data_2AOQ
# 
_entry.id   2AOQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AOQ         
NDB   PD0703       
RCSB  RCSB034139   
WWPDB D_1000034139 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2AOR 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AOQ 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.Y.'     1 
'Chang, J.'     2 
'Joseph, N.'    3 
'Ghirlando, R.' 4 
'Rao, D.N.'     5 
'Yang, W.'      6 
# 
_citation.id                        primary 
_citation.title                     'MutH complexed with hemi- and unmethylated DNAs: coupling base recognition and DNA cleavage.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            20 
_citation.page_first                155 
_citation.page_last                 166 
_citation.year                      2005 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16209953 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2005.08.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.Y.'     1 
primary 'Chang, J.'     2 
primary 'Joseph, N.'    3 
primary 'Ghirlando, R.' 4 
primary 'Rao, D.N.'     5 
primary 'Yang, W.'      6 
# 
_cell.entry_id           2AOQ 
_cell.length_a           114.624 
_cell.length_b           114.624 
_cell.length_c           46.755 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2AOQ 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*CP*AP*TP*GP*AP*TP*CP*AP*TP*GP*C)-3'" 3662.404  2   ? ? ? ? 
2 polymer     man 'DNA mismatch repair protein mutH'             24936.848 1   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                  40.078    2   ? ? ? ? 
4 water       nat water                                          18.015    154 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Methyl-directed mismatch repair protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DT)(DG)(DA)(DT)(DC)(DA)(DT)(DG)(DC)' GCATGATCATGC B,C ? 
2 'polypeptide(L)'        no no 
;MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATAGSKAEQDFSHLGVELKTLPINAEGY
PLETTFVSLAPLVQNSGVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIVLG
KLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFLETKSL
;
;MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATAGSKAEQDFSHLGVELKTLPINAEGY
PLETTFVSLAPLVQNSGVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIVLG
KLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFLETKSL
;
A   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DA  n 
1 4   DT  n 
1 5   DG  n 
1 6   DA  n 
1 7   DT  n 
1 8   DC  n 
1 9   DA  n 
1 10  DT  n 
1 11  DG  n 
1 12  DC  n 
2 1   MET n 
2 2   ILE n 
2 3   PRO n 
2 4   GLN n 
2 5   THR n 
2 6   LEU n 
2 7   GLU n 
2 8   GLN n 
2 9   LEU n 
2 10  LEU n 
2 11  SER n 
2 12  GLN n 
2 13  ALA n 
2 14  GLN n 
2 15  SER n 
2 16  ILE n 
2 17  ALA n 
2 18  GLY n 
2 19  LEU n 
2 20  THR n 
2 21  PHE n 
2 22  GLY n 
2 23  GLU n 
2 24  LEU n 
2 25  ALA n 
2 26  ASP n 
2 27  GLU n 
2 28  LEU n 
2 29  HIS n 
2 30  ILE n 
2 31  PRO n 
2 32  VAL n 
2 33  PRO n 
2 34  ILE n 
2 35  ASP n 
2 36  LEU n 
2 37  LYS n 
2 38  ARG n 
2 39  ASP n 
2 40  LYS n 
2 41  GLY n 
2 42  TRP n 
2 43  VAL n 
2 44  GLY n 
2 45  MET n 
2 46  LEU n 
2 47  LEU n 
2 48  GLU n 
2 49  ARG n 
2 50  ALA n 
2 51  LEU n 
2 52  GLY n 
2 53  ALA n 
2 54  THR n 
2 55  ALA n 
2 56  GLY n 
2 57  SER n 
2 58  LYS n 
2 59  ALA n 
2 60  GLU n 
2 61  GLN n 
2 62  ASP n 
2 63  PHE n 
2 64  SER n 
2 65  HIS n 
2 66  LEU n 
2 67  GLY n 
2 68  VAL n 
2 69  GLU n 
2 70  LEU n 
2 71  LYS n 
2 72  THR n 
2 73  LEU n 
2 74  PRO n 
2 75  ILE n 
2 76  ASN n 
2 77  ALA n 
2 78  GLU n 
2 79  GLY n 
2 80  TYR n 
2 81  PRO n 
2 82  LEU n 
2 83  GLU n 
2 84  THR n 
2 85  THR n 
2 86  PHE n 
2 87  VAL n 
2 88  SER n 
2 89  LEU n 
2 90  ALA n 
2 91  PRO n 
2 92  LEU n 
2 93  VAL n 
2 94  GLN n 
2 95  ASN n 
2 96  SER n 
2 97  GLY n 
2 98  VAL n 
2 99  LYS n 
2 100 TRP n 
2 101 GLU n 
2 102 ASN n 
2 103 SER n 
2 104 HIS n 
2 105 VAL n 
2 106 ARG n 
2 107 HIS n 
2 108 LYS n 
2 109 LEU n 
2 110 SER n 
2 111 CYS n 
2 112 VAL n 
2 113 LEU n 
2 114 TRP n 
2 115 MET n 
2 116 PRO n 
2 117 ILE n 
2 118 GLU n 
2 119 GLY n 
2 120 SER n 
2 121 ARG n 
2 122 HIS n 
2 123 ILE n 
2 124 PRO n 
2 125 LEU n 
2 126 ARG n 
2 127 GLU n 
2 128 ARG n 
2 129 HIS n 
2 130 ILE n 
2 131 GLY n 
2 132 ALA n 
2 133 PRO n 
2 134 ILE n 
2 135 PHE n 
2 136 TRP n 
2 137 LYS n 
2 138 PRO n 
2 139 THR n 
2 140 ALA n 
2 141 GLU n 
2 142 GLN n 
2 143 GLU n 
2 144 ARG n 
2 145 GLN n 
2 146 LEU n 
2 147 LYS n 
2 148 GLN n 
2 149 ASP n 
2 150 TRP n 
2 151 GLU n 
2 152 GLU n 
2 153 LEU n 
2 154 MET n 
2 155 ASP n 
2 156 LEU n 
2 157 ILE n 
2 158 VAL n 
2 159 LEU n 
2 160 GLY n 
2 161 LYS n 
2 162 LEU n 
2 163 ASP n 
2 164 GLN n 
2 165 ILE n 
2 166 THR n 
2 167 ALA n 
2 168 ARG n 
2 169 ILE n 
2 170 GLY n 
2 171 GLU n 
2 172 VAL n 
2 173 MET n 
2 174 GLN n 
2 175 LEU n 
2 176 ARG n 
2 177 PRO n 
2 178 LYS n 
2 179 GLY n 
2 180 ALA n 
2 181 ASN n 
2 182 SER n 
2 183 ARG n 
2 184 ALA n 
2 185 VAL n 
2 186 THR n 
2 187 LYS n 
2 188 GLY n 
2 189 ILE n 
2 190 GLY n 
2 191 LYS n 
2 192 ASN n 
2 193 GLY n 
2 194 GLU n 
2 195 ILE n 
2 196 ILE n 
2 197 ASP n 
2 198 THR n 
2 199 LEU n 
2 200 PRO n 
2 201 LEU n 
2 202 GLY n 
2 203 PHE n 
2 204 TYR n 
2 205 LEU n 
2 206 ARG n 
2 207 LYS n 
2 208 GLU n 
2 209 PHE n 
2 210 THR n 
2 211 ALA n 
2 212 GLN n 
2 213 ILE n 
2 214 LEU n 
2 215 ASN n 
2 216 ALA n 
2 217 PHE n 
2 218 LEU n 
2 219 GLU n 
2 220 THR n 
2 221 LYS n 
2 222 SER n 
2 223 LEU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Haemophilus 
_entity_src_gen.pdbx_gene_src_gene                 mutH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Haemophilus influenzae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     727 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b-MutH 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MUTH_HAEIN P44688 2 
;MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERALGATAGSKAEQDFSHLGVELKTLPINAEGY
PLETTFVSLAPLVQNSGVKWENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIVLG
KLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFLETKSL
;
1 ? 
2 PDB 2AOQ       2AOQ   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AOQ A 1 ? 223 ? P44688 1 ? 223 ? 9 231 
2 2 2AOQ B 1 ? 12  ? 2AOQ   1 ? 12  ? 1 12  
3 2 2AOQ C 1 ? 12  ? 2AOQ   1 ? 12  ? 1 12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2AOQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_percent_sol   54.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, calcium acetate, cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'        ? ? ? 
1 2 1 'calcium acetate' ? ? ? 
1 3 1 cacodylate        ? ? ? 
1 4 1 H2O               ? ? ? 
1 5 2 'PEG 8000'        ? ? ? 
1 6 2 'calcium acetate' ? ? ? 
1 7 2 cacodylate        ? ? ? 
1 8 2 H2O               ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-10-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     2AOQ 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   16986 
_reflns.number_all                   17994 
_reflns.percent_possible_obs         94.4 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.4 
_reflns.B_iso_Wilson_estimate        23.2 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   64.6 
_reflns_shell.Rmerge_I_obs           0.354 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.65 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1148 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AOQ 
_refine.ls_number_reflns_obs                     16344 
_refine.ls_number_reflns_all                     18030 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               428123.82 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.85 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    90.8 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.22 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1642 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.5 
_refine.aniso_B[1][1]                            6.56 
_refine.aniso_B[2][2]                            6.56 
_refine.aniso_B[3][3]                            -13.12 
_refine.aniso_B[1][2]                            8.96 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.361596 
_refine.solvent_model_param_bsol                 52.7681 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2AZO, chain B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2AOQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1710 
_refine_hist.pdbx_number_atoms_nucleic_acid   486 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               2352 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        19.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.08  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.50  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.60  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.31  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             1654 
_refine_ls_shell.R_factor_R_work                  0.322 
_refine_ls_shell.percent_reflns_obs               61.1 
_refine_ls_shell.R_factor_R_free                  0.37 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            9.7 
_refine_ls_shell.number_reflns_R_free             177 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2AOQ 
_struct.title                     'Crystal structure of MutH-unmethylated DNA complex' 
_struct.pdbx_descriptor           'DNA mismatch repair protein mutH/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AOQ 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
_struct_keywords.text            'GATC recognition, Hydrolase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 5   ? ALA C 17  ? THR A 13  ALA A 25  1 ? 13 
HELX_P HELX_P2 2 THR C 20  ? LEU C 28  ? THR A 28  LEU A 36  1 ? 9  
HELX_P HELX_P3 3 GLY C 41  ? GLY C 52  ? GLY A 49  GLY A 60  1 ? 12 
HELX_P HELX_P4 5 SER C 103 ? LEU C 109 ? SER A 111 LEU A 117 1 ? 7  
HELX_P HELX_P5 6 PRO C 124 ? ARG C 128 ? PRO A 132 ARG A 136 5 ? 5  
HELX_P HELX_P6 7 THR C 139 ? LEU C 159 ? THR A 147 LEU A 167 1 ? 21 
HELX_P HELX_P7 8 GLY C 160 ? GLN C 164 ? GLY A 168 GLN A 172 5 ? 5  
HELX_P HELX_P8 9 ARG C 206 ? GLU C 219 ? ARG A 214 GLU A 227 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CA .  CA ? ? ? 1_555 B DT  4  "O3'" ? ? A CA 232 C DT  4   1_555 ? ? ? ? ? ? ?            2.984 ? 
metalc2  metalc ? ? D CA .  CA ? ? ? 1_555 B DG  5  OP1   ? ? A CA 232 C DG  5   1_555 ? ? ? ? ? ? ?            2.510 ? 
metalc3  metalc ? ? D CA .  CA ? ? ? 1_555 H HOH .  O     ? ? A CA 232 A HOH 259 1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc4  metalc ? ? D CA .  CA ? ? ? 1_555 C THR 54 O     ? ? A CA 232 A THR 62  1_555 ? ? ? ? ? ? ?            2.878 ? 
metalc5  metalc ? ? D CA .  CA ? ? ? 1_555 C ASP 62 OD1   ? ? A CA 232 A ASP 70  1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc6  metalc ? ? D CA .  CA ? ? ? 1_555 H HOH .  O     ? ? A CA 232 A HOH 258 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc7  metalc ? ? D CA .  CA ? ? ? 1_555 C GLU 48 OE2   ? ? A CA 232 A GLU 56  1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc8  metalc ? ? E CA .  CA ? ? ? 1_555 C LEU 70 O     ? ? A CA 233 A LEU 78  1_555 ? ? ? ? ? ? ?            2.351 ? 
metalc9  metalc ? ? E CA .  CA ? ? ? 1_555 B DG  5  OP1   ? ? A CA 233 C DG  5   1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc10 metalc ? ? E CA .  CA ? ? ? 1_555 C GLU 69 OE1   ? ? A CA 233 A GLU 77  1_555 ? ? ? ? ? ? ?            2.462 ? 
metalc11 metalc ? ? E CA .  CA ? ? ? 1_555 G HOH .  O     ? ? A CA 233 C HOH 20  1_555 ? ? ? ? ? ? ?            2.495 ? 
metalc12 metalc ? ? E CA .  CA ? ? ? 1_555 H HOH .  O     ? ? A CA 233 A HOH 260 1_555 ? ? ? ? ? ? ?            2.385 ? 
metalc13 metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 62 OD1   ? ? A CA 233 A ASP 70  1_555 ? ? ? ? ? ? ?            3.115 ? 
metalc14 metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 62 OD2   ? ? A CA 233 A ASP 70  1_555 ? ? ? ? ? ? ?            2.350 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  12 N3    ? ? B DG 1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  12 O2    ? ? B DG 1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  12 N4    ? ? B DG 1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG  11 N1    ? ? B DC 2   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG  11 O6    ? ? B DC 2   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG  11 N2    ? ? B DC 2   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT  10 N3    ? ? B DA 3   C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT  10 O4    ? ? B DA 3   C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA  9  N1    ? ? B DT 4   C DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA  9  N6    ? ? B DT 4   C DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC  8  N3    ? ? B DG 5   C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC  8  O2    ? ? B DG 5   C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC  8  N4    ? ? B DG 5   C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT  7  N3    ? ? B DA 6   C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT  7  O4    ? ? B DA 6   C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA  6  N1    ? ? B DT 7   C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA  6  N6    ? ? B DT 7   C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG  5  N1    ? ? B DC 8   C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG  5  O6    ? ? B DC 8   C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG  5  N2    ? ? B DC 8   C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT  4  N3    ? ? B DA 9   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT  4  O4    ? ? B DA 9   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA  3  N1    ? ? B DT 10  C DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA  3  N6    ? ? B DT 10  C DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC  2  N3    ? ? B DG 11  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC  2  O2    ? ? B DG 11  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC  2  N4    ? ? B DG 11  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG  1  N1    ? ? B DC 12  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG  1  O6    ? ? B DC 12  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG  1  N2    ? ? B DC 12  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 69  ? ILE C 75  ? GLU A 77  ILE A 83  
A 2 VAL C 112 ? GLU C 118 ? VAL A 120 GLU A 126 
A 3 ILE C 134 ? TRP C 136 ? ILE A 142 TRP A 144 
B 1 THR C 85  ? LEU C 89  ? THR A 93  LEU A 97  
B 2 LEU C 201 ? LEU C 205 ? LEU A 209 LEU A 213 
B 3 MET C 173 ? PRO C 177 ? MET A 181 PRO A 185 
C 1 THR C 186 ? ILE C 189 ? THR A 194 ILE A 197 
C 2 ILE C 195 ? THR C 198 ? ILE A 203 THR A 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 69  ? N GLU A 77  O LEU C 113 ? O LEU A 121 
A 2 3 N VAL C 112 ? N VAL A 120 O TRP C 136 ? O TRP A 144 
B 1 2 N VAL C 87  ? N VAL A 95  O PHE C 203 ? O PHE A 211 
B 2 3 O GLY C 202 ? O GLY A 210 N ARG C 176 ? N ARG A 184 
C 1 2 N THR C 186 ? N THR A 194 O THR C 198 ? O THR A 206 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 232' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 233' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLU C 48 ? GLU A 56  . ? 1_555 ? 
2  AC1 7 THR C 54 ? THR A 62  . ? 1_555 ? 
3  AC1 7 ASP C 62 ? ASP A 70  . ? 1_555 ? 
4  AC1 7 HOH H .  ? HOH A 258 . ? 1_555 ? 
5  AC1 7 HOH H .  ? HOH A 259 . ? 1_555 ? 
6  AC1 7 DT  B 4  ? DT  C 4   . ? 1_555 ? 
7  AC1 7 DG  B 5  ? DG  C 5   . ? 1_555 ? 
8  AC2 6 ASP C 62 ? ASP A 70  . ? 1_555 ? 
9  AC2 6 GLU C 69 ? GLU A 77  . ? 1_555 ? 
10 AC2 6 LEU C 70 ? LEU A 78  . ? 1_555 ? 
11 AC2 6 HOH H .  ? HOH A 260 . ? 1_555 ? 
12 AC2 6 DG  B 5  ? DG  C 5   . ? 1_555 ? 
13 AC2 6 HOH G .  ? HOH C 20  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AOQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AOQ 
_atom_sites.fract_transf_matrix[1][1]   0.008724 
_atom_sites.fract_transf_matrix[1][2]   0.005037 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010074 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021388 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 61.021  61.689 22.404  1.00 61.67 ? 1   DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 62.187  61.625 21.576  1.00 58.91 ? 1   DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 61.828  61.361 20.132  1.00 59.55 ? 1   DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 60.962  62.417 19.657  1.00 57.89 ? 1   DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 63.020  61.343 19.179  1.00 58.87 ? 1   DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 62.773  60.408 18.120  1.00 58.74 ? 1   DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 63.091  62.779 18.687  1.00 57.52 ? 1   DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 61.637  63.245 18.719  1.00 55.69 ? 1   DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 61.460  64.625 19.164  1.00 53.76 ? 1   DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 61.965  65.192 20.312  1.00 53.59 ? 1   DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 61.604  66.438 20.473  1.00 51.93 ? 1   DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 60.822  66.714 19.359  1.00 51.04 ? 1   DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 60.140  67.901 18.988  1.00 49.62 ? 1   DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 60.101  68.981 19.581  1.00 48.61 ? 1   DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 59.455  67.746 17.791  1.00 49.57 ? 1   DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 59.429  66.602 17.038  1.00 49.61 ? 1   DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 58.704  66.662 15.907  1.00 48.96 ? 1   DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 60.063  65.484 17.367  1.00 49.06 ? 1   DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 60.731  65.612 18.532  1.00 50.98 ? 1   DG  B C4    1 
ATOM   20   P  P     . DC  A 1 2   ? 63.906  60.126 17.007  1.00 59.06 ? 2   DC  B P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? 63.610  58.777 16.449  1.00 56.41 ? 2   DC  B OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? 65.249  60.415 17.566  1.00 54.86 ? 2   DC  B OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? 63.597  61.210 15.879  1.00 56.36 ? 2   DC  B "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? 62.384  61.144 15.129  1.00 54.11 ? 2   DC  B "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? 62.320  62.269 14.122  1.00 51.72 ? 2   DC  B "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? 62.111  63.546 14.775  1.00 49.82 ? 2   DC  B "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? 63.564  62.442 13.250  1.00 50.02 ? 2   DC  B "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? 63.135  62.843 11.953  1.00 51.13 ? 2   DC  B "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? 64.273  63.616 13.900  1.00 49.39 ? 2   DC  B "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? 63.082  64.464 14.305  1.00 48.79 ? 2   DC  B "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? 63.326  65.451 15.364  1.00 47.53 ? 2   DC  B N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? 62.665  66.671 15.289  1.00 47.18 ? 2   DC  B C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? 61.915  66.877 14.323  1.00 48.90 ? 2   DC  B O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? 62.861  67.595 16.259  1.00 46.47 ? 2   DC  B N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? 63.684  67.329 17.272  1.00 46.92 ? 2   DC  B C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? 63.832  68.258 18.217  1.00 47.59 ? 2   DC  B N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? 64.389  66.094 17.367  1.00 46.44 ? 2   DC  B C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? 64.179  65.190 16.401  1.00 46.22 ? 2   DC  B C6    1 
ATOM   39   P  P     . DA  A 1 3   ? 63.775  62.168 10.654  1.00 48.43 ? 3   DA  B P     1 
ATOM   40   O  OP1   . DA  A 1 3   ? 63.268  60.777 10.546  1.00 48.28 ? 3   DA  B OP1   1 
ATOM   41   O  OP2   . DA  A 1 3   ? 65.242  62.422 10.698  1.00 48.81 ? 3   DA  B OP2   1 
ATOM   42   O  "O5'" . DA  A 1 3   ? 63.122  62.999 9.463   1.00 48.55 ? 3   DA  B "O5'" 1 
ATOM   43   C  "C5'" . DA  A 1 3   ? 61.706  63.084 9.336   1.00 46.02 ? 3   DA  B "C5'" 1 
ATOM   44   C  "C4'" . DA  A 1 3   ? 61.306  64.435 8.793   1.00 44.54 ? 3   DA  B "C4'" 1 
ATOM   45   O  "O4'" . DA  A 1 3   ? 61.567  65.473 9.764   1.00 45.11 ? 3   DA  B "O4'" 1 
ATOM   46   C  "C3'" . DA  A 1 3   ? 62.039  64.856 7.527   1.00 44.76 ? 3   DA  B "C3'" 1 
ATOM   47   O  "O3'" . DA  A 1 3   ? 61.126  65.568 6.695   1.00 45.31 ? 3   DA  B "O3'" 1 
ATOM   48   C  "C2'" . DA  A 1 3   ? 63.154  65.745 8.047   1.00 43.38 ? 3   DA  B "C2'" 1 
ATOM   49   C  "C1'" . DA  A 1 3   ? 62.535  66.395 9.274   1.00 43.56 ? 3   DA  B "C1'" 1 
ATOM   50   N  N9    . DA  A 1 3   ? 63.489  66.628 10.356  1.00 43.36 ? 3   DA  B N9    1 
ATOM   51   C  C8    . DA  A 1 3   ? 64.506  65.797 10.757  1.00 42.88 ? 3   DA  B C8    1 
ATOM   52   N  N7    . DA  A 1 3   ? 65.161  66.231 11.808  1.00 43.08 ? 3   DA  B N7    1 
ATOM   53   C  C5    . DA  A 1 3   ? 64.539  67.434 12.114  1.00 40.82 ? 3   DA  B C5    1 
ATOM   54   C  C6    . DA  A 1 3   ? 64.748  68.371 13.138  1.00 40.88 ? 3   DA  B C6    1 
ATOM   55   N  N6    . DA  A 1 3   ? 65.653  68.216 14.109  1.00 40.65 ? 3   DA  B N6    1 
ATOM   56   N  N1    . DA  A 1 3   ? 63.976  69.479 13.144  1.00 41.36 ? 3   DA  B N1    1 
ATOM   57   C  C2    . DA  A 1 3   ? 63.041  69.612 12.197  1.00 41.85 ? 3   DA  B C2    1 
ATOM   58   N  N3    . DA  A 1 3   ? 62.730  68.788 11.199  1.00 42.68 ? 3   DA  B N3    1 
ATOM   59   C  C4    . DA  A 1 3   ? 63.526  67.705 11.212  1.00 42.17 ? 3   DA  B C4    1 
ATOM   60   P  P     . DT  A 1 4   ? 61.621  66.178 5.298   1.00 45.92 ? 4   DT  B P     1 
ATOM   61   O  OP1   . DT  A 1 4   ? 60.645  65.757 4.266   1.00 48.47 ? 4   DT  B OP1   1 
ATOM   62   O  OP2   . DT  A 1 4   ? 63.062  65.897 5.099   1.00 47.77 ? 4   DT  B OP2   1 
ATOM   63   O  "O5'" . DT  A 1 4   ? 61.445  67.742 5.534   1.00 46.26 ? 4   DT  B "O5'" 1 
ATOM   64   C  "C5'" . DT  A 1 4   ? 60.356  68.232 6.313   1.00 43.57 ? 4   DT  B "C5'" 1 
ATOM   65   C  "C4'" . DT  A 1 4   ? 60.548  69.696 6.625   1.00 43.21 ? 4   DT  B "C4'" 1 
ATOM   66   O  "O4'" . DT  A 1 4   ? 61.556  69.857 7.650   1.00 43.97 ? 4   DT  B "O4'" 1 
ATOM   67   C  "C3'" . DT  A 1 4   ? 61.000  70.541 5.436   1.00 45.81 ? 4   DT  B "C3'" 1 
ATOM   68   O  "O3'" . DT  A 1 4   ? 60.308  71.797 5.424   1.00 46.69 ? 4   DT  B "O3'" 1 
ATOM   69   C  "C2'" . DT  A 1 4   ? 62.495  70.712 5.667   1.00 45.37 ? 4   DT  B "C2'" 1 
ATOM   70   C  "C1'" . DT  A 1 4   ? 62.630  70.659 7.185   1.00 42.38 ? 4   DT  B "C1'" 1 
ATOM   71   N  N1    . DT  A 1 4   ? 63.879  70.048 7.689   1.00 42.25 ? 4   DT  B N1    1 
ATOM   72   C  C2    . DT  A 1 4   ? 64.467  70.622 8.788   1.00 42.76 ? 4   DT  B C2    1 
ATOM   73   O  O2    . DT  A 1 4   ? 64.056  71.646 9.300   1.00 48.14 ? 4   DT  B O2    1 
ATOM   74   N  N3    . DT  A 1 4   ? 65.569  69.954 9.266   1.00 41.47 ? 4   DT  B N3    1 
ATOM   75   C  C4    . DT  A 1 4   ? 66.145  68.809 8.746   1.00 39.61 ? 4   DT  B C4    1 
ATOM   76   O  O4    . DT  A 1 4   ? 67.110  68.298 9.306   1.00 40.50 ? 4   DT  B O4    1 
ATOM   77   C  C5    . DT  A 1 4   ? 65.523  68.297 7.554   1.00 39.34 ? 4   DT  B C5    1 
ATOM   78   C  C7    . DT  A 1 4   ? 66.133  67.107 6.881   1.00 37.20 ? 4   DT  B C7    1 
ATOM   79   C  C6    . DT  A 1 4   ? 64.425  68.923 7.094   1.00 40.55 ? 4   DT  B C6    1 
ATOM   80   P  P     . DG  A 1 5   ? 60.426  72.759 4.143   1.00 49.05 ? 5   DG  B P     1 
ATOM   81   O  OP1   . DG  A 1 5   ? 59.093  73.380 3.925   1.00 48.81 ? 5   DG  B OP1   1 
ATOM   82   O  OP2   . DG  A 1 5   ? 61.076  72.019 3.036   1.00 48.20 ? 5   DG  B OP2   1 
ATOM   83   O  "O5'" . DG  A 1 5   ? 61.421  73.889 4.651   1.00 48.10 ? 5   DG  B "O5'" 1 
ATOM   84   C  "C5'" . DG  A 1 5   ? 61.144  74.565 5.867   1.00 47.75 ? 5   DG  B "C5'" 1 
ATOM   85   C  "C4'" . DG  A 1 5   ? 62.376  75.268 6.387   1.00 48.41 ? 5   DG  B "C4'" 1 
ATOM   86   O  "O4'" . DG  A 1 5   ? 63.343  74.309 6.879   1.00 47.14 ? 5   DG  B "O4'" 1 
ATOM   87   C  "C3'" . DG  A 1 5   ? 63.124  76.173 5.404   1.00 47.55 ? 5   DG  B "C3'" 1 
ATOM   88   O  "O3'" . DG  A 1 5   ? 63.401  77.409 6.072   1.00 47.47 ? 5   DG  B "O3'" 1 
ATOM   89   C  "C2'" . DG  A 1 5   ? 64.401  75.399 5.115   1.00 45.87 ? 5   DG  B "C2'" 1 
ATOM   90   C  "C1'" . DG  A 1 5   ? 64.632  74.681 6.433   1.00 44.46 ? 5   DG  B "C1'" 1 
ATOM   91   N  N9    . DG  A 1 5   ? 65.469  73.480 6.382   1.00 41.20 ? 5   DG  B N9    1 
ATOM   92   C  C8    . DG  A 1 5   ? 65.447  72.477 5.441   1.00 40.73 ? 5   DG  B C8    1 
ATOM   93   N  N7    . DG  A 1 5   ? 66.338  71.547 5.663   1.00 40.80 ? 5   DG  B N7    1 
ATOM   94   C  C5    . DG  A 1 5   ? 66.986  71.961 6.821   1.00 39.23 ? 5   DG  B C5    1 
ATOM   95   C  C6    . DG  A 1 5   ? 68.065  71.371 7.546   1.00 38.47 ? 5   DG  B C6    1 
ATOM   96   O  O6    . DG  A 1 5   ? 68.691  70.338 7.296   1.00 40.15 ? 5   DG  B O6    1 
ATOM   97   N  N1    . DG  A 1 5   ? 68.402  72.123 8.662   1.00 34.97 ? 5   DG  B N1    1 
ATOM   98   C  C2    . DG  A 1 5   ? 67.797  73.295 9.032   1.00 34.52 ? 5   DG  B C2    1 
ATOM   99   N  N2    . DG  A 1 5   ? 68.267  73.878 10.144  1.00 37.21 ? 5   DG  B N2    1 
ATOM   100  N  N3    . DG  A 1 5   ? 66.806  73.858 8.367   1.00 35.46 ? 5   DG  B N3    1 
ATOM   101  C  C4    . DG  A 1 5   ? 66.452  73.145 7.282   1.00 37.67 ? 5   DG  B C4    1 
ATOM   102  P  P     . DA  A 1 6   ? 64.393  78.492 5.412   1.00 51.89 ? 6   DA  B P     1 
ATOM   103  O  OP1   . DA  A 1 6   ? 63.790  79.826 5.686   1.00 52.65 ? 6   DA  B OP1   1 
ATOM   104  O  OP2   . DA  A 1 6   ? 64.739  78.119 4.017   1.00 48.48 ? 6   DA  B OP2   1 
ATOM   105  O  "O5'" . DA  A 1 6   ? 65.683  78.359 6.332   1.00 47.59 ? 6   DA  B "O5'" 1 
ATOM   106  C  "C5'" . DA  A 1 6   ? 65.528  78.258 7.738   1.00 44.19 ? 6   DA  B "C5'" 1 
ATOM   107  C  "C4'" . DA  A 1 6   ? 66.868  78.325 8.426   1.00 44.16 ? 6   DA  B "C4'" 1 
ATOM   108  O  "O4'" . DA  A 1 6   ? 67.532  77.038 8.379   1.00 43.39 ? 6   DA  B "O4'" 1 
ATOM   109  C  "C3'" . DA  A 1 6   ? 67.837  79.353 7.839   1.00 44.13 ? 6   DA  B "C3'" 1 
ATOM   110  O  "O3'" . DA  A 1 6   ? 68.362  80.161 8.890   1.00 44.63 ? 6   DA  B "O3'" 1 
ATOM   111  C  "C2'" . DA  A 1 6   ? 68.914  78.509 7.170   1.00 41.32 ? 6   DA  B "C2'" 1 
ATOM   112  C  "C1'" . DA  A 1 6   ? 68.880  77.195 7.942   1.00 41.90 ? 6   DA  B "C1'" 1 
ATOM   113  N  N9    . DA  A 1 6   ? 69.227  76.014 7.141   1.00 40.19 ? 6   DA  B N9    1 
ATOM   114  C  C8    . DA  A 1 6   ? 68.689  75.658 5.930   1.00 37.43 ? 6   DA  B C8    1 
ATOM   115  N  N7    . DA  A 1 6   ? 69.174  74.544 5.443   1.00 36.79 ? 6   DA  B N7    1 
ATOM   116  C  C5    . DA  A 1 6   ? 70.101  74.138 6.393   1.00 38.22 ? 6   DA  B C5    1 
ATOM   117  C  C6    . DA  A 1 6   ? 70.963  73.019 6.462   1.00 38.55 ? 6   DA  B C6    1 
ATOM   118  N  N6    . DA  A 1 6   ? 71.033  72.078 5.518   1.00 36.45 ? 6   DA  B N6    1 
ATOM   119  N  N1    . DA  A 1 6   ? 71.757  72.904 7.546   1.00 36.95 ? 6   DA  B N1    1 
ATOM   120  C  C2    . DA  A 1 6   ? 71.683  73.850 8.489   1.00 36.26 ? 6   DA  B C2    1 
ATOM   121  N  N3    . DA  A 1 6   ? 70.921  74.943 8.536   1.00 36.44 ? 6   DA  B N3    1 
ATOM   122  C  C4    . DA  A 1 6   ? 70.145  75.032 7.444   1.00 36.70 ? 6   DA  B C4    1 
ATOM   123  P  P     . DT  A 1 7   ? 69.515  81.232 8.577   1.00 47.11 ? 7   DT  B P     1 
ATOM   124  O  OP1   . DT  A 1 7   ? 69.467  82.228 9.673   1.00 45.48 ? 7   DT  B OP1   1 
ATOM   125  O  OP2   . DT  A 1 7   ? 69.418  81.681 7.167   1.00 45.57 ? 7   DT  B OP2   1 
ATOM   126  O  "O5'" . DT  A 1 7   ? 70.830  80.362 8.781   1.00 48.33 ? 7   DT  B "O5'" 1 
ATOM   127  C  "C5'" . DT  A 1 7   ? 70.957  79.585 9.964   1.00 46.70 ? 7   DT  B "C5'" 1 
ATOM   128  C  "C4'" . DT  A 1 7   ? 72.280  78.865 10.003  1.00 46.87 ? 7   DT  B "C4'" 1 
ATOM   129  O  "O4'" . DT  A 1 7   ? 72.240  77.698 9.149   1.00 45.42 ? 7   DT  B "O4'" 1 
ATOM   130  C  "C3'" . DT  A 1 7   ? 73.501  79.685 9.585   1.00 45.78 ? 7   DT  B "C3'" 1 
ATOM   131  O  "O3'" . DT  A 1 7   ? 74.461  79.686 10.638  1.00 49.49 ? 7   DT  B "O3'" 1 
ATOM   132  C  "C2'" . DT  A 1 7   ? 74.041  78.949 8.367   1.00 45.07 ? 7   DT  B "C2'" 1 
ATOM   133  C  "C1'" . DT  A 1 7   ? 73.493  77.538 8.532   1.00 42.66 ? 7   DT  B "C1'" 1 
ATOM   134  N  N1    . DT  A 1 7   ? 73.283  76.803 7.270   1.00 39.35 ? 7   DT  B N1    1 
ATOM   135  C  C2    . DT  A 1 7   ? 73.965  75.622 7.095   1.00 37.87 ? 7   DT  B C2    1 
ATOM   136  O  O2    . DT  A 1 7   ? 74.691  75.152 7.951   1.00 40.41 ? 7   DT  B O2    1 
ATOM   137  N  N3    . DT  A 1 7   ? 73.764  75.013 5.881   1.00 33.93 ? 7   DT  B N3    1 
ATOM   138  C  C4    . DT  A 1 7   ? 72.960  75.466 4.849   1.00 36.84 ? 7   DT  B C4    1 
ATOM   139  O  O4    . DT  A 1 7   ? 72.893  74.836 3.796   1.00 37.56 ? 7   DT  B O4    1 
ATOM   140  C  C5    . DT  A 1 7   ? 72.253  76.698 5.112   1.00 37.71 ? 7   DT  B C5    1 
ATOM   141  C  C7    . DT  A 1 7   ? 71.348  77.250 4.058   1.00 39.43 ? 7   DT  B C7    1 
ATOM   142  C  C6    . DT  A 1 7   ? 72.444  77.297 6.296   1.00 38.60 ? 7   DT  B C6    1 
ATOM   143  P  P     . DC  A 1 8   ? 75.616  80.804 10.662  1.00 48.90 ? 8   DC  B P     1 
ATOM   144  O  OP1   . DC  A 1 8   ? 75.633  81.419 12.007  1.00 49.51 ? 8   DC  B OP1   1 
ATOM   145  O  OP2   . DC  A 1 8   ? 75.477  81.662 9.461   1.00 50.35 ? 8   DC  B OP2   1 
ATOM   146  O  "O5'" . DC  A 1 8   ? 76.939  79.936 10.505  1.00 50.17 ? 8   DC  B "O5'" 1 
ATOM   147  C  "C5'" . DC  A 1 8   ? 77.162  78.801 11.337  1.00 48.15 ? 8   DC  B "C5'" 1 
ATOM   148  C  "C4'" . DC  A 1 8   ? 78.427  78.101 10.909  1.00 49.85 ? 8   DC  B "C4'" 1 
ATOM   149  O  "O4'" . DC  A 1 8   ? 78.174  77.068 9.923   1.00 47.44 ? 8   DC  B "O4'" 1 
ATOM   150  C  "C3'" . DC  A 1 8   ? 79.422  79.065 10.273  1.00 49.37 ? 8   DC  B "C3'" 1 
ATOM   151  O  "O3'" . DC  A 1 8   ? 80.718  78.863 10.801  1.00 53.53 ? 8   DC  B "O3'" 1 
ATOM   152  C  "C2'" . DC  A 1 8   ? 79.414  78.685 8.806   1.00 47.87 ? 8   DC  B "C2'" 1 
ATOM   153  C  "C1'" . DC  A 1 8   ? 79.101  77.205 8.865   1.00 45.50 ? 8   DC  B "C1'" 1 
ATOM   154  N  N1    . DC  A 1 8   ? 78.492  76.669 7.633   1.00 43.06 ? 8   DC  B N1    1 
ATOM   155  C  C2    . DC  A 1 8   ? 79.029  75.513 7.080   1.00 41.58 ? 8   DC  B C2    1 
ATOM   156  O  O2    . DC  A 1 8   ? 79.953  74.942 7.679   1.00 39.16 ? 8   DC  B O2    1 
ATOM   157  N  N3    . DC  A 1 8   ? 78.529  75.043 5.914   1.00 40.02 ? 8   DC  B N3    1 
ATOM   158  C  C4    . DC  A 1 8   ? 77.519  75.682 5.317   1.00 40.66 ? 8   DC  B C4    1 
ATOM   159  N  N4    . DC  A 1 8   ? 77.066  75.197 4.153   1.00 37.97 ? 8   DC  B N4    1 
ATOM   160  C  C5    . DC  A 1 8   ? 76.931  76.848 5.880   1.00 37.35 ? 8   DC  B C5    1 
ATOM   161  C  C6    . DC  A 1 8   ? 77.440  77.300 7.028   1.00 40.46 ? 8   DC  B C6    1 
ATOM   162  P  P     . DA  A 1 9   ? 81.857  79.939 10.492  1.00 54.00 ? 9   DA  B P     1 
ATOM   163  O  OP1   . DA  A 1 9   ? 82.461  80.293 11.805  1.00 55.54 ? 9   DA  B OP1   1 
ATOM   164  O  OP2   . DA  A 1 9   ? 81.285  81.002 9.629   1.00 53.34 ? 9   DA  B OP2   1 
ATOM   165  O  "O5'" . DA  A 1 9   ? 82.896  79.109 9.628   1.00 52.76 ? 9   DA  B "O5'" 1 
ATOM   166  C  "C5'" . DA  A 1 9   ? 83.476  77.936 10.161  1.00 50.11 ? 9   DA  B "C5'" 1 
ATOM   167  C  "C4'" . DA  A 1 9   ? 84.422  77.327 9.159   1.00 50.23 ? 9   DA  B "C4'" 1 
ATOM   168  O  "O4'" . DA  A 1 9   ? 83.674  76.657 8.115   1.00 48.24 ? 9   DA  B "O4'" 1 
ATOM   169  C  "C3'" . DA  A 1 9   ? 85.332  78.339 8.463   1.00 49.71 ? 9   DA  B "C3'" 1 
ATOM   170  O  "O3'" . DA  A 1 9   ? 86.666  77.835 8.451   1.00 51.99 ? 9   DA  B "O3'" 1 
ATOM   171  C  "C2'" . DA  A 1 9   ? 84.753  78.435 7.059   1.00 48.02 ? 9   DA  B "C2'" 1 
ATOM   172  C  "C1'" . DA  A 1 9   ? 84.178  77.043 6.850   1.00 47.19 ? 9   DA  B "C1'" 1 
ATOM   173  N  N9    . DA  A 1 9   ? 83.080  76.930 5.887   1.00 43.59 ? 9   DA  B N9    1 
ATOM   174  C  C8    . DA  A 1 9   ? 81.911  77.642 5.857   1.00 40.85 ? 9   DA  B C8    1 
ATOM   175  N  N7    . DA  A 1 9   ? 81.103  77.290 4.887   1.00 40.42 ? 9   DA  B N7    1 
ATOM   176  C  C5    . DA  A 1 9   ? 81.789  76.283 4.229   1.00 37.42 ? 9   DA  B C5    1 
ATOM   177  C  C6    . DA  A 1 9   ? 81.467  75.498 3.110   1.00 37.83 ? 9   DA  B C6    1 
ATOM   178  N  N6    . DA  A 1 9   ? 80.324  75.613 2.432   1.00 35.53 ? 9   DA  B N6    1 
ATOM   179  N  N1    . DA  A 1 9   ? 82.371  74.581 2.705   1.00 37.24 ? 9   DA  B N1    1 
ATOM   180  C  C2    . DA  A 1 9   ? 83.517  74.475 3.384   1.00 38.14 ? 9   DA  B C2    1 
ATOM   181  N  N3    . DA  A 1 9   ? 83.933  75.156 4.449   1.00 38.43 ? 9   DA  B N3    1 
ATOM   182  C  C4    . DA  A 1 9   ? 83.011  76.054 4.827   1.00 39.02 ? 9   DA  B C4    1 
ATOM   183  P  P     . DT  A 1 10  ? 87.878  78.796 8.022   1.00 54.82 ? 10  DT  B P     1 
ATOM   184  O  OP1   . DT  A 1 10  ? 89.075  78.321 8.761   1.00 56.09 ? 10  DT  B OP1   1 
ATOM   185  O  OP2   . DT  A 1 10  ? 87.469  80.224 8.119   1.00 53.64 ? 10  DT  B OP2   1 
ATOM   186  O  "O5'" . DT  A 1 10  ? 88.075  78.425 6.491   1.00 53.74 ? 10  DT  B "O5'" 1 
ATOM   187  C  "C5'" . DT  A 1 10  ? 88.217  77.065 6.111   1.00 53.00 ? 10  DT  B "C5'" 1 
ATOM   188  C  "C4'" . DT  A 1 10  ? 88.308  76.943 4.610   1.00 53.68 ? 10  DT  B "C4'" 1 
ATOM   189  O  "O4'" . DT  A 1 10  ? 86.996  76.815 4.010   1.00 52.32 ? 10  DT  B "O4'" 1 
ATOM   190  C  "C3'" . DT  A 1 10  ? 89.005  78.109 3.903   1.00 54.26 ? 10  DT  B "C3'" 1 
ATOM   191  O  "O3'" . DT  A 1 10  ? 90.030  77.616 3.042   1.00 58.24 ? 10  DT  B "O3'" 1 
ATOM   192  C  "C2'" . DT  A 1 10  ? 87.897  78.742 3.075   1.00 52.55 ? 10  DT  B "C2'" 1 
ATOM   193  C  "C1'" . DT  A 1 10  ? 86.987  77.553 2.803   1.00 51.74 ? 10  DT  B "C1'" 1 
ATOM   194  N  N1    . DT  A 1 10  ? 85.580  77.877 2.466   1.00 48.45 ? 10  DT  B N1    1 
ATOM   195  C  C2    . DT  A 1 10  ? 84.984  77.203 1.418   1.00 46.92 ? 10  DT  B C2    1 
ATOM   196  O  O2    . DT  A 1 10  ? 85.554  76.352 0.756   1.00 47.45 ? 10  DT  B O2    1 
ATOM   197  N  N3    . DT  A 1 10  ? 83.683  77.564 1.173   1.00 45.54 ? 10  DT  B N3    1 
ATOM   198  C  C4    . DT  A 1 10  ? 82.934  78.499 1.854   1.00 45.03 ? 10  DT  B C4    1 
ATOM   199  O  O4    . DT  A 1 10  ? 81.764  78.699 1.532   1.00 46.42 ? 10  DT  B O4    1 
ATOM   200  C  C5    . DT  A 1 10  ? 83.622  79.174 2.931   1.00 45.93 ? 10  DT  B C5    1 
ATOM   201  C  C7    . DT  A 1 10  ? 82.896  80.223 3.711   1.00 45.34 ? 10  DT  B C7    1 
ATOM   202  C  C6    . DT  A 1 10  ? 84.891  78.829 3.183   1.00 46.36 ? 10  DT  B C6    1 
ATOM   203  P  P     . DG  A 1 11  ? 91.233  78.586 2.597   1.00 60.96 ? 11  DG  B P     1 
ATOM   204  O  OP1   . DG  A 1 11  ? 92.510  77.949 3.010   1.00 59.37 ? 11  DG  B OP1   1 
ATOM   205  O  OP2   . DG  A 1 11  ? 90.936  79.983 3.022   1.00 57.61 ? 11  DG  B OP2   1 
ATOM   206  O  "O5'" . DG  A 1 11  ? 91.152  78.516 1.014   1.00 56.84 ? 11  DG  B "O5'" 1 
ATOM   207  C  "C5'" . DG  A 1 11  ? 91.122  77.257 0.359   1.00 56.02 ? 11  DG  B "C5'" 1 
ATOM   208  C  "C4'" . DG  A 1 11  ? 90.810  77.450 -1.104  1.00 55.92 ? 11  DG  B "C4'" 1 
ATOM   209  O  "O4'" . DG  A 1 11  ? 89.390  77.648 -1.297  1.00 56.07 ? 11  DG  B "O4'" 1 
ATOM   210  C  "C3'" . DG  A 1 11  ? 91.501  78.670 -1.702  1.00 56.64 ? 11  DG  B "C3'" 1 
ATOM   211  O  "O3'" . DG  A 1 11  ? 92.063  78.334 -2.964  1.00 58.06 ? 11  DG  B "O3'" 1 
ATOM   212  C  "C2'" . DG  A 1 11  ? 90.386  79.699 -1.822  1.00 54.34 ? 11  DG  B "C2'" 1 
ATOM   213  C  "C1'" . DG  A 1 11  ? 89.153  78.836 -2.036  1.00 53.42 ? 11  DG  B "C1'" 1 
ATOM   214  N  N9    . DG  A 1 11  ? 87.894  79.408 -1.564  1.00 50.73 ? 11  DG  B N9    1 
ATOM   215  C  C8    . DG  A 1 11  ? 87.705  80.233 -0.480  1.00 51.08 ? 11  DG  B C8    1 
ATOM   216  N  N7    . DG  A 1 11  ? 86.451  80.541 -0.279  1.00 49.45 ? 11  DG  B N7    1 
ATOM   217  C  C5    . DG  A 1 11  ? 85.772  79.887 -1.297  1.00 48.04 ? 11  DG  B C5    1 
ATOM   218  C  C6    . DG  A 1 11  ? 84.381  79.836 -1.590  1.00 47.48 ? 11  DG  B C6    1 
ATOM   219  O  O6    . DG  A 1 11  ? 83.446  80.373 -0.987  1.00 46.72 ? 11  DG  B O6    1 
ATOM   220  N  N1    . DG  A 1 11  ? 84.126  79.062 -2.715  1.00 46.51 ? 11  DG  B N1    1 
ATOM   221  C  C2    . DG  A 1 11  ? 85.084  78.428 -3.470  1.00 47.25 ? 11  DG  B C2    1 
ATOM   222  N  N2    . DG  A 1 11  ? 84.645  77.750 -4.542  1.00 46.09 ? 11  DG  B N2    1 
ATOM   223  N  N3    . DG  A 1 11  ? 86.378  78.460 -3.201  1.00 47.47 ? 11  DG  B N3    1 
ATOM   224  C  C4    . DG  A 1 11  ? 86.646  79.200 -2.108  1.00 47.70 ? 11  DG  B C4    1 
ATOM   225  P  P     . DC  A 1 12  ? 92.980  79.401 -3.728  1.00 61.37 ? 12  DC  B P     1 
ATOM   226  O  OP1   . DC  A 1 12  ? 94.124  78.655 -4.314  1.00 62.49 ? 12  DC  B OP1   1 
ATOM   227  O  OP2   . DC  A 1 12  ? 93.241  80.541 -2.815  1.00 59.08 ? 12  DC  B OP2   1 
ATOM   228  O  "O5'" . DC  A 1 12  ? 92.028  79.898 -4.905  1.00 61.08 ? 12  DC  B "O5'" 1 
ATOM   229  C  "C5'" . DC  A 1 12  ? 91.427  78.956 -5.791  1.00 59.13 ? 12  DC  B "C5'" 1 
ATOM   230  C  "C4'" . DC  A 1 12  ? 90.360  79.620 -6.634  1.00 59.43 ? 12  DC  B "C4'" 1 
ATOM   231  O  "O4'" . DC  A 1 12  ? 89.165  79.877 -5.854  1.00 58.02 ? 12  DC  B "O4'" 1 
ATOM   232  C  "C3'" . DC  A 1 12  ? 90.746  80.959 -7.270  1.00 58.81 ? 12  DC  B "C3'" 1 
ATOM   233  O  "O3'" . DC  A 1 12  ? 90.105  81.071 -8.538  1.00 63.30 ? 12  DC  B "O3'" 1 
ATOM   234  C  "C2'" . DC  A 1 12  ? 90.017  81.972 -6.408  1.00 56.33 ? 12  DC  B "C2'" 1 
ATOM   235  C  "C1'" . DC  A 1 12  ? 88.748  81.209 -6.102  1.00 53.67 ? 12  DC  B "C1'" 1 
ATOM   236  N  N1    . DC  A 1 12  ? 87.974  81.685 -4.947  1.00 47.08 ? 12  DC  B N1    1 
ATOM   237  C  C2    . DC  A 1 12  ? 86.591  81.550 -4.985  1.00 44.28 ? 12  DC  B C2    1 
ATOM   238  O  O2    . DC  A 1 12  ? 86.081  80.941 -5.936  1.00 41.73 ? 12  DC  B O2    1 
ATOM   239  N  N3    . DC  A 1 12  ? 85.845  82.071 -3.986  1.00 43.92 ? 12  DC  B N3    1 
ATOM   240  C  C4    . DC  A 1 12  ? 86.440  82.689 -2.964  1.00 45.36 ? 12  DC  B C4    1 
ATOM   241  N  N4    . DC  A 1 12  ? 85.661  83.222 -2.017  1.00 46.26 ? 12  DC  B N4    1 
ATOM   242  C  C5    . DC  A 1 12  ? 87.859  82.793 -2.871  1.00 44.03 ? 12  DC  B C5    1 
ATOM   243  C  C6    . DC  A 1 12  ? 88.581  82.280 -3.877  1.00 45.15 ? 12  DC  B C6    1 
ATOM   244  O  "O5'" . DG  B 1 1   ? 75.798  84.851 -5.085  1.00 59.98 ? 1   DG  C "O5'" 1 
ATOM   245  C  "C5'" . DG  B 1 1   ? 75.836  85.034 -6.498  1.00 58.61 ? 1   DG  C "C5'" 1 
ATOM   246  C  "C4'" . DG  B 1 1   ? 76.539  83.901 -7.209  1.00 58.15 ? 1   DG  C "C4'" 1 
ATOM   247  O  "O4'" . DG  B 1 1   ? 77.920  83.845 -6.794  1.00 57.02 ? 1   DG  C "O4'" 1 
ATOM   248  C  "C3'" . DG  B 1 1   ? 75.972  82.510 -6.940  1.00 58.91 ? 1   DG  C "C3'" 1 
ATOM   249  O  "O3'" . DG  B 1 1   ? 76.083  81.736 -8.132  1.00 59.61 ? 1   DG  C "O3'" 1 
ATOM   250  C  "C2'" . DG  B 1 1   ? 76.880  81.967 -5.848  1.00 57.51 ? 1   DG  C "C2'" 1 
ATOM   251  C  "C1'" . DG  B 1 1   ? 78.216  82.586 -6.210  1.00 55.49 ? 1   DG  C "C1'" 1 
ATOM   252  N  N9    . DG  B 1 1   ? 79.117  82.836 -5.091  1.00 52.83 ? 1   DG  C N9    1 
ATOM   253  C  C8    . DG  B 1 1   ? 78.830  83.501 -3.925  1.00 52.71 ? 1   DG  C C8    1 
ATOM   254  N  N7    . DG  B 1 1   ? 79.868  83.634 -3.141  1.00 51.29 ? 1   DG  C N7    1 
ATOM   255  C  C5    . DG  B 1 1   ? 80.896  83.007 -3.829  1.00 48.90 ? 1   DG  C C5    1 
ATOM   256  C  C6    . DG  B 1 1   ? 82.263  82.853 -3.494  1.00 47.87 ? 1   DG  C C6    1 
ATOM   257  O  O6    . DG  B 1 1   ? 82.869  83.284 -2.501  1.00 45.88 ? 1   DG  C O6    1 
ATOM   258  N  N1    . DG  B 1 1   ? 82.948  82.131 -4.466  1.00 47.28 ? 1   DG  C N1    1 
ATOM   259  C  C2    . DG  B 1 1   ? 82.400  81.645 -5.622  1.00 47.05 ? 1   DG  C C2    1 
ATOM   260  N  N2    . DG  B 1 1   ? 83.232  80.973 -6.437  1.00 44.23 ? 1   DG  C N2    1 
ATOM   261  N  N3    . DG  B 1 1   ? 81.130  81.802 -5.958  1.00 49.11 ? 1   DG  C N3    1 
ATOM   262  C  C4    . DG  B 1 1   ? 80.446  82.486 -5.022  1.00 49.90 ? 1   DG  C C4    1 
ATOM   263  P  P     . DC  B 1 2   ? 75.409  80.285 -8.206  1.00 63.56 ? 2   DC  C P     1 
ATOM   264  O  OP1   . DC  B 1 2   ? 74.803  80.159 -9.557  1.00 62.42 ? 2   DC  C OP1   1 
ATOM   265  O  OP2   . DC  B 1 2   ? 74.574  80.059 -6.996  1.00 63.64 ? 2   DC  C OP2   1 
ATOM   266  O  "O5'" . DC  B 1 2   ? 76.657  79.301 -8.145  1.00 61.65 ? 2   DC  C "O5'" 1 
ATOM   267  C  "C5'" . DC  B 1 2   ? 77.660  79.358 -9.150  1.00 58.75 ? 2   DC  C "C5'" 1 
ATOM   268  C  "C4'" . DC  B 1 2   ? 78.771  78.388 -8.835  1.00 57.76 ? 2   DC  C "C4'" 1 
ATOM   269  O  "O4'" . DC  B 1 2   ? 79.569  78.853 -7.720  1.00 56.04 ? 2   DC  C "O4'" 1 
ATOM   270  C  "C3'" . DC  B 1 2   ? 78.316  76.976 -8.469  1.00 57.20 ? 2   DC  C "C3'" 1 
ATOM   271  O  "O3'" . DC  B 1 2   ? 79.234  76.064 -9.062  1.00 57.73 ? 2   DC  C "O3'" 1 
ATOM   272  C  "C2'" . DC  B 1 2   ? 78.458  76.947 -6.956  1.00 54.57 ? 2   DC  C "C2'" 1 
ATOM   273  C  "C1'" . DC  B 1 2   ? 79.690  77.813 -6.764  1.00 52.97 ? 2   DC  C "C1'" 1 
ATOM   274  N  N1    . DC  B 1 2   ? 79.861  78.434 -5.440  1.00 48.95 ? 2   DC  C N1    1 
ATOM   275  C  C2    . DC  B 1 2   ? 81.134  78.436 -4.870  1.00 46.60 ? 2   DC  C C2    1 
ATOM   276  O  O2    . DC  B 1 2   ? 82.066  77.902 -5.487  1.00 48.29 ? 2   DC  C O2    1 
ATOM   277  N  N3    . DC  B 1 2   ? 81.322  79.019 -3.669  1.00 45.32 ? 2   DC  C N3    1 
ATOM   278  C  C4    . DC  B 1 2   ? 80.297  79.592 -3.038  1.00 46.21 ? 2   DC  C C4    1 
ATOM   279  N  N4    . DC  B 1 2   ? 80.538  80.172 -1.858  1.00 41.98 ? 2   DC  C N4    1 
ATOM   280  C  C5    . DC  B 1 2   ? 78.980  79.598 -3.590  1.00 46.58 ? 2   DC  C C5    1 
ATOM   281  C  C6    . DC  B 1 2   ? 78.809  79.009 -4.782  1.00 48.30 ? 2   DC  C C6    1 
ATOM   282  P  P     . DA  B 1 3   ? 78.735  74.618 -9.528  1.00 60.90 ? 3   DA  C P     1 
ATOM   283  O  OP1   . DA  B 1 3   ? 79.112  74.460 -10.957 1.00 60.58 ? 3   DA  C OP1   1 
ATOM   284  O  OP2   . DA  B 1 3   ? 77.321  74.423 -9.113  1.00 60.84 ? 3   DA  C OP2   1 
ATOM   285  O  "O5'" . DA  B 1 3   ? 79.662  73.650 -8.674  1.00 59.47 ? 3   DA  C "O5'" 1 
ATOM   286  C  "C5'" . DA  B 1 3   ? 81.067  73.641 -8.889  1.00 57.38 ? 3   DA  C "C5'" 1 
ATOM   287  C  "C4'" . DA  B 1 3   ? 81.775  73.078 -7.682  1.00 54.76 ? 3   DA  C "C4'" 1 
ATOM   288  O  "O4'" . DA  B 1 3   ? 81.923  74.096 -6.656  1.00 54.18 ? 3   DA  C "O4'" 1 
ATOM   289  C  "C3'" . DA  B 1 3   ? 81.038  71.904 -7.035  1.00 51.74 ? 3   DA  C "C3'" 1 
ATOM   290  O  "O3'" . DA  B 1 3   ? 81.916  70.806 -6.820  1.00 49.15 ? 3   DA  C "O3'" 1 
ATOM   291  C  "C2'" . DA  B 1 3   ? 80.598  72.455 -5.695  1.00 53.53 ? 3   DA  C "C2'" 1 
ATOM   292  C  "C1'" . DA  B 1 3   ? 81.652  73.507 -5.407  1.00 51.71 ? 3   DA  C "C1'" 1 
ATOM   293  N  N9    . DA  B 1 3   ? 81.156  74.528 -4.485  1.00 47.48 ? 3   DA  C N9    1 
ATOM   294  C  C8    . DA  B 1 3   ? 79.878  75.013 -4.411  1.00 46.10 ? 3   DA  C C8    1 
ATOM   295  N  N7    . DA  B 1 3   ? 79.662  75.776 -3.371  1.00 47.04 ? 3   DA  C N7    1 
ATOM   296  C  C5    . DA  B 1 3   ? 80.891  75.830 -2.737  1.00 44.33 ? 3   DA  C C5    1 
ATOM   297  C  C6    . DA  B 1 3   ? 81.307  76.447 -1.556  1.00 43.69 ? 3   DA  C C6    1 
ATOM   298  N  N6    . DA  B 1 3   ? 80.484  77.121 -0.756  1.00 41.93 ? 3   DA  C N6    1 
ATOM   299  N  N1    . DA  B 1 3   ? 82.609  76.330 -1.208  1.00 46.23 ? 3   DA  C N1    1 
ATOM   300  C  C2    . DA  B 1 3   ? 83.420  75.618 -2.003  1.00 45.31 ? 3   DA  C C2    1 
ATOM   301  N  N3    . DA  B 1 3   ? 83.137  74.968 -3.128  1.00 46.78 ? 3   DA  C N3    1 
ATOM   302  C  C4    . DA  B 1 3   ? 81.837  75.110 -3.443  1.00 46.98 ? 3   DA  C C4    1 
ATOM   303  P  P     . DT  B 1 4   ? 81.368  69.471 -6.109  1.00 45.95 ? 4   DT  C P     1 
ATOM   304  O  OP1   . DT  B 1 4   ? 81.653  68.346 -7.029  1.00 42.94 ? 4   DT  C OP1   1 
ATOM   305  O  OP2   . DT  B 1 4   ? 79.984  69.686 -5.625  1.00 44.36 ? 4   DT  C OP2   1 
ATOM   306  O  "O5'" . DT  B 1 4   ? 82.303  69.360 -4.826  1.00 43.68 ? 4   DT  C "O5'" 1 
ATOM   307  C  "C5'" . DT  B 1 4   ? 83.716  69.434 -4.957  1.00 42.11 ? 4   DT  C "C5'" 1 
ATOM   308  C  "C4'" . DT  B 1 4   ? 84.351  69.734 -3.624  1.00 40.88 ? 4   DT  C "C4'" 1 
ATOM   309  O  "O4'" . DT  B 1 4   ? 84.093  71.109 -3.248  1.00 42.00 ? 4   DT  C "O4'" 1 
ATOM   310  C  "C3'" . DT  B 1 4   ? 83.823  68.947 -2.436  1.00 40.64 ? 4   DT  C "C3'" 1 
ATOM   311  O  "O3'" . DT  B 1 4   ? 84.357  67.627 -2.382  1.00 38.50 ? 4   DT  C "O3'" 1 
ATOM   312  C  "C2'" . DT  B 1 4   ? 84.292  69.805 -1.268  1.00 38.64 ? 4   DT  C "C2'" 1 
ATOM   313  C  "C1'" . DT  B 1 4   ? 84.115  71.218 -1.834  1.00 39.84 ? 4   DT  C "C1'" 1 
ATOM   314  N  N1    . DT  B 1 4   ? 82.867  71.862 -1.382  1.00 39.02 ? 4   DT  C N1    1 
ATOM   315  C  C2    . DT  B 1 4   ? 82.930  72.581 -0.215  1.00 38.80 ? 4   DT  C C2    1 
ATOM   316  O  O2    . DT  B 1 4   ? 83.958  72.703 0.430   1.00 40.59 ? 4   DT  C O2    1 
ATOM   317  N  N3    . DT  B 1 4   ? 81.747  73.152 0.174   1.00 37.15 ? 4   DT  C N3    1 
ATOM   318  C  C4    . DT  B 1 4   ? 80.533  73.080 -0.472  1.00 37.29 ? 4   DT  C C4    1 
ATOM   319  O  O4    . DT  B 1 4   ? 79.553  73.666 0.004   1.00 35.99 ? 4   DT  C O4    1 
ATOM   320  C  C5    . DT  B 1 4   ? 80.535  72.293 -1.696  1.00 36.59 ? 4   DT  C C5    1 
ATOM   321  C  C7    . DT  B 1 4   ? 79.260  72.120 -2.453  1.00 38.40 ? 4   DT  C C7    1 
ATOM   322  C  C6    . DT  B 1 4   ? 81.691  71.741 -2.088  1.00 37.00 ? 4   DT  C C6    1 
ATOM   323  P  P     . DG  B 1 5   ? 83.453  66.429 -1.799  1.00 36.68 ? 5   DG  C P     1 
ATOM   324  O  OP1   . DG  B 1 5   ? 84.273  65.196 -1.812  1.00 36.30 ? 5   DG  C OP1   1 
ATOM   325  O  OP2   . DG  B 1 5   ? 82.134  66.446 -2.497  1.00 36.78 ? 5   DG  C OP2   1 
ATOM   326  O  "O5'" . DG  B 1 5   ? 83.219  66.832 -0.279  1.00 36.19 ? 5   DG  C "O5'" 1 
ATOM   327  C  "C5'" . DG  B 1 5   ? 84.320  66.914 0.610   1.00 34.94 ? 5   DG  C "C5'" 1 
ATOM   328  C  "C4'" . DG  B 1 5   ? 83.874  67.399 1.967   1.00 35.57 ? 5   DG  C "C4'" 1 
ATOM   329  O  "O4'" . DG  B 1 5   ? 83.544  68.810 1.951   1.00 33.81 ? 5   DG  C "O4'" 1 
ATOM   330  C  "C3'" . DG  B 1 5   ? 82.631  66.775 2.576   1.00 32.95 ? 5   DG  C "C3'" 1 
ATOM   331  O  "O3'" . DG  B 1 5   ? 82.953  65.479 3.056   1.00 34.57 ? 5   DG  C "O3'" 1 
ATOM   332  C  "C2'" . DG  B 1 5   ? 82.345  67.749 3.718   1.00 32.24 ? 5   DG  C "C2'" 1 
ATOM   333  C  "C1'" . DG  B 1 5   ? 82.772  69.094 3.106   1.00 32.66 ? 5   DG  C "C1'" 1 
ATOM   334  N  N9    . DG  B 1 5   ? 81.617  69.890 2.740   1.00 31.54 ? 5   DG  C N9    1 
ATOM   335  C  C8    . DG  B 1 5   ? 80.735  69.683 1.704   1.00 31.33 ? 5   DG  C C8    1 
ATOM   336  N  N7    . DG  B 1 5   ? 79.726  70.510 1.715   1.00 29.44 ? 5   DG  C N7    1 
ATOM   337  C  C5    . DG  B 1 5   ? 79.973  71.321 2.810   1.00 27.23 ? 5   DG  C C5    1 
ATOM   338  C  C6    . DG  B 1 5   ? 79.215  72.394 3.342   1.00 26.81 ? 5   DG  C C6    1 
ATOM   339  O  O6    . DG  B 1 5   ? 78.125  72.827 2.957   1.00 29.75 ? 5   DG  C O6    1 
ATOM   340  N  N1    . DG  B 1 5   ? 79.842  72.966 4.443   1.00 26.13 ? 5   DG  C N1    1 
ATOM   341  C  C2    . DG  B 1 5   ? 81.041  72.548 4.975   1.00 30.13 ? 5   DG  C C2    1 
ATOM   342  N  N2    . DG  B 1 5   ? 81.507  73.239 6.042   1.00 29.52 ? 5   DG  C N2    1 
ATOM   343  N  N3    . DG  B 1 5   ? 81.742  71.529 4.503   1.00 28.23 ? 5   DG  C N3    1 
ATOM   344  C  C4    . DG  B 1 5   ? 81.147  70.978 3.429   1.00 28.49 ? 5   DG  C C4    1 
ATOM   345  P  P     . DA  B 1 6   ? 81.786  64.480 3.525   1.00 30.50 ? 6   DA  C P     1 
ATOM   346  O  OP1   . DA  B 1 6   ? 82.457  63.238 4.007   1.00 32.87 ? 6   DA  C OP1   1 
ATOM   347  O  OP2   . DA  B 1 6   ? 80.769  64.392 2.455   1.00 31.60 ? 6   DA  C OP2   1 
ATOM   348  O  "O5'" . DA  B 1 6   ? 81.185  65.218 4.795   1.00 32.30 ? 6   DA  C "O5'" 1 
ATOM   349  C  "C5'" . DA  B 1 6   ? 79.789  65.414 4.966   1.00 29.98 ? 6   DA  C "C5'" 1 
ATOM   350  C  "C4'" . DA  B 1 6   ? 79.574  66.606 5.862   1.00 29.76 ? 6   DA  C "C4'" 1 
ATOM   351  O  "O4'" . DA  B 1 6   ? 79.291  67.776 5.064   1.00 30.64 ? 6   DA  C "O4'" 1 
ATOM   352  C  "C3'" . DA  B 1 6   ? 78.422  66.545 6.837   1.00 30.55 ? 6   DA  C "C3'" 1 
ATOM   353  O  "O3'" . DA  B 1 6   ? 78.874  65.854 7.986   1.00 31.34 ? 6   DA  C "O3'" 1 
ATOM   354  C  "C2'" . DA  B 1 6   ? 78.196  68.019 7.160   1.00 30.63 ? 6   DA  C "C2'" 1 
ATOM   355  C  "C1'" . DA  B 1 6   ? 78.567  68.697 5.839   1.00 29.31 ? 6   DA  C "C1'" 1 
ATOM   356  N  N9    . DA  B 1 6   ? 77.435  69.193 5.059   1.00 30.24 ? 6   DA  C N9    1 
ATOM   357  C  C8    . DA  B 1 6   ? 76.764  68.643 3.993   1.00 30.18 ? 6   DA  C C8    1 
ATOM   358  N  N7    . DA  B 1 6   ? 75.776  69.393 3.549   1.00 28.41 ? 6   DA  C N7    1 
ATOM   359  C  C5    . DA  B 1 6   ? 75.809  70.506 4.376   1.00 29.19 ? 6   DA  C C5    1 
ATOM   360  C  C6    . DA  B 1 6   ? 75.028  71.671 4.431   1.00 29.31 ? 6   DA  C C6    1 
ATOM   361  N  N6    . DA  B 1 6   ? 74.015  71.931 3.608   1.00 27.30 ? 6   DA  C N6    1 
ATOM   362  N  N1    . DA  B 1 6   ? 75.330  72.579 5.380   1.00 31.97 ? 6   DA  C N1    1 
ATOM   363  C  C2    . DA  B 1 6   ? 76.347  72.328 6.210   1.00 31.74 ? 6   DA  C C2    1 
ATOM   364  N  N3    . DA  B 1 6   ? 77.150  71.276 6.260   1.00 31.05 ? 6   DA  C N3    1 
ATOM   365  C  C4    . DA  B 1 6   ? 76.824  70.393 5.305   1.00 30.61 ? 6   DA  C C4    1 
ATOM   366  P  P     . DT  B 1 7   ? 77.812  65.312 9.051   1.00 32.62 ? 7   DT  C P     1 
ATOM   367  O  OP1   . DT  B 1 7   ? 78.580  64.388 9.931   1.00 30.91 ? 7   DT  C OP1   1 
ATOM   368  O  OP2   . DT  B 1 7   ? 76.621  64.825 8.306   1.00 32.42 ? 7   DT  C OP2   1 
ATOM   369  O  "O5'" . DT  B 1 7   ? 77.406  66.605 9.879   1.00 30.48 ? 7   DT  C "O5'" 1 
ATOM   370  C  "C5'" . DT  B 1 7   ? 78.407  67.361 10.540  1.00 30.27 ? 7   DT  C "C5'" 1 
ATOM   371  C  "C4'" . DT  B 1 7   ? 77.788  68.537 11.246  1.00 32.22 ? 7   DT  C "C4'" 1 
ATOM   372  O  "O4'" . DT  B 1 7   ? 77.067  69.328 10.270  1.00 33.97 ? 7   DT  C "O4'" 1 
ATOM   373  C  "C3'" . DT  B 1 7   ? 76.775  68.169 12.334  1.00 33.54 ? 7   DT  C "C3'" 1 
ATOM   374  O  "O3'" . DT  B 1 7   ? 76.953  69.063 13.432  1.00 38.92 ? 7   DT  C "O3'" 1 
ATOM   375  C  "C2'" . DT  B 1 7   ? 75.432  68.365 11.661  1.00 33.07 ? 7   DT  C "C2'" 1 
ATOM   376  C  "C1'" . DT  B 1 7   ? 75.713  69.479 10.673  1.00 32.52 ? 7   DT  C "C1'" 1 
ATOM   377  N  N1    . DT  B 1 7   ? 74.877  69.440 9.467   1.00 30.74 ? 7   DT  C N1    1 
ATOM   378  C  C2    . DT  B 1 7   ? 74.156  70.563 9.184   1.00 28.42 ? 7   DT  C C2    1 
ATOM   379  O  O2    . DT  B 1 7   ? 74.186  71.551 9.886   1.00 28.96 ? 7   DT  C O2    1 
ATOM   380  N  N3    . DT  B 1 7   ? 73.403  70.494 8.048   1.00 27.62 ? 7   DT  C N3    1 
ATOM   381  C  C4    . DT  B 1 7   ? 73.317  69.435 7.169   1.00 28.40 ? 7   DT  C C4    1 
ATOM   382  O  O4    . DT  B 1 7   ? 72.618  69.534 6.165   1.00 27.69 ? 7   DT  C O4    1 
ATOM   383  C  C5    . DT  B 1 7   ? 74.102  68.272 7.529   1.00 29.46 ? 7   DT  C C5    1 
ATOM   384  C  C7    . DT  B 1 7   ? 74.079  67.071 6.635   1.00 28.93 ? 7   DT  C C7    1 
ATOM   385  C  C6    . DT  B 1 7   ? 74.828  68.329 8.652   1.00 31.03 ? 7   DT  C C6    1 
ATOM   386  P  P     . DC  B 1 8   ? 75.907  69.080 14.646  1.00 38.20 ? 8   DC  C P     1 
ATOM   387  O  OP1   . DC  B 1 8   ? 76.724  69.213 15.874  1.00 38.25 ? 8   DC  C OP1   1 
ATOM   388  O  OP2   . DC  B 1 8   ? 74.943  67.961 14.527  1.00 39.81 ? 8   DC  C OP2   1 
ATOM   389  O  "O5'" . DC  B 1 8   ? 75.145  70.456 14.412  1.00 39.63 ? 8   DC  C "O5'" 1 
ATOM   390  C  "C5'" . DC  B 1 8   ? 75.885  71.638 14.115  1.00 39.56 ? 8   DC  C "C5'" 1 
ATOM   391  C  "C4'" . DC  B 1 8   ? 74.956  72.821 13.988  1.00 40.89 ? 8   DC  C "C4'" 1 
ATOM   392  O  "O4'" . DC  B 1 8   ? 74.126  72.670 12.814  1.00 41.80 ? 8   DC  C "O4'" 1 
ATOM   393  C  "C3'" . DC  B 1 8   ? 73.999  73.024 15.160  1.00 40.62 ? 8   DC  C "C3'" 1 
ATOM   394  O  "O3'" . DC  B 1 8   ? 73.841  74.431 15.369  1.00 44.96 ? 8   DC  C "O3'" 1 
ATOM   395  C  "C2'" . DC  B 1 8   ? 72.712  72.376 14.672  1.00 40.81 ? 8   DC  C "C2'" 1 
ATOM   396  C  "C1'" . DC  B 1 8   ? 72.749  72.654 13.177  1.00 40.91 ? 8   DC  C "C1'" 1 
ATOM   397  N  N1    . DC  B 1 8   ? 72.088  71.655 12.321  1.00 38.48 ? 8   DC  C N1    1 
ATOM   398  C  C2    . DC  B 1 8   ? 70.995  72.046 11.549  1.00 38.85 ? 8   DC  C C2    1 
ATOM   399  O  O2    . DC  B 1 8   ? 70.568  73.206 11.660  1.00 39.06 ? 8   DC  C O2    1 
ATOM   400  N  N3    . DC  B 1 8   ? 70.428  71.153 10.702  1.00 36.72 ? 8   DC  C N3    1 
ATOM   401  C  C4    . DC  B 1 8   ? 70.909  69.911 10.627  1.00 36.27 ? 8   DC  C C4    1 
ATOM   402  N  N4    . DC  B 1 8   ? 70.339  69.068 9.763   1.00 36.76 ? 8   DC  C N4    1 
ATOM   403  C  C5    . DC  B 1 8   ? 72.000  69.477 11.431  1.00 35.62 ? 8   DC  C C5    1 
ATOM   404  C  C6    . DC  B 1 8   ? 72.553  70.372 12.257  1.00 37.87 ? 8   DC  C C6    1 
ATOM   405  P  P     . DA  B 1 9   ? 73.183  74.981 16.729  1.00 44.91 ? 9   DA  C P     1 
ATOM   406  O  OP1   . DA  B 1 9   ? 73.534  76.416 16.835  1.00 48.59 ? 9   DA  C OP1   1 
ATOM   407  O  OP2   . DA  B 1 9   ? 73.515  74.068 17.843  1.00 45.08 ? 9   DA  C OP2   1 
ATOM   408  O  "O5'" . DA  B 1 9   ? 71.619  74.893 16.436  1.00 47.08 ? 9   DA  C "O5'" 1 
ATOM   409  C  "C5'" . DA  B 1 9   ? 70.958  75.930 15.708  1.00 46.80 ? 9   DA  C "C5'" 1 
ATOM   410  C  "C4'" . DA  B 1 9   ? 69.468  75.687 15.688  1.00 48.59 ? 9   DA  C "C4'" 1 
ATOM   411  O  "O4'" . DA  B 1 9   ? 69.143  74.596 14.796  1.00 48.19 ? 9   DA  C "O4'" 1 
ATOM   412  C  "C3'" . DA  B 1 9   ? 68.846  75.316 17.037  1.00 50.93 ? 9   DA  C "C3'" 1 
ATOM   413  O  "O3'" . DA  B 1 9   ? 67.505  75.808 17.061  1.00 57.33 ? 9   DA  C "O3'" 1 
ATOM   414  C  "C2'" . DA  B 1 9   ? 68.756  73.805 16.951  1.00 48.47 ? 9   DA  C "C2'" 1 
ATOM   415  C  "C1'" . DA  B 1 9   ? 68.340  73.663 15.500  1.00 45.42 ? 9   DA  C "C1'" 1 
ATOM   416  N  N9    . DA  B 1 9   ? 68.528  72.353 14.889  1.00 41.25 ? 9   DA  C N9    1 
ATOM   417  C  C8    . DA  B 1 9   ? 69.375  71.336 15.252  1.00 39.60 ? 9   DA  C C8    1 
ATOM   418  N  N7    . DA  B 1 9   ? 69.307  70.290 14.467  1.00 39.68 ? 9   DA  C N7    1 
ATOM   419  C  C5    . DA  B 1 9   ? 68.350  70.644 13.524  1.00 37.81 ? 9   DA  C C5    1 
ATOM   420  C  C6    . DA  B 1 9   ? 67.831  69.973 12.406  1.00 37.61 ? 9   DA  C C6    1 
ATOM   421  N  N6    . DA  B 1 9   ? 68.232  68.762 12.013  1.00 35.81 ? 9   DA  C N6    1 
ATOM   422  N  N1    . DA  B 1 9   ? 66.878  70.600 11.687  1.00 37.41 ? 9   DA  C N1    1 
ATOM   423  C  C2    . DA  B 1 9   ? 66.493  71.828 12.063  1.00 37.43 ? 9   DA  C C2    1 
ATOM   424  N  N3    . DA  B 1 9   ? 66.918  72.566 13.082  1.00 38.32 ? 9   DA  C N3    1 
ATOM   425  C  C4    . DA  B 1 9   ? 67.856  71.906 13.781  1.00 38.17 ? 9   DA  C C4    1 
ATOM   426  P  P     . DT  B 1 10  ? 67.081  76.962 18.094  1.00 59.38 ? 10  DT  C P     1 
ATOM   427  O  OP1   . DT  B 1 10  ? 68.156  77.981 18.148  1.00 59.62 ? 10  DT  C OP1   1 
ATOM   428  O  OP2   . DT  B 1 10  ? 66.611  76.321 19.347  1.00 59.31 ? 10  DT  C OP2   1 
ATOM   429  O  "O5'" . DT  B 1 10  ? 65.845  77.617 17.346  1.00 58.94 ? 10  DT  C "O5'" 1 
ATOM   430  C  "C5'" . DT  B 1 10  ? 65.986  78.082 16.007  1.00 60.25 ? 10  DT  C "C5'" 1 
ATOM   431  C  "C4'" . DT  B 1 10  ? 64.828  77.600 15.169  1.00 61.55 ? 10  DT  C "C4'" 1 
ATOM   432  O  "O4'" . DT  B 1 10  ? 64.974  76.193 14.847  1.00 62.30 ? 10  DT  C "O4'" 1 
ATOM   433  C  "C3'" . DT  B 1 10  ? 63.476  77.738 15.864  1.00 63.37 ? 10  DT  C "C3'" 1 
ATOM   434  O  "O3'" . DT  B 1 10  ? 62.511  78.208 14.927  1.00 66.44 ? 10  DT  C "O3'" 1 
ATOM   435  C  "C2'" . DT  B 1 10  ? 63.163  76.322 16.324  1.00 61.16 ? 10  DT  C "C2'" 1 
ATOM   436  C  "C1'" . DT  B 1 10  ? 63.796  75.486 15.223  1.00 59.05 ? 10  DT  C "C1'" 1 
ATOM   437  N  N1    . DT  B 1 10  ? 64.189  74.103 15.595  1.00 52.82 ? 10  DT  C N1    1 
ATOM   438  C  C2    . DT  B 1 10  ? 63.858  73.082 14.725  1.00 49.10 ? 10  DT  C C2    1 
ATOM   439  O  O2    . DT  B 1 10  ? 63.218  73.259 13.701  1.00 48.49 ? 10  DT  C O2    1 
ATOM   440  N  N3    . DT  B 1 10  ? 64.309  71.841 15.100  1.00 46.71 ? 10  DT  C N3    1 
ATOM   441  C  C4    . DT  B 1 10  ? 65.038  71.522 16.231  1.00 46.86 ? 10  DT  C C4    1 
ATOM   442  O  O4    . DT  B 1 10  ? 65.419  70.371 16.410  1.00 44.24 ? 10  DT  C O4    1 
ATOM   443  C  C5    . DT  B 1 10  ? 65.309  72.629 17.123  1.00 47.72 ? 10  DT  C C5    1 
ATOM   444  C  C7    . DT  B 1 10  ? 66.047  72.367 18.396  1.00 46.14 ? 10  DT  C C7    1 
ATOM   445  C  C6    . DT  B 1 10  ? 64.880  73.848 16.765  1.00 50.44 ? 10  DT  C C6    1 
ATOM   446  P  P     . DG  B 1 11  ? 61.030  78.576 15.428  1.00 69.67 ? 11  DG  C P     1 
ATOM   447  O  OP1   . DG  B 1 11  ? 60.712  79.927 14.889  1.00 69.64 ? 11  DG  C OP1   1 
ATOM   448  O  OP2   . DG  B 1 11  ? 60.915  78.311 16.894  1.00 65.90 ? 11  DG  C OP2   1 
ATOM   449  O  "O5'" . DG  B 1 11  ? 60.137  77.527 14.644  1.00 64.75 ? 11  DG  C "O5'" 1 
ATOM   450  C  "C5'" . DG  B 1 11  ? 60.314  77.345 13.247  1.00 61.90 ? 11  DG  C "C5'" 1 
ATOM   451  C  "C4'" . DG  B 1 11  ? 59.419  76.233 12.767  1.00 60.73 ? 11  DG  C "C4'" 1 
ATOM   452  O  "O4'" . DG  B 1 11  ? 59.941  74.966 13.235  1.00 59.30 ? 11  DG  C "O4'" 1 
ATOM   453  C  "C3'" . DG  B 1 11  ? 57.996  76.339 13.315  1.00 58.82 ? 11  DG  C "C3'" 1 
ATOM   454  O  "O3'" . DG  B 1 11  ? 57.057  75.994 12.303  1.00 59.85 ? 11  DG  C "O3'" 1 
ATOM   455  C  "C2'" . DG  B 1 11  ? 57.975  75.348 14.465  1.00 56.55 ? 11  DG  C "C2'" 1 
ATOM   456  C  "C1'" . DG  B 1 11  ? 58.973  74.290 14.025  1.00 55.33 ? 11  DG  C "C1'" 1 
ATOM   457  N  N9    . DG  B 1 11  ? 59.681  73.642 15.122  1.00 49.96 ? 11  DG  C N9    1 
ATOM   458  C  C8    . DG  B 1 11  ? 60.029  74.201 16.326  1.00 49.20 ? 11  DG  C C8    1 
ATOM   459  N  N7    . DG  B 1 11  ? 60.683  73.381 17.101  1.00 47.89 ? 11  DG  C N7    1 
ATOM   460  C  C5    . DG  B 1 11  ? 60.768  72.209 16.365  1.00 45.16 ? 11  DG  C C5    1 
ATOM   461  C  C6    . DG  B 1 11  ? 61.378  70.974 16.686  1.00 44.56 ? 11  DG  C C6    1 
ATOM   462  O  O6    . DG  B 1 11  ? 61.987  70.662 17.718  1.00 43.63 ? 11  DG  C O6    1 
ATOM   463  N  N1    . DG  B 1 11  ? 61.233  70.050 15.655  1.00 41.63 ? 11  DG  C N1    1 
ATOM   464  C  C2    . DG  B 1 11  ? 60.583  70.285 14.471  1.00 42.51 ? 11  DG  C C2    1 
ATOM   465  N  N2    . DG  B 1 11  ? 60.537  69.264 13.604  1.00 41.67 ? 11  DG  C N2    1 
ATOM   466  N  N3    . DG  B 1 11  ? 60.014  71.439 14.159  1.00 45.09 ? 11  DG  C N3    1 
ATOM   467  C  C4    . DG  B 1 11  ? 60.147  72.348 15.147  1.00 46.29 ? 11  DG  C C4    1 
ATOM   468  P  P     . DC  B 1 12  ? 55.493  75.975 12.646  1.00 61.72 ? 12  DC  C P     1 
ATOM   469  O  OP1   . DC  B 1 12  ? 54.782  76.407 11.420  1.00 60.32 ? 12  DC  C OP1   1 
ATOM   470  O  OP2   . DC  B 1 12  ? 55.254  76.684 13.925  1.00 60.48 ? 12  DC  C OP2   1 
ATOM   471  O  "O5'" . DC  B 1 12  ? 55.214  74.423 12.844  1.00 62.09 ? 12  DC  C "O5'" 1 
ATOM   472  C  "C5'" . DC  B 1 12  ? 55.543  73.516 11.799  1.00 61.08 ? 12  DC  C "C5'" 1 
ATOM   473  C  "C4'" . DC  B 1 12  ? 55.339  72.088 12.245  1.00 60.84 ? 12  DC  C "C4'" 1 
ATOM   474  O  "O4'" . DC  B 1 12  ? 56.365  71.699 13.194  1.00 58.52 ? 12  DC  C "O4'" 1 
ATOM   475  C  "C3'" . DC  B 1 12  ? 53.991  71.790 12.906  1.00 59.66 ? 12  DC  C "C3'" 1 
ATOM   476  O  "O3'" . DC  B 1 12  ? 53.346  70.692 12.268  1.00 62.66 ? 12  DC  C "O3'" 1 
ATOM   477  C  "C2'" . DC  B 1 12  ? 54.355  71.427 14.336  1.00 58.34 ? 12  DC  C "C2'" 1 
ATOM   478  C  "C1'" . DC  B 1 12  ? 55.774  70.901 14.198  1.00 54.66 ? 12  DC  C "C1'" 1 
ATOM   479  N  N1    . DC  B 1 12  ? 56.581  71.030 15.421  1.00 49.69 ? 12  DC  C N1    1 
ATOM   480  C  C2    . DC  B 1 12  ? 57.330  69.932 15.856  1.00 46.00 ? 12  DC  C C2    1 
ATOM   481  O  O2    . DC  B 1 12  ? 57.347  68.902 15.164  1.00 45.17 ? 12  DC  C O2    1 
ATOM   482  N  N3    . DC  B 1 12  ? 58.017  70.021 17.012  1.00 44.37 ? 12  DC  C N3    1 
ATOM   483  C  C4    . DC  B 1 12  ? 57.985  71.150 17.724  1.00 46.08 ? 12  DC  C C4    1 
ATOM   484  N  N4    . DC  B 1 12  ? 58.659  71.183 18.876  1.00 47.03 ? 12  DC  C N4    1 
ATOM   485  C  C5    . DC  B 1 12  ? 57.258  72.294 17.290  1.00 45.50 ? 12  DC  C C5    1 
ATOM   486  C  C6    . DC  B 1 12  ? 56.581  72.193 16.141  1.00 47.90 ? 12  DC  C C6    1 
ATOM   487  N  N     . MET C 2 1   ? 100.899 57.705 -1.071  1.00 81.27 ? 9   MET A N     1 
ATOM   488  C  CA    . MET C 2 1   ? 99.791  58.267 -0.248  1.00 80.98 ? 9   MET A CA    1 
ATOM   489  C  C     . MET C 2 1   ? 98.456  58.007 -0.944  1.00 78.78 ? 9   MET A C     1 
ATOM   490  O  O     . MET C 2 1   ? 97.498  57.541 -0.326  1.00 78.56 ? 9   MET A O     1 
ATOM   491  C  CB    . MET C 2 1   ? 99.994  59.773 -0.058  1.00 84.24 ? 9   MET A CB    1 
ATOM   492  C  CG    . MET C 2 1   ? 101.426 60.169 0.284   1.00 87.82 ? 9   MET A CG    1 
ATOM   493  S  SD    . MET C 2 1   ? 101.603 61.940 0.603   1.00 93.42 ? 9   MET A SD    1 
ATOM   494  C  CE    . MET C 2 1   ? 101.417 62.607 -1.056  1.00 91.36 ? 9   MET A CE    1 
ATOM   495  N  N     . ILE C 2 2   ? 98.401  58.313 -2.235  1.00 75.47 ? 10  ILE A N     1 
ATOM   496  C  CA    . ILE C 2 2   ? 97.192  58.102 -3.021  1.00 72.87 ? 10  ILE A CA    1 
ATOM   497  C  C     . ILE C 2 2   ? 97.129  56.637 -3.445  1.00 69.99 ? 10  ILE A C     1 
ATOM   498  O  O     . ILE C 2 2   ? 98.040  56.132 -4.097  1.00 70.39 ? 10  ILE A O     1 
ATOM   499  C  CB    . ILE C 2 2   ? 97.202  58.977 -4.284  1.00 73.95 ? 10  ILE A CB    1 
ATOM   500  C  CG1   . ILE C 2 2   ? 97.605  60.407 -3.922  1.00 74.96 ? 10  ILE A CG1   1 
ATOM   501  C  CG2   . ILE C 2 2   ? 95.828  58.967 -4.930  1.00 73.97 ? 10  ILE A CG2   1 
ATOM   502  C  CD1   . ILE C 2 2   ? 97.715  61.331 -5.119  1.00 75.88 ? 10  ILE A CD1   1 
ATOM   503  N  N     . PRO C 2 3   ? 96.051  55.929 -3.081  1.00 67.77 ? 11  PRO A N     1 
ATOM   504  C  CA    . PRO C 2 3   ? 95.956  54.517 -3.469  1.00 65.72 ? 11  PRO A CA    1 
ATOM   505  C  C     . PRO C 2 3   ? 95.981  54.337 -4.985  1.00 63.03 ? 11  PRO A C     1 
ATOM   506  O  O     . PRO C 2 3   ? 95.480  55.181 -5.726  1.00 61.60 ? 11  PRO A O     1 
ATOM   507  C  CB    . PRO C 2 3   ? 94.633  54.078 -2.843  1.00 65.33 ? 11  PRO A CB    1 
ATOM   508  C  CG    . PRO C 2 3   ? 93.815  55.327 -2.904  1.00 66.55 ? 11  PRO A CG    1 
ATOM   509  C  CD    . PRO C 2 3   ? 94.803  56.384 -2.447  1.00 66.59 ? 11  PRO A CD    1 
ATOM   510  N  N     . GLN C 2 4   ? 96.562  53.234 -5.442  1.00 60.88 ? 12  GLN A N     1 
ATOM   511  C  CA    . GLN C 2 4   ? 96.651  52.967 -6.873  1.00 59.33 ? 12  GLN A CA    1 
ATOM   512  C  C     . GLN C 2 4   ? 95.538  52.048 -7.360  1.00 56.52 ? 12  GLN A C     1 
ATOM   513  O  O     . GLN C 2 4   ? 95.237  52.007 -8.551  1.00 55.26 ? 12  GLN A O     1 
ATOM   514  C  CB    . GLN C 2 4   ? 98.010  52.344 -7.209  1.00 61.99 ? 12  GLN A CB    1 
ATOM   515  C  CG    . GLN C 2 4   ? 99.198  53.259 -6.947  1.00 66.49 ? 12  GLN A CG    1 
ATOM   516  C  CD    . GLN C 2 4   ? 99.152  54.533 -7.773  1.00 68.71 ? 12  GLN A CD    1 
ATOM   517  O  OE1   . GLN C 2 4   ? 99.298  54.503 -8.996  1.00 70.37 ? 12  GLN A OE1   1 
ATOM   518  N  NE2   . GLN C 2 4   ? 98.942  55.662 -7.105  1.00 70.13 ? 12  GLN A NE2   1 
ATOM   519  N  N     . THR C 2 5   ? 94.932  51.316 -6.431  1.00 53.18 ? 13  THR A N     1 
ATOM   520  C  CA    . THR C 2 5   ? 93.861  50.380 -6.755  1.00 50.69 ? 13  THR A CA    1 
ATOM   521  C  C     . THR C 2 5   ? 92.763  50.402 -5.701  1.00 48.06 ? 13  THR A C     1 
ATOM   522  O  O     . THR C 2 5   ? 92.950  50.926 -4.606  1.00 46.77 ? 13  THR A O     1 
ATOM   523  C  CB    . THR C 2 5   ? 94.402  48.947 -6.829  1.00 52.25 ? 13  THR A CB    1 
ATOM   524  O  OG1   . THR C 2 5   ? 94.972  48.593 -5.562  1.00 50.62 ? 13  THR A OG1   1 
ATOM   525  C  CG2   . THR C 2 5   ? 95.473  48.838 -7.908  1.00 53.41 ? 13  THR A CG2   1 
ATOM   526  N  N     . LEU C 2 6   ? 91.616  49.822 -6.032  1.00 47.07 ? 14  LEU A N     1 
ATOM   527  C  CA    . LEU C 2 6   ? 90.511  49.769 -5.088  1.00 46.14 ? 14  LEU A CA    1 
ATOM   528  C  C     . LEU C 2 6   ? 90.961  48.986 -3.861  1.00 45.52 ? 14  LEU A C     1 
ATOM   529  O  O     . LEU C 2 6   ? 90.648  49.351 -2.727  1.00 45.97 ? 14  LEU A O     1 
ATOM   530  C  CB    . LEU C 2 6   ? 89.289  49.090 -5.720  1.00 44.86 ? 14  LEU A CB    1 
ATOM   531  C  CG    . LEU C 2 6   ? 88.065  48.973 -4.800  1.00 46.15 ? 14  LEU A CG    1 
ATOM   532  C  CD1   . LEU C 2 6   ? 87.671  50.361 -4.314  1.00 44.76 ? 14  LEU A CD1   1 
ATOM   533  C  CD2   . LEU C 2 6   ? 86.900  48.306 -5.537  1.00 45.22 ? 14  LEU A CD2   1 
ATOM   534  N  N     . GLU C 2 7   ? 91.709  47.913 -4.098  1.00 45.07 ? 15  GLU A N     1 
ATOM   535  C  CA    . GLU C 2 7   ? 92.205  47.063 -3.023  1.00 44.14 ? 15  GLU A CA    1 
ATOM   536  C  C     . GLU C 2 7   ? 93.026  47.848 -2.016  1.00 43.49 ? 15  GLU A C     1 
ATOM   537  O  O     . GLU C 2 7   ? 92.927  47.635 -0.810  1.00 42.81 ? 15  GLU A O     1 
ATOM   538  C  CB    . GLU C 2 7   ? 93.057  45.927 -3.595  1.00 45.54 ? 15  GLU A CB    1 
ATOM   539  C  CG    . GLU C 2 7   ? 93.702  45.027 -2.540  1.00 47.73 ? 15  GLU A CG    1 
ATOM   540  C  CD    . GLU C 2 7   ? 94.330  43.773 -3.144  1.00 51.43 ? 15  GLU A CD    1 
ATOM   541  O  OE1   . GLU C 2 7   ? 94.321  43.651 -4.389  1.00 49.33 ? 15  GLU A OE1   1 
ATOM   542  O  OE2   . GLU C 2 7   ? 94.830  42.912 -2.377  1.00 50.90 ? 15  GLU A OE2   1 
ATOM   543  N  N     . GLN C 2 8   ? 93.835  48.765 -2.522  1.00 43.06 ? 16  GLN A N     1 
ATOM   544  C  CA    . GLN C 2 8   ? 94.689  49.574 -1.674  1.00 42.11 ? 16  GLN A CA    1 
ATOM   545  C  C     . GLN C 2 8   ? 93.855  50.561 -0.861  1.00 41.08 ? 16  GLN A C     1 
ATOM   546  O  O     . GLN C 2 8   ? 94.128  50.782 0.317   1.00 40.40 ? 16  GLN A O     1 
ATOM   547  C  CB    . GLN C 2 8   ? 95.708  50.307 -2.548  1.00 43.40 ? 16  GLN A CB    1 
ATOM   548  C  CG    . GLN C 2 8   ? 97.105  50.393 -1.970  1.00 44.76 ? 16  GLN A CG    1 
ATOM   549  C  CD    . GLN C 2 8   ? 98.166  50.646 -3.039  1.00 47.26 ? 16  GLN A CD    1 
ATOM   550  O  OE1   . GLN C 2 8   ? 98.020  51.531 -3.889  1.00 45.76 ? 16  GLN A OE1   1 
ATOM   551  N  NE2   . GLN C 2 8   ? 99.246  49.868 -2.993  1.00 47.44 ? 16  GLN A NE2   1 
ATOM   552  N  N     . LEU C 2 9   ? 92.836  51.145 -1.493  1.00 39.64 ? 17  LEU A N     1 
ATOM   553  C  CA    . LEU C 2 9   ? 91.965  52.100 -0.820  1.00 38.61 ? 17  LEU A CA    1 
ATOM   554  C  C     . LEU C 2 9   ? 91.146  51.421 0.271   1.00 38.89 ? 17  LEU A C     1 
ATOM   555  O  O     . LEU C 2 9   ? 91.015  51.948 1.373   1.00 38.39 ? 17  LEU A O     1 
ATOM   556  C  CB    . LEU C 2 9   ? 91.014  52.763 -1.816  1.00 36.61 ? 17  LEU A CB    1 
ATOM   557  C  CG    . LEU C 2 9   ? 89.936  53.667 -1.197  1.00 36.84 ? 17  LEU A CG    1 
ATOM   558  C  CD1   . LEU C 2 9   ? 90.573  54.869 -0.502  1.00 34.37 ? 17  LEU A CD1   1 
ATOM   559  C  CD2   . LEU C 2 9   ? 88.977  54.136 -2.282  1.00 36.33 ? 17  LEU A CD2   1 
ATOM   560  N  N     . LEU C 2 10  ? 90.594  50.252 -0.041  1.00 40.09 ? 18  LEU A N     1 
ATOM   561  C  CA    . LEU C 2 10  ? 89.793  49.521 0.926   1.00 40.02 ? 18  LEU A CA    1 
ATOM   562  C  C     . LEU C 2 10  ? 90.658  49.055 2.064   1.00 40.05 ? 18  LEU A C     1 
ATOM   563  O  O     . LEU C 2 10  ? 90.198  48.927 3.192   1.00 39.67 ? 18  LEU A O     1 
ATOM   564  C  CB    . LEU C 2 10  ? 89.125  48.316 0.277   1.00 42.70 ? 18  LEU A CB    1 
ATOM   565  C  CG    . LEU C 2 10  ? 88.045  48.647 -0.753  1.00 45.97 ? 18  LEU A CG    1 
ATOM   566  C  CD1   . LEU C 2 10  ? 87.428  47.352 -1.278  1.00 45.98 ? 18  LEU A CD1   1 
ATOM   567  C  CD2   . LEU C 2 10  ? 86.979  49.524 -0.105  1.00 46.31 ? 18  LEU A CD2   1 
ATOM   568  N  N     . SER C 2 11  ? 91.921  48.798 1.765   1.00 40.76 ? 19  SER A N     1 
ATOM   569  C  CA    . SER C 2 11  ? 92.846  48.342 2.790   1.00 42.23 ? 19  SER A CA    1 
ATOM   570  C  C     . SER C 2 11  ? 93.185  49.482 3.757   1.00 40.97 ? 19  SER A C     1 
ATOM   571  O  O     . SER C 2 11  ? 93.204  49.294 4.978   1.00 42.11 ? 19  SER A O     1 
ATOM   572  C  CB    . SER C 2 11  ? 94.116  47.800 2.138   1.00 44.43 ? 19  SER A CB    1 
ATOM   573  O  OG    . SER C 2 11  ? 95.062  47.437 3.125   1.00 50.29 ? 19  SER A OG    1 
ATOM   574  N  N     . GLN C 2 12  ? 93.453  50.660 3.207   1.00 39.55 ? 20  GLN A N     1 
ATOM   575  C  CA    . GLN C 2 12  ? 93.760  51.832 4.018   1.00 40.80 ? 20  GLN A CA    1 
ATOM   576  C  C     . GLN C 2 12  ? 92.562  52.231 4.874   1.00 40.05 ? 20  GLN A C     1 
ATOM   577  O  O     . GLN C 2 12  ? 92.735  52.706 5.985   1.00 39.64 ? 20  GLN A O     1 
ATOM   578  C  CB    . GLN C 2 12  ? 94.156  53.022 3.136   1.00 39.26 ? 20  GLN A CB    1 
ATOM   579  C  CG    . GLN C 2 12  ? 95.635  53.351 3.176   1.00 48.67 ? 20  GLN A CG    1 
ATOM   580  C  CD    . GLN C 2 12  ? 96.143  53.623 4.589   1.00 50.64 ? 20  GLN A CD    1 
ATOM   581  O  OE1   . GLN C 2 12  ? 95.705  54.569 5.253   1.00 52.18 ? 20  GLN A OE1   1 
ATOM   582  N  NE2   . GLN C 2 12  ? 97.067  52.787 5.054   1.00 50.71 ? 20  GLN A NE2   1 
ATOM   583  N  N     . ALA C 2 13  ? 91.351  52.060 4.347   1.00 40.50 ? 21  ALA A N     1 
ATOM   584  C  CA    . ALA C 2 13  ? 90.152  52.413 5.100   1.00 41.50 ? 21  ALA A CA    1 
ATOM   585  C  C     . ALA C 2 13  ? 89.993  51.452 6.266   1.00 41.42 ? 21  ALA A C     1 
ATOM   586  O  O     . ALA C 2 13  ? 89.750  51.871 7.393   1.00 43.31 ? 21  ALA A O     1 
ATOM   587  C  CB    . ALA C 2 13  ? 88.918  52.355 4.206   1.00 40.33 ? 21  ALA A CB    1 
ATOM   588  N  N     . GLN C 2 14  ? 90.129  50.161 5.986   1.00 42.59 ? 22  GLN A N     1 
ATOM   589  C  CA    . GLN C 2 14  ? 90.009  49.145 7.018   1.00 43.53 ? 22  GLN A CA    1 
ATOM   590  C  C     . GLN C 2 14  ? 91.059  49.412 8.084   1.00 43.44 ? 22  GLN A C     1 
ATOM   591  O  O     . GLN C 2 14  ? 90.869  49.108 9.256   1.00 44.47 ? 22  GLN A O     1 
ATOM   592  C  CB    . GLN C 2 14  ? 90.216  47.750 6.425   1.00 45.01 ? 22  GLN A CB    1 
ATOM   593  C  CG    . GLN C 2 14  ? 89.873  46.620 7.384   1.00 49.36 ? 22  GLN A CG    1 
ATOM   594  C  CD    . GLN C 2 14  ? 88.479  46.768 7.985   1.00 49.88 ? 22  GLN A CD    1 
ATOM   595  O  OE1   . GLN C 2 14  ? 88.322  46.834 9.203   1.00 50.23 ? 22  GLN A OE1   1 
ATOM   596  N  NE2   . GLN C 2 14  ? 87.462  46.822 7.127   1.00 49.58 ? 22  GLN A NE2   1 
ATOM   597  N  N     . SER C 2 15  ? 92.168  50.002 7.669   1.00 42.12 ? 23  SER A N     1 
ATOM   598  C  CA    . SER C 2 15  ? 93.244  50.310 8.595   1.00 41.79 ? 23  SER A CA    1 
ATOM   599  C  C     . SER C 2 15  ? 92.902  51.408 9.611   1.00 42.79 ? 23  SER A C     1 
ATOM   600  O  O     . SER C 2 15  ? 93.407  51.392 10.737  1.00 42.87 ? 23  SER A O     1 
ATOM   601  C  CB    . SER C 2 15  ? 94.492  50.706 7.815   1.00 40.80 ? 23  SER A CB    1 
ATOM   602  O  OG    . SER C 2 15  ? 95.461  51.245 8.683   1.00 45.31 ? 23  SER A OG    1 
ATOM   603  N  N     . ILE C 2 16  ? 92.057  52.360 9.218   1.00 41.75 ? 24  ILE A N     1 
ATOM   604  C  CA    . ILE C 2 16  ? 91.674  53.447 10.118  1.00 39.38 ? 24  ILE A CA    1 
ATOM   605  C  C     . ILE C 2 16  ? 90.342  53.189 10.821  1.00 38.29 ? 24  ILE A C     1 
ATOM   606  O  O     . ILE C 2 16  ? 89.887  54.021 11.606  1.00 37.45 ? 24  ILE A O     1 
ATOM   607  C  CB    . ILE C 2 16  ? 91.582  54.812 9.382   1.00 38.75 ? 24  ILE A CB    1 
ATOM   608  C  CG1   . ILE C 2 16  ? 90.421  54.807 8.388   1.00 38.57 ? 24  ILE A CG1   1 
ATOM   609  C  CG2   . ILE C 2 16  ? 92.881  55.098 8.664   1.00 36.13 ? 24  ILE A CG2   1 
ATOM   610  C  CD1   . ILE C 2 16  ? 90.210  56.145 7.706   1.00 39.36 ? 24  ILE A CD1   1 
ATOM   611  N  N     . ALA C 2 17  ? 89.720  52.046 10.533  1.00 36.90 ? 25  ALA A N     1 
ATOM   612  C  CA    . ALA C 2 17  ? 88.449  51.677 11.164  1.00 36.47 ? 25  ALA A CA    1 
ATOM   613  C  C     . ALA C 2 17  ? 88.711  51.307 12.624  1.00 37.62 ? 25  ALA A C     1 
ATOM   614  O  O     . ALA C 2 17  ? 89.498  50.396 12.909  1.00 37.80 ? 25  ALA A O     1 
ATOM   615  C  CB    . ALA C 2 17  ? 87.821  50.496 10.436  1.00 35.48 ? 25  ALA A CB    1 
ATOM   616  N  N     . GLY C 2 18  ? 88.055  52.013 13.543  1.00 38.04 ? 26  GLY A N     1 
ATOM   617  C  CA    . GLY C 2 18  ? 88.246  51.754 14.961  1.00 36.51 ? 26  GLY A CA    1 
ATOM   618  C  C     . GLY C 2 18  ? 89.067  52.832 15.645  1.00 36.34 ? 26  GLY A C     1 
ATOM   619  O  O     . GLY C 2 18  ? 89.107  52.928 16.870  1.00 35.90 ? 26  GLY A O     1 
ATOM   620  N  N     . LEU C 2 19  ? 89.745  53.649 14.854  1.00 36.51 ? 27  LEU A N     1 
ATOM   621  C  CA    . LEU C 2 19  ? 90.539  54.725 15.425  1.00 36.67 ? 27  LEU A CA    1 
ATOM   622  C  C     . LEU C 2 19  ? 89.570  55.830 15.823  1.00 36.73 ? 27  LEU A C     1 
ATOM   623  O  O     . LEU C 2 19  ? 88.442  55.868 15.326  1.00 36.20 ? 27  LEU A O     1 
ATOM   624  C  CB    . LEU C 2 19  ? 91.532  55.247 14.385  1.00 37.62 ? 27  LEU A CB    1 
ATOM   625  C  CG    . LEU C 2 19  ? 92.971  54.714 14.366  1.00 41.80 ? 27  LEU A CG    1 
ATOM   626  C  CD1   . LEU C 2 19  ? 93.031  53.212 14.590  1.00 40.30 ? 27  LEU A CD1   1 
ATOM   627  C  CD2   . LEU C 2 19  ? 93.586  55.093 13.022  1.00 41.00 ? 27  LEU A CD2   1 
ATOM   628  N  N     . THR C 2 20  ? 89.991  56.705 16.733  1.00 36.25 ? 28  THR A N     1 
ATOM   629  C  CA    . THR C 2 20  ? 89.159  57.834 17.143  1.00 37.13 ? 28  THR A CA    1 
ATOM   630  C  C     . THR C 2 20  ? 89.614  59.017 16.285  1.00 35.40 ? 28  THR A C     1 
ATOM   631  O  O     . THR C 2 20  ? 90.729  59.016 15.771  1.00 36.08 ? 28  THR A O     1 
ATOM   632  C  CB    . THR C 2 20  ? 89.377  58.200 18.631  1.00 38.11 ? 28  THR A CB    1 
ATOM   633  O  OG1   . THR C 2 20  ? 90.778  58.357 18.871  1.00 40.85 ? 28  THR A OG1   1 
ATOM   634  C  CG2   . THR C 2 20  ? 88.839  57.109 19.557  1.00 38.84 ? 28  THR A CG2   1 
ATOM   635  N  N     . PHE C 2 21  ? 88.759  60.017 16.123  1.00 37.11 ? 29  PHE A N     1 
ATOM   636  C  CA    . PHE C 2 21  ? 89.114  61.200 15.340  1.00 36.48 ? 29  PHE A CA    1 
ATOM   637  C  C     . PHE C 2 21  ? 90.406  61.771 15.931  1.00 37.27 ? 29  PHE A C     1 
ATOM   638  O  O     . PHE C 2 21  ? 91.322  62.161 15.201  1.00 38.59 ? 29  PHE A O     1 
ATOM   639  C  CB    . PHE C 2 21  ? 87.998  62.259 15.420  1.00 36.85 ? 29  PHE A CB    1 
ATOM   640  C  CG    . PHE C 2 21  ? 86.666  61.815 14.841  1.00 35.85 ? 29  PHE A CG    1 
ATOM   641  C  CD1   . PHE C 2 21  ? 86.506  60.544 14.288  1.00 36.03 ? 29  PHE A CD1   1 
ATOM   642  C  CD2   . PHE C 2 21  ? 85.578  62.691 14.825  1.00 35.37 ? 29  PHE A CD2   1 
ATOM   643  C  CE1   . PHE C 2 21  ? 85.290  60.157 13.718  1.00 35.48 ? 29  PHE A CE1   1 
ATOM   644  C  CE2   . PHE C 2 21  ? 84.354  62.315 14.258  1.00 33.06 ? 29  PHE A CE2   1 
ATOM   645  C  CZ    . PHE C 2 21  ? 84.210  61.052 13.705  1.00 35.71 ? 29  PHE A CZ    1 
ATOM   646  N  N     . GLY C 2 22  ? 90.474  61.808 17.259  1.00 36.85 ? 30  GLY A N     1 
ATOM   647  C  CA    . GLY C 2 22  ? 91.654  62.330 17.934  1.00 38.39 ? 30  GLY A CA    1 
ATOM   648  C  C     . GLY C 2 22  ? 92.944  61.624 17.556  1.00 40.85 ? 30  GLY A C     1 
ATOM   649  O  O     . GLY C 2 22  ? 93.951  62.273 17.257  1.00 42.46 ? 30  GLY A O     1 
ATOM   650  N  N     . GLU C 2 23  ? 92.928  60.296 17.583  1.00 40.31 ? 31  GLU A N     1 
ATOM   651  C  CA    . GLU C 2 23  ? 94.105  59.517 17.218  1.00 43.25 ? 31  GLU A CA    1 
ATOM   652  C  C     . GLU C 2 23  ? 94.510  59.792 15.771  1.00 42.83 ? 31  GLU A C     1 
ATOM   653  O  O     . GLU C 2 23  ? 95.690  59.958 15.458  1.00 42.89 ? 31  GLU A O     1 
ATOM   654  C  CB    . GLU C 2 23  ? 93.826  58.020 17.344  1.00 45.97 ? 31  GLU A CB    1 
ATOM   655  C  CG    . GLU C 2 23  ? 93.656  57.502 18.739  1.00 50.73 ? 31  GLU A CG    1 
ATOM   656  C  CD    . GLU C 2 23  ? 93.137  56.076 18.738  1.00 56.16 ? 31  GLU A CD    1 
ATOM   657  O  OE1   . GLU C 2 23  ? 91.970  55.872 18.332  1.00 58.07 ? 31  GLU A OE1   1 
ATOM   658  O  OE2   . GLU C 2 23  ? 93.894  55.158 19.131  1.00 58.54 ? 31  GLU A OE2   1 
ATOM   659  N  N     . LEU C 2 24  ? 93.524  59.828 14.883  1.00 41.87 ? 32  LEU A N     1 
ATOM   660  C  CA    . LEU C 2 24  ? 93.808  60.052 13.477  1.00 42.54 ? 32  LEU A CA    1 
ATOM   661  C  C     . LEU C 2 24  ? 94.297  61.474 13.239  1.00 43.90 ? 32  LEU A C     1 
ATOM   662  O  O     . LEU C 2 24  ? 95.309  61.683 12.568  1.00 43.69 ? 32  LEU A O     1 
ATOM   663  C  CB    . LEU C 2 24  ? 92.563  59.755 12.640  1.00 40.83 ? 32  LEU A CB    1 
ATOM   664  C  CG    . LEU C 2 24  ? 92.702  59.801 11.120  1.00 38.59 ? 32  LEU A CG    1 
ATOM   665  C  CD1   . LEU C 2 24  ? 93.740  58.797 10.631  1.00 35.51 ? 32  LEU A CD1   1 
ATOM   666  C  CD2   . LEU C 2 24  ? 91.343  59.515 10.510  1.00 35.99 ? 32  LEU A CD2   1 
ATOM   667  N  N     . ALA C 2 25  ? 93.586  62.445 13.805  1.00 44.57 ? 33  ALA A N     1 
ATOM   668  C  CA    . ALA C 2 25  ? 93.957  63.849 13.667  1.00 45.99 ? 33  ALA A CA    1 
ATOM   669  C  C     . ALA C 2 25  ? 95.394  64.097 14.144  1.00 48.30 ? 33  ALA A C     1 
ATOM   670  O  O     . ALA C 2 25  ? 96.194  64.715 13.436  1.00 49.95 ? 33  ALA A O     1 
ATOM   671  C  CB    . ALA C 2 25  ? 92.993  64.717 14.453  1.00 44.39 ? 33  ALA A CB    1 
ATOM   672  N  N     . ASP C 2 26  ? 95.723  63.619 15.341  1.00 49.30 ? 34  ASP A N     1 
ATOM   673  C  CA    . ASP C 2 26  ? 97.072  63.806 15.872  1.00 51.04 ? 34  ASP A CA    1 
ATOM   674  C  C     . ASP C 2 26  ? 98.107  63.180 14.953  1.00 51.37 ? 34  ASP A C     1 
ATOM   675  O  O     . ASP C 2 26  ? 99.145  63.774 14.673  1.00 51.88 ? 34  ASP A O     1 
ATOM   676  C  CB    . ASP C 2 26  ? 97.200  63.178 17.258  1.00 51.42 ? 34  ASP A CB    1 
ATOM   677  C  CG    . ASP C 2 26  ? 96.379  63.899 18.306  1.00 53.15 ? 34  ASP A CG    1 
ATOM   678  O  OD1   . ASP C 2 26  ? 96.350  63.414 19.455  1.00 55.41 ? 34  ASP A OD1   1 
ATOM   679  O  OD2   . ASP C 2 26  ? 95.770  64.944 17.991  1.00 52.02 ? 34  ASP A OD2   1 
ATOM   680  N  N     . GLU C 2 27  ? 97.815  61.975 14.484  1.00 52.11 ? 35  GLU A N     1 
ATOM   681  C  CA    . GLU C 2 27  ? 98.719  61.257 13.602  1.00 52.77 ? 35  GLU A CA    1 
ATOM   682  C  C     . GLU C 2 27  ? 98.978  62.011 12.303  1.00 51.30 ? 35  GLU A C     1 
ATOM   683  O  O     . GLU C 2 27  ? 100.014 61.829 11.671  1.00 50.41 ? 35  GLU A O     1 
ATOM   684  C  CB    . GLU C 2 27  ? 98.131  59.885 13.285  1.00 55.67 ? 35  GLU A CB    1 
ATOM   685  C  CG    . GLU C 2 27  ? 99.054  58.953 12.526  1.00 61.74 ? 35  GLU A CG    1 
ATOM   686  C  CD    . GLU C 2 27  ? 98.424  57.582 12.301  1.00 66.44 ? 35  GLU A CD    1 
ATOM   687  O  OE1   . GLU C 2 27  ? 97.890  56.997 13.276  1.00 67.44 ? 35  GLU A OE1   1 
ATOM   688  O  OE2   . GLU C 2 27  ? 98.468  57.085 11.152  1.00 68.76 ? 35  GLU A OE2   1 
ATOM   689  N  N     . LEU C 2 28  ? 98.032  62.860 11.911  1.00 50.54 ? 36  LEU A N     1 
ATOM   690  C  CA    . LEU C 2 28  ? 98.153  63.616 10.671  1.00 49.03 ? 36  LEU A CA    1 
ATOM   691  C  C     . LEU C 2 28  ? 98.492  65.069 10.929  1.00 49.00 ? 36  LEU A C     1 
ATOM   692  O  O     . LEU C 2 28  ? 98.594  65.864 9.998   1.00 49.13 ? 36  LEU A O     1 
ATOM   693  C  CB    . LEU C 2 28  ? 96.848  63.532 9.879   1.00 47.41 ? 36  LEU A CB    1 
ATOM   694  C  CG    . LEU C 2 28  ? 96.405  62.156 9.381   1.00 47.59 ? 36  LEU A CG    1 
ATOM   695  C  CD1   . LEU C 2 28  ? 95.018  62.255 8.776   1.00 45.73 ? 36  LEU A CD1   1 
ATOM   696  C  CD2   . LEU C 2 28  ? 97.389  61.638 8.357   1.00 48.50 ? 36  LEU A CD2   1 
ATOM   697  N  N     . HIS C 2 29  ? 98.658  65.411 12.199  1.00 49.96 ? 37  HIS A N     1 
ATOM   698  C  CA    . HIS C 2 29  ? 98.982  66.775 12.592  1.00 51.73 ? 37  HIS A CA    1 
ATOM   699  C  C     . HIS C 2 29  ? 97.887  67.733 12.163  1.00 50.11 ? 37  HIS A C     1 
ATOM   700  O  O     . HIS C 2 29  ? 98.159  68.788 11.602  1.00 50.01 ? 37  HIS A O     1 
ATOM   701  C  CB    . HIS C 2 29  ? 100.319 67.202 11.980  1.00 55.63 ? 37  HIS A CB    1 
ATOM   702  C  CG    . HIS C 2 29  ? 101.467 66.340 12.399  1.00 60.09 ? 37  HIS A CG    1 
ATOM   703  N  ND1   . HIS C 2 29  ? 101.882 66.244 13.710  1.00 62.50 ? 37  HIS A ND1   1 
ATOM   704  C  CD2   . HIS C 2 29  ? 102.250 65.493 11.692  1.00 62.49 ? 37  HIS A CD2   1 
ATOM   705  C  CE1   . HIS C 2 29  ? 102.870 65.371 13.793  1.00 63.45 ? 37  HIS A CE1   1 
ATOM   706  N  NE2   . HIS C 2 29  ? 103.113 64.901 12.583  1.00 64.49 ? 37  HIS A NE2   1 
ATOM   707  N  N     . ILE C 2 30  ? 96.643  67.347 12.426  1.00 49.67 ? 38  ILE A N     1 
ATOM   708  C  CA    . ILE C 2 30  ? 95.486  68.171 12.086  1.00 47.37 ? 38  ILE A CA    1 
ATOM   709  C  C     . ILE C 2 30  ? 94.814  68.575 13.389  1.00 46.72 ? 38  ILE A C     1 
ATOM   710  O  O     . ILE C 2 30  ? 94.464  67.723 14.202  1.00 46.12 ? 38  ILE A O     1 
ATOM   711  C  CB    . ILE C 2 30  ? 94.472  67.391 11.213  1.00 47.20 ? 38  ILE A CB    1 
ATOM   712  C  CG1   . ILE C 2 30  ? 95.079  67.106 9.836   1.00 46.15 ? 38  ILE A CG1   1 
ATOM   713  C  CG2   . ILE C 2 30  ? 93.174  68.183 11.077  1.00 44.34 ? 38  ILE A CG2   1 
ATOM   714  C  CD1   . ILE C 2 30  ? 94.183  66.296 8.925   1.00 46.03 ? 38  ILE A CD1   1 
ATOM   715  N  N     . PRO C 2 31  ? 94.637  69.885 13.612  1.00 46.91 ? 39  PRO A N     1 
ATOM   716  C  CA    . PRO C 2 31  ? 93.998  70.351 14.850  1.00 47.14 ? 39  PRO A CA    1 
ATOM   717  C  C     . PRO C 2 31  ? 92.518  69.968 14.955  1.00 46.28 ? 39  PRO A C     1 
ATOM   718  O  O     . PRO C 2 31  ? 91.753  70.115 14.007  1.00 47.74 ? 39  PRO A O     1 
ATOM   719  C  CB    . PRO C 2 31  ? 94.235  71.863 14.811  1.00 46.73 ? 39  PRO A CB    1 
ATOM   720  C  CG    . PRO C 2 31  ? 94.263  72.167 13.344  1.00 46.67 ? 39  PRO A CG    1 
ATOM   721  C  CD    . PRO C 2 31  ? 95.061  71.017 12.769  1.00 46.36 ? 39  PRO A CD    1 
ATOM   722  N  N     . VAL C 2 32  ? 92.126  69.466 16.119  1.00 46.95 ? 40  VAL A N     1 
ATOM   723  C  CA    . VAL C 2 32  ? 90.750  69.045 16.355  1.00 45.41 ? 40  VAL A CA    1 
ATOM   724  C  C     . VAL C 2 32  ? 89.959  70.138 17.054  1.00 45.30 ? 40  VAL A C     1 
ATOM   725  O  O     . VAL C 2 32  ? 90.346  70.579 18.126  1.00 45.08 ? 40  VAL A O     1 
ATOM   726  C  CB    . VAL C 2 32  ? 90.717  67.811 17.252  1.00 44.44 ? 40  VAL A CB    1 
ATOM   727  C  CG1   . VAL C 2 32  ? 89.288  67.336 17.430  1.00 47.40 ? 40  VAL A CG1   1 
ATOM   728  C  CG2   . VAL C 2 32  ? 91.582  66.735 16.672  1.00 42.69 ? 40  VAL A CG2   1 
ATOM   729  N  N     . PRO C 2 33  ? 88.839  70.586 16.461  1.00 46.53 ? 41  PRO A N     1 
ATOM   730  C  CA    . PRO C 2 33  ? 88.008  71.639 17.069  1.00 46.37 ? 41  PRO A CA    1 
ATOM   731  C  C     . PRO C 2 33  ? 87.229  71.064 18.248  1.00 48.21 ? 41  PRO A C     1 
ATOM   732  O  O     . PRO C 2 33  ? 87.209  69.846 18.432  1.00 49.43 ? 41  PRO A O     1 
ATOM   733  C  CB    . PRO C 2 33  ? 87.096  72.053 15.927  1.00 46.06 ? 41  PRO A CB    1 
ATOM   734  C  CG    . PRO C 2 33  ? 86.890  70.757 15.199  1.00 46.30 ? 41  PRO A CG    1 
ATOM   735  C  CD    . PRO C 2 33  ? 88.287  70.172 15.157  1.00 46.40 ? 41  PRO A CD    1 
ATOM   736  N  N     . ILE C 2 34  ? 86.580  71.912 19.042  1.00 49.06 ? 42  ILE A N     1 
ATOM   737  C  CA    . ILE C 2 34  ? 85.834  71.404 20.193  1.00 49.59 ? 42  ILE A CA    1 
ATOM   738  C  C     . ILE C 2 34  ? 84.556  70.691 19.783  1.00 47.51 ? 42  ILE A C     1 
ATOM   739  O  O     . ILE C 2 34  ? 84.134  69.739 20.431  1.00 49.40 ? 42  ILE A O     1 
ATOM   740  C  CB    . ILE C 2 34  ? 85.463  72.520 21.190  1.00 52.16 ? 42  ILE A CB    1 
ATOM   741  C  CG1   . ILE C 2 34  ? 84.427  73.462 20.568  1.00 55.53 ? 42  ILE A CG1   1 
ATOM   742  C  CG2   . ILE C 2 34  ? 86.708  73.298 21.579  1.00 53.06 ? 42  ILE A CG2   1 
ATOM   743  C  CD1   . ILE C 2 34  ? 83.857  74.486 21.547  1.00 58.18 ? 42  ILE A CD1   1 
ATOM   744  N  N     . ASP C 2 35  ? 83.929  71.161 18.715  1.00 45.91 ? 43  ASP A N     1 
ATOM   745  C  CA    . ASP C 2 35  ? 82.707  70.534 18.219  1.00 43.51 ? 43  ASP A CA    1 
ATOM   746  C  C     . ASP C 2 35  ? 82.593  70.833 16.729  1.00 42.10 ? 43  ASP A C     1 
ATOM   747  O  O     . ASP C 2 35  ? 83.479  71.470 16.155  1.00 43.44 ? 43  ASP A O     1 
ATOM   748  C  CB    . ASP C 2 35  ? 81.475  71.046 18.978  1.00 40.86 ? 43  ASP A CB    1 
ATOM   749  C  CG    . ASP C 2 35  ? 81.301  72.553 18.873  1.00 42.76 ? 43  ASP A CG    1 
ATOM   750  O  OD1   . ASP C 2 35  ? 81.422  73.092 17.751  1.00 40.87 ? 43  ASP A OD1   1 
ATOM   751  O  OD2   . ASP C 2 35  ? 81.031  73.196 19.913  1.00 43.28 ? 43  ASP A OD2   1 
ATOM   752  N  N     . LEU C 2 36  ? 81.509  70.386 16.106  1.00 40.57 ? 44  LEU A N     1 
ATOM   753  C  CA    . LEU C 2 36  ? 81.326  70.592 14.674  1.00 40.93 ? 44  LEU A CA    1 
ATOM   754  C  C     . LEU C 2 36  ? 80.461  71.794 14.278  1.00 42.85 ? 44  LEU A C     1 
ATOM   755  O  O     . LEU C 2 36  ? 80.270  72.054 13.089  1.00 42.42 ? 44  LEU A O     1 
ATOM   756  C  CB    . LEU C 2 36  ? 80.760  69.310 14.049  1.00 37.41 ? 44  LEU A CB    1 
ATOM   757  C  CG    . LEU C 2 36  ? 81.607  68.037 14.219  1.00 35.37 ? 44  LEU A CG    1 
ATOM   758  C  CD1   . LEU C 2 36  ? 80.937  66.854 13.532  1.00 32.33 ? 44  LEU A CD1   1 
ATOM   759  C  CD2   . LEU C 2 36  ? 82.994  68.262 13.620  1.00 34.06 ? 44  LEU A CD2   1 
ATOM   760  N  N     . LYS C 2 37  ? 79.958  72.535 15.266  1.00 45.06 ? 45  LYS A N     1 
ATOM   761  C  CA    . LYS C 2 37  ? 79.101  73.693 15.001  1.00 47.38 ? 45  LYS A CA    1 
ATOM   762  C  C     . LYS C 2 37  ? 79.670  74.663 13.972  1.00 48.36 ? 45  LYS A C     1 
ATOM   763  O  O     . LYS C 2 37  ? 78.927  75.228 13.172  1.00 48.18 ? 45  LYS A O     1 
ATOM   764  C  CB    . LYS C 2 37  ? 78.799  74.440 16.304  1.00 49.09 ? 45  LYS A CB    1 
ATOM   765  C  CG    . LYS C 2 37  ? 77.874  73.688 17.237  1.00 53.10 ? 45  LYS A CG    1 
ATOM   766  C  CD    . LYS C 2 37  ? 77.593  74.460 18.524  1.00 55.04 ? 45  LYS A CD    1 
ATOM   767  C  CE    . LYS C 2 37  ? 76.703  73.635 19.455  1.00 58.08 ? 45  LYS A CE    1 
ATOM   768  N  NZ    . LYS C 2 37  ? 76.344  74.347 20.716  1.00 62.44 ? 45  LYS A NZ    1 
ATOM   769  N  N     . ARG C 2 38  ? 80.984  74.863 13.995  1.00 51.61 ? 46  ARG A N     1 
ATOM   770  C  CA    . ARG C 2 38  ? 81.620  75.761 13.040  1.00 54.30 ? 46  ARG A CA    1 
ATOM   771  C  C     . ARG C 2 38  ? 82.753  75.107 12.253  1.00 53.08 ? 46  ARG A C     1 
ATOM   772  O  O     . ARG C 2 38  ? 83.683  75.768 11.810  1.00 54.31 ? 46  ARG A O     1 
ATOM   773  C  CB    . ARG C 2 38  ? 82.106  77.030 13.750  1.00 59.37 ? 46  ARG A CB    1 
ATOM   774  C  CG    . ARG C 2 38  ? 80.990  78.057 13.919  1.00 65.86 ? 46  ARG A CG    1 
ATOM   775  C  CD    . ARG C 2 38  ? 81.465  79.413 14.438  1.00 70.58 ? 46  ARG A CD    1 
ATOM   776  N  NE    . ARG C 2 38  ? 80.497  80.448 14.077  1.00 76.00 ? 46  ARG A NE    1 
ATOM   777  C  CZ    . ARG C 2 38  ? 80.494  81.691 14.550  1.00 79.97 ? 46  ARG A CZ    1 
ATOM   778  N  NH1   . ARG C 2 38  ? 81.413  82.082 15.424  1.00 82.29 ? 46  ARG A NH1   1 
ATOM   779  N  NH2   . ARG C 2 38  ? 79.568  82.549 14.142  1.00 81.88 ? 46  ARG A NH2   1 
ATOM   780  N  N     . ASP C 2 39  ? 82.660  73.794 12.086  1.00 51.42 ? 47  ASP A N     1 
ATOM   781  C  CA    . ASP C 2 39  ? 83.637  73.014 11.327  1.00 49.42 ? 47  ASP A CA    1 
ATOM   782  C  C     . ASP C 2 39  ? 82.861  71.802 10.813  1.00 45.38 ? 47  ASP A C     1 
ATOM   783  O  O     . ASP C 2 39  ? 83.301  70.658 10.922  1.00 43.94 ? 47  ASP A O     1 
ATOM   784  C  CB    . ASP C 2 39  ? 84.802  72.556 12.225  1.00 54.04 ? 47  ASP A CB    1 
ATOM   785  C  CG    . ASP C 2 39  ? 85.856  73.640 12.434  1.00 58.69 ? 47  ASP A CG    1 
ATOM   786  O  OD1   . ASP C 2 39  ? 85.597  74.608 13.183  1.00 62.42 ? 47  ASP A OD1   1 
ATOM   787  O  OD2   . ASP C 2 39  ? 86.952  73.527 11.845  1.00 60.84 ? 47  ASP A OD2   1 
ATOM   788  N  N     . LYS C 2 40  ? 81.698  72.076 10.240  1.00 40.69 ? 48  LYS A N     1 
ATOM   789  C  CA    . LYS C 2 40  ? 80.819  71.030 9.756   1.00 35.90 ? 48  LYS A CA    1 
ATOM   790  C  C     . LYS C 2 40  ? 81.411  69.985 8.821   1.00 33.40 ? 48  LYS A C     1 
ATOM   791  O  O     . LYS C 2 40  ? 81.025  68.831 8.897   1.00 30.86 ? 48  LYS A O     1 
ATOM   792  C  CB    . LYS C 2 40  ? 79.562  71.665 9.155   1.00 34.71 ? 48  LYS A CB    1 
ATOM   793  C  CG    . LYS C 2 40  ? 78.746  72.441 10.203  1.00 31.61 ? 48  LYS A CG    1 
ATOM   794  C  CD    . LYS C 2 40  ? 77.425  72.961 9.652   1.00 32.17 ? 48  LYS A CD    1 
ATOM   795  C  CE    . LYS C 2 40  ? 76.651  73.743 10.714  1.00 34.13 ? 48  LYS A CE    1 
ATOM   796  N  NZ    . LYS C 2 40  ? 75.304  74.180 10.223  1.00 35.16 ? 48  LYS A NZ    1 
ATOM   797  N  N     . GLY C 2 41  ? 82.360  70.362 7.968   1.00 30.70 ? 49  GLY A N     1 
ATOM   798  C  CA    . GLY C 2 41  ? 82.940  69.389 7.062   1.00 28.92 ? 49  GLY A CA    1 
ATOM   799  C  C     . GLY C 2 41  ? 84.268  68.815 7.526   1.00 30.06 ? 49  GLY A C     1 
ATOM   800  O  O     . GLY C 2 41  ? 84.978  68.154 6.762   1.00 28.37 ? 49  GLY A O     1 
ATOM   801  N  N     . TRP C 2 42  ? 84.595  69.055 8.788   1.00 31.04 ? 50  TRP A N     1 
ATOM   802  C  CA    . TRP C 2 42  ? 85.855  68.600 9.357   1.00 32.81 ? 50  TRP A CA    1 
ATOM   803  C  C     . TRP C 2 42  ? 86.075  67.092 9.267   1.00 33.26 ? 50  TRP A C     1 
ATOM   804  O  O     . TRP C 2 42  ? 87.134  66.654 8.827   1.00 34.89 ? 50  TRP A O     1 
ATOM   805  C  CB    . TRP C 2 42  ? 85.962  69.065 10.818  1.00 33.84 ? 50  TRP A CB    1 
ATOM   806  C  CG    . TRP C 2 42  ? 87.291  68.811 11.435  1.00 34.58 ? 50  TRP A CG    1 
ATOM   807  C  CD1   . TRP C 2 42  ? 88.420  69.582 11.313  1.00 33.46 ? 50  TRP A CD1   1 
ATOM   808  C  CD2   . TRP C 2 42  ? 87.678  67.645 12.173  1.00 34.35 ? 50  TRP A CD2   1 
ATOM   809  N  NE1   . TRP C 2 42  ? 89.485  68.956 11.922  1.00 33.70 ? 50  TRP A NE1   1 
ATOM   810  C  CE2   . TRP C 2 42  ? 89.060  67.770 12.458  1.00 34.06 ? 50  TRP A CE2   1 
ATOM   811  C  CE3   . TRP C 2 42  ? 86.994  66.509 12.624  1.00 35.87 ? 50  TRP A CE3   1 
ATOM   812  C  CZ2   . TRP C 2 42  ? 89.768  66.794 13.163  1.00 34.68 ? 50  TRP A CZ2   1 
ATOM   813  C  CZ3   . TRP C 2 42  ? 87.702  65.534 13.329  1.00 35.73 ? 50  TRP A CZ3   1 
ATOM   814  C  CH2   . TRP C 2 42  ? 89.076  65.687 13.592  1.00 36.37 ? 50  TRP A CH2   1 
ATOM   815  N  N     . VAL C 2 43  ? 85.094  66.289 9.671   1.00 32.82 ? 51  VAL A N     1 
ATOM   816  C  CA    . VAL C 2 43  ? 85.293  64.849 9.609   1.00 31.67 ? 51  VAL A CA    1 
ATOM   817  C  C     . VAL C 2 43  ? 85.477  64.414 8.168   1.00 32.58 ? 51  VAL A C     1 
ATOM   818  O  O     . VAL C 2 43  ? 86.285  63.530 7.867   1.00 32.78 ? 51  VAL A O     1 
ATOM   819  C  CB    . VAL C 2 43  ? 84.122  64.072 10.219  1.00 33.02 ? 51  VAL A CB    1 
ATOM   820  C  CG1   . VAL C 2 43  ? 84.480  62.593 10.290  1.00 30.00 ? 51  VAL A CG1   1 
ATOM   821  C  CG2   . VAL C 2 43  ? 83.818  64.597 11.625  1.00 33.59 ? 51  VAL A CG2   1 
ATOM   822  N  N     . GLY C 2 44  ? 84.736  65.046 7.271   1.00 32.77 ? 52  GLY A N     1 
ATOM   823  C  CA    . GLY C 2 44  ? 84.867  64.704 5.872   1.00 33.58 ? 52  GLY A CA    1 
ATOM   824  C  C     . GLY C 2 44  ? 86.292  64.934 5.418   1.00 35.58 ? 52  GLY A C     1 
ATOM   825  O  O     . GLY C 2 44  ? 86.911  64.078 4.796   1.00 36.91 ? 52  GLY A O     1 
ATOM   826  N  N     . MET C 2 45  ? 86.837  66.092 5.759   1.00 37.46 ? 53  MET A N     1 
ATOM   827  C  CA    . MET C 2 45  ? 88.194  66.412 5.347   1.00 38.17 ? 53  MET A CA    1 
ATOM   828  C  C     . MET C 2 45  ? 89.228  65.520 6.010   1.00 37.82 ? 53  MET A C     1 
ATOM   829  O  O     . MET C 2 45  ? 90.259  65.174 5.408   1.00 38.64 ? 53  MET A O     1 
ATOM   830  C  CB    . MET C 2 45  ? 88.501  67.871 5.651   1.00 41.56 ? 53  MET A CB    1 
ATOM   831  C  CG    . MET C 2 45  ? 87.643  68.866 4.826   1.00 52.02 ? 53  MET A CG    1 
ATOM   832  S  SD    . MET C 2 45  ? 87.618  68.487 3.012   1.00 63.24 ? 53  MET A SD    1 
ATOM   833  C  CE    . MET C 2 45  ? 87.255  70.152 2.180   1.00 60.74 ? 53  MET A CE    1 
ATOM   834  N  N     . LEU C 2 46  ? 88.952  65.154 7.261   1.00 36.48 ? 54  LEU A N     1 
ATOM   835  C  CA    . LEU C 2 46  ? 89.860  64.288 8.013   1.00 37.94 ? 54  LEU A CA    1 
ATOM   836  C  C     . LEU C 2 46  ? 90.043  62.985 7.247   1.00 37.94 ? 54  LEU A C     1 
ATOM   837  O  O     . LEU C 2 46  ? 91.151  62.509 7.081   1.00 39.66 ? 54  LEU A O     1 
ATOM   838  C  CB    . LEU C 2 46  ? 89.337  64.009 9.450   1.00 38.51 ? 54  LEU A CB    1 
ATOM   839  C  CG    . LEU C 2 46  ? 90.221  63.049 10.284  1.00 41.11 ? 54  LEU A CG    1 
ATOM   840  C  CD1   . LEU C 2 46  ? 91.649  63.602 10.432  1.00 40.41 ? 54  LEU A CD1   1 
ATOM   841  C  CD2   . LEU C 2 46  ? 89.616  62.807 11.676  1.00 41.33 ? 54  LEU A CD2   1 
ATOM   842  N  N     . LEU C 2 47  ? 88.947  62.418 6.771   1.00 36.37 ? 55  LEU A N     1 
ATOM   843  C  CA    . LEU C 2 47  ? 89.008  61.184 6.017   1.00 35.84 ? 55  LEU A CA    1 
ATOM   844  C  C     . LEU C 2 47  ? 89.661  61.378 4.644   1.00 36.02 ? 55  LEU A C     1 
ATOM   845  O  O     . LEU C 2 47  ? 90.371  60.505 4.175   1.00 33.99 ? 55  LEU A O     1 
ATOM   846  C  CB    . LEU C 2 47  ? 87.605  60.601 5.844   1.00 36.62 ? 55  LEU A CB    1 
ATOM   847  C  CG    . LEU C 2 47  ? 87.016  59.659 6.906   1.00 39.75 ? 55  LEU A CG    1 
ATOM   848  C  CD1   . LEU C 2 47  ? 87.553  58.263 6.698   1.00 41.70 ? 55  LEU A CD1   1 
ATOM   849  C  CD2   . LEU C 2 47  ? 87.328  60.142 8.306   1.00 38.33 ? 55  LEU A CD2   1 
ATOM   850  N  N     . GLU C 2 48  ? 89.434  62.508 3.985   1.00 37.49 ? 56  GLU A N     1 
ATOM   851  C  CA    . GLU C 2 48  ? 90.059  62.709 2.675   1.00 38.41 ? 56  GLU A CA    1 
ATOM   852  C  C     . GLU C 2 48  ? 91.584  62.631 2.801   1.00 39.59 ? 56  GLU A C     1 
ATOM   853  O  O     . GLU C 2 48  ? 92.262  61.959 2.016   1.00 36.92 ? 56  GLU A O     1 
ATOM   854  C  CB    . GLU C 2 48  ? 89.654  64.054 2.080   1.00 37.34 ? 56  GLU A CB    1 
ATOM   855  C  CG    . GLU C 2 48  ? 88.200  64.125 1.673   1.00 39.18 ? 56  GLU A CG    1 
ATOM   856  C  CD    . GLU C 2 48  ? 87.927  65.282 0.733   1.00 39.59 ? 56  GLU A CD    1 
ATOM   857  O  OE1   . GLU C 2 48  ? 88.378  66.405 1.036   1.00 42.55 ? 56  GLU A OE1   1 
ATOM   858  O  OE2   . GLU C 2 48  ? 87.265  65.073 -0.301  1.00 36.83 ? 56  GLU A OE2   1 
ATOM   859  N  N     . ARG C 2 49  ? 92.116  63.301 3.816   1.00 40.21 ? 57  ARG A N     1 
ATOM   860  C  CA    . ARG C 2 49  ? 93.550  63.297 4.031   1.00 42.38 ? 57  ARG A CA    1 
ATOM   861  C  C     . ARG C 2 49  ? 94.059  61.931 4.442   1.00 41.70 ? 57  ARG A C     1 
ATOM   862  O  O     . ARG C 2 49  ? 95.146  61.523 4.048   1.00 43.84 ? 57  ARG A O     1 
ATOM   863  C  CB    . ARG C 2 49  ? 93.934  64.330 5.088   1.00 44.88 ? 57  ARG A CB    1 
ATOM   864  C  CG    . ARG C 2 49  ? 93.643  65.763 4.662   1.00 53.17 ? 57  ARG A CG    1 
ATOM   865  C  CD    . ARG C 2 49  ? 94.454  66.751 5.484   1.00 58.68 ? 57  ARG A CD    1 
ATOM   866  N  NE    . ARG C 2 49  ? 95.873  66.396 5.464   1.00 64.30 ? 57  ARG A NE    1 
ATOM   867  C  CZ    . ARG C 2 49  ? 96.818  67.044 6.139   1.00 66.38 ? 57  ARG A CZ    1 
ATOM   868  N  NH1   . ARG C 2 49  ? 96.499  68.091 6.892   1.00 66.39 ? 57  ARG A NH1   1 
ATOM   869  N  NH2   . ARG C 2 49  ? 98.080  66.636 6.068   1.00 67.69 ? 57  ARG A NH2   1 
ATOM   870  N  N     . ALA C 2 50  ? 93.272  61.217 5.229   1.00 40.52 ? 58  ALA A N     1 
ATOM   871  C  CA    . ALA C 2 50  ? 93.681  59.904 5.680   1.00 38.64 ? 58  ALA A CA    1 
ATOM   872  C  C     . ALA C 2 50  ? 93.657  58.864 4.561   1.00 38.13 ? 58  ALA A C     1 
ATOM   873  O  O     . ALA C 2 50  ? 94.389  57.889 4.608   1.00 39.46 ? 58  ALA A O     1 
ATOM   874  C  CB    . ALA C 2 50  ? 92.792  59.455 6.852   1.00 37.64 ? 58  ALA A CB    1 
ATOM   875  N  N     . LEU C 2 51  ? 92.832  59.059 3.545   1.00 39.01 ? 59  LEU A N     1 
ATOM   876  C  CA    . LEU C 2 51  ? 92.778  58.066 2.483   1.00 39.75 ? 59  LEU A CA    1 
ATOM   877  C  C     . LEU C 2 51  ? 93.408  58.513 1.169   1.00 40.25 ? 59  LEU A C     1 
ATOM   878  O  O     . LEU C 2 51  ? 93.366  57.785 0.177   1.00 39.42 ? 59  LEU A O     1 
ATOM   879  C  CB    . LEU C 2 51  ? 91.333  57.625 2.257   1.00 39.87 ? 59  LEU A CB    1 
ATOM   880  C  CG    . LEU C 2 51  ? 90.665  57.051 3.510   1.00 39.80 ? 59  LEU A CG    1 
ATOM   881  C  CD1   . LEU C 2 51  ? 89.173  56.904 3.290   1.00 38.82 ? 59  LEU A CD1   1 
ATOM   882  C  CD2   . LEU C 2 51  ? 91.285  55.711 3.837   1.00 39.90 ? 59  LEU A CD2   1 
ATOM   883  N  N     . GLY C 2 52  ? 93.995  59.705 1.166   1.00 41.90 ? 60  GLY A N     1 
ATOM   884  C  CA    . GLY C 2 52  ? 94.642  60.205 -0.036  1.00 45.42 ? 60  GLY A CA    1 
ATOM   885  C  C     . GLY C 2 52  ? 93.691  60.620 -1.143  1.00 48.81 ? 60  GLY A C     1 
ATOM   886  O  O     . GLY C 2 52  ? 93.970  60.406 -2.325  1.00 49.23 ? 60  GLY A O     1 
ATOM   887  N  N     . ALA C 2 53  ? 92.569  61.219 -0.761  1.00 50.54 ? 61  ALA A N     1 
ATOM   888  C  CA    . ALA C 2 53  ? 91.573  61.673 -1.722  1.00 54.43 ? 61  ALA A CA    1 
ATOM   889  C  C     . ALA C 2 53  ? 91.843  63.109 -2.162  1.00 58.03 ? 61  ALA A C     1 
ATOM   890  O  O     . ALA C 2 53  ? 92.624  63.828 -1.531  1.00 57.66 ? 61  ALA A O     1 
ATOM   891  C  CB    . ALA C 2 53  ? 90.184  61.578 -1.113  1.00 52.47 ? 61  ALA A CB    1 
ATOM   892  N  N     . THR C 2 54  ? 91.192  63.520 -3.249  1.00 61.88 ? 62  THR A N     1 
ATOM   893  C  CA    . THR C 2 54  ? 91.345  64.877 -3.768  1.00 66.19 ? 62  THR A CA    1 
ATOM   894  C  C     . THR C 2 54  ? 90.701  65.859 -2.788  1.00 67.58 ? 62  THR A C     1 
ATOM   895  O  O     . THR C 2 54  ? 89.522  65.718 -2.442  1.00 66.65 ? 62  THR A O     1 
ATOM   896  C  CB    . THR C 2 54  ? 90.646  65.054 -5.145  1.00 66.97 ? 62  THR A CB    1 
ATOM   897  O  OG1   . THR C 2 54  ? 91.037  63.998 -6.028  1.00 69.53 ? 62  THR A OG1   1 
ATOM   898  C  CG2   . THR C 2 54  ? 91.041  66.381 -5.772  1.00 67.36 ? 62  THR A CG2   1 
ATOM   899  N  N     . ALA C 2 55  ? 91.481  66.842 -2.342  1.00 68.51 ? 63  ALA A N     1 
ATOM   900  C  CA    . ALA C 2 55  ? 90.991  67.855 -1.415  1.00 69.86 ? 63  ALA A CA    1 
ATOM   901  C  C     . ALA C 2 55  ? 90.450  69.032 -2.216  1.00 70.44 ? 63  ALA A C     1 
ATOM   902  O  O     . ALA C 2 55  ? 90.254  68.933 -3.428  1.00 69.71 ? 63  ALA A O     1 
ATOM   903  C  CB    . ALA C 2 55  ? 92.121  68.321 -0.504  1.00 69.75 ? 63  ALA A CB    1 
ATOM   904  N  N     . GLY C 2 56  ? 90.213  70.145 -1.530  1.00 71.58 ? 64  GLY A N     1 
ATOM   905  C  CA    . GLY C 2 56  ? 89.715  71.334 -2.196  1.00 73.68 ? 64  GLY A CA    1 
ATOM   906  C  C     . GLY C 2 56  ? 88.398  71.168 -2.930  1.00 74.67 ? 64  GLY A C     1 
ATOM   907  O  O     . GLY C 2 56  ? 87.645  70.223 -2.689  1.00 74.30 ? 64  GLY A O     1 
ATOM   908  N  N     . SER C 2 57  ? 88.129  72.095 -3.844  1.00 75.38 ? 65  SER A N     1 
ATOM   909  C  CA    . SER C 2 57  ? 86.892  72.079 -4.608  1.00 75.92 ? 65  SER A CA    1 
ATOM   910  C  C     . SER C 2 57  ? 87.022  71.348 -5.944  1.00 76.26 ? 65  SER A C     1 
ATOM   911  O  O     . SER C 2 57  ? 86.243  71.586 -6.872  1.00 76.34 ? 65  SER A O     1 
ATOM   912  C  CB    . SER C 2 57  ? 86.415  73.518 -4.832  1.00 76.27 ? 65  SER A CB    1 
ATOM   913  O  OG    . SER C 2 57  ? 86.345  74.226 -3.600  1.00 76.50 ? 65  SER A OG    1 
ATOM   914  N  N     . LYS C 2 58  ? 88.006  70.459 -6.042  1.00 76.75 ? 66  LYS A N     1 
ATOM   915  C  CA    . LYS C 2 58  ? 88.204  69.690 -7.268  1.00 78.14 ? 66  LYS A CA    1 
ATOM   916  C  C     . LYS C 2 58  ? 86.868  69.025 -7.593  1.00 79.12 ? 66  LYS A C     1 
ATOM   917  O  O     . LYS C 2 58  ? 86.329  68.266 -6.784  1.00 78.96 ? 66  LYS A O     1 
ATOM   918  C  CB    . LYS C 2 58  ? 89.288  68.643 -7.066  1.00 77.61 ? 66  LYS A CB    1 
ATOM   919  N  N     . ALA C 2 59  ? 86.351  69.310 -8.784  1.00 80.05 ? 67  ALA A N     1 
ATOM   920  C  CA    . ALA C 2 59  ? 85.055  68.808 -9.236  1.00 80.60 ? 67  ALA A CA    1 
ATOM   921  C  C     . ALA C 2 59  ? 84.729  67.306 -9.225  1.00 81.22 ? 67  ALA A C     1 
ATOM   922  O  O     . ALA C 2 59  ? 85.425  66.473 -9.816  1.00 81.31 ? 67  ALA A O     1 
ATOM   923  C  CB    . ALA C 2 59  ? 84.752  69.380 -10.620 1.00 80.72 ? 67  ALA A CB    1 
ATOM   924  N  N     . GLU C 2 60  ? 83.633  67.013 -8.529  1.00 81.22 ? 68  GLU A N     1 
ATOM   925  C  CA    . GLU C 2 60  ? 83.001  65.700 -8.370  1.00 79.52 ? 68  GLU A CA    1 
ATOM   926  C  C     . GLU C 2 60  ? 83.714  64.381 -8.074  1.00 77.84 ? 68  GLU A C     1 
ATOM   927  O  O     . GLU C 2 60  ? 83.020  63.368 -7.932  1.00 78.90 ? 68  GLU A O     1 
ATOM   928  C  CB    . GLU C 2 60  ? 82.050  65.475 -9.550  1.00 78.93 ? 68  GLU A CB    1 
ATOM   929  N  N     . GLN C 2 61  ? 85.041  64.320 -7.986  1.00 73.50 ? 69  GLN A N     1 
ATOM   930  C  CA    . GLN C 2 61  ? 85.594  63.004 -7.676  1.00 69.40 ? 69  GLN A CA    1 
ATOM   931  C  C     . GLN C 2 61  ? 86.908  62.841 -6.924  1.00 64.92 ? 69  GLN A C     1 
ATOM   932  O  O     . GLN C 2 61  ? 87.988  63.200 -7.393  1.00 64.88 ? 69  GLN A O     1 
ATOM   933  C  CB    . GLN C 2 61  ? 85.573  62.113 -8.927  1.00 70.71 ? 69  GLN A CB    1 
ATOM   934  C  CG    . GLN C 2 61  ? 84.454  61.062 -8.815  1.00 73.55 ? 69  GLN A CG    1 
ATOM   935  C  CD    . GLN C 2 61  ? 84.288  60.168 -10.031 1.00 75.64 ? 69  GLN A CD    1 
ATOM   936  O  OE1   . GLN C 2 61  ? 85.248  59.876 -10.749 1.00 75.98 ? 69  GLN A OE1   1 
ATOM   937  N  NE2   . GLN C 2 61  ? 83.060  59.704 -10.250 1.00 76.69 ? 69  GLN A NE2   1 
ATOM   938  N  N     . ASP C 2 62  ? 86.764  62.259 -5.736  1.00 58.64 ? 70  ASP A N     1 
ATOM   939  C  CA    . ASP C 2 62  ? 87.850  61.990 -4.810  1.00 53.26 ? 70  ASP A CA    1 
ATOM   940  C  C     . ASP C 2 62  ? 88.933  61.077 -5.384  1.00 51.50 ? 70  ASP A C     1 
ATOM   941  O  O     . ASP C 2 62  ? 90.117  61.307 -5.167  1.00 49.95 ? 70  ASP A O     1 
ATOM   942  C  CB    . ASP C 2 62  ? 87.273  61.379 -3.525  1.00 50.15 ? 70  ASP A CB    1 
ATOM   943  C  CG    . ASP C 2 62  ? 86.174  62.240 -2.910  1.00 46.88 ? 70  ASP A CG    1 
ATOM   944  O  OD1   . ASP C 2 62  ? 86.433  63.438 -2.653  1.00 42.34 ? 70  ASP A OD1   1 
ATOM   945  O  OD2   . ASP C 2 62  ? 85.058  61.718 -2.686  1.00 42.89 ? 70  ASP A OD2   1 
ATOM   946  N  N     . PHE C 2 63  ? 88.530  60.034 -6.100  1.00 49.72 ? 71  PHE A N     1 
ATOM   947  C  CA    . PHE C 2 63  ? 89.496  59.115 -6.690  1.00 49.26 ? 71  PHE A CA    1 
ATOM   948  C  C     . PHE C 2 63  ? 89.136  58.916 -8.161  1.00 49.54 ? 71  PHE A C     1 
ATOM   949  O  O     . PHE C 2 63  ? 88.672  57.852 -8.570  1.00 47.72 ? 71  PHE A O     1 
ATOM   950  C  CB    . PHE C 2 63  ? 89.486  57.777 -5.943  1.00 46.68 ? 71  PHE A CB    1 
ATOM   951  C  CG    . PHE C 2 63  ? 89.666  57.910 -4.456  1.00 44.66 ? 71  PHE A CG    1 
ATOM   952  C  CD1   . PHE C 2 63  ? 88.567  57.863 -3.602  1.00 43.25 ? 71  PHE A CD1   1 
ATOM   953  C  CD2   . PHE C 2 63  ? 90.935  58.076 -3.907  1.00 43.74 ? 71  PHE A CD2   1 
ATOM   954  C  CE1   . PHE C 2 63  ? 88.728  57.980 -2.219  1.00 43.52 ? 71  PHE A CE1   1 
ATOM   955  C  CE2   . PHE C 2 63  ? 91.115  58.195 -2.531  1.00 42.57 ? 71  PHE A CE2   1 
ATOM   956  C  CZ    . PHE C 2 63  ? 90.010  58.146 -1.680  1.00 43.78 ? 71  PHE A CZ    1 
ATOM   957  N  N     . SER C 2 64  ? 89.352  59.968 -8.943  1.00 51.39 ? 72  SER A N     1 
ATOM   958  C  CA    . SER C 2 64  ? 89.043  59.965 -10.365 1.00 53.23 ? 72  SER A CA    1 
ATOM   959  C  C     . SER C 2 64  ? 89.678  58.794 -11.102 1.00 53.64 ? 72  SER A C     1 
ATOM   960  O  O     . SER C 2 64  ? 89.071  58.235 -12.009 1.00 54.48 ? 72  SER A O     1 
ATOM   961  C  CB    . SER C 2 64  ? 89.478  61.297 -10.998 1.00 53.99 ? 72  SER A CB    1 
ATOM   962  O  OG    . SER C 2 64  ? 90.847  61.583 -10.739 1.00 57.05 ? 72  SER A OG    1 
ATOM   963  N  N     . HIS C 2 65  ? 90.890  58.411 -10.711 1.00 54.84 ? 73  HIS A N     1 
ATOM   964  C  CA    . HIS C 2 65  ? 91.561  57.295 -11.369 1.00 56.17 ? 73  HIS A CA    1 
ATOM   965  C  C     . HIS C 2 65  ? 90.924  55.961 -11.005 1.00 54.80 ? 73  HIS A C     1 
ATOM   966  O  O     . HIS C 2 65  ? 91.156  54.955 -11.674 1.00 54.73 ? 73  HIS A O     1 
ATOM   967  C  CB    . HIS C 2 65  ? 93.048  57.264 -11.011 1.00 59.35 ? 73  HIS A CB    1 
ATOM   968  C  CG    . HIS C 2 65  ? 93.318  57.076 -9.552  1.00 62.48 ? 73  HIS A CG    1 
ATOM   969  N  ND1   . HIS C 2 65  ? 93.151  58.084 -8.627  1.00 63.41 ? 73  HIS A ND1   1 
ATOM   970  C  CD2   . HIS C 2 65  ? 93.753  55.997 -8.859  1.00 64.17 ? 73  HIS A CD2   1 
ATOM   971  C  CE1   . HIS C 2 65  ? 93.475  57.636 -7.427  1.00 64.90 ? 73  HIS A CE1   1 
ATOM   972  N  NE2   . HIS C 2 65  ? 93.844  56.372 -7.540  1.00 65.69 ? 73  HIS A NE2   1 
ATOM   973  N  N     . LEU C 2 66  ? 90.128  55.958 -9.938  1.00 53.17 ? 74  LEU A N     1 
ATOM   974  C  CA    . LEU C 2 66  ? 89.437  54.750 -9.494  1.00 50.82 ? 74  LEU A CA    1 
ATOM   975  C  C     . LEU C 2 66  ? 87.945  54.862 -9.771  1.00 50.08 ? 74  LEU A C     1 
ATOM   976  O  O     . LEU C 2 66  ? 87.239  53.851 -9.858  1.00 50.65 ? 74  LEU A O     1 
ATOM   977  C  CB    . LEU C 2 66  ? 89.635  54.532 -7.994  1.00 48.62 ? 74  LEU A CB    1 
ATOM   978  C  CG    . LEU C 2 66  ? 91.048  54.263 -7.498  1.00 46.90 ? 74  LEU A CG    1 
ATOM   979  C  CD1   . LEU C 2 66  ? 91.023  53.989 -5.994  1.00 47.61 ? 74  LEU A CD1   1 
ATOM   980  C  CD2   . LEU C 2 66  ? 91.613  53.081 -8.248  1.00 44.08 ? 74  LEU A CD2   1 
ATOM   981  N  N     . GLY C 2 67  ? 87.467  56.097 -9.902  1.00 47.68 ? 75  GLY A N     1 
ATOM   982  C  CA    . GLY C 2 67  ? 86.056  56.314 -10.143 1.00 45.41 ? 75  GLY A CA    1 
ATOM   983  C  C     . GLY C 2 67  ? 85.289  56.093 -8.854  1.00 43.83 ? 75  GLY A C     1 
ATOM   984  O  O     . GLY C 2 67  ? 84.156  55.608 -8.861  1.00 45.18 ? 75  GLY A O     1 
ATOM   985  N  N     . VAL C 2 68  ? 85.916  56.431 -7.734  1.00 39.97 ? 76  VAL A N     1 
ATOM   986  C  CA    . VAL C 2 68  ? 85.259  56.268 -6.454  1.00 37.99 ? 76  VAL A CA    1 
ATOM   987  C  C     . VAL C 2 68  ? 85.028  57.603 -5.768  1.00 37.62 ? 76  VAL A C     1 
ATOM   988  O  O     . VAL C 2 68  ? 85.888  58.482 -5.806  1.00 37.74 ? 76  VAL A O     1 
ATOM   989  C  CB    . VAL C 2 68  ? 86.074  55.361 -5.518  1.00 38.33 ? 76  VAL A CB    1 
ATOM   990  C  CG1   . VAL C 2 68  ? 85.404  55.284 -4.154  1.00 35.47 ? 76  VAL A CG1   1 
ATOM   991  C  CG2   . VAL C 2 68  ? 86.190  53.970 -6.121  1.00 37.35 ? 76  VAL A CG2   1 
ATOM   992  N  N     . GLU C 2 69  ? 83.848  57.738 -5.161  1.00 36.92 ? 77  GLU A N     1 
ATOM   993  C  CA    . GLU C 2 69  ? 83.447  58.928 -4.410  1.00 36.06 ? 77  GLU A CA    1 
ATOM   994  C  C     . GLU C 2 69  ? 83.449  58.558 -2.930  1.00 36.75 ? 77  GLU A C     1 
ATOM   995  O  O     . GLU C 2 69  ? 82.856  57.556 -2.535  1.00 36.85 ? 77  GLU A O     1 
ATOM   996  C  CB    . GLU C 2 69  ? 82.037  59.376 -4.803  1.00 37.02 ? 77  GLU A CB    1 
ATOM   997  C  CG    . GLU C 2 69  ? 81.453  60.478 -3.916  1.00 41.28 ? 77  GLU A CG    1 
ATOM   998  C  CD    . GLU C 2 69  ? 82.163  61.832 -4.064  1.00 45.89 ? 77  GLU A CD    1 
ATOM   999  O  OE1   . GLU C 2 69  ? 81.982  62.694 -3.173  1.00 44.44 ? 77  GLU A OE1   1 
ATOM   1000 O  OE2   . GLU C 2 69  ? 82.890  62.043 -5.066  1.00 46.94 ? 77  GLU A OE2   1 
ATOM   1001 N  N     . LEU C 2 70  ? 84.117  59.364 -2.112  1.00 35.69 ? 78  LEU A N     1 
ATOM   1002 C  CA    . LEU C 2 70  ? 84.184  59.105 -0.680  1.00 33.75 ? 78  LEU A CA    1 
ATOM   1003 C  C     . LEU C 2 70  ? 83.135  59.926 0.072   1.00 33.74 ? 78  LEU A C     1 
ATOM   1004 O  O     . LEU C 2 70  ? 82.942  61.111 -0.202  1.00 32.75 ? 78  LEU A O     1 
ATOM   1005 C  CB    . LEU C 2 70  ? 85.580  59.456 -0.163  1.00 31.78 ? 78  LEU A CB    1 
ATOM   1006 C  CG    . LEU C 2 70  ? 85.812  59.409 1.346   1.00 33.33 ? 78  LEU A CG    1 
ATOM   1007 C  CD1   . LEU C 2 70  ? 85.789  57.967 1.820   1.00 32.98 ? 78  LEU A CD1   1 
ATOM   1008 C  CD2   . LEU C 2 70  ? 87.148  60.057 1.679   1.00 29.73 ? 78  LEU A CD2   1 
ATOM   1009 N  N     . LYS C 2 71  ? 82.439  59.291 1.010   1.00 34.98 ? 79  LYS A N     1 
ATOM   1010 C  CA    . LYS C 2 71  ? 81.436  59.991 1.808   1.00 34.99 ? 79  LYS A CA    1 
ATOM   1011 C  C     . LYS C 2 71  ? 81.360  59.485 3.228   1.00 33.63 ? 79  LYS A C     1 
ATOM   1012 O  O     . LYS C 2 71  ? 81.272  58.292 3.448   1.00 34.16 ? 79  LYS A O     1 
ATOM   1013 C  CB    . LYS C 2 71  ? 80.054  59.872 1.173   1.00 35.89 ? 79  LYS A CB    1 
ATOM   1014 C  CG    . LYS C 2 71  ? 79.877  60.743 -0.049  1.00 38.37 ? 79  LYS A CG    1 
ATOM   1015 C  CD    . LYS C 2 71  ? 78.422  60.804 -0.479  1.00 42.33 ? 79  LYS A CD    1 
ATOM   1016 C  CE    . LYS C 2 71  ? 78.253  61.851 -1.553  1.00 42.64 ? 79  LYS A CE    1 
ATOM   1017 N  NZ    . LYS C 2 71  ? 78.834  63.134 -1.075  1.00 44.21 ? 79  LYS A NZ    1 
ATOM   1018 N  N     . THR C 2 72  ? 81.418  60.395 4.195   1.00 33.85 ? 80  THR A N     1 
ATOM   1019 C  CA    . THR C 2 72  ? 81.299  60.015 5.602   1.00 33.73 ? 80  THR A CA    1 
ATOM   1020 C  C     . THR C 2 72  ? 79.801  59.907 5.869   1.00 32.74 ? 80  THR A C     1 
ATOM   1021 O  O     . THR C 2 72  ? 79.011  60.531 5.167   1.00 32.57 ? 80  THR A O     1 
ATOM   1022 C  CB    . THR C 2 72  ? 81.869  61.089 6.540   1.00 33.68 ? 80  THR A CB    1 
ATOM   1023 O  OG1   . THR C 2 72  ? 81.318  62.362 6.184   1.00 32.47 ? 80  THR A OG1   1 
ATOM   1024 C  CG2   . THR C 2 72  ? 83.390  61.133 6.459   1.00 32.15 ? 80  THR A CG2   1 
ATOM   1025 N  N     . LEU C 2 73  ? 79.414  59.127 6.876   1.00 32.67 ? 81  LEU A N     1 
ATOM   1026 C  CA    . LEU C 2 73  ? 78.001  58.934 7.209   1.00 31.74 ? 81  LEU A CA    1 
ATOM   1027 C  C     . LEU C 2 73  ? 77.839  58.836 8.720   1.00 30.15 ? 81  LEU A C     1 
ATOM   1028 O  O     . LEU C 2 73  ? 78.131  57.808 9.321   1.00 30.82 ? 81  LEU A O     1 
ATOM   1029 C  CB    . LEU C 2 73  ? 77.491  57.656 6.539   1.00 32.37 ? 81  LEU A CB    1 
ATOM   1030 C  CG    . LEU C 2 73  ? 76.046  57.210 6.755   1.00 34.33 ? 81  LEU A CG    1 
ATOM   1031 C  CD1   . LEU C 2 73  ? 75.067  58.224 6.162   1.00 32.37 ? 81  LEU A CD1   1 
ATOM   1032 C  CD2   . LEU C 2 73  ? 75.869  55.854 6.098   1.00 34.17 ? 81  LEU A CD2   1 
ATOM   1033 N  N     . PRO C 2 74  ? 77.359  59.908 9.357   1.00 30.65 ? 82  PRO A N     1 
ATOM   1034 C  CA    . PRO C 2 74  ? 77.198  59.859 10.807  1.00 30.04 ? 82  PRO A CA    1 
ATOM   1035 C  C     . PRO C 2 74  ? 76.085  58.920 11.267  1.00 31.33 ? 82  PRO A C     1 
ATOM   1036 O  O     . PRO C 2 74  ? 74.986  58.946 10.735  1.00 32.37 ? 82  PRO A O     1 
ATOM   1037 C  CB    . PRO C 2 74  ? 76.955  61.321 11.167  1.00 27.69 ? 82  PRO A CB    1 
ATOM   1038 C  CG    . PRO C 2 74  ? 76.204  61.822 10.003  1.00 32.75 ? 82  PRO A CG    1 
ATOM   1039 C  CD    . PRO C 2 74  ? 76.917  61.207 8.818   1.00 29.63 ? 82  PRO A CD    1 
ATOM   1040 N  N     . ILE C 2 75  ? 76.393  58.081 12.250  1.00 32.14 ? 83  ILE A N     1 
ATOM   1041 C  CA    . ILE C 2 75  ? 75.433  57.128 12.782  1.00 34.18 ? 83  ILE A CA    1 
ATOM   1042 C  C     . ILE C 2 75  ? 75.380  57.187 14.307  1.00 36.33 ? 83  ILE A C     1 
ATOM   1043 O  O     . ILE C 2 75  ? 76.345  57.593 14.964  1.00 36.43 ? 83  ILE A O     1 
ATOM   1044 C  CB    . ILE C 2 75  ? 75.799  55.685 12.398  1.00 33.90 ? 83  ILE A CB    1 
ATOM   1045 C  CG1   . ILE C 2 75  ? 77.221  55.373 12.864  1.00 34.90 ? 83  ILE A CG1   1 
ATOM   1046 C  CG2   . ILE C 2 75  ? 75.648  55.478 10.903  1.00 33.72 ? 83  ILE A CG2   1 
ATOM   1047 C  CD1   . ILE C 2 75  ? 77.579  53.891 12.781  1.00 37.77 ? 83  ILE A CD1   1 
ATOM   1048 N  N     . ASN C 2 76  ? 74.248  56.776 14.869  1.00 37.48 ? 84  ASN A N     1 
ATOM   1049 C  CA    . ASN C 2 76  ? 74.106  56.749 16.320  1.00 39.07 ? 84  ASN A CA    1 
ATOM   1050 C  C     . ASN C 2 76  ? 74.524  55.367 16.819  1.00 39.45 ? 84  ASN A C     1 
ATOM   1051 O  O     . ASN C 2 76  ? 75.038  54.557 16.044  1.00 39.36 ? 84  ASN A O     1 
ATOM   1052 C  CB    . ASN C 2 76  ? 72.668  57.059 16.739  1.00 37.55 ? 84  ASN A CB    1 
ATOM   1053 C  CG    . ASN C 2 76  ? 71.672  56.044 16.225  1.00 37.36 ? 84  ASN A CG    1 
ATOM   1054 O  OD1   . ASN C 2 76  ? 72.037  54.940 15.819  1.00 36.28 ? 84  ASN A OD1   1 
ATOM   1055 N  ND2   . ASN C 2 76  ? 70.394  56.411 16.255  1.00 36.71 ? 84  ASN A ND2   1 
ATOM   1056 N  N     . ALA C 2 77  ? 74.294  55.109 18.106  1.00 41.54 ? 85  ALA A N     1 
ATOM   1057 C  CA    . ALA C 2 77  ? 74.652  53.842 18.753  1.00 41.84 ? 85  ALA A CA    1 
ATOM   1058 C  C     . ALA C 2 77  ? 73.987  52.592 18.176  1.00 43.00 ? 85  ALA A C     1 
ATOM   1059 O  O     . ALA C 2 77  ? 74.555  51.499 18.227  1.00 43.55 ? 85  ALA A O     1 
ATOM   1060 C  CB    . ALA C 2 77  ? 74.358  53.932 20.240  1.00 41.37 ? 85  ALA A CB    1 
ATOM   1061 N  N     . GLU C 2 78  ? 72.786  52.749 17.634  1.00 43.38 ? 86  GLU A N     1 
ATOM   1062 C  CA    . GLU C 2 78  ? 72.071  51.624 17.045  1.00 45.41 ? 86  GLU A CA    1 
ATOM   1063 C  C     . GLU C 2 78  ? 72.446  51.396 15.571  1.00 44.81 ? 86  GLU A C     1 
ATOM   1064 O  O     . GLU C 2 78  ? 71.878  50.522 14.902  1.00 42.71 ? 86  GLU A O     1 
ATOM   1065 C  CB    . GLU C 2 78  ? 70.558  51.843 17.158  1.00 50.11 ? 86  GLU A CB    1 
ATOM   1066 C  CG    . GLU C 2 78  ? 70.010  51.933 18.586  1.00 57.95 ? 86  GLU A CG    1 
ATOM   1067 C  CD    . GLU C 2 78  ? 70.398  53.222 19.302  1.00 64.81 ? 86  GLU A CD    1 
ATOM   1068 O  OE1   . GLU C 2 78  ? 70.683  54.231 18.620  1.00 68.79 ? 86  GLU A OE1   1 
ATOM   1069 O  OE2   . GLU C 2 78  ? 70.399  53.235 20.554  1.00 68.66 ? 86  GLU A OE2   1 
ATOM   1070 N  N     . GLY C 2 79  ? 73.399  52.186 15.070  1.00 42.64 ? 87  GLY A N     1 
ATOM   1071 C  CA    . GLY C 2 79  ? 73.834  52.055 13.689  1.00 40.14 ? 87  GLY A CA    1 
ATOM   1072 C  C     . GLY C 2 79  ? 72.937  52.756 12.684  1.00 39.89 ? 87  GLY A C     1 
ATOM   1073 O  O     . GLY C 2 79  ? 72.956  52.434 11.495  1.00 39.43 ? 87  GLY A O     1 
ATOM   1074 N  N     . TYR C 2 80  ? 72.153  53.722 13.149  1.00 38.28 ? 88  TYR A N     1 
ATOM   1075 C  CA    . TYR C 2 80  ? 71.245  54.446 12.264  1.00 36.62 ? 88  TYR A CA    1 
ATOM   1076 C  C     . TYR C 2 80  ? 71.791  55.842 11.886  1.00 35.60 ? 88  TYR A C     1 
ATOM   1077 O  O     . TYR C 2 80  ? 72.436  56.510 12.693  1.00 34.49 ? 88  TYR A O     1 
ATOM   1078 C  CB    . TYR C 2 80  ? 69.864  54.571 12.935  1.00 36.05 ? 88  TYR A CB    1 
ATOM   1079 C  CG    . TYR C 2 80  ? 68.744  54.882 11.972  1.00 34.52 ? 88  TYR A CG    1 
ATOM   1080 C  CD1   . TYR C 2 80  ? 68.184  53.883 11.178  1.00 33.88 ? 88  TYR A CD1   1 
ATOM   1081 C  CD2   . TYR C 2 80  ? 68.281  56.189 11.810  1.00 36.11 ? 88  TYR A CD2   1 
ATOM   1082 C  CE1   . TYR C 2 80  ? 67.188  54.172 10.240  1.00 34.97 ? 88  TYR A CE1   1 
ATOM   1083 C  CE2   . TYR C 2 80  ? 67.283  56.494 10.870  1.00 37.68 ? 88  TYR A CE2   1 
ATOM   1084 C  CZ    . TYR C 2 80  ? 66.741  55.477 10.092  1.00 37.66 ? 88  TYR A CZ    1 
ATOM   1085 O  OH    . TYR C 2 80  ? 65.732  55.759 9.193   1.00 41.63 ? 88  TYR A OH    1 
ATOM   1086 N  N     . PRO C 2 81  ? 71.523  56.302 10.650  1.00 36.29 ? 89  PRO A N     1 
ATOM   1087 C  CA    . PRO C 2 81  ? 72.021  57.625 10.230  1.00 36.27 ? 89  PRO A CA    1 
ATOM   1088 C  C     . PRO C 2 81  ? 71.462  58.803 11.027  1.00 35.06 ? 89  PRO A C     1 
ATOM   1089 O  O     . PRO C 2 81  ? 70.250  58.915 11.207  1.00 36.91 ? 89  PRO A O     1 
ATOM   1090 C  CB    . PRO C 2 81  ? 71.617  57.712 8.750   1.00 36.00 ? 89  PRO A CB    1 
ATOM   1091 C  CG    . PRO C 2 81  ? 71.456  56.270 8.325   1.00 36.41 ? 89  PRO A CG    1 
ATOM   1092 C  CD    . PRO C 2 81  ? 70.837  55.613 9.540   1.00 34.43 ? 89  PRO A CD    1 
ATOM   1093 N  N     . LEU C 2 82  ? 72.355  59.681 11.481  1.00 33.68 ? 90  LEU A N     1 
ATOM   1094 C  CA    . LEU C 2 82  ? 71.984  60.874 12.235  1.00 34.08 ? 90  LEU A CA    1 
ATOM   1095 C  C     . LEU C 2 82  ? 71.724  62.090 11.342  1.00 34.44 ? 90  LEU A C     1 
ATOM   1096 O  O     . LEU C 2 82  ? 71.224  63.109 11.816  1.00 36.43 ? 90  LEU A O     1 
ATOM   1097 C  CB    . LEU C 2 82  ? 73.082  61.219 13.242  1.00 35.82 ? 90  LEU A CB    1 
ATOM   1098 C  CG    . LEU C 2 82  ? 73.050  60.452 14.562  1.00 38.81 ? 90  LEU A CG    1 
ATOM   1099 C  CD1   . LEU C 2 82  ? 74.429  60.453 15.241  1.00 39.14 ? 90  LEU A CD1   1 
ATOM   1100 C  CD2   . LEU C 2 82  ? 72.001  61.091 15.451  1.00 37.26 ? 90  LEU A CD2   1 
ATOM   1101 N  N     . GLU C 2 83  ? 72.076  61.994 10.061  1.00 33.55 ? 91  GLU A N     1 
ATOM   1102 C  CA    . GLU C 2 83  ? 71.875  63.100 9.126   1.00 34.38 ? 91  GLU A CA    1 
ATOM   1103 C  C     . GLU C 2 83  ? 71.620  62.574 7.726   1.00 33.32 ? 91  GLU A C     1 
ATOM   1104 O  O     . GLU C 2 83  ? 71.881  61.406 7.435   1.00 32.40 ? 91  GLU A O     1 
ATOM   1105 C  CB    . GLU C 2 83  ? 73.117  64.001 9.062   1.00 37.00 ? 91  GLU A CB    1 
ATOM   1106 C  CG    . GLU C 2 83  ? 73.486  64.745 10.340  1.00 38.93 ? 91  GLU A CG    1 
ATOM   1107 C  CD    . GLU C 2 83  ? 72.486  65.828 10.699  1.00 41.94 ? 91  GLU A CD    1 
ATOM   1108 O  OE1   . GLU C 2 83  ? 71.832  66.362 9.778   1.00 42.41 ? 91  GLU A OE1   1 
ATOM   1109 O  OE2   . GLU C 2 83  ? 72.365  66.158 11.901  1.00 43.61 ? 91  GLU A OE2   1 
ATOM   1110 N  N     . THR C 2 84  ? 71.106  63.448 6.864   1.00 33.68 ? 92  THR A N     1 
ATOM   1111 C  CA    . THR C 2 84  ? 70.862  63.111 5.467   1.00 34.57 ? 92  THR A CA    1 
ATOM   1112 C  C     . THR C 2 84  ? 72.227  63.235 4.779   1.00 34.66 ? 92  THR A C     1 
ATOM   1113 O  O     . THR C 2 84  ? 73.191  63.713 5.379   1.00 33.32 ? 92  THR A O     1 
ATOM   1114 C  CB    . THR C 2 84  ? 69.892  64.107 4.813   1.00 35.79 ? 92  THR A CB    1 
ATOM   1115 O  OG1   . THR C 2 84  ? 70.384  65.436 5.017   1.00 33.83 ? 92  THR A OG1   1 
ATOM   1116 C  CG2   . THR C 2 84  ? 68.490  63.986 5.428   1.00 32.08 ? 92  THR A CG2   1 
ATOM   1117 N  N     . THR C 2 85  ? 72.319  62.814 3.525   1.00 33.88 ? 93  THR A N     1 
ATOM   1118 C  CA    . THR C 2 85  ? 73.588  62.888 2.823   1.00 34.36 ? 93  THR A CA    1 
ATOM   1119 C  C     . THR C 2 85  ? 73.515  63.802 1.608   1.00 35.49 ? 93  THR A C     1 
ATOM   1120 O  O     . THR C 2 85  ? 72.712  63.582 0.697   1.00 32.02 ? 93  THR A O     1 
ATOM   1121 C  CB    . THR C 2 85  ? 74.045  61.494 2.358   1.00 34.39 ? 93  THR A CB    1 
ATOM   1122 O  OG1   . THR C 2 85  ? 74.266  60.658 3.500   1.00 32.57 ? 93  THR A OG1   1 
ATOM   1123 C  CG2   . THR C 2 85  ? 75.325  61.596 1.533   1.00 31.29 ? 93  THR A CG2   1 
ATOM   1124 N  N     . PHE C 2 86  ? 74.363  64.826 1.602   1.00 35.94 ? 94  PHE A N     1 
ATOM   1125 C  CA    . PHE C 2 86  ? 74.408  65.764 0.489   1.00 36.03 ? 94  PHE A CA    1 
ATOM   1126 C  C     . PHE C 2 86  ? 75.028  65.076 -0.718  1.00 35.33 ? 94  PHE A C     1 
ATOM   1127 O  O     . PHE C 2 86  ? 76.019  64.358 -0.584  1.00 35.32 ? 94  PHE A O     1 
ATOM   1128 C  CB    . PHE C 2 86  ? 75.246  66.990 0.851   1.00 36.76 ? 94  PHE A CB    1 
ATOM   1129 C  CG    . PHE C 2 86  ? 75.478  67.902 -0.305  1.00 36.72 ? 94  PHE A CG    1 
ATOM   1130 C  CD1   . PHE C 2 86  ? 74.406  68.532 -0.927  1.00 36.88 ? 94  PHE A CD1   1 
ATOM   1131 C  CD2   . PHE C 2 86  ? 76.751  68.069 -0.827  1.00 35.08 ? 94  PHE A CD2   1 
ATOM   1132 C  CE1   . PHE C 2 86  ? 74.595  69.310 -2.059  1.00 35.38 ? 94  PHE A CE1   1 
ATOM   1133 C  CE2   . PHE C 2 86  ? 76.948  68.845 -1.956  1.00 37.72 ? 94  PHE A CE2   1 
ATOM   1134 C  CZ    . PHE C 2 86  ? 75.863  69.466 -2.574  1.00 36.08 ? 94  PHE A CZ    1 
ATOM   1135 N  N     . VAL C 2 87  ? 74.445  65.290 -1.892  1.00 36.16 ? 95  VAL A N     1 
ATOM   1136 C  CA    . VAL C 2 87  ? 74.949  64.675 -3.115  1.00 37.19 ? 95  VAL A CA    1 
ATOM   1137 C  C     . VAL C 2 87  ? 75.570  65.737 -4.028  1.00 40.14 ? 95  VAL A C     1 
ATOM   1138 O  O     . VAL C 2 87  ? 76.764  65.677 -4.330  1.00 41.33 ? 95  VAL A O     1 
ATOM   1139 C  CB    . VAL C 2 87  ? 73.814  63.926 -3.867  1.00 36.15 ? 95  VAL A CB    1 
ATOM   1140 C  CG1   . VAL C 2 87  ? 74.358  63.241 -5.095  1.00 32.72 ? 95  VAL A CG1   1 
ATOM   1141 C  CG2   . VAL C 2 87  ? 73.169  62.896 -2.947  1.00 36.43 ? 95  VAL A CG2   1 
ATOM   1142 N  N     . SER C 2 88  ? 74.771  66.711 -4.462  1.00 42.48 ? 96  SER A N     1 
ATOM   1143 C  CA    . SER C 2 88  ? 75.287  67.766 -5.333  1.00 44.74 ? 96  SER A CA    1 
ATOM   1144 C  C     . SER C 2 88  ? 74.284  68.893 -5.545  1.00 46.01 ? 96  SER A C     1 
ATOM   1145 O  O     . SER C 2 88  ? 73.076  68.695 -5.441  1.00 46.80 ? 96  SER A O     1 
ATOM   1146 C  CB    . SER C 2 88  ? 75.686  67.186 -6.689  1.00 46.76 ? 96  SER A CB    1 
ATOM   1147 O  OG    . SER C 2 88  ? 74.553  66.689 -7.372  1.00 49.46 ? 96  SER A OG    1 
ATOM   1148 N  N     . LEU C 2 89  ? 74.791  70.083 -5.834  1.00 47.08 ? 97  LEU A N     1 
ATOM   1149 C  CA    . LEU C 2 89  ? 73.931  71.225 -6.065  1.00 48.52 ? 97  LEU A CA    1 
ATOM   1150 C  C     . LEU C 2 89  ? 73.014  70.966 -7.251  1.00 49.92 ? 97  LEU A C     1 
ATOM   1151 O  O     . LEU C 2 89  ? 73.385  70.257 -8.185  1.00 50.41 ? 97  LEU A O     1 
ATOM   1152 C  CB    . LEU C 2 89  ? 74.780  72.458 -6.345  1.00 49.74 ? 97  LEU A CB    1 
ATOM   1153 C  CG    . LEU C 2 89  ? 75.416  73.141 -5.141  1.00 51.15 ? 97  LEU A CG    1 
ATOM   1154 C  CD1   . LEU C 2 89  ? 76.563  74.017 -5.605  1.00 52.32 ? 97  LEU A CD1   1 
ATOM   1155 C  CD2   . LEU C 2 89  ? 74.364  73.956 -4.409  1.00 50.15 ? 97  LEU A CD2   1 
ATOM   1156 N  N     . ALA C 2 90  ? 71.817  71.541 -7.215  1.00 51.11 ? 98  ALA A N     1 
ATOM   1157 C  CA    . ALA C 2 90  ? 70.867  71.380 -8.310  1.00 53.61 ? 98  ALA A CA    1 
ATOM   1158 C  C     . ALA C 2 90  ? 70.958  72.577 -9.252  1.00 55.22 ? 98  ALA A C     1 
ATOM   1159 O  O     . ALA C 2 90  ? 71.001  73.728 -8.808  1.00 54.13 ? 98  ALA A O     1 
ATOM   1160 C  CB    . ALA C 2 90  ? 69.450  71.254 -7.770  1.00 53.28 ? 98  ALA A CB    1 
ATOM   1161 N  N     . PRO C 2 91  ? 71.009  72.319 -10.568 1.00 57.44 ? 99  PRO A N     1 
ATOM   1162 C  CA    . PRO C 2 91  ? 71.093  73.391 -11.563 1.00 58.27 ? 99  PRO A CA    1 
ATOM   1163 C  C     . PRO C 2 91  ? 69.691  73.932 -11.799 1.00 58.83 ? 99  PRO A C     1 
ATOM   1164 O  O     . PRO C 2 91  ? 68.880  73.297 -12.468 1.00 59.50 ? 99  PRO A O     1 
ATOM   1165 C  CB    . PRO C 2 91  ? 71.656  72.672 -12.782 1.00 59.65 ? 99  PRO A CB    1 
ATOM   1166 C  CG    . PRO C 2 91  ? 70.989  71.330 -12.694 1.00 58.72 ? 99  PRO A CG    1 
ATOM   1167 C  CD    . PRO C 2 91  ? 71.084  70.994 -11.213 1.00 57.88 ? 99  PRO A CD    1 
ATOM   1168 N  N     . LEU C 2 92  ? 69.407  75.102 -11.244 1.00 60.42 ? 100 LEU A N     1 
ATOM   1169 C  CA    . LEU C 2 92  ? 68.084  75.697 -11.376 1.00 63.27 ? 100 LEU A CA    1 
ATOM   1170 C  C     . LEU C 2 92  ? 67.847  76.433 -12.697 1.00 65.90 ? 100 LEU A C     1 
ATOM   1171 O  O     . LEU C 2 92  ? 66.783  77.020 -12.907 1.00 64.43 ? 100 LEU A O     1 
ATOM   1172 C  CB    . LEU C 2 92  ? 67.834  76.640 -10.200 1.00 61.69 ? 100 LEU A CB    1 
ATOM   1173 C  CG    . LEU C 2 92  ? 68.052  76.033 -8.811  1.00 61.72 ? 100 LEU A CG    1 
ATOM   1174 C  CD1   . LEU C 2 92  ? 67.697  77.067 -7.753  1.00 61.34 ? 100 LEU A CD1   1 
ATOM   1175 C  CD2   . LEU C 2 92  ? 67.200  74.780 -8.646  1.00 61.00 ? 100 LEU A CD2   1 
ATOM   1176 N  N     . VAL C 2 93  ? 68.838  76.391 -13.583 1.00 69.74 ? 101 VAL A N     1 
ATOM   1177 C  CA    . VAL C 2 93  ? 68.743  77.050 -14.880 1.00 74.57 ? 101 VAL A CA    1 
ATOM   1178 C  C     . VAL C 2 93  ? 69.538  76.281 -15.924 1.00 77.93 ? 101 VAL A C     1 
ATOM   1179 O  O     . VAL C 2 93  ? 70.565  75.682 -15.613 1.00 78.68 ? 101 VAL A O     1 
ATOM   1180 C  CB    . VAL C 2 93  ? 69.294  78.494 -14.822 1.00 74.62 ? 101 VAL A CB    1 
ATOM   1181 C  CG1   . VAL C 2 93  ? 69.431  79.057 -16.225 1.00 75.45 ? 101 VAL A CG1   1 
ATOM   1182 C  CG2   . VAL C 2 93  ? 68.367  79.375 -14.001 1.00 74.93 ? 101 VAL A CG2   1 
ATOM   1183 N  N     . GLN C 2 94  ? 69.055  76.304 -17.162 1.00 81.70 ? 102 GLN A N     1 
ATOM   1184 C  CA    . GLN C 2 94  ? 69.719  75.623 -18.269 1.00 84.94 ? 102 GLN A CA    1 
ATOM   1185 C  C     . GLN C 2 94  ? 69.855  74.120 -18.041 1.00 86.88 ? 102 GLN A C     1 
ATOM   1186 O  O     . GLN C 2 94  ? 70.719  73.470 -18.634 1.00 87.09 ? 102 GLN A O     1 
ATOM   1187 C  CB    . GLN C 2 94  ? 71.096  76.241 -18.509 1.00 85.42 ? 102 GLN A CB    1 
ATOM   1188 N  N     . ASN C 2 95  ? 69.003  73.572 -17.181 1.00 88.60 ? 103 ASN A N     1 
ATOM   1189 C  CA    . ASN C 2 95  ? 69.036  72.144 -16.900 1.00 90.35 ? 103 ASN A CA    1 
ATOM   1190 C  C     . ASN C 2 95  ? 68.644  71.399 -18.173 1.00 91.71 ? 103 ASN A C     1 
ATOM   1191 O  O     . ASN C 2 95  ? 68.797  70.179 -18.273 1.00 93.07 ? 103 ASN A O     1 
ATOM   1192 C  CB    . ASN C 2 95  ? 68.072  71.811 -15.775 1.00 90.17 ? 103 ASN A CB    1 
ATOM   1193 N  N     . SER C 2 96  ? 68.138  72.150 -19.147 1.00 91.84 ? 104 SER A N     1 
ATOM   1194 C  CA    . SER C 2 96  ? 67.716  71.582 -20.421 1.00 91.39 ? 104 SER A CA    1 
ATOM   1195 C  C     . SER C 2 96  ? 68.836  70.784 -21.095 1.00 90.70 ? 104 SER A C     1 
ATOM   1196 O  O     . SER C 2 96  ? 69.871  71.344 -21.468 1.00 91.09 ? 104 SER A O     1 
ATOM   1197 C  CB    . SER C 2 96  ? 67.238  72.698 -21.346 1.00 92.04 ? 104 SER A CB    1 
ATOM   1198 N  N     . GLY C 2 97  ? 68.627  69.476 -21.240 1.00 89.15 ? 105 GLY A N     1 
ATOM   1199 C  CA    . GLY C 2 97  ? 69.623  68.635 -21.886 1.00 86.47 ? 105 GLY A CA    1 
ATOM   1200 C  C     . GLY C 2 97  ? 70.006  67.339 -21.186 1.00 84.32 ? 105 GLY A C     1 
ATOM   1201 O  O     . GLY C 2 97  ? 70.144  66.295 -21.831 1.00 84.57 ? 105 GLY A O     1 
ATOM   1202 N  N     . VAL C 2 98  ? 70.177  67.397 -19.869 1.00 80.74 ? 106 VAL A N     1 
ATOM   1203 C  CA    . VAL C 2 98  ? 70.579  66.226 -19.098 1.00 76.78 ? 106 VAL A CA    1 
ATOM   1204 C  C     . VAL C 2 98  ? 69.491  65.183 -18.865 1.00 73.76 ? 106 VAL A C     1 
ATOM   1205 O  O     . VAL C 2 98  ? 68.342  65.510 -18.578 1.00 73.72 ? 106 VAL A O     1 
ATOM   1206 C  CB    . VAL C 2 98  ? 71.157  66.672 -17.757 1.00 76.61 ? 106 VAL A CB    1 
ATOM   1207 N  N     . LYS C 2 99  ? 69.876  63.919 -19.002 1.00 70.39 ? 107 LYS A N     1 
ATOM   1208 C  CA    . LYS C 2 99  ? 68.984  62.789 -18.768 1.00 67.25 ? 107 LYS A CA    1 
ATOM   1209 C  C     . LYS C 2 99  ? 69.537  62.135 -17.509 1.00 64.39 ? 107 LYS A C     1 
ATOM   1210 O  O     . LYS C 2 99  ? 70.682  62.388 -17.131 1.00 63.47 ? 107 LYS A O     1 
ATOM   1211 C  CB    . LYS C 2 99  ? 69.043  61.788 -19.929 1.00 68.36 ? 107 LYS A CB    1 
ATOM   1212 C  CG    . LYS C 2 99  ? 68.605  62.369 -21.145 1.00 69.51 ? 107 LYS A CG    1 
ATOM   1213 N  N     . TRP C 2 100 ? 68.740  61.301 -16.854 1.00 60.74 ? 108 TRP A N     1 
ATOM   1214 C  CA    . TRP C 2 100 ? 69.207  60.645 -15.644 1.00 56.80 ? 108 TRP A CA    1 
ATOM   1215 C  C     . TRP C 2 100 ? 70.571  59.991 -15.851 1.00 56.97 ? 108 TRP A C     1 
ATOM   1216 O  O     . TRP C 2 100 ? 71.501  60.209 -15.075 1.00 55.47 ? 108 TRP A O     1 
ATOM   1217 C  CB    . TRP C 2 100 ? 68.203  59.589 -15.185 1.00 52.58 ? 108 TRP A CB    1 
ATOM   1218 C  CG    . TRP C 2 100 ? 68.795  58.599 -14.220 1.00 47.93 ? 108 TRP A CG    1 
ATOM   1219 C  CD1   . TRP C 2 100 ? 68.980  57.265 -14.433 1.00 45.78 ? 108 TRP A CD1   1 
ATOM   1220 C  CD2   . TRP C 2 100 ? 69.301  58.869 -12.906 1.00 44.20 ? 108 TRP A CD2   1 
ATOM   1221 N  NE1   . TRP C 2 100 ? 69.569  56.684 -13.340 1.00 44.45 ? 108 TRP A NE1   1 
ATOM   1222 C  CE2   . TRP C 2 100 ? 69.781  57.646 -12.387 1.00 43.98 ? 108 TRP A CE2   1 
ATOM   1223 C  CE3   . TRP C 2 100 ? 69.401  60.024 -12.121 1.00 42.77 ? 108 TRP A CE3   1 
ATOM   1224 C  CZ2   . TRP C 2 100 ? 70.347  57.541 -11.114 1.00 40.75 ? 108 TRP A CZ2   1 
ATOM   1225 C  CZ3   . TRP C 2 100 ? 69.964  59.920 -10.853 1.00 43.14 ? 108 TRP A CZ3   1 
ATOM   1226 C  CH2   . TRP C 2 100 ? 70.432  58.684 -10.364 1.00 42.12 ? 108 TRP A CH2   1 
ATOM   1227 N  N     . GLU C 2 101 ? 70.681  59.197 -16.907 1.00 56.99 ? 109 GLU A N     1 
ATOM   1228 C  CA    . GLU C 2 101 ? 71.914  58.483 -17.216 1.00 58.13 ? 109 GLU A CA    1 
ATOM   1229 C  C     . GLU C 2 101 ? 73.173  59.347 -17.252 1.00 55.81 ? 109 GLU A C     1 
ATOM   1230 O  O     . GLU C 2 101 ? 74.261  58.866 -16.941 1.00 54.84 ? 109 GLU A O     1 
ATOM   1231 C  CB    . GLU C 2 101 ? 71.772  57.744 -18.550 1.00 61.42 ? 109 GLU A CB    1 
ATOM   1232 C  CG    . GLU C 2 101 ? 70.616  56.743 -18.607 1.00 65.70 ? 109 GLU A CG    1 
ATOM   1233 C  CD    . GLU C 2 101 ? 69.252  57.414 -18.549 1.00 68.22 ? 109 GLU A CD    1 
ATOM   1234 O  OE1   . GLU C 2 101 ? 69.026  58.378 -19.315 1.00 69.14 ? 109 GLU A OE1   1 
ATOM   1235 O  OE2   . GLU C 2 101 ? 68.402  56.975 -17.745 1.00 70.83 ? 109 GLU A OE2   1 
ATOM   1236 N  N     . ASN C 2 102 ? 73.036  60.616 -17.623 1.00 54.09 ? 110 ASN A N     1 
ATOM   1237 C  CA    . ASN C 2 102 ? 74.196  61.503 -17.694 1.00 54.32 ? 110 ASN A CA    1 
ATOM   1238 C  C     . ASN C 2 102 ? 74.168  62.619 -16.641 1.00 53.11 ? 110 ASN A C     1 
ATOM   1239 O  O     . ASN C 2 102 ? 74.764  63.677 -16.839 1.00 52.88 ? 110 ASN A O     1 
ATOM   1240 C  CB    . ASN C 2 102 ? 74.295  62.127 -19.093 1.00 56.68 ? 110 ASN A CB    1 
ATOM   1241 C  CG    . ASN C 2 102 ? 73.904  61.157 -20.196 1.00 60.25 ? 110 ASN A CG    1 
ATOM   1242 O  OD1   . ASN C 2 102 ? 74.492  60.081 -20.339 1.00 60.05 ? 110 ASN A OD1   1 
ATOM   1243 N  ND2   . ASN C 2 102 ? 72.904  61.538 -20.987 1.00 62.15 ? 110 ASN A ND2   1 
ATOM   1244 N  N     . SER C 2 103 ? 73.493  62.385 -15.521 1.00 51.42 ? 111 SER A N     1 
ATOM   1245 C  CA    . SER C 2 103 ? 73.397  63.397 -14.470 1.00 50.25 ? 111 SER A CA    1 
ATOM   1246 C  C     . SER C 2 103 ? 74.588  63.399 -13.532 1.00 49.40 ? 111 SER A C     1 
ATOM   1247 O  O     . SER C 2 103 ? 75.246  62.368 -13.356 1.00 48.80 ? 111 SER A O     1 
ATOM   1248 C  CB    . SER C 2 103 ? 72.143  63.169 -13.627 1.00 49.72 ? 111 SER A CB    1 
ATOM   1249 O  OG    . SER C 2 103 ? 72.181  61.891 -13.024 1.00 47.78 ? 111 SER A OG    1 
ATOM   1250 N  N     . HIS C 2 104 ? 74.848  64.565 -12.937 1.00 49.25 ? 112 HIS A N     1 
ATOM   1251 C  CA    . HIS C 2 104 ? 75.916  64.723 -11.950 1.00 49.68 ? 112 HIS A CA    1 
ATOM   1252 C  C     . HIS C 2 104 ? 75.563  63.792 -10.794 1.00 47.81 ? 112 HIS A C     1 
ATOM   1253 O  O     . HIS C 2 104 ? 76.422  63.084 -10.265 1.00 47.83 ? 112 HIS A O     1 
ATOM   1254 C  CB    . HIS C 2 104 ? 75.982  66.159 -11.395 1.00 53.47 ? 112 HIS A CB    1 
ATOM   1255 C  CG    . HIS C 2 104 ? 76.643  67.145 -12.310 1.00 60.02 ? 112 HIS A CG    1 
ATOM   1256 N  ND1   . HIS C 2 104 ? 77.805  66.858 -12.996 1.00 61.76 ? 112 HIS A ND1   1 
ATOM   1257 C  CD2   . HIS C 2 104 ? 76.320  68.421 -12.636 1.00 61.50 ? 112 HIS A CD2   1 
ATOM   1258 C  CE1   . HIS C 2 104 ? 78.167  67.912 -13.707 1.00 62.85 ? 112 HIS A CE1   1 
ATOM   1259 N  NE2   . HIS C 2 104 ? 77.283  68.875 -13.506 1.00 62.69 ? 112 HIS A NE2   1 
ATOM   1260 N  N     . VAL C 2 105 ? 74.289  63.802 -10.411 1.00 44.02 ? 113 VAL A N     1 
ATOM   1261 C  CA    . VAL C 2 105 ? 73.813  62.967 -9.312  1.00 42.02 ? 113 VAL A CA    1 
ATOM   1262 C  C     . VAL C 2 105 ? 74.110  61.482 -9.520  1.00 41.56 ? 113 VAL A C     1 
ATOM   1263 O  O     . VAL C 2 105 ? 74.694  60.836 -8.650  1.00 39.87 ? 113 VAL A O     1 
ATOM   1264 C  CB    . VAL C 2 105 ? 72.290  63.161 -9.083  1.00 41.11 ? 113 VAL A CB    1 
ATOM   1265 C  CG1   . VAL C 2 105 ? 71.724  62.025 -8.212  1.00 37.40 ? 113 VAL A CG1   1 
ATOM   1266 C  CG2   . VAL C 2 105 ? 72.048  64.518 -8.423  1.00 37.94 ? 113 VAL A CG2   1 
ATOM   1267 N  N     . ARG C 2 106 ? 73.710  60.945 -10.666 1.00 41.12 ? 114 ARG A N     1 
ATOM   1268 C  CA    . ARG C 2 106 ? 73.944  59.539 -10.950 1.00 42.57 ? 114 ARG A CA    1 
ATOM   1269 C  C     . ARG C 2 106 ? 75.444  59.254 -10.943 1.00 43.97 ? 114 ARG A C     1 
ATOM   1270 O  O     . ARG C 2 106 ? 75.896  58.227 -10.430 1.00 43.55 ? 114 ARG A O     1 
ATOM   1271 C  CB    . ARG C 2 106 ? 73.366  59.166 -12.312 1.00 42.93 ? 114 ARG A CB    1 
ATOM   1272 C  CG    . ARG C 2 106 ? 73.555  57.713 -12.644 1.00 45.40 ? 114 ARG A CG    1 
ATOM   1273 C  CD    . ARG C 2 106 ? 73.394  57.435 -14.111 1.00 49.65 ? 114 ARG A CD    1 
ATOM   1274 N  NE    . ARG C 2 106 ? 73.660  56.026 -14.378 1.00 53.46 ? 114 ARG A NE    1 
ATOM   1275 C  CZ    . ARG C 2 106 ? 74.024  55.537 -15.558 1.00 53.90 ? 114 ARG A CZ    1 
ATOM   1276 N  NH1   . ARG C 2 106 ? 74.169  56.339 -16.605 1.00 55.69 ? 114 ARG A NH1   1 
ATOM   1277 N  NH2   . ARG C 2 106 ? 74.258  54.241 -15.682 1.00 55.26 ? 114 ARG A NH2   1 
ATOM   1278 N  N     . HIS C 2 107 ? 76.214  60.170 -11.520 1.00 44.68 ? 115 HIS A N     1 
ATOM   1279 C  CA    . HIS C 2 107 ? 77.658  60.010 -11.579 1.00 45.89 ? 115 HIS A CA    1 
ATOM   1280 C  C     . HIS C 2 107 ? 78.288  59.947 -10.183 1.00 45.86 ? 115 HIS A C     1 
ATOM   1281 O  O     . HIS C 2 107 ? 79.081  59.048 -9.889  1.00 43.98 ? 115 HIS A O     1 
ATOM   1282 C  CB    . HIS C 2 107 ? 78.278  61.153 -12.377 1.00 48.08 ? 115 HIS A CB    1 
ATOM   1283 C  CG    . HIS C 2 107 ? 79.767  61.070 -12.484 1.00 53.43 ? 115 HIS A CG    1 
ATOM   1284 N  ND1   . HIS C 2 107 ? 80.609  61.983 -11.884 1.00 55.83 ? 115 HIS A ND1   1 
ATOM   1285 C  CD2   . HIS C 2 107 ? 80.566  60.184 -13.125 1.00 55.57 ? 115 HIS A CD2   1 
ATOM   1286 C  CE1   . HIS C 2 107 ? 81.863  61.664 -12.154 1.00 57.27 ? 115 HIS A CE1   1 
ATOM   1287 N  NE2   . HIS C 2 107 ? 81.865  60.577 -12.905 1.00 57.40 ? 115 HIS A NE2   1 
ATOM   1288 N  N     . LYS C 2 108 ? 77.937  60.897 -9.322  1.00 44.69 ? 116 LYS A N     1 
ATOM   1289 C  CA    . LYS C 2 108 ? 78.493  60.910 -7.978  1.00 44.95 ? 116 LYS A CA    1 
ATOM   1290 C  C     . LYS C 2 108 ? 78.070  59.704 -7.150  1.00 43.99 ? 116 LYS A C     1 
ATOM   1291 O  O     . LYS C 2 108 ? 78.820  59.249 -6.294  1.00 43.06 ? 116 LYS A O     1 
ATOM   1292 C  CB    . LYS C 2 108 ? 78.130  62.209 -7.255  1.00 45.74 ? 116 LYS A CB    1 
ATOM   1293 C  CG    . LYS C 2 108 ? 79.085  63.348 -7.595  1.00 50.04 ? 116 LYS A CG    1 
ATOM   1294 C  CD    . LYS C 2 108 ? 78.891  64.548 -6.694  1.00 54.62 ? 116 LYS A CD    1 
ATOM   1295 C  CE    . LYS C 2 108 ? 79.857  65.670 -7.055  1.00 56.43 ? 116 LYS A CE    1 
ATOM   1296 N  NZ    . LYS C 2 108 ? 79.525  66.937 -6.329  1.00 58.87 ? 116 LYS A NZ    1 
ATOM   1297 N  N     . LEU C 2 109 ? 76.887  59.170 -7.433  1.00 42.30 ? 117 LEU A N     1 
ATOM   1298 C  CA    . LEU C 2 109 ? 76.380  58.025 -6.699  1.00 40.89 ? 117 LEU A CA    1 
ATOM   1299 C  C     . LEU C 2 109 ? 76.568  56.693 -7.396  1.00 41.52 ? 117 LEU A C     1 
ATOM   1300 O  O     . LEU C 2 109 ? 75.979  55.696 -6.974  1.00 41.91 ? 117 LEU A O     1 
ATOM   1301 C  CB    . LEU C 2 109 ? 74.895  58.201 -6.405  1.00 39.39 ? 117 LEU A CB    1 
ATOM   1302 C  CG    . LEU C 2 109 ? 74.545  59.278 -5.388  1.00 38.35 ? 117 LEU A CG    1 
ATOM   1303 C  CD1   . LEU C 2 109 ? 73.029  59.397 -5.270  1.00 34.53 ? 117 LEU A CD1   1 
ATOM   1304 C  CD2   . LEU C 2 109 ? 75.178  58.927 -4.060  1.00 35.93 ? 117 LEU A CD2   1 
ATOM   1305 N  N     . SER C 2 110 ? 77.372  56.653 -8.454  1.00 41.02 ? 118 SER A N     1 
ATOM   1306 C  CA    . SER C 2 110 ? 77.569  55.383 -9.159  1.00 43.34 ? 118 SER A CA    1 
ATOM   1307 C  C     . SER C 2 110 ? 78.474  54.422 -8.391  1.00 43.79 ? 118 SER A C     1 
ATOM   1308 O  O     . SER C 2 110 ? 78.309  53.205 -8.479  1.00 44.16 ? 118 SER A O     1 
ATOM   1309 C  CB    . SER C 2 110 ? 78.135  55.618 -10.562 1.00 41.59 ? 118 SER A CB    1 
ATOM   1310 O  OG    . SER C 2 110 ? 79.300  56.410 -10.506 1.00 43.34 ? 118 SER A OG    1 
ATOM   1311 N  N     . CYS C 2 111 ? 79.419  54.975 -7.635  1.00 43.34 ? 119 CYS A N     1 
ATOM   1312 C  CA    . CYS C 2 111 ? 80.347  54.171 -6.848  1.00 43.12 ? 119 CYS A CA    1 
ATOM   1313 C  C     . CYS C 2 111 ? 80.825  54.936 -5.611  1.00 40.88 ? 119 CYS A C     1 
ATOM   1314 O  O     . CYS C 2 111 ? 81.720  55.782 -5.691  1.00 39.76 ? 119 CYS A O     1 
ATOM   1315 C  CB    . CYS C 2 111 ? 81.544  53.780 -7.702  1.00 47.00 ? 119 CYS A CB    1 
ATOM   1316 S  SG    . CYS C 2 111 ? 82.558  52.542 -6.900  1.00 57.63 ? 119 CYS A SG    1 
ATOM   1317 N  N     . VAL C 2 112 ? 80.243  54.611 -4.463  1.00 37.58 ? 120 VAL A N     1 
ATOM   1318 C  CA    . VAL C 2 112 ? 80.571  55.297 -3.220  1.00 35.61 ? 120 VAL A CA    1 
ATOM   1319 C  C     . VAL C 2 112 ? 81.272  54.451 -2.169  1.00 35.35 ? 120 VAL A C     1 
ATOM   1320 O  O     . VAL C 2 112 ? 80.955  53.274 -1.983  1.00 36.77 ? 120 VAL A O     1 
ATOM   1321 C  CB    . VAL C 2 112 ? 79.288  55.870 -2.564  1.00 34.20 ? 120 VAL A CB    1 
ATOM   1322 C  CG1   . VAL C 2 112 ? 79.652  56.782 -1.413  1.00 31.98 ? 120 VAL A CG1   1 
ATOM   1323 C  CG2   . VAL C 2 112 ? 78.452  56.614 -3.604  1.00 32.60 ? 120 VAL A CG2   1 
ATOM   1324 N  N     . LEU C 2 113 ? 82.235  55.062 -1.490  1.00 33.69 ? 121 LEU A N     1 
ATOM   1325 C  CA    . LEU C 2 113 ? 82.936  54.401 -0.402  1.00 33.11 ? 121 LEU A CA    1 
ATOM   1326 C  C     . LEU C 2 113 ? 82.389  55.116 0.826   1.00 32.19 ? 121 LEU A C     1 
ATOM   1327 O  O     . LEU C 2 113 ? 82.817  56.228 1.137   1.00 32.40 ? 121 LEU A O     1 
ATOM   1328 C  CB    . LEU C 2 113 ? 84.445  54.638 -0.468  1.00 33.31 ? 121 LEU A CB    1 
ATOM   1329 C  CG    . LEU C 2 113 ? 85.364  53.693 0.320   1.00 34.76 ? 121 LEU A CG    1 
ATOM   1330 C  CD1   . LEU C 2 113 ? 86.581  54.485 0.744   1.00 34.55 ? 121 LEU A CD1   1 
ATOM   1331 C  CD2   . LEU C 2 113 ? 84.694  53.103 1.549   1.00 33.47 ? 121 LEU A CD2   1 
ATOM   1332 N  N     . TRP C 2 114 ? 81.421  54.501 1.497   1.00 31.42 ? 122 TRP A N     1 
ATOM   1333 C  CA    . TRP C 2 114 ? 80.844  55.095 2.692   1.00 30.81 ? 122 TRP A CA    1 
ATOM   1334 C  C     . TRP C 2 114 ? 81.728  54.793 3.890   1.00 33.52 ? 122 TRP A C     1 
ATOM   1335 O  O     . TRP C 2 114 ? 82.136  53.645 4.092   1.00 33.29 ? 122 TRP A O     1 
ATOM   1336 C  CB    . TRP C 2 114 ? 79.462  54.521 2.982   1.00 32.08 ? 122 TRP A CB    1 
ATOM   1337 C  CG    . TRP C 2 114 ? 78.464  54.708 1.891   1.00 32.36 ? 122 TRP A CG    1 
ATOM   1338 C  CD1   . TRP C 2 114 ? 78.173  53.834 0.883   1.00 32.52 ? 122 TRP A CD1   1 
ATOM   1339 C  CD2   . TRP C 2 114 ? 77.638  55.853 1.683   1.00 30.89 ? 122 TRP A CD2   1 
ATOM   1340 N  NE1   . TRP C 2 114 ? 77.211  54.369 0.055   1.00 33.16 ? 122 TRP A NE1   1 
ATOM   1341 C  CE2   . TRP C 2 114 ? 76.871  55.611 0.520   1.00 30.87 ? 122 TRP A CE2   1 
ATOM   1342 C  CE3   . TRP C 2 114 ? 77.478  57.066 2.357   1.00 29.60 ? 122 TRP A CE3   1 
ATOM   1343 C  CZ2   . TRP C 2 114 ? 75.950  56.538 0.022   1.00 31.05 ? 122 TRP A CZ2   1 
ATOM   1344 C  CZ3   . TRP C 2 114 ? 76.561  57.989 1.863   1.00 32.94 ? 122 TRP A CZ3   1 
ATOM   1345 C  CH2   . TRP C 2 114 ? 75.812  57.718 0.701   1.00 32.17 ? 122 TRP A CH2   1 
ATOM   1346 N  N     . MET C 2 115 ? 82.042  55.821 4.672   1.00 33.37 ? 123 MET A N     1 
ATOM   1347 C  CA    . MET C 2 115 ? 82.829  55.632 5.880   1.00 34.13 ? 123 MET A CA    1 
ATOM   1348 C  C     . MET C 2 115 ? 81.924  56.030 7.035   1.00 34.46 ? 123 MET A C     1 
ATOM   1349 O  O     . MET C 2 115 ? 81.792  57.213 7.361   1.00 33.28 ? 123 MET A O     1 
ATOM   1350 C  CB    . MET C 2 115 ? 84.085  56.513 5.892   1.00 35.96 ? 123 MET A CB    1 
ATOM   1351 C  CG    . MET C 2 115 ? 85.223  56.027 4.981   1.00 39.13 ? 123 MET A CG    1 
ATOM   1352 S  SD    . MET C 2 115 ? 85.764  54.334 5.374   1.00 41.33 ? 123 MET A SD    1 
ATOM   1353 C  CE    . MET C 2 115 ? 86.871  54.647 6.750   1.00 38.47 ? 123 MET A CE    1 
ATOM   1354 N  N     . PRO C 2 116 ? 81.257  55.046 7.659   1.00 34.50 ? 124 PRO A N     1 
ATOM   1355 C  CA    . PRO C 2 116 ? 80.376  55.371 8.781   1.00 34.73 ? 124 PRO A CA    1 
ATOM   1356 C  C     . PRO C 2 116 ? 81.225  55.957 9.890   1.00 33.86 ? 124 PRO A C     1 
ATOM   1357 O  O     . PRO C 2 116 ? 82.380  55.564 10.053  1.00 34.57 ? 124 PRO A O     1 
ATOM   1358 C  CB    . PRO C 2 116 ? 79.805  54.010 9.169   1.00 33.12 ? 124 PRO A CB    1 
ATOM   1359 C  CG    . PRO C 2 116 ? 79.755  53.312 7.834   1.00 34.94 ? 124 PRO A CG    1 
ATOM   1360 C  CD    . PRO C 2 116 ? 81.159  53.610 7.358   1.00 34.88 ? 124 PRO A CD    1 
ATOM   1361 N  N     . ILE C 2 117 ? 80.673  56.904 10.639  1.00 31.21 ? 125 ILE A N     1 
ATOM   1362 C  CA    . ILE C 2 117 ? 81.410  57.490 11.748  1.00 31.32 ? 125 ILE A CA    1 
ATOM   1363 C  C     . ILE C 2 117 ? 80.448  57.751 12.881  1.00 32.03 ? 125 ILE A C     1 
ATOM   1364 O  O     . ILE C 2 117 ? 79.262  57.984 12.659  1.00 34.40 ? 125 ILE A O     1 
ATOM   1365 C  CB    . ILE C 2 117 ? 82.051  58.842 11.388  1.00 31.01 ? 125 ILE A CB    1 
ATOM   1366 C  CG1   . ILE C 2 117 ? 80.960  59.805 10.900  1.00 31.42 ? 125 ILE A CG1   1 
ATOM   1367 C  CG2   . ILE C 2 117 ? 83.155  58.645 10.355  1.00 29.97 ? 125 ILE A CG2   1 
ATOM   1368 C  CD1   . ILE C 2 117 ? 81.417  61.212 10.725  1.00 34.88 ? 125 ILE A CD1   1 
ATOM   1369 N  N     . GLU C 2 118 ? 80.949  57.703 14.101  1.00 33.04 ? 126 GLU A N     1 
ATOM   1370 C  CA    . GLU C 2 118 ? 80.105  57.988 15.250  1.00 35.09 ? 126 GLU A CA    1 
ATOM   1371 C  C     . GLU C 2 118 ? 79.698  59.460 15.160  1.00 34.96 ? 126 GLU A C     1 
ATOM   1372 O  O     . GLU C 2 118 ? 80.557  60.340 15.060  1.00 33.86 ? 126 GLU A O     1 
ATOM   1373 C  CB    . GLU C 2 118 ? 80.881  57.715 16.543  1.00 35.73 ? 126 GLU A CB    1 
ATOM   1374 C  CG    . GLU C 2 118 ? 80.893  56.235 16.918  1.00 40.65 ? 126 GLU A CG    1 
ATOM   1375 C  CD    . GLU C 2 118 ? 81.770  55.918 18.109  1.00 44.77 ? 126 GLU A CD    1 
ATOM   1376 O  OE1   . GLU C 2 118 ? 82.040  56.822 18.927  1.00 47.47 ? 126 GLU A OE1   1 
ATOM   1377 O  OE2   . GLU C 2 118 ? 82.183  54.748 18.236  1.00 50.21 ? 126 GLU A OE2   1 
ATOM   1378 N  N     . GLY C 2 119 ? 78.398  59.737 15.194  1.00 34.23 ? 127 GLY A N     1 
ATOM   1379 C  CA    . GLY C 2 119 ? 77.960  61.120 15.087  1.00 34.75 ? 127 GLY A CA    1 
ATOM   1380 C  C     . GLY C 2 119 ? 77.234  61.742 16.268  1.00 37.10 ? 127 GLY A C     1 
ATOM   1381 O  O     . GLY C 2 119 ? 76.946  62.942 16.239  1.00 39.16 ? 127 GLY A O     1 
ATOM   1382 N  N     . SER C 2 120 ? 76.943  60.955 17.303  1.00 37.36 ? 128 SER A N     1 
ATOM   1383 C  CA    . SER C 2 120 ? 76.223  61.469 18.469  1.00 38.67 ? 128 SER A CA    1 
ATOM   1384 C  C     . SER C 2 120 ? 76.847  62.713 19.070  1.00 40.16 ? 128 SER A C     1 
ATOM   1385 O  O     . SER C 2 120 ? 78.028  62.727 19.421  1.00 39.70 ? 128 SER A O     1 
ATOM   1386 C  CB    . SER C 2 120 ? 76.098  60.385 19.535  1.00 38.71 ? 128 SER A CB    1 
ATOM   1387 O  OG    . SER C 2 120 ? 75.279  59.335 19.054  1.00 41.97 ? 128 SER A OG    1 
ATOM   1388 N  N     . ARG C 2 121 ? 76.027  63.754 19.198  1.00 41.94 ? 129 ARG A N     1 
ATOM   1389 C  CA    . ARG C 2 121 ? 76.467  65.037 19.729  1.00 44.13 ? 129 ARG A CA    1 
ATOM   1390 C  C     . ARG C 2 121 ? 77.068  65.005 21.125  1.00 46.19 ? 129 ARG A C     1 
ATOM   1391 O  O     . ARG C 2 121 ? 77.974  65.779 21.429  1.00 45.51 ? 129 ARG A O     1 
ATOM   1392 C  CB    . ARG C 2 121 ? 75.312  66.039 19.691  1.00 45.08 ? 129 ARG A CB    1 
ATOM   1393 C  CG    . ARG C 2 121 ? 74.960  66.521 18.284  1.00 47.42 ? 129 ARG A CG    1 
ATOM   1394 C  CD    . ARG C 2 121 ? 73.633  67.271 18.250  1.00 48.72 ? 129 ARG A CD    1 
ATOM   1395 N  NE    . ARG C 2 121 ? 73.230  67.601 16.881  1.00 50.99 ? 129 ARG A NE    1 
ATOM   1396 C  CZ    . ARG C 2 121 ? 71.994  67.936 16.523  1.00 50.64 ? 129 ARG A CZ    1 
ATOM   1397 N  NH1   . ARG C 2 121 ? 71.032  67.989 17.432  1.00 51.90 ? 129 ARG A NH1   1 
ATOM   1398 N  NH2   . ARG C 2 121 ? 71.714  68.208 15.255  1.00 50.97 ? 129 ARG A NH2   1 
ATOM   1399 N  N     . HIS C 2 122 ? 76.591  64.115 21.984  1.00 48.16 ? 130 HIS A N     1 
ATOM   1400 C  CA    . HIS C 2 122 ? 77.140  64.080 23.332  1.00 49.78 ? 130 HIS A CA    1 
ATOM   1401 C  C     . HIS C 2 122 ? 78.562  63.514 23.399  1.00 50.40 ? 130 HIS A C     1 
ATOM   1402 O  O     . HIS C 2 122 ? 79.251  63.697 24.403  1.00 51.35 ? 130 HIS A O     1 
ATOM   1403 C  CB    . HIS C 2 122 ? 76.235  63.279 24.265  1.00 50.36 ? 130 HIS A CB    1 
ATOM   1404 C  CG    . HIS C 2 122 ? 76.235  61.810 23.988  1.00 52.00 ? 130 HIS A CG    1 
ATOM   1405 N  ND1   . HIS C 2 122 ? 75.364  61.219 23.098  1.00 53.27 ? 130 HIS A ND1   1 
ATOM   1406 C  CD2   . HIS C 2 122 ? 76.998  60.809 24.489  1.00 51.61 ? 130 HIS A CD2   1 
ATOM   1407 C  CE1   . HIS C 2 122 ? 75.588  59.917 23.065  1.00 53.88 ? 130 HIS A CE1   1 
ATOM   1408 N  NE2   . HIS C 2 122 ? 76.575  59.642 23.900  1.00 53.78 ? 130 HIS A NE2   1 
ATOM   1409 N  N     . ILE C 2 123 ? 79.005  62.823 22.350  1.00 48.51 ? 131 ILE A N     1 
ATOM   1410 C  CA    . ILE C 2 123 ? 80.354  62.263 22.360  1.00 46.43 ? 131 ILE A CA    1 
ATOM   1411 C  C     . ILE C 2 123 ? 81.371  63.337 22.009  1.00 44.88 ? 131 ILE A C     1 
ATOM   1412 O  O     . ILE C 2 123 ? 81.243  64.004 20.982  1.00 44.53 ? 131 ILE A O     1 
ATOM   1413 C  CB    . ILE C 2 123 ? 80.521  61.112 21.336  1.00 47.00 ? 131 ILE A CB    1 
ATOM   1414 C  CG1   . ILE C 2 123 ? 79.490  60.012 21.591  1.00 46.69 ? 131 ILE A CG1   1 
ATOM   1415 C  CG2   . ILE C 2 123 ? 81.911  60.509 21.457  1.00 47.35 ? 131 ILE A CG2   1 
ATOM   1416 C  CD1   . ILE C 2 123 ? 79.601  58.844 20.619  1.00 44.64 ? 131 ILE A CD1   1 
ATOM   1417 N  N     . PRO C 2 124 ? 82.391  63.533 22.863  1.00 44.18 ? 132 PRO A N     1 
ATOM   1418 C  CA    . PRO C 2 124 ? 83.413  64.551 22.577  1.00 42.88 ? 132 PRO A CA    1 
ATOM   1419 C  C     . PRO C 2 124 ? 84.040  64.234 21.215  1.00 42.09 ? 132 PRO A C     1 
ATOM   1420 O  O     . PRO C 2 124 ? 84.484  63.108 20.977  1.00 39.72 ? 132 PRO A O     1 
ATOM   1421 C  CB    . PRO C 2 124 ? 84.407  64.376 23.724  1.00 42.57 ? 132 PRO A CB    1 
ATOM   1422 C  CG    . PRO C 2 124 ? 83.538  63.891 24.841  1.00 45.28 ? 132 PRO A CG    1 
ATOM   1423 C  CD    . PRO C 2 124 ? 82.656  62.873 24.152  1.00 43.72 ? 132 PRO A CD    1 
ATOM   1424 N  N     . LEU C 2 125 ? 84.057  65.223 20.327  1.00 41.89 ? 133 LEU A N     1 
ATOM   1425 C  CA    . LEU C 2 125 ? 84.591  65.050 18.980  1.00 41.76 ? 133 LEU A CA    1 
ATOM   1426 C  C     . LEU C 2 125 ? 85.827  64.143 18.932  1.00 42.83 ? 133 LEU A C     1 
ATOM   1427 O  O     . LEU C 2 125 ? 85.903  63.219 18.118  1.00 41.06 ? 133 LEU A O     1 
ATOM   1428 C  CB    . LEU C 2 125 ? 84.912  66.419 18.372  1.00 40.55 ? 133 LEU A CB    1 
ATOM   1429 C  CG    . LEU C 2 125 ? 85.351  66.443 16.906  1.00 39.84 ? 133 LEU A CG    1 
ATOM   1430 C  CD1   . LEU C 2 125 ? 84.372  65.617 16.068  1.00 37.64 ? 133 LEU A CD1   1 
ATOM   1431 C  CD2   . LEU C 2 125 ? 85.423  67.895 16.402  1.00 39.23 ? 133 LEU A CD2   1 
ATOM   1432 N  N     . ARG C 2 126 ? 86.779  64.395 19.822  1.00 43.00 ? 134 ARG A N     1 
ATOM   1433 C  CA    . ARG C 2 126 ? 88.005  63.607 19.873  1.00 43.98 ? 134 ARG A CA    1 
ATOM   1434 C  C     . ARG C 2 126 ? 87.814  62.113 20.143  1.00 43.49 ? 134 ARG A C     1 
ATOM   1435 O  O     . ARG C 2 126 ? 88.634  61.300 19.733  1.00 44.44 ? 134 ARG A O     1 
ATOM   1436 C  CB    . ARG C 2 126 ? 88.957  64.181 20.937  1.00 45.15 ? 134 ARG A CB    1 
ATOM   1437 C  CG    . ARG C 2 126 ? 90.213  64.856 20.372  1.00 44.87 ? 134 ARG A CG    1 
ATOM   1438 C  CD    . ARG C 2 126 ? 91.202  65.232 21.472  1.00 42.74 ? 134 ARG A CD    1 
ATOM   1439 N  NE    . ARG C 2 126 ? 92.298  64.272 21.565  1.00 44.96 ? 134 ARG A NE    1 
ATOM   1440 C  CZ    . ARG C 2 126 ? 93.304  64.196 20.698  1.00 42.67 ? 134 ARG A CZ    1 
ATOM   1441 N  NH1   . ARG C 2 126 ? 93.374  65.026 19.671  1.00 44.99 ? 134 ARG A NH1   1 
ATOM   1442 N  NH2   . ARG C 2 126 ? 94.235  63.273 20.848  1.00 46.21 ? 134 ARG A NH2   1 
ATOM   1443 N  N     . GLU C 2 127 ? 86.736  61.750 20.824  1.00 44.67 ? 135 GLU A N     1 
ATOM   1444 C  CA    . GLU C 2 127 ? 86.489  60.351 21.182  1.00 45.63 ? 135 GLU A CA    1 
ATOM   1445 C  C     . GLU C 2 127 ? 85.625  59.518 20.230  1.00 43.59 ? 135 GLU A C     1 
ATOM   1446 O  O     . GLU C 2 127 ? 85.511  58.296 20.391  1.00 43.32 ? 135 GLU A O     1 
ATOM   1447 C  CB    . GLU C 2 127 ? 85.898  60.295 22.598  1.00 49.20 ? 135 GLU A CB    1 
ATOM   1448 C  CG    . GLU C 2 127 ? 86.900  60.613 23.715  1.00 56.03 ? 135 GLU A CG    1 
ATOM   1449 C  CD    . GLU C 2 127 ? 86.224  60.969 25.037  1.00 61.57 ? 135 GLU A CD    1 
ATOM   1450 O  OE1   . GLU C 2 127 ? 85.277  60.255 25.445  1.00 63.71 ? 135 GLU A OE1   1 
ATOM   1451 O  OE2   . GLU C 2 127 ? 86.646  61.963 25.671  1.00 62.69 ? 135 GLU A OE2   1 
ATOM   1452 N  N     . ARG C 2 128 ? 85.021  60.165 19.240  1.00 40.36 ? 136 ARG A N     1 
ATOM   1453 C  CA    . ARG C 2 128 ? 84.182  59.452 18.285  1.00 39.12 ? 136 ARG A CA    1 
ATOM   1454 C  C     . ARG C 2 128 ? 85.034  58.516 17.438  1.00 40.11 ? 136 ARG A C     1 
ATOM   1455 O  O     . ARG C 2 128 ? 86.173  58.844 17.091  1.00 41.31 ? 136 ARG A O     1 
ATOM   1456 C  CB    . ARG C 2 128 ? 83.463  60.451 17.391  1.00 38.56 ? 136 ARG A CB    1 
ATOM   1457 C  CG    . ARG C 2 128 ? 82.723  61.500 18.194  1.00 38.72 ? 136 ARG A CG    1 
ATOM   1458 C  CD    . ARG C 2 128 ? 81.947  62.458 17.328  1.00 36.67 ? 136 ARG A CD    1 
ATOM   1459 N  NE    . ARG C 2 128 ? 81.301  63.459 18.163  1.00 38.29 ? 136 ARG A NE    1 
ATOM   1460 C  CZ    . ARG C 2 128 ? 80.529  64.441 17.713  1.00 38.22 ? 136 ARG A CZ    1 
ATOM   1461 N  NH1   . ARG C 2 128 ? 80.295  64.567 16.413  1.00 33.63 ? 136 ARG A NH1   1 
ATOM   1462 N  NH2   . ARG C 2 128 ? 79.984  65.290 18.576  1.00 37.19 ? 136 ARG A NH2   1 
ATOM   1463 N  N     . HIS C 2 129 ? 84.487  57.348 17.114  1.00 38.33 ? 137 HIS A N     1 
ATOM   1464 C  CA    . HIS C 2 129 ? 85.206  56.379 16.308  1.00 37.01 ? 137 HIS A CA    1 
ATOM   1465 C  C     . HIS C 2 129 ? 84.819  56.407 14.827  1.00 36.70 ? 137 HIS A C     1 
ATOM   1466 O  O     . HIS C 2 129 ? 83.720  56.835 14.444  1.00 34.08 ? 137 HIS A O     1 
ATOM   1467 C  CB    . HIS C 2 129 ? 84.983  54.953 16.833  1.00 39.60 ? 137 HIS A CB    1 
ATOM   1468 C  CG    . HIS C 2 129 ? 85.468  54.728 18.232  1.00 42.98 ? 137 HIS A CG    1 
ATOM   1469 N  ND1   . HIS C 2 129 ? 84.751  55.120 19.344  1.00 43.75 ? 137 HIS A ND1   1 
ATOM   1470 C  CD2   . HIS C 2 129 ? 86.593  54.136 18.700  1.00 43.86 ? 137 HIS A CD2   1 
ATOM   1471 C  CE1   . HIS C 2 129 ? 85.413  54.777 20.435  1.00 43.10 ? 137 HIS A CE1   1 
ATOM   1472 N  NE2   . HIS C 2 129 ? 86.533  54.179 20.073  1.00 44.56 ? 137 HIS A NE2   1 
ATOM   1473 N  N     . ILE C 2 130 ? 85.757  55.930 14.013  1.00 36.67 ? 138 ILE A N     1 
ATOM   1474 C  CA    . ILE C 2 130 ? 85.602  55.808 12.573  1.00 36.14 ? 138 ILE A CA    1 
ATOM   1475 C  C     . ILE C 2 130 ? 85.138  54.369 12.348  1.00 36.66 ? 138 ILE A C     1 
ATOM   1476 O  O     . ILE C 2 130 ? 85.681  53.446 12.960  1.00 37.23 ? 138 ILE A O     1 
ATOM   1477 C  CB    . ILE C 2 130 ? 86.950  56.024 11.878  1.00 36.33 ? 138 ILE A CB    1 
ATOM   1478 C  CG1   . ILE C 2 130 ? 87.389  57.473 12.090  1.00 36.30 ? 138 ILE A CG1   1 
ATOM   1479 C  CG2   . ILE C 2 130 ? 86.852  55.678 10.399  1.00 35.05 ? 138 ILE A CG2   1 
ATOM   1480 C  CD1   . ILE C 2 130 ? 88.831  57.734 11.774  1.00 30.82 ? 138 ILE A CD1   1 
ATOM   1481 N  N     . GLY C 2 131 ? 84.135  54.179 11.492  1.00 34.73 ? 139 GLY A N     1 
ATOM   1482 C  CA    . GLY C 2 131 ? 83.628  52.839 11.240  1.00 36.47 ? 139 GLY A CA    1 
ATOM   1483 C  C     . GLY C 2 131 ? 84.333  52.086 10.122  1.00 39.09 ? 139 GLY A C     1 
ATOM   1484 O  O     . GLY C 2 131 ? 85.229  52.626 9.467   1.00 38.20 ? 139 GLY A O     1 
ATOM   1485 N  N     . ALA C 2 132 ? 83.930  50.833 9.901   1.00 39.79 ? 140 ALA A N     1 
ATOM   1486 C  CA    . ALA C 2 132 ? 84.524  50.018 8.845   1.00 39.77 ? 140 ALA A CA    1 
ATOM   1487 C  C     . ALA C 2 132 ? 84.000  50.505 7.506   1.00 39.86 ? 140 ALA A C     1 
ATOM   1488 O  O     . ALA C 2 132 ? 82.846  50.912 7.391   1.00 41.38 ? 140 ALA A O     1 
ATOM   1489 C  CB    . ALA C 2 132 ? 84.177  48.544 9.044   1.00 39.21 ? 140 ALA A CB    1 
ATOM   1490 N  N     . PRO C 2 133 ? 84.842  50.458 6.468   1.00 39.85 ? 141 PRO A N     1 
ATOM   1491 C  CA    . PRO C 2 133 ? 84.432  50.911 5.140   1.00 38.76 ? 141 PRO A CA    1 
ATOM   1492 C  C     . PRO C 2 133 ? 83.319  50.076 4.516   1.00 39.76 ? 141 PRO A C     1 
ATOM   1493 O  O     . PRO C 2 133 ? 83.226  48.867 4.748   1.00 39.57 ? 141 PRO A O     1 
ATOM   1494 C  CB    . PRO C 2 133 ? 85.731  50.833 4.345   1.00 38.79 ? 141 PRO A CB    1 
ATOM   1495 C  CG    . PRO C 2 133 ? 86.396  49.626 4.936   1.00 40.40 ? 141 PRO A CG    1 
ATOM   1496 C  CD    . PRO C 2 133 ? 86.184  49.846 6.426   1.00 40.24 ? 141 PRO A CD    1 
ATOM   1497 N  N     . ILE C 2 134 ? 82.461  50.732 3.738   1.00 38.18 ? 142 ILE A N     1 
ATOM   1498 C  CA    . ILE C 2 134 ? 81.381  50.045 3.046   1.00 36.59 ? 142 ILE A CA    1 
ATOM   1499 C  C     . ILE C 2 134 ? 81.408  50.527 1.610   1.00 36.27 ? 142 ILE A C     1 
ATOM   1500 O  O     . ILE C 2 134 ? 81.074  51.677 1.321   1.00 36.76 ? 142 ILE A O     1 
ATOM   1501 C  CB    . ILE C 2 134 ? 79.997  50.337 3.683   1.00 35.94 ? 142 ILE A CB    1 
ATOM   1502 C  CG1   . ILE C 2 134 ? 79.991  49.845 5.134   1.00 34.63 ? 142 ILE A CG1   1 
ATOM   1503 C  CG2   . ILE C 2 134 ? 78.888  49.626 2.887   1.00 33.65 ? 142 ILE A CG2   1 
ATOM   1504 C  CD1   . ILE C 2 134 ? 78.700  50.083 5.864   1.00 36.00 ? 142 ILE A CD1   1 
ATOM   1505 N  N     . PHE C 2 135 ? 81.832  49.644 0.713   1.00 36.64 ? 143 PHE A N     1 
ATOM   1506 C  CA    . PHE C 2 135 ? 81.923  49.964 -0.702  1.00 38.48 ? 143 PHE A CA    1 
ATOM   1507 C  C     . PHE C 2 135 ? 80.573  49.667 -1.347  1.00 39.08 ? 143 PHE A C     1 
ATOM   1508 O  O     . PHE C 2 135 ? 80.110  48.532 -1.354  1.00 39.96 ? 143 PHE A O     1 
ATOM   1509 C  CB    . PHE C 2 135 ? 83.037  49.140 -1.343  1.00 38.36 ? 143 PHE A CB    1 
ATOM   1510 C  CG    . PHE C 2 135 ? 83.361  49.544 -2.737  1.00 40.40 ? 143 PHE A CG    1 
ATOM   1511 C  CD1   . PHE C 2 135 ? 83.767  50.845 -3.019  1.00 41.24 ? 143 PHE A CD1   1 
ATOM   1512 C  CD2   . PHE C 2 135 ? 83.201  48.648 -3.784  1.00 39.43 ? 143 PHE A CD2   1 
ATOM   1513 C  CE1   . PHE C 2 135 ? 84.049  51.234 -4.319  1.00 40.33 ? 143 PHE A CE1   1 
ATOM   1514 C  CE2   . PHE C 2 135 ? 83.481  49.022 -5.090  1.00 40.23 ? 143 PHE A CE2   1 
ATOM   1515 C  CZ    . PHE C 2 135 ? 83.886  50.322 -5.363  1.00 41.77 ? 143 PHE A CZ    1 
ATOM   1516 N  N     . TRP C 2 136 ? 79.954  50.693 -1.915  1.00 39.19 ? 144 TRP A N     1 
ATOM   1517 C  CA    . TRP C 2 136 ? 78.623  50.538 -2.477  1.00 37.87 ? 144 TRP A CA    1 
ATOM   1518 C  C     . TRP C 2 136 ? 78.409  50.997 -3.913  1.00 37.74 ? 144 TRP A C     1 
ATOM   1519 O  O     . TRP C 2 136 ? 79.006  51.967 -4.369  1.00 37.63 ? 144 TRP A O     1 
ATOM   1520 C  CB    . TRP C 2 136 ? 77.640  51.283 -1.560  1.00 36.51 ? 144 TRP A CB    1 
ATOM   1521 C  CG    . TRP C 2 136 ? 76.230  51.401 -2.061  1.00 36.04 ? 144 TRP A CG    1 
ATOM   1522 C  CD1   . TRP C 2 136 ? 75.230  50.486 -1.914  1.00 35.47 ? 144 TRP A CD1   1 
ATOM   1523 C  CD2   . TRP C 2 136 ? 75.653  52.524 -2.743  1.00 34.24 ? 144 TRP A CD2   1 
ATOM   1524 N  NE1   . TRP C 2 136 ? 74.063  50.970 -2.457  1.00 34.75 ? 144 TRP A NE1   1 
ATOM   1525 C  CE2   . TRP C 2 136 ? 74.294  52.211 -2.978  1.00 34.38 ? 144 TRP A CE2   1 
ATOM   1526 C  CE3   . TRP C 2 136 ? 76.152  53.754 -3.187  1.00 33.58 ? 144 TRP A CE3   1 
ATOM   1527 C  CZ2   . TRP C 2 136 ? 73.422  53.099 -3.624  1.00 34.31 ? 144 TRP A CZ2   1 
ATOM   1528 C  CZ3   . TRP C 2 136 ? 75.282  54.640 -3.832  1.00 34.05 ? 144 TRP A CZ3   1 
ATOM   1529 C  CH2   . TRP C 2 136 ? 73.932  54.300 -4.049  1.00 35.08 ? 144 TRP A CH2   1 
ATOM   1530 N  N     . LYS C 2 137 ? 77.536  50.272 -4.603  1.00 38.58 ? 145 LYS A N     1 
ATOM   1531 C  CA    . LYS C 2 137 ? 77.112  50.573 -5.969  1.00 39.27 ? 145 LYS A CA    1 
ATOM   1532 C  C     . LYS C 2 137 ? 75.607  50.344 -5.894  1.00 39.27 ? 145 LYS A C     1 
ATOM   1533 O  O     . LYS C 2 137 ? 75.159  49.305 -5.407  1.00 39.74 ? 145 LYS A O     1 
ATOM   1534 C  CB    . LYS C 2 137 ? 77.724  49.609 -6.998  1.00 39.43 ? 145 LYS A CB    1 
ATOM   1535 C  CG    . LYS C 2 137 ? 79.217  49.771 -7.213  1.00 40.99 ? 145 LYS A CG    1 
ATOM   1536 C  CD    . LYS C 2 137 ? 79.645  49.272 -8.587  1.00 42.85 ? 145 LYS A CD    1 
ATOM   1537 C  CE    . LYS C 2 137 ? 79.155  50.198 -9.690  1.00 42.37 ? 145 LYS A CE    1 
ATOM   1538 N  NZ    . LYS C 2 137 ? 79.917  49.994 -10.954 1.00 43.45 ? 145 LYS A NZ    1 
ATOM   1539 N  N     . PRO C 2 138 ? 74.802  51.309 -6.366  1.00 40.04 ? 146 PRO A N     1 
ATOM   1540 C  CA    . PRO C 2 138 ? 73.352  51.111 -6.298  1.00 40.27 ? 146 PRO A CA    1 
ATOM   1541 C  C     . PRO C 2 138 ? 72.848  49.841 -6.985  1.00 42.03 ? 146 PRO A C     1 
ATOM   1542 O  O     . PRO C 2 138 ? 73.349  49.443 -8.044  1.00 41.12 ? 146 PRO A O     1 
ATOM   1543 C  CB    . PRO C 2 138 ? 72.799  52.384 -6.938  1.00 40.38 ? 146 PRO A CB    1 
ATOM   1544 C  CG    . PRO C 2 138 ? 73.871  52.768 -7.915  1.00 39.05 ? 146 PRO A CG    1 
ATOM   1545 C  CD    . PRO C 2 138 ? 75.139  52.518 -7.141  1.00 38.34 ? 146 PRO A CD    1 
ATOM   1546 N  N     . THR C 2 139 ? 71.874  49.194 -6.351  1.00 43.74 ? 147 THR A N     1 
ATOM   1547 C  CA    . THR C 2 139 ? 71.251  47.995 -6.905  1.00 44.34 ? 147 THR A CA    1 
ATOM   1548 C  C     . THR C 2 139 ? 70.276  48.505 -7.956  1.00 46.55 ? 147 THR A C     1 
ATOM   1549 O  O     . THR C 2 139 ? 70.042  49.715 -8.064  1.00 46.50 ? 147 THR A O     1 
ATOM   1550 C  CB    . THR C 2 139 ? 70.415  47.243 -5.864  1.00 41.88 ? 147 THR A CB    1 
ATOM   1551 O  OG1   . THR C 2 139 ? 69.373  48.110 -5.390  1.00 42.23 ? 147 THR A OG1   1 
ATOM   1552 C  CG2   . THR C 2 139 ? 71.271  46.784 -4.714  1.00 37.96 ? 147 THR A CG2   1 
ATOM   1553 N  N     . ALA C 2 140 ? 69.696  47.585 -8.718  1.00 47.90 ? 148 ALA A N     1 
ATOM   1554 C  CA    . ALA C 2 140 ? 68.735  47.960 -9.749  1.00 48.49 ? 148 ALA A CA    1 
ATOM   1555 C  C     . ALA C 2 140 ? 67.605  48.792 -9.137  1.00 47.99 ? 148 ALA A C     1 
ATOM   1556 O  O     . ALA C 2 140 ? 67.258  49.858 -9.650  1.00 47.99 ? 148 ALA A O     1 
ATOM   1557 C  CB    . ALA C 2 140 ? 68.169  46.706 -10.413 1.00 49.04 ? 148 ALA A CB    1 
ATOM   1558 N  N     . GLU C 2 141 ? 67.049  48.300 -8.033  1.00 47.40 ? 149 GLU A N     1 
ATOM   1559 C  CA    . GLU C 2 141 ? 65.954  48.975 -7.342  1.00 48.60 ? 149 GLU A CA    1 
ATOM   1560 C  C     . GLU C 2 141 ? 66.340  50.370 -6.850  1.00 48.68 ? 149 GLU A C     1 
ATOM   1561 O  O     . GLU C 2 141 ? 65.587  51.334 -7.019  1.00 48.04 ? 149 GLU A O     1 
ATOM   1562 C  CB    . GLU C 2 141 ? 65.492  48.126 -6.154  1.00 50.48 ? 149 GLU A CB    1 
ATOM   1563 C  CG    . GLU C 2 141 ? 64.266  48.658 -5.439  1.00 53.71 ? 149 GLU A CG    1 
ATOM   1564 C  CD    . GLU C 2 141 ? 63.129  48.957 -6.397  1.00 57.21 ? 149 GLU A CD    1 
ATOM   1565 O  OE1   . GLU C 2 141 ? 63.081  48.315 -7.472  1.00 58.86 ? 149 GLU A OE1   1 
ATOM   1566 O  OE2   . GLU C 2 141 ? 62.281  49.824 -6.071  1.00 57.00 ? 149 GLU A OE2   1 
ATOM   1567 N  N     . GLN C 2 142 ? 67.514  50.475 -6.242  1.00 47.49 ? 150 GLN A N     1 
ATOM   1568 C  CA    . GLN C 2 142 ? 67.968  51.755 -5.736  1.00 46.21 ? 150 GLN A CA    1 
ATOM   1569 C  C     . GLN C 2 142 ? 68.112  52.781 -6.840  1.00 47.29 ? 150 GLN A C     1 
ATOM   1570 O  O     . GLN C 2 142 ? 67.778  53.950 -6.644  1.00 47.21 ? 150 GLN A O     1 
ATOM   1571 C  CB    . GLN C 2 142 ? 69.280  51.588 -4.978  1.00 43.60 ? 150 GLN A CB    1 
ATOM   1572 C  CG    . GLN C 2 142 ? 69.098  50.780 -3.720  1.00 40.18 ? 150 GLN A CG    1 
ATOM   1573 C  CD    . GLN C 2 142 ? 70.400  50.444 -3.044  1.00 39.02 ? 150 GLN A CD    1 
ATOM   1574 O  OE1   . GLN C 2 142 ? 71.397  50.137 -3.701  1.00 36.36 ? 150 GLN A OE1   1 
ATOM   1575 N  NE2   . GLN C 2 142 ? 70.398  50.479 -1.719  1.00 38.02 ? 150 GLN A NE2   1 
ATOM   1576 N  N     . GLU C 2 143 ? 68.585  52.364 -8.011  1.00 49.32 ? 151 GLU A N     1 
ATOM   1577 C  CA    . GLU C 2 143 ? 68.727  53.330 -9.086  1.00 51.35 ? 151 GLU A CA    1 
ATOM   1578 C  C     . GLU C 2 143 ? 67.354  53.682 -9.635  1.00 52.68 ? 151 GLU A C     1 
ATOM   1579 O  O     . GLU C 2 143 ? 67.116  54.818 -10.056 1.00 53.01 ? 151 GLU A O     1 
ATOM   1580 C  CB    . GLU C 2 143 ? 69.624  52.806 -10.214 1.00 52.39 ? 151 GLU A CB    1 
ATOM   1581 C  CG    . GLU C 2 143 ? 70.273  53.964 -10.975 1.00 55.82 ? 151 GLU A CG    1 
ATOM   1582 C  CD    . GLU C 2 143 ? 71.266  53.541 -12.039 1.00 56.80 ? 151 GLU A CD    1 
ATOM   1583 O  OE1   . GLU C 2 143 ? 71.992  52.548 -11.826 1.00 59.63 ? 151 GLU A OE1   1 
ATOM   1584 O  OE2   . GLU C 2 143 ? 71.333  54.228 -13.080 1.00 57.40 ? 151 GLU A OE2   1 
ATOM   1585 N  N     . ARG C 2 144 ? 66.447  52.709 -9.623  1.00 53.47 ? 152 ARG A N     1 
ATOM   1586 C  CA    . ARG C 2 144 ? 65.091  52.937 -10.117 1.00 54.73 ? 152 ARG A CA    1 
ATOM   1587 C  C     . ARG C 2 144 ? 64.479  54.014 -9.222  1.00 53.34 ? 152 ARG A C     1 
ATOM   1588 O  O     . ARG C 2 144 ? 63.831  54.951 -9.696  1.00 53.40 ? 152 ARG A O     1 
ATOM   1589 C  CB    . ARG C 2 144 ? 64.276  51.630 -10.057 1.00 56.09 ? 152 ARG A CB    1 
ATOM   1590 C  CG    . ARG C 2 144 ? 63.022  51.591 -10.939 1.00 57.92 ? 152 ARG A CG    1 
ATOM   1591 C  CD    . ARG C 2 144 ? 61.849  52.286 -10.276 1.00 61.07 ? 152 ARG A CD    1 
ATOM   1592 N  NE    . ARG C 2 144 ? 61.511  51.636 -9.011  1.00 62.42 ? 152 ARG A NE    1 
ATOM   1593 C  CZ    . ARG C 2 144 ? 60.764  52.185 -8.062  1.00 62.84 ? 152 ARG A CZ    1 
ATOM   1594 N  NH1   . ARG C 2 144 ? 60.264  53.401 -8.230  1.00 64.46 ? 152 ARG A NH1   1 
ATOM   1595 N  NH2   . ARG C 2 144 ? 60.540  51.529 -6.933  1.00 63.20 ? 152 ARG A NH2   1 
ATOM   1596 N  N     . GLN C 2 145 ? 64.728  53.896 -7.923  1.00 51.53 ? 153 GLN A N     1 
ATOM   1597 C  CA    . GLN C 2 145 ? 64.207  54.860 -6.969  1.00 51.00 ? 153 GLN A CA    1 
ATOM   1598 C  C     . GLN C 2 145 ? 64.868  56.217 -7.183  1.00 49.15 ? 153 GLN A C     1 
ATOM   1599 O  O     . GLN C 2 145 ? 64.186  57.231 -7.338  1.00 48.92 ? 153 GLN A O     1 
ATOM   1600 C  CB    . GLN C 2 145 ? 64.443  54.358 -5.541  1.00 52.62 ? 153 GLN A CB    1 
ATOM   1601 C  CG    . GLN C 2 145 ? 63.871  52.962 -5.303  1.00 58.53 ? 153 GLN A CG    1 
ATOM   1602 C  CD    . GLN C 2 145 ? 64.034  52.470 -3.870  1.00 62.73 ? 153 GLN A CD    1 
ATOM   1603 O  OE1   . GLN C 2 145 ? 65.144  52.426 -3.330  1.00 64.68 ? 153 GLN A OE1   1 
ATOM   1604 N  NE2   . GLN C 2 145 ? 62.921  52.090 -3.249  1.00 64.84 ? 153 GLN A NE2   1 
ATOM   1605 N  N     . LEU C 2 146 ? 66.197  56.234 -7.208  1.00 47.49 ? 154 LEU A N     1 
ATOM   1606 C  CA    . LEU C 2 146 ? 66.936  57.474 -7.406  1.00 46.04 ? 154 LEU A CA    1 
ATOM   1607 C  C     . LEU C 2 146 ? 66.532  58.181 -8.693  1.00 47.29 ? 154 LEU A C     1 
ATOM   1608 O  O     . LEU C 2 146 ? 66.351  59.400 -8.714  1.00 47.33 ? 154 LEU A O     1 
ATOM   1609 C  CB    . LEU C 2 146 ? 68.435  57.189 -7.436  1.00 44.96 ? 154 LEU A CB    1 
ATOM   1610 C  CG    . LEU C 2 146 ? 69.045  56.742 -6.112  1.00 43.95 ? 154 LEU A CG    1 
ATOM   1611 C  CD1   . LEU C 2 146 ? 70.438  56.216 -6.372  1.00 43.52 ? 154 LEU A CD1   1 
ATOM   1612 C  CD2   . LEU C 2 146 ? 69.061  57.905 -5.116  1.00 41.34 ? 154 LEU A CD2   1 
ATOM   1613 N  N     . LYS C 2 147 ? 66.393  57.412 -9.768  1.00 49.04 ? 155 LYS A N     1 
ATOM   1614 C  CA    . LYS C 2 147 ? 66.019  57.976 -11.060 1.00 50.93 ? 155 LYS A CA    1 
ATOM   1615 C  C     . LYS C 2 147 ? 64.664  58.662 -10.982 1.00 51.08 ? 155 LYS A C     1 
ATOM   1616 O  O     . LYS C 2 147 ? 64.502  59.790 -11.447 1.00 51.08 ? 155 LYS A O     1 
ATOM   1617 C  CB    . LYS C 2 147 ? 65.981  56.880 -12.133 1.00 52.82 ? 155 LYS A CB    1 
ATOM   1618 C  CG    . LYS C 2 147 ? 65.512  57.367 -13.515 1.00 55.12 ? 155 LYS A CG    1 
ATOM   1619 C  CD    . LYS C 2 147 ? 65.578  56.252 -14.557 1.00 58.23 ? 155 LYS A CD    1 
ATOM   1620 C  CE    . LYS C 2 147 ? 64.913  56.653 -15.870 1.00 58.58 ? 155 LYS A CE    1 
ATOM   1621 N  NZ    . LYS C 2 147 ? 65.521  57.876 -16.461 1.00 60.55 ? 155 LYS A NZ    1 
ATOM   1622 N  N     . GLN C 2 148 ? 63.697  57.973 -10.387 1.00 51.27 ? 156 GLN A N     1 
ATOM   1623 C  CA    . GLN C 2 148 ? 62.349  58.501 -10.248 1.00 51.69 ? 156 GLN A CA    1 
ATOM   1624 C  C     . GLN C 2 148 ? 62.343  59.867 -9.574  1.00 50.89 ? 156 GLN A C     1 
ATOM   1625 O  O     . GLN C 2 148 ? 61.773  60.824 -10.102 1.00 50.97 ? 156 GLN A O     1 
ATOM   1626 C  CB    . GLN C 2 148 ? 61.494  57.522 -9.446  1.00 54.67 ? 156 GLN A CB    1 
ATOM   1627 C  CG    . GLN C 2 148 ? 60.030  57.906 -9.323  1.00 57.53 ? 156 GLN A CG    1 
ATOM   1628 C  CD    . GLN C 2 148 ? 59.238  56.852 -8.583  1.00 61.34 ? 156 GLN A CD    1 
ATOM   1629 O  OE1   . GLN C 2 148 ? 58.635  57.122 -7.543  1.00 63.42 ? 156 GLN A OE1   1 
ATOM   1630 N  NE2   . GLN C 2 148 ? 59.245  55.631 -9.112  1.00 61.64 ? 156 GLN A NE2   1 
ATOM   1631 N  N     . ASP C 2 149 ? 62.975  59.960 -8.407  1.00 49.81 ? 157 ASP A N     1 
ATOM   1632 C  CA    . ASP C 2 149 ? 63.016  61.223 -7.685  1.00 48.46 ? 157 ASP A CA    1 
ATOM   1633 C  C     . ASP C 2 149 ? 63.710  62.325 -8.476  1.00 46.32 ? 157 ASP A C     1 
ATOM   1634 O  O     . ASP C 2 149 ? 63.234  63.462 -8.507  1.00 43.41 ? 157 ASP A O     1 
ATOM   1635 C  CB    . ASP C 2 149 ? 63.710  61.060 -6.329  1.00 51.16 ? 157 ASP A CB    1 
ATOM   1636 C  CG    . ASP C 2 149 ? 62.917  60.197 -5.361  1.00 54.78 ? 157 ASP A CG    1 
ATOM   1637 O  OD1   . ASP C 2 149 ? 61.672  60.134 -5.486  1.00 55.29 ? 157 ASP A OD1   1 
ATOM   1638 O  OD2   . ASP C 2 149 ? 63.545  59.592 -4.461  1.00 55.53 ? 157 ASP A OD2   1 
ATOM   1639 N  N     . TRP C 2 150 ? 64.831  61.989 -9.112  1.00 46.11 ? 158 TRP A N     1 
ATOM   1640 C  CA    . TRP C 2 150 ? 65.583  62.962 -9.896  1.00 46.13 ? 158 TRP A CA    1 
ATOM   1641 C  C     . TRP C 2 150 ? 64.713  63.605 -10.985 1.00 46.47 ? 158 TRP A C     1 
ATOM   1642 O  O     . TRP C 2 150 ? 64.672  64.832 -11.123 1.00 43.83 ? 158 TRP A O     1 
ATOM   1643 C  CB    . TRP C 2 150 ? 66.800  62.292 -10.539 1.00 45.82 ? 158 TRP A CB    1 
ATOM   1644 C  CG    . TRP C 2 150 ? 67.774  63.274 -11.138 1.00 48.10 ? 158 TRP A CG    1 
ATOM   1645 C  CD1   . TRP C 2 150 ? 68.765  63.952 -10.484 1.00 47.88 ? 158 TRP A CD1   1 
ATOM   1646 C  CD2   . TRP C 2 150 ? 67.842  63.690 -12.509 1.00 48.30 ? 158 TRP A CD2   1 
ATOM   1647 N  NE1   . TRP C 2 150 ? 69.448  64.760 -11.362 1.00 47.07 ? 158 TRP A NE1   1 
ATOM   1648 C  CE2   . TRP C 2 150 ? 68.903  64.620 -12.611 1.00 48.46 ? 158 TRP A CE2   1 
ATOM   1649 C  CE3   . TRP C 2 150 ? 67.109  63.370 -13.662 1.00 49.50 ? 158 TRP A CE3   1 
ATOM   1650 C  CZ2   . TRP C 2 150 ? 69.253  65.232 -13.821 1.00 49.64 ? 158 TRP A CZ2   1 
ATOM   1651 C  CZ3   . TRP C 2 150 ? 67.455  63.978 -14.868 1.00 50.83 ? 158 TRP A CZ3   1 
ATOM   1652 C  CH2   . TRP C 2 150 ? 68.520  64.900 -14.936 1.00 50.58 ? 158 TRP A CH2   1 
ATOM   1653 N  N     . GLU C 2 151 ? 64.014  62.775 -11.752 1.00 48.36 ? 159 GLU A N     1 
ATOM   1654 C  CA    . GLU C 2 151 ? 63.153  63.276 -12.826 1.00 52.34 ? 159 GLU A CA    1 
ATOM   1655 C  C     . GLU C 2 151 ? 62.023  64.144 -12.292 1.00 52.69 ? 159 GLU A C     1 
ATOM   1656 O  O     . GLU C 2 151 ? 61.710  65.188 -12.868 1.00 52.95 ? 159 GLU A O     1 
ATOM   1657 C  CB    . GLU C 2 151 ? 62.575  62.112 -13.635 1.00 52.73 ? 159 GLU A CB    1 
ATOM   1658 C  CG    . GLU C 2 151 ? 63.642  61.284 -14.320 1.00 57.71 ? 159 GLU A CG    1 
ATOM   1659 C  CD    . GLU C 2 151 ? 63.077  60.227 -15.245 1.00 60.67 ? 159 GLU A CD    1 
ATOM   1660 O  OE1   . GLU C 2 151 ? 62.207  59.450 -14.800 1.00 63.11 ? 159 GLU A OE1   1 
ATOM   1661 O  OE2   . GLU C 2 151 ? 63.512  60.167 -16.418 1.00 63.84 ? 159 GLU A OE2   1 
ATOM   1662 N  N     . GLU C 2 152 ? 61.421  63.713 -11.187 1.00 53.84 ? 160 GLU A N     1 
ATOM   1663 C  CA    . GLU C 2 152 ? 60.327  64.457 -10.575 1.00 54.40 ? 160 GLU A CA    1 
ATOM   1664 C  C     . GLU C 2 152 ? 60.805  65.839 -10.153 1.00 54.19 ? 160 GLU A C     1 
ATOM   1665 O  O     . GLU C 2 152 ? 60.203  66.850 -10.514 1.00 54.92 ? 160 GLU A O     1 
ATOM   1666 C  CB    . GLU C 2 152 ? 59.794  63.716 -9.345  1.00 56.34 ? 160 GLU A CB    1 
ATOM   1667 C  CG    . GLU C 2 152 ? 58.448  64.233 -8.846  1.00 58.81 ? 160 GLU A CG    1 
ATOM   1668 C  CD    . GLU C 2 152 ? 57.959  63.498 -7.609  1.00 60.86 ? 160 GLU A CD    1 
ATOM   1669 O  OE1   . GLU C 2 152 ? 58.269  62.294 -7.469  1.00 61.68 ? 160 GLU A OE1   1 
ATOM   1670 O  OE2   . GLU C 2 152 ? 57.251  64.118 -6.784  1.00 62.39 ? 160 GLU A OE2   1 
ATOM   1671 N  N     . LEU C 2 153 ? 61.897  65.876 -9.395  1.00 53.17 ? 161 LEU A N     1 
ATOM   1672 C  CA    . LEU C 2 153 ? 62.448  67.135 -8.911  1.00 52.17 ? 161 LEU A CA    1 
ATOM   1673 C  C     . LEU C 2 153 ? 62.958  68.015 -10.049 1.00 52.20 ? 161 LEU A C     1 
ATOM   1674 O  O     . LEU C 2 153 ? 62.796  69.233 -10.014 1.00 51.03 ? 161 LEU A O     1 
ATOM   1675 C  CB    . LEU C 2 153 ? 63.560  66.859 -7.895  1.00 50.70 ? 161 LEU A CB    1 
ATOM   1676 C  CG    . LEU C 2 153 ? 63.093  66.165 -6.608  1.00 49.64 ? 161 LEU A CG    1 
ATOM   1677 C  CD1   . LEU C 2 153 ? 64.288  65.665 -5.807  1.00 49.66 ? 161 LEU A CD1   1 
ATOM   1678 C  CD2   . LEU C 2 153 ? 62.264  67.136 -5.786  1.00 47.22 ? 161 LEU A CD2   1 
ATOM   1679 N  N     . MET C 2 154 ? 63.562  67.402 -11.062 1.00 53.36 ? 162 MET A N     1 
ATOM   1680 C  CA    . MET C 2 154 ? 64.065  68.163 -12.202 1.00 56.14 ? 162 MET A CA    1 
ATOM   1681 C  C     . MET C 2 154 ? 62.943  68.821 -13.009 1.00 57.69 ? 162 MET A C     1 
ATOM   1682 O  O     . MET C 2 154 ? 63.079  69.967 -13.441 1.00 57.33 ? 162 MET A O     1 
ATOM   1683 C  CB    . MET C 2 154 ? 64.899  67.270 -13.124 1.00 55.81 ? 162 MET A CB    1 
ATOM   1684 C  CG    . MET C 2 154 ? 66.296  67.004 -12.617 1.00 58.50 ? 162 MET A CG    1 
ATOM   1685 S  SD    . MET C 2 154 ? 67.160  68.546 -12.247 1.00 60.21 ? 162 MET A SD    1 
ATOM   1686 C  CE    . MET C 2 154 ? 67.660  69.070 -13.904 1.00 59.68 ? 162 MET A CE    1 
ATOM   1687 N  N     . ASP C 2 155 ? 61.842  68.104 -13.223 1.00 59.53 ? 163 ASP A N     1 
ATOM   1688 C  CA    . ASP C 2 155 ? 60.732  68.674 -13.980 1.00 62.37 ? 163 ASP A CA    1 
ATOM   1689 C  C     . ASP C 2 155 ? 60.282  69.970 -13.327 1.00 63.12 ? 163 ASP A C     1 
ATOM   1690 O  O     . ASP C 2 155 ? 60.112  70.983 -14.001 1.00 63.85 ? 163 ASP A O     1 
ATOM   1691 C  CB    . ASP C 2 155 ? 59.546  67.704 -14.061 1.00 63.43 ? 163 ASP A CB    1 
ATOM   1692 C  CG    . ASP C 2 155 ? 59.824  66.511 -14.962 1.00 66.36 ? 163 ASP A CG    1 
ATOM   1693 O  OD1   . ASP C 2 155 ? 60.558  66.676 -15.965 1.00 67.11 ? 163 ASP A OD1   1 
ATOM   1694 O  OD2   . ASP C 2 155 ? 59.296  65.410 -14.677 1.00 68.05 ? 163 ASP A OD2   1 
ATOM   1695 N  N     . LEU C 2 156 ? 60.101  69.936 -12.012 1.00 63.53 ? 164 LEU A N     1 
ATOM   1696 C  CA    . LEU C 2 156 ? 59.681  71.118 -11.271 1.00 64.01 ? 164 LEU A CA    1 
ATOM   1697 C  C     . LEU C 2 156 ? 60.624  72.300 -11.515 1.00 64.87 ? 164 LEU A C     1 
ATOM   1698 O  O     . LEU C 2 156 ? 60.176  73.426 -11.754 1.00 65.53 ? 164 LEU A O     1 
ATOM   1699 C  CB    . LEU C 2 156 ? 59.619  70.796 -9.776  1.00 63.96 ? 164 LEU A CB    1 
ATOM   1700 C  CG    . LEU C 2 156 ? 58.498  69.852 -9.340  1.00 64.01 ? 164 LEU A CG    1 
ATOM   1701 C  CD1   . LEU C 2 156 ? 58.778  69.331 -7.951  1.00 65.57 ? 164 LEU A CD1   1 
ATOM   1702 C  CD2   . LEU C 2 156 ? 57.173  70.583 -9.372  1.00 64.99 ? 164 LEU A CD2   1 
ATOM   1703 N  N     . ILE C 2 157 ? 61.927  72.038 -11.459 1.00 64.28 ? 165 ILE A N     1 
ATOM   1704 C  CA    . ILE C 2 157 ? 62.932  73.074 -11.666 1.00 64.05 ? 165 ILE A CA    1 
ATOM   1705 C  C     . ILE C 2 157 ? 62.889  73.624 -13.081 1.00 65.00 ? 165 ILE A C     1 
ATOM   1706 O  O     . ILE C 2 157 ? 63.082  74.821 -13.294 1.00 65.60 ? 165 ILE A O     1 
ATOM   1707 C  CB    . ILE C 2 157 ? 64.356  72.540 -11.400 1.00 63.79 ? 165 ILE A CB    1 
ATOM   1708 C  CG1   . ILE C 2 157 ? 64.543  72.276 -9.906  1.00 62.76 ? 165 ILE A CG1   1 
ATOM   1709 C  CG2   . ILE C 2 157 ? 65.394  73.539 -11.895 1.00 63.78 ? 165 ILE A CG2   1 
ATOM   1710 C  CD1   . ILE C 2 157 ? 65.879  71.688 -9.560  1.00 62.48 ? 165 ILE A CD1   1 
ATOM   1711 N  N     . VAL C 2 158 ? 62.640  72.744 -14.045 1.00 65.99 ? 166 VAL A N     1 
ATOM   1712 C  CA    . VAL C 2 158 ? 62.576  73.138 -15.448 1.00 67.01 ? 166 VAL A CA    1 
ATOM   1713 C  C     . VAL C 2 158 ? 61.272  73.856 -15.790 1.00 67.36 ? 166 VAL A C     1 
ATOM   1714 O  O     . VAL C 2 158 ? 61.185  74.557 -16.794 1.00 67.81 ? 166 VAL A O     1 
ATOM   1715 C  CB    . VAL C 2 158 ? 62.736  71.906 -16.371 1.00 66.50 ? 166 VAL A CB    1 
ATOM   1716 C  CG1   . VAL C 2 158 ? 62.605  72.319 -17.831 1.00 66.20 ? 166 VAL A CG1   1 
ATOM   1717 C  CG2   . VAL C 2 158 ? 64.086  71.254 -16.125 1.00 65.91 ? 166 VAL A CG2   1 
ATOM   1718 N  N     . LEU C 2 159 ? 60.266  73.696 -14.942 1.00 68.11 ? 167 LEU A N     1 
ATOM   1719 C  CA    . LEU C 2 159 ? 58.975  74.325 -15.185 1.00 69.24 ? 167 LEU A CA    1 
ATOM   1720 C  C     . LEU C 2 159 ? 58.674  75.522 -14.277 1.00 69.26 ? 167 LEU A C     1 
ATOM   1721 O  O     . LEU C 2 159 ? 57.523  75.923 -14.143 1.00 70.15 ? 167 LEU A O     1 
ATOM   1722 C  CB    . LEU C 2 159 ? 57.862  73.282 -15.054 1.00 69.91 ? 167 LEU A CB    1 
ATOM   1723 C  CG    . LEU C 2 159 ? 58.059  72.061 -15.964 1.00 71.19 ? 167 LEU A CG    1 
ATOM   1724 C  CD1   . LEU C 2 159 ? 56.962  71.037 -15.710 1.00 71.24 ? 167 LEU A CD1   1 
ATOM   1725 C  CD2   . LEU C 2 159 ? 58.060  72.496 -17.424 1.00 71.47 ? 167 LEU A CD2   1 
ATOM   1726 N  N     . GLY C 2 160 ? 59.705  76.092 -13.660 1.00 69.12 ? 168 GLY A N     1 
ATOM   1727 C  CA    . GLY C 2 160 ? 59.518  77.245 -12.790 1.00 68.03 ? 168 GLY A CA    1 
ATOM   1728 C  C     . GLY C 2 160 ? 58.710  77.056 -11.512 1.00 67.89 ? 168 GLY A C     1 
ATOM   1729 O  O     . GLY C 2 160 ? 58.355  78.057 -10.878 1.00 68.14 ? 168 GLY A O     1 
ATOM   1730 N  N     . LYS C 2 161 ? 58.428  75.817 -11.112 1.00 67.71 ? 169 LYS A N     1 
ATOM   1731 C  CA    . LYS C 2 161 ? 57.659  75.584 -9.894  1.00 67.42 ? 169 LYS A CA    1 
ATOM   1732 C  C     . LYS C 2 161 ? 58.607  75.556 -8.729  1.00 67.02 ? 169 LYS A C     1 
ATOM   1733 O  O     . LYS C 2 161 ? 58.423  74.798 -7.787  1.00 67.46 ? 169 LYS A O     1 
ATOM   1734 C  CB    . LYS C 2 161 ? 56.875  74.278 -10.033 1.00 66.78 ? 169 LYS A CB    1 
ATOM   1735 C  CG    . LYS C 2 161 ? 55.988  74.335 -11.257 1.00 67.32 ? 169 LYS A CG    1 
ATOM   1736 C  CD    . LYS C 2 161 ? 55.179  73.055 -11.480 1.00 68.91 ? 169 LYS A CD    1 
ATOM   1737 C  CE    . LYS C 2 161 ? 54.460  73.091 -12.839 1.00 68.18 ? 169 LYS A CE    1 
ATOM   1738 N  NZ    . LYS C 2 161 ? 53.691  71.848 -13.161 1.00 69.53 ? 169 LYS A NZ    1 
ATOM   1739 N  N     . LEU C 2 162 ? 59.643  76.376 -8.826  1.00 66.52 ? 170 LEU A N     1 
ATOM   1740 C  CA    . LEU C 2 162 ? 60.603  76.443 -7.756  1.00 66.49 ? 170 LEU A CA    1 
ATOM   1741 C  C     . LEU C 2 162 ? 59.924  76.801 -6.436  1.00 66.88 ? 170 LEU A C     1 
ATOM   1742 O  O     . LEU C 2 162 ? 60.351  76.406 -5.348  1.00 67.17 ? 170 LEU A O     1 
ATOM   1743 C  CB    . LEU C 2 162 ? 61.630  77.492 -8.088  1.00 66.54 ? 170 LEU A CB    1 
ATOM   1744 C  CG    . LEU C 2 162 ? 62.754  77.305 -9.064  1.00 65.30 ? 170 LEU A CG    1 
ATOM   1745 C  CD1   . LEU C 2 162 ? 63.602  78.519 -8.901  1.00 64.42 ? 170 LEU A CD1   1 
ATOM   1746 C  CD2   . LEU C 2 162 ? 63.511  76.043 -8.750  1.00 65.08 ? 170 LEU A CD2   1 
ATOM   1747 N  N     . ASP C 2 163 ? 58.831  77.537 -6.549  1.00 68.01 ? 171 ASP A N     1 
ATOM   1748 C  CA    . ASP C 2 163 ? 58.104  77.958 -5.379  1.00 69.66 ? 171 ASP A CA    1 
ATOM   1749 C  C     . ASP C 2 163 ? 57.264  76.826 -4.825  1.00 69.33 ? 171 ASP A C     1 
ATOM   1750 O  O     . ASP C 2 163 ? 56.724  76.973 -3.749  1.00 68.27 ? 171 ASP A O     1 
ATOM   1751 C  CB    . ASP C 2 163 ? 57.216  79.171 -5.680  1.00 72.45 ? 171 ASP A CB    1 
ATOM   1752 C  CG    . ASP C 2 163 ? 56.223  78.899 -6.807  1.00 76.27 ? 171 ASP A CG    1 
ATOM   1753 O  OD1   . ASP C 2 163 ? 56.658  78.717 -7.967  1.00 76.95 ? 171 ASP A OD1   1 
ATOM   1754 O  OD2   . ASP C 2 163 ? 55.000  78.834 -6.539  1.00 78.12 ? 171 ASP A OD2   1 
ATOM   1755 N  N     . GLN C 2 164 ? 57.148  75.697 -5.530  1.00 68.68 ? 172 GLN A N     1 
ATOM   1756 C  CA    . GLN C 2 164 ? 56.371  74.533 -5.028  1.00 67.79 ? 172 GLN A CA    1 
ATOM   1757 C  C     . GLN C 2 164 ? 57.269  73.423 -4.475  1.00 65.77 ? 172 GLN A C     1 
ATOM   1758 O  O     . GLN C 2 164 ? 56.805  72.486 -3.827  1.00 66.47 ? 172 GLN A O     1 
ATOM   1759 C  CB    . GLN C 2 164 ? 55.499  73.910 -6.143  1.00 66.87 ? 172 GLN A CB    1 
ATOM   1760 C  CG    . GLN C 2 164 ? 54.702  74.939 -6.907  1.00 69.74 ? 172 GLN A CG    1 
ATOM   1761 C  CD    . GLN C 2 164 ? 53.826  74.414 -8.072  1.00 71.12 ? 172 GLN A CD    1 
ATOM   1762 O  OE1   . GLN C 2 164 ? 53.056  73.449 -7.944  1.00 71.07 ? 172 GLN A OE1   1 
ATOM   1763 N  NE2   . GLN C 2 164 ? 53.923  75.097 -9.211  1.00 70.53 ? 172 GLN A NE2   1 
ATOM   1764 N  N     . ILE C 2 165 ? 58.546  73.492 -4.812  1.00 62.92 ? 173 ILE A N     1 
ATOM   1765 C  CA    . ILE C 2 165 ? 59.494  72.494 -4.352  1.00 59.92 ? 173 ILE A CA    1 
ATOM   1766 C  C     . ILE C 2 165 ? 59.648  72.550 -2.839  1.00 57.68 ? 173 ILE A C     1 
ATOM   1767 O  O     . ILE C 2 165 ? 59.937  73.603 -2.278  1.00 56.98 ? 173 ILE A O     1 
ATOM   1768 C  CB    . ILE C 2 165 ? 60.862  72.723 -4.994  1.00 59.85 ? 173 ILE A CB    1 
ATOM   1769 C  CG1   . ILE C 2 165 ? 60.748  72.546 -6.501  1.00 58.92 ? 173 ILE A CG1   1 
ATOM   1770 C  CG2   . ILE C 2 165 ? 61.881  71.791 -4.398  1.00 58.66 ? 173 ILE A CG2   1 
ATOM   1771 C  CD1   . ILE C 2 165 ? 62.045  72.738 -7.225  1.00 60.06 ? 173 ILE A CD1   1 
ATOM   1772 N  N     . THR C 2 166 ? 59.431  71.418 -2.181  1.00 56.75 ? 174 THR A N     1 
ATOM   1773 C  CA    . THR C 2 166 ? 59.568  71.337 -0.732  1.00 56.24 ? 174 THR A CA    1 
ATOM   1774 C  C     . THR C 2 166 ? 60.380  70.083 -0.423  1.00 55.16 ? 174 THR A C     1 
ATOM   1775 O  O     . THR C 2 166 ? 60.376  69.130 -1.205  1.00 54.54 ? 174 THR A O     1 
ATOM   1776 C  CB    . THR C 2 166 ? 58.192  71.232 -0.040  1.00 56.06 ? 174 THR A CB    1 
ATOM   1777 O  OG1   . THR C 2 166 ? 58.363  71.248 1.381   1.00 58.61 ? 174 THR A OG1   1 
ATOM   1778 C  CG2   . THR C 2 166 ? 57.507  69.940 -0.427  1.00 57.93 ? 174 THR A CG2   1 
ATOM   1779 N  N     . ALA C 2 167 ? 61.075  70.085 0.712   1.00 54.07 ? 175 ALA A N     1 
ATOM   1780 C  CA    . ALA C 2 167 ? 61.896  68.943 1.114   1.00 53.29 ? 175 ALA A CA    1 
ATOM   1781 C  C     . ALA C 2 167 ? 61.074  67.666 1.267   1.00 52.87 ? 175 ALA A C     1 
ATOM   1782 O  O     . ALA C 2 167 ? 61.629  66.590 1.464   1.00 53.38 ? 175 ALA A O     1 
ATOM   1783 C  CB    . ALA C 2 167 ? 62.618  69.252 2.424   1.00 52.80 ? 175 ALA A CB    1 
ATOM   1784 N  N     . ARG C 2 168 ? 59.753  67.791 1.171   1.00 52.53 ? 176 ARG A N     1 
ATOM   1785 C  CA    . ARG C 2 168 ? 58.863  66.644 1.318   1.00 51.43 ? 176 ARG A CA    1 
ATOM   1786 C  C     . ARG C 2 168 ? 58.716  65.844 0.033   1.00 50.43 ? 176 ARG A C     1 
ATOM   1787 O  O     . ARG C 2 168 ? 58.312  64.683 0.056   1.00 49.44 ? 176 ARG A O     1 
ATOM   1788 C  CB    . ARG C 2 168 ? 57.492  67.111 1.810   1.00 51.46 ? 176 ARG A CB    1 
ATOM   1789 C  CG    . ARG C 2 168 ? 57.566  67.857 3.135   1.00 51.78 ? 176 ARG A CG    1 
ATOM   1790 C  CD    . ARG C 2 168 ? 56.200  68.225 3.681   1.00 51.39 ? 176 ARG A CD    1 
ATOM   1791 N  NE    . ARG C 2 168 ? 56.316  68.930 4.955   1.00 52.75 ? 176 ARG A NE    1 
ATOM   1792 C  CZ    . ARG C 2 168 ? 56.737  70.187 5.086   1.00 53.09 ? 176 ARG A CZ    1 
ATOM   1793 N  NH1   . ARG C 2 168 ? 57.078  70.896 4.014   1.00 52.99 ? 176 ARG A NH1   1 
ATOM   1794 N  NH2   . ARG C 2 168 ? 56.844  70.731 6.293   1.00 51.29 ? 176 ARG A NH2   1 
ATOM   1795 N  N     . ILE C 2 169 ? 59.051  66.469 -1.088  1.00 50.61 ? 177 ILE A N     1 
ATOM   1796 C  CA    . ILE C 2 169 ? 58.968  65.808 -2.384  1.00 49.74 ? 177 ILE A CA    1 
ATOM   1797 C  C     . ILE C 2 169 ? 60.136  64.834 -2.527  1.00 49.29 ? 177 ILE A C     1 
ATOM   1798 O  O     . ILE C 2 169 ? 61.259  65.134 -2.113  1.00 47.62 ? 177 ILE A O     1 
ATOM   1799 C  CB    . ILE C 2 169 ? 59.029  66.836 -3.536  1.00 51.19 ? 177 ILE A CB    1 
ATOM   1800 C  CG1   . ILE C 2 169 ? 57.957  67.912 -3.328  1.00 50.94 ? 177 ILE A CG1   1 
ATOM   1801 C  CG2   . ILE C 2 169 ? 58.830  66.135 -4.878  1.00 49.43 ? 177 ILE A CG2   1 
ATOM   1802 C  CD1   . ILE C 2 169 ? 58.034  69.047 -4.323  1.00 52.16 ? 177 ILE A CD1   1 
ATOM   1803 N  N     . GLY C 2 170 ? 59.856  63.669 -3.110  1.00 49.23 ? 178 GLY A N     1 
ATOM   1804 C  CA    . GLY C 2 170 ? 60.878  62.651 -3.308  1.00 48.26 ? 178 GLY A CA    1 
ATOM   1805 C  C     . GLY C 2 170 ? 60.799  61.540 -2.275  1.00 47.79 ? 178 GLY A C     1 
ATOM   1806 O  O     . GLY C 2 170 ? 60.648  61.813 -1.086  1.00 48.20 ? 178 GLY A O     1 
ATOM   1807 N  N     . GLU C 2 171 ? 60.917  60.289 -2.711  1.00 47.42 ? 179 GLU A N     1 
ATOM   1808 C  CA    . GLU C 2 171 ? 60.838  59.167 -1.784  1.00 47.61 ? 179 GLU A CA    1 
ATOM   1809 C  C     . GLU C 2 171 ? 62.154  58.847 -1.068  1.00 46.99 ? 179 GLU A C     1 
ATOM   1810 O  O     . GLU C 2 171 ? 62.154  58.567 0.133   1.00 47.67 ? 179 GLU A O     1 
ATOM   1811 C  CB    . GLU C 2 171 ? 60.332  57.919 -2.506  1.00 50.96 ? 179 GLU A CB    1 
ATOM   1812 C  CG    . GLU C 2 171 ? 59.870  56.815 -1.566  1.00 58.15 ? 179 GLU A CG    1 
ATOM   1813 C  CD    . GLU C 2 171 ? 59.439  55.561 -2.305  1.00 63.74 ? 179 GLU A CD    1 
ATOM   1814 O  OE1   . GLU C 2 171 ? 58.607  55.680 -3.232  1.00 68.14 ? 179 GLU A OE1   1 
ATOM   1815 O  OE2   . GLU C 2 171 ? 59.928  54.460 -1.962  1.00 65.19 ? 179 GLU A OE2   1 
ATOM   1816 N  N     . VAL C 2 172 ? 63.270  58.871 -1.793  1.00 43.72 ? 180 VAL A N     1 
ATOM   1817 C  CA    . VAL C 2 172 ? 64.565  58.592 -1.176  1.00 41.22 ? 180 VAL A CA    1 
ATOM   1818 C  C     . VAL C 2 172 ? 65.533  59.770 -1.328  1.00 41.96 ? 180 VAL A C     1 
ATOM   1819 O  O     . VAL C 2 172 ? 66.460  59.934 -0.529  1.00 42.05 ? 180 VAL A O     1 
ATOM   1820 C  CB    . VAL C 2 172 ? 65.216  57.320 -1.758  1.00 39.88 ? 180 VAL A CB    1 
ATOM   1821 C  CG1   . VAL C 2 172 ? 64.338  56.116 -1.469  1.00 38.10 ? 180 VAL A CG1   1 
ATOM   1822 C  CG2   . VAL C 2 172 ? 65.452  57.485 -3.246  1.00 38.48 ? 180 VAL A CG2   1 
ATOM   1823 N  N     . MET C 2 173 ? 65.313  60.588 -2.352  1.00 40.54 ? 181 MET A N     1 
ATOM   1824 C  CA    . MET C 2 173 ? 66.148  61.755 -2.587  1.00 38.91 ? 181 MET A CA    1 
ATOM   1825 C  C     . MET C 2 173 ? 65.253  62.982 -2.596  1.00 40.84 ? 181 MET A C     1 
ATOM   1826 O  O     . MET C 2 173 ? 64.107  62.929 -3.059  1.00 40.60 ? 181 MET A O     1 
ATOM   1827 C  CB    . MET C 2 173 ? 66.897  61.629 -3.910  1.00 39.14 ? 181 MET A CB    1 
ATOM   1828 C  CG    . MET C 2 173 ? 67.868  62.774 -4.174  1.00 40.79 ? 181 MET A CG    1 
ATOM   1829 S  SD    . MET C 2 173 ? 69.090  62.367 -5.439  1.00 43.78 ? 181 MET A SD    1 
ATOM   1830 C  CE    . MET C 2 173 ? 68.072  62.443 -6.916  1.00 42.77 ? 181 MET A CE    1 
ATOM   1831 N  N     . GLN C 2 174 ? 65.786  64.090 -2.095  1.00 39.95 ? 182 GLN A N     1 
ATOM   1832 C  CA    . GLN C 2 174 ? 65.029  65.328 -1.985  1.00 39.51 ? 182 GLN A CA    1 
ATOM   1833 C  C     . GLN C 2 174 ? 65.867  66.565 -2.312  1.00 40.12 ? 182 GLN A C     1 
ATOM   1834 O  O     . GLN C 2 174 ? 67.076  66.479 -2.550  1.00 39.48 ? 182 GLN A O     1 
ATOM   1835 C  CB    . GLN C 2 174 ? 64.536  65.462 -0.545  1.00 40.51 ? 182 GLN A CB    1 
ATOM   1836 C  CG    . GLN C 2 174 ? 65.722  65.481 0.437   1.00 41.53 ? 182 GLN A CG    1 
ATOM   1837 C  CD    . GLN C 2 174 ? 65.353  65.623 1.907   1.00 41.55 ? 182 GLN A CD    1 
ATOM   1838 O  OE1   . GLN C 2 174 ? 66.224  65.509 2.776   1.00 40.38 ? 182 GLN A OE1   1 
ATOM   1839 N  NE2   . GLN C 2 174 ? 64.076  65.878 2.194   1.00 37.72 ? 182 GLN A NE2   1 
ATOM   1840 N  N     . LEU C 2 175 ? 65.198  67.716 -2.292  1.00 39.67 ? 183 LEU A N     1 
ATOM   1841 C  CA    . LEU C 2 175 ? 65.822  69.014 -2.517  1.00 39.03 ? 183 LEU A CA    1 
ATOM   1842 C  C     . LEU C 2 175 ? 65.692  69.868 -1.245  1.00 39.08 ? 183 LEU A C     1 
ATOM   1843 O  O     . LEU C 2 175 ? 64.592  70.080 -0.731  1.00 38.41 ? 183 LEU A O     1 
ATOM   1844 C  CB    . LEU C 2 175 ? 65.147  69.755 -3.685  1.00 40.12 ? 183 LEU A CB    1 
ATOM   1845 C  CG    . LEU C 2 175 ? 65.409  69.277 -5.119  1.00 42.82 ? 183 LEU A CG    1 
ATOM   1846 C  CD1   . LEU C 2 175 ? 64.569  70.090 -6.097  1.00 41.75 ? 183 LEU A CD1   1 
ATOM   1847 C  CD2   . LEU C 2 175 ? 66.892  69.407 -5.439  1.00 40.31 ? 183 LEU A CD2   1 
ATOM   1848 N  N     . ARG C 2 176 ? 66.818  70.344 -0.728  1.00 37.53 ? 184 ARG A N     1 
ATOM   1849 C  CA    . ARG C 2 176 ? 66.807  71.200 0.448   1.00 37.31 ? 184 ARG A CA    1 
ATOM   1850 C  C     . ARG C 2 176 ? 67.795  72.327 0.160   1.00 37.91 ? 184 ARG A C     1 
ATOM   1851 O  O     . ARG C 2 176 ? 68.615  72.220 -0.757  1.00 38.62 ? 184 ARG A O     1 
ATOM   1852 C  CB    . ARG C 2 176 ? 67.238  70.433 1.706   1.00 36.19 ? 184 ARG A CB    1 
ATOM   1853 C  CG    . ARG C 2 176 ? 66.490  69.133 1.986   1.00 34.96 ? 184 ARG A CG    1 
ATOM   1854 C  CD    . ARG C 2 176 ? 66.188  68.970 3.480   1.00 32.05 ? 184 ARG A CD    1 
ATOM   1855 N  NE    . ARG C 2 176 ? 67.338  69.244 4.350   1.00 35.42 ? 184 ARG A NE    1 
ATOM   1856 C  CZ    . ARG C 2 176 ? 68.391  68.437 4.513   1.00 34.04 ? 184 ARG A CZ    1 
ATOM   1857 N  NH1   . ARG C 2 176 ? 68.467  67.281 3.869   1.00 28.02 ? 184 ARG A NH1   1 
ATOM   1858 N  NH2   . ARG C 2 176 ? 69.374  68.792 5.329   1.00 30.58 ? 184 ARG A NH2   1 
ATOM   1859 N  N     . PRO C 2 177 ? 67.723  73.432 0.919   1.00 38.29 ? 185 PRO A N     1 
ATOM   1860 C  CA    . PRO C 2 177 ? 68.652  74.542 0.681   1.00 38.51 ? 185 PRO A CA    1 
ATOM   1861 C  C     . PRO C 2 177 ? 70.115  74.098 0.823   1.00 38.68 ? 185 PRO A C     1 
ATOM   1862 O  O     . PRO C 2 177 ? 70.431  73.191 1.597   1.00 39.78 ? 185 PRO A O     1 
ATOM   1863 C  CB    . PRO C 2 177 ? 68.245  75.564 1.737   1.00 38.73 ? 185 PRO A CB    1 
ATOM   1864 C  CG    . PRO C 2 177 ? 66.772  75.277 1.934   1.00 39.89 ? 185 PRO A CG    1 
ATOM   1865 C  CD    . PRO C 2 177 ? 66.742  73.776 1.961   1.00 38.03 ? 185 PRO A CD    1 
ATOM   1866 N  N     . LYS C 2 178 ? 70.999  74.740 0.071   1.00 36.83 ? 186 LYS A N     1 
ATOM   1867 C  CA    . LYS C 2 178 ? 72.415  74.406 0.099   1.00 39.68 ? 186 LYS A CA    1 
ATOM   1868 C  C     . LYS C 2 178 ? 73.208  75.680 -0.145  1.00 39.73 ? 186 LYS A C     1 
ATOM   1869 O  O     . LYS C 2 178 ? 73.319  76.133 -1.279  1.00 41.01 ? 186 LYS A O     1 
ATOM   1870 C  CB    . LYS C 2 178 ? 72.712  73.372 -0.992  1.00 38.28 ? 186 LYS A CB    1 
ATOM   1871 C  CG    . LYS C 2 178 ? 74.173  72.990 -1.154  1.00 37.15 ? 186 LYS A CG    1 
ATOM   1872 C  CD    . LYS C 2 178 ? 74.760  72.404 0.111   1.00 34.24 ? 186 LYS A CD    1 
ATOM   1873 C  CE    . LYS C 2 178 ? 76.128  71.793 -0.163  1.00 31.81 ? 186 LYS A CE    1 
ATOM   1874 N  NZ    . LYS C 2 178 ? 76.776  71.280 1.087   1.00 31.58 ? 186 LYS A NZ    1 
ATOM   1875 N  N     . GLY C 2 179 ? 73.754  76.257 0.919   1.00 41.41 ? 187 GLY A N     1 
ATOM   1876 C  CA    . GLY C 2 179 ? 74.512  77.490 0.778   1.00 42.95 ? 187 GLY A CA    1 
ATOM   1877 C  C     . GLY C 2 179 ? 74.890  78.069 2.122   1.00 44.20 ? 187 GLY A C     1 
ATOM   1878 O  O     . GLY C 2 179 ? 74.817  77.379 3.139   1.00 45.51 ? 187 GLY A O     1 
ATOM   1879 N  N     . ALA C 2 180 ? 75.285  79.337 2.140   1.00 44.75 ? 188 ALA A N     1 
ATOM   1880 C  CA    . ALA C 2 180 ? 75.690  79.986 3.383   1.00 45.68 ? 188 ALA A CA    1 
ATOM   1881 C  C     . ALA C 2 180 ? 74.541  80.130 4.367   1.00 45.86 ? 188 ALA A C     1 
ATOM   1882 O  O     . ALA C 2 180 ? 74.715  79.924 5.567   1.00 46.76 ? 188 ALA A O     1 
ATOM   1883 C  CB    . ALA C 2 180 ? 76.282  81.349 3.088   1.00 44.88 ? 188 ALA A CB    1 
ATOM   1884 N  N     . ASN C 2 181 ? 73.371  80.497 3.860   1.00 46.68 ? 189 ASN A N     1 
ATOM   1885 C  CA    . ASN C 2 181 ? 72.200  80.674 4.708   1.00 48.58 ? 189 ASN A CA    1 
ATOM   1886 C  C     . ASN C 2 181 ? 70.966  80.961 3.870   1.00 49.39 ? 189 ASN A C     1 
ATOM   1887 O  O     . ASN C 2 181 ? 70.991  80.796 2.660   1.00 49.80 ? 189 ASN A O     1 
ATOM   1888 C  CB    . ASN C 2 181 ? 72.417  81.815 5.710   1.00 48.33 ? 189 ASN A CB    1 
ATOM   1889 C  CG    . ASN C 2 181 ? 72.766  83.139 5.040   1.00 47.94 ? 189 ASN A CG    1 
ATOM   1890 O  OD1   . ASN C 2 181 ? 72.202  83.502 4.003   1.00 46.29 ? 189 ASN A OD1   1 
ATOM   1891 N  ND2   . ASN C 2 181 ? 73.691  83.877 5.647   1.00 46.90 ? 189 ASN A ND2   1 
ATOM   1892 N  N     . SER C 2 182 ? 69.897  81.404 4.518   1.00 50.88 ? 190 SER A N     1 
ATOM   1893 C  CA    . SER C 2 182 ? 68.645  81.694 3.829   1.00 54.53 ? 190 SER A CA    1 
ATOM   1894 C  C     . SER C 2 182 ? 68.702  82.881 2.861   1.00 56.29 ? 190 SER A C     1 
ATOM   1895 O  O     . SER C 2 182 ? 67.833  83.010 1.998   1.00 56.66 ? 190 SER A O     1 
ATOM   1896 C  CB    . SER C 2 182 ? 67.544  81.942 4.854   1.00 54.85 ? 190 SER A CB    1 
ATOM   1897 O  OG    . SER C 2 182 ? 67.828  83.102 5.610   1.00 60.52 ? 190 SER A OG    1 
ATOM   1898 N  N     . ARG C 2 183 ? 69.710  83.743 2.991   1.00 58.45 ? 191 ARG A N     1 
ATOM   1899 C  CA    . ARG C 2 183 ? 69.821  84.910 2.110   1.00 60.38 ? 191 ARG A CA    1 
ATOM   1900 C  C     . ARG C 2 183 ? 70.660  84.632 0.870   1.00 60.15 ? 191 ARG A C     1 
ATOM   1901 O  O     . ARG C 2 183 ? 70.788  85.489 -0.004  1.00 61.36 ? 191 ARG A O     1 
ATOM   1902 C  CB    . ARG C 2 183 ? 70.416  86.098 2.869   1.00 63.43 ? 191 ARG A CB    1 
ATOM   1903 C  CG    . ARG C 2 183 ? 69.706  86.419 4.170   1.00 66.98 ? 191 ARG A CG    1 
ATOM   1904 C  CD    . ARG C 2 183 ? 70.735  86.667 5.252   1.00 72.19 ? 191 ARG A CD    1 
ATOM   1905 N  NE    . ARG C 2 183 ? 70.292  86.193 6.560   1.00 77.05 ? 191 ARG A NE    1 
ATOM   1906 C  CZ    . ARG C 2 183 ? 71.113  85.953 7.579   1.00 79.52 ? 191 ARG A CZ    1 
ATOM   1907 N  NH1   . ARG C 2 183 ? 72.421  86.140 7.437   1.00 80.86 ? 191 ARG A NH1   1 
ATOM   1908 N  NH2   . ARG C 2 183 ? 70.630  85.525 8.740   1.00 80.90 ? 191 ARG A NH2   1 
ATOM   1909 N  N     . ALA C 2 184 ? 71.241  83.439 0.800   1.00 59.43 ? 192 ALA A N     1 
ATOM   1910 C  CA    . ALA C 2 184 ? 72.039  83.065 -0.358  1.00 59.03 ? 192 ALA A CA    1 
ATOM   1911 C  C     . ALA C 2 184 ? 71.093  83.108 -1.551  1.00 59.48 ? 192 ALA A C     1 
ATOM   1912 O  O     . ALA C 2 184 ? 69.909  82.817 -1.412  1.00 59.55 ? 192 ALA A O     1 
ATOM   1913 C  CB    . ALA C 2 184 ? 72.602  81.662 -0.182  1.00 56.61 ? 192 ALA A CB    1 
ATOM   1914 N  N     . VAL C 2 185 ? 71.605  83.470 -2.719  1.00 60.39 ? 193 VAL A N     1 
ATOM   1915 C  CA    . VAL C 2 185 ? 70.758  83.552 -3.898  1.00 62.65 ? 193 VAL A CA    1 
ATOM   1916 C  C     . VAL C 2 185 ? 71.456  83.078 -5.168  1.00 63.31 ? 193 VAL A C     1 
ATOM   1917 O  O     . VAL C 2 185 ? 72.646  83.327 -5.367  1.00 64.30 ? 193 VAL A O     1 
ATOM   1918 C  CB    . VAL C 2 185 ? 70.258  85.002 -4.111  1.00 63.84 ? 193 VAL A CB    1 
ATOM   1919 C  CG1   . VAL C 2 185 ? 69.487  85.102 -5.406  1.00 65.44 ? 193 VAL A CG1   1 
ATOM   1920 C  CG2   . VAL C 2 185 ? 69.372  85.426 -2.947  1.00 64.12 ? 193 VAL A CG2   1 
ATOM   1921 N  N     . THR C 2 186 ? 70.702  82.383 -6.017  1.00 63.70 ? 194 THR A N     1 
ATOM   1922 C  CA    . THR C 2 186 ? 71.209  81.873 -7.289  1.00 64.21 ? 194 THR A CA    1 
ATOM   1923 C  C     . THR C 2 186 ? 70.160  82.156 -8.363  1.00 65.06 ? 194 THR A C     1 
ATOM   1924 O  O     . THR C 2 186 ? 69.033  82.547 -8.051  1.00 65.08 ? 194 THR A O     1 
ATOM   1925 C  CB    . THR C 2 186 ? 71.473  80.342 -7.232  1.00 63.41 ? 194 THR A CB    1 
ATOM   1926 O  OG1   . THR C 2 186 ? 72.077  79.907 -8.457  1.00 61.33 ? 194 THR A OG1   1 
ATOM   1927 C  CG2   . THR C 2 186 ? 70.176  79.583 -7.033  1.00 63.40 ? 194 THR A CG2   1 
ATOM   1928 N  N     . LYS C 2 187 ? 70.533  81.963 -9.623  1.00 65.21 ? 195 LYS A N     1 
ATOM   1929 C  CA    . LYS C 2 187 ? 69.613  82.193 -10.729 1.00 66.39 ? 195 LYS A CA    1 
ATOM   1930 C  C     . LYS C 2 187 ? 68.722  80.977 -10.951 1.00 66.40 ? 195 LYS A C     1 
ATOM   1931 O  O     . LYS C 2 187 ? 69.200  79.843 -10.971 1.00 65.66 ? 195 LYS A O     1 
ATOM   1932 C  CB    . LYS C 2 187 ? 70.390  82.499 -12.013 1.00 68.31 ? 195 LYS A CB    1 
ATOM   1933 C  CG    . LYS C 2 187 ? 71.198  83.790 -11.973 1.00 72.56 ? 195 LYS A CG    1 
ATOM   1934 C  CD    . LYS C 2 187 ? 70.298  84.996 -11.751 1.00 75.70 ? 195 LYS A CD    1 
ATOM   1935 C  CE    . LYS C 2 187 ? 71.090  86.294 -11.770 1.00 78.71 ? 195 LYS A CE    1 
ATOM   1936 N  NZ    . LYS C 2 187 ? 70.206  87.481 -11.560 1.00 81.04 ? 195 LYS A NZ    1 
ATOM   1937 N  N     . GLY C 2 188 ? 67.426  81.229 -11.116 1.00 67.86 ? 196 GLY A N     1 
ATOM   1938 C  CA    . GLY C 2 188 ? 66.465  80.162 -11.343 1.00 69.08 ? 196 GLY A CA    1 
ATOM   1939 C  C     . GLY C 2 188 ? 65.479  80.520 -12.445 1.00 69.95 ? 196 GLY A C     1 
ATOM   1940 O  O     . GLY C 2 188 ? 65.766  81.371 -13.287 1.00 71.39 ? 196 GLY A O     1 
ATOM   1941 N  N     . ILE C 2 189 ? 64.316  79.872 -12.440 1.00 69.84 ? 197 ILE A N     1 
ATOM   1942 C  CA    . ILE C 2 189 ? 63.273  80.113 -13.446 1.00 69.43 ? 197 ILE A CA    1 
ATOM   1943 C  C     . ILE C 2 189 ? 61.958  80.491 -12.772 1.00 69.66 ? 197 ILE A C     1 
ATOM   1944 O  O     . ILE C 2 189 ? 61.442  79.751 -11.917 1.00 67.87 ? 197 ILE A O     1 
ATOM   1945 C  CB    . ILE C 2 189 ? 63.010  78.863 -14.298 1.00 70.65 ? 197 ILE A CB    1 
ATOM   1946 C  CG1   . ILE C 2 189 ? 64.279  78.423 -15.031 1.00 66.69 ? 197 ILE A CG1   1 
ATOM   1947 C  CG2   . ILE C 2 189 ? 61.899  79.155 -15.297 1.00 68.84 ? 197 ILE A CG2   1 
ATOM   1948 C  CD1   . ILE C 2 189 ? 64.109  77.065 -15.704 1.00 66.95 ? 197 ILE A CD1   1 
ATOM   1949 N  N     . GLY C 2 190 ? 61.410  81.631 -13.181 1.00 71.82 ? 198 GLY A N     1 
ATOM   1950 C  CA    . GLY C 2 190 ? 60.179  82.108 -12.583 1.00 74.37 ? 198 GLY A CA    1 
ATOM   1951 C  C     . GLY C 2 190 ? 58.915  81.420 -13.040 1.00 75.63 ? 198 GLY A C     1 
ATOM   1952 O  O     . GLY C 2 190 ? 58.922  80.577 -13.949 1.00 76.22 ? 198 GLY A O     1 
ATOM   1953 N  N     . LYS C 2 191 ? 57.813  81.776 -12.392 1.00 76.88 ? 199 LYS A N     1 
ATOM   1954 C  CA    . LYS C 2 191 ? 56.534  81.191 -12.754 1.00 78.58 ? 199 LYS A CA    1 
ATOM   1955 C  C     . LYS C 2 191 ? 56.181  81.461 -14.229 1.00 79.19 ? 199 LYS A C     1 
ATOM   1956 O  O     . LYS C 2 191 ? 55.254  80.849 -14.748 1.00 80.22 ? 199 LYS A O     1 
ATOM   1957 C  CB    . LYS C 2 191 ? 55.430  81.771 -11.867 1.00 78.21 ? 199 LYS A CB    1 
ATOM   1958 C  CG    . LYS C 2 191 ? 55.741  81.738 -10.376 1.00 78.38 ? 199 LYS A CG    1 
ATOM   1959 C  CD    . LYS C 2 191 ? 54.708  82.540 -9.578  1.00 77.32 ? 199 LYS A CD    1 
ATOM   1960 C  CE    . LYS C 2 191 ? 55.108  82.676 -8.103  1.00 77.01 ? 199 LYS A CE    1 
ATOM   1961 N  NZ    . LYS C 2 191 ? 54.227  83.620 -7.338  1.00 76.83 ? 199 LYS A NZ    1 
ATOM   1962 N  N     . ASN C 2 192 ? 56.919  82.350 -14.900 1.00 79.42 ? 200 ASN A N     1 
ATOM   1963 C  CA    . ASN C 2 192 ? 56.619  82.708 -16.285 1.00 79.36 ? 200 ASN A CA    1 
ATOM   1964 C  C     . ASN C 2 192 ? 57.791  82.562 -17.224 1.00 78.60 ? 200 ASN A C     1 
ATOM   1965 O  O     . ASN C 2 192 ? 57.844  83.180 -18.295 1.00 78.20 ? 200 ASN A O     1 
ATOM   1966 C  CB    . ASN C 2 192 ? 56.123  84.133 -16.335 1.00 81.46 ? 200 ASN A CB    1 
ATOM   1967 C  CG    . ASN C 2 192 ? 54.694  84.250 -15.844 1.00 84.66 ? 200 ASN A CG    1 
ATOM   1968 O  OD1   . ASN C 2 192 ? 53.792  83.642 -16.423 1.00 86.75 ? 200 ASN A OD1   1 
ATOM   1969 N  ND2   . ASN C 2 192 ? 54.475  85.011 -14.768 1.00 84.47 ? 200 ASN A ND2   1 
ATOM   1970 N  N     . GLY C 2 193 ? 58.754  81.754 -16.806 1.00 77.78 ? 201 GLY A N     1 
ATOM   1971 C  CA    . GLY C 2 193 ? 59.902  81.489 -17.645 1.00 76.42 ? 201 GLY A CA    1 
ATOM   1972 C  C     . GLY C 2 193 ? 60.998  82.523 -17.633 1.00 76.40 ? 201 GLY A C     1 
ATOM   1973 O  O     . GLY C 2 193 ? 61.889  82.420 -18.465 1.00 76.02 ? 201 GLY A O     1 
ATOM   1974 N  N     . GLU C 2 194 ? 60.957  83.486 -16.709 1.00 76.16 ? 202 GLU A N     1 
ATOM   1975 C  CA    . GLU C 2 194 ? 61.985  84.525 -16.611 1.00 76.07 ? 202 GLU A CA    1 
ATOM   1976 C  C     . GLU C 2 194 ? 63.033  84.220 -15.527 1.00 75.55 ? 202 GLU A C     1 
ATOM   1977 O  O     . GLU C 2 194 ? 62.703  83.774 -14.428 1.00 75.86 ? 202 GLU A O     1 
ATOM   1978 C  CB    . GLU C 2 194 ? 61.329  85.879 -16.316 1.00 76.97 ? 202 GLU A CB    1 
ATOM   1979 C  CG    . GLU C 2 194 ? 59.798  85.870 -16.436 1.00 77.94 ? 202 GLU A CG    1 
ATOM   1980 C  CD    . GLU C 2 194 ? 59.088  85.121 -15.295 1.00 79.06 ? 202 GLU A CD    1 
ATOM   1981 O  OE1   . GLU C 2 194 ? 59.290  83.895 -15.136 1.00 78.45 ? 202 GLU A OE1   1 
ATOM   1982 O  OE2   . GLU C 2 194 ? 58.313  85.766 -14.552 1.00 79.67 ? 202 GLU A OE2   1 
ATOM   1983 N  N     . ILE C 2 195 ? 64.298  84.470 -15.842 1.00 74.74 ? 203 ILE A N     1 
ATOM   1984 C  CA    . ILE C 2 195 ? 65.366  84.234 -14.886 1.00 73.40 ? 203 ILE A CA    1 
ATOM   1985 C  C     . ILE C 2 195 ? 65.187  85.134 -13.668 1.00 72.53 ? 203 ILE A C     1 
ATOM   1986 O  O     . ILE C 2 195 ? 65.147  86.358 -13.793 1.00 72.32 ? 203 ILE A O     1 
ATOM   1987 C  CB    . ILE C 2 195 ? 66.736  84.514 -15.509 1.00 73.49 ? 203 ILE A CB    1 
ATOM   1988 C  CG1   . ILE C 2 195 ? 66.956  83.560 -16.685 1.00 74.14 ? 203 ILE A CG1   1 
ATOM   1989 C  CG2   . ILE C 2 195 ? 67.832  84.343 -14.459 1.00 74.63 ? 203 ILE A CG2   1 
ATOM   1990 C  CD1   . ILE C 2 195 ? 68.293  83.719 -17.370 1.00 75.59 ? 203 ILE A CD1   1 
ATOM   1991 N  N     . ILE C 2 196 ? 65.087  84.519 -12.491 1.00 71.35 ? 204 ILE A N     1 
ATOM   1992 C  CA    . ILE C 2 196 ? 64.916  85.260 -11.240 1.00 71.06 ? 204 ILE A CA    1 
ATOM   1993 C  C     . ILE C 2 196 ? 65.954  84.858 -10.190 1.00 70.19 ? 204 ILE A C     1 
ATOM   1994 O  O     . ILE C 2 196 ? 66.803  83.990 -10.424 1.00 69.14 ? 204 ILE A O     1 
ATOM   1995 C  CB    . ILE C 2 196 ? 63.531  85.002 -10.624 1.00 71.39 ? 204 ILE A CB    1 
ATOM   1996 C  CG1   . ILE C 2 196 ? 63.420  83.521 -10.256 1.00 71.57 ? 204 ILE A CG1   1 
ATOM   1997 C  CG2   . ILE C 2 196 ? 62.434  85.441 -11.601 1.00 71.96 ? 204 ILE A CG2   1 
ATOM   1998 C  CD1   . ILE C 2 196 ? 62.170  83.183 -9.476  1.00 72.05 ? 204 ILE A CD1   1 
ATOM   1999 N  N     . ASP C 2 197 ? 65.872  85.507 -9.033  1.00 68.86 ? 205 ASP A N     1 
ATOM   2000 C  CA    . ASP C 2 197 ? 66.754  85.223 -7.912  1.00 67.97 ? 205 ASP A CA    1 
ATOM   2001 C  C     . ASP C 2 197 ? 65.984  84.292 -6.980  1.00 67.17 ? 205 ASP A C     1 
ATOM   2002 O  O     . ASP C 2 197 ? 64.796  84.512 -6.706  1.00 68.04 ? 205 ASP A O     1 
ATOM   2003 C  CB    . ASP C 2 197 ? 67.144  86.520 -7.180  1.00 67.78 ? 205 ASP A CB    1 
ATOM   2004 C  CG    . ASP C 2 197 ? 68.034  87.428 -8.027  1.00 71.41 ? 205 ASP A CG    1 
ATOM   2005 O  OD1   . ASP C 2 197 ? 68.436  88.520 -7.557  1.00 72.26 ? 205 ASP A OD1   1 
ATOM   2006 O  OD2   . ASP C 2 197 ? 68.332  87.038 -9.177  1.00 71.46 ? 205 ASP A OD2   1 
ATOM   2007 N  N     . THR C 2 198 ? 66.662  83.250 -6.506  1.00 64.15 ? 206 THR A N     1 
ATOM   2008 C  CA    . THR C 2 198 ? 66.048  82.275 -5.619  1.00 61.26 ? 206 THR A CA    1 
ATOM   2009 C  C     . THR C 2 198 ? 67.094  81.584 -4.740  1.00 59.78 ? 206 THR A C     1 
ATOM   2010 O  O     . THR C 2 198 ? 68.299  81.804 -4.887  1.00 60.38 ? 206 THR A O     1 
ATOM   2011 C  CB    . THR C 2 198 ? 65.268  81.217 -6.440  1.00 60.46 ? 206 THR A CB    1 
ATOM   2012 O  OG1   . THR C 2 198 ? 64.427  80.455 -5.566  1.00 60.50 ? 206 THR A OG1   1 
ATOM   2013 C  CG2   . THR C 2 198 ? 66.225  80.279 -7.162  1.00 59.04 ? 206 THR A CG2   1 
ATOM   2014 N  N     . LEU C 2 199 ? 66.620  80.750 -3.821  1.00 58.45 ? 207 LEU A N     1 
ATOM   2015 C  CA    . LEU C 2 199 ? 67.492  80.030 -2.905  1.00 55.08 ? 207 LEU A CA    1 
ATOM   2016 C  C     . LEU C 2 199 ? 68.143  78.828 -3.581  1.00 52.59 ? 207 LEU A C     1 
ATOM   2017 O  O     . LEU C 2 199 ? 67.479  78.037 -4.251  1.00 51.70 ? 207 LEU A O     1 
ATOM   2018 C  CB    . LEU C 2 199 ? 66.689  79.571 -1.689  1.00 55.31 ? 207 LEU A CB    1 
ATOM   2019 C  CG    . LEU C 2 199 ? 67.457  78.965 -0.515  1.00 55.75 ? 207 LEU A CG    1 
ATOM   2020 C  CD1   . LEU C 2 199 ? 68.393  80.001 0.092   1.00 55.45 ? 207 LEU A CD1   1 
ATOM   2021 C  CD2   . LEU C 2 199 ? 66.470  78.473 0.527   1.00 54.27 ? 207 LEU A CD2   1 
ATOM   2022 N  N     . PRO C 2 200 ? 69.464  78.684 -3.420  1.00 51.17 ? 208 PRO A N     1 
ATOM   2023 C  CA    . PRO C 2 200 ? 70.220  77.574 -4.013  1.00 49.53 ? 208 PRO A CA    1 
ATOM   2024 C  C     . PRO C 2 200 ? 69.774  76.253 -3.396  1.00 47.68 ? 208 PRO A C     1 
ATOM   2025 O  O     . PRO C 2 200 ? 69.656  76.144 -2.178  1.00 46.41 ? 208 PRO A O     1 
ATOM   2026 C  CB    . PRO C 2 200 ? 71.668  77.910 -3.657  1.00 49.66 ? 208 PRO A CB    1 
ATOM   2027 C  CG    . PRO C 2 200 ? 71.651  79.407 -3.509  1.00 51.62 ? 208 PRO A CG    1 
ATOM   2028 C  CD    . PRO C 2 200 ? 70.369  79.644 -2.767  1.00 51.14 ? 208 PRO A CD    1 
ATOM   2029 N  N     . LEU C 2 201 ? 69.537  75.250 -4.230  1.00 45.14 ? 209 LEU A N     1 
ATOM   2030 C  CA    . LEU C 2 201 ? 69.095  73.962 -3.720  1.00 43.24 ? 209 LEU A CA    1 
ATOM   2031 C  C     . LEU C 2 201 ? 70.047  72.834 -4.070  1.00 41.26 ? 209 LEU A C     1 
ATOM   2032 O  O     . LEU C 2 201 ? 70.742  72.885 -5.079  1.00 42.19 ? 209 LEU A O     1 
ATOM   2033 C  CB    . LEU C 2 201 ? 67.708  73.635 -4.269  1.00 43.37 ? 209 LEU A CB    1 
ATOM   2034 C  CG    . LEU C 2 201 ? 66.609  74.652 -3.977  1.00 44.82 ? 209 LEU A CG    1 
ATOM   2035 C  CD1   . LEU C 2 201 ? 65.321  74.181 -4.628  1.00 46.57 ? 209 LEU A CD1   1 
ATOM   2036 C  CD2   . LEU C 2 201 ? 66.426  74.813 -2.480  1.00 43.56 ? 209 LEU A CD2   1 
ATOM   2037 N  N     . GLY C 2 202 ? 70.072  71.811 -3.226  1.00 39.63 ? 210 GLY A N     1 
ATOM   2038 C  CA    . GLY C 2 202 ? 70.924  70.669 -3.487  1.00 38.70 ? 210 GLY A CA    1 
ATOM   2039 C  C     . GLY C 2 202 ? 70.179  69.363 -3.283  1.00 38.07 ? 210 GLY A C     1 
ATOM   2040 O  O     . GLY C 2 202 ? 69.125  69.335 -2.651  1.00 38.33 ? 210 GLY A O     1 
ATOM   2041 N  N     . PHE C 2 203 ? 70.725  68.281 -3.820  1.00 37.26 ? 211 PHE A N     1 
ATOM   2042 C  CA    . PHE C 2 203 ? 70.131  66.957 -3.688  1.00 37.09 ? 211 PHE A CA    1 
ATOM   2043 C  C     . PHE C 2 203 ? 70.672  66.259 -2.433  1.00 37.96 ? 211 PHE A C     1 
ATOM   2044 O  O     . PHE C 2 203 ? 71.872  66.296 -2.165  1.00 37.96 ? 211 PHE A O     1 
ATOM   2045 C  CB    . PHE C 2 203 ? 70.473  66.105 -4.910  1.00 37.75 ? 211 PHE A CB    1 
ATOM   2046 C  CG    . PHE C 2 203 ? 69.733  66.494 -6.161  1.00 40.10 ? 211 PHE A CG    1 
ATOM   2047 C  CD1   . PHE C 2 203 ? 68.430  66.050 -6.381  1.00 38.85 ? 211 PHE A CD1   1 
ATOM   2048 C  CD2   . PHE C 2 203 ? 70.358  67.265 -7.152  1.00 39.56 ? 211 PHE A CD2   1 
ATOM   2049 C  CE1   . PHE C 2 203 ? 67.760  66.359 -7.567  1.00 39.04 ? 211 PHE A CE1   1 
ATOM   2050 C  CE2   . PHE C 2 203 ? 69.693  67.579 -8.344  1.00 39.06 ? 211 PHE A CE2   1 
ATOM   2051 C  CZ    . PHE C 2 203 ? 68.394  67.123 -8.552  1.00 38.55 ? 211 PHE A CZ    1 
ATOM   2052 N  N     . TYR C 2 204 ? 69.785  65.617 -1.678  1.00 36.22 ? 212 TYR A N     1 
ATOM   2053 C  CA    . TYR C 2 204 ? 70.172  64.911 -0.463  1.00 33.52 ? 212 TYR A CA    1 
ATOM   2054 C  C     . TYR C 2 204 ? 69.479  63.548 -0.408  1.00 33.20 ? 212 TYR A C     1 
ATOM   2055 O  O     . TYR C 2 204 ? 68.365  63.387 -0.909  1.00 34.57 ? 212 TYR A O     1 
ATOM   2056 C  CB    . TYR C 2 204 ? 69.751  65.704 0.783   1.00 31.82 ? 212 TYR A CB    1 
ATOM   2057 C  CG    . TYR C 2 204 ? 70.410  67.052 1.002   1.00 33.56 ? 212 TYR A CG    1 
ATOM   2058 C  CD1   . TYR C 2 204 ? 69.994  68.187 0.298   1.00 33.22 ? 212 TYR A CD1   1 
ATOM   2059 C  CD2   . TYR C 2 204 ? 71.410  67.206 1.969   1.00 32.39 ? 212 TYR A CD2   1 
ATOM   2060 C  CE1   . TYR C 2 204 ? 70.559  69.451 0.560   1.00 33.39 ? 212 TYR A CE1   1 
ATOM   2061 C  CE2   . TYR C 2 204 ? 71.974  68.448 2.236   1.00 33.25 ? 212 TYR A CE2   1 
ATOM   2062 C  CZ    . TYR C 2 204 ? 71.547  69.572 1.530   1.00 34.55 ? 212 TYR A CZ    1 
ATOM   2063 O  OH    . TYR C 2 204 ? 72.112  70.807 1.800   1.00 31.46 ? 212 TYR A OH    1 
ATOM   2064 N  N     . LEU C 2 205 ? 70.127  62.572 0.211   1.00 30.97 ? 213 LEU A N     1 
ATOM   2065 C  CA    . LEU C 2 205 ? 69.521  61.262 0.348   1.00 32.70 ? 213 LEU A CA    1 
ATOM   2066 C  C     . LEU C 2 205 ? 68.871  61.258 1.723   1.00 33.38 ? 213 LEU A C     1 
ATOM   2067 O  O     . LEU C 2 205 ? 69.451  61.776 2.674   1.00 34.53 ? 213 LEU A O     1 
ATOM   2068 C  CB    . LEU C 2 205 ? 70.580  60.161 0.289   1.00 31.07 ? 213 LEU A CB    1 
ATOM   2069 C  CG    . LEU C 2 205 ? 71.408  60.126 -0.985  1.00 30.72 ? 213 LEU A CG    1 
ATOM   2070 C  CD1   . LEU C 2 205 ? 72.513  59.087 -0.848  1.00 32.65 ? 213 LEU A CD1   1 
ATOM   2071 C  CD2   . LEU C 2 205 ? 70.501  59.819 -2.162  1.00 30.15 ? 213 LEU A CD2   1 
ATOM   2072 N  N     . ARG C 2 206 ? 67.665  60.702 1.828   1.00 34.46 ? 214 ARG A N     1 
ATOM   2073 C  CA    . ARG C 2 206 ? 66.980  60.636 3.116   1.00 34.87 ? 214 ARG A CA    1 
ATOM   2074 C  C     . ARG C 2 206 ? 67.667  59.550 3.914   1.00 34.61 ? 214 ARG A C     1 
ATOM   2075 O  O     . ARG C 2 206 ? 68.288  58.659 3.339   1.00 34.71 ? 214 ARG A O     1 
ATOM   2076 C  CB    . ARG C 2 206 ? 65.493  60.286 2.938   1.00 35.56 ? 214 ARG A CB    1 
ATOM   2077 C  CG    . ARG C 2 206 ? 64.663  61.374 2.240   1.00 37.62 ? 214 ARG A CG    1 
ATOM   2078 C  CD    . ARG C 2 206 ? 63.169  61.049 2.230   1.00 36.30 ? 214 ARG A CD    1 
ATOM   2079 N  NE    . ARG C 2 206 ? 62.425  61.960 1.359   1.00 36.70 ? 214 ARG A NE    1 
ATOM   2080 C  CZ    . ARG C 2 206 ? 61.916  63.129 1.735   1.00 34.02 ? 214 ARG A CZ    1 
ATOM   2081 N  NH1   . ARG C 2 206 ? 62.053  63.555 2.982   1.00 34.45 ? 214 ARG A NH1   1 
ATOM   2082 N  NH2   . ARG C 2 206 ? 61.277  63.882 0.853   1.00 33.21 ? 214 ARG A NH2   1 
ATOM   2083 N  N     . LYS C 2 207 ? 67.556  59.632 5.236   1.00 35.38 ? 215 LYS A N     1 
ATOM   2084 C  CA    . LYS C 2 207 ? 68.164  58.658 6.146   1.00 36.43 ? 215 LYS A CA    1 
ATOM   2085 C  C     . LYS C 2 207 ? 67.722  57.220 5.873   1.00 37.53 ? 215 LYS A C     1 
ATOM   2086 O  O     . LYS C 2 207 ? 68.496  56.278 6.058   1.00 37.74 ? 215 LYS A O     1 
ATOM   2087 C  CB    . LYS C 2 207 ? 67.817  59.001 7.595   1.00 36.03 ? 215 LYS A CB    1 
ATOM   2088 C  CG    . LYS C 2 207 ? 68.311  60.344 8.080   1.00 33.80 ? 215 LYS A CG    1 
ATOM   2089 C  CD    . LYS C 2 207 ? 67.887  60.550 9.515   1.00 34.60 ? 215 LYS A CD    1 
ATOM   2090 C  CE    . LYS C 2 207 ? 68.352  61.877 10.056  1.00 35.86 ? 215 LYS A CE    1 
ATOM   2091 N  NZ    . LYS C 2 207 ? 67.849  62.040 11.448  1.00 37.08 ? 215 LYS A NZ    1 
ATOM   2092 N  N     . GLU C 2 208 ? 66.473  57.053 5.451   1.00 38.04 ? 216 GLU A N     1 
ATOM   2093 C  CA    . GLU C 2 208 ? 65.944  55.719 5.164   1.00 41.64 ? 216 GLU A CA    1 
ATOM   2094 C  C     . GLU C 2 208 ? 66.740  55.013 4.065   1.00 40.75 ? 216 GLU A C     1 
ATOM   2095 O  O     . GLU C 2 208 ? 67.009  53.814 4.164   1.00 41.57 ? 216 GLU A O     1 
ATOM   2096 C  CB    . GLU C 2 208 ? 64.463  55.799 4.766   1.00 41.82 ? 216 GLU A CB    1 
ATOM   2097 C  CG    . GLU C 2 208 ? 63.503  56.048 5.934   1.00 46.81 ? 216 GLU A CG    1 
ATOM   2098 C  CD    . GLU C 2 208 ? 63.652  57.436 6.568   1.00 52.65 ? 216 GLU A CD    1 
ATOM   2099 O  OE1   . GLU C 2 208 ? 63.965  57.511 7.786   1.00 52.77 ? 216 GLU A OE1   1 
ATOM   2100 O  OE2   . GLU C 2 208 ? 63.448  58.448 5.852   1.00 51.96 ? 216 GLU A OE2   1 
ATOM   2101 N  N     . PHE C 2 209 ? 67.117  55.767 3.031   1.00 40.03 ? 217 PHE A N     1 
ATOM   2102 C  CA    . PHE C 2 209 ? 67.884  55.234 1.907   1.00 37.96 ? 217 PHE A CA    1 
ATOM   2103 C  C     . PHE C 2 209 ? 69.262  54.770 2.365   1.00 38.34 ? 217 PHE A C     1 
ATOM   2104 O  O     . PHE C 2 209 ? 69.629  53.622 2.141   1.00 39.46 ? 217 PHE A O     1 
ATOM   2105 C  CB    . PHE C 2 209 ? 68.042  56.297 0.817   1.00 38.20 ? 217 PHE A CB    1 
ATOM   2106 C  CG    . PHE C 2 209 ? 68.638  55.779 -0.473  1.00 40.33 ? 217 PHE A CG    1 
ATOM   2107 C  CD1   . PHE C 2 209 ? 67.849  55.106 -1.401  1.00 38.57 ? 217 PHE A CD1   1 
ATOM   2108 C  CD2   . PHE C 2 209 ? 69.993  55.967 -0.759  1.00 40.80 ? 217 PHE A CD2   1 
ATOM   2109 C  CE1   . PHE C 2 209 ? 68.385  54.646 -2.595  1.00 39.37 ? 217 PHE A CE1   1 
ATOM   2110 C  CE2   . PHE C 2 209 ? 70.545  55.508 -1.953  1.00 40.63 ? 217 PHE A CE2   1 
ATOM   2111 C  CZ    . PHE C 2 209 ? 69.737  54.839 -2.874  1.00 40.53 ? 217 PHE A CZ    1 
ATOM   2112 N  N     . THR C 2 210 ? 70.025  55.645 3.020   1.00 37.82 ? 218 THR A N     1 
ATOM   2113 C  CA    . THR C 2 210 ? 71.359  55.252 3.471   1.00 37.15 ? 218 THR A CA    1 
ATOM   2114 C  C     . THR C 2 210 ? 71.312  54.172 4.539   1.00 38.26 ? 218 THR A C     1 
ATOM   2115 O  O     . THR C 2 210 ? 72.244  53.372 4.659   1.00 37.69 ? 218 THR A O     1 
ATOM   2116 C  CB    . THR C 2 210 ? 72.175  56.454 4.006   1.00 36.11 ? 218 THR A CB    1 
ATOM   2117 O  OG1   . THR C 2 210 ? 71.410  57.171 4.976   1.00 34.29 ? 218 THR A OG1   1 
ATOM   2118 C  CG2   . THR C 2 210 ? 72.560  57.380 2.866   1.00 33.37 ? 218 THR A CG2   1 
ATOM   2119 N  N     . ALA C 2 211 ? 70.234  54.149 5.320   1.00 39.13 ? 219 ALA A N     1 
ATOM   2120 C  CA    . ALA C 2 211 ? 70.087  53.129 6.358   1.00 40.27 ? 219 ALA A CA    1 
ATOM   2121 C  C     . ALA C 2 211 ? 69.981  51.747 5.697   1.00 39.82 ? 219 ALA A C     1 
ATOM   2122 O  O     . ALA C 2 211 ? 70.515  50.769 6.198   1.00 38.55 ? 219 ALA A O     1 
ATOM   2123 C  CB    . ALA C 2 211 ? 68.850  53.410 7.205   1.00 39.58 ? 219 ALA A CB    1 
ATOM   2124 N  N     . GLN C 2 212 ? 69.297  51.678 4.563   1.00 40.57 ? 220 GLN A N     1 
ATOM   2125 C  CA    . GLN C 2 212 ? 69.147  50.419 3.845   1.00 42.98 ? 220 GLN A CA    1 
ATOM   2126 C  C     . GLN C 2 212 ? 70.520  49.971 3.339   1.00 42.34 ? 220 GLN A C     1 
ATOM   2127 O  O     . GLN C 2 212 ? 70.804  48.777 3.255   1.00 41.79 ? 220 GLN A O     1 
ATOM   2128 C  CB    . GLN C 2 212 ? 68.198  50.601 2.658   1.00 46.32 ? 220 GLN A CB    1 
ATOM   2129 C  CG    . GLN C 2 212 ? 67.268  49.428 2.399   1.00 52.47 ? 220 GLN A CG    1 
ATOM   2130 C  CD    . GLN C 2 212 ? 67.997  48.160 2.006   1.00 55.89 ? 220 GLN A CD    1 
ATOM   2131 O  OE1   . GLN C 2 212 ? 68.641  48.094 0.956   1.00 59.10 ? 220 GLN A OE1   1 
ATOM   2132 N  NE2   . GLN C 2 212 ? 67.895  47.141 2.850   1.00 56.46 ? 220 GLN A NE2   1 
ATOM   2133 N  N     . ILE C 2 213 ? 71.373  50.932 2.993   1.00 40.90 ? 221 ILE A N     1 
ATOM   2134 C  CA    . ILE C 2 213 ? 72.701  50.591 2.507   1.00 39.80 ? 221 ILE A CA    1 
ATOM   2135 C  C     . ILE C 2 213 ? 73.462  49.961 3.659   1.00 41.63 ? 221 ILE A C     1 
ATOM   2136 O  O     . ILE C 2 213 ? 74.192  48.991 3.479   1.00 41.17 ? 221 ILE A O     1 
ATOM   2137 C  CB    . ILE C 2 213 ? 73.459  51.836 2.001   1.00 37.53 ? 221 ILE A CB    1 
ATOM   2138 C  CG1   . ILE C 2 213 ? 72.823  52.332 0.699   1.00 37.28 ? 221 ILE A CG1   1 
ATOM   2139 C  CG2   . ILE C 2 213 ? 74.939  51.510 1.811   1.00 36.07 ? 221 ILE A CG2   1 
ATOM   2140 C  CD1   . ILE C 2 213 ? 73.460  53.602 0.123   1.00 36.66 ? 221 ILE A CD1   1 
ATOM   2141 N  N     . LEU C 2 214 ? 73.273  50.522 4.848   1.00 44.39 ? 222 LEU A N     1 
ATOM   2142 C  CA    . LEU C 2 214 ? 73.921  50.020 6.053   1.00 47.17 ? 222 LEU A CA    1 
ATOM   2143 C  C     . LEU C 2 214 ? 73.389  48.631 6.385   1.00 49.80 ? 222 LEU A C     1 
ATOM   2144 O  O     . LEU C 2 214 ? 74.147  47.742 6.772   1.00 49.71 ? 222 LEU A O     1 
ATOM   2145 C  CB    . LEU C 2 214 ? 73.660  50.966 7.229   1.00 46.02 ? 222 LEU A CB    1 
ATOM   2146 C  CG    . LEU C 2 214 ? 74.370  52.321 7.216   1.00 44.19 ? 222 LEU A CG    1 
ATOM   2147 C  CD1   . LEU C 2 214 ? 73.845  53.188 8.329   1.00 44.40 ? 222 LEU A CD1   1 
ATOM   2148 C  CD2   . LEU C 2 214 ? 75.859  52.116 7.378   1.00 43.83 ? 222 LEU A CD2   1 
ATOM   2149 N  N     . ASN C 2 215 ? 72.082  48.453 6.229   1.00 53.19 ? 223 ASN A N     1 
ATOM   2150 C  CA    . ASN C 2 215 ? 71.445  47.173 6.507   1.00 57.10 ? 223 ASN A CA    1 
ATOM   2151 C  C     . ASN C 2 215 ? 71.829  46.088 5.517   1.00 57.67 ? 223 ASN A C     1 
ATOM   2152 O  O     . ASN C 2 215 ? 72.186  44.982 5.910   1.00 57.38 ? 223 ASN A O     1 
ATOM   2153 C  CB    . ASN C 2 215 ? 69.929  47.328 6.515   1.00 59.13 ? 223 ASN A CB    1 
ATOM   2154 C  CG    . ASN C 2 215 ? 69.395  47.662 7.884   1.00 64.72 ? 223 ASN A CG    1 
ATOM   2155 O  OD1   . ASN C 2 215 ? 69.857  48.610 8.535   1.00 66.53 ? 223 ASN A OD1   1 
ATOM   2156 N  ND2   . ASN C 2 215 ? 68.414  46.884 8.341   1.00 65.66 ? 223 ASN A ND2   1 
ATOM   2157 N  N     . ALA C 2 216 ? 71.747  46.403 4.231   1.00 58.58 ? 224 ALA A N     1 
ATOM   2158 C  CA    . ALA C 2 216 ? 72.087  45.433 3.201   1.00 60.81 ? 224 ALA A CA    1 
ATOM   2159 C  C     . ALA C 2 216 ? 73.540  45.009 3.332   1.00 62.92 ? 224 ALA A C     1 
ATOM   2160 O  O     . ALA C 2 216 ? 73.951  43.998 2.774   1.00 63.79 ? 224 ALA A O     1 
ATOM   2161 C  CB    . ALA C 2 216 ? 71.840  46.022 1.828   1.00 60.20 ? 224 ALA A CB    1 
ATOM   2162 N  N     . PHE C 2 217 ? 74.321  45.796 4.061   1.00 65.05 ? 225 PHE A N     1 
ATOM   2163 C  CA    . PHE C 2 217 ? 75.723  45.484 4.259   1.00 67.05 ? 225 PHE A CA    1 
ATOM   2164 C  C     . PHE C 2 217 ? 75.825  44.497 5.410   1.00 69.70 ? 225 PHE A C     1 
ATOM   2165 O  O     . PHE C 2 217 ? 76.522  43.487 5.315   1.00 70.10 ? 225 PHE A O     1 
ATOM   2166 C  CB    . PHE C 2 217 ? 76.507  46.753 4.586   1.00 65.91 ? 225 PHE A CB    1 
ATOM   2167 C  CG    . PHE C 2 217 ? 77.943  46.506 4.925   1.00 63.92 ? 225 PHE A CG    1 
ATOM   2168 C  CD1   . PHE C 2 217 ? 78.831  46.045 3.961   1.00 64.85 ? 225 PHE A CD1   1 
ATOM   2169 C  CD2   . PHE C 2 217 ? 78.408  46.715 6.218   1.00 63.51 ? 225 PHE A CD2   1 
ATOM   2170 C  CE1   . PHE C 2 217 ? 80.165  45.798 4.285   1.00 64.52 ? 225 PHE A CE1   1 
ATOM   2171 C  CE2   . PHE C 2 217 ? 79.737  46.471 6.548   1.00 62.91 ? 225 PHE A CE2   1 
ATOM   2172 C  CZ    . PHE C 2 217 ? 80.615  46.011 5.583   1.00 62.28 ? 225 PHE A CZ    1 
ATOM   2173 N  N     . LEU C 2 218 ? 75.120  44.792 6.497   1.00 72.12 ? 226 LEU A N     1 
ATOM   2174 C  CA    . LEU C 2 218 ? 75.128  43.915 7.658   1.00 76.07 ? 226 LEU A CA    1 
ATOM   2175 C  C     . LEU C 2 218 ? 74.581  42.537 7.277   1.00 78.37 ? 226 LEU A C     1 
ATOM   2176 O  O     . LEU C 2 218 ? 75.104  41.514 7.713   1.00 77.98 ? 226 LEU A O     1 
ATOM   2177 C  CB    . LEU C 2 218 ? 74.296  44.524 8.794   1.00 77.40 ? 226 LEU A CB    1 
ATOM   2178 C  CG    . LEU C 2 218 ? 74.765  45.894 9.307   1.00 80.54 ? 226 LEU A CG    1 
ATOM   2179 C  CD1   . LEU C 2 218 ? 73.843  46.371 10.421  1.00 80.87 ? 226 LEU A CD1   1 
ATOM   2180 C  CD2   . LEU C 2 218 ? 76.206  45.804 9.807   1.00 81.70 ? 226 LEU A CD2   1 
ATOM   2181 N  N     . GLU C 2 219 ? 73.537  42.509 6.452   1.00 81.04 ? 227 GLU A N     1 
ATOM   2182 C  CA    . GLU C 2 219 ? 72.944  41.245 6.020   1.00 84.08 ? 227 GLU A CA    1 
ATOM   2183 C  C     . GLU C 2 219 ? 73.845  40.530 5.021   1.00 85.09 ? 227 GLU A C     1 
ATOM   2184 O  O     . GLU C 2 219 ? 73.396  39.672 4.262   1.00 86.17 ? 227 GLU A O     1 
ATOM   2185 C  CB    . GLU C 2 219 ? 71.567  41.476 5.389   1.00 85.59 ? 227 GLU A CB    1 
ATOM   2186 C  CG    . GLU C 2 219 ? 70.488  41.931 6.365   1.00 88.16 ? 227 GLU A CG    1 
ATOM   2187 C  CD    . GLU C 2 219 ? 69.104  41.955 5.731   1.00 89.37 ? 227 GLU A CD    1 
ATOM   2188 O  OE1   . GLU C 2 219 ? 68.925  42.653 4.709   1.00 89.13 ? 227 GLU A OE1   1 
ATOM   2189 O  OE2   . GLU C 2 219 ? 68.196  41.275 6.258   1.00 90.91 ? 227 GLU A OE2   1 
ATOM   2190 N  N     . THR C 2 220 ? 75.118  40.902 5.022   1.00 86.40 ? 228 THR A N     1 
ATOM   2191 C  CA    . THR C 2 220 ? 76.104  40.301 4.136   1.00 87.56 ? 228 THR A CA    1 
ATOM   2192 C  C     . THR C 2 220 ? 77.096  39.519 4.997   1.00 88.81 ? 228 THR A C     1 
ATOM   2193 O  O     . THR C 2 220 ? 77.772  38.623 4.454   1.00 87.66 ? 228 THR A O     1 
ATOM   2194 C  CB    . THR C 2 220 ? 76.842  41.386 3.296   1.00 87.30 ? 228 THR A CB    1 
ATOM   2195 O  OG1   . THR C 2 220 ? 75.950  41.904 2.301   1.00 87.97 ? 228 THR A OG1   1 
ATOM   2196 C  CG2   . THR C 2 220 ? 78.071  40.809 2.601   1.00 88.11 ? 228 THR A CG2   1 
HETATM 2197 CA CA    . CA  D 3 .   ? 86.644  65.711 -2.454  1.00 45.97 ? 232 CA  A CA    1 
HETATM 2198 CA CA    . CA  E 3 .   ? 83.623  63.034 -1.370  1.00 36.14 ? 233 CA  A CA    1 
HETATM 2199 O  O     . HOH F 4 .   ? 62.402  73.578 10.414  1.00 37.46 ? 13  HOH B O     1 
HETATM 2200 O  O     . HOH F 4 .   ? 66.470  63.467 8.403   1.00 42.16 ? 14  HOH B O     1 
HETATM 2201 O  O     . HOH F 4 .   ? 68.001  65.793 9.091   1.00 40.05 ? 15  HOH B O     1 
HETATM 2202 O  O     . HOH F 4 .   ? 58.693  64.009 4.777   1.00 40.52 ? 16  HOH B O     1 
HETATM 2203 O  O     . HOH F 4 .   ? 71.375  75.828 11.063  1.00 31.07 ? 17  HOH B O     1 
HETATM 2204 O  O     . HOH F 4 .   ? 81.292  74.935 9.798   1.00 48.32 ? 18  HOH B O     1 
HETATM 2205 O  O     . HOH F 4 .   ? 64.924  64.021 4.852   1.00 41.64 ? 19  HOH B O     1 
HETATM 2206 O  O     . HOH F 4 .   ? 64.809  56.387 14.328  1.00 72.05 ? 20  HOH B O     1 
HETATM 2207 O  O     . HOH F 4 .   ? 63.202  53.799 12.269  1.00 78.32 ? 21  HOH B O     1 
HETATM 2208 O  O     . HOH F 4 .   ? 65.212  53.789 13.953  1.00 70.32 ? 22  HOH B O     1 
HETATM 2209 O  O     . HOH F 4 .   ? 78.015  77.654 1.936   1.00 52.54 ? 23  HOH B O     1 
HETATM 2210 O  O     . HOH F 4 .   ? 67.800  66.781 15.213  1.00 58.89 ? 24  HOH B O     1 
HETATM 2211 O  O     . HOH F 4 .   ? 64.711  75.021 10.136  1.00 43.02 ? 25  HOH B O     1 
HETATM 2212 O  O     . HOH F 4 .   ? 63.711  72.859 2.365   1.00 45.99 ? 26  HOH B O     1 
HETATM 2213 O  O     . HOH F 4 .   ? 61.507  79.851 7.500   1.00 66.34 ? 27  HOH B O     1 
HETATM 2214 O  O     . HOH F 4 .   ? 86.234  78.227 -7.003  1.00 62.99 ? 28  HOH B O     1 
HETATM 2215 O  O     . HOH F 4 .   ? 73.625  83.598 8.502   1.00 64.86 ? 29  HOH B O     1 
HETATM 2216 O  O     . HOH F 4 .   ? 56.385  65.068 6.110   1.00 70.60 ? 30  HOH B O     1 
HETATM 2217 O  O     . HOH F 4 .   ? 85.009  80.211 12.928  1.00 69.78 ? 31  HOH B O     1 
HETATM 2218 O  O     . HOH F 4 .   ? 82.701  82.450 0.467   1.00 50.63 ? 32  HOH B O     1 
HETATM 2219 O  O     . HOH F 4 .   ? 87.901  76.849 -4.515  1.00 72.35 ? 33  HOH B O     1 
HETATM 2220 O  O     . HOH F 4 .   ? 63.636  60.667 7.773   1.00 64.82 ? 34  HOH B O     1 
HETATM 2221 O  O     . HOH F 4 .   ? 60.359  66.729 12.170  1.00 64.39 ? 35  HOH B O     1 
HETATM 2222 O  O     . HOH F 4 .   ? 94.124  82.332 -1.349  1.00 74.91 ? 36  HOH B O     1 
HETATM 2223 O  O     . HOH F 4 .   ? 65.530  68.121 20.806  1.00 55.63 ? 37  HOH B O     1 
HETATM 2224 O  O     . HOH F 4 .   ? 67.657  78.183 3.991   1.00 60.29 ? 38  HOH B O     1 
HETATM 2225 O  O     . HOH F 4 .   ? 81.523  80.734 6.810   1.00 58.43 ? 39  HOH B O     1 
HETATM 2226 O  O     . HOH G 4 .   ? 78.943  63.958 12.508  1.00 32.18 ? 13  HOH C O     1 
HETATM 2227 O  O     . HOH G 4 .   ? 75.905  63.721 5.943   1.00 29.82 ? 14  HOH C O     1 
HETATM 2228 O  O     . HOH G 4 .   ? 74.197  65.558 13.823  1.00 32.90 ? 15  HOH C O     1 
HETATM 2229 O  O     . HOH G 4 .   ? 85.038  62.585 2.997   1.00 31.38 ? 16  HOH C O     1 
HETATM 2230 O  O     . HOH G 4 .   ? 81.034  64.061 8.706   1.00 38.50 ? 17  HOH C O     1 
HETATM 2231 O  O     . HOH G 4 .   ? 78.542  62.974 3.048   1.00 29.43 ? 18  HOH C O     1 
HETATM 2232 O  O     . HOH G 4 .   ? 77.424  74.977 0.654   1.00 42.85 ? 19  HOH C O     1 
HETATM 2233 O  O     . HOH G 4 .   ? 81.573  64.018 -0.343  1.00 42.88 ? 20  HOH C O     1 
HETATM 2234 O  O     . HOH G 4 .   ? 82.218  79.619 -8.581  1.00 50.38 ? 21  HOH C O     1 
HETATM 2235 O  O     . HOH G 4 .   ? 62.083  74.209 19.252  1.00 55.65 ? 22  HOH C O     1 
HETATM 2236 O  O     . HOH G 4 .   ? 66.602  75.596 12.478  1.00 52.49 ? 23  HOH C O     1 
HETATM 2237 O  O     . HOH G 4 .   ? 75.728  70.407 17.998  1.00 49.76 ? 24  HOH C O     1 
HETATM 2238 O  O     . HOH G 4 .   ? 77.386  75.644 -1.997  1.00 64.07 ? 25  HOH C O     1 
HETATM 2239 O  O     . HOH G 4 .   ? 76.734  71.371 -9.900  1.00 63.20 ? 26  HOH C O     1 
HETATM 2240 O  O     . HOH G 4 .   ? 80.473  68.232 -9.656  1.00 58.69 ? 27  HOH C O     1 
HETATM 2241 O  O     . HOH H 4 .   ? 72.256  66.309 -11.742 1.00 36.95 ? 234 HOH A O     1 
HETATM 2242 O  O     . HOH H 4 .   ? 74.051  75.982 11.854  1.00 33.66 ? 235 HOH A O     1 
HETATM 2243 O  O     . HOH H 4 .   ? 80.976  63.059 13.936  1.00 37.14 ? 236 HOH A O     1 
HETATM 2244 O  O     . HOH H 4 .   ? 65.791  61.766 6.246   1.00 34.80 ? 237 HOH A O     1 
HETATM 2245 O  O     . HOH H 4 .   ? 63.318  72.396 -0.478  1.00 49.20 ? 238 HOH A O     1 
HETATM 2246 O  O     . HOH H 4 .   ? 62.428  67.736 -2.137  1.00 41.07 ? 239 HOH A O     1 
HETATM 2247 O  O     . HOH H 4 .   ? 70.390  65.963 7.523   1.00 31.37 ? 240 HOH A O     1 
HETATM 2248 O  O     . HOH H 4 .   ? 94.890  41.463 -5.675  1.00 41.53 ? 241 HOH A O     1 
HETATM 2249 O  O     . HOH H 4 .   ? 76.273  61.450 5.031   1.00 35.41 ? 242 HOH A O     1 
HETATM 2250 O  O     . HOH H 4 .   ? 61.601  57.370 -5.957  1.00 48.94 ? 243 HOH A O     1 
HETATM 2251 O  O     . HOH H 4 .   ? 72.141  59.878 4.963   1.00 39.88 ? 244 HOH A O     1 
HETATM 2252 O  O     . HOH H 4 .   ? 76.869  64.544 14.145  1.00 46.53 ? 245 HOH A O     1 
HETATM 2253 O  O     . HOH H 4 .   ? 84.166  72.505 7.438   1.00 34.33 ? 246 HOH A O     1 
HETATM 2254 O  O     . HOH H 4 .   ? 78.241  66.317 16.148  1.00 47.33 ? 247 HOH A O     1 
HETATM 2255 O  O     . HOH H 4 .   ? 68.131  65.045 11.761  1.00 40.60 ? 248 HOH A O     1 
HETATM 2256 O  O     . HOH H 4 .   ? 76.561  64.777 3.408   1.00 39.08 ? 249 HOH A O     1 
HETATM 2257 O  O     . HOH H 4 .   ? 76.078  80.682 -0.360  1.00 46.41 ? 250 HOH A O     1 
HETATM 2258 O  O     . HOH H 4 .   ? 94.311  44.813 -6.543  1.00 40.08 ? 251 HOH A O     1 
HETATM 2259 O  O     . HOH H 4 .   ? 82.297  66.747 8.578   1.00 40.72 ? 252 HOH A O     1 
HETATM 2260 O  O     . HOH H 4 .   ? 68.662  52.424 -0.298  1.00 46.99 ? 253 HOH A O     1 
HETATM 2261 O  O     . HOH H 4 .   ? 90.989  53.066 18.641  1.00 43.29 ? 254 HOH A O     1 
HETATM 2262 O  O     . HOH H 4 .   ? 70.008  66.635 13.023  1.00 36.31 ? 255 HOH A O     1 
HETATM 2263 O  O     . HOH H 4 .   ? 65.721  60.831 -17.559 1.00 52.69 ? 256 HOH A O     1 
HETATM 2264 O  O     . HOH H 4 .   ? 91.447  46.492 -6.692  1.00 48.04 ? 257 HOH A O     1 
HETATM 2265 O  O     . HOH H 4 .   ? 87.259  67.683 -1.254  1.00 46.57 ? 258 HOH A O     1 
HETATM 2266 O  O     . HOH H 4 .   ? 86.014  65.706 -4.657  1.00 46.83 ? 259 HOH A O     1 
HETATM 2267 O  O     . HOH H 4 .   ? 84.995  63.318 0.560   1.00 29.13 ? 260 HOH A O     1 
HETATM 2268 O  O     . HOH H 4 .   ? 93.923  66.807 -3.269  1.00 54.76 ? 261 HOH A O     1 
HETATM 2269 O  O     . HOH H 4 .   ? 90.934  48.859 -8.968  1.00 55.02 ? 262 HOH A O     1 
HETATM 2270 O  O     . HOH H 4 .   ? 91.171  45.838 0.216   1.00 53.08 ? 263 HOH A O     1 
HETATM 2271 O  O     . HOH H 4 .   ? 97.101  56.321 8.002   1.00 50.53 ? 264 HOH A O     1 
HETATM 2272 O  O     . HOH H 4 .   ? 97.787  52.814 10.922  1.00 72.79 ? 265 HOH A O     1 
HETATM 2273 O  O     . HOH H 4 .   ? 97.441  55.142 14.765  1.00 58.77 ? 266 HOH A O     1 
HETATM 2274 O  O     . HOH H 4 .   ? 95.785  67.060 16.454  1.00 49.11 ? 267 HOH A O     1 
HETATM 2275 O  O     . HOH H 4 .   ? 93.588  68.847 18.901  1.00 55.75 ? 268 HOH A O     1 
HETATM 2276 O  O     . HOH H 4 .   ? 86.146  74.653 17.881  1.00 62.38 ? 269 HOH A O     1 
HETATM 2277 O  O     . HOH H 4 .   ? 79.364  69.268 17.141  1.00 42.46 ? 270 HOH A O     1 
HETATM 2278 O  O     . HOH H 4 .   ? 97.297  63.488 2.159   1.00 59.98 ? 271 HOH A O     1 
HETATM 2279 O  O     . HOH H 4 .   ? 93.584  60.592 -8.816  1.00 59.13 ? 272 HOH A O     1 
HETATM 2280 O  O     . HOH H 4 .   ? 86.732  51.143 -9.420  1.00 62.95 ? 273 HOH A O     1 
HETATM 2281 O  O     . HOH H 4 .   ? 84.384  51.836 -10.189 1.00 53.53 ? 274 HOH A O     1 
HETATM 2282 O  O     . HOH H 4 .   ? 74.531  57.031 19.678  1.00 57.91 ? 275 HOH A O     1 
HETATM 2283 O  O     . HOH H 4 .   ? 69.953  59.283 17.855  1.00 42.59 ? 276 HOH A O     1 
HETATM 2284 O  O     . HOH H 4 .   ? 72.364  60.911 19.182  1.00 46.20 ? 277 HOH A O     1 
HETATM 2285 O  O     . HOH H 4 .   ? 73.143  63.168 18.468  1.00 43.80 ? 278 HOH A O     1 
HETATM 2286 O  O     . HOH H 4 .   ? 70.885  75.396 -6.585  1.00 51.35 ? 279 HOH A O     1 
HETATM 2287 O  O     . HOH H 4 .   ? 75.358  77.066 -2.883  1.00 47.40 ? 280 HOH A O     1 
HETATM 2288 O  O     . HOH H 4 .   ? 77.419  70.060 -6.699  1.00 48.50 ? 281 HOH A O     1 
HETATM 2289 O  O     . HOH H 4 .   ? 74.654  54.183 -11.596 1.00 43.75 ? 282 HOH A O     1 
HETATM 2290 O  O     . HOH H 4 .   ? 81.100  57.881 -7.859  1.00 52.50 ? 283 HOH A O     1 
HETATM 2291 O  O     . HOH H 4 .   ? 81.952  47.229 1.572   1.00 62.29 ? 284 HOH A O     1 
HETATM 2292 O  O     . HOH H 4 .   ? 81.584  46.095 -2.189  1.00 72.43 ? 285 HOH A O     1 
HETATM 2293 O  O     . HOH H 4 .   ? 77.084  47.253 -3.068  1.00 54.23 ? 286 HOH A O     1 
HETATM 2294 O  O     . HOH H 4 .   ? 70.103  46.798 -0.975  1.00 48.56 ? 287 HOH A O     1 
HETATM 2295 O  O     . HOH H 4 .   ? 68.342  47.836 -2.956  1.00 55.46 ? 288 HOH A O     1 
HETATM 2296 O  O     . HOH H 4 .   ? 67.805  45.469 -7.233  1.00 57.34 ? 289 HOH A O     1 
HETATM 2297 O  O     . HOH H 4 .   ? 60.923  58.369 -18.146 1.00 70.47 ? 290 HOH A O     1 
HETATM 2298 O  O     . HOH H 4 .   ? 60.167  63.377 -17.737 1.00 71.02 ? 291 HOH A O     1 
HETATM 2299 O  O     . HOH H 4 .   ? 63.588  65.880 -17.138 1.00 73.86 ? 292 HOH A O     1 
HETATM 2300 O  O     . HOH H 4 .   ? 56.992  60.033 0.061   1.00 73.86 ? 293 HOH A O     1 
HETATM 2301 O  O     . HOH H 4 .   ? 62.979  75.448 0.827   1.00 49.48 ? 294 HOH A O     1 
HETATM 2302 O  O     . HOH H 4 .   ? 65.442  51.892 5.454   1.00 52.59 ? 295 HOH A O     1 
HETATM 2303 O  O     . HOH H 4 .   ? 66.199  51.770 -0.961  1.00 54.09 ? 296 HOH A O     1 
HETATM 2304 O  O     . HOH H 4 .   ? 66.452  48.989 -1.671  1.00 60.12 ? 297 HOH A O     1 
HETATM 2305 O  O     . HOH H 4 .   ? 75.025  47.889 0.935   1.00 47.80 ? 298 HOH A O     1 
HETATM 2306 O  O     . HOH H 4 .   ? 81.609  51.879 -9.725  1.00 64.03 ? 299 HOH A O     1 
HETATM 2307 O  O     . HOH H 4 .   ? 89.038  75.787 13.610  1.00 74.87 ? 300 HOH A O     1 
HETATM 2308 O  O     . HOH H 4 .   ? 55.219  84.824 -20.823 1.00 62.40 ? 301 HOH A O     1 
HETATM 2309 O  O     . HOH H 4 .   ? 68.316  59.547 13.411  1.00 50.40 ? 302 HOH A O     1 
HETATM 2310 O  O     . HOH H 4 .   ? 73.135  66.598 -14.157 1.00 68.21 ? 303 HOH A O     1 
HETATM 2311 O  O     . HOH H 4 .   ? 62.810  74.905 -1.695  1.00 58.09 ? 304 HOH A O     1 
HETATM 2312 O  O     . HOH H 4 .   ? 74.633  57.384 22.133  1.00 84.73 ? 305 HOH A O     1 
HETATM 2313 O  O     . HOH H 4 .   ? 74.369  47.640 -3.153  1.00 50.52 ? 306 HOH A O     1 
HETATM 2314 O  O     . HOH H 4 .   ? 57.481  69.083 8.448   1.00 61.61 ? 307 HOH A O     1 
HETATM 2315 O  O     . HOH H 4 .   ? 84.771  73.807 -8.024  1.00 57.82 ? 308 HOH A O     1 
HETATM 2316 O  O     . HOH H 4 .   ? 75.191  79.940 -2.674  1.00 46.23 ? 309 HOH A O     1 
HETATM 2317 O  O     . HOH H 4 .   ? 67.397  55.210 15.790  1.00 59.18 ? 310 HOH A O     1 
HETATM 2318 O  O     . HOH H 4 .   ? 72.764  64.356 15.693  1.00 41.84 ? 311 HOH A O     1 
HETATM 2319 O  O     . HOH H 4 .   ? 59.960  78.414 -0.472  1.00 64.16 ? 312 HOH A O     1 
HETATM 2320 O  O     . HOH H 4 .   ? 96.128  51.582 12.554  1.00 72.77 ? 313 HOH A O     1 
HETATM 2321 O  O     . HOH H 4 .   ? 88.478  68.645 20.728  1.00 51.24 ? 314 HOH A O     1 
HETATM 2322 O  O     . HOH H 4 .   ? 73.831  87.194 4.827   1.00 75.72 ? 315 HOH A O     1 
HETATM 2323 O  O     . HOH H 4 .   ? 59.256  60.016 -7.029  1.00 52.26 ? 316 HOH A O     1 
HETATM 2324 O  O     . HOH H 4 .   ? 87.069  66.627 21.725  1.00 53.65 ? 317 HOH A O     1 
HETATM 2325 O  O     . HOH H 4 .   ? 69.939  44.617 -8.772  1.00 54.58 ? 318 HOH A O     1 
HETATM 2326 O  O     . HOH H 4 .   ? 75.190  50.231 -10.326 1.00 58.61 ? 319 HOH A O     1 
HETATM 2327 O  O     . HOH H 4 .   ? 84.531  46.734 6.078   1.00 55.22 ? 320 HOH A O     1 
HETATM 2328 O  O     . HOH H 4 .   ? 96.797  55.292 10.218  1.00 73.46 ? 321 HOH A O     1 
HETATM 2329 O  O     . HOH H 4 .   ? 91.364  61.332 -7.861  1.00 63.32 ? 322 HOH A O     1 
HETATM 2330 O  O     . HOH H 4 .   ? 72.383  63.966 -20.385 1.00 73.94 ? 323 HOH A O     1 
HETATM 2331 O  O     . HOH H 4 .   ? 70.381  64.177 14.259  1.00 45.31 ? 324 HOH A O     1 
HETATM 2332 O  O     . HOH H 4 .   ? 87.055  45.953 4.753   1.00 64.85 ? 325 HOH A O     1 
HETATM 2333 O  O     . HOH H 4 .   ? 93.762  69.706 -2.606  1.00 77.16 ? 326 HOH A O     1 
HETATM 2334 O  O     . HOH H 4 .   ? 75.926  46.494 -6.242  1.00 62.29 ? 327 HOH A O     1 
HETATM 2335 O  O     . HOH H 4 .   ? 66.754  50.249 -12.356 1.00 70.24 ? 328 HOH A O     1 
HETATM 2336 O  O     . HOH H 4 .   ? 64.946  77.819 -4.877  1.00 56.85 ? 329 HOH A O     1 
HETATM 2337 O  O     . HOH H 4 .   ? 64.285  77.101 -11.984 1.00 73.64 ? 330 HOH A O     1 
HETATM 2338 O  O     . HOH H 4 .   ? 50.514  76.768 -4.592  1.00 76.23 ? 331 HOH A O     1 
HETATM 2339 O  O     . HOH H 4 .   ? 58.901  62.951 -13.399 1.00 68.24 ? 332 HOH A O     1 
HETATM 2340 O  O     . HOH H 4 .   ? 84.152  45.072 8.838   1.00 57.38 ? 333 HOH A O     1 
HETATM 2341 O  O     . HOH H 4 .   ? 66.129  44.088 4.020   1.00 69.76 ? 334 HOH A O     1 
HETATM 2342 O  O     . HOH H 4 .   ? 62.522  55.028 -12.162 1.00 63.11 ? 335 HOH A O     1 
HETATM 2343 O  O     . HOH H 4 .   ? 76.449  55.121 -13.379 1.00 54.64 ? 336 HOH A O     1 
HETATM 2344 O  O     . HOH H 4 .   ? 82.664  56.236 21.618  1.00 67.18 ? 337 HOH A O     1 
HETATM 2345 O  O     . HOH H 4 .   ? 94.930  63.202 1.164   1.00 77.41 ? 338 HOH A O     1 
HETATM 2346 O  O     . HOH H 4 .   ? 72.141  42.160 1.373   1.00 61.83 ? 339 HOH A O     1 
HETATM 2347 O  O     . HOH H 4 .   ? 59.927  55.171 -5.485  1.00 69.11 ? 340 HOH A O     1 
HETATM 2348 O  O     . HOH H 4 .   ? 94.580  42.491 0.062   1.00 66.21 ? 341 HOH A O     1 
HETATM 2349 O  O     . HOH H 4 .   ? 79.250  66.258 -11.060 1.00 68.22 ? 342 HOH A O     1 
HETATM 2350 O  O     . HOH H 4 .   ? 101.424 62.119 8.913   1.00 66.32 ? 343 HOH A O     1 
HETATM 2351 O  O     . HOH H 4 .   ? 50.262  73.264 -1.681  1.00 63.18 ? 344 HOH A O     1 
HETATM 2352 O  O     . HOH H 4 .   ? 70.601  50.582 10.455  1.00 70.74 ? 345 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  G   B . n 
A 1 2   DC  2   2   2   DC  C   B . n 
A 1 3   DA  3   3   3   DA  A   B . n 
A 1 4   DT  4   4   4   DT  T   B . n 
A 1 5   DG  5   5   5   DG  G   B . n 
A 1 6   DA  6   6   6   DA  A   B . n 
A 1 7   DT  7   7   7   DT  T   B . n 
A 1 8   DC  8   8   8   DC  C   B . n 
A 1 9   DA  9   9   9   DA  A   B . n 
A 1 10  DT  10  10  10  DT  T   B . n 
A 1 11  DG  11  11  11  DG  G   B . n 
A 1 12  DC  12  12  12  DC  C   B . n 
B 1 1   DG  1   1   1   DG  G   C . n 
B 1 2   DC  2   2   2   DC  C   C . n 
B 1 3   DA  3   3   3   DA  A   C . n 
B 1 4   DT  4   4   4   DT  T   C . n 
B 1 5   DG  5   5   5   DG  G   C . n 
B 1 6   DA  6   6   6   DA  A   C . n 
B 1 7   DT  7   7   7   DT  T   C . n 
B 1 8   DC  8   8   8   DC  C   C . n 
B 1 9   DA  9   9   9   DA  A   C . n 
B 1 10  DT  10  10  10  DT  T   C . n 
B 1 11  DG  11  11  11  DG  G   C . n 
B 1 12  DC  12  12  12  DC  C   C . n 
C 2 1   MET 1   9   9   MET MET A . n 
C 2 2   ILE 2   10  10  ILE ILE A . n 
C 2 3   PRO 3   11  11  PRO PRO A . n 
C 2 4   GLN 4   12  12  GLN GLN A . n 
C 2 5   THR 5   13  13  THR THR A . n 
C 2 6   LEU 6   14  14  LEU LEU A . n 
C 2 7   GLU 7   15  15  GLU GLU A . n 
C 2 8   GLN 8   16  16  GLN GLN A . n 
C 2 9   LEU 9   17  17  LEU LEU A . n 
C 2 10  LEU 10  18  18  LEU LEU A . n 
C 2 11  SER 11  19  19  SER SER A . n 
C 2 12  GLN 12  20  20  GLN GLN A . n 
C 2 13  ALA 13  21  21  ALA ALA A . n 
C 2 14  GLN 14  22  22  GLN GLN A . n 
C 2 15  SER 15  23  23  SER SER A . n 
C 2 16  ILE 16  24  24  ILE ILE A . n 
C 2 17  ALA 17  25  25  ALA ALA A . n 
C 2 18  GLY 18  26  26  GLY GLY A . n 
C 2 19  LEU 19  27  27  LEU LEU A . n 
C 2 20  THR 20  28  28  THR THR A . n 
C 2 21  PHE 21  29  29  PHE PHE A . n 
C 2 22  GLY 22  30  30  GLY GLY A . n 
C 2 23  GLU 23  31  31  GLU GLU A . n 
C 2 24  LEU 24  32  32  LEU LEU A . n 
C 2 25  ALA 25  33  33  ALA ALA A . n 
C 2 26  ASP 26  34  34  ASP ASP A . n 
C 2 27  GLU 27  35  35  GLU GLU A . n 
C 2 28  LEU 28  36  36  LEU LEU A . n 
C 2 29  HIS 29  37  37  HIS HIS A . n 
C 2 30  ILE 30  38  38  ILE ILE A . n 
C 2 31  PRO 31  39  39  PRO PRO A . n 
C 2 32  VAL 32  40  40  VAL VAL A . n 
C 2 33  PRO 33  41  41  PRO PRO A . n 
C 2 34  ILE 34  42  42  ILE ILE A . n 
C 2 35  ASP 35  43  43  ASP ASP A . n 
C 2 36  LEU 36  44  44  LEU LEU A . n 
C 2 37  LYS 37  45  45  LYS LYS A . n 
C 2 38  ARG 38  46  46  ARG ARG A . n 
C 2 39  ASP 39  47  47  ASP ASP A . n 
C 2 40  LYS 40  48  48  LYS LYS A . n 
C 2 41  GLY 41  49  49  GLY GLY A . n 
C 2 42  TRP 42  50  50  TRP TRP A . n 
C 2 43  VAL 43  51  51  VAL VAL A . n 
C 2 44  GLY 44  52  52  GLY GLY A . n 
C 2 45  MET 45  53  53  MET MET A . n 
C 2 46  LEU 46  54  54  LEU LEU A . n 
C 2 47  LEU 47  55  55  LEU LEU A . n 
C 2 48  GLU 48  56  56  GLU GLU A . n 
C 2 49  ARG 49  57  57  ARG ARG A . n 
C 2 50  ALA 50  58  58  ALA ALA A . n 
C 2 51  LEU 51  59  59  LEU LEU A . n 
C 2 52  GLY 52  60  60  GLY GLY A . n 
C 2 53  ALA 53  61  61  ALA ALA A . n 
C 2 54  THR 54  62  62  THR THR A . n 
C 2 55  ALA 55  63  63  ALA ALA A . n 
C 2 56  GLY 56  64  64  GLY GLY A . n 
C 2 57  SER 57  65  65  SER SER A . n 
C 2 58  LYS 58  66  66  LYS LYS A . n 
C 2 59  ALA 59  67  67  ALA ALA A . n 
C 2 60  GLU 60  68  68  GLU GLU A . n 
C 2 61  GLN 61  69  69  GLN GLN A . n 
C 2 62  ASP 62  70  70  ASP ASP A . n 
C 2 63  PHE 63  71  71  PHE PHE A . n 
C 2 64  SER 64  72  72  SER SER A . n 
C 2 65  HIS 65  73  73  HIS HIS A . n 
C 2 66  LEU 66  74  74  LEU LEU A . n 
C 2 67  GLY 67  75  75  GLY GLY A . n 
C 2 68  VAL 68  76  76  VAL VAL A . n 
C 2 69  GLU 69  77  77  GLU GLU A . n 
C 2 70  LEU 70  78  78  LEU LEU A . n 
C 2 71  LYS 71  79  79  LYS LYS A . n 
C 2 72  THR 72  80  80  THR THR A . n 
C 2 73  LEU 73  81  81  LEU LEU A . n 
C 2 74  PRO 74  82  82  PRO PRO A . n 
C 2 75  ILE 75  83  83  ILE ILE A . n 
C 2 76  ASN 76  84  84  ASN ASN A . n 
C 2 77  ALA 77  85  85  ALA ALA A . n 
C 2 78  GLU 78  86  86  GLU GLU A . n 
C 2 79  GLY 79  87  87  GLY GLY A . n 
C 2 80  TYR 80  88  88  TYR TYR A . n 
C 2 81  PRO 81  89  89  PRO PRO A . n 
C 2 82  LEU 82  90  90  LEU LEU A . n 
C 2 83  GLU 83  91  91  GLU GLU A . n 
C 2 84  THR 84  92  92  THR THR A . n 
C 2 85  THR 85  93  93  THR THR A . n 
C 2 86  PHE 86  94  94  PHE PHE A . n 
C 2 87  VAL 87  95  95  VAL VAL A . n 
C 2 88  SER 88  96  96  SER SER A . n 
C 2 89  LEU 89  97  97  LEU LEU A . n 
C 2 90  ALA 90  98  98  ALA ALA A . n 
C 2 91  PRO 91  99  99  PRO PRO A . n 
C 2 92  LEU 92  100 100 LEU LEU A . n 
C 2 93  VAL 93  101 101 VAL VAL A . n 
C 2 94  GLN 94  102 102 GLN GLN A . n 
C 2 95  ASN 95  103 103 ASN ASN A . n 
C 2 96  SER 96  104 104 SER SER A . n 
C 2 97  GLY 97  105 105 GLY GLY A . n 
C 2 98  VAL 98  106 106 VAL VAL A . n 
C 2 99  LYS 99  107 107 LYS LYS A . n 
C 2 100 TRP 100 108 108 TRP TRP A . n 
C 2 101 GLU 101 109 109 GLU GLU A . n 
C 2 102 ASN 102 110 110 ASN ASN A . n 
C 2 103 SER 103 111 111 SER SER A . n 
C 2 104 HIS 104 112 112 HIS HIS A . n 
C 2 105 VAL 105 113 113 VAL VAL A . n 
C 2 106 ARG 106 114 114 ARG ARG A . n 
C 2 107 HIS 107 115 115 HIS HIS A . n 
C 2 108 LYS 108 116 116 LYS LYS A . n 
C 2 109 LEU 109 117 117 LEU LEU A . n 
C 2 110 SER 110 118 118 SER SER A . n 
C 2 111 CYS 111 119 119 CYS CYS A . n 
C 2 112 VAL 112 120 120 VAL VAL A . n 
C 2 113 LEU 113 121 121 LEU LEU A . n 
C 2 114 TRP 114 122 122 TRP TRP A . n 
C 2 115 MET 115 123 123 MET MET A . n 
C 2 116 PRO 116 124 124 PRO PRO A . n 
C 2 117 ILE 117 125 125 ILE ILE A . n 
C 2 118 GLU 118 126 126 GLU GLU A . n 
C 2 119 GLY 119 127 127 GLY GLY A . n 
C 2 120 SER 120 128 128 SER SER A . n 
C 2 121 ARG 121 129 129 ARG ARG A . n 
C 2 122 HIS 122 130 130 HIS HIS A . n 
C 2 123 ILE 123 131 131 ILE ILE A . n 
C 2 124 PRO 124 132 132 PRO PRO A . n 
C 2 125 LEU 125 133 133 LEU LEU A . n 
C 2 126 ARG 126 134 134 ARG ARG A . n 
C 2 127 GLU 127 135 135 GLU GLU A . n 
C 2 128 ARG 128 136 136 ARG ARG A . n 
C 2 129 HIS 129 137 137 HIS HIS A . n 
C 2 130 ILE 130 138 138 ILE ILE A . n 
C 2 131 GLY 131 139 139 GLY GLY A . n 
C 2 132 ALA 132 140 140 ALA ALA A . n 
C 2 133 PRO 133 141 141 PRO PRO A . n 
C 2 134 ILE 134 142 142 ILE ILE A . n 
C 2 135 PHE 135 143 143 PHE PHE A . n 
C 2 136 TRP 136 144 144 TRP TRP A . n 
C 2 137 LYS 137 145 145 LYS LYS A . n 
C 2 138 PRO 138 146 146 PRO PRO A . n 
C 2 139 THR 139 147 147 THR THR A . n 
C 2 140 ALA 140 148 148 ALA ALA A . n 
C 2 141 GLU 141 149 149 GLU GLU A . n 
C 2 142 GLN 142 150 150 GLN GLN A . n 
C 2 143 GLU 143 151 151 GLU GLU A . n 
C 2 144 ARG 144 152 152 ARG ARG A . n 
C 2 145 GLN 145 153 153 GLN GLN A . n 
C 2 146 LEU 146 154 154 LEU LEU A . n 
C 2 147 LYS 147 155 155 LYS LYS A . n 
C 2 148 GLN 148 156 156 GLN GLN A . n 
C 2 149 ASP 149 157 157 ASP ASP A . n 
C 2 150 TRP 150 158 158 TRP TRP A . n 
C 2 151 GLU 151 159 159 GLU GLU A . n 
C 2 152 GLU 152 160 160 GLU GLU A . n 
C 2 153 LEU 153 161 161 LEU LEU A . n 
C 2 154 MET 154 162 162 MET MET A . n 
C 2 155 ASP 155 163 163 ASP ASP A . n 
C 2 156 LEU 156 164 164 LEU LEU A . n 
C 2 157 ILE 157 165 165 ILE ILE A . n 
C 2 158 VAL 158 166 166 VAL VAL A . n 
C 2 159 LEU 159 167 167 LEU LEU A . n 
C 2 160 GLY 160 168 168 GLY GLY A . n 
C 2 161 LYS 161 169 169 LYS LYS A . n 
C 2 162 LEU 162 170 170 LEU LEU A . n 
C 2 163 ASP 163 171 171 ASP ASP A . n 
C 2 164 GLN 164 172 172 GLN GLN A . n 
C 2 165 ILE 165 173 173 ILE ILE A . n 
C 2 166 THR 166 174 174 THR THR A . n 
C 2 167 ALA 167 175 175 ALA ALA A . n 
C 2 168 ARG 168 176 176 ARG ARG A . n 
C 2 169 ILE 169 177 177 ILE ILE A . n 
C 2 170 GLY 170 178 178 GLY GLY A . n 
C 2 171 GLU 171 179 179 GLU GLU A . n 
C 2 172 VAL 172 180 180 VAL VAL A . n 
C 2 173 MET 173 181 181 MET MET A . n 
C 2 174 GLN 174 182 182 GLN GLN A . n 
C 2 175 LEU 175 183 183 LEU LEU A . n 
C 2 176 ARG 176 184 184 ARG ARG A . n 
C 2 177 PRO 177 185 185 PRO PRO A . n 
C 2 178 LYS 178 186 186 LYS LYS A . n 
C 2 179 GLY 179 187 187 GLY GLY A . n 
C 2 180 ALA 180 188 188 ALA ALA A . n 
C 2 181 ASN 181 189 189 ASN ASN A . n 
C 2 182 SER 182 190 190 SER SER A . n 
C 2 183 ARG 183 191 191 ARG ARG A . n 
C 2 184 ALA 184 192 192 ALA ALA A . n 
C 2 185 VAL 185 193 193 VAL VAL A . n 
C 2 186 THR 186 194 194 THR THR A . n 
C 2 187 LYS 187 195 195 LYS LYS A . n 
C 2 188 GLY 188 196 196 GLY GLY A . n 
C 2 189 ILE 189 197 197 ILE ILE A . n 
C 2 190 GLY 190 198 198 GLY GLY A . n 
C 2 191 LYS 191 199 199 LYS LYS A . n 
C 2 192 ASN 192 200 200 ASN ASN A . n 
C 2 193 GLY 193 201 201 GLY GLY A . n 
C 2 194 GLU 194 202 202 GLU GLU A . n 
C 2 195 ILE 195 203 203 ILE ILE A . n 
C 2 196 ILE 196 204 204 ILE ILE A . n 
C 2 197 ASP 197 205 205 ASP ASP A . n 
C 2 198 THR 198 206 206 THR THR A . n 
C 2 199 LEU 199 207 207 LEU LEU A . n 
C 2 200 PRO 200 208 208 PRO PRO A . n 
C 2 201 LEU 201 209 209 LEU LEU A . n 
C 2 202 GLY 202 210 210 GLY GLY A . n 
C 2 203 PHE 203 211 211 PHE PHE A . n 
C 2 204 TYR 204 212 212 TYR TYR A . n 
C 2 205 LEU 205 213 213 LEU LEU A . n 
C 2 206 ARG 206 214 214 ARG ARG A . n 
C 2 207 LYS 207 215 215 LYS LYS A . n 
C 2 208 GLU 208 216 216 GLU GLU A . n 
C 2 209 PHE 209 217 217 PHE PHE A . n 
C 2 210 THR 210 218 218 THR THR A . n 
C 2 211 ALA 211 219 219 ALA ALA A . n 
C 2 212 GLN 212 220 220 GLN GLN A . n 
C 2 213 ILE 213 221 221 ILE ILE A . n 
C 2 214 LEU 214 222 222 LEU LEU A . n 
C 2 215 ASN 215 223 223 ASN ASN A . n 
C 2 216 ALA 216 224 224 ALA ALA A . n 
C 2 217 PHE 217 225 225 PHE PHE A . n 
C 2 218 LEU 218 226 226 LEU LEU A . n 
C 2 219 GLU 219 227 227 GLU GLU A . n 
C 2 220 THR 220 228 228 THR THR A . n 
C 2 221 LYS 221 229 ?   ?   ?   A . n 
C 2 222 SER 222 230 ?   ?   ?   A . n 
C 2 223 LEU 223 231 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 CA  1   232 201 CA  CA  A . 
E 3 CA  1   233 202 CA  CA  A . 
F 4 HOH 1   13  2   HOH HOH B . 
F 4 HOH 2   14  8   HOH HOH B . 
F 4 HOH 3   15  10  HOH HOH B . 
F 4 HOH 4   16  22  HOH HOH B . 
F 4 HOH 5   17  24  HOH HOH B . 
F 4 HOH 6   18  27  HOH HOH B . 
F 4 HOH 7   19  35  HOH HOH B . 
F 4 HOH 8   20  61  HOH HOH B . 
F 4 HOH 9   21  62  HOH HOH B . 
F 4 HOH 10  22  92  HOH HOH B . 
F 4 HOH 11  23  96  HOH HOH B . 
F 4 HOH 12  24  98  HOH HOH B . 
F 4 HOH 13  25  106 HOH HOH B . 
F 4 HOH 14  26  110 HOH HOH B . 
F 4 HOH 15  27  113 HOH HOH B . 
F 4 HOH 16  28  119 HOH HOH B . 
F 4 HOH 17  29  121 HOH HOH B . 
F 4 HOH 18  30  123 HOH HOH B . 
F 4 HOH 19  31  133 HOH HOH B . 
F 4 HOH 20  32  136 HOH HOH B . 
F 4 HOH 21  33  143 HOH HOH B . 
F 4 HOH 22  34  148 HOH HOH B . 
F 4 HOH 23  35  149 HOH HOH B . 
F 4 HOH 24  36  154 HOH HOH B . 
F 4 HOH 25  37  159 HOH HOH B . 
F 4 HOH 26  38  163 HOH HOH B . 
F 4 HOH 27  39  164 HOH HOH B . 
G 4 HOH 1   13  4   HOH HOH C . 
G 4 HOH 2   14  6   HOH HOH C . 
G 4 HOH 3   15  7   HOH HOH C . 
G 4 HOH 4   16  11  HOH HOH C . 
G 4 HOH 5   17  12  HOH HOH C . 
G 4 HOH 6   18  16  HOH HOH C . 
G 4 HOH 7   19  38  HOH HOH C . 
G 4 HOH 8   20  42  HOH HOH C . 
G 4 HOH 9   21  97  HOH HOH C . 
G 4 HOH 10  22  103 HOH HOH C . 
G 4 HOH 11  23  104 HOH HOH C . 
G 4 HOH 12  24  114 HOH HOH C . 
G 4 HOH 13  25  129 HOH HOH C . 
G 4 HOH 14  26  158 HOH HOH C . 
G 4 HOH 15  27  166 HOH HOH C . 
H 4 HOH 1   234 1   HOH HOH A . 
H 4 HOH 2   235 3   HOH HOH A . 
H 4 HOH 3   236 5   HOH HOH A . 
H 4 HOH 4   237 9   HOH HOH A . 
H 4 HOH 5   238 13  HOH HOH A . 
H 4 HOH 6   239 14  HOH HOH A . 
H 4 HOH 7   240 15  HOH HOH A . 
H 4 HOH 8   241 17  HOH HOH A . 
H 4 HOH 9   242 18  HOH HOH A . 
H 4 HOH 10  243 19  HOH HOH A . 
H 4 HOH 11  244 20  HOH HOH A . 
H 4 HOH 12  245 21  HOH HOH A . 
H 4 HOH 13  246 23  HOH HOH A . 
H 4 HOH 14  247 25  HOH HOH A . 
H 4 HOH 15  248 26  HOH HOH A . 
H 4 HOH 16  249 28  HOH HOH A . 
H 4 HOH 17  250 29  HOH HOH A . 
H 4 HOH 18  251 30  HOH HOH A . 
H 4 HOH 19  252 31  HOH HOH A . 
H 4 HOH 20  253 32  HOH HOH A . 
H 4 HOH 21  254 33  HOH HOH A . 
H 4 HOH 22  255 34  HOH HOH A . 
H 4 HOH 23  256 36  HOH HOH A . 
H 4 HOH 24  257 37  HOH HOH A . 
H 4 HOH 25  258 39  HOH HOH A . 
H 4 HOH 26  259 40  HOH HOH A . 
H 4 HOH 27  260 41  HOH HOH A . 
H 4 HOH 28  261 43  HOH HOH A . 
H 4 HOH 29  262 44  HOH HOH A . 
H 4 HOH 30  263 45  HOH HOH A . 
H 4 HOH 31  264 46  HOH HOH A . 
H 4 HOH 32  265 47  HOH HOH A . 
H 4 HOH 33  266 48  HOH HOH A . 
H 4 HOH 34  267 49  HOH HOH A . 
H 4 HOH 35  268 50  HOH HOH A . 
H 4 HOH 36  269 51  HOH HOH A . 
H 4 HOH 37  270 52  HOH HOH A . 
H 4 HOH 38  271 53  HOH HOH A . 
H 4 HOH 39  272 54  HOH HOH A . 
H 4 HOH 40  273 55  HOH HOH A . 
H 4 HOH 41  274 56  HOH HOH A . 
H 4 HOH 42  275 57  HOH HOH A . 
H 4 HOH 43  276 58  HOH HOH A . 
H 4 HOH 44  277 59  HOH HOH A . 
H 4 HOH 45  278 60  HOH HOH A . 
H 4 HOH 46  279 63  HOH HOH A . 
H 4 HOH 47  280 64  HOH HOH A . 
H 4 HOH 48  281 65  HOH HOH A . 
H 4 HOH 49  282 67  HOH HOH A . 
H 4 HOH 50  283 68  HOH HOH A . 
H 4 HOH 51  284 69  HOH HOH A . 
H 4 HOH 52  285 70  HOH HOH A . 
H 4 HOH 53  286 71  HOH HOH A . 
H 4 HOH 54  287 72  HOH HOH A . 
H 4 HOH 55  288 73  HOH HOH A . 
H 4 HOH 56  289 74  HOH HOH A . 
H 4 HOH 57  290 75  HOH HOH A . 
H 4 HOH 58  291 76  HOH HOH A . 
H 4 HOH 59  292 77  HOH HOH A . 
H 4 HOH 60  293 78  HOH HOH A . 
H 4 HOH 61  294 79  HOH HOH A . 
H 4 HOH 62  295 80  HOH HOH A . 
H 4 HOH 63  296 81  HOH HOH A . 
H 4 HOH 64  297 82  HOH HOH A . 
H 4 HOH 65  298 83  HOH HOH A . 
H 4 HOH 66  299 84  HOH HOH A . 
H 4 HOH 67  300 85  HOH HOH A . 
H 4 HOH 68  301 86  HOH HOH A . 
H 4 HOH 69  302 87  HOH HOH A . 
H 4 HOH 70  303 88  HOH HOH A . 
H 4 HOH 71  304 89  HOH HOH A . 
H 4 HOH 72  305 90  HOH HOH A . 
H 4 HOH 73  306 91  HOH HOH A . 
H 4 HOH 74  307 93  HOH HOH A . 
H 4 HOH 75  308 94  HOH HOH A . 
H 4 HOH 76  309 95  HOH HOH A . 
H 4 HOH 77  310 99  HOH HOH A . 
H 4 HOH 78  311 100 HOH HOH A . 
H 4 HOH 79  312 102 HOH HOH A . 
H 4 HOH 80  313 108 HOH HOH A . 
H 4 HOH 81  314 109 HOH HOH A . 
H 4 HOH 82  315 111 HOH HOH A . 
H 4 HOH 83  316 112 HOH HOH A . 
H 4 HOH 84  317 115 HOH HOH A . 
H 4 HOH 85  318 116 HOH HOH A . 
H 4 HOH 86  319 117 HOH HOH A . 
H 4 HOH 87  320 120 HOH HOH A . 
H 4 HOH 88  321 122 HOH HOH A . 
H 4 HOH 89  322 125 HOH HOH A . 
H 4 HOH 90  323 126 HOH HOH A . 
H 4 HOH 91  324 128 HOH HOH A . 
H 4 HOH 92  325 131 HOH HOH A . 
H 4 HOH 93  326 132 HOH HOH A . 
H 4 HOH 94  327 134 HOH HOH A . 
H 4 HOH 95  328 135 HOH HOH A . 
H 4 HOH 96  329 139 HOH HOH A . 
H 4 HOH 97  330 140 HOH HOH A . 
H 4 HOH 98  331 141 HOH HOH A . 
H 4 HOH 99  332 144 HOH HOH A . 
H 4 HOH 100 333 145 HOH HOH A . 
H 4 HOH 101 334 146 HOH HOH A . 
H 4 HOH 102 335 150 HOH HOH A . 
H 4 HOH 103 336 151 HOH HOH A . 
H 4 HOH 104 337 152 HOH HOH A . 
H 4 HOH 105 338 153 HOH HOH A . 
H 4 HOH 106 339 155 HOH HOH A . 
H 4 HOH 107 340 156 HOH HOH A . 
H 4 HOH 108 341 157 HOH HOH A . 
H 4 HOH 109 342 162 HOH HOH A . 
H 4 HOH 110 343 165 HOH HOH A . 
H 4 HOH 111 344 167 HOH HOH A . 
H 4 HOH 112 345 168 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OP1 ? B DG  5  ? C DG  5   ? 1_555 53.2  ? 
2  "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 259 ? 1_555 79.3  ? 
3  OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 259 ? 1_555 89.2  ? 
4  "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? C THR 54 ? A THR 62  ? 1_555 139.9 ? 
5  OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? C THR 54 ? A THR 62  ? 1_555 160.8 ? 
6  O     ? H HOH .  ? A HOH 259 ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? C THR 54 ? A THR 62  ? 1_555 106.2 ? 
7  "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 124.6 ? 
8  OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 74.4  ? 
9  O     ? H HOH .  ? A HOH 259 ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 83.6  ? 
10 O     ? C THR 54 ? A THR 62  ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 95.4  ? 
11 "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 258 ? 1_555 69.8  ? 
12 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 258 ? 1_555 106.5 ? 
13 O     ? H HOH .  ? A HOH 259 ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 258 ? 1_555 123.7 ? 
14 O     ? C THR 54 ? A THR 62  ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 258 ? 1_555 74.8  ? 
15 OD1   ? C ASP 62 ? A ASP 70  ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 O   ? H HOH .  ? A HOH 258 ? 1_555 152.4 ? 
16 "O3'" ? B DT  4  ? C DT  4   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 111.0 ? 
17 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 87.7  ? 
18 O     ? H HOH .  ? A HOH 259 ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 164.0 ? 
19 O     ? C THR 54 ? A THR 62  ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 74.4  ? 
20 OD1   ? C ASP 62 ? A ASP 70  ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 80.4  ? 
21 O     ? H HOH .  ? A HOH 258 ? 1_555 CA ? D CA . ? A CA 232 ? 1_555 OE2 ? C GLU 48 ? A GLU 56  ? 1_555 72.1  ? 
22 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OP1 ? B DG  5  ? C DG  5   ? 1_555 161.1 ? 
23 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OE1 ? C GLU 69 ? A GLU 77  ? 1_555 93.3  ? 
24 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OE1 ? C GLU 69 ? A GLU 77  ? 1_555 100.2 ? 
25 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? G HOH .  ? C HOH 20  ? 1_555 83.1  ? 
26 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? G HOH .  ? C HOH 20  ? 1_555 86.6  ? 
27 OE1   ? C GLU 69 ? A GLU 77  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? G HOH .  ? C HOH 20  ? 1_555 78.9  ? 
28 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? H HOH .  ? A HOH 260 ? 1_555 82.1  ? 
29 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? H HOH .  ? A HOH 260 ? 1_555 83.2  ? 
30 OE1   ? C GLU 69 ? A GLU 77  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? H HOH .  ? A HOH 260 ? 1_555 173.1 ? 
31 O     ? G HOH .  ? C HOH 20  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 O   ? H HOH .  ? A HOH 260 ? 1_555 95.3  ? 
32 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 124.9 ? 
33 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 62.9  ? 
34 OE1   ? C GLU 69 ? A GLU 77  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 108.5 ? 
35 O     ? G HOH .  ? C HOH 20  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 149.3 ? 
36 O     ? H HOH .  ? A HOH 260 ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD1 ? C ASP 62 ? A ASP 70  ? 1_555 78.4  ? 
37 O     ? C LEU 70 ? A LEU 78  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 89.8  ? 
38 OP1   ? B DG  5  ? C DG  5   ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 104.2 ? 
39 OE1   ? C GLU 69 ? A GLU 77  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 85.4  ? 
40 O     ? G HOH .  ? C HOH 20  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 162.4 ? 
41 O     ? H HOH .  ? A HOH 260 ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 99.7  ? 
42 OD1   ? C ASP 62 ? A ASP 70  ? 1_555 CA ? E CA . ? A CA 233 ? 1_555 OD2 ? C ASP 62 ? A ASP 70  ? 1_555 44.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-10-11 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 47  ? ? -153.10 48.18   
2 1 GLU A 68  ? ? 44.71   -2.79   
3 1 LYS A 169 ? ? -86.79  34.51   
4 1 ALA A 175 ? ? -59.78  -7.33   
5 1 ASN A 189 ? ? -174.46 -166.90 
6 1 GLU A 227 ? ? -72.89  20.06   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     3 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.079 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 66  ? CG  ? C LYS 58 CG  
2  1 Y 1 A LYS 66  ? CD  ? C LYS 58 CD  
3  1 Y 1 A LYS 66  ? CE  ? C LYS 58 CE  
4  1 Y 1 A LYS 66  ? NZ  ? C LYS 58 NZ  
5  1 Y 1 A GLU 68  ? CG  ? C GLU 60 CG  
6  1 Y 1 A GLU 68  ? CD  ? C GLU 60 CD  
7  1 Y 1 A GLU 68  ? OE1 ? C GLU 60 OE1 
8  1 Y 1 A GLU 68  ? OE2 ? C GLU 60 OE2 
9  1 Y 1 A GLN 102 ? CG  ? C GLN 94 CG  
10 1 Y 1 A GLN 102 ? CD  ? C GLN 94 CD  
11 1 Y 1 A GLN 102 ? OE1 ? C GLN 94 OE1 
12 1 Y 1 A GLN 102 ? NE2 ? C GLN 94 NE2 
13 1 Y 1 A ASN 103 ? CG  ? C ASN 95 CG  
14 1 Y 1 A ASN 103 ? OD1 ? C ASN 95 OD1 
15 1 Y 1 A ASN 103 ? ND2 ? C ASN 95 ND2 
16 1 Y 1 A SER 104 ? OG  ? C SER 96 OG  
17 1 Y 1 A VAL 106 ? CG1 ? C VAL 98 CG1 
18 1 Y 1 A VAL 106 ? CG2 ? C VAL 98 CG2 
19 1 Y 1 A LYS 107 ? CD  ? C LYS 99 CD  
20 1 Y 1 A LYS 107 ? CE  ? C LYS 99 CE  
21 1 Y 1 A LYS 107 ? NZ  ? C LYS 99 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 229 ? C LYS 221 
2 1 Y 1 A SER 230 ? C SER 222 
3 1 Y 1 A LEU 231 ? C LEU 223 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2AOQ 'double helix'        
2AOQ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 12 1_555 -0.215 -0.261 0.044  -1.508 -0.509  -1.971 1  B_DG1:DC12_C B 1  ? C 12 ? 19 1 
1 A DC 2  1_555 B DG 11 1_555 0.587  -0.107 0.176  5.830  -8.000  0.880  2  B_DC2:DG11_C B 2  ? C 11 ? 19 1 
1 A DA 3  1_555 B DT 10 1_555 0.229  0.127  0.368  10.111 -19.974 -2.694 3  B_DA3:DT10_C B 3  ? C 10 ? 20 1 
1 A DT 4  1_555 B DA 9  1_555 -0.495 -0.131 0.355  -0.467 -12.453 -0.091 4  B_DT4:DA9_C  B 4  ? C 9  ? 20 1 
1 A DG 5  1_555 B DC 8  1_555 0.011  0.032  0.609  5.178  -15.989 1.661  5  B_DG5:DC8_C  B 5  ? C 8  ? 19 1 
1 A DA 6  1_555 B DT 7  1_555 -0.063 0.008  0.006  -7.884 -6.452  0.521  6  B_DA6:DT7_C  B 6  ? C 7  ? 20 1 
1 A DT 7  1_555 B DA 6  1_555 -0.052 -0.010 0.017  -2.789 -16.442 1.618  7  B_DT7:DA6_C  B 7  ? C 6  ? 20 1 
1 A DC 8  1_555 B DG 5  1_555 -0.024 -0.160 -0.287 3.166  -10.004 0.109  8  B_DC8:DG5_C  B 8  ? C 5  ? 19 1 
1 A DA 9  1_555 B DT 4  1_555 -0.466 -0.031 0.114  8.722  -11.743 4.013  9  B_DA9:DT4_C  B 9  ? C 4  ? 20 1 
1 A DT 10 1_555 B DA 3  1_555 0.092  -0.075 -0.175 4.191  -8.906  1.489  10 B_DT10:DA3_C B 10 ? C 3  ? 20 1 
1 A DG 11 1_555 B DC 2  1_555 -0.269 -0.046 0.139  8.622  -4.353  2.319  11 B_DG11:DC2_C B 11 ? C 2  ? 19 1 
1 A DC 12 1_555 B DG 1  1_555 0.286  -0.110 -0.231 15.820 -1.975  -1.857 12 B_DC12:DG1_C B 12 ? C 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 12 1_555 A DC 2  1_555 B DG 11 1_555 -0.097 -0.013 3.210 1.044  2.704   31.755 -0.506 0.364  3.193 4.928   
-1.904 31.884 1  BB_DG1DC2:DG11DC12_CC B 1  ? C 12 ? B 2  ? C 11 ? 
1 A DC 2  1_555 B DG 11 1_555 A DA 3  1_555 B DT 10 1_555 -0.691 1.308  3.225 -2.639 -5.070  42.976 2.251  0.687  3.093 -6.884  
3.583  43.337 2  BB_DC2DA3:DT10DG11_CC B 2  ? C 11 ? B 3  ? C 10 ? 
1 A DA 3  1_555 B DT 10 1_555 A DT 4  1_555 B DA 9  1_555 0.573  0.998  3.630 2.061  -11.509 40.257 2.692  -0.571 3.262 -16.309 
-2.921 41.853 3  BB_DA3DT4:DA9DT10_CC  B 3  ? C 10 ? B 4  ? C 9  ? 
1 A DT 4  1_555 B DA 9  1_555 A DG 5  1_555 B DC 8  1_555 0.277  0.412  3.122 -2.904 5.396   33.729 -0.117 -0.909 3.114 9.205   
4.955  34.265 4  BB_DT4DG5:DC8DA9_CC   B 4  ? C 9  ? B 5  ? C 8  ? 
1 A DG 5  1_555 B DC 8  1_555 A DA 6  1_555 B DT 7  1_555 0.274  -0.840 3.650 6.688  -7.662  38.809 -0.219 0.479  3.738 -11.296 
-9.859 40.070 5  BB_DG5DA6:DT7DC8_CC   B 5  ? C 8  ? B 6  ? C 7  ? 
1 A DA 6  1_555 B DT 7  1_555 A DT 7  1_555 B DA 6  1_555 0.441  -0.815 3.388 -3.439 0.919   31.460 -1.669 -1.460 3.298 1.688   
6.318  31.656 6  BB_DA6DT7:DA6DT7_CC   B 6  ? C 7  ? B 7  ? C 6  ? 
1 A DT 7  1_555 B DA 6  1_555 A DC 8  1_555 B DG 5  1_555 -2.388 -1.582 3.330 -7.325 6.867   17.258 -8.025 3.205  3.215 20.757  
22.141 19.947 7  BB_DT7DC8:DG5DA6_CC   B 7  ? C 6  ? B 8  ? C 5  ? 
1 A DC 8  1_555 B DG 5  1_555 A DA 9  1_555 B DT 4  1_555 -0.897 -1.271 3.203 -8.905 14.645  24.745 -5.244 0.034  2.301 30.007  
18.247 30.025 8  BB_DC8DA9:DT4DG5_CC   B 8  ? C 5  ? B 9  ? C 4  ? 
1 A DA 9  1_555 B DT 4  1_555 A DT 10 1_555 B DA 3  1_555 0.115  -0.816 3.501 1.749  2.951   33.504 -1.918 0.103  3.420 5.102   
-3.025 33.674 9  BB_DA9DT10:DA3DT4_CC  B 9  ? C 4  ? B 10 ? C 3  ? 
1 A DT 10 1_555 B DA 3  1_555 A DG 11 1_555 B DC 2  1_555 -0.192 0.203  3.274 1.324  9.108   31.891 -1.191 0.560  3.199 16.161  
-2.349 33.160 10 BB_DT10DG11:DC2DA3_CC B 10 ? C 3  ? B 11 ? C 2  ? 
1 A DG 11 1_555 B DC 2  1_555 A DC 12 1_555 B DG 1  1_555 0.314  0.064  3.186 2.777  3.666   31.851 -0.526 -0.080 3.189 6.636   
-5.028 32.173 11 BB_DG11DC12:DG1DC2_CC B 11 ? C 2  ? B 12 ? C 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
#