   -1.224  1.00 0.00 ? 69  SER A HA   8  
ATOM 11344 H HB2  . SER A 1 69 ? 12.871  4.692   1.568   1.00 0.00 ? 69  SER A HB2  8  
ATOM 11345 H HB3  . SER A 1 69 ? 13.485  3.772   0.194   1.00 0.00 ? 69  SER A HB3  8  
ATOM 11346 H HG   . SER A 1 69 ? 13.915  5.770   -0.843  1.00 0.00 ? 69  SER A HG   8  
ATOM 11347 N N    . GLN A 1 70 ? 10.717  2.466   -0.192  1.00 0.00 ? 70  GLN A N    8  
ATOM 11348 C CA   . GLN A 1 70 ? 9.914   1.336   0.283   1.00 0.00 ? 70  GLN A CA   8  
ATOM 11349 C C    . GLN A 1 70 ? 9.981   1.204   1.809   1.00 0.00 ? 70  GLN A C    8  
ATOM 11350 O O    . GLN A 1 70 ? 8.968   0.939   2.456   1.00 0.00 ? 70  GLN A O    8  
ATOM 11351 C CB   . GLN A 1 70 ? 10.386  0.035   -0.370  1.00 0.00 ? 70  GLN A CB   8  
ATOM 11352 C CG   . GLN A 1 70 ? 9.471   -1.148  -0.100  1.00 0.00 ? 70  GLN A CG   8  
ATOM 11353 C CD   . GLN A 1 70 ? 8.722   -1.600  -1.336  1.00 0.00 ? 70  GLN A CD   8  
ATOM 11354 O OE1  . GLN A 1 70 ? 9.064   -2.606  -1.943  1.00 0.00 ? 70  GLN A OE1  8  
ATOM 11355 N NE2  . GLN A 1 70 ? 7.687   -0.855  -1.709  1.00 0.00 ? 70  GLN A NE2  8  
ATOM 11356 H H    . GLN A 1 70 ? 11.273  2.351   -0.993  1.00 0.00 ? 70  GLN A H    8  
ATOM 11357 H HA   . GLN A 1 70 ? 8.888   1.520   -0.003  1.00 0.00 ? 70  GLN A HA   8  
ATOM 11358 H HB2  . GLN A 1 70 ? 10.445  0.181   -1.438  1.00 0.00 ? 70  GLN A HB2  8  
ATOM 11359 H HB3  . GLN A 1 70 ? 11.369  -0.206  0.005   1.00 0.00 ? 70  GLN A HB3  8  
ATOM 11360 H HG2  . GLN A 1 70 ? 10.068  -1.968  0.264   1.00 0.00 ? 70  GLN A HG2  8  
ATOM 11361 H HG3  . GLN A 1 70 ? 8.751   -0.870  0.653   1.00 0.00 ? 70  GLN A HG3  8  
ATOM 11362 H HE21 . GLN A 1 70 ? 7.472   -0.068  -1.174  1.00 0.00 ? 70  GLN A HE21 8  
ATOM 11363 H HE22 . GLN A 1 70 ? 7.179   -1.129  -2.502  1.00 0.00 ? 70  GLN A HE22 8  
ATOM 11364 N N    . GLU A 1 71 ? 11.179  1.393   2.374   1.00 0.00 ? 71  GLU A N    8  
ATOM 11365 C CA   . GLU A 1 71 ? 11.374  1.299   3.822   1.00 0.00 ? 71  GLU A CA   8  
ATOM 11366 C C    . GLU A 1 71 ? 10.390  2.197   4.575   1.00 0.00 ? 71  GLU A C    8  
ATOM 11367 O O    . GLU A 1 71 ? 9.633   1.719   5.418   1.00 0.00 ? 71  GLU A O    8  
ATOM 11368 C CB   . GLU A 1 71 ? 12.807  1.687   4.199   1.00 0.00 ? 71  GLU A CB   8  
ATOM 11369 C CG   . GLU A 1 71 ? 13.848  0.634   3.851   1.00 0.00 ? 71  GLU A CG   8  
ATOM 11370 C CD   . GLU A 1 71 ? 14.907  0.482   4.927   1.00 0.00 ? 71  GLU A CD   8  
ATOM 11371 O OE1  . GLU A 1 71 ? 15.811  1.341   4.998   1.00 0.00 ? 71  GLU A OE1  8  
ATOM 11372 O OE2  . GLU A 1 71 ? 14.832  -0.498  5.698   1.00 0.00 ? 71  GLU A OE2  8  
ATOM 11373 H H    . GLU A 1 71 ? 11.948  1.603   1.804   1.00 0.00 ? 71  GLU A H    8  
ATOM 11374 H HA   . GLU A 1 71 ? 11.198  0.272   4.111   1.00 0.00 ? 71  GLU A HA   8  
ATOM 11375 H HB2  . GLU A 1 71 ? 13.066  2.599   3.684   1.00 0.00 ? 71  GLU A HB2  8  
ATOM 11376 H HB3  . GLU A 1 71 ? 12.848  1.863   5.264   1.00 0.00 ? 71  GLU A HB3  8  
ATOM 11377 H HG2  . GLU A 1 71 ? 13.353  -0.315  3.716   1.00 0.00 ? 71  GLU A HG2  8  
ATOM 11378 H HG3  . GLU A 1 71 ? 14.333  0.920   2.929   1.00 0.00 ? 71  GLU A HG3  8  
ATOM 11379 N N    . ARG A 1 72 ? 10.404  3.497   4.265   1.00 0.00 ? 72  ARG A N    8  
ATOM 11380 C CA   . ARG A 1 72 ? 9.506   4.449   4.923   1.00 0.00 ? 72  ARG A CA   8  
ATOM 11381 C C    . ARG A 1 72 ? 8.046   4.080   4.675   1.00 0.00 ? 72  ARG A C    8  
ATOM 11382 O O    . ARG A 1 72 ? 7.219   4.170   5.577   1.00 0.00 ? 72  ARG A O    8  
ATOM 11383 C CB   . ARG A 1 72 ? 9.760   5.882   4.434   1.00 0.00 ? 72  ARG A CB   8  
ATOM 11384 C CG   . ARG A 1 72 ? 11.230  6.278   4.374   1.00 0.00 ? 72  ARG A CG   8  
ATOM 11385 C CD   . ARG A 1 72 ? 11.976  5.906   5.650   1.00 0.00 ? 72  ARG A CD   8  
ATOM 11386 N NE   . ARG A 1 72 ? 13.418  6.099   5.511   1.00 0.00 ? 72  ARG A NE   8  
ATOM 11387 C CZ   . ARG A 1 72 ? 14.335  5.495   6.272   1.00 0.00 ? 72  ARG A CZ   8  
ATOM 11388 N NH1  . ARG A 1 72 ? 13.971  4.671   7.251   1.00 0.00 ? 72  ARG A NH1  8  
ATOM 11389 N NH2  . ARG A 1 72 ? 15.625  5.722   6.055   1.00 0.00 ? 72  ARG A NH2  8  
ATOM 11390 H H    . ARG A 1 72 ? 11.028  3.823   3.580   1.00 0.00 ? 72  ARG A H    8  
ATOM 11391 H HA   . ARG A 1 72 ? 9.698   4.401   5.985   1.00 0.00 ? 72  ARG A HA   8  
ATOM 11392 H HB2  . ARG A 1 72 ? 9.346   5.987   3.442   1.00 0.00 ? 72  ARG A HB2  8  
ATOM 11393 H HB3  . ARG A 1 72 ? 9.253   6.569   5.097   1.00 0.00 ? 72  ARG A HB3  8  
ATOM 11394 H HG2  . ARG A 1 72 ? 11.693  5.773   3.540   1.00 0.00 ? 72  ARG A HG2  8  
ATOM 11395 H HG3  . ARG A 1 72 ? 11.296  7.347   4.228   1.00 0.00 ? 72  ARG A HG3  8  
ATOM 11396 H HD2  . ARG A 1 72 ? 11.616  6.525   6.460   1.00 0.00 ? 72  ARG A HD2  8  
ATOM 11397 H HD3  . ARG A 1 72 ? 11.781  4.869   5.877   1.00 0.00 ? 72  ARG A HD3  8  
ATOM 11398 H HE   . ARG A 1 72 ? 13.722  6.708   4.806   1.00 0.00 ? 72  ARG A HE   8  
ATOM 11399 H HH11 . ARG A 1 72 ? 13.003  4.496   7.427   1.00 0.00 ? 72  ARG A HH11 8  
ATOM 11400 H HH12 . ARG A 1 72 ? 14.668  4.222   7.812   1.00 0.00 ? 72  ARG A HH12 8  
ATOM 11401 H HH21 . ARG A 1 72 ? 15.907  6.345   5.324   1.00 0.00 ? 72  ARG A HH21 8  
ATOM 11402 H HH22 . ARG A 1 72 ? 16.316  5.271   6.619   1.00 0.00 ? 72  ARG A HH22 8  
ATOM 11403 N N    . ALA A 1 73 ? 7.738   3.667   3.445   1.00 0.00 ? 73  ALA A N    8  
ATOM 11404 C CA   . ALA A 1 73 ? 6.374   3.290   3.080   1.00 0.00 ? 73  ALA A CA   8  
ATOM 11405 C C    . ALA A 1 73 ? 5.851   2.150   3.951   1.00 0.00 ? 73  ALA A C    8  
ATOM 11406 O O    . ALA A 1 73 ? 4.856   2.311   4.659   1.00 0.00 ? 73  ALA A O    8  
ATOM 11407 C CB   . ALA A 1 73 ? 6.307   2.907   1.610   1.00 0.00 ? 73  ALA A CB   8  
ATOM 11408 H H    . ALA A 1 73 ? 8.445   3.619   2.766   1.00 0.00 ? 73  ALA A H    8  
ATOM 11409 H HA   . ALA A 1 73 ? 5.746   4.155   3.228   1.00 0.00 ? 73  ALA A HA   8  
ATOM 11410 H HB1  . ALA A 1 73 ? 7.259   2.503   1.300   1.00 0.00 ? 73  ALA A HB1  8  
ATOM 11411 H HB2  . ALA A 1 73 ? 6.078   3.782   1.019   1.00 0.00 ? 73  ALA A HB2  8  
ATOM 11412 H HB3  . ALA A 1 73 ? 5.536   2.164   1.467   1.00 0.00 ? 73  ALA A HB3  8  
ATOM 11413 N N    . ALA A 1 74 ? 6.526   1.000   3.897   1.00 0.00 ? 74  ALA A N    8  
ATOM 11414 C CA   . ALA A 1 74 ? 6.122   -0.164  4.687   1.00 0.00 ? 74  ALA A CA   8  
ATOM 11415 C C    . ALA A 1 74 ? 6.227   0.117   6.186   1.00 0.00 ? 74  ALA A C    8  
ATOM 11416 O O    . ALA A 1 74 ? 5.397   -0.343  6.970   1.00 0.00 ? 74  ALA A O    8  
ATOM 11417 C CB   . ALA A 1 74 ? 6.962   -1.380  4.318   1.00 0.00 ? 74  ALA A CB   8  
ATOM 11418 H H    . ALA A 1 74 ? 7.316   0.933   3.315   1.00 0.00 ? 74  ALA A H    8  
ATOM 11419 H HA   . ALA A 1 74 ? 5.090   -0.385  4.447   1.00 0.00 ? 74  ALA A HA   8  
ATOM 11420 H HB1  . ALA A 1 74 ? 7.830   -1.425  4.960   1.00 0.00 ? 74  ALA A HB1  8  
ATOM 11421 H HB2  . ALA A 1 74 ? 7.279   -1.301  3.290   1.00 0.00 ? 74  ALA A HB2  8  
ATOM 11422 H HB3  . ALA A 1 74 ? 6.373   -2.277  4.446   1.00 0.00 ? 74  ALA A HB3  8  
ATOM 11423 N N    . GLU A 1 75 ? 7.252   0.873   6.575   1.00 0.00 ? 75  GLU A N    8  
ATOM 11424 C CA   . GLU A 1 75 ? 7.464   1.215   7.979   1.00 0.00 ? 75  GLU A CA   8  
ATOM 11425 C C    . GLU A 1 75 ? 6.384   2.171   8.491   1.00 0.00 ? 75  GLU A C    8  
ATOM 11426 O O    . GLU A 1 75 ? 5.967   2.084   9.646   1.00 0.00 ? 75  GLU A O    8  
ATOM 11427 C CB   . GLU A 1 75 ? 8.848   1.839   8.169   1.00 0.00 ? 75  GLU A CB   8  
ATOM 11428 C CG   . GLU A 1 75 ? 9.231   2.032   9.627   1.00 0.00 ? 75  GLU A CG   8  
ATOM 11429 C CD   . GLU A 1 75 ? 10.489  1.277   10.009  1.00 0.00 ? 75  GLU A CD   8  
ATOM 11430 O OE1  . GLU A 1 75 ? 10.475  0.029   9.950   1.00 0.00 ? 75  GLU A OE1  8  
ATOM 11431 O OE2  . GLU A 1 75 ? 11.489  1.934   10.369  1.00 0.00 ? 75  GLU A OE2  8  
ATOM 11432 H H    . GLU A 1 75 ? 7.881   1.209   5.901   1.00 0.00 ? 75  GLU A H    8  
ATOM 11433 H HA   . GLU A 1 75 ? 7.413   0.298   8.549   1.00 0.00 ? 75  GLU A HA   8  
ATOM 11434 H HB2  . GLU A 1 75 ? 9.585   1.198   7.707   1.00 0.00 ? 75  GLU A HB2  8  
ATOM 11435 H HB3  . GLU A 1 75 ? 8.866   2.802   7.683   1.00 0.00 ? 75  GLU A HB3  8  
ATOM 11436 H HG2  . GLU A 1 75 ? 9.392   3.084   9.806   1.00 0.00 ? 75  GLU A HG2  8  
ATOM 11437 H HG3  . GLU A 1 75 ? 8.418   1.683   10.248  1.00 0.00 ? 75  GLU A HG3  8  
ATOM 11438 N N    . LEU A 1 76 ? 5.935   3.083   7.628   1.00 0.00 ? 76  LEU A N    8  
ATOM 11439 C CA   . LEU A 1 76 ? 4.904   4.051   8.001   1.00 0.00 ? 76  LEU A CA   8  
ATOM 11440 C C    . LEU A 1 76 ? 3.531   3.384   8.098   1.00 0.00 ? 76  LEU A C    8  
ATOM 11441 O O    . LEU A 1 76 ? 2.779   3.635   9.040   1.00 0.00 ? 76  LEU A O    8  
ATOM 11442 C CB   . LEU A 1 76 ? 4.856   5.201   6.989   1.00 0.00 ? 76  LEU A CB   8  
ATOM 11443 C CG   . LEU A 1 76 ? 5.915   6.291   7.188   1.00 0.00 ? 76  LEU A CG   8  
ATOM 11444 C CD1  . LEU A 1 76 ? 6.120   7.079   5.900   1.00 0.00 ? 76  LEU A CD1  8  
ATOM 11445 C CD2  . LEU A 1 76 ? 5.519   7.219   8.329   1.00 0.00 ? 76  LEU A CD2  8  
ATOM 11446 H H    . LEU A 1 76 ? 6.306   3.105   6.719   1.00 0.00 ? 76  LEU A H    8  
ATOM 11447 H HA   . LEU A 1 76 ? 5.165   4.450   8.971   1.00 0.00 ? 76  LEU A HA   8  
ATOM 11448 H HB2  . LEU A 1 76 ? 4.978   4.786   6.000   1.00 0.00 ? 76  LEU A HB2  8  
ATOM 11449 H HB3  . LEU A 1 76 ? 3.883   5.662   7.047   1.00 0.00 ? 76  LEU A HB3  8  
ATOM 11450 H HG   . LEU A 1 76 ? 6.856   5.826   7.446   1.00 0.00 ? 76  LEU A HG   8  
ATOM 11451 H HD11 . LEU A 1 76 ? 5.350   7.831   5.810   1.00 0.00 ? 76  LEU A HD11 8  
ATOM 11452 H HD12 . LEU A 1 76 ? 6.069   6.408   5.055   1.00 0.00 ? 76  LEU A HD12 8  
ATOM 11453 H HD13 . LEU A 1 76 ? 7.089   7.556   5.921   1.00 0.00 ? 76  LEU A HD13 8  
ATOM 11454 H HD21 . LEU A 1 76 ? 4.841   6.703   8.994   1.00 0.00 ? 76  LEU A HD21 8  
ATOM 11455 H HD22 . LEU A 1 76 ? 5.032   8.096   7.929   1.00 0.00 ? 76  LEU A HD22 8  
ATOM 11456 H HD23 . LEU A 1 76 ? 6.402   7.515   8.875   1.00 0.00 ? 76  LEU A HD23 8  
ATOM 11457 N N    . MET A 1 77 ? 3.210   2.538   7.120   1.00 0.00 ? 77  MET A N    8  
ATOM 11458 C CA   . MET A 1 77 ? 1.922   1.839   7.096   1.00 0.00 ? 77  MET A CA   8  
ATOM 11459 C C    . MET A 1 77 ? 1.733   0.974   8.341   1.00 0.00 ? 77  MET A C    8  
ATOM 11460 O O    . MET A 1 77 ? 0.686   1.029   8.984   1.00 0.00 ? 77  MET A O    8  
ATOM 11461 C CB   . MET A 1 77 ? 1.801   0.972   5.841   1.00 0.00 ? 77  MET A CB   8  
ATOM 11462 C CG   . MET A 1 77 ? 1.587   1.764   4.560   1.00 0.00 ? 77  MET A CG   8  
ATOM 11463 S SD   . MET A 1 77 ? 2.508   1.093   3.164   1.00 0.00 ? 77  MET A SD   8  
ATOM 11464 C CE   . MET A 1 77 ? 1.819   -0.557  3.071   1.00 0.00 ? 77  MET A CE   8  
ATOM 11465 H H    . MET A 1 77 ? 3.851   2.382   6.395   1.00 0.00 ? 77  MET A H    8  
ATOM 11466 H HA   . MET A 1 77 ? 1.145   2.590   7.081   1.00 0.00 ? 77  MET A HA   8  
ATOM 11467 H HB2  . MET A 1 77 ? 2.703   0.389   5.731   1.00 0.00 ? 77  MET A HB2  8  
ATOM 11468 H HB3  . MET A 1 77 ? 0.963   0.302   5.965   1.00 0.00 ? 77  MET A HB3  8  
ATOM 11469 H HG2  . MET A 1 77 ? 0.535   1.748   4.317   1.00 0.00 ? 77  MET A HG2  8  
ATOM 11470 H HG3  . MET A 1 77 ? 1.901   2.785   4.724   1.00 0.00 ? 77  MET A HG3  8  
ATOM 11471 H HE1  . MET A 1 77 ? 0.916   -0.602  3.661   1.00 0.00 ? 77  MET A HE1  8  
ATOM 11472 H HE2  . MET A 1 77 ? 2.536   -1.267  3.453   1.00 0.00 ? 77  MET A HE2  8  
ATOM 11473 H HE3  . MET A 1 77 ? 1.589   -0.793  2.043   1.00 0.00 ? 77  MET A HE3  8  
ATOM 11474 N N    . THR A 1 78 ? 2.749   0.181   8.679   1.00 0.00 ? 78  THR A N    8  
ATOM 11475 C CA   . THR A 1 78 ? 2.680   -0.683  9.856   1.00 0.00 ? 78  THR A CA   8  
ATOM 11476 C C    . THR A 1 78 ? 2.585   0.154   11.134  1.00 0.00 ? 78  THR A C    8  
ATOM 11477 O O    . THR A 1 78 ? 1.934   -0.247  12.100  1.00 0.00 ? 78  THR A O    8  
ATOM 11478 C CB   . THR A 1 78 ? 3.898   -1.616  9.914   1.00 0.00 ? 78  THR A CB   8  
ATOM 11479 O OG1  . THR A 1 78 ? 3.849   -2.445  11.064  1.00 0.00 ? 78  THR A OG1  8  
ATOM 11480 C CG2  . THR A 1 78 ? 5.227   -0.887  9.926   1.00 0.00 ? 78  THR A CG2  8  
ATOM 11481 H H    . THR A 1 78 ? 3.562   0.180   8.129   1.00 0.00 ? 78  THR A H    8  
ATOM 11482 H HA   . THR A 1 78 ? 1.785   -1.283  9.771   1.00 0.00 ? 78  THR A HA   8  
ATOM 11483 H HB   . THR A 1 78 ? 3.881   -2.252  9.043   1.00 0.00 ? 78  THR A HB   8  
ATOM 11484 H HG1  . THR A 1 78 ? 4.055   -1.926  11.845  1.00 0.00 ? 78  THR A HG1  8  
ATOM 11485 H HG21 . THR A 1 78 ? 5.925   -1.400  9.281   1.00 0.00 ? 78  THR A HG21 8  
ATOM 11486 H HG22 . THR A 1 78 ? 5.618   -0.863  10.932  1.00 0.00 ? 78  THR A HG22 8  
ATOM 11487 H HG23 . THR A 1 78 ? 5.087   0.123   9.571   1.00 0.00 ? 78  THR A HG23 8  
ATOM 11488 N N    . ARG A 1 79 ? 3.233   1.320   11.127  1.00 0.00 ? 79  ARG A N    8  
ATOM 11489 C CA   . ARG A 1 79 ? 3.222   2.217   12.281  1.00 0.00 ? 79  ARG A CA   8  
ATOM 11490 C C    . ARG A 1 79 ? 1.995   3.142   12.276  1.00 0.00 ? 79  ARG A C    8  
ATOM 11491 O O    . ARG A 1 79 ? 2.125   4.358   12.436  1.00 0.00 ? 79  ARG A O    8  
ATOM 11492 C CB   . ARG A 1 79 ? 4.507   3.054   12.309  1.00 0.00 ? 79  ARG A CB   8  
ATOM 11493 C CG   . ARG A 1 79 ? 5.634   2.418   13.105  1.00 0.00 ? 79  ARG A CG   8  
ATOM 11494 C CD   . ARG A 1 79 ? 5.990   3.250   14.329  1.00 0.00 ? 79  ARG A CD   8  
ATOM 11495 N NE   . ARG A 1 79 ? 7.426   3.234   14.610  1.00 0.00 ? 79  ARG A NE   8  
ATOM 11496 C CZ   . ARG A 1 79 ? 7.988   3.815   15.674  1.00 0.00 ? 79  ARG A CZ   8  
ATOM 11497 N NH1  . ARG A 1 79 ? 7.243   4.465   16.564  1.00 0.00 ? 79  ARG A NH1  8  
ATOM 11498 N NH2  . ARG A 1 79 ? 9.304   3.748   15.847  1.00 0.00 ? 79  ARG A NH2  8  
ATOM 11499 H H    . ARG A 1 79 ? 3.733   1.582   10.325  1.00 0.00 ? 79  ARG A H    8  
ATOM 11500 H HA   . ARG A 1 79 ? 3.190   1.604   13.170  1.00 0.00 ? 79  ARG A HA   8  
ATOM 11501 H HB2  . ARG A 1 79 ? 4.849   3.203   11.295  1.00 0.00 ? 79  ARG A HB2  8  
ATOM 11502 H HB3  . ARG A 1 79 ? 4.285   4.015   12.748  1.00 0.00 ? 79  ARG A HB3  8  
ATOM 11503 H HG2  . ARG A 1 79 ? 5.324   1.435   13.428  1.00 0.00 ? 79  ARG A HG2  8  
ATOM 11504 H HG3  . ARG A 1 79 ? 6.504   2.333   12.471  1.00 0.00 ? 79  ARG A HG3  8  
ATOM 11505 H HD2  . ARG A 1 79 ? 5.679   4.270   14.157  1.00 0.00 ? 79  ARG A HD2  8  
ATOM 11506 H HD3  . ARG A 1 79 ? 5.461   2.852   15.183  1.00 0.00 ? 79  ARG A HD3  8  
ATOM 11507 H HE   . ARG A 1 79 ? 8.004   2.765   13.972  1.00 0.00 ? 79  ARG A HE   8  
ATOM 11508 H HH11 . ARG A 1 79 ? 6.253   4.524   16.443  1.00 0.00 ? 79  ARG A HH11 8  
ATOM 11509 H HH12 . ARG A 1 79 ? 7.674   4.894   17.359  1.00 0.00 ? 79  ARG A HH12 8  
ATOM 11510 H HH21 . ARG A 1 79 ? 9.873   3.264   15.181  1.00 0.00 ? 79  ARG A HH21 8  
ATOM 11511 H HH22 . ARG A 1 79 ? 9.728   4.180   16.644  1.00 0.00 ? 79  ARG A HH22 8  
ATOM 11512 N N    . THR A 1 80 ? 0.801   2.566   12.103  1.00 0.00 ? 80  THR A N    8  
ATOM 11513 C CA   . THR A 1 80 ? -0.437  3.353   12.094  1.00 0.00 ? 80  THR A CA   8  
ATOM 11514 C C    . THR A 1 80 ? -1.194  3.192   13.412  1.00 0.00 ? 80  THR A C    8  
ATOM 11515 O O    . THR A 1 80 ? -0.828  2.365   14.250  1.00 0.00 ? 80  THR A O    8  
ATOM 11516 C CB   . THR A 1 80 ? -1.340  2.928   10.933  1.00 0.00 ? 80  THR A CB   8  
ATOM 11517 O OG1  . THR A 1 80 ? -1.371  1.516   10.808  1.00 0.00 ? 80  THR A OG1  8  
ATOM 11518 C CG2  . THR A 1 80 ? -0.909  3.502   9.601   1.00 0.00 ? 80  THR A CG2  8  
ATOM 11519 H H    . THR A 1 80 ? 0.748   1.595   11.986  1.00 0.00 ? 80  THR A H    8  
ATOM 11520 H HA   . THR A 1 80 ? -0.169  4.393   11.969  1.00 0.00 ? 80  THR A HA   8  
ATOM 11521 H HB   . THR A 1 80 ? -2.346  3.272   11.130  1.00 0.00 ? 80  THR A HB   8  
ATOM 11522 H HG1  . THR A 1 80 ? -1.887  1.143   11.527  1.00 0.00 ? 80  THR A HG1  8  
ATOM 11523 H HG21 . THR A 1 80 ? 0.157   3.671   9.611   1.00 0.00 ? 80  THR A HG21 8  
ATOM 11524 H HG22 . THR A 1 80 ? -1.421  4.439   9.432   1.00 0.00 ? 80  THR A HG22 8  
ATOM 11525 H HG23 . THR A 1 80 ? -1.158  2.809   8.812   1.00 0.00 ? 80  THR A HG23 8  
ATOM 11526 N N    . SER A 1 81 ? -2.261  3.977   13.584  1.00 0.00 ? 81  SER A N    8  
ATOM 11527 C CA   . SER A 1 81 ? -3.076  3.909   14.795  1.00 0.00 ? 81  SER A CA   8  
ATOM 11528 C C    . SER A 1 81 ? -4.041  2.721   14.726  1.00 0.00 ? 81  SER A C    8  
ATOM 11529 O O    . SER A 1 81 ? -3.931  1.876   13.834  1.00 0.00 ? 81  SER A O    8  
ATOM 11530 C CB   . SER A 1 81 ? -3.850  5.219   14.989  1.00 0.00 ? 81  SER A CB   8  
ATOM 11531 O OG   . SER A 1 81 ? -4.241  5.385   16.342  1.00 0.00 ? 81  SER A OG   8  
ATOM 11532 H H    . SER A 1 81 ? -2.509  4.609   12.877  1.00 0.00 ? 81  SER A H    8  
ATOM 11533 H HA   . SER A 1 81 ? -2.409  3.766   15.634  1.00 0.00 ? 81  SER A HA   8  
ATOM 11534 H HB2  . SER A 1 81 ? -3.223  6.051   14.705  1.00 0.00 ? 81  SER A HB2  8  
ATOM 11535 H HB3  . SER A 1 81 ? -4.735  5.208   14.369  1.00 0.00 ? 81  SER A HB3  8  
ATOM 11536 H HG   . SER A 1 81 ? -3.471  5.597   16.876  1.00 0.00 ? 81  SER A HG   8  
ATOM 11537 N N    . SER A 1 82 ? -4.983  2.661   15.667  1.00 0.00 ? 82  SER A N    8  
ATOM 11538 C CA   . SER A 1 82 ? -5.965  1.576   15.707  1.00 0.00 ? 82  SER A CA   8  
ATOM 11539 C C    . SER A 1 82 ? -6.688  1.431   14.363  1.00 0.00 ? 82  SER A C    8  
ATOM 11540 O O    . SER A 1 82 ? -6.934  0.316   13.900  1.00 0.00 ? 82  SER A O    8  
ATOM 11541 C CB   . SER A 1 82 ? -6.984  1.823   16.824  1.00 0.00 ? 82  SER A CB   8  
ATOM 11542 O OG   . SER A 1 82 ? -7.669  3.049   16.631  1.00 0.00 ? 82  SER A OG   8  
ATOM 11543 H H    . SER A 1 82 ? -5.020  3.364   16.350  1.00 0.00 ? 82  SER A H    8  
ATOM 11544 H HA   . SER A 1 82 ? -5.434  0.658   15.916  1.00 0.00 ? 82  SER A HA   8  
ATOM 11545 H HB2  . SER A 1 82 ? -7.706  1.020   16.833  1.00 0.00 ? 82  SER A HB2  8  
ATOM 11546 H HB3  . SER A 1 82 ? -6.471  1.856   17.774  1.00 0.00 ? 82  SER A HB3  8  
ATOM 11547 H HG   . SER A 1 82 ? -8.533  2.878   16.253  1.00 0.00 ? 82  SER A HG   8  
ATOM 11548 N N    . VAL A 1 83 ? -7.025  2.566   13.746  1.00 0.00 ? 83  VAL A N    8  
ATOM 11549 C CA   . VAL A 1 83 ? -7.718  2.568   12.460  1.00 0.00 ? 83  VAL A CA   8  
ATOM 11550 C C    . VAL A 1 83 ? -6.735  2.756   11.305  1.00 0.00 ? 83  VAL A C    8  
ATOM 11551 O O    . VAL A 1 83 ? -5.753  3.491   11.425  1.00 0.00 ? 83  VAL A O    8  
ATOM 11552 C CB   . VAL A 1 83 ? -8.793  3.677   12.400  1.00 0.00 ? 83  VAL A CB   8  
ATOM 11553 C CG1  . VAL A 1 83 ? -9.646  3.538   11.146  1.00 0.00 ? 83  VAL A CG1  8  
ATOM 11554 C CG2  . VAL A 1 83 ? -9.663  3.645   13.648  1.00 0.00 ? 83  VAL A CG2  8  
ATOM 11555 H H    . VAL A 1 83 ? -6.803  3.423   14.169  1.00 0.00 ? 83  VAL A H    8  
ATOM 11556 H HA   . VAL A 1 83 ? -8.210  1.613   12.347  1.00 0.00 ? 83  VAL A HA   8  
ATOM 11557 H HB   . VAL A 1 83 ? -8.293  4.634   12.362  1.00 0.00 ? 83  VAL A HB   8  
ATOM 11558 H HG11 . VAL A 1 83 ? -10.179 2.600   11.175  1.00 0.00 ? 83  VAL A HG11 8  
ATOM 11559 H HG12 . VAL A 1 83 ? -9.011  3.565   10.272  1.00 0.00 ? 83  VAL A HG12 8  
ATOM 11560 H HG13 . VAL A 1 83 ? -10.353 4.353   11.100  1.00 0.00 ? 83  VAL A HG13 8  
ATOM 11561 H HG21 . VAL A 1 83 ? -10.671 3.937   13.391  1.00 0.00 ? 83  VAL A HG21 8  
ATOM 11562 H HG22 . VAL A 1 83 ? -9.267  4.331   14.381  1.00 0.00 ? 83  VAL A HG22 8  
ATOM 11563 H HG23 . VAL A 1 83 ? -9.670  2.645   14.057  1.00 0.00 ? 83  VAL A HG23 8  
ATOM 11564 N N    . VAL A 1 84 ? -7.007  2.080   10.190  1.00 0.00 ? 84  VAL A N    8  
ATOM 11565 C CA   . VAL A 1 84 ? -6.154  2.159   9.006   1.00 0.00 ? 84  VAL A CA   8  
ATOM 11566 C C    . VAL A 1 84 ? -6.929  2.697   7.803   1.00 0.00 ? 84  VAL A C    8  
ATOM 11567 O O    . VAL A 1 84 ? -8.137  2.482   7.688   1.00 0.00 ? 84  VAL A O    8  
ATOM 11568 C CB   . VAL A 1 84 ? -5.562  0.778   8.645   1.00 0.00 ? 84  VAL A CB   8  
ATOM 11569 C CG1  . VAL A 1 84 ? -4.543  0.904   7.521   1.00 0.00 ? 84  VAL A CG1  8  
ATOM 11570 C CG2  . VAL A 1 84 ? -4.931  0.121   9.866   1.00 0.00 ? 84  VAL A CG2  8  
ATOM 11571 H H    . VAL A 1 84 ? -7.805  1.508   10.162  1.00 0.00 ? 84  VAL A H    8  
ATOM 11572 H HA   . VAL A 1 84 ? -5.338  2.831   9.227   1.00 0.00 ? 84  VAL A HA   8  
ATOM 11573 H HB   . VAL A 1 84 ? -6.366  0.143   8.300   1.00 0.00 ? 84  VAL A HB   8  
ATOM 11574 H HG11 . VAL A 1 84 ? -4.021  -0.034  7.404   1.00 0.00 ? 84  VAL A HG11 8  
ATOM 11575 H HG12 . VAL A 1 84 ? -3.835  1.682   7.762   1.00 0.00 ? 84  VAL A HG12 8  
ATOM 11576 H HG13 . VAL A 1 84 ? -5.051  1.152   6.600   1.00 0.00 ? 84  VAL A HG13 8  
ATOM 11577 H HG21 . VAL A 1 84 ? -5.309  0.587   10.764  1.00 0.00 ? 84  VAL A HG21 8  
ATOM 11578 H HG22 . VAL A 1 84 ? -3.859  0.239   9.823   1.00 0.00 ? 84  VAL A HG22 8  
ATOM 11579 H HG23 . VAL A 1 84 ? -5.178  -0.930  9.876   1.00 0.00 ? 84  VAL A HG23 8  
ATOM 11580 N N    . THR A 1 85 ? -6.223  3.397   6.913   1.00 0.00 ? 85  THR A N    8  
ATOM 11581 C CA   . THR A 1 85 ? -6.832  3.973   5.715   1.00 0.00 ? 85  THR A CA   8  
ATOM 11582 C C    . THR A 1 85 ? -5.869  3.901   4.525   1.00 0.00 ? 85  THR A C    8  
ATOM 11583 O O    . THR A 1 85 ? -5.135  4.853   4.247   1.00 0.00 ? 85  THR A O    8  
ATOM 11584 C CB   . THR A 1 85 ? -7.247  5.427   5.980   1.00 0.00 ? 85  THR A CB   8  
ATOM 11585 O OG1  . THR A 1 85 ? -8.087  5.513   7.118   1.00 0.00 ? 85  THR A OG1  8  
ATOM 11586 C CG2  . THR A 1 85 ? -7.986  6.063   4.822   1.00 0.00 ? 85  THR A CG2  8  
ATOM 11587 H H    . THR A 1 85 ? -5.265  3.530   7.067   1.00 0.00 ? 85  THR A H    8  
ATOM 11588 H HA   . THR A 1 85 ? -7.714  3.394   5.482   1.00 0.00 ? 85  THR A HA   8  
ATOM 11589 H HB   . THR A 1 85 ? -6.359  6.015   6.169   1.00 0.00 ? 85  THR A HB   8  
ATOM 11590 H HG1  . THR A 1 85 ? -7.938  6.350   7.565   1.00 0.00 ? 85  THR A HG1  8  
ATOM 11591 H HG21 . THR A 1 85 ? -7.952  7.138   4.921   1.00 0.00 ? 85  THR A HG21 8  
ATOM 11592 H HG22 . THR A 1 85 ? -9.014  5.733   4.826   1.00 0.00 ? 85  THR A HG22 8  
ATOM 11593 H HG23 . THR A 1 85 ? -7.518  5.773   3.893   1.00 0.00 ? 85  THR A HG23 8  
ATOM 11594 N N    . LEU A 1 86 ? -5.874  2.762   3.829   1.00 0.00 ? 86  LEU A N    8  
ATOM 11595 C CA   . LEU A 1 86 ? -5.001  2.558   2.670   1.00 0.00 ? 86  LEU A CA   8  
ATOM 11596 C C    . LEU A 1 86 ? -5.746  2.813   1.360   1.00 0.00 ? 86  LEU A C    8  
ATOM 11597 O O    . LEU A 1 86 ? -6.908  2.431   1.213   1.00 0.00 ? 86  LEU A O    8  
ATOM 11598 C CB   . LEU A 1 86 ? -4.448  1.129   2.663   1.00 0.00 ? 86  LEU A CB   8  
ATOM 11599 C CG   . LEU A 1 86 ? -3.602  0.742   3.878   1.00 0.00 ? 86  LEU A CG   8  
ATOM 11600 C CD1  . LEU A 1 86 ? -3.885  -0.698  4.283   1.00 0.00 ? 86  LEU A CD1  8  
ATOM 11601 C CD2  . LEU A 1 86 ? -2.122  0.936   3.580   1.00 0.00 ? 86  LEU A CD2  8  
ATOM 11602 H H    . LEU A 1 86 ? -6.478  2.040   4.101   1.00 0.00 ? 86  LEU A H    8  
ATOM 11603 H HA   . LEU A 1 86 ? -4.178  3.255   2.746   1.00 0.00 ? 86  LEU A HA   8  
ATOM 11604 H HB2  . LEU A 1 86 ? -5.284  0.445   2.602   1.00 0.00 ? 86  LEU A HB2  8  
ATOM 11605 H HB3  . LEU A 1 86 ? -3.842  1.005   1.777   1.00 0.00 ? 86  LEU A HB3  8  
ATOM 11606 H HG   . LEU A 1 86 ? -3.864  1.379   4.710   1.00 0.00 ? 86  LEU A HG   8  
ATOM 11607 H HD11 . LEU A 1 86 ? -3.160  -1.353  3.821   1.00 0.00 ? 86  LEU A HD11 8  
ATOM 11608 H HD12 . LEU A 1 86 ? -4.877  -0.975  3.958   1.00 0.00 ? 86  LEU A HD12 8  
ATOM 11609 H HD13 . LEU A 1 86 ? -3.819  -0.791  5.357   1.00 0.00 ? 86  LEU A HD13 8  
ATOM 11610 H HD21 . LEU A 1 86 ? -1.564  0.930   4.506   1.00 0.00 ? 86  LEU A HD21 8  
ATOM 11611 H HD22 . LEU A 1 86 ? -1.976  1.881   3.079   1.00 0.00 ? 86  LEU A HD22 8  
ATOM 11612 H HD23 . LEU A 1 86 ? -1.772  0.135   2.945   1.00 0.00 ? 86  LEU A HD23 8  
ATOM 11613 N N    . GLU A 1 87 ? -5.062  3.446   0.407   1.00 0.00 ? 87  GLU A N    8  
ATOM 11614 C CA   . GLU A 1 87 ? -5.650  3.741   -0.898  1.00 0.00 ? 87  GLU A CA   8  
ATOM 11615 C C    . GLU A 1 87 ? -4.825  3.110   -2.018  1.00 0.00 ? 87  GLU A C    8  
ATOM 11616 O O    . GLU A 1 87 ? -3.705  3.544   -2.297  1.00 0.00 ? 87  GLU A O    8  
ATOM 11617 C CB   . GLU A 1 87 ? -5.750  5.255   -1.103  1.00 0.00 ? 87  GLU A CB   8  
ATOM 11618 C CG   . GLU A 1 87 ? -6.309  5.660   -2.459  1.00 0.00 ? 87  GLU A CG   8  
ATOM 11619 C CD   . GLU A 1 87 ? -6.349  7.165   -2.647  1.00 0.00 ? 87  GLU A CD   8  
ATOM 11620 O OE1  . GLU A 1 87 ? -5.271  7.798   -2.608  1.00 0.00 ? 87  GLU A OE1  8  
ATOM 11621 O OE2  . GLU A 1 87 ? -7.457  7.709   -2.831  1.00 0.00 ? 87  GLU A OE2  8  
ATOM 11622 H H    . GLU A 1 87 ? -4.135  3.715   0.582   1.00 0.00 ? 87  GLU A H    8  
ATOM 11623 H HA   . GLU A 1 87 ? -6.643  3.317   -0.918  1.00 0.00 ? 87  GLU A HA   8  
ATOM 11624 H HB2  . GLU A 1 87 ? -6.391  5.667   -0.339  1.00 0.00 ? 87  GLU A HB2  8  
ATOM 11625 H HB3  . GLU A 1 87 ? -4.766  5.685   -1.003  1.00 0.00 ? 87  GLU A HB3  8  
ATOM 11626 H HG2  . GLU A 1 87 ? -5.690  5.233   -3.234  1.00 0.00 ? 87  GLU A HG2  8  
ATOM 11627 H HG3  . GLU A 1 87 ? -7.314  5.274   -2.549  1.00 0.00 ? 87  GLU A HG3  8  
ATOM 11628 N N    . VAL A 1 88 ? -5.388  2.085   -2.660  1.00 0.00 ? 88  VAL A N    8  
ATOM 11629 C CA   . VAL A 1 88 ? -4.705  1.396   -3.754  1.00 0.00 ? 88  VAL A CA   8  
ATOM 11630 C C    . VAL A 1 88 ? -5.328  1.749   -5.104  1.00 0.00 ? 88  VAL A C    8  
ATOM 11631 O O    . VAL A 1 88 ? -6.400  2.356   -5.166  1.00 0.00 ? 88  VAL A O    8  
ATOM 11632 C CB   . VAL A 1 88 ? -4.727  -0.139  -3.581  1.00 0.00 ? 88  VAL A CB   8  
ATOM 11633 C CG1  . VAL A 1 88 ? -3.967  -0.555  -2.331  1.00 0.00 ? 88  VAL A CG1  8  
ATOM 11634 C CG2  . VAL A 1 88 ? -6.157  -0.660  -3.548  1.00 0.00 ? 88  VAL A CG2  8  
ATOM 11635 H H    . VAL A 1 88 ? -6.284  1.787   -2.394  1.00 0.00 ? 88  VAL A H    8  
ATOM 11636 H HA   . VAL A 1 88 ? -3.674  1.720   -3.753  1.00 0.00 ? 88  VAL A HA   8  
ATOM 11637 H HB   . VAL A 1 88 ? -4.230  -0.580  -4.433  1.00 0.00 ? 88  VAL A HB   8  
ATOM 11638 H HG11 . VAL A 1 88 ? -4.287  -1.540  -2.024  1.00 0.00 ? 88  VAL A HG11 8  
ATOM 11639 H HG12 . VAL A 1 88 ? -4.162  0.151   -1.537  1.00 0.00 ? 88  VAL A HG12 8  
ATOM 11640 H HG13 . VAL A 1 88 ? -2.909  -0.572  -2.545  1.00 0.00 ? 88  VAL A HG13 8  
ATOM 11641 H HG21 . VAL A 1 88 ? -6.676  -0.338  -4.439  1.00 0.00 ? 88  VAL A HG21 8  
ATOM 11642 H HG22 . VAL A 1 88 ? -6.661  -0.273  -2.675  1.00 0.00 ? 88  VAL A HG22 8  
ATOM 11643 H HG23 . VAL A 1 88 ? -6.145  -1.739  -3.508  1.00 0.00 ? 88  VAL A HG23 8  
ATOM 11644 N N    . ALA A 1 89 ? -4.649  1.357   -6.181  1.00 0.00 ? 89  ALA A N    8  
ATOM 11645 C CA   . ALA A 1 89 ? -5.125  1.624   -7.534  1.00 0.00 ? 89  ALA A CA   8  
ATOM 11646 C C    . ALA A 1 89 ? -5.199  0.341   -8.355  1.00 0.00 ? 89  ALA A C    8  
ATOM 11647 O O    . ALA A 1 89 ? -4.295  -0.497  -8.299  1.00 0.00 ? 89  ALA A O    8  
ATOM 11648 C CB   . ALA A 1 89 ? -4.220  2.637   -8.221  1.00 0.00 ? 89  ALA A CB   8  
ATOM 11649 H H    . ALA A 1 89 ? -3.804  0.874   -6.060  1.00 0.00 ? 89  ALA A H    8  
ATOM 11650 H HA   . ALA A 1 89 ? -6.115  2.052   -7.462  1.00 0.00 ? 89  ALA A HA   8  
ATOM 11651 H HB1  . ALA A 1 89 ? -4.481  3.632   -7.894  1.00 0.00 ? 89  ALA A HB1  8  
ATOM 11652 H HB2  . ALA A 1 89 ? -4.348  2.566   -9.291  1.00 0.00 ? 89  ALA A HB2  8  
ATOM 11653 H HB3  . ALA A 1 89 ? -3.190  2.433   -7.967  1.00 0.00 ? 89  ALA A HB3  8  
ATOM 11654 N N    . LYS A 1 90 ? -6.280  0.197   -9.121  1.00 0.00 ? 90  LYS A N    8  
ATOM 11655 C CA   . LYS A 1 90 ? -6.476  -0.978  -9.965  1.00 0.00 ? 90  LYS A CA   8  
ATOM 11656 C C    . LYS A 1 90 ? -5.977  -0.709  -11.382 1.00 0.00 ? 90  LYS A C    8  
ATOM 11657 O O    . LYS A 1 90 ? -6.437  0.223   -12.046 1.00 0.00 ? 90  LYS A O    8  
ATOM 11658 C CB   . LYS A 1 90 ? -7.957  -1.376  -9.990  1.00 0.00 ? 90  LYS A CB   8  
ATOM 11659 C CG   . LYS A 1 90 ? -8.259  -2.664  -9.237  1.00 0.00 ? 90  LYS A CG   8  
ATOM 11660 C CD   . LYS A 1 90 ? -7.777  -2.598  -7.795  1.00 0.00 ? 90  LYS A CD   8  
ATOM 11661 C CE   . LYS A 1 90 ? -8.734  -1.802  -6.920  1.00 0.00 ? 90  LYS A CE   8  
ATOM 11662 N NZ   . LYS A 1 90 ? -9.434  -2.667  -5.930  1.00 0.00 ? 90  LYS A NZ   8  
ATOM 11663 H H    . LYS A 1 90 ? -6.961  0.903   -9.122  1.00 0.00 ? 90  LYS A H    8  
ATOM 11664 H HA   . LYS A 1 90 ? -5.901  -1.789  -9.542  1.00 0.00 ? 90  LYS A HA   8  
ATOM 11665 H HB2  . LYS A 1 90 ? -8.539  -0.581  -9.546  1.00 0.00 ? 90  LYS A HB2  8  
ATOM 11666 H HB3  . LYS A 1 90 ? -8.267  -1.504  -11.017 1.00 0.00 ? 90  LYS A HB3  8  
ATOM 11667 H HG2  . LYS A 1 90 ? -9.326  -2.829  -9.241  1.00 0.00 ? 90  LYS A HG2  8  
ATOM 11668 H HG3  . LYS A 1 90 ? -7.765  -3.486  -9.736  1.00 0.00 ? 90  LYS A HG3  8  
ATOM 11669 H HD2  . LYS A 1 90 ? -7.699  -3.602  -7.406  1.00 0.00 ? 90  LYS A HD2  8  
ATOM 11670 H HD3  . LYS A 1 90 ? -6.806  -2.126  -7.773  1.00 0.00 ? 90  LYS A HD3  8  
ATOM 11671 H HE2  . LYS A 1 90 ? -8.172  -1.046  -6.390  1.00 0.00 ? 90  LYS A HE2  8  
ATOM 11672 H HE3  . LYS A 1 90 ? -9.469  -1.325  -7.552  1.00 0.00 ? 90  LYS A HE3  8  
ATOM 11673 H HZ1  . LYS A 1 90 ? -9.802  -3.520  -6.397  1.00 0.00 ? 90  LYS A HZ1  8  
ATOM 11674 H HZ2  . LYS A 1 90 ? -10.228 -2.150  -5.502  1.00 0.00 ? 90  LYS A HZ2  8  
ATOM 11675 H HZ3  . LYS A 1 90 ? -8.775  -2.954  -5.177  1.00 0.00 ? 90  LYS A HZ3  8  
ATOM 11676 N N    . GLN A 1 91 ? -5.025  -1.526  -11.833 1.00 0.00 ? 91  GLN A N    8  
ATOM 11677 C CA   . GLN A 1 91 ? -4.447  -1.379  -13.167 1.00 0.00 ? 91  GLN A CA   8  
ATOM 11678 C C    . GLN A 1 91 ? -3.785  -2.684  -13.622 1.00 0.00 ? 91  GLN A C    8  
ATOM 11679 O O    . GLN A 1 91 ? -3.913  -3.717  -12.961 1.00 0.00 ? 91  GLN A O    8  
ATOM 11680 C CB   . GLN A 1 91 ? -3.429  -0.228  -13.175 1.00 0.00 ? 91  GLN A CB   8  
ATOM 11681 C CG   . GLN A 1 91 ? -2.147  -0.527  -12.407 1.00 0.00 ? 91  GLN A CG   8  
ATOM 11682 C CD   . GLN A 1 91 ? -2.349  -