data_2ARB
# 
_entry.id   2ARB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ARB         
RCSB  RCSB034222   
WWPDB D_1000034222 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Q8O 'Related complex'     unspecified 
PDB 2AR6 'Related complex'     unspecified 
PDB 1S1A 'Ligand-free protein' unspecified 
PDB 2ARE .                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ARB 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Buts, L.'        1  
'Garcia-Pino, A.' 2  
'Imberty, A.'     3  
'Amiot, N.'       4  
'Boons, G.-J.'    5  
'Versees, W.'     6  
'Lah, J.'         7  
'Beeckmans, S.'   8  
'Wyns, L.'        9  
'Loris, R.'       10 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.' 
_citation.journal_abbrev            'Febs J.' 
_citation.journal_volume            273 
_citation.page_first                2407 
_citation.page_last                 2420 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16704415 
_citation.pdbx_database_id_DOI      10.1111/j.1742-4658.2006.05248.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Buts, L.'        1 ? 
primary 'Garcia-Pino, A.' 2 ? 
primary 'Imberty, A.'     3 ? 
primary 'Amiot, N.'       4 ? 
primary 'Boons, G.J.'     5 ? 
primary 'Beeckmans, S.'   6 ? 
primary 'Versees, W.'     7 ? 
primary 'Wyns, L.'        8 ? 
primary 'Loris, R.'       9 ? 
# 
_cell.entry_id           2ARB 
_cell.length_a           56.877 
_cell.length_b           83.478 
_cell.length_c           123.077 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ARB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat lectin                                                                 27575.326 2   ? ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alpha-D-mannopyranose' 383.349   2   ? ? ? ? 
3 non-polymer syn 'MANGANESE (II) ION'                                                   54.938    2   ? ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                          40.078    2   ? ? ? ? 
5 water       nat water                                                                  18.015    231 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PAL 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ASP n 
1 3   SER n 
1 4   LEU n 
1 5   SER n 
1 6   PHE n 
1 7   GLY n 
1 8   PHE n 
1 9   PRO n 
1 10  THR n 
1 11  PHE n 
1 12  PRO n 
1 13  SER n 
1 14  ASP n 
1 15  GLN n 
1 16  LYS n 
1 17  ASN n 
1 18  LEU n 
1 19  ILE n 
1 20  PHE n 
1 21  GLN n 
1 22  GLY n 
1 23  ASP n 
1 24  ALA n 
1 25  GLN n 
1 26  ILE n 
1 27  LYS n 
1 28  ASN n 
1 29  ASN n 
1 30  ALA n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  THR n 
1 37  ASP n 
1 38  SER n 
1 39  ASN n 
1 40  GLY n 
1 41  ASN n 
1 42  PRO n 
1 43  VAL n 
1 44  ALA n 
1 45  SER n 
1 46  THR n 
1 47  VAL n 
1 48  GLY n 
1 49  ARG n 
1 50  ILE n 
1 51  LEU n 
1 52  PHE n 
1 53  SER n 
1 54  ALA n 
1 55  GLN n 
1 56  VAL n 
1 57  HIS n 
1 58  LEU n 
1 59  TRP n 
1 60  GLU n 
1 61  LYS n 
1 62  SER n 
1 63  SER n 
1 64  SER n 
1 65  ARG n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  PHE n 
1 70  GLN n 
1 71  SER n 
1 72  GLN n 
1 73  PHE n 
1 74  SER n 
1 75  PHE n 
1 76  SER n 
1 77  LEU n 
1 78  LYS n 
1 79  SER n 
1 80  PRO n 
1 81  LEU n 
1 82  SER n 
1 83  ASN n 
1 84  GLY n 
1 85  ALA n 
1 86  ASP n 
1 87  GLY n 
1 88  ILE n 
1 89  ALA n 
1 90  PHE n 
1 91  PHE n 
1 92  ILE n 
1 93  ALA n 
1 94  PRO n 
1 95  PRO n 
1 96  ASP n 
1 97  THR n 
1 98  THR n 
1 99  ILE n 
1 100 PRO n 
1 101 SER n 
1 102 GLY n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 LEU n 
1 108 LEU n 
1 109 GLY n 
1 110 LEU n 
1 111 PHE n 
1 112 ALA n 
1 113 PRO n 
1 114 GLY n 
1 115 THR n 
1 116 ALA n 
1 117 GLN n 
1 118 ASN n 
1 119 THR n 
1 120 SER n 
1 121 ALA n 
1 122 ASN n 
1 123 GLN n 
1 124 VAL n 
1 125 ILE n 
1 126 ALA n 
1 127 VAL n 
1 128 GLU n 
1 129 PHE n 
1 130 ASP n 
1 131 THR n 
1 132 PHE n 
1 133 TYR n 
1 134 ALA n 
1 135 GLN n 
1 136 ASP n 
1 137 SER n 
1 138 ASN n 
1 139 THR n 
1 140 TRP n 
1 141 ASP n 
1 142 PRO n 
1 143 ASN n 
1 144 TYR n 
1 145 PRO n 
1 146 HIS n 
1 147 ILE n 
1 148 GLY n 
1 149 ILE n 
1 150 ASP n 
1 151 VAL n 
1 152 ASN n 
1 153 SER n 
1 154 ILE n 
1 155 ARG n 
1 156 SER n 
1 157 VAL n 
1 158 LYS n 
1 159 THR n 
1 160 VAL n 
1 161 LYS n 
1 162 TRP n 
1 163 ASP n 
1 164 ARG n 
1 165 ARG n 
1 166 ASP n 
1 167 GLY n 
1 168 GLN n 
1 169 SER n 
1 170 LEU n 
1 171 ASN n 
1 172 VAL n 
1 173 LEU n 
1 174 VAL n 
1 175 THR n 
1 176 PHE n 
1 177 ASN n 
1 178 PRO n 
1 179 SER n 
1 180 THR n 
1 181 ARG n 
1 182 ASN n 
1 183 LEU n 
1 184 ASP n 
1 185 VAL n 
1 186 VAL n 
1 187 ALA n 
1 188 THR n 
1 189 TYR n 
1 190 SER n 
1 191 ASP n 
1 192 GLY n 
1 193 THR n 
1 194 ARG n 
1 195 TYR n 
1 196 GLU n 
1 197 VAL n 
1 198 SER n 
1 199 TYR n 
1 200 GLU n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 ARG n 
1 205 SER n 
1 206 VAL n 
1 207 LEU n 
1 208 PRO n 
1 209 GLU n 
1 210 TRP n 
1 211 VAL n 
1 212 ARG n 
1 213 VAL n 
1 214 GLY n 
1 215 PHE n 
1 216 SER n 
1 217 ALA n 
1 218 ALA n 
1 219 SER n 
1 220 GLY n 
1 221 GLU n 
1 222 GLN n 
1 223 TYR n 
1 224 GLN n 
1 225 THR n 
1 226 HIS n 
1 227 THR n 
1 228 LEU n 
1 229 GLU n 
1 230 SER n 
1 231 TRP n 
1 232 SER n 
1 233 PHE n 
1 234 THR n 
1 235 SER n 
1 236 THR n 
1 237 LEU n 
1 238 LEU n 
1 239 TYR n 
1 240 THR n 
1 241 ALA n 
1 242 GLN n 
1 243 LYS n 
1 244 LYS n 
1 245 GLY n 
1 246 GLU n 
1 247 ASN n 
1 248 LEU n 
1 249 ALA n 
1 250 LEU n 
1 251 GLU n 
1 252 MET n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Pterocarpus angolensis' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      182271 
_entity_src_nat.genus                      Pterocarpus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     seed 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GSD2_9FABA 
_struct_ref.pdbx_db_accession          Q8GSD2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ARB A 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
2 1 2ARB B 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'                     ? 'Mn 2'           54.938  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ARB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   52.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG8000, 200 mM calcium acetate, 100 mM sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.812 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.812 
# 
_reflns.entry_id                     2ARB 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.8 
_reflns.d_resolution_low             25.0 
_reflns.number_all                   55366 
_reflns.number_obs                   54435 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           0.458 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ARB 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             25.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     54435 
_refine.ls_number_reflns_obs                     54204 
_refine.ls_number_reflns_R_free                  3290 
_refine.ls_percent_reflns_obs                    98.4 
_refine.ls_R_factor_all                          0.1806 
_refine.ls_R_factor_obs                          0.1806 
_refine.ls_R_factor_R_work                       0.179 
_refine.ls_R_factor_R_free                       0.212 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1Q8O' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3655 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               3942 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        25.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2ARB 
_struct.title                     'Pterocarpus angolensis Lectin (PAL) In Complex With The GlcNAc(beta1-2)Man Disaccharide' 
_struct.pdbx_descriptor           lectin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ARB 
_struct_keywords.pdbx_keywords   'SUGAR BINDING PROTEIN' 
_struct_keywords.text            'LECTIN, CARBOHYDRATE RECOGNITION, SUGAR BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 104 ? LEU A 108 ? GLY A 104 LEU A 108 5 ? 5 
HELX_P HELX_P2 2 ALA A 112 ? ALA A 116 ? ALA A 112 ALA A 116 5 ? 5 
HELX_P HELX_P3 3 ASN A 118 ? ASN A 122 ? ASN A 118 ASN A 122 5 ? 5 
HELX_P HELX_P4 4 ASP A 202 ? VAL A 206 ? ASP A 202 VAL A 206 5 ? 5 
HELX_P HELX_P5 5 GLY B 104 ? LEU B 108 ? GLY B 104 LEU B 108 5 ? 5 
HELX_P HELX_P6 6 ALA B 112 ? ALA B 116 ? ALA B 112 ALA B 116 5 ? 5 
HELX_P HELX_P7 7 ASP B 202 ? VAL B 206 ? ASP B 202 VAL B 206 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? C MAN .   O2  ? ? ? 1_555 C NAG . C1 ? ? C MAN 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.376 ? ? 
covale2  covale both ? D MAN .   O2  ? ? ? 1_555 D NAG . C1 ? ? D MAN 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ? 
metalc1  metalc ?    ? A GLU 128 OE1 ? ? ? 1_555 E MN  . MN ? ? A GLU 128 A MN  261 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc2  metalc ?    ? A ASP 130 OD2 ? ? ? 1_555 E MN  . MN ? ? A ASP 130 A MN  261 1_555 ? ? ? ? ? ? ? 2.114 ? ? 
metalc3  metalc ?    ? A ASP 130 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 130 A CA  263 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc4  metalc ?    ? A ASP 130 OD2 ? ? ? 1_555 F CA  . CA ? ? A ASP 130 A CA  263 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc5  metalc ?    ? A PHE 132 O   ? ? ? 1_555 F CA  . CA ? ? A PHE 132 A CA  263 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc6  metalc ?    ? A ASN 138 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASN 138 A CA  263 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc7  metalc ?    ? A ASP 141 OD1 ? ? ? 1_555 E MN  . MN ? ? A ASP 141 A MN  261 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc8  metalc ?    ? A ASP 141 OD2 ? ? ? 1_555 F CA  . CA ? ? A ASP 141 A CA  263 1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc9  metalc ?    ? A HIS 146 NE2 ? ? ? 1_555 E MN  . MN ? ? A HIS 146 A MN  261 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc10 metalc ?    ? E MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  261 A HOH 266 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc11 metalc ?    ? E MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  261 A HOH 267 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc12 metalc ?    ? F CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  263 A HOH 264 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc13 metalc ?    ? F CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  263 A HOH 265 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc14 metalc ?    ? B GLU 128 OE1 ? ? ? 1_555 G MN  . MN ? ? B GLU 128 B MN  262 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc15 metalc ?    ? B ASP 130 OD2 ? ? ? 1_555 G MN  . MN ? ? B ASP 130 B MN  262 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc16 metalc ?    ? B ASP 130 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  264 1_555 ? ? ? ? ? ? ? 2.514 ? ? 
metalc17 metalc ?    ? B ASP 130 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  264 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc18 metalc ?    ? B PHE 132 O   ? ? ? 1_555 H CA  . CA ? ? B PHE 132 B CA  264 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc19 metalc ?    ? B ASN 138 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASN 138 B CA  264 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc20 metalc ?    ? B ASP 141 OD1 ? ? ? 1_555 G MN  . MN ? ? B ASP 141 B MN  262 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc21 metalc ?    ? B ASP 141 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 141 B CA  264 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc22 metalc ?    ? B HIS 146 NE2 ? ? ? 1_555 G MN  . MN ? ? B HIS 146 B MN  262 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc23 metalc ?    ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  262 B HOH 267 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc24 metalc ?    ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  262 B HOH 268 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc25 metalc ?    ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  264 B HOH 265 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc26 metalc ?    ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  264 B HOH 266 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 85 A . ? ALA 85 A ASP 86 A ? ASP 86 A 1 0.04 
2 ALA 85 B . ? ALA 85 B ASP 86 B ? ASP 86 B 1 0.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5  ? 
B ? 10 ? 
C ? 12 ? 
D ? 4  ? 
E ? 7  ? 
F ? 4  ? 
G ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? anti-parallel 
C 6  7  ? anti-parallel 
C 7  8  ? anti-parallel 
C 8  9  ? anti-parallel 
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
C 11 12 ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN B 25  ? LYS B 27  ? GLN B 25  LYS B 27  
A 2  ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
A 3  THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
A 4  ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
A 5  TRP B 59  ? GLU B 60  ? TRP B 59  GLU B 60  
B 1  GLN A 25  ? LYS A 27  ? GLN A 25  LYS A 27  
B 2  ALA A 30  ? GLN A 32  ? ALA A 30  GLN A 32  
B 3  THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
B 4  SER A 3   ? PHE A 8   ? SER A 3   PHE A 8   
B 5  SER B 3   ? PHE B 8   ? SER B 3   PHE B 8   
B 6  THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
B 7  ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
B 8  LEU B 170 ? ASN B 177 ? LEU B 170 ASN B 177 
B 9  ASN B 182 ? THR B 188 ? ASN B 182 THR B 188 
B 10 ARG B 194 ? GLU B 200 ? ARG B 194 GLU B 200 
C 1  ARG A 194 ? GLU A 200 ? ARG A 194 GLU A 200 
C 2  ASN A 182 ? THR A 188 ? ASN A 182 THR A 188 
C 3  LEU A 170 ? ASN A 177 ? LEU A 170 ASN A 177 
C 4  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
C 5  TRP A 59  ? GLU A 60  ? TRP A 59  GLU A 60  
C 6  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
C 7  THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
C 8  SER A 3   ? PHE A 8   ? SER A 3   PHE A 8   
C 9  SER B 3   ? PHE B 8   ? SER B 3   PHE B 8   
C 10 THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
C 11 ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
C 12 GLN B 25  ? LYS B 27  ? GLN B 25  LYS B 27  
D 1  LEU A 18  ? GLY A 22  ? LEU A 18  GLY A 22  
D 2  THR A 46  ? PHE A 52  ? THR A 46  PHE A 52  
D 3  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
D 4  VAL A 56  ? HIS A 57  ? VAL A 56  HIS A 57  
E 1  LEU A 18  ? GLY A 22  ? LEU A 18  GLY A 22  
E 2  THR A 46  ? PHE A 52  ? THR A 46  PHE A 52  
E 3  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
E 4  GLY A 87  ? ALA A 93  ? GLY A 87  ALA A 93  
E 5  ILE A 125 ? ASP A 130 ? ILE A 125 ASP A 130 
E 6  HIS A 146 ? VAL A 151 ? HIS A 146 VAL A 151 
E 7  LYS A 158 ? LYS A 161 ? LYS A 158 LYS A 161 
F 1  LEU B 18  ? GLY B 22  ? LEU B 18  GLY B 22  
F 2  THR B 46  ? PHE B 52  ? THR B 46  PHE B 52  
F 3  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
F 4  VAL B 56  ? HIS B 57  ? VAL B 56  HIS B 57  
G 1  LEU B 18  ? GLY B 22  ? LEU B 18  GLY B 22  
G 2  THR B 46  ? PHE B 52  ? THR B 46  PHE B 52  
G 3  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
G 4  GLY B 87  ? ALA B 93  ? GLY B 87  ALA B 93  
G 5  ILE B 125 ? ASP B 130 ? ILE B 125 ASP B 130 
G 6  HIS B 146 ? VAL B 151 ? HIS B 146 VAL B 151 
G 7  LYS B 158 ? LYS B 161 ? LYS B 158 LYS B 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLN B 25  ? N GLN B 25  O GLN B 32  ? O GLN B 32  
A 2  3  N VAL B 31  ? N VAL B 31  O LEU B 228 ? O LEU B 228 
A 3  4  O THR B 236 ? O THR B 236 N ASN B 68  ? N ASN B 68  
A 4  5  O ARG B 65  ? O ARG B 65  N GLU B 60  ? N GLU B 60  
B 1  2  N GLN A 25  ? N GLN A 25  O GLN A 32  ? O GLN A 32  
B 2  3  N VAL A 31  ? N VAL A 31  O LEU A 228 ? O LEU A 228 
B 3  4  O TRP A 231 ? O TRP A 231 N PHE A 8   ? N PHE A 8   
B 4  5  N SER A 5   ? N SER A 5   O SER B 5   ? O SER B 5   
B 5  6  N PHE B 8   ? N PHE B 8   O TRP B 231 ? O TRP B 231 
B 6  7  O THR B 236 ? O THR B 236 N ASN B 68  ? N ASN B 68  
B 7  8  N PHE B 73  ? N PHE B 73  O VAL B 172 ? O VAL B 172 
B 8  9  N ASN B 171 ? N ASN B 171 O THR B 188 ? O THR B 188 
B 9  10 N LEU B 183 ? N LEU B 183 O TYR B 199 ? O TYR B 199 
C 1  2  O TYR A 199 ? O TYR A 199 N LEU A 183 ? N LEU A 183 
C 2  3  O THR A 188 ? O THR A 188 N ASN A 171 ? N ASN A 171 
C 3  4  O VAL A 172 ? O VAL A 172 N PHE A 73  ? N PHE A 73  
C 4  5  O ARG A 65  ? O ARG A 65  N GLU A 60  ? N GLU A 60  
C 5  6  N GLU A 60  ? N GLU A 60  O ARG A 65  ? O ARG A 65  
C 6  7  N GLN A 72  ? N GLN A 72  O SER A 232 ? O SER A 232 
C 7  8  O TRP A 231 ? O TRP A 231 N PHE A 8   ? N PHE A 8   
C 8  9  N SER A 5   ? N SER A 5   O SER B 5   ? O SER B 5   
C 9  10 N PHE B 8   ? N PHE B 8   O TRP B 231 ? O TRP B 231 
C 10 11 O LEU B 228 ? O LEU B 228 N VAL B 31  ? N VAL B 31  
C 11 12 O GLN B 32  ? O GLN B 32  N GLN B 25  ? N GLN B 25  
D 1  2  N ILE A 19  ? N ILE A 19  O LEU A 51  ? O LEU A 51  
D 2  3  N PHE A 52  ? N PHE A 52  O VAL A 213 ? O VAL A 213 
D 3  4  O VAL A 211 ? O VAL A 211 N VAL A 56  ? N VAL A 56  
E 1  2  N ILE A 19  ? N ILE A 19  O LEU A 51  ? O LEU A 51  
E 2  3  N PHE A 52  ? N PHE A 52  O VAL A 213 ? O VAL A 213 
E 3  4  O ARG A 212 ? O ARG A 212 N ALA A 93  ? N ALA A 93  
E 4  5  N PHE A 90  ? N PHE A 90  O VAL A 127 ? O VAL A 127 
E 5  6  N ALA A 126 ? N ALA A 126 O ASP A 150 ? O ASP A 150 
E 6  7  N ILE A 149 ? N ILE A 149 O LYS A 158 ? O LYS A 158 
F 1  2  N GLN B 21  ? N GLN B 21  O ARG B 49  ? O ARG B 49  
F 2  3  N PHE B 52  ? N PHE B 52  O VAL B 213 ? O VAL B 213 
F 3  4  O VAL B 211 ? O VAL B 211 N VAL B 56  ? N VAL B 56  
G 1  2  N GLN B 21  ? N GLN B 21  O ARG B 49  ? O ARG B 49  
G 2  3  N PHE B 52  ? N PHE B 52  O VAL B 213 ? O VAL B 213 
G 3  4  O SER B 216 ? O SER B 216 N ALA B 89  ? N ALA B 89  
G 4  5  N PHE B 90  ? N PHE B 90  O VAL B 127 ? O VAL B 127 
G 5  6  N ALA B 126 ? N ALA B 126 O ASP B 150 ? O ASP B 150 
G 6  7  N ILE B 149 ? N ILE B 149 O LYS B 158 ? O LYS B 158 
# 
_database_PDB_matrix.entry_id          2ARB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ARB 
_atom_sites.fract_transf_matrix[1][1]   0.017582 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011979 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008125 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C  CA  . GLN A 1 1   ? -5.613  3.002   14.736  1.00 15.91 ? 1   GLN A CA  1 
ATOM   2    C  C   . GLN A 1 1   ? -6.293  3.305   16.056  1.00 17.50 ? 1   GLN A C   1 
ATOM   3    O  O   . GLN A 1 1   ? -6.488  4.486   16.411  1.00 20.59 ? 1   GLN A O   1 
ATOM   4    C  CB  . GLN A 1 1   ? -4.097  3.057   14.909  1.00 16.46 ? 1   GLN A CB  1 
ATOM   5    C  CG  . GLN A 1 1   ? -3.675  4.401   14.397  1.00 21.27 ? 1   GLN A CG  1 
ATOM   6    C  CD  . GLN A 1 1   ? -4.792  4.894   13.490  1.00 17.88 ? 1   GLN A CD  1 
ATOM   7    O  OE1 . GLN A 1 1   ? -4.679  5.894   12.801  1.00 22.71 ? 1   GLN A OE1 1 
ATOM   8    N  NE2 . GLN A 1 1   ? -5.968  4.016   13.706  1.00 19.11 ? 1   GLN A NE2 1 
ATOM   9    N  N   . ASP A 1 2   ? -6.647  2.250   16.778  1.00 14.45 ? 2   ASP A N   1 
ATOM   10   C  CA  . ASP A 1 2   ? -7.253  2.411   18.085  1.00 16.54 ? 2   ASP A CA  1 
ATOM   11   C  C   . ASP A 1 2   ? -6.157  2.811   19.069  1.00 18.17 ? 2   ASP A C   1 
ATOM   12   O  O   . ASP A 1 2   ? -6.448  3.430   20.103  1.00 17.46 ? 2   ASP A O   1 
ATOM   13   C  CB  . ASP A 1 2   ? -7.869  1.101   18.592  1.00 18.16 ? 2   ASP A CB  1 
ATOM   14   C  CG  . ASP A 1 2   ? -9.203  0.771   17.928  1.00 20.67 ? 2   ASP A CG  1 
ATOM   15   O  OD1 . ASP A 1 2   ? -9.612  1.460   16.976  1.00 25.01 ? 2   ASP A OD1 1 
ATOM   16   O  OD2 . ASP A 1 2   ? -9.812  -0.194  18.392  1.00 24.10 ? 2   ASP A OD2 1 
ATOM   17   N  N   . SER A 1 3   ? -4.907  2.411   18.789  1.00 15.78 ? 3   SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? -3.808  2.745   19.715  1.00 16.49 ? 3   SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? -2.630  3.297   18.931  1.00 17.88 ? 3   SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? -2.400  2.898   17.803  1.00 14.02 ? 3   SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? -3.362  1.513   20.513  1.00 18.79 ? 3   SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? -2.892  0.503   19.626  1.00 22.48 ? 3   SER A OG  1 
ATOM   23   N  N   . LEU A 1 4   ? -1.886  4.221   19.541  1.00 13.45 ? 4   LEU A N   1 
ATOM   24   C  CA  . LEU A 1 4   ? -0.750  4.840   18.858  1.00 12.50 ? 4   LEU A CA  1 
ATOM   25   C  C   . LEU A 1 4   ? 0.259   5.216   19.925  1.00 15.17 ? 4   LEU A C   1 
ATOM   26   O  O   . LEU A 1 4   ? -0.123  5.716   20.992  1.00 17.79 ? 4   LEU A O   1 
ATOM   27   C  CB  . LEU A 1 4   ? -1.207  6.134   18.163  1.00 14.79 ? 4   LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 4   ? -0.081  7.020   17.585  1.00 20.73 ? 4   LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 4   ? 0.636   6.231   16.470  1.00 25.16 ? 4   LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 4   ? -0.605  8.329   17.012  1.00 26.11 ? 4   LEU A CD2 1 
ATOM   31   N  N   . SER A 1 5   ? 1.536   4.999   19.677  1.00 13.74 ? 5   SER A N   1 
ATOM   32   C  CA  . SER A 1 5   ? 2.507   5.466   20.679  1.00 15.13 ? 5   SER A CA  1 
ATOM   33   C  C   . SER A 1 5   ? 3.799   5.821   19.962  1.00 17.35 ? 5   SER A C   1 
ATOM   34   O  O   . SER A 1 5   ? 4.106   5.255   18.909  1.00 16.12 ? 5   SER A O   1 
ATOM   35   C  CB  . SER A 1 5   ? 2.780   4.422   21.776  1.00 21.90 ? 5   SER A CB  1 
ATOM   36   O  OG  . SER A 1 5   ? 3.550   3.364   21.292  1.00 37.06 ? 5   SER A OG  1 
ATOM   37   N  N   . PHE A 1 6   ? 4.527   6.810   20.480  1.00 14.72 ? 6   PHE A N   1 
ATOM   38   C  CA  . PHE A 1 6   ? 5.804   7.157   19.860  1.00 14.22 ? 6   PHE A CA  1 
ATOM   39   C  C   . PHE A 1 6   ? 6.695   7.705   20.952  1.00 13.80 ? 6   PHE A C   1 
ATOM   40   O  O   . PHE A 1 6   ? 6.207   8.223   21.960  1.00 15.07 ? 6   PHE A O   1 
ATOM   41   C  CB  . PHE A 1 6   ? 5.633   8.149   18.682  1.00 15.61 ? 6   PHE A CB  1 
ATOM   42   C  CG  . PHE A 1 6   ? 4.886   9.422   19.020  1.00 17.88 ? 6   PHE A CG  1 
ATOM   43   C  CD1 . PHE A 1 6   ? 5.522   10.469  19.702  1.00 16.09 ? 6   PHE A CD1 1 
ATOM   44   C  CD2 . PHE A 1 6   ? 3.550   9.562   18.670  1.00 19.93 ? 6   PHE A CD2 1 
ATOM   45   C  CE1 . PHE A 1 6   ? 4.817   11.657  20.037  1.00 17.78 ? 6   PHE A CE1 1 
ATOM   46   C  CE2 . PHE A 1 6   ? 2.832   10.745  18.998  1.00 20.68 ? 6   PHE A CE2 1 
ATOM   47   C  CZ  . PHE A 1 6   ? 3.468   11.793  19.684  1.00 17.26 ? 6   PHE A CZ  1 
ATOM   48   N  N   . GLY A 1 7   ? 8.001   7.543   20.778  1.00 13.79 ? 7   GLY A N   1 
ATOM   49   C  CA  . GLY A 1 7   ? 8.929   8.041   21.779  1.00 15.32 ? 7   GLY A CA  1 
ATOM   50   C  C   . GLY A 1 7   ? 10.158  8.699   21.167  1.00 17.10 ? 7   GLY A C   1 
ATOM   51   O  O   . GLY A 1 7   ? 10.785  8.137   20.242  1.00 16.27 ? 7   GLY A O   1 
ATOM   52   N  N   . PHE A 1 8   ? 10.460  9.910   21.660  1.00 14.22 ? 8   PHE A N   1 
ATOM   53   C  CA  . PHE A 1 8   ? 11.636  10.686  21.241  1.00 16.66 ? 8   PHE A CA  1 
ATOM   54   C  C   . PHE A 1 8   ? 12.527  10.893  22.474  1.00 18.09 ? 8   PHE A C   1 
ATOM   55   O  O   . PHE A 1 8   ? 12.313  11.853  23.244  1.00 18.34 ? 8   PHE A O   1 
ATOM   56   C  CB  . PHE A 1 8   ? 11.270  12.099  20.753  1.00 17.78 ? 8   PHE A CB  1 
ATOM   57   C  CG  . PHE A 1 8   ? 10.450  12.160  19.487  1.00 16.20 ? 8   PHE A CG  1 
ATOM   58   C  CD1 . PHE A 1 8   ? 9.056   12.169  19.536  1.00 16.20 ? 8   PHE A CD1 1 
ATOM   59   C  CD2 . PHE A 1 8   ? 11.077  12.337  18.244  1.00 16.03 ? 8   PHE A CD2 1 
ATOM   60   C  CE1 . PHE A 1 8   ? 8.290   12.367  18.353  1.00 16.10 ? 8   PHE A CE1 1 
ATOM   61   C  CE2 . PHE A 1 8   ? 10.333  12.532  17.078  1.00 15.85 ? 8   PHE A CE2 1 
ATOM   62   C  CZ  . PHE A 1 8   ? 8.944   12.551  17.126  1.00 19.07 ? 8   PHE A CZ  1 
ATOM   63   N  N   . PRO A 1 9   ? 13.499  10.004  22.712  1.00 19.86 ? 9   PRO A N   1 
ATOM   64   C  CA  . PRO A 1 9   ? 14.402  10.149  23.869  1.00 21.77 ? 9   PRO A CA  1 
ATOM   65   C  C   . PRO A 1 9   ? 15.238  11.421  23.692  1.00 23.18 ? 9   PRO A C   1 
ATOM   66   O  O   . PRO A 1 9   ? 15.656  12.044  24.674  1.00 26.69 ? 9   PRO A O   1 
ATOM   67   C  CB  . PRO A 1 9   ? 15.254  8.870   23.803  1.00 21.76 ? 9   PRO A CB  1 
ATOM   68   C  CG  . PRO A 1 9   ? 14.306  7.888   23.142  1.00 27.05 ? 9   PRO A CG  1 
ATOM   69   C  CD  . PRO A 1 9   ? 13.821  8.765   21.989  1.00 23.08 ? 9   PRO A CD  1 
ATOM   70   N  N   . THR A 1 10  ? 15.508  11.760  22.435  1.00 20.81 ? 10  THR A N   1 
ATOM   71   C  CA  . THR A 1 10  ? 16.215  12.972  22.063  1.00 21.88 ? 10  THR A CA  1 
ATOM   72   C  C   . THR A 1 10  ? 15.664  13.322  20.702  1.00 22.56 ? 10  THR A C   1 
ATOM   73   O  O   . THR A 1 10  ? 14.836  12.571  20.144  1.00 24.49 ? 10  THR A O   1 
ATOM   74   C  CB  . THR A 1 10  ? 17.757  12.782  21.967  1.00 27.06 ? 10  THR A CB  1 
ATOM   75   O  OG1 . THR A 1 10  ? 18.057  11.875  20.898  1.00 28.05 ? 10  THR A OG1 1 
ATOM   76   C  CG2 . THR A 1 10  ? 18.305  12.213  23.258  1.00 30.06 ? 10  THR A CG2 1 
ATOM   77   N  N   . PHE A 1 11  ? 16.094  14.461  20.161  1.00 21.67 ? 11  PHE A N   1 
ATOM   78   C  CA  . PHE A 1 11  ? 15.642  14.922  18.850  1.00 23.91 ? 11  PHE A CA  1 
ATOM   79   C  C   . PHE A 1 11  ? 16.752  15.147  17.808  1.00 28.29 ? 11  PHE A C   1 
ATOM   80   O  O   . PHE A 1 11  ? 17.214  16.266  17.628  1.00 26.74 ? 11  PHE A O   1 
ATOM   81   C  CB  . PHE A 1 11  ? 14.856  16.228  18.989  1.00 22.91 ? 11  PHE A CB  1 
ATOM   82   C  CG  . PHE A 1 11  ? 13.505  16.079  19.661  1.00 20.62 ? 11  PHE A CG  1 
ATOM   83   C  CD1 . PHE A 1 11  ? 12.369  15.746  18.916  1.00 21.36 ? 11  PHE A CD1 1 
ATOM   84   C  CD2 . PHE A 1 11  ? 13.369  16.298  21.029  1.00 20.53 ? 11  PHE A CD2 1 
ATOM   85   C  CE1 . PHE A 1 11  ? 11.114  15.640  19.516  1.00 18.96 ? 11  PHE A CE1 1 
ATOM   86   C  CE2 . PHE A 1 11  ? 12.111  16.194  21.659  1.00 22.11 ? 11  PHE A CE2 1 
ATOM   87   C  CZ  . PHE A 1 11  ? 10.975  15.864  20.884  1.00 22.47 ? 11  PHE A CZ  1 
ATOM   88   N  N   . PRO A 1 12  ? 17.191  14.087  17.106  1.00 30.91 ? 12  PRO A N   1 
ATOM   89   C  CA  . PRO A 1 12  ? 18.242  14.280  16.093  1.00 31.26 ? 12  PRO A CA  1 
ATOM   90   C  C   . PRO A 1 12  ? 17.736  15.210  14.996  1.00 33.29 ? 12  PRO A C   1 
ATOM   91   O  O   . PRO A 1 12  ? 16.524  15.347  14.791  1.00 31.39 ? 12  PRO A O   1 
ATOM   92   C  CB  . PRO A 1 12  ? 18.485  12.865  15.595  1.00 35.06 ? 12  PRO A CB  1 
ATOM   93   C  CG  . PRO A 1 12  ? 18.147  12.027  16.839  1.00 35.90 ? 12  PRO A CG  1 
ATOM   94   C  CD  . PRO A 1 12  ? 16.832  12.664  17.188  1.00 29.58 ? 12  PRO A CD  1 
ATOM   95   N  N   . SER A 1 13  ? 18.646  15.843  14.261  1.00 32.10 ? 13  SER A N   1 
ATOM   96   C  CA  . SER A 1 13  ? 18.213  16.791  13.242  1.00 33.40 ? 13  SER A CA  1 
ATOM   97   C  C   . SER A 1 13  ? 17.432  16.212  12.071  1.00 33.40 ? 13  SER A C   1 
ATOM   98   O  O   . SER A 1 13  ? 16.676  16.927  11.421  1.00 34.07 ? 13  SER A O   1 
ATOM   99   C  CB  . SER A 1 13  ? 19.409  17.593  12.718  1.00 36.97 ? 13  SER A CB  1 
ATOM   100  O  OG  . SER A 1 13  ? 20.394  16.723  12.207  1.00 46.73 ? 13  SER A OG  1 
ATOM   101  N  N   . ASP A 1 14  ? 17.582  14.924  11.799  1.00 34.25 ? 14  ASP A N   1 
ATOM   102  C  CA  . ASP A 1 14  ? 16.845  14.363  10.676  1.00 38.98 ? 14  ASP A CA  1 
ATOM   103  C  C   . ASP A 1 14  ? 15.489  13.815  11.140  1.00 37.08 ? 14  ASP A C   1 
ATOM   104  O  O   . ASP A 1 14  ? 15.357  12.662  11.529  1.00 43.21 ? 14  ASP A O   1 
ATOM   105  C  CB  . ASP A 1 14  ? 17.688  13.287  9.977   1.00 41.21 ? 14  ASP A CB  1 
ATOM   106  C  CG  A ASP A 1 14  ? 16.995  12.710  8.769   0.50 42.45 ? 14  ASP A CG  1 
ATOM   107  C  CG  B ASP A 1 14  ? 17.925  12.061  10.845  0.50 42.87 ? 14  ASP A CG  1 
ATOM   108  O  OD1 A ASP A 1 14  ? 16.468  13.502  7.958   0.50 43.93 ? 14  ASP A OD1 1 
ATOM   109  O  OD1 B ASP A 1 14  ? 18.243  12.222  12.043  0.50 42.89 ? 14  ASP A OD1 1 
ATOM   110  O  OD2 A ASP A 1 14  ? 16.994  11.470  8.624   0.50 44.34 ? 14  ASP A OD2 1 
ATOM   111  O  OD2 B ASP A 1 14  ? 17.813  10.933  10.314  0.50 41.81 ? 14  ASP A OD2 1 
ATOM   112  N  N   . GLN A 1 15  ? 14.495  14.685  11.106  1.00 35.21 ? 15  GLN A N   1 
ATOM   113  C  CA  . GLN A 1 15  ? 13.141  14.358  11.522  1.00 30.69 ? 15  GLN A CA  1 
ATOM   114  C  C   . GLN A 1 15  ? 12.249  14.226  10.308  1.00 28.82 ? 15  GLN A C   1 
ATOM   115  O  O   . GLN A 1 15  ? 12.380  14.993  9.355   1.00 28.40 ? 15  GLN A O   1 
ATOM   116  C  CB  . GLN A 1 15  ? 12.621  15.467  12.422  1.00 31.87 ? 15  GLN A CB  1 
ATOM   117  C  CG  . GLN A 1 15  ? 13.334  15.537  13.763  1.00 32.10 ? 15  GLN A CG  1 
ATOM   118  C  CD  . GLN A 1 15  ? 13.124  14.275  14.558  1.00 34.54 ? 15  GLN A CD  1 
ATOM   119  O  OE1 . GLN A 1 15  ? 12.006  13.763  14.611  1.00 37.04 ? 15  GLN A OE1 1 
ATOM   120  N  NE2 . GLN A 1 15  ? 14.178  13.770  15.189  1.00 32.30 ? 15  GLN A NE2 1 
ATOM   121  N  N   . LYS A 1 16  ? 11.343  13.250  10.339  1.00 22.63 ? 16  LYS A N   1 
ATOM   122  C  CA  . LYS A 1 16  ? 10.429  13.053  9.224   1.00 24.40 ? 16  LYS A CA  1 
ATOM   123  C  C   . LYS A 1 16  ? 8.964   13.210  9.617   1.00 21.64 ? 16  LYS A C   1 
ATOM   124  O  O   . LYS A 1 16  ? 8.145   13.564  8.774   1.00 21.10 ? 16  LYS A O   1 
ATOM   125  C  CB  . LYS A 1 16  ? 10.618  11.647  8.609   1.00 21.99 ? 16  LYS A CB  1 
ATOM   126  C  CG  . LYS A 1 16  ? 12.024  11.344  8.106   1.00 26.04 ? 16  LYS A CG  1 
ATOM   127  C  CD  . LYS A 1 16  ? 12.423  12.196  6.932   1.00 26.94 ? 16  LYS A CD  1 
ATOM   128  C  CE  . LYS A 1 16  ? 13.868  11.863  6.581   1.00 36.22 ? 16  LYS A CE  1 
ATOM   129  N  NZ  . LYS A 1 16  ? 14.328  12.682  5.424   1.00 44.32 ? 16  LYS A NZ  1 
ATOM   130  N  N   . ASN A 1 17  ? 8.649   12.974  10.896  1.00 19.57 ? 17  ASN A N   1 
ATOM   131  C  CA  . ASN A 1 17  ? 7.256   13.004  11.371  1.00 18.40 ? 17  ASN A CA  1 
ATOM   132  C  C   . ASN A 1 17  ? 6.817   14.192  12.223  1.00 21.50 ? 17  ASN A C   1 
ATOM   133  O  O   . ASN A 1 17  ? 5.801   14.117  12.917  1.00 19.92 ? 17  ASN A O   1 
ATOM   134  C  CB  . ASN A 1 17  ? 6.952   11.723  12.145  1.00 16.74 ? 17  ASN A CB  1 
ATOM   135  C  CG  . ASN A 1 17  ? 7.102   10.475  11.276  1.00 16.62 ? 17  ASN A CG  1 
ATOM   136  O  OD1 . ASN A 1 17  ? 6.661   10.478  10.138  1.00 19.35 ? 17  ASN A OD1 1 
ATOM   137  N  ND2 . ASN A 1 17  ? 7.712   9.425   11.817  1.00 16.57 ? 17  ASN A ND2 1 
ATOM   138  N  N   . LEU A 1 18  ? 7.586   15.268  12.177  1.00 20.46 ? 18  LEU A N   1 
ATOM   139  C  CA  . LEU A 1 18  ? 7.211   16.464  12.929  1.00 22.76 ? 18  LEU A CA  1 
ATOM   140  C  C   . LEU A 1 18  ? 6.872   17.607  11.984  1.00 23.82 ? 18  LEU A C   1 
ATOM   141  O  O   . LEU A 1 18  ? 7.548   17.824  10.969  1.00 24.93 ? 18  LEU A O   1 
ATOM   142  C  CB  . LEU A 1 18  ? 8.341   16.916  13.850  1.00 22.50 ? 18  LEU A CB  1 
ATOM   143  C  CG  . LEU A 1 18  ? 8.689   15.990  15.013  1.00 24.00 ? 18  LEU A CG  1 
ATOM   144  C  CD1 . LEU A 1 18  ? 9.935   16.485  15.740  1.00 29.50 ? 18  LEU A CD1 1 
ATOM   145  C  CD2 . LEU A 1 18  ? 7.486   15.906  15.957  1.00 19.82 ? 18  LEU A CD2 1 
ATOM   146  N  N   . ILE A 1 19  ? 5.797   18.304  12.315  1.00 20.37 ? 19  ILE A N   1 
ATOM   147  C  CA  . ILE A 1 19  ? 5.363   19.487  11.563  1.00 22.20 ? 19  ILE A CA  1 
ATOM   148  C  C   . ILE A 1 19  ? 5.909   20.672  12.354  1.00 23.93 ? 19  ILE A C   1 
ATOM   149  O  O   . ILE A 1 19  ? 5.552   20.850  13.520  1.00 22.52 ? 19  ILE A O   1 
ATOM   150  C  CB  . ILE A 1 19  ? 3.855   19.599  11.543  1.00 21.72 ? 19  ILE A CB  1 
ATOM   151  C  CG1 . ILE A 1 19  ? 3.260   18.392  10.806  1.00 24.53 ? 19  ILE A CG1 1 
ATOM   152  C  CG2 . ILE A 1 19  ? 3.448   20.917  10.917  1.00 27.51 ? 19  ILE A CG2 1 
ATOM   153  C  CD1 . ILE A 1 19  ? 1.740   18.300  10.913  1.00 27.40 ? 19  ILE A CD1 1 
ATOM   154  N  N   . PHE A 1 20  ? 6.789   21.461  11.739  1.00 23.71 ? 20  PHE A N   1 
ATOM   155  C  CA  . PHE A 1 20  ? 7.371   22.620  12.427  1.00 22.27 ? 20  PHE A CA  1 
ATOM   156  C  C   . PHE A 1 20  ? 6.601   23.845  11.996  1.00 25.59 ? 20  PHE A C   1 
ATOM   157  O  O   . PHE A 1 20  ? 6.335   24.015  10.812  1.00 23.88 ? 20  PHE A O   1 
ATOM   158  C  CB  . PHE A 1 20  ? 8.836   22.780  12.045  1.00 22.41 ? 20  PHE A CB  1 
ATOM   159  C  CG  . PHE A 1 20  ? 9.723   21.682  12.553  1.00 24.96 ? 20  PHE A CG  1 
ATOM   160  C  CD1 . PHE A 1 20  ? 10.346  21.788  13.795  1.00 24.99 ? 20  PHE A CD1 1 
ATOM   161  C  CD2 . PHE A 1 20  ? 9.931   20.525  11.794  1.00 28.19 ? 20  PHE A CD2 1 
ATOM   162  C  CE1 . PHE A 1 20  ? 11.170  20.753  14.276  1.00 30.38 ? 20  PHE A CE1 1 
ATOM   163  C  CE2 . PHE A 1 20  ? 10.743  19.495  12.266  1.00 28.45 ? 20  PHE A CE2 1 
ATOM   164  C  CZ  . PHE A 1 20  ? 11.366  19.606  13.510  1.00 27.35 ? 20  PHE A CZ  1 
ATOM   165  N  N   . GLN A 1 21  ? 6.214   24.699  12.944  1.00 20.68 ? 21  GLN A N   1 
ATOM   166  C  CA  . GLN A 1 21  ? 5.484   25.907  12.603  1.00 23.94 ? 21  GLN A CA  1 
ATOM   167  C  C   . GLN A 1 21  ? 6.177   27.098  13.247  1.00 25.72 ? 21  GLN A C   1 
ATOM   168  O  O   . GLN A 1 21  ? 6.760   26.980  14.328  1.00 23.35 ? 21  GLN A O   1 
ATOM   169  C  CB  . GLN A 1 21  ? 4.034   25.836  13.080  1.00 26.75 ? 21  GLN A CB  1 
ATOM   170  C  CG  . GLN A 1 21  ? 3.265   24.630  12.561  1.00 28.36 ? 21  GLN A CG  1 
ATOM   171  C  CD  . GLN A 1 21  ? 1.823   24.642  12.985  1.00 29.74 ? 21  GLN A CD  1 
ATOM   172  O  OE1 . GLN A 1 21  ? 1.501   24.978  14.125  1.00 26.64 ? 21  GLN A OE1 1 
ATOM   173  N  NE2 . GLN A 1 21  ? 0.940   24.239  12.087  1.00 26.03 ? 21  GLN A NE2 1 
ATOM   174  N  N   . GLY A 1 22  ? 6.144   28.244  12.572  1.00 26.77 ? 22  GLY A N   1 
ATOM   175  C  CA  . GLY A 1 22  ? 6.782   29.418  13.157  1.00 25.15 ? 22  GLY A CA  1 
ATOM   176  C  C   . GLY A 1 22  ? 8.283   29.264  13.229  1.00 23.95 ? 22  GLY A C   1 
ATOM   177  O  O   . GLY A 1 22  ? 8.905   28.760  12.296  1.00 23.83 ? 22  GLY A O   1 
ATOM   178  N  N   . ASP A 1 23  ? 8.883   29.659  14.349  1.00 23.70 ? 23  ASP A N   1 
ATOM   179  C  CA  . ASP A 1 23  ? 10.338  29.611  14.488  1.00 22.04 ? 23  ASP A CA  1 
ATOM   180  C  C   . ASP A 1 23  ? 10.944  28.336  15.031  1.00 22.31 ? 23  ASP A C   1 
ATOM   181  O  O   . ASP A 1 23  ? 12.142  28.268  15.248  1.00 24.89 ? 23  ASP A O   1 
ATOM   182  C  CB  . ASP A 1 23  ? 10.834  30.779  15.368  1.00 28.76 ? 23  ASP A CB  1 
ATOM   183  C  CG  . ASP A 1 23  ? 10.394  32.130  14.845  1.00 33.06 ? 23  ASP A CG  1 
ATOM   184  O  OD1 . ASP A 1 23  ? 10.443  32.331  13.619  1.00 34.11 ? 23  ASP A OD1 1 
ATOM   185  O  OD2 . ASP A 1 23  ? 10.021  32.997  15.655  1.00 33.48 ? 23  ASP A OD2 1 
ATOM   186  N  N   . ALA A 1 24  ? 10.138  27.304  15.234  1.00 24.44 ? 24  ALA A N   1 
ATOM   187  C  CA  . ALA A 1 24  ? 10.675  26.079  15.813  1.00 22.04 ? 24  ALA A CA  1 
ATOM   188  C  C   . ALA A 1 24  ? 11.733  25.335  14.982  1.00 22.97 ? 24  ALA A C   1 
ATOM   189  O  O   . ALA A 1 24  ? 11.574  25.156  13.783  1.00 26.00 ? 24  ALA A O   1 
ATOM   190  C  CB  . ALA A 1 24  ? 9.500   25.119  16.137  1.00 20.72 ? 24  ALA A CB  1 
ATOM   191  N  N   . GLN A 1 25  ? 12.798  24.879  15.620  1.00 24.75 ? 25  GLN A N   1 
ATOM   192  C  CA  . GLN A 1 25  ? 13.786  24.090  14.895  1.00 29.02 ? 25  GLN A CA  1 
ATOM   193  C  C   . GLN A 1 25  ? 14.639  23.214  15.809  1.00 29.94 ? 25  GLN A C   1 
ATOM   194  O  O   . GLN A 1 25  ? 14.713  23.423  17.030  1.00 29.21 ? 25  GLN A O   1 
ATOM   195  C  CB  . GLN A 1 25  ? 14.675  24.997  14.025  1.00 34.42 ? 25  GLN A CB  1 
ATOM   196  C  CG  . GLN A 1 25  ? 15.548  25.939  14.785  1.00 40.73 ? 25  GLN A CG  1 
ATOM   197  C  CD  . GLN A 1 25  ? 16.527  26.686  13.877  1.00 47.58 ? 25  GLN A CD  1 
ATOM   198  O  OE1 . GLN A 1 25  ? 17.482  27.291  14.354  1.00 51.59 ? 25  GLN A OE1 1 
ATOM   199  N  NE2 . GLN A 1 25  ? 16.284  26.651  12.568  1.00 49.52 ? 25  GLN A NE2 1 
ATOM   200  N  N   . ILE A 1 26  ? 15.261  22.204  15.218  1.00 27.34 ? 26  ILE A N   1 
ATOM   201  C  CA  . ILE A 1 26  ? 16.128  21.305  15.955  1.00 27.04 ? 26  ILE A CA  1 
ATOM   202  C  C   . ILE A 1 26  ? 17.524  21.902  16.061  1.00 32.54 ? 26  ILE A C   1 
ATOM   203  O  O   . ILE A 1 26  ? 18.067  22.399  15.073  1.00 33.13 ? 26  ILE A O   1 
ATOM   204  C  CB  . ILE A 1 26  ? 16.276  19.961  15.227  1.00 31.20 ? 26  ILE A CB  1 
ATOM   205  C  CG1 . ILE A 1 26  ? 14.902  19.316  15.038  1.00 34.67 ? 26  ILE A CG1 1 
ATOM   206  C  CG2 . ILE A 1 26  ? 17.206  19.038  16.008  1.00 27.92 ? 26  ILE A CG2 1 
ATOM   207  C  CD1 . ILE A 1 26  ? 14.278  18.909  16.299  1.00 35.00 ? 26  ILE A CD1 1 
ATOM   208  N  N   . LYS A 1 27  ? 18.102  21.849  17.256  1.00 33.44 ? 27  LYS A N   1 
ATOM   209  C  CA  . LYS A 1 27  ? 19.476  22.325  17.497  1.00 35.55 ? 27  LYS A CA  1 
ATOM   210  C  C   . LYS A 1 27  ? 20.027  21.555  18.676  1.00 34.33 ? 27  LYS A C   1 
ATOM   211  O  O   . LYS A 1 27  ? 19.366  21.424  19.708  1.00 35.53 ? 27  LYS A O   1 
ATOM   212  C  CB  . LYS A 1 27  ? 19.541  23.823  17.816  1.00 38.61 ? 27  LYS A CB  1 
ATOM   213  C  CG  . LYS A 1 27  ? 19.191  24.748  16.673  1.00 42.97 ? 27  LYS A CG  1 
ATOM   214  C  CD  . LYS A 1 27  ? 19.428  26.217  17.051  1.00 45.31 ? 27  LYS A CD  1 
ATOM   215  N  N   . ASN A 1 28  ? 21.223  21.010  18.519  1.00 33.42 ? 28  ASN A N   1 
ATOM   216  C  CA  . ASN A 1 28  ? 21.846  20.245  19.589  1.00 35.32 ? 28  ASN A CA  1 
ATOM   217  C  C   . ASN A 1 28  ? 20.961  19.102  20.119  1.00 33.73 ? 28  ASN A C   1 
ATOM   218  O  O   . ASN A 1 28  ? 20.897  18.874  21.324  1.00 32.85 ? 28  ASN A O   1 
ATOM   219  C  CB  . ASN A 1 28  ? 22.216  21.172  20.751  1.00 41.15 ? 28  ASN A CB  1 
ATOM   220  N  N   . ASN A 1 29  ? 20.278  18.400  19.219  1.00 30.46 ? 29  ASN A N   1 
ATOM   221  C  CA  . ASN A 1 29  ? 19.435  17.269  19.604  1.00 31.24 ? 29  ASN A CA  1 
ATOM   222  C  C   . ASN A 1 29  ? 18.253  17.550  20.523  1.00 25.31 ? 29  ASN A C   1 
ATOM   223  O  O   . ASN A 1 29  ? 17.768  16.658  21.242  1.00 26.44 ? 29  ASN A O   1 
ATOM   224  C  CB  . ASN A 1 29  ? 20.300  16.155  20.185  1.00 37.43 ? 29  ASN A CB  1 
ATOM   225  C  CG  . ASN A 1 29  ? 21.022  15.389  19.101  1.00 43.18 ? 29  ASN A CG  1 
ATOM   226  O  OD1 . ASN A 1 29  ? 21.804  15.959  18.349  1.00 49.55 ? 29  ASN A OD1 1 
ATOM   227  N  ND2 . ASN A 1 29  ? 20.734  14.098  18.990  1.00 49.66 ? 29  ASN A ND2 1 
ATOM   228  N  N   . ALA A 1 30  ? 17.772  18.784  20.451  1.00 24.76 ? 30  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 30  ? 16.625  19.216  21.236  1.00 24.29 ? 30  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 30  ? 15.848  20.107  20.321  1.00 22.78 ? 30  ALA A C   1 
ATOM   231  O  O   . ALA A 1 30  ? 16.391  20.615  19.348  1.00 25.91 ? 30  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 30  ? 17.079  20.003  22.456  1.00 26.94 ? 30  ALA A CB  1 
ATOM   233  N  N   . VAL A 1 31  ? 14.564  20.282  20.596  1.00 19.65 ? 31  VAL A N   1 
ATOM   234  C  CA  . VAL A 1 31  ? 13.761  21.183  19.790  1.00 19.09 ? 31  VAL A CA  1 
ATOM   235  C  C   . VAL A 1 31  ? 13.808  22.570  20.457  1.00 23.83 ? 31  VAL A C   1 
ATOM   236  O  O   . VAL A 1 31  ? 13.498  22.705  21.657  1.00 23.01 ? 31  VAL A O   1 
ATOM   237  C  CB  . VAL A 1 31  ? 12.269  20.741  19.722  1.00 23.60 ? 31  VAL A CB  1 
ATOM   238  C  CG1 . VAL A 1 31  ? 11.438  21.773  18.971  1.00 24.86 ? 31  VAL A CG1 1 
ATOM   239  C  CG2 . VAL A 1 31  ? 12.152  19.368  19.039  1.00 24.69 ? 31  VAL A CG2 1 
ATOM   240  N  N   . GLN A 1 32  ? 14.227  23.583  19.704  1.00 19.66 ? 32  GLN A N   1 
ATOM   241  C  CA  . GLN A 1 32  ? 14.230  24.965  20.223  1.00 23.30 ? 32  GLN A CA  1 
ATOM   242  C  C   . GLN A 1 32  ? 12.953  25.549  19.665  1.00 22.39 ? 32  GLN A C   1 
ATOM   243  O  O   . GLN A 1 32  ? 12.867  25.850  18.471  1.00 24.76 ? 32  GLN A O   1 
ATOM   244  C  CB  . GLN A 1 32  ? 15.412  25.786  19.692  1.00 26.23 ? 32  GLN A CB  1 
ATOM   245  C  CG  . GLN A 1 32  ? 16.753  25.326  20.132  1.00 31.32 ? 32  GLN A CG  1 
ATOM   246  C  CD  . GLN A 1 32  ? 16.903  25.257  21.640  1.00 37.08 ? 32  GLN A CD  1 
ATOM   247  O  OE1 . GLN A 1 32  ? 16.332  26.066  22.385  1.00 33.86 ? 32  GLN A OE1 1 
ATOM   248  N  NE2 . GLN A 1 32  ? 17.700  24.295  22.100  1.00 42.21 ? 32  GLN A NE2 1 
ATOM   249  N  N   . LEU A 1 33  ? 11.942  25.710  20.519  1.00 19.78 ? 33  LEU A N   1 
ATOM   250  C  CA  . LEU A 1 33  ? 10.675  26.202  20.056  1.00 20.67 ? 33  LEU A CA  1 
ATOM   251  C  C   . LEU A 1 33  ? 10.676  27.655  19.644  1.00 23.89 ? 33  LEU A C   1 
ATOM   252  O  O   . LEU A 1 33  ? 9.992   28.014  18.701  1.00 25.57 ? 33  LEU A O   1 
ATOM   253  C  CB  . LEU A 1 33  ? 9.597   25.974  21.108  1.00 22.46 ? 33  LEU A CB  1 
ATOM   254  C  CG  . LEU A 1 33  ? 9.171   24.510  21.281  1.00 21.66 ? 33  LEU A CG  1 
ATOM   255  C  CD1 . LEU A 1 33  ? 8.362   24.398  22.560  1.00 25.57 ? 33  LEU A CD1 1 
ATOM   256  C  CD2 . LEU A 1 33  ? 8.363   24.044  20.088  1.00 23.87 ? 33  LEU A CD2 1 
ATOM   257  N  N   . THR A 1 34  ? 11.438  28.479  20.363  1.00 23.97 ? 34  THR A N   1 
ATOM   258  C  CA  . THR A 1 34  ? 11.519  29.912  20.064  1.00 21.54 ? 34  THR A CA  1 
ATOM   259  C  C   . THR A 1 34  ? 12.909  30.241  19.516  1.00 22.32 ? 34  THR A C   1 
ATOM   260  O  O   . THR A 1 34  ? 13.907  29.592  19.846  1.00 25.23 ? 34  THR A O   1 
ATOM   261  C  CB  . THR A 1 34  ? 11.236  30.781  21.333  1.00 17.71 ? 34  THR A CB  1 
ATOM   262  O  OG1 . THR A 1 34  ? 11.939  30.228  22.452  1.00 21.65 ? 34  THR A OG1 1 
ATOM   263  C  CG2 . THR A 1 34  ? 9.733   30.847  21.625  1.00 18.25 ? 34  THR A CG2 1 
ATOM   264  N  N   . LYS A 1 35  ? 12.963  31.279  18.694  1.00 24.19 ? 35  LYS A N   1 
ATOM   265  C  CA  . LYS A 1 35  ? 14.206  31.684  18.039  1.00 29.49 ? 35  LYS A CA  1 
ATOM   266  C  C   . LYS A 1 35  ? 15.397  32.029  18.933  1.00 34.00 ? 35  LYS A C   1 
ATOM   267  O  O   . LYS A 1 35  ? 15.240  32.567  20.033  1.00 34.25 ? 35  LYS A O   1 
ATOM   268  C  CB  . LYS A 1 35  ? 13.901  32.857  17.108  1.00 29.16 ? 35  LYS A CB  1 
ATOM   269  C  CG  . LYS A 1 35  ? 15.093  33.296  16.262  1.00 37.87 ? 35  LYS A CG  1 
ATOM   270  C  CD  . LYS A 1 35  ? 14.703  34.448  15.343  1.00 37.82 ? 35  LYS A CD  1 
ATOM   271  N  N   . THR A 1 36  ? 16.592  31.680  18.461  1.00 34.04 ? 36  THR A N   1 
ATOM   272  C  CA  . THR A 1 36  ? 17.820  32.003  19.178  1.00 38.66 ? 36  THR A CA  1 
ATOM   273  C  C   . THR A 1 36  ? 18.768  32.645  18.171  1.00 41.52 ? 36  THR A C   1 
ATOM   274  O  O   . THR A 1 36  ? 18.669  32.393  16.970  1.00 41.99 ? 36  THR A O   1 
ATOM   275  C  CB  . THR A 1 36  ? 18.485  30.754  19.790  1.00 39.93 ? 36  THR A CB  1 
ATOM   276  O  OG1 . THR A 1 36  ? 18.671  29.763  18.768  1.00 44.75 ? 36  THR A OG1 1 
ATOM   277  C  CG2 . THR A 1 36  ? 17.619  30.181  20.920  1.00 38.65 ? 36  THR A CG2 1 
ATOM   278  N  N   . ASP A 1 37  ? 19.676  33.490  18.647  1.00 41.93 ? 37  ASP A N   1 
ATOM   279  C  CA  . ASP A 1 37  ? 20.624  34.159  17.733  1.00 44.72 ? 37  ASP A CA  1 
ATOM   280  C  C   . ASP A 1 37  ? 21.779  33.250  17.366  1.00 44.96 ? 37  ASP A C   1 
ATOM   281  O  O   . ASP A 1 37  ? 21.833  32.078  17.814  1.00 43.68 ? 37  ASP A O   1 
ATOM   282  C  CB  . ASP A 1 37  ? 21.193  35.453  18.343  1.00 40.64 ? 37  ASP A CB  1 
ATOM   283  C  CG  . ASP A 1 37  ? 22.048  35.220  19.586  1.00 38.84 ? 37  ASP A CG  1 
ATOM   284  O  OD1 . ASP A 1 37  ? 22.666  34.150  19.781  1.00 43.19 ? 37  ASP A OD1 1 
ATOM   285  O  OD2 . ASP A 1 37  ? 22.123  36.242  20.436  1.00 43.37 ? 37  ASP A OD2 1 
ATOM   286  N  N   . SER A 1 38  ? 22.712  33.776  16.568  1.00 46.61 ? 38  SER A N   1 
ATOM   287  C  CA  . SER A 1 38  ? 23.891  33.023  16.144  1.00 49.22 ? 38  SER A CA  1 
ATOM   288  C  C   . SER A 1 38  ? 24.630  32.428  17.345  1.00 51.34 ? 38  SER A C   1 
ATOM   289  O  O   . SER A 1 38  ? 25.065  31.272  17.305  1.00 53.61 ? 38  SER A O   1 
ATOM   290  C  CB  . SER A 1 38  ? 24.844  33.932  15.357  1.00 49.94 ? 38  SER A CB  1 
ATOM   291  N  N   . ASN A 1 39  ? 24.762  33.223  18.408  1.00 51.50 ? 39  ASN A N   1 
ATOM   292  C  CA  . ASN A 1 39  ? 25.442  32.789  19.625  1.00 51.38 ? 39  ASN A CA  1 
ATOM   293  C  C   . ASN A 1 39  ? 24.582  31.833  20.475  1.00 51.32 ? 39  ASN A C   1 
ATOM   294  O  O   . ASN A 1 39  ? 25.067  31.253  21.448  1.00 51.48 ? 39  ASN A O   1 
ATOM   295  C  CB  . ASN A 1 39  ? 25.844  34.015  20.455  1.00 50.46 ? 39  ASN A CB  1 
ATOM   296  N  N   . GLY A 1 40  ? 23.305  31.686  20.115  1.00 50.85 ? 40  GLY A N   1 
ATOM   297  C  CA  . GLY A 1 40  ? 22.420  30.779  20.840  1.00 47.36 ? 40  GLY A CA  1 
ATOM   298  C  C   . GLY A 1 40  ? 21.677  31.377  22.025  1.00 46.93 ? 40  GLY A C   1 
ATOM   299  O  O   . GLY A 1 40  ? 21.237  30.664  22.930  1.00 45.53 ? 40  GLY A O   1 
ATOM   300  N  N   . ASN A 1 41  ? 21.527  32.695  22.021  1.00 42.95 ? 41  ASN A N   1 
ATOM   301  C  CA  . ASN A 1 41  ? 20.844  33.361  23.110  1.00 42.84 ? 41  ASN A CA  1 
ATOM   302  C  C   . ASN A 1 41  ? 19.447  33.623  22.623  1.00 39.42 ? 41  ASN A C   1 
ATOM   303  O  O   . ASN A 1 41  ? 19.236  33.816  21.408  1.00 39.22 ? 41  ASN A O   1 
ATOM   304  C  CB  . ASN A 1 41  ? 21.511  34.699  23.449  1.00 41.22 ? 41  ASN A CB  1 
ATOM   305  N  N   . PRO A 1 42  ? 18.466  33.635  23.538  1.00 37.08 ? 42  PRO A N   1 
ATOM   306  C  CA  . PRO A 1 42  ? 17.072  33.881  23.171  1.00 34.97 ? 42  PRO A CA  1 
ATOM   307  C  C   . PRO A 1 42  ? 16.860  35.317  22.686  1.00 33.64 ? 42  PRO A C   1 
ATOM   308  O  O   . PRO A 1 42  ? 17.559  36.231  23.135  1.00 34.06 ? 42  PRO A O   1 
ATOM   309  C  CB  . PRO A 1 42  ? 16.337  33.602  24.475  1.00 33.26 ? 42  PRO A CB  1 
ATOM   310  C  CG  . PRO A 1 42  ? 17.353  34.089  25.503  1.00 33.95 ? 42  PRO A CG  1 
ATOM   311  C  CD  . PRO A 1 42  ? 18.576  33.385  24.985  1.00 34.27 ? 42  PRO A CD  1 
ATOM   312  N  N   . VAL A 1 43  ? 15.901  35.506  21.782  1.00 31.29 ? 43  VAL A N   1 
ATOM   313  C  CA  . VAL A 1 43  ? 15.580  36.828  21.260  1.00 31.65 ? 43  VAL A CA  1 
ATOM   314  C  C   . VAL A 1 43  ? 14.099  37.131  21.466  1.00 32.01 ? 43  VAL A C   1 
ATOM   315  O  O   . VAL A 1 43  ? 13.278  36.226  21.665  1.00 31.72 ? 43  VAL A O   1 
ATOM   316  C  CB  . VAL A 1 43  ? 15.915  36.958  19.737  1.00 35.75 ? 43  VAL A CB  1 
ATOM   317  C  CG1 . VAL A 1 43  ? 17.342  36.520  19.474  1.00 38.34 ? 43  VAL A CG1 1 
ATOM   318  C  CG2 . VAL A 1 43  ? 14.945  36.155  18.902  1.00 36.87 ? 43  VAL A CG2 1 
ATOM   319  N  N   . ALA A 1 44  ? 13.755  38.409  21.414  1.00 31.78 ? 44  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 44  ? 12.367  38.829  21.593  1.00 31.77 ? 44  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 44  ? 11.515  38.546  20.368  1.00 31.96 ? 44  ALA A C   1 
ATOM   322  O  O   . ALA A 1 44  ? 12.031  38.262  19.286  1.00 33.13 ? 44  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 44  ? 12.308  40.318  21.903  1.00 34.93 ? 44  ALA A CB  1 
ATOM   324  N  N   . SER A 1 45  ? 10.205  38.608  20.581  1.00 31.34 ? 45  SER A N   1 
ATOM   325  C  CA  . SER A 1 45  ? 9.195   38.462  19.555  1.00 30.30 ? 45  SER A CA  1 
ATOM   326  C  C   . SER A 1 45  ? 9.363   37.222  18.679  1.00 31.34 ? 45  SER A C   1 
ATOM   327  O  O   . SER A 1 45  ? 9.747   37.313  17.510  1.00 29.64 ? 45  SER A O   1 
ATOM   328  C  CB  . SER A 1 45  ? 9.198   39.751  18.723  1.00 34.94 ? 45  SER A CB  1 
ATOM   329  O  OG  . SER A 1 45  ? 8.094   39.821  17.842  1.00 43.61 ? 45  SER A OG  1 
ATOM   330  N  N   . THR A 1 46  ? 9.064   36.053  19.241  1.00 26.95 ? 46  THR A N   1 
ATOM   331  C  CA  . THR A 1 46  ? 9.209   34.813  18.487  1.00 25.62 ? 46  THR A CA  1 
ATOM   332  C  C   . THR A 1 46  ? 8.146   33.811  18.943  1.00 25.01 ? 46  THR A C   1 
ATOM   333  O  O   . THR A 1 46  ? 7.741   33.805  20.121  1.00 24.37 ? 46  THR A O   1 
ATOM   334  C  CB  . THR A 1 46  ? 10.648  34.233  18.677  1.00 26.03 ? 46  THR A CB  1 
ATOM   335  O  OG1 . THR A 1 46  ? 10.731  32.906  18.126  1.00 30.19 ? 46  THR A OG1 1 
ATOM   336  C  CG2 . THR A 1 46  ? 11.031  34.218  20.136  1.00 27.49 ? 46  THR A CG2 1 
ATOM   337  N  N   . VAL A 1 47  ? 7.640   33.024  18.002  1.00 23.55 ? 47  VAL A N   1 
ATOM   338  C  CA  . VAL A 1 47  ? 6.653   32.001  18.319  1.00 25.17 ? 47  VAL A CA  1 
ATOM   339  C  C   . VAL A 1 47  ? 7.057   30.745  17.543  1.00 24.03 ? 47  VAL A C   1 
ATOM   340  O  O   . VAL A 1 47  ? 7.508   30.838  16.404  1.00 25.74 ? 47  VAL A O   1 
ATOM   341  C  CB  . VAL A 1 47  ? 5.228   32.384  17.874  1.00 27.67 ? 47  VAL A CB  1 
ATOM   342  C  CG1 . VAL A 1 47  ? 4.250   31.269  18.276  1.00 28.43 ? 47  VAL A CG1 1 
ATOM   343  C  CG2 . VAL A 1 47  ? 4.813   33.712  18.485  1.00 33.25 ? 47  VAL A CG2 1 
ATOM   344  N  N   . GLY A 1 48  ? 6.896   29.579  18.152  1.00 20.70 ? 48  GLY A N   1 
ATOM   345  C  CA  . GLY A 1 48  ? 7.234   28.350  17.444  1.00 22.78 ? 48  GLY A CA  1 
ATOM   346  C  C   . GLY A 1 48  ? 6.424   27.208  18.016  1.00 22.67 ? 48  GLY A C   1 
ATOM   347  O  O   . GLY A 1 48  ? 6.081   27.251  19.212  1.00 20.05 ? 48  GLY A O   1 
ATOM   348  N  N   . ARG A 1 49  ? 6.089   26.208  17.181  1.00 19.06 ? 49  ARG A N   1 
ATOM   349  C  CA  . ARG A 1 49  ? 5.310   25.056  17.671  1.00 19.21 ? 49  ARG A CA  1 
ATOM   350  C  C   . ARG A 1 49  ? 5.719   23.829  16.868  1.00 19.40 ? 49  ARG A C   1 
ATOM   351  O  O   . ARG A 1 49  ? 6.329   23.954  15.798  1.00 19.25 ? 49  ARG A O   1 
ATOM   352  C  CB  . ARG A 1 49  ? 3.787   25.248  17.451  1.00 18.51 ? 49  ARG A CB  1 
ATOM   353  C  CG  . ARG A 1 49  ? 3.257   26.703  17.612  1.00 19.22 ? 49  ARG A CG  1 
ATOM   354  C  CD  . ARG A 1 49  ? 1.765   26.791  17.800  1.00 20.16 ? 49  ARG A CD  1 
ATOM   355  N  NE  . ARG A 1 49  ? 1.010   26.186  16.695  1.00 19.77 ? 49  ARG A NE  1 
ATOM   356  C  CZ  . ARG A 1 49  ? -0.318  26.196  16.603  1.00 24.42 ? 49  ARG A CZ  1 
ATOM   357  N  NH1 . ARG A 1 49  ? -1.042  26.785  17.542  1.00 24.74 ? 49  ARG A NH1 1 
ATOM   358  N  NH2 . ARG A 1 49  ? -0.935  25.555  15.601  1.00 25.26 ? 49  ARG A NH2 1 
ATOM   359  N  N   . ILE A 1 50  ? 5.427   22.643  17.404  1.00 17.68 ? 50  ILE A N   1 
ATOM   360  C  CA  . ILE A 1 50  ? 5.674   21.404  16.648  1.00 18.73 ? 50  ILE A CA  1 
ATOM   361  C  C   . ILE A 1 50  ? 4.471   20.512  16.902  1.00 21.45 ? 50  ILE A C   1 
ATOM   362  O  O   . ILE A 1 50  ? 3.831   20.587  17.959  1.00 20.58 ? 50  ILE A O   1 
ATOM   363  C  CB  . ILE A 1 50  ? 6.956   20.594  17.066  1.00 21.06 ? 50  ILE A CB  1 
ATOM   364  C  CG1 . ILE A 1 50  ? 6.910   20.240  18.556  1.00 20.70 ? 50  ILE A CG1 1 
ATOM   365  C  CG2 . ILE A 1 50  ? 8.246   21.348  16.656  1.00 18.02 ? 50  ILE A CG2 1 
ATOM   366  C  CD1 . ILE A 1 50  ? 7.900   19.141  18.940  1.00 32.40 ? 50  ILE A CD1 1 
ATOM   367  N  N   . LEU A 1 51  ? 4.140   19.679  15.923  1.00 18.98 ? 51  LEU A N   1 
ATOM   368  C  CA  . LEU A 1 51  ? 3.019   18.758  16.083  1.00 19.05 ? 51  LEU A CA  1 
ATOM   369  C  C   . LEU A 1 51  ? 3.498   17.423  15.525  1.00 20.01 ? 51  LEU A C   1 
ATOM   370  O  O   . LEU A 1 51  ? 4.277   17.385  14.562  1.00 19.86 ? 51  LEU A O   1 
ATOM   371  C  CB  . LEU A 1 51  ? 1.820   19.200  15.244  1.00 23.65 ? 51  LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 51  ? 1.109   20.518  15.569  1.00 30.27 ? 51  LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 51  ? 0.324   20.973  14.345  1.00 35.68 ? 51  LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 51  ? 0.202   20.320  16.764  1.00 30.65 ? 51  LEU A CD2 1 
ATOM   375  N  N   . PHE A 1 52  ? 3.066   16.327  16.129  1.00 17.26 ? 52  PHE A N   1 
ATOM   376  C  CA  . PHE A 1 52  ? 3.442   15.048  15.537  1.00 17.59 ? 52  PHE A CA  1 
ATOM   377  C  C   . PHE A 1 52  ? 2.530   14.913  14.299  1.00 15.93 ? 52  PHE A C   1 
ATOM   378  O  O   . PHE A 1 52  ? 1.360   15.306  14.321  1.00 18.39 ? 52  PHE A O   1 
ATOM   379  C  CB  . PHE A 1 52  ? 3.176   13.901  16.511  1.00 15.12 ? 52  PHE A CB  1 
ATOM   380  C  CG  . PHE A 1 52  ? 3.696   12.588  16.018  1.00 16.37 ? 52  PHE A CG  1 
ATOM   381  C  CD1 . PHE A 1 52  ? 5.059   12.391  15.909  1.00 16.14 ? 52  PHE A CD1 1 
ATOM   382  C  CD2 . PHE A 1 52  ? 2.825   11.556  15.698  1.00 18.73 ? 52  PHE A CD2 1 
ATOM   383  C  CE1 . PHE A 1 52  ? 5.580   11.171  15.493  1.00 21.03 ? 52  PHE A CE1 1 
ATOM   384  C  CE2 . PHE A 1 52  ? 3.335   10.307  15.275  1.00 17.99 ? 52  PHE A CE2 1 
ATOM   385  C  CZ  . PHE A 1 52  ? 4.714   10.121  15.177  1.00 20.03 ? 52  PHE A CZ  1 
ATOM   386  N  N   . SER A 1 53  ? 3.040   14.322  13.219  1.00 16.58 ? 53  SER A N   1 
ATOM   387  C  CA  . SER A 1 53  ? 2.233   14.272  12.005  1.00 16.64 ? 53  SER A CA  1 
ATOM   388  C  C   . SER A 1 53  ? 1.034   13.334  11.989  1.00 17.23 ? 53  SER A C   1 
ATOM   389  O  O   . SER A 1 53  ? -0.008  13.699  11.441  1.00 21.95 ? 53  SER A O   1 
ATOM   390  C  CB  . SER A 1 53  ? 3.120   13.989  10.791  1.00 22.19 ? 53  SER A CB  1 
ATOM   391  O  OG  . SER A 1 53  ? 3.726   12.732  10.923  1.00 25.75 ? 53  SER A OG  1 
ATOM   392  N  N   . ALA A 1 54  ? 1.136   12.152  12.595  1.00 16.04 ? 54  ALA A N   1 
ATOM   393  C  CA  . ALA A 1 54  ? -0.021  11.263  12.572  1.00 18.20 ? 54  ALA A CA  1 
ATOM   394  C  C   . ALA A 1 54  ? -1.076  11.813  13.512  1.00 21.24 ? 54  ALA A C   1 
ATOM   395  O  O   . ALA A 1 54  ? -0.764  12.344  14.619  1.00 22.00 ? 54  ALA A O   1 
ATOM   396  C  CB  . ALA A 1 54  ? 0.372   9.831   13.002  1.00 18.75 ? 54  ALA A CB  1 
ATOM   397  N  N   . GLN A 1 55  ? -2.320  11.695  13.082  1.00 17.94 ? 55  GLN A N   1 
ATOM   398  C  CA  . GLN A 1 55  ? -3.444  12.139  13.875  1.00 17.48 ? 55  GLN A CA  1 
ATOM   399  C  C   . GLN A 1 55  ? -3.783  11.112  14.937  1.00 19.59 ? 55  GLN A C   1 
ATOM   400  O  O   . GLN A 1 55  ? -3.640  9.910   14.736  1.00 19.17 ? 55  GLN A O   1 
ATOM   401  C  CB  . GLN A 1 55  ? -4.647  12.396  12.966  1.00 16.62 ? 55  GLN A CB  1 
ATOM   402  C  CG  . GLN A 1 55  ? -4.309  13.406  11.854  1.00 23.27 ? 55  GLN A CG  1 
ATOM   403  C  CD  . GLN A 1 55  ? -5.530  13.811  11.012  1.00 23.70 ? 55  GLN A CD  1 
ATOM   404  O  OE1 . GLN A 1 55  ? -5.381  14.143  9.840   1.00 31.53 ? 55  GLN A OE1 1 
ATOM   405  N  NE2 . GLN A 1 55  ? -6.713  13.799  11.606  1.00 22.68 ? 55  GLN A NE2 1 
ATOM   406  N  N   . VAL A 1 56  ? -4.231  11.600  16.083  1.00 18.85 ? 56  VAL A N   1 
ATOM   407  C  CA  . VAL A 1 56  ? -4.588  10.749  17.211  1.00 20.18 ? 56  VAL A CA  1 
ATOM   408  C  C   . VAL A 1 56  ? -6.093  10.596  17.281  1.00 19.86 ? 56  VAL A C   1 
ATOM   409  O  O   . VAL A 1 56  ? -6.828  11.591  17.210  1.00 18.88 ? 56  VAL A O   1 
ATOM   410  C  CB  . VAL A 1 56  ? -4.078  11.388  18.547  1.00 19.36 ? 56  VAL A CB  1 
ATOM   411  C  CG1 . VAL A 1 56  ? -4.503  10.544  19.728  1.00 22.22 ? 56  VAL A CG1 1 
ATOM   412  C  CG2 . VAL A 1 56  ? -2.560  11.521  18.505  1.00 21.50 ? 56  VAL A CG2 1 
ATOM   413  N  N   . HIS A 1 57  ? -6.562  9.357   17.436  1.00 18.73 ? 57  HIS A N   1 
ATOM   414  C  CA  . HIS A 1 57  ? -8.002  9.135   17.527  1.00 17.55 ? 57  HIS A CA  1 
ATOM   415  C  C   . HIS A 1 57  ? -8.360  9.260   19.014  1.00 19.87 ? 57  HIS A C   1 
ATOM   416  O  O   . HIS A 1 57  ? -8.218  8.310   19.798  1.00 20.03 ? 57  HIS A O   1 
ATOM   417  C  CB  . HIS A 1 57  ? -8.353  7.740   17.000  1.00 22.14 ? 57  HIS A CB  1 
ATOM   418  C  CG  . HIS A 1 57  ? -9.774  7.618   16.570  1.00 23.74 ? 57  HIS A CG  1 
ATOM   419  N  ND1 . HIS A 1 57  ? -10.313 6.438   16.099  1.00 29.39 ? 57  HIS A ND1 1 
ATOM   420  C  CD2 . HIS A 1 57  ? -10.775 8.528   16.547  1.00 25.99 ? 57  HIS A CD2 1 
ATOM   421  C  CE1 . HIS A 1 57  ? -11.588 6.629   15.804  1.00 29.27 ? 57  HIS A CE1 1 
ATOM   422  N  NE2 . HIS A 1 57  ? -11.894 7.887   16.067  1.00 30.63 ? 57  HIS A NE2 1 
ATOM   423  N  N   . LEU A 1 58  ? -8.795  10.454  19.393  1.00 21.74 ? 58  LEU A N   1 
ATOM   424  C  CA  . LEU A 1 58  ? -9.120  10.790  20.784  1.00 20.24 ? 58  LEU A CA  1 
ATOM   425  C  C   . LEU A 1 58  ? -10.430 10.196  21.285  1.00 20.10 ? 58  LEU A C   1 
ATOM   426  O  O   . LEU A 1 58  ? -10.557 9.829   22.464  1.00 20.95 ? 58  LEU A O   1 
ATOM   427  C  CB  . LEU A 1 58  ? -9.158  12.325  20.916  1.00 21.69 ? 58  LEU A CB  1 
ATOM   428  C  CG  . LEU A 1 58  ? -9.401  12.846  22.322  1.00 21.05 ? 58  LEU A CG  1 
ATOM   429  C  CD1 . LEU A 1 58  ? -8.217  12.460  23.196  1.00 25.18 ? 58  LEU A CD1 1 
ATOM   430  C  CD2 . LEU A 1 58  ? -9.556  14.357  22.267  1.00 29.37 ? 58  LEU A CD2 1 
ATOM   431  N  N   . TRP A 1 59  ? -11.433 10.144  20.414  1.00 22.10 ? 59  TRP A N   1 
ATOM   432  C  CA  . TRP A 1 59  ? -12.696 9.519   20.803  1.00 22.96 ? 59  TRP A CA  1 
ATOM   433  C  C   . TRP A 1 59  ? -13.421 9.045   19.544  1.00 25.46 ? 59  TRP A C   1 
ATOM   434  O  O   . TRP A 1 59  ? -13.135 9.489   18.431  1.00 24.39 ? 59  TRP A O   1 
ATOM   435  C  CB  . TRP A 1 59  ? -13.595 10.434  21.678  1.00 23.35 ? 59  TRP A CB  1 
ATOM   436  C  CG  . TRP A 1 59  ? -14.035 11.726  21.098  1.00 20.64 ? 59  TRP A CG  1 
ATOM   437  C  CD1 . TRP A 1 59  ? -13.303 12.868  20.990  1.00 23.99 ? 59  TRP A CD1 1 
ATOM   438  C  CD2 . TRP A 1 59  ? -15.343 12.039  20.584  1.00 28.05 ? 59  TRP A CD2 1 
ATOM   439  N  NE1 . TRP A 1 59  ? -14.069 13.880  20.447  1.00 21.87 ? 59  TRP A NE1 1 
ATOM   440  C  CE2 . TRP A 1 59  ? -15.323 13.396  20.187  1.00 26.99 ? 59  TRP A CE2 1 
ATOM   441  C  CE3 . TRP A 1 59  ? -16.526 11.301  20.421  1.00 31.52 ? 59  TRP A CE3 1 
ATOM   442  C  CZ2 . TRP A 1 59  ? -16.442 14.039  19.635  1.00 30.65 ? 59  TRP A CZ2 1 
ATOM   443  C  CZ3 . TRP A 1 59  ? -17.649 11.943  19.869  1.00 32.48 ? 59  TRP A CZ3 1 
ATOM   444  C  CH2 . TRP A 1 59  ? -17.596 13.293  19.485  1.00 36.42 ? 59  TRP A CH2 1 
ATOM   445  N  N   . GLU A 1 60  ? -14.328 8.093   19.731  1.00 29.98 ? 60  GLU A N   1 
ATOM   446  C  CA  . GLU A 1 60  ? -15.030 7.505   18.602  1.00 32.31 ? 60  GLU A CA  1 
ATOM   447  C  C   . GLU A 1 60  ? -16.504 7.444   18.959  1.00 34.27 ? 60  GLU A C   1 
ATOM   448  O  O   . GLU A 1 60  ? -16.908 6.728   19.880  1.00 35.38 ? 60  GLU A O   1 
ATOM   449  C  CB  . GLU A 1 60  ? -14.461 6.101   18.348  1.00 32.15 ? 60  GLU A CB  1 
ATOM   450  C  CG  . GLU A 1 60  ? -15.000 5.382   17.111  1.00 34.89 ? 60  GLU A CG  1 
ATOM   451  C  CD  . GLU A 1 60  ? -14.321 4.034   16.900  1.00 36.01 ? 60  GLU A CD  1 
ATOM   452  O  OE1 . GLU A 1 60  ? -14.513 3.133   17.745  1.00 40.54 ? 60  GLU A OE1 1 
ATOM   453  O  OE2 . GLU A 1 60  ? -13.587 3.880   15.899  1.00 40.50 ? 60  GLU A OE2 1 
ATOM   454  N  N   . LYS A 1 61  ? -17.287 8.230   18.238  1.00 37.46 ? 61  LYS A N   1 
ATOM   455  C  CA  . LYS A 1 61  ? -18.726 8.299   18.457  1.00 41.97 ? 61  LYS A CA  1 
ATOM   456  C  C   . LYS A 1 61  ? -19.430 6.952   18.212  1.00 41.56 ? 61  LYS A C   1 
ATOM   457  O  O   . LYS A 1 61  ? -20.163 6.464   19.071  1.00 44.38 ? 61  LYS A O   1 
ATOM   458  C  CB  . LYS A 1 61  ? -19.323 9.378   17.553  1.00 42.52 ? 61  LYS A CB  1 
ATOM   459  C  CG  . LYS A 1 61  ? -20.803 9.636   17.807  1.00 46.42 ? 61  LYS A CG  1 
ATOM   460  C  CD  . LYS A 1 61  ? -21.276 10.828  17.006  1.00 44.77 ? 61  LYS A CD  1 
ATOM   461  N  N   . SER A 1 62  ? -19.183 6.338   17.063  1.00 43.96 ? 62  SER A N   1 
ATOM   462  C  CA  . SER A 1 62  ? -19.826 5.061   16.741  1.00 45.51 ? 62  SER A CA  1 
ATOM   463  C  C   . SER A 1 62  ? -19.731 3.994   17.834  1.00 47.22 ? 62  SER A C   1 
ATOM   464  O  O   . SER A 1 62  ? -20.642 3.165   17.963  1.00 48.45 ? 62  SER A O   1 
ATOM   465  C  CB  . SER A 1 62  ? -19.250 4.474   15.458  1.00 44.40 ? 62  SER A CB  1 
ATOM   466  O  OG  . SER A 1 62  ? -17.985 3.883   15.710  1.00 47.39 ? 62  SER A OG  1 
ATOM   467  N  N   . SER A 1 63  ? -18.651 3.994   18.618  1.00 45.18 ? 63  SER A N   1 
ATOM   468  C  CA  . SER A 1 63  ? -18.493 2.980   19.664  1.00 43.74 ? 63  SER A CA  1 
ATOM   469  C  C   . SER A 1 63  ? -18.551 3.522   21.072  1.00 44.47 ? 63  SER A C   1 
ATOM   470  O  O   . SER A 1 63  ? -18.417 2.753   22.028  1.00 45.81 ? 63  SER A O   1 
ATOM   471  C  CB  . SER A 1 63  ? -17.162 2.232   19.506  1.00 48.04 ? 63  SER A CB  1 
ATOM   472  O  OG  . SER A 1 63  ? -16.051 3.090   19.740  1.00 46.96 ? 63  SER A OG  1 
ATOM   473  N  N   . SER A 1 64  ? -18.735 4.835   21.206  1.00 42.94 ? 64  SER A N   1 
ATOM   474  C  CA  . SER A 1 64  ? -18.785 5.493   22.508  1.00 41.28 ? 64  SER A CA  1 
ATOM   475  C  C   . SER A 1 64  ? -17.469 5.281   23.299  1.00 37.28 ? 64  SER A C   1 
ATOM   476  O  O   . SER A 1 64  ? -17.459 5.175   24.521  1.00 35.71 ? 64  SER A O   1 
ATOM   477  C  CB  . SER A 1 64  ? -19.979 4.960   23.310  1.00 47.08 ? 64  SER A CB  1 
ATOM   478  O  OG  . SER A 1 64  ? -20.226 5.757   24.462  1.00 50.95 ? 64  SER A OG  1 
ATOM   479  N  N   . ARG A 1 65  ? -16.351 5.193   22.591  1.00 32.31 ? 65  ARG A N   1 
ATOM   480  C  CA  . ARG A 1 65  ? -15.086 5.005   23.275  1.00 27.47 ? 65  ARG A CA  1 
ATOM   481  C  C   . ARG A 1 65  ? -14.339 6.325   23.384  1.00 23.79 ? 65  ARG A C   1 
ATOM   482  O  O   . ARG A 1 65  ? -14.537 7.212   22.573  1.00 23.07 ? 65  ARG A O   1 
ATOM   483  C  CB  . ARG A 1 65  ? -14.226 3.968   22.535  1.00 30.37 ? 65  ARG A CB  1 
ATOM   484  C  CG  . ARG A 1 65  ? -14.743 2.540   22.698  1.00 25.81 ? 65  ARG A CG  1 
ATOM   485  C  CD  . ARG A 1 65  ? -13.766 1.524   22.068  1.00 27.90 ? 65  ARG A CD  1 
ATOM   486  N  NE  . ARG A 1 65  ? -13.606 1.713   20.631  1.00 27.22 ? 65  ARG A NE  1 
ATOM   487  C  CZ  . ARG A 1 65  ? -12.615 1.155   19.938  1.00 29.65 ? 65  ARG A CZ  1 
ATOM   488  N  NH1 . ARG A 1 65  ? -11.732 0.394   20.573  1.00 27.71 ? 65  ARG A NH1 1 
ATOM   489  N  NH2 . ARG A 1 65  ? -12.487 1.374   18.640  1.00 29.12 ? 65  ARG A NH2 1 
ATOM   490  N  N   . VAL A 1 66  ? -13.498 6.446   24.405  1.00 21.00 ? 66  VAL A N   1 
ATOM   491  C  CA  . VAL A 1 66  ? -12.703 7.650   24.568  1.00 21.68 ? 66  VAL A CA  1 
ATOM   492  C  C   . VAL A 1 66  ? -11.309 7.194   24.947  1.00 18.58 ? 66  VAL A C   1 
ATOM   493  O  O   . VAL A 1 66  ? -11.130 6.238   25.720  1.00 21.03 ? 66  VAL A O   1 
ATOM   494  C  CB  . VAL A 1 66  ? -13.298 8.582   25.651  1.00 26.14 ? 66  VAL A CB  1 
ATOM   495  C  CG1 . VAL A 1 66  ? -12.401 9.826   25.840  1.00 20.55 ? 66  VAL A CG1 1 
ATOM   496  C  CG2 . VAL A 1 66  ? -14.711 8.981   25.228  1.00 23.28 ? 66  VAL A CG2 1 
ATOM   497  N  N   . ALA A 1 67  ? -10.314 7.879   24.401  1.00 18.00 ? 67  ALA A N   1 
ATOM   498  C  CA  . ALA A 1 67  ? -8.939  7.475   24.666  1.00 18.30 ? 67  ALA A CA  1 
ATOM   499  C  C   . ALA A 1 67  ? -8.382  7.806   26.035  1.00 20.57 ? 67  ALA A C   1 
ATOM   500  O  O   . ALA A 1 67  ? -8.704  8.842   26.629  1.00 20.07 ? 67  ALA A O   1 
ATOM   501  C  CB  . ALA A 1 67  ? -7.984  8.087   23.584  1.00 18.16 ? 67  ALA A CB  1 
ATOM   502  N  N   . ASN A 1 68  ? -7.560  6.892   26.529  1.00 17.69 ? 68  ASN A N   1 
ATOM   503  C  CA  . ASN A 1 68  ? -6.793  7.086   27.755  1.00 19.87 ? 68  ASN A CA  1 
ATOM   504  C  C   . ASN A 1 68  ? -5.457  7.532   27.118  1.00 23.32 ? 68  ASN A C   1 
ATOM   505  O  O   . ASN A 1 68  ? -4.973  6.855   26.181  1.00 25.78 ? 68  ASN A O   1 
ATOM   506  C  CB  . ASN A 1 68  ? -6.621  5.731   28.467  1.00 25.99 ? 68  ASN A CB  1 
ATOM   507  C  CG  . ASN A 1 68  ? -5.566  5.763   29.572  1.00 40.54 ? 68  ASN A CG  1 
ATOM   508  O  OD1 . ASN A 1 68  ? -5.744  6.389   30.619  1.00 46.80 ? 68  ASN A OD1 1 
ATOM   509  N  ND2 . ASN A 1 68  ? -4.455  5.081   29.332  1.00 44.61 ? 68  ASN A ND2 1 
ATOM   510  N  N   . PHE A 1 69  ? -4.846  8.638   27.547  1.00 15.20 ? 69  PHE A N   1 
ATOM   511  C  CA  . PHE A 1 69  ? -3.561  8.977   26.910  1.00 16.04 ? 69  PHE A CA  1 
ATOM   512  C  C   . PHE A 1 69  ? -2.599  9.453   27.970  1.00 17.21 ? 69  PHE A C   1 
ATOM   513  O  O   . PHE A 1 69  ? -3.014  9.822   29.079  1.00 17.31 ? 69  PHE A O   1 
ATOM   514  C  CB  . PHE A 1 69  ? -3.713  10.018  25.766  1.00 18.32 ? 69  PHE A CB  1 
ATOM   515  C  CG  . PHE A 1 69  ? -4.179  11.413  26.202  1.00 20.79 ? 69  PHE A CG  1 
ATOM   516  C  CD1 . PHE A 1 69  ? -3.299  12.314  26.799  1.00 25.68 ? 69  PHE A CD1 1 
ATOM   517  C  CD2 . PHE A 1 69  ? -5.486  11.824  25.961  1.00 23.22 ? 69  PHE A CD2 1 
ATOM   518  C  CE1 . PHE A 1 69  ? -3.729  13.617  27.142  1.00 24.19 ? 69  PHE A CE1 1 
ATOM   519  C  CE2 . PHE A 1 69  ? -5.921  13.114  26.301  1.00 24.76 ? 69  PHE A CE2 1 
ATOM   520  C  CZ  . PHE A 1 69  ? -5.040  14.002  26.887  1.00 20.11 ? 69  PHE A CZ  1 
ATOM   521  N  N   . GLN A 1 70  ? -1.314  9.391   27.648  1.00 13.00 ? 70  GLN A N   1 
ATOM   522  C  CA  . GLN A 1 70  ? -0.284  9.814   28.578  1.00 14.80 ? 70  GLN A CA  1 
ATOM   523  C  C   . GLN A 1 70  ? 0.796   10.496  27.760  1.00 17.13 ? 70  GLN A C   1 
ATOM   524  O  O   . GLN A 1 70  ? 1.202   9.992   26.710  1.00 17.21 ? 70  GLN A O   1 
ATOM   525  C  CB  . GLN A 1 70  ? 0.293   8.588   29.296  1.00 18.29 ? 70  GLN A CB  1 
ATOM   526  C  CG  . GLN A 1 70  ? 1.531   8.881   30.113  1.00 25.47 ? 70  GLN A CG  1 
ATOM   527  C  CD  . GLN A 1 70  ? 2.021   7.646   30.885  1.00 30.94 ? 70  GLN A CD  1 
ATOM   528  O  OE1 . GLN A 1 70  ? 1.388   7.210   31.842  1.00 36.52 ? 70  GLN A OE1 1 
ATOM   529  N  NE2 . GLN A 1 70  ? 3.130   7.070   30.436  1.00 34.46 ? 70  GLN A NE2 1 
ATOM   530  N  N   . SER A 1 71  ? 1.254   11.646  28.224  1.00 15.48 ? 71  SER A N   1 
ATOM   531  C  CA  . SER A 1 71  ? 2.307   12.351  27.515  1.00 17.11 ? 71  SER A CA  1 
ATOM   532  C  C   . SER A 1 71  ? 3.396   12.658  28.528  1.00 18.78 ? 71  SER A C   1 
ATOM   533  O  O   . SER A 1 71  ? 3.122   13.260  29.556  1.00 20.01 ? 71  SER A O   1 
ATOM   534  C  CB  . SER A 1 71  ? 1.749   13.649  26.919  1.00 17.97 ? 71  SER A CB  1 
ATOM   535  O  OG  . SER A 1 71  ? 2.738   14.284  26.104  1.00 21.51 ? 71  SER A OG  1 
ATOM   536  N  N   . GLN A 1 72  ? 4.617   12.217  28.265  1.00 16.14 ? 72  GLN A N   1 
ATOM   537  C  CA  . GLN A 1 72  ? 5.719   12.493  29.188  1.00 14.35 ? 72  GLN A CA  1 
ATOM   538  C  C   . GLN A 1 72  ? 6.761   13.301  28.440  1.00 15.48 ? 72  GLN A C   1 
ATOM   539  O  O   . GLN A 1 72  ? 7.101   12.975  27.309  1.00 15.41 ? 72  GLN A O   1 
ATOM   540  C  CB  . GLN A 1 72  ? 6.316   11.177  29.670  1.00 24.01 ? 72  GLN A CB  1 
ATOM   541  C  CG  . GLN A 1 72  ? 7.562   11.339  30.492  1.00 29.66 ? 72  GLN A CG  1 
ATOM   542  C  CD  . GLN A 1 72  ? 7.868   10.075  31.280  1.00 43.62 ? 72  GLN A CD  1 
ATOM   543  O  OE1 . GLN A 1 72  ? 7.728   8.958   30.763  1.00 47.14 ? 72  GLN A OE1 1 
ATOM   544  N  NE2 . GLN A 1 72  ? 8.298   10.242  32.534  1.00 45.91 ? 72  GLN A NE2 1 
ATOM   545  N  N   . PHE A 1 73  ? 7.258   14.374  29.043  1.00 12.37 ? 73  PHE A N   1 
ATOM   546  C  CA  . PHE A 1 73  ? 8.237   15.174  28.367  1.00 12.90 ? 73  PHE A CA  1 
ATOM   547  C  C   . PHE A 1 73  ? 9.086   15.953  29.369  1.00 14.75 ? 73  PHE A C   1 
ATOM   548  O  O   . PHE A 1 73  ? 8.739   16.080  30.524  1.00 15.47 ? 73  PHE A O   1 
ATOM   549  C  CB  . PHE A 1 73  ? 7.563   16.154  27.383  1.00 13.19 ? 73  PHE A CB  1 
ATOM   550  C  CG  . PHE A 1 73  ? 6.480   17.053  28.000  1.00 15.13 ? 73  PHE A CG  1 
ATOM   551  C  CD1 . PHE A 1 73  ? 6.797   18.324  28.516  1.00 15.75 ? 73  PHE A CD1 1 
ATOM   552  C  CD2 . PHE A 1 73  ? 5.147   16.621  28.048  1.00 17.08 ? 73  PHE A CD2 1 
ATOM   553  C  CE1 . PHE A 1 73  ? 5.777   19.159  29.073  1.00 16.40 ? 73  PHE A CE1 1 
ATOM   554  C  CE2 . PHE A 1 73  ? 4.115   17.456  28.607  1.00 16.53 ? 73  PHE A CE2 1 
ATOM   555  C  CZ  . PHE A 1 73  ? 4.458   18.725  29.113  1.00 15.31 ? 73  PHE A CZ  1 
ATOM   556  N  N   . SER A 1 74  ? 10.193  16.469  28.878  1.00 13.87 ? 74  SER A N   1 
ATOM   557  C  CA  . SER A 1 74  ? 11.119  17.270  29.691  1.00 14.85 ? 74  SER A CA  1 
ATOM   558  C  C   . SER A 1 74  ? 11.493  18.505  28.906  1.00 14.76 ? 74  SER A C   1 
ATOM   559  O  O   . SER A 1 74  ? 11.645  18.465  27.675  1.00 15.76 ? 74  SER A O   1 
ATOM   560  C  CB  . SER A 1 74  ? 12.414  16.493  29.983  1.00 21.03 ? 74  SER A CB  1 
ATOM   561  O  OG  . SER A 1 74  ? 12.126  15.405  30.838  1.00 37.19 ? 74  SER A OG  1 
ATOM   562  N  N   . PHE A 1 75  ? 11.628  19.631  29.606  1.00 14.54 ? 75  PHE A N   1 
ATOM   563  C  CA  . PHE A 1 75  ? 12.027  20.844  28.904  1.00 14.45 ? 75  PHE A CA  1 
ATOM   564  C  C   . PHE A 1 75  ? 12.840  21.708  29.865  1.00 18.07 ? 75  PHE A C   1 
ATOM   565  O  O   . PHE A 1 75  ? 12.814  21.477  31.062  1.00 16.95 ? 75  PHE A O   1 
ATOM   566  C  CB  . PHE A 1 75  ? 10.834  21.668  28.401  1.00 15.38 ? 75  PHE A CB  1 
ATOM   567  C  CG  . PHE A 1 75  ? 9.965   22.285  29.503  1.00 18.71 ? 75  PHE A CG  1 
ATOM   568  C  CD1 . PHE A 1 75  ? 8.881   21.590  30.037  1.00 18.78 ? 75  PHE A CD1 1 
ATOM   569  C  CD2 . PHE A 1 75  ? 10.253  23.569  30.005  1.00 17.82 ? 75  PHE A CD2 1 
ATOM   570  C  CE1 . PHE A 1 75  ? 8.074   22.157  31.069  1.00 19.28 ? 75  PHE A CE1 1 
ATOM   571  C  CE2 . PHE A 1 75  ? 9.476   24.141  31.019  1.00 20.75 ? 75  PHE A CE2 1 
ATOM   572  C  CZ  . PHE A 1 75  ? 8.373   23.437  31.561  1.00 17.85 ? 75  PHE A CZ  1 
ATOM   573  N  N   . SER A 1 76  ? 13.580  22.670  29.326  1.00 17.11 ? 76  SER A N   1 
ATOM   574  C  CA  . SER A 1 76  ? 14.309  23.591  30.203  1.00 18.76 ? 76  SER A CA  1 
ATOM   575  C  C   . SER A 1 76  ? 14.156  24.969  29.596  1.00 19.36 ? 76  SER A C   1 
ATOM   576  O  O   . SER A 1 76  ? 13.918  25.107  28.399  1.00 20.77 ? 76  SER A O   1 
ATOM   577  C  CB  . SER A 1 76  ? 15.785  23.201  30.343  1.00 21.55 ? 76  SER A CB  1 
ATOM   578  O  OG  . SER A 1 76  ? 16.412  23.174  29.088  1.00 23.79 ? 76  SER A OG  1 
ATOM   579  N  N   . LEU A 1 77  ? 14.289  25.996  30.428  1.00 20.34 ? 77  LEU A N   1 
ATOM   580  C  CA  . LEU A 1 77  ? 14.151  27.377  30.004  1.00 21.04 ? 77  LEU A CA  1 
ATOM   581  C  C   . LEU A 1 77  ? 15.441  28.087  30.445  1.00 23.40 ? 77  LEU A C   1 
ATOM   582  O  O   . LEU A 1 77  ? 15.934  27.846  31.546  1.00 25.24 ? 77  LEU A O   1 
ATOM   583  C  CB  . LEU A 1 77  ? 12.955  28.011  30.741  1.00 20.48 ? 77  LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 77  ? 11.612  27.274  30.642  1.00 21.66 ? 77  LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 77  ? 10.591  27.985  31.553  1.00 21.43 ? 77  LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 77  ? 11.123  27.258  29.190  1.00 17.05 ? 77  LEU A CD2 1 
ATOM   587  N  N   . LYS A 1 78  ? 15.973  28.948  29.594  1.00 24.47 ? 78  LYS A N   1 
ATOM   588  C  CA  . LYS A 1 78  ? 17.206  29.682  29.923  1.00 26.89 ? 78  LYS A CA  1 
ATOM   589  C  C   . LYS A 1 78  ? 17.082  31.138  29.484  1.00 26.36 ? 78  LYS A C   1 
ATOM   590  O  O   . LYS A 1 78  ? 16.562  31.445  28.410  1.00 24.21 ? 78  LYS A O   1 
ATOM   591  C  CB  . LYS A 1 78  ? 18.406  29.042  29.220  1.00 28.74 ? 78  LYS A CB  1 
ATOM   592  N  N   . SER A 1 79  ? 17.566  32.052  30.318  1.00 28.98 ? 79  SER A N   1 
ATOM   593  C  CA  . SER A 1 79  ? 17.476  33.466  29.958  1.00 32.34 ? 79  SER A CA  1 
ATOM   594  C  C   . SER A 1 79  ? 18.448  34.312  30.769  1.00 32.94 ? 79  SER A C   1 
ATOM   595  O  O   . SER A 1 79  ? 18.676  34.041  31.945  1.00 31.78 ? 79  SER A O   1 
ATOM   596  C  CB  . SER A 1 79  ? 16.064  33.993  30.224  1.00 33.96 ? 79  SER A CB  1 
ATOM   597  O  OG  . SER A 1 79  ? 16.006  35.392  30.011  1.00 36.16 ? 79  SER A OG  1 
ATOM   598  N  N   . PRO A 1 80  ? 19.043  35.327  30.134  1.00 37.22 ? 80  PRO A N   1 
ATOM   599  C  CA  . PRO A 1 80  ? 19.990  36.260  30.754  1.00 40.09 ? 80  PRO A CA  1 
ATOM   600  C  C   . PRO A 1 80  ? 19.232  37.140  31.769  1.00 40.20 ? 80  PRO A C   1 
ATOM   601  O  O   . PRO A 1 80  ? 19.812  37.677  32.706  1.00 44.16 ? 80  PRO A O   1 
ATOM   602  C  CB  . PRO A 1 80  ? 20.468  37.085  29.554  1.00 40.91 ? 80  PRO A CB  1 
ATOM   603  C  CG  . PRO A 1 80  ? 20.291  36.125  28.383  1.00 44.82 ? 80  PRO A CG  1 
ATOM   604  C  CD  . PRO A 1 80  ? 18.903  35.647  28.704  1.00 39.72 ? 80  PRO A CD  1 
ATOM   605  N  N   . LEU A 1 81  ? 17.925  37.267  31.567  1.00 40.46 ? 81  LEU A N   1 
ATOM   606  C  CA  . LEU A 1 81  ? 17.039  38.084  32.410  1.00 39.42 ? 81  LEU A CA  1 
ATOM   607  C  C   . LEU A 1 81  ? 16.484  37.321  33.629  1.00 42.63 ? 81  LEU A C   1 
ATOM   608  O  O   . LEU A 1 81  ? 16.323  36.095  33.598  1.00 44.06 ? 81  LEU A O   1 
ATOM   609  C  CB  . LEU A 1 81  ? 15.844  38.540  31.571  1.00 38.29 ? 81  LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 81  ? 16.105  39.115  30.179  1.00 39.05 ? 81  LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 81  ? 14.764  39.193  29.390  1.00 38.45 ? 81  LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 81  ? 16.792  40.475  30.323  1.00 38.00 ? 81  LEU A CD2 1 
ATOM   613  N  N   . SER A 1 82  ? 16.130  38.057  34.679  1.00 43.81 ? 82  SER A N   1 
ATOM   614  C  CA  . SER A 1 82  ? 15.565  37.447  35.883  1.00 45.26 ? 82  SER A CA  1 
ATOM   615  C  C   . SER A 1 82  ? 14.073  37.118  35.684  1.00 45.98 ? 82  SER A C   1 
ATOM   616  O  O   . SER A 1 82  ? 13.475  36.392  36.479  1.00 48.46 ? 82  SER A O   1 
ATOM   617  C  CB  . SER A 1 82  ? 15.738  38.397  37.084  1.00 46.66 ? 82  SER A CB  1 
ATOM   618  O  OG  . SER A 1 82  ? 15.140  39.671  36.843  1.00 49.62 ? 82  SER A OG  1 
ATOM   619  N  N   . ASN A 1 83  ? 13.477  37.665  34.624  1.00 43.29 ? 83  ASN A N   1 
ATOM   620  C  CA  . ASN A 1 83  ? 12.070  37.424  34.320  1.00 40.43 ? 83  ASN A CA  1 
ATOM   621  C  C   . ASN A 1 83  ? 11.873  36.990  32.862  1.00 38.72 ? 83  ASN A C   1 
ATOM   622  O  O   . ASN A 1 83  ? 11.334  37.744  32.038  1.00 40.12 ? 83  ASN A O   1 
ATOM   623  C  CB  . ASN A 1 83  ? 11.243  38.684  34.648  1.00 40.87 ? 83  ASN A CB  1 
ATOM   624  C  CG  . ASN A 1 83  ? 11.982  39.983  34.311  1.00 42.01 ? 83  ASN A CG  1 
ATOM   625  O  OD1 . ASN A 1 83  ? 12.196  40.843  35.187  1.00 36.98 ? 83  ASN A OD1 1 
ATOM   626  N  ND2 . ASN A 1 83  ? 12.372  40.134  33.047  1.00 41.64 ? 83  ASN A ND2 1 
ATOM   627  N  N   . GLY A 1 84  ? 12.319  35.770  32.551  1.00 32.26 ? 84  GLY A N   1 
ATOM   628  C  CA  . GLY A 1 84  ? 12.178  35.252  31.198  1.00 29.45 ? 84  GLY A CA  1 
ATOM   629  C  C   . GLY A 1 84  ? 10.702  35.060  30.884  1.00 25.22 ? 84  GLY A C   1 
ATOM   630  O  O   . GLY A 1 84  ? 9.882   34.897  31.798  1.00 24.76 ? 84  GLY A O   1 
ATOM   631  N  N   . ALA A 1 85  ? 10.354  35.103  29.600  1.00 22.34 ? 85  ALA A N   1 
ATOM   632  C  CA  . ALA A 1 85  ? 8.961   34.945  29.160  1.00 22.75 ? 85  ALA A CA  1 
ATOM   633  C  C   . ALA A 1 85  ? 8.946   34.253  27.795  1.00 20.72 ? 85  ALA A C   1 
ATOM   634  O  O   . ALA A 1 85  ? 9.971   34.213  27.124  1.00 21.60 ? 85  ALA A O   1 
ATOM   635  C  CB  . ALA A 1 85  ? 8.288   36.291  29.047  1.00 21.25 ? 85  ALA A CB  1 
ATOM   636  N  N   . ASP A 1 86  ? 7.802   33.722  27.365  1.00 19.00 ? 86  ASP A N   1 
ATOM   637  C  CA  . ASP A 1 86  ? 6.545   33.741  28.086  1.00 15.82 ? 86  ASP A CA  1 
ATOM   638  C  C   . ASP A 1 86  ? 6.101   32.401  28.638  1.00 18.53 ? 86  ASP A C   1 
ATOM   639  O  O   . ASP A 1 86  ? 5.305   32.354  29.567  1.00 19.10 ? 86  ASP A O   1 
ATOM   640  C  CB  . ASP A 1 86  ? 5.445   34.252  27.185  1.00 16.60 ? 86  ASP A CB  1 
ATOM   641  C  CG  . ASP A 1 86  ? 5.398   35.758  27.177  1.00 21.28 ? 86  ASP A CG  1 
ATOM   642  O  OD1 . ASP A 1 86  ? 6.083   36.393  26.337  1.00 23.06 ? 86  ASP A OD1 1 
ATOM   643  O  OD2 . ASP A 1 86  ? 4.694   36.276  28.060  1.00 21.29 ? 86  ASP A OD2 1 
ATOM   644  N  N   . GLY A 1 87  ? 6.615   31.318  28.060  1.00 16.89 ? 87  GLY A N   1 
ATOM   645  C  CA  . GLY A 1 87  ? 6.209   30.018  28.563  1.00 16.85 ? 87  GLY A CA  1 
ATOM   646  C  C   . GLY A 1 87  ? 6.074   29.004  27.455  1.00 18.92 ? 87  GLY A C   1 
ATOM   647  O  O   . GLY A 1 87  ? 6.145   29.358  26.267  1.00 18.23 ? 87  GLY A O   1 
ATOM   648  N  N   . ILE A 1 88  ? 5.849   27.755  27.858  1.00 17.86 ? 88  ILE A N   1 
ATOM   649  C  CA  . ILE A 1 88  ? 5.713   26.648  26.919  1.00 16.45 ? 88  ILE A CA  1 
ATOM   650  C  C   . ILE A 1 88  ? 4.444   25.878  27.261  1.00 17.85 ? 88  ILE A C   1 
ATOM   651  O  O   . ILE A 1 88  ? 4.032   25.831  28.434  1.00 16.63 ? 88  ILE A O   1 
ATOM   652  C  CB  . ILE A 1 88  ? 6.961   25.730  27.019  1.00 19.01 ? 88  ILE A CB  1 
ATOM   653  C  CG1 . ILE A 1 88  ? 6.842   24.586  26.013  1.00 18.51 ? 88  ILE A CG1 1 
ATOM   654  C  CG2 . ILE A 1 88  ? 7.156   25.160  28.481  1.00 18.30 ? 88  ILE A CG2 1 
ATOM   655  C  CD1 . ILE A 1 88  ? 8.075   23.655  26.058  1.00 27.75 ? 88  ILE A CD1 1 
ATOM   656  N  N   . ALA A 1 89  ? 3.797   25.279  26.255  1.00 15.15 ? 89  ALA A N   1 
ATOM   657  C  CA  . ALA A 1 89  ? 2.571   24.531  26.533  1.00 13.09 ? 89  ALA A CA  1 
ATOM   658  C  C   . ALA A 1 89  ? 2.499   23.269  25.727  1.00 15.69 ? 89  ALA A C   1 
ATOM   659  O  O   . ALA A 1 89  ? 2.941   23.255  24.580  1.00 17.29 ? 89  ALA A O   1 
ATOM   660  C  CB  . ALA A 1 89  ? 1.315   25.397  26.196  1.00 15.40 ? 89  ALA A CB  1 
ATOM   661  N  N   . PHE A 1 90  ? 2.005   22.211  26.366  1.00 15.10 ? 90  PHE A N   1 
ATOM   662  C  CA  . PHE A 1 90  ? 1.711   20.976  25.654  1.00 15.04 ? 90  PHE A CA  1 
ATOM   663  C  C   . PHE A 1 90  ? 0.242   21.217  25.204  1.00 13.95 ? 90  PHE A C   1 
ATOM   664  O  O   . PHE A 1 90  ? -0.591  21.702  26.001  1.00 17.11 ? 90  PHE A O   1 
ATOM   665  C  CB  . PHE A 1 90  ? 1.747   19.783  26.618  1.00 15.83 ? 90  PHE A CB  1 
ATOM   666  C  CG  . PHE A 1 90  ? 1.140   18.519  26.033  1.00 16.56 ? 90  PHE A CG  1 
ATOM   667  C  CD1 . PHE A 1 90  ? 1.729   17.882  24.952  1.00 17.52 ? 90  PHE A CD1 1 
ATOM   668  C  CD2 . PHE A 1 90  ? -0.054  18.015  26.551  1.00 20.71 ? 90  PHE A CD2 1 
ATOM   669  C  CE1 . PHE A 1 90  ? 1.125   16.735  24.373  1.00 20.61 ? 90  PHE A CE1 1 
ATOM   670  C  CE2 . PHE A 1 90  ? -0.660  16.869  25.985  1.00 24.79 ? 90  PHE A CE2 1 
ATOM   671  C  CZ  . PHE A 1 90  ? -0.064  16.238  24.897  1.00 20.37 ? 90  PHE A CZ  1 
ATOM   672  N  N   . PHE A 1 91  ? -0.098  20.944  23.951  1.00 13.96 ? 91  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 91  ? -1.488  21.158  23.557  1.00 14.28 ? 91  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 91  ? -2.052  20.075  22.633  1.00 16.75 ? 91  PHE A C   1 
ATOM   675  O  O   . PHE A 1 91  ? -1.307  19.317  22.008  1.00 16.32 ? 91  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 91  ? -1.688  22.558  22.906  1.00 14.75 ? 91  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 91  ? -1.103  22.705  21.521  1.00 17.36 ? 91  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 91  ? 0.276   22.825  21.315  1.00 17.38 ? 91  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 91  ? -1.955  22.809  20.419  1.00 23.27 ? 91  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 91  ? 0.788   23.055  20.034  1.00 17.88 ? 91  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 91  ? -1.449  23.038  19.129  1.00 23.70 ? 91  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 91  ? -0.087  23.165  18.934  1.00 24.99 ? 91  PHE A CZ  1 
ATOM   683  N  N   . ILE A 1 92  ? -3.383  20.005  22.602  1.00 13.65 ? 92  ILE A N   1 
ATOM   684  C  CA  . ILE A 1 92  ? -4.122  19.042  21.778  1.00 15.57 ? 92  ILE A CA  1 
ATOM   685  C  C   . ILE A 1 92  ? -5.106  19.920  21.006  1.00 18.18 ? 92  ILE A C   1 
ATOM   686  O  O   . ILE A 1 92  ? -5.825  20.719  21.625  1.00 19.11 ? 92  ILE A O   1 
ATOM   687  C  CB  . ILE A 1 92  ? -4.919  18.103  22.644  1.00 16.85 ? 92  ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 92  ? -3.986  17.494  23.695  1.00 15.85 ? 92  ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 92  ? -5.565  17.005  21.757  1.00 17.91 ? 92  ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 92  ? -4.721  16.628  24.679  1.00 26.88 ? 92  ILE A CD1 1 
ATOM   691  N  N   . ALA A 1 93  ? -5.128  19.782  19.678  1.00 18.09 ? 93  ALA A N   1 
ATOM   692  C  CA  . ALA A 1 93  ? -5.990  20.651  18.864  1.00 22.45 ? 93  ALA A CA  1 
ATOM   693  C  C   . ALA A 1 93  ? -6.443  19.947  17.584  1.00 23.64 ? 93  ALA A C   1 
ATOM   694  O  O   . ALA A 1 93  ? -5.966  18.856  17.267  1.00 21.71 ? 93  ALA A O   1 
ATOM   695  C  CB  . ALA A 1 93  ? -5.194  21.944  18.468  1.00 19.57 ? 93  ALA A CB  1 
ATOM   696  N  N   . PRO A 1 94  ? -7.408  20.550  16.857  1.00 25.50 ? 94  PRO A N   1 
ATOM   697  C  CA  . PRO A 1 94  ? -7.859  19.931  15.598  1.00 24.23 ? 94  PRO A CA  1 
ATOM   698  C  C   . PRO A 1 94  ? -6.601  19.780  14.726  1.00 22.51 ? 94  PRO A C   1 
ATOM   699  O  O   . PRO A 1 94  ? -5.648  20.572  14.814  1.00 21.85 ? 94  PRO A O   1 
ATOM   700  C  CB  . PRO A 1 94  ? -8.862  20.961  15.053  1.00 24.78 ? 94  PRO A CB  1 
ATOM   701  C  CG  . PRO A 1 94  ? -9.480  21.506  16.355  1.00 25.95 ? 94  PRO A CG  1 
ATOM   702  C  CD  . PRO A 1 94  ? -8.186  21.780  17.137  1.00 24.04 ? 94  PRO A CD  1 
ATOM   703  N  N   . PRO A 1 95  ? -6.598  18.805  13.806  1.00 21.68 ? 95  PRO A N   1 
ATOM   704  C  CA  . PRO A 1 95  ? -5.419  18.574  12.960  1.00 18.96 ? 95  PRO A CA  1 
ATOM   705  C  C   . PRO A 1 95  ? -4.885  19.695  12.101  1.00 21.01 ? 95  PRO A C   1 
ATOM   706  O  O   . PRO A 1 95  ? -3.685  19.765  11.837  1.00 23.25 ? 95  PRO A O   1 
ATOM   707  C  CB  . PRO A 1 95  ? -5.852  17.377  12.083  1.00 21.48 ? 95  PRO A CB  1 
ATOM   708  C  CG  . PRO A 1 95  ? -6.927  16.714  12.922  1.00 27.05 ? 95  PRO A CG  1 
ATOM   709  C  CD  . PRO A 1 95  ? -7.704  17.922  13.397  1.00 22.62 ? 95  PRO A CD  1 
ATOM   710  N  N   . ASP A 1 96  ? -5.768  20.567  11.627  1.00 19.81 ? 96  ASP A N   1 
ATOM   711  C  CA  . ASP A 1 96  ? -5.298  21.625  10.742  1.00 25.04 ? 96  ASP A CA  1 
ATOM   712  C  C   . ASP A 1 96  ? -4.851  22.898  11.486  1.00 27.21 ? 96  ASP A C   1 
ATOM   713  O  O   . ASP A 1 96  ? -4.677  23.930  10.866  1.00 25.70 ? 96  ASP A O   1 
ATOM   714  C  CB  . ASP A 1 96  ? -6.412  21.991  9.753   1.00 32.35 ? 96  ASP A CB  1 
ATOM   715  C  CG  . ASP A 1 96  ? -7.692  22.432  10.449  1.00 38.19 ? 96  ASP A CG  1 
ATOM   716  O  OD1 . ASP A 1 96  ? -8.659  22.809  9.746   1.00 44.08 ? 96  ASP A OD1 1 
ATOM   717  O  OD2 . ASP A 1 96  ? -7.751  22.406  11.699  1.00 44.88 ? 96  ASP A OD2 1 
ATOM   718  N  N   . THR A 1 97  ? -4.665  22.814  12.799  1.00 23.96 ? 97  THR A N   1 
ATOM   719  C  CA  . THR A 1 97  ? -4.292  23.998  13.557  1.00 23.47 ? 97  THR A CA  1 
ATOM   720  C  C   . THR A 1 97  ? -3.033  24.662  13.017  1.00 24.88 ? 97  THR A C   1 
ATOM   721  O  O   . THR A 1 97  ? -2.115  23.996  12.527  1.00 26.42 ? 97  THR A O   1 
ATOM   722  C  CB  . THR A 1 97  ? -4.080  23.651  15.058  1.00 24.32 ? 97  THR A CB  1 
ATOM   723  O  OG1 . THR A 1 97  ? -3.726  24.841  15.786  1.00 27.89 ? 97  THR A OG1 1 
ATOM   724  C  CG2 . THR A 1 97  ? -2.963  22.589  15.206  1.00 24.14 ? 97  THR A CG2 1 
ATOM   725  N  N   . THR A 1 98  ? -3.004  25.990  13.079  1.00 26.08 ? 98  THR A N   1 
ATOM   726  C  CA  . THR A 1 98  ? -1.835  26.760  12.658  1.00 25.24 ? 98  THR A CA  1 
ATOM   727  C  C   . THR A 1 98  ? -1.707  27.926  13.638  1.00 25.39 ? 98  THR A C   1 
ATOM   728  O  O   . THR A 1 98  ? -2.634  28.200  14.388  1.00 24.45 ? 98  THR A O   1 
ATOM   729  C  CB  . THR A 1 98  ? -1.974  27.337  11.229  1.00 30.62 ? 98  THR A CB  1 
ATOM   730  O  OG1 . THR A 1 98  ? -3.193  28.078  11.140  1.00 32.53 ? 98  THR A OG1 1 
ATOM   731  C  CG2 . THR A 1 98  ? -1.939  26.209  10.177  1.00 29.11 ? 98  THR A CG2 1 
ATOM   732  N  N   . ILE A 1 99  ? -0.551  28.580  13.640  1.00 26.42 ? 99  ILE A N   1 
ATOM   733  C  CA  . ILE A 1 99  ? -0.299  29.704  14.552  1.00 28.68 ? 99  ILE A CA  1 
ATOM   734  C  C   . ILE A 1 99  ? -1.256  30.849  14.247  1.00 28.96 ? 99  ILE A C   1 
ATOM   735  O  O   . ILE A 1 99  ? -1.243  31.377  13.139  1.00 30.90 ? 99  ILE A O   1 
ATOM   736  C  CB  . ILE A 1 99  ? 1.156   30.222  14.390  1.00 24.67 ? 99  ILE A CB  1 
ATOM   737  C  CG1 . ILE A 1 99  ? 2.143   29.160  14.857  1.00 26.51 ? 99  ILE A CG1 1 
ATOM   738  C  CG2 . ILE A 1 99  ? 1.365   31.509  15.218  1.00 26.59 ? 99  ILE A CG2 1 
ATOM   739  C  CD1 . ILE A 1 99  ? 3.631   29.515  14.652  1.00 25.89 ? 99  ILE A CD1 1 
ATOM   740  N  N   . PRO A 1 100 ? -2.105  31.242  15.215  1.00 29.72 ? 100 PRO A N   1 
ATOM   741  C  CA  . PRO A 1 100 ? -3.056  32.347  14.996  1.00 29.40 ? 100 PRO A CA  1 
ATOM   742  C  C   . PRO A 1 100 ? -2.323  33.691  14.866  1.00 32.33 ? 100 PRO A C   1 
ATOM   743  O  O   . PRO A 1 100 ? -1.297  33.913  15.511  1.00 28.58 ? 100 PRO A O   1 
ATOM   744  C  CB  . PRO A 1 100 ? -3.925  32.310  16.253  1.00 26.54 ? 100 PRO A CB  1 
ATOM   745  C  CG  . PRO A 1 100 ? -3.762  30.855  16.765  1.00 29.40 ? 100 PRO A CG  1 
ATOM   746  C  CD  . PRO A 1 100 ? -2.267  30.705  16.579  1.00 27.88 ? 100 PRO A CD  1 
ATOM   747  N  N   . SER A 1 101 ? -2.849  34.597  14.039  1.00 33.52 ? 101 SER A N   1 
ATOM   748  C  CA  . SER A 1 101 ? -2.216  35.908  13.866  1.00 33.36 ? 101 SER A CA  1 
ATOM   749  C  C   . SER A 1 101 ? -2.165  36.658  15.201  1.00 28.78 ? 101 SER A C   1 
ATOM   750  O  O   . SER A 1 101 ? -3.164  36.722  15.902  1.00 32.22 ? 101 SER A O   1 
ATOM   751  C  CB  . SER A 1 101 ? -3.007  36.748  12.845  1.00 39.22 ? 101 SER A CB  1 
ATOM   752  O  OG  . SER A 1 101 ? -3.045  36.099  11.583  1.00 43.58 ? 101 SER A OG  1 
ATOM   753  N  N   . GLY A 1 102 ? -1.001  37.202  15.546  1.00 30.59 ? 102 GLY A N   1 
ATOM   754  C  CA  . GLY A 1 102 ? -0.865  37.950  16.794  1.00 31.24 ? 102 GLY A CA  1 
ATOM   755  C  C   . GLY A 1 102 ? -0.851  37.110  18.078  1.00 33.24 ? 102 GLY A C   1 
ATOM   756  O  O   . GLY A 1 102 ? -1.027  37.645  19.177  1.00 32.19 ? 102 GLY A O   1 
ATOM   757  N  N   . SER A 1 103 ? -0.610  35.803  17.965  1.00 30.38 ? 103 SER A N   1 
ATOM   758  C  CA  . SER A 1 103 ? -0.633  34.944  19.153  1.00 29.13 ? 103 SER A CA  1 
ATOM   759  C  C   . SER A 1 103 ? 0.668   34.875  19.970  1.00 30.49 ? 103 SER A C   1 
ATOM   760  O  O   . SER A 1 103 ? 0.835   33.971  20.804  1.00 28.77 ? 103 SER A O   1 
ATOM   761  C  CB  . SER A 1 103 ? -1.036  33.529  18.740  1.00 28.06 ? 103 SER A CB  1 
ATOM   762  O  OG  . SER A 1 103 ? -0.079  33.006  17.834  1.00 28.32 ? 103 SER A OG  1 
ATOM   763  N  N   . GLY A 1 104 ? 1.589   35.803  19.736  1.00 25.77 ? 104 GLY A N   1 
ATOM   764  C  CA  . GLY A 1 104 ? 2.839   35.803  20.475  1.00 22.93 ? 104 GLY A CA  1 
ATOM   765  C  C   . GLY A 1 104 ? 2.707   36.278  21.919  1.00 23.00 ? 104 GLY A C   1 
ATOM   766  O  O   . GLY A 1 104 ? 1.599   36.460  22.432  1.00 24.48 ? 104 GLY A O   1 
ATOM   767  N  N   . GLY A 1 105 ? 3.846   36.478  22.578  1.00 23.46 ? 105 GLY A N   1 
ATOM   768  C  CA  . GLY A 1 105 ? 3.823   36.921  23.960  1.00 24.71 ? 105 GLY A CA  1 
ATOM   769  C  C   . GLY A 1 105 ? 3.051   35.970  24.852  1.00 23.65 ? 105 GLY A C   1 
ATOM   770  O  O   . GLY A 1 105 ? 3.159   34.758  24.700  1.00 22.11 ? 105 GLY A O   1 
ATOM   771  N  N   . GLY A 1 106 ? 2.248   36.535  25.747  1.00 21.19 ? 106 GLY A N   1 
ATOM   772  C  CA  . GLY A 1 106 ? 1.466   35.760  26.697  1.00 21.55 ? 106 GLY A CA  1 
ATOM   773  C  C   . GLY A 1 106 ? 0.386   34.879  26.112  1.00 21.22 ? 106 GLY A C   1 
ATOM   774  O  O   . GLY A 1 106 ? -0.259  34.132  26.859  1.00 22.49 ? 106 GLY A O   1 
ATOM   775  N  N   . LEU A 1 107 ? 0.148   34.981  24.799  1.00 20.34 ? 107 LEU A N   1 
ATOM   776  C  CA  . LEU A 1 107 ? -0.859  34.116  24.196  1.00 20.55 ? 107 LEU A CA  1 
ATOM   777  C  C   . LEU A 1 107 ? -0.246  32.758  23.828  1.00 21.54 ? 107 LEU A C   1 
ATOM   778  O  O   . LEU A 1 107 ? -0.936  31.858  23.353  1.00 21.33 ? 107 LEU A O   1 
ATOM   779  C  CB  . LEU A 1 107 ? -1.525  34.800  22.989  1.00 23.65 ? 107 LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 107 ? -2.362  35.995  23.495  1.00 21.93 ? 107 LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 107 ? -3.065  36.682  22.329  1.00 25.04 ? 107 LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 107 ? -3.409  35.513  24.508  1.00 24.57 ? 107 LEU A CD2 1 
ATOM   783  N  N   . LEU A 1 108 ? 1.064   32.650  24.024  1.00 20.39 ? 108 LEU A N   1 
ATOM   784  C  CA  . LEU A 1 108 ? 1.793   31.400  23.868  1.00 21.73 ? 108 LEU A CA  1 
ATOM   785  C  C   . LEU A 1 108 ? 1.728   30.696  22.503  1.00 23.76 ? 108 LEU A C   1 
ATOM   786  O  O   . LEU A 1 108 ? 2.092   29.518  22.416  1.00 23.43 ? 108 LEU A O   1 
ATOM   787  C  CB  . LEU A 1 108 ? 1.329   30.415  24.975  1.00 19.12 ? 108 LEU A CB  1 
ATOM   788  C  CG  . LEU A 1 108 ? 1.403   30.894  26.444  1.00 22.15 ? 108 LEU A CG  1 
ATOM   789  C  CD1 . LEU A 1 108 ? 1.008   29.769  27.392  1.00 24.20 ? 108 LEU A CD1 1 
ATOM   790  C  CD2 . LEU A 1 108 ? 2.832   31.361  26.759  1.00 21.31 ? 108 LEU A CD2 1 
ATOM   791  N  N   . GLY A 1 109 ? 1.302   31.404  21.453  1.00 21.35 ? 109 GLY A N   1 
ATOM   792  C  CA  . GLY A 1 109 ? 1.217   30.786  20.137  1.00 21.82 ? 109 GLY A CA  1 
ATOM   793  C  C   . GLY A 1 109 ? -0.049  29.945  19.991  1.00 22.04 ? 109 GLY A C   1 
ATOM   794  O  O   . GLY A 1 109 ? -0.202  29.209  19.016  1.00 24.98 ? 109 GLY A O   1 
ATOM   795  N  N   . LEU A 1 110 ? -0.966  30.070  20.944  1.00 21.31 ? 110 LEU A N   1 
ATOM   796  C  CA  . LEU A 1 110 ? -2.193  29.278  20.941  1.00 23.69 ? 110 LEU A CA  1 
ATOM   797  C  C   . LEU A 1 110 ? -3.495  29.997  20.673  1.00 24.69 ? 110 LEU A C   1 
ATOM   798  O  O   . LEU A 1 110 ? -4.440  29.386  20.166  1.00 24.16 ? 110 LEU A O   1 
ATOM   799  C  CB  . LEU A 1 110 ? -2.350  28.530  22.284  1.00 23.21 ? 110 LEU A CB  1 
ATOM   800  C  CG  . LEU A 1 110 ? -1.272  27.488  22.612  1.00 26.93 ? 110 LEU A CG  1 
ATOM   801  C  CD1 . LEU A 1 110 ? -1.509  26.918  24.005  1.00 27.09 ? 110 LEU A CD1 1 
ATOM   802  C  CD2 . LEU A 1 110 ? -1.304  26.387  21.551  1.00 28.79 ? 110 LEU A CD2 1 
ATOM   803  N  N   . PHE A 1 111 ? -3.571  31.275  21.029  1.00 23.85 ? 111 PHE A N   1 
ATOM   804  C  CA  . PHE A 1 111 ? -4.824  31.994  20.862  1.00 25.31 ? 111 PHE A CA  1 
ATOM   805  C  C   . PHE A 1 111 ? -4.608  33.316  20.150  1.00 27.31 ? 111 PHE A C   1 
ATOM   806  O  O   . PHE A 1 111 ? -3.524  33.908  20.233  1.00 28.03 ? 111 PHE A O   1 
ATOM   807  C  CB  . PHE A 1 111 ? -5.489  32.305  22.215  1.00 27.84 ? 111 PHE A CB  1 
ATOM   808  C  CG  . PHE A 1 111 ? -5.714  31.109  23.093  1.00 26.76 ? 111 PHE A CG  1 
ATOM   809  C  CD1 . PHE A 1 111 ? -4.706  30.645  23.943  1.00 27.11 ? 111 PHE A CD1 1 
ATOM   810  C  CD2 . PHE A 1 111 ? -6.934  30.460  23.089  1.00 27.73 ? 111 PHE A CD2 1 
ATOM   811  C  CE1 . PHE A 1 111 ? -4.928  29.558  24.778  1.00 23.74 ? 111 PHE A CE1 1 
ATOM   812  C  CE2 . PHE A 1 111 ? -7.176  29.364  23.918  1.00 30.44 ? 111 PHE A CE2 1 
ATOM   813  C  CZ  . PHE A 1 111 ? -6.176  28.911  24.769  1.00 24.61 ? 111 PHE A CZ  1 
ATOM   814  N  N   . ALA A 1 112 ? -5.646  33.758  19.442  1.00 30.09 ? 112 ALA A N   1 
ATOM   815  C  CA  . ALA A 1 112 ? -5.611  35.046  18.731  1.00 32.30 ? 112 ALA A CA  1 
ATOM   816  C  C   . ALA A 1 112 ? -6.082  36.101  19.733  1.00 31.18 ? 112 ALA A C   1 
ATOM   817  O  O   . ALA A 1 112 ? -6.970  35.845  20.542  1.00 33.51 ? 112 ALA A O   1 
ATOM   818  C  CB  . ALA A 1 112 ? -6.552  35.023  17.517  1.00 32.75 ? 112 ALA A CB  1 
ATOM   819  N  N   . PRO A 1 113 ? -5.508  37.309  19.671  1.00 32.49 ? 113 PRO A N   1 
ATOM   820  C  CA  . PRO A 1 113 ? -5.877  38.382  20.591  1.00 36.31 ? 113 PRO A CA  1 
ATOM   821  C  C   . PRO A 1 113 ? -7.364  38.633  20.813  1.00 37.74 ? 113 PRO A C   1 
ATOM   822  O  O   . PRO A 1 113 ? -7.839  38.683  21.957  1.00 37.70 ? 113 PRO A O   1 
ATOM   823  C  CB  . PRO A 1 113 ? -5.155  39.583  19.997  1.00 34.56 ? 113 PRO A CB  1 
ATOM   824  C  CG  . PRO A 1 113 ? -3.907  38.959  19.487  1.00 36.89 ? 113 PRO A CG  1 
ATOM   825  C  CD  . PRO A 1 113 ? -4.497  37.795  18.719  1.00 30.40 ? 113 PRO A CD  1 
ATOM   826  N  N   . GLY A 1 114 ? -8.112  38.785  19.733  1.00 38.79 ? 114 GLY A N   1 
ATOM   827  C  CA  . GLY A 1 114 ? -9.524  39.086  19.899  1.00 40.90 ? 114 GLY A CA  1 
ATOM   828  C  C   . GLY A 1 114 ? -10.414 38.021  20.497  1.00 41.04 ? 114 GLY A C   1 
ATOM   829  O  O   . GLY A 1 114 ? -11.522 38.314  20.981  1.00 42.13 ? 114 GLY A O   1 
ATOM   830  N  N   . THR A 1 115 ? -9.949  36.777  20.480  1.00 39.32 ? 115 THR A N   1 
ATOM   831  C  CA  . THR A 1 115 ? -10.782 35.707  20.988  1.00 36.46 ? 115 THR A CA  1 
ATOM   832  C  C   . THR A 1 115 ? -10.137 34.832  22.051  1.00 33.60 ? 115 THR A C   1 
ATOM   833  O  O   . THR A 1 115 ? -10.677 33.787  22.380  1.00 35.42 ? 115 THR A O   1 
ATOM   834  C  CB  . THR A 1 115 ? -11.236 34.799  19.832  1.00 38.45 ? 115 THR A CB  1 
ATOM   835  O  OG1 . THR A 1 115 ? -10.080 34.298  19.153  1.00 38.60 ? 115 THR A OG1 1 
ATOM   836  C  CG2 . THR A 1 115 ? -12.105 35.576  18.837  1.00 37.48 ? 115 THR A CG2 1 
ATOM   837  N  N   . ALA A 1 116 ? -9.018  35.283  22.607  1.00 35.08 ? 116 ALA A N   1 
ATOM   838  C  CA  . ALA A 1 116 ? -8.280  34.511  23.612  1.00 32.47 ? 116 ALA A CA  1 
ATOM   839  C  C   . ALA A 1 116 ? -9.067  34.037  24.817  1.00 31.82 ? 116 ALA A C   1 
ATOM   840  O  O   . ALA A 1 116 ? -8.720  32.998  25.401  1.00 29.91 ? 116 ALA A O   1 
ATOM   841  C  CB  . ALA A 1 116 ? -7.061  35.306  24.082  1.00 30.73 ? 116 ALA A CB  1 
ATOM   842  N  N   . GLN A 1 117 ? -10.098 34.791  25.216  1.00 30.04 ? 117 GLN A N   1 
ATOM   843  C  CA  . GLN A 1 117 ? -10.900 34.406  26.383  1.00 31.73 ? 117 GLN A CA  1 
ATOM   844  C  C   . GLN A 1 117 ? -12.324 33.974  26.057  1.00 33.84 ? 117 GLN A C   1 
ATOM   845  O  O   . GLN A 1 117 ? -13.151 33.805  26.953  1.00 35.99 ? 117 GLN A O   1 
ATOM   846  C  CB  . GLN A 1 117 ? -10.919 35.535  27.436  1.00 35.56 ? 117 GLN A CB  1 
ATOM   847  C  CG  . GLN A 1 117 ? -9.526  35.833  28.015  1.00 38.98 ? 117 GLN A CG  1 
ATOM   848  C  CD  . GLN A 1 117 ? -9.535  36.807  29.187  1.00 40.13 ? 117 GLN A CD  1 
ATOM   849  O  OE1 . GLN A 1 117 ? -10.070 36.509  30.261  1.00 37.91 ? 117 GLN A OE1 1 
ATOM   850  N  NE2 . GLN A 1 117 ? -8.943  37.978  28.981  1.00 37.68 ? 117 GLN A NE2 1 
ATOM   851  N  N   . ASN A 1 118 ? -12.598 33.764  24.772  1.00 36.14 ? 118 ASN A N   1 
ATOM   852  C  CA  . ASN A 1 118 ? -13.934 33.337  24.338  1.00 37.51 ? 118 ASN A CA  1 
ATOM   853  C  C   . ASN A 1 118 ? -13.927 31.807  24.153  1.00 34.04 ? 118 ASN A C   1 
ATOM   854  O  O   . ASN A 1 118 ? -13.450 31.303  23.130  1.00 34.98 ? 118 ASN A O   1 
ATOM   855  C  CB  . ASN A 1 118 ? -14.300 34.004  23.003  1.00 38.54 ? 118 ASN A CB  1 
ATOM   856  C  CG  . ASN A 1 118 ? -15.754 33.772  22.622  1.00 40.80 ? 118 ASN A CG  1 
ATOM   857  O  OD1 . ASN A 1 118 ? -16.321 32.716  22.921  1.00 40.47 ? 118 ASN A OD1 1 
ATOM   858  N  ND2 . ASN A 1 118 ? -16.355 34.741  21.935  1.00 44.14 ? 118 ASN A ND2 1 
ATOM   859  N  N   . THR A 1 119 ? -14.456 31.083  25.133  1.00 35.44 ? 119 THR A N   1 
ATOM   860  C  CA  . THR A 1 119 ? -14.448 29.629  25.057  1.00 37.11 ? 119 THR A CA  1 
ATOM   861  C  C   . THR A 1 119 ? -15.209 29.102  23.848  1.00 41.08 ? 119 THR A C   1 
ATOM   862  O  O   . THR A 1 119 ? -14.954 27.988  23.385  1.00 38.82 ? 119 THR A O   1 
ATOM   863  C  CB  . THR A 1 119 ? -15.019 28.992  26.339  1.00 35.96 ? 119 THR A CB  1 
ATOM   864  O  OG1 . THR A 1 119 ? -16.361 29.453  26.553  1.00 42.23 ? 119 THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 119 ? -14.174 29.363  27.533  1.00 38.74 ? 119 THR A CG2 1 
ATOM   866  N  N   . SER A 1 120 ? -16.134 29.902  23.316  1.00 41.76 ? 120 SER A N   1 
ATOM   867  C  CA  . SER A 1 120 ? -16.907 29.463  22.150  1.00 40.58 ? 120 SER A CA  1 
ATOM   868  C  C   . SER A 1 120 ? -16.140 29.573  20.837  1.00 38.41 ? 120 SER A C   1 
ATOM   869  O  O   . SER A 1 120 ? -16.496 28.921  19.861  1.00 39.80 ? 120 SER A O   1 
ATOM   870  C  CB  . SER A 1 120 ? -18.212 30.276  22.031  1.00 41.48 ? 120 SER A CB  1 
ATOM   871  O  OG  . SER A 1 120 ? -19.040 30.084  23.164  1.00 42.28 ? 120 SER A OG  1 
ATOM   872  N  N   . ALA A 1 121 ? -15.091 30.386  20.799  1.00 35.60 ? 121 ALA A N   1 
ATOM   873  C  CA  . ALA A 1 121 ? -14.340 30.576  19.558  1.00 35.54 ? 121 ALA A CA  1 
ATOM   874  C  C   . ALA A 1 121 ? -13.100 29.694  19.395  1.00 36.17 ? 121 ALA A C   1 
ATOM   875  O  O   . ALA A 1 121 ? -12.422 29.770  18.362  1.00 37.86 ? 121 ALA A O   1 
ATOM   876  C  CB  . ALA A 1 121 ? -13.934 32.037  19.420  1.00 32.65 ? 121 ALA A CB  1 
ATOM   877  N  N   . ASN A 1 122 ? -12.793 28.868  20.397  1.00 33.79 ? 122 ASN A N   1 
ATOM   878  C  CA  . ASN A 1 122 ? -11.595 28.020  20.322  1.00 32.28 ? 122 ASN A CA  1 
ATOM   879  C  C   . ASN A 1 122 ? -11.863 26.533  20.532  1.00 29.68 ? 122 ASN A C   1 
ATOM   880  O  O   . ASN A 1 122 ? -12.907 26.153  21.063  1.00 31.68 ? 122 ASN A O   1 
ATOM   881  C  CB  . ASN A 1 122 ? -10.571 28.471  21.386  1.00 29.84 ? 122 ASN A CB  1 
ATOM   882  C  CG  . ASN A 1 122 ? -10.154 29.926  21.234  1.00 31.75 ? 122 ASN A CG  1 
ATOM   883  O  OD1 . ASN A 1 122 ? -9.447  30.295  20.294  1.00 34.91 ? 122 ASN A OD1 1 
ATOM   884  N  ND2 . ASN A 1 122 ? -10.602 30.765  22.161  1.00 32.32 ? 122 ASN A ND2 1 
ATOM   885  N  N   . GLN A 1 123 ? -10.896 25.703  20.118  1.00 28.32 ? 123 GLN A N   1 
ATOM   886  C  CA  . GLN A 1 123 ? -10.932 24.243  20.307  1.00 27.18 ? 123 GLN A CA  1 
ATOM   887  C  C   . GLN A 1 123 ? -9.503  23.832  20.660  1.00 25.69 ? 123 GLN A C   1 
ATOM   888  O  O   . GLN A 1 123 ? -8.691  23.528  19.785  1.00 24.04 ? 123 GLN A O   1 
ATOM   889  C  CB  . GLN A 1 123 ? -11.341 23.487  19.035  1.00 31.40 ? 123 GLN A CB  1 
ATOM   890  C  CG  . GLN A 1 123 ? -12.813 23.498  18.743  1.00 38.52 ? 123 GLN A CG  1 
ATOM   891  C  CD  . GLN A 1 123 ? -13.121 22.603  17.568  1.00 39.71 ? 123 GLN A CD  1 
ATOM   892  O  OE1 . GLN A 1 123 ? -12.688 22.870  16.450  1.00 40.19 ? 123 GLN A OE1 1 
ATOM   893  N  NE2 . GLN A 1 123 ? -13.850 21.524  17.820  1.00 40.45 ? 123 GLN A NE2 1 
ATOM   894  N  N   . VAL A 1 124 ? -9.192  23.830  21.947  1.00 23.93 ? 124 VAL A N   1 
ATOM   895  C  CA  . VAL A 1 124 ? -7.840  23.474  22.323  1.00 22.35 ? 124 VAL A CA  1 
ATOM   896  C  C   . VAL A 1 124 ? -7.807  23.129  23.776  1.00 21.56 ? 124 VAL A C   1 
ATOM   897  O  O   . VAL A 1 124 ? -8.528  23.717  24.583  1.00 22.19 ? 124 VAL A O   1 
ATOM   898  C  CB  . VAL A 1 124 ? -6.874  24.674  22.033  1.00 24.14 ? 124 VAL A CB  1 
ATOM   899  C  CG1 . VAL A 1 124 ? -7.373  25.901  22.782  1.00 28.86 ? 124 VAL A CG1 1 
ATOM   900  C  CG2 . VAL A 1 124 ? -5.425  24.358  22.461  1.00 23.29 ? 124 VAL A CG2 1 
ATOM   901  N  N   . ILE A 1 125 ? -7.006  22.132  24.120  1.00 20.52 ? 125 ILE A N   1 
ATOM   902  C  CA  . ILE A 1 125 ? -6.817  21.816  25.521  1.00 20.17 ? 125 ILE A CA  1 
ATOM   903  C  C   . ILE A 1 125 ? -5.309  21.952  25.632  1.00 21.72 ? 125 ILE A C   1 
ATOM   904  O  O   . ILE A 1 125 ? -4.587  21.432  24.795  1.00 17.42 ? 125 ILE A O   1 
ATOM   905  C  CB  . ILE A 1 125 ? -7.248  20.394  25.876  1.00 22.20 ? 125 ILE A CB  1 
ATOM   906  C  CG1 . ILE A 1 125 ? -8.780  20.312  25.863  1.00 21.19 ? 125 ILE A CG1 1 
ATOM   907  C  CG2 . ILE A 1 125 ? -6.694  19.996  27.258  1.00 22.52 ? 125 ILE A CG2 1 
ATOM   908  C  CD1 . ILE A 1 125 ? -9.332  18.944  26.269  1.00 26.77 ? 125 ILE A CD1 1 
ATOM   909  N  N   . ALA A 1 126 ? -4.831  22.676  26.632  1.00 18.44 ? 126 ALA A N   1 
ATOM   910  C  CA  . ALA A 1 126 ? -3.383  22.860  26.765  1.00 18.85 ? 126 ALA A CA  1 
ATOM   911  C  C   . ALA A 1 126 ? -2.956  22.851  28.220  1.00 15.35 ? 126 ALA A C   1 
ATOM   912  O  O   . ALA A 1 126 ? -3.755  23.135  29.111  1.00 19.78 ? 126 ALA A O   1 
ATOM   913  C  CB  . ALA A 1 126 ? -2.958  24.183  26.128  1.00 17.84 ? 126 ALA A CB  1 
ATOM   914  N  N   . VAL A 1 127 ? -1.694  22.514  28.457  1.00 17.13 ? 127 VAL A N   1 
ATOM   915  C  CA  . VAL A 1 127 ? -1.149  22.514  29.822  1.00 14.36 ? 127 VAL A CA  1 
ATOM   916  C  C   . VAL A 1 127 ? -0.002  23.501  29.659  1.00 14.54 ? 127 VAL A C   1 
ATOM   917  O  O   . VAL A 1 127 ? 0.959   23.242  28.928  1.00 15.04 ? 127 VAL A O   1 
ATOM   918  C  CB  . VAL A 1 127 ? -0.614  21.145  30.241  1.00 18.12 ? 127 VAL A CB  1 
ATOM   919  C  CG1 . VAL A 1 127 ? 0.053   21.282  31.620  1.00 15.96 ? 127 VAL A CG1 1 
ATOM   920  C  CG2 . VAL A 1 127 ? -1.765  20.130  30.315  1.00 18.09 ? 127 VAL A CG2 1 
ATOM   921  N  N   . GLU A 1 128 ? -0.120  24.656  30.317  1.00 15.31 ? 128 GLU A N   1 
ATOM   922  C  CA  . GLU A 1 128 ? 0.871   25.695  30.155  1.00 18.18 ? 128 GLU A CA  1 
ATOM   923  C  C   . GLU A 1 128 ? 1.813   25.814  31.350  1.00 15.80 ? 128 GLU A C   1 
ATOM   924  O  O   . GLU A 1 128 ? 1.425   25.523  32.478  1.00 15.91 ? 128 GLU A O   1 
ATOM   925  C  CB  . GLU A 1 128 ? 0.176   27.045  29.951  1.00 16.96 ? 128 GLU A CB  1 
ATOM   926  C  CG  . GLU A 1 128 ? -0.691  27.444  31.169  1.00 14.77 ? 128 GLU A CG  1 
ATOM   927  C  CD  . GLU A 1 128 ? -1.212  28.872  31.111  1.00 22.28 ? 128 GLU A CD  1 
ATOM   928  O  OE1 . GLU A 1 128 ? -0.949  29.602  32.071  1.00 17.28 ? 128 GLU A OE1 1 
ATOM   929  O  OE2 . GLU A 1 128 ? -1.884  29.258  30.147  1.00 22.25 ? 128 GLU A OE2 1 
ATOM   930  N  N   . PHE A 1 129 ? 3.044   26.235  31.069  1.00 15.39 ? 129 PHE A N   1 
ATOM   931  C  CA  . PHE A 1 129 ? 4.077   26.454  32.086  1.00 15.37 ? 129 PHE A CA  1 
ATOM   932  C  C   . PHE A 1 129 ? 4.396   27.912  31.782  1.00 16.97 ? 129 PHE A C   1 
ATOM   933  O  O   . PHE A 1 129 ? 5.184   28.235  30.895  1.00 16.91 ? 129 PHE A O   1 
ATOM   934  C  CB  . PHE A 1 129 ? 5.251   25.484  31.842  1.00 15.80 ? 129 PHE A CB  1 
ATOM   935  C  CG  . PHE A 1 129 ? 4.849   24.040  31.977  1.00 15.38 ? 129 PHE A CG  1 
ATOM   936  C  CD1 . PHE A 1 129 ? 4.217   23.362  30.932  1.00 18.45 ? 129 PHE A CD1 1 
ATOM   937  C  CD2 . PHE A 1 129 ? 5.011   23.388  33.189  1.00 18.29 ? 129 PHE A CD2 1 
ATOM   938  C  CE1 . PHE A 1 129 ? 3.743   22.044  31.109  1.00 19.41 ? 129 PHE A CE1 1 
ATOM   939  C  CE2 . PHE A 1 129 ? 4.548   22.098  33.370  1.00 18.39 ? 129 PHE A CE2 1 
ATOM   940  C  CZ  . PHE A 1 129 ? 3.909   21.425  32.325  1.00 17.21 ? 129 PHE A CZ  1 
ATOM   941  N  N   . ASP A 1 130 ? 3.768   28.778  32.576  1.00 17.56 ? 130 ASP A N   1 
ATOM   942  C  CA  . ASP A 1 130 ? 3.727   30.225  32.360  1.00 15.61 ? 130 ASP A CA  1 
ATOM   943  C  C   . ASP A 1 130 ? 4.630   30.969  33.316  1.00 17.51 ? 130 ASP A C   1 
ATOM   944  O  O   . ASP A 1 130 ? 4.386   30.973  34.513  1.00 16.78 ? 130 ASP A O   1 
ATOM   945  C  CB  . ASP A 1 130 ? 2.248   30.629  32.559  1.00 16.10 ? 130 ASP A CB  1 
ATOM   946  C  CG  . ASP A 1 130 ? 1.912   32.043  32.030  1.00 16.04 ? 130 ASP A CG  1 
ATOM   947  O  OD1 . ASP A 1 130 ? 2.858   32.823  31.851  1.00 17.55 ? 130 ASP A OD1 1 
ATOM   948  O  OD2 . ASP A 1 130 ? 0.693   32.335  31.833  1.00 17.52 ? 130 ASP A OD2 1 
ATOM   949  N  N   . THR A 1 131 ? 5.663   31.620  32.778  1.00 17.28 ? 131 THR A N   1 
ATOM   950  C  CA  . THR A 1 131 ? 6.639   32.300  33.624  1.00 18.66 ? 131 THR A CA  1 
ATOM   951  C  C   . THR A 1 131 ? 6.494   33.810  33.719  1.00 22.66 ? 131 THR A C   1 
ATOM   952  O  O   . THR A 1 131 ? 7.267   34.463  34.432  1.00 23.19 ? 131 THR A O   1 
ATOM   953  C  CB  . THR A 1 131 ? 8.061   32.055  33.103  1.00 19.25 ? 131 THR A CB  1 
ATOM   954  O  OG1 . THR A 1 131 ? 8.152   32.576  31.769  1.00 20.99 ? 131 THR A OG1 1 
ATOM   955  C  CG2 . THR A 1 131 ? 8.398   30.559  33.100  1.00 19.81 ? 131 THR A CG2 1 
ATOM   956  N  N   . PHE A 1 132 ? 5.516   34.372  33.024  1.00 20.17 ? 132 PHE A N   1 
ATOM   957  C  CA  . PHE A 1 132 ? 5.393   35.830  32.987  1.00 21.63 ? 132 PHE A CA  1 
ATOM   958  C  C   . PHE A 1 132 ? 3.938   36.196  33.255  1.00 19.24 ? 132 PHE A C   1 
ATOM   959  O  O   . PHE A 1 132 ? 3.031   35.709  32.586  1.00 18.34 ? 132 PHE A O   1 
ATOM   960  C  CB  . PHE A 1 132 ? 5.831   36.333  31.610  1.00 20.63 ? 132 PHE A CB  1 
ATOM   961  C  CG  . PHE A 1 132 ? 5.941   37.823  31.525  1.00 22.10 ? 132 PHE A CG  1 
ATOM   962  C  CD1 . PHE A 1 132 ? 7.130   38.457  31.881  1.00 25.30 ? 132 PHE A CD1 1 
ATOM   963  C  CD2 . PHE A 1 132 ? 4.858   38.588  31.117  1.00 26.61 ? 132 PHE A CD2 1 
ATOM   964  C  CE1 . PHE A 1 132 ? 7.242   39.859  31.826  1.00 25.01 ? 132 PHE A CE1 1 
ATOM   965  C  CE2 . PHE A 1 132 ? 4.946   40.000  31.058  1.00 29.84 ? 132 PHE A CE2 1 
ATOM   966  C  CZ  . PHE A 1 132 ? 6.147   40.627  31.416  1.00 24.62 ? 132 PHE A CZ  1 
ATOM   967  N  N   . TYR A 1 133 ? 3.718   37.081  34.228  1.00 18.96 ? 133 TYR A N   1 
ATOM   968  C  CA  . TYR A 1 133 ? 2.354   37.395  34.649  1.00 19.04 ? 133 TYR A CA  1 
ATOM   969  C  C   . TYR A 1 133 ? 2.039   38.861  34.931  1.00 21.86 ? 133 TYR A C   1 
ATOM   970  O  O   . TYR A 1 133 ? 1.091   39.148  35.659  1.00 26.27 ? 133 TYR A O   1 
ATOM   971  C  CB  . TYR A 1 133 ? 2.050   36.600  35.909  1.00 22.63 ? 133 TYR A CB  1 
ATOM   972  C  CG  . TYR A 1 133 ? 3.211   36.650  36.868  1.00 29.95 ? 133 TYR A CG  1 
ATOM   973  C  CD1 . TYR A 1 133 ? 4.275   35.760  36.736  1.00 31.14 ? 133 TYR A CD1 1 
ATOM   974  C  CD2 . TYR A 1 133 ? 3.297   37.644  37.842  1.00 32.27 ? 133 TYR A CD2 1 
ATOM   975  C  CE1 . TYR A 1 133 ? 5.400   35.851  37.542  1.00 34.73 ? 133 TYR A CE1 1 
ATOM   976  C  CE2 . TYR A 1 133 ? 4.433   37.745  38.666  1.00 36.77 ? 133 TYR A CE2 1 
ATOM   977  C  CZ  . TYR A 1 133 ? 5.475   36.841  38.501  1.00 36.49 ? 133 TYR A CZ  1 
ATOM   978  O  OH  . TYR A 1 133 ? 6.598   36.908  39.290  1.00 44.59 ? 133 TYR A OH  1 
ATOM   979  N  N   . ALA A 1 134 ? 2.822   39.771  34.372  1.00 22.96 ? 134 ALA A N   1 
ATOM   980  C  CA  . ALA A 1 134 ? 2.580   41.207  34.579  1.00 27.37 ? 134 ALA A CA  1 
ATOM   981  C  C   . ALA A 1 134 ? 1.102   41.505  34.274  1.00 28.95 ? 134 ALA A C   1 
ATOM   982  O  O   . ALA A 1 134 ? 0.588   41.182  33.202  1.00 27.60 ? 134 ALA A O   1 
ATOM   983  C  CB  . ALA A 1 134 ? 3.500   42.031  33.681  1.00 25.35 ? 134 ALA A CB  1 
ATOM   984  N  N   . GLN A 1 135 ? 0.422   42.146  35.222  1.00 29.70 ? 135 GLN A N   1 
ATOM   985  C  CA  . GLN A 1 135 ? -1.002  42.395  35.068  1.00 28.95 ? 135 GLN A CA  1 
ATOM   986  C  C   . GLN A 1 135 ? -1.431  43.445  34.041  1.00 32.19 ? 135 GLN A C   1 
ATOM   987  O  O   . GLN A 1 135 ? -2.622  43.583  33.792  1.00 35.15 ? 135 GLN A O   1 
ATOM   988  C  CB  . GLN A 1 135 ? -1.611  42.707  36.438  1.00 28.40 ? 135 GLN A CB  1 
ATOM   989  C  CG  . GLN A 1 135 ? -1.322  41.643  37.495  1.00 34.93 ? 135 GLN A CG  1 
ATOM   990  C  CD  . GLN A 1 135 ? -2.132  40.377  37.297  1.00 36.86 ? 135 GLN A CD  1 
ATOM   991  O  OE1 . GLN A 1 135 ? -3.352  40.395  37.454  1.00 39.18 ? 135 GLN A OE1 1 
ATOM   992  N  NE2 . GLN A 1 135 ? -1.463  39.271  36.950  1.00 32.82 ? 135 GLN A NE2 1 
ATOM   993  N  N   . ASP A 1 136 ? -0.493  44.188  33.451  1.00 31.38 ? 136 ASP A N   1 
ATOM   994  C  CA  . ASP A 1 136 ? -0.888  45.167  32.439  1.00 32.76 ? 136 ASP A CA  1 
ATOM   995  C  C   . ASP A 1 136 ? -1.131  44.453  31.088  1.00 32.60 ? 136 ASP A C   1 
ATOM   996  O  O   . ASP A 1 136 ? -2.046  44.825  30.337  1.00 34.48 ? 136 ASP A O   1 
ATOM   997  C  CB  . ASP A 1 136 ? 0.177   46.263  32.283  1.00 32.33 ? 136 ASP A CB  1 
ATOM   998  C  CG  . ASP A 1 136 ? 1.516   45.712  31.870  1.00 40.65 ? 136 ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1 136 ? 2.066   44.861  32.606  1.00 37.50 ? 136 ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1 136 ? 2.015   46.125  30.805  1.00 41.16 ? 136 ASP A OD2 1 
ATOM   1001 N  N   . SER A 1 137 ? -0.338  43.424  30.787  1.00 26.18 ? 137 SER A N   1 
ATOM   1002 C  CA  . SER A 1 137 ? -0.490  42.689  29.518  1.00 26.76 ? 137 SER A CA  1 
ATOM   1003 C  C   . SER A 1 137 ? -1.102  41.267  29.642  1.00 27.73 ? 137 SER A C   1 
ATOM   1004 O  O   . SER A 1 137 ? -1.802  40.805  28.728  1.00 30.01 ? 137 SER A O   1 
ATOM   1005 C  CB  . SER A 1 137 ? 0.863   42.600  28.809  1.00 26.27 ? 137 SER A CB  1 
ATOM   1006 O  OG  . SER A 1 137 ? 1.795   41.919  29.639  1.00 27.72 ? 137 SER A OG  1 
ATOM   1007 N  N   . ASN A 1 138 ? -0.844  40.579  30.757  1.00 25.27 ? 138 ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 138 ? -1.378  39.225  30.974  1.00 23.28 ? 138 ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 138 ? -2.440  39.345  32.055  1.00 24.49 ? 138 ASN A C   1 
ATOM   1010 O  O   . ASN A 1 138 ? -2.311  38.767  33.130  1.00 23.94 ? 138 ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 138 ? -0.273  38.267  31.453  1.00 20.29 ? 138 ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 138 ? 0.762   37.957  30.377  1.00 23.64 ? 138 ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 138 ? 1.044   36.782  30.111  1.00 23.00 ? 138 ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 138 ? 1.351   38.999  29.762  1.00 22.52 ? 138 ASN A ND2 1 
ATOM   1015 N  N   . THR A 1 139 ? -3.515  40.061  31.744  1.00 23.62 ? 139 THR A N   1 
ATOM   1016 C  CA  . THR A 1 139 ? -4.569  40.337  32.715  1.00 27.34 ? 139 THR A CA  1 
ATOM   1017 C  C   . THR A 1 139 ? -5.304  39.146  33.271  1.00 27.81 ? 139 THR A C   1 
ATOM   1018 O  O   . THR A 1 139 ? -5.860  39.215  34.346  1.00 28.56 ? 139 THR A O   1 
ATOM   1019 C  CB  . THR A 1 139 ? -5.617  41.315  32.121  1.00 32.42 ? 139 THR A CB  1 
ATOM   1020 O  OG1 . THR A 1 139 ? -6.339  40.664  31.061  1.00 35.87 ? 139 THR A OG1 1 
ATOM   1021 C  CG2 . THR A 1 139 ? -4.922  42.536  31.530  1.00 33.33 ? 139 THR A CG2 1 
ATOM   1022 N  N   . TRP A 1 140 ? -5.279  38.044  32.534  1.00 24.37 ? 140 TRP A N   1 
ATOM   1023 C  CA  . TRP A 1 140 ? -5.981  36.826  32.914  1.00 24.24 ? 140 TRP A CA  1 
ATOM   1024 C  C   . TRP A 1 140 ? -5.200  35.943  33.891  1.00 22.85 ? 140 TRP A C   1 
ATOM   1025 O  O   . TRP A 1 140 ? -5.758  35.018  34.451  1.00 27.33 ? 140 TRP A O   1 
ATOM   1026 C  CB  . TRP A 1 140 ? -6.257  36.017  31.624  1.00 20.62 ? 140 TRP A CB  1 
ATOM   1027 C  CG  . TRP A 1 140 ? -5.002  35.854  30.844  1.00 21.06 ? 140 TRP A CG  1 
ATOM   1028 C  CD1 . TRP A 1 140 ? -3.974  35.000  31.121  1.00 20.43 ? 140 TRP A CD1 1 
ATOM   1029 C  CD2 . TRP A 1 140 ? -4.560  36.673  29.758  1.00 22.71 ? 140 TRP A CD2 1 
ATOM   1030 N  NE1 . TRP A 1 140 ? -2.918  35.243  30.277  1.00 23.11 ? 140 TRP A NE1 1 
ATOM   1031 C  CE2 . TRP A 1 140 ? -3.250  36.265  29.429  1.00 23.58 ? 140 TRP A CE2 1 
ATOM   1032 C  CE3 . TRP A 1 140 ? -5.144  37.721  29.029  1.00 24.08 ? 140 TRP A CE3 1 
ATOM   1033 C  CZ2 . TRP A 1 140 ? -2.510  36.866  28.399  1.00 25.59 ? 140 TRP A CZ2 1 
ATOM   1034 C  CZ3 . TRP A 1 140 ? -4.408  38.318  28.004  1.00 28.13 ? 140 TRP A CZ3 1 
ATOM   1035 C  CH2 . TRP A 1 140 ? -3.102  37.887  27.701  1.00 26.52 ? 140 TRP A CH2 1 
ATOM   1036 N  N   . ASP A 1 141 ? -3.911  36.212  34.067  1.00 22.37 ? 141 ASP A N   1 
ATOM   1037 C  CA  . ASP A 1 141 ? -3.044  35.401  34.935  1.00 23.18 ? 141 ASP A CA  1 
ATOM   1038 C  C   . ASP A 1 141 ? -3.042  35.703  36.433  1.00 25.36 ? 141 ASP A C   1 
ATOM   1039 O  O   . ASP A 1 141 ? -3.284  36.840  36.844  1.00 24.55 ? 141 ASP A O   1 
ATOM   1040 C  CB  . ASP A 1 141 ? -1.558  35.547  34.545  1.00 18.82 ? 141 ASP A CB  1 
ATOM   1041 C  CG  . ASP A 1 141 ? -1.153  34.741  33.308  1.00 18.97 ? 141 ASP A CG  1 
ATOM   1042 O  OD1 . ASP A 1 141 ? -1.796  33.736  33.039  1.00 17.69 ? 141 ASP A OD1 1 
ATOM   1043 O  OD2 . ASP A 1 141 ? -0.155  35.104  32.666  1.00 18.95 ? 141 ASP A OD2 1 
ATOM   1044 N  N   . PRO A 1 142 ? -2.811  34.670  37.264  1.00 24.44 ? 142 PRO A N   1 
ATOM   1045 C  CA  . PRO A 1 142 ? -2.733  34.867  38.716  1.00 25.91 ? 142 PRO A CA  1 
ATOM   1046 C  C   . PRO A 1 142 ? -1.410  35.657  38.837  1.00 23.96 ? 142 PRO A C   1 
ATOM   1047 O  O   . PRO A 1 142 ? -0.629  35.700  37.886  1.00 22.08 ? 142 PRO A O   1 
ATOM   1048 C  CB  . PRO A 1 142 ? -2.632  33.438  39.249  1.00 26.82 ? 142 PRO A CB  1 
ATOM   1049 C  CG  . PRO A 1 142 ? -1.940  32.704  38.117  1.00 27.51 ? 142 PRO A CG  1 
ATOM   1050 C  CD  . PRO A 1 142 ? -2.754  33.231  36.947  1.00 24.63 ? 142 PRO A CD  1 
ATOM   1051 N  N   . ASN A 1 143 ? -1.139  36.304  39.963  1.00 21.22 ? 143 ASN A N   1 
ATOM   1052 C  CA  . ASN A 1 143 ? 0.077   37.098  40.026  1.00 25.42 ? 143 ASN A CA  1 
ATOM   1053 C  C   . ASN A 1 143 ? 1.315   36.369  40.557  1.00 26.35 ? 143 ASN A C   1 
ATOM   1054 O  O   . ASN A 1 143 ? 1.920   36.751  41.557  1.00 29.34 ? 143 ASN A O   1 
ATOM   1055 C  CB  . ASN A 1 143 ? -0.227  38.446  40.770  1.00 32.05 ? 143 ASN A CB  1 
ATOM   1056 C  CG  A ASN A 1 143 ? -0.968  38.270  42.077  0.50 35.10 ? 143 ASN A CG  1 
ATOM   1057 C  CG  B ASN A 1 143 ? 0.921   39.424  40.712  0.50 34.81 ? 143 ASN A CG  1 
ATOM   1058 O  OD1 A ASN A 1 143 ? -1.827  37.398  42.215  0.50 39.28 ? 143 ASN A OD1 1 
ATOM   1059 O  OD1 B ASN A 1 143 ? 1.422   39.748  39.637  0.50 39.08 ? 143 ASN A OD1 1 
ATOM   1060 N  ND2 A ASN A 1 143 ? -0.678  39.149  43.036  0.50 39.39 ? 143 ASN A ND2 1 
ATOM   1061 N  ND2 B ASN A 1 143 ? 1.329   39.923  41.871  0.50 36.48 ? 143 ASN A ND2 1 
ATOM   1062 N  N   . TYR A 1 144 ? 1.677   35.292  39.858  1.00 23.31 ? 144 TYR A N   1 
ATOM   1063 C  CA  . TYR A 1 144 ? 2.852   34.481  40.178  1.00 23.51 ? 144 TYR A CA  1 
ATOM   1064 C  C   . TYR A 1 144 ? 3.053   33.447  39.066  1.00 22.91 ? 144 TYR A C   1 
ATOM   1065 O  O   . TYR A 1 144 ? 2.124   33.157  38.326  1.00 21.01 ? 144 TYR A O   1 
ATOM   1066 C  CB  . TYR A 1 144 ? 2.698   33.778  41.547  1.00 22.76 ? 144 TYR A CB  1 
ATOM   1067 C  CG  . TYR A 1 144 ? 1.361   33.133  41.829  1.00 22.50 ? 144 TYR A CG  1 
ATOM   1068 C  CD1 . TYR A 1 144 ? 1.013   31.890  41.267  1.00 20.97 ? 144 TYR A CD1 1 
ATOM   1069 C  CD2 . TYR A 1 144 ? 0.421   33.779  42.642  1.00 21.95 ? 144 TYR A CD2 1 
ATOM   1070 C  CE1 . TYR A 1 144 ? -0.234  31.316  41.508  1.00 25.70 ? 144 TYR A CE1 1 
ATOM   1071 C  CE2 . TYR A 1 144 ? -0.834  33.219  42.892  1.00 25.71 ? 144 TYR A CE2 1 
ATOM   1072 C  CZ  . TYR A 1 144 ? -1.162  31.988  42.322  1.00 24.98 ? 144 TYR A CZ  1 
ATOM   1073 O  OH  . TYR A 1 144 ? -2.413  31.470  42.527  1.00 26.98 ? 144 TYR A OH  1 
ATOM   1074 N  N   . PRO A 1 145 ? 4.275   32.902  38.927  1.00 24.38 ? 145 PRO A N   1 
ATOM   1075 C  CA  . PRO A 1 145 ? 4.542   31.890  37.885  1.00 21.59 ? 145 PRO A CA  1 
ATOM   1076 C  C   . PRO A 1 145 ? 3.617   30.706  38.195  1.00 20.22 ? 145 PRO A C   1 
ATOM   1077 O  O   . PRO A 1 145 ? 3.332   30.434  39.356  1.00 21.03 ? 145 PRO A O   1 
ATOM   1078 C  CB  . PRO A 1 145 ? 6.006   31.547  38.114  1.00 23.38 ? 145 PRO A CB  1 
ATOM   1079 C  CG  . PRO A 1 145 ? 6.550   32.845  38.699  1.00 28.43 ? 145 PRO A CG  1 
ATOM   1080 C  CD  . PRO A 1 145 ? 5.491   33.126  39.721  1.00 22.68 ? 145 PRO A CD  1 
ATOM   1081 N  N   . HIS A 1 146 ? 3.182   29.962  37.177  1.00 15.12 ? 146 HIS A N   1 
ATOM   1082 C  CA  . HIS A 1 146 ? 2.245   28.909  37.445  1.00 15.75 ? 146 HIS A CA  1 
ATOM   1083 C  C   . HIS A 1 146 ? 2.130   27.882  36.330  1.00 15.18 ? 146 HIS A C   1 
ATOM   1084 O  O   . HIS A 1 146 ? 2.546   28.141  35.212  1.00 17.21 ? 146 HIS A O   1 
ATOM   1085 C  CB  . HIS A 1 146 ? 0.845   29.530  37.628  1.00 16.26 ? 146 HIS A CB  1 
ATOM   1086 C  CG  . HIS A 1 146 ? 0.437   30.434  36.498  1.00 18.58 ? 146 HIS A CG  1 
ATOM   1087 N  ND1 . HIS A 1 146 ? 0.903   31.726  36.369  1.00 19.01 ? 146 HIS A ND1 1 
ATOM   1088 C  CD2 . HIS A 1 146 ? -0.324  30.202  35.399  1.00 15.83 ? 146 HIS A CD2 1 
ATOM   1089 C  CE1 . HIS A 1 146 ? 0.449   32.251  35.243  1.00 22.24 ? 146 HIS A CE1 1 
ATOM   1090 N  NE2 . HIS A 1 146 ? -0.294  31.343  34.634  1.00 16.66 ? 146 HIS A NE2 1 
ATOM   1091 N  N   . ILE A 1 147 ? 1.593   26.719  36.676  1.00 17.05 ? 147 ILE A N   1 
ATOM   1092 C  CA  . ILE A 1 147 ? 1.265   25.687  35.679  1.00 14.21 ? 147 ILE A CA  1 
ATOM   1093 C  C   . ILE A 1 147 ? -0.261  25.799  35.601  1.00 15.28 ? 147 ILE A C   1 
ATOM   1094 O  O   . ILE A 1 147 ? -0.950  25.916  36.628  1.00 19.31 ? 147 ILE A O   1 
ATOM   1095 C  CB  . ILE A 1 147 ? 1.660   24.277  36.173  1.00 14.53 ? 147 ILE A CB  1 
ATOM   1096 C  CG1 . ILE A 1 147 ? 3.176   24.214  36.311  1.00 18.55 ? 147 ILE A CG1 1 
ATOM   1097 C  CG2 . ILE A 1 147 ? 1.150   23.213  35.191  1.00 15.79 ? 147 ILE A CG2 1 
ATOM   1098 C  CD1 . ILE A 1 147 ? 3.690   22.994  37.075  1.00 22.48 ? 147 ILE A CD1 1 
ATOM   1099 N  N   . GLY A 1 148 ? -0.821  25.781  34.401  1.00 16.45 ? 148 GLY A N   1 
ATOM   1100 C  CA  . GLY A 1 148 ? -2.261  25.884  34.320  1.00 14.21 ? 148 GLY A CA  1 
ATOM   1101 C  C   . GLY A 1 148 ? -2.827  24.923  33.287  1.00 15.14 ? 148 GLY A C   1 
ATOM   1102 O  O   . GLY A 1 148 ? -2.114  24.472  32.395  1.00 16.78 ? 148 GLY A O   1 
ATOM   1103 N  N   . ILE A 1 149 ? -4.091  24.552  33.468  1.00 14.70 ? 149 ILE A N   1 
ATOM   1104 C  CA  . ILE A 1 149 ? -4.777  23.713  32.491  1.00 16.67 ? 149 ILE A CA  1 
ATOM   1105 C  C   . ILE A 1 149 ? -5.694  24.722  31.762  1.00 19.12 ? 149 ILE A C   1 
ATOM   1106 O  O   . ILE A 1 149 ? -6.458  25.452  32.403  1.00 19.38 ? 149 ILE A O   1 
ATOM   1107 C  CB  . ILE A 1 149 ? -5.560  22.579  33.207  1.00 17.84 ? 149 ILE A CB  1 
ATOM   1108 C  CG1 . ILE A 1 149 ? -4.543  21.589  33.809  1.00 19.15 ? 149 ILE A CG1 1 
ATOM   1109 C  CG2 . ILE A 1 149 ? -6.517  21.882  32.193  1.00 17.13 ? 149 ILE A CG2 1 
ATOM   1110 C  CD1 . ILE A 1 149 ? -5.157  20.489  34.660  1.00 23.04 ? 149 ILE A CD1 1 
ATOM   1111 N  N   . ASP A 1 150 ? -5.571  24.785  30.436  1.00 17.27 ? 150 ASP A N   1 
ATOM   1112 C  CA  . ASP A 1 150 ? -6.326  25.725  29.592  1.00 17.87 ? 150 ASP A CA  1 
ATOM   1113 C  C   . ASP A 1 150 ? -7.314  24.950  28.722  1.00 21.59 ? 150 ASP A C   1 
ATOM   1114 O  O   . ASP A 1 150 ? -6.913  24.059  27.957  1.00 21.73 ? 150 ASP A O   1 
ATOM   1115 C  CB  . ASP A 1 150 ? -5.380  26.491  28.657  1.00 17.58 ? 150 ASP A CB  1 
ATOM   1116 C  CG  . ASP A 1 150 ? -4.350  27.332  29.403  1.00 20.08 ? 150 ASP A CG  1 
ATOM   1117 O  OD1 . ASP A 1 150 ? -3.382  27.806  28.771  1.00 17.20 ? 150 ASP A OD1 1 
ATOM   1118 O  OD2 . ASP A 1 150 ? -4.524  27.517  30.616  1.00 22.37 ? 150 ASP A OD2 1 
ATOM   1119 N  N   . VAL A 1 151 ? -8.591  25.295  28.841  1.00 18.85 ? 151 VAL A N   1 
ATOM   1120 C  CA  . VAL A 1 151 ? -9.640  24.648  28.065  1.00 21.31 ? 151 VAL A CA  1 
ATOM   1121 C  C   . VAL A 1 151 ? -10.365 25.757  27.298  1.00 23.44 ? 151 VAL A C   1 
ATOM   1122 O  O   . VAL A 1 151 ? -11.174 26.483  27.872  1.00 23.52 ? 151 VAL A O   1 
ATOM   1123 C  CB  . VAL A 1 151 ? -10.638 23.890  28.967  1.00 21.15 ? 151 VAL A CB  1 
ATOM   1124 C  CG1 . VAL A 1 151 ? -11.713 23.244  28.092  1.00 25.61 ? 151 VAL A CG1 1 
ATOM   1125 C  CG2 . VAL A 1 151 ? -9.917  22.804  29.787  1.00 17.94 ? 151 VAL A CG2 1 
ATOM   1126 N  N   . ASN A 1 152 ? -10.005 25.905  26.025  1.00 22.28 ? 152 ASN A N   1 
ATOM   1127 C  CA  . ASN A 1 152 ? -10.565 26.917  25.112  1.00 24.82 ? 152 ASN A CA  1 
ATOM   1128 C  C   . ASN A 1 152 ? -10.338 28.388  25.482  1.00 27.68 ? 152 ASN A C   1 
ATOM   1129 O  O   . ASN A 1 152 ? -10.971 29.283  24.927  1.00 25.08 ? 152 ASN A O   1 
ATOM   1130 C  CB  . ASN A 1 152 ? -12.057 26.671  24.900  1.00 24.96 ? 152 ASN A CB  1 
ATOM   1131 C  CG  . ASN A 1 152 ? -12.326 25.358  24.166  1.00 29.80 ? 152 ASN A CG  1 
ATOM   1132 O  OD1 . ASN A 1 152 ? -11.493 24.898  23.389  1.00 28.41 ? 152 ASN A OD1 1 
ATOM   1133 N  ND2 . ASN A 1 152 ? -13.488 24.775  24.391  1.00 26.35 ? 152 ASN A ND2 1 
ATOM   1134 N  N   . SER A 1 153 ? -9.421  28.646  26.406  1.00 24.74 ? 153 SER A N   1 
ATOM   1135 C  CA  . SER A 1 153 ? -9.166  30.023  26.810  1.00 23.67 ? 153 SER A CA  1 
ATOM   1136 C  C   . SER A 1 153 ? -7.788  30.142  27.439  1.00 25.67 ? 153 SER A C   1 
ATOM   1137 O  O   . SER A 1 153 ? -7.322  29.197  28.080  1.00 24.20 ? 153 SER A O   1 
ATOM   1138 C  CB  . SER A 1 153 ? -10.225 30.468  27.819  1.00 25.28 ? 153 SER A CB  1 
ATOM   1139 O  OG  . SER A 1 153 ? -9.880  31.727  28.382  1.00 24.91 ? 153 SER A OG  1 
ATOM   1140 N  N   . ILE A 1 154 ? -7.143  31.293  27.244  1.00 23.17 ? 154 ILE A N   1 
ATOM   1141 C  CA  . ILE A 1 154 ? -5.830  31.541  27.831  1.00 21.99 ? 154 ILE A CA  1 
ATOM   1142 C  C   . ILE A 1 154 ? -5.991  31.733  29.353  1.00 23.28 ? 154 ILE A C   1 
ATOM   1143 O  O   . ILE A 1 154 ? -5.013  31.668  30.115  1.00 22.39 ? 154 ILE A O   1 
ATOM   1144 C  CB  . ILE A 1 154 ? -5.139  32.766  27.155  1.00 20.36 ? 154 ILE A CB  1 
ATOM   1145 C  CG1 . ILE A 1 154 ? -3.640  32.815  27.507  1.00 21.09 ? 154 ILE A CG1 1 
ATOM   1146 C  CG2 . ILE A 1 154 ? -5.796  34.056  27.590  1.00 20.23 ? 154 ILE A CG2 1 
ATOM   1147 C  CD1 . ILE A 1 154 ? -2.829  31.606  27.046  1.00 21.64 ? 154 ILE A CD1 1 
ATOM   1148 N  N   . ARG A 1 155 ? -7.220  31.969  29.808  1.00 22.91 ? 155 ARG A N   1 
ATOM   1149 C  CA  . ARG A 1 155 ? -7.460  32.108  31.249  1.00 22.10 ? 155 ARG A CA  1 
ATOM   1150 C  C   . ARG A 1 155 ? -7.695  30.685  31.770  1.00 20.49 ? 155 ARG A C   1 
ATOM   1151 O  O   . ARG A 1 155 ? -8.782  30.112  31.613  1.00 23.27 ? 155 ARG A O   1 
ATOM   1152 C  CB  . ARG A 1 155 ? -8.688  32.983  31.550  1.00 22.02 ? 155 ARG A CB  1 
ATOM   1153 C  CG  . ARG A 1 155 ? -8.966  33.062  33.069  1.00 27.25 ? 155 ARG A CG  1 
ATOM   1154 C  CD  . ARG A 1 155 ? -10.208 33.859  33.433  1.00 34.82 ? 155 ARG A CD  1 
ATOM   1155 N  NE  . ARG A 1 155 ? -9.994  35.300  33.322  1.00 40.04 ? 155 ARG A NE  1 
ATOM   1156 N  N   . SER A 1 156 ? -6.669  30.127  32.398  1.00 19.06 ? 156 SER A N   1 
ATOM   1157 C  CA  . SER A 1 156 ? -6.692  28.760  32.894  1.00 16.87 ? 156 SER A CA  1 
ATOM   1158 C  C   . SER A 1 156 ? -7.878  28.393  33.774  1.00 22.69 ? 156 SER A C   1 
ATOM   1159 O  O   . SER A 1 156 ? -8.285  29.184  34.616  1.00 24.11 ? 156 SER A O   1 
ATOM   1160 C  CB  . SER A 1 156 ? -5.396  28.488  33.678  1.00 17.70 ? 156 SER A CB  1 
ATOM   1161 O  OG  . SER A 1 156 ? -4.249  28.714  32.880  1.00 17.68 ? 156 SER A OG  1 
ATOM   1162 N  N   . VAL A 1 157 ? -8.435  27.196  33.589  1.00 18.43 ? 157 VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 157 ? -9.525  26.778  34.451  1.00 21.93 ? 157 VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 157 ? -9.000  26.355  35.820  1.00 24.58 ? 157 VAL A C   1 
ATOM   1165 O  O   . VAL A 1 157 ? -9.746  26.330  36.794  1.00 24.71 ? 157 VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 157 ? -10.353 25.617  33.855  1.00 24.75 ? 157 VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 157 ? -11.014 26.080  32.570  1.00 27.46 ? 157 VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 157 ? -9.472  24.357  33.661  1.00 24.14 ? 157 VAL A CG2 1 
ATOM   1169 N  N   . LYS A 1 158 ? -7.707  26.051  35.909  1.00 20.86 ? 158 LYS A N   1 
ATOM   1170 C  CA  . LYS A 1 158 ? -7.126  25.618  37.172  1.00 20.90 ? 158 LYS A CA  1 
ATOM   1171 C  C   . LYS A 1 158 ? -5.619  25.898  37.108  1.00 21.43 ? 158 LYS A C   1 
ATOM   1172 O  O   . LYS A 1 158 ? -4.988  25.652  36.070  1.00 20.44 ? 158 LYS A O   1 
ATOM   1173 C  CB  . LYS A 1 158 ? -7.349  24.116  37.333  1.00 24.94 ? 158 LYS A CB  1 
ATOM   1174 C  CG  . LYS A 1 158 ? -7.092  23.555  38.717  1.00 33.52 ? 158 LYS A CG  1 
ATOM   1175 C  CD  . LYS A 1 158 ? -8.191  23.969  39.691  1.00 38.14 ? 158 LYS A CD  1 
ATOM   1176 C  CE  . LYS A 1 158 ? -8.051  23.249  41.030  1.00 44.69 ? 158 LYS A CE  1 
ATOM   1177 N  NZ  . LYS A 1 158 ? -8.315  21.779  40.900  1.00 48.64 ? 158 LYS A NZ  1 
ATOM   1178 N  N   . THR A 1 159 ? -5.040  26.416  38.186  1.00 19.43 ? 159 THR A N   1 
ATOM   1179 C  CA  . THR A 1 159 ? -3.597  26.691  38.197  1.00 18.68 ? 159 THR A CA  1 
ATOM   1180 C  C   . THR A 1 159 ? -2.976  26.249  39.506  1.00 22.43 ? 159 THR A C   1 
ATOM   1181 O  O   . THR A 1 159 ? -3.679  26.008  40.506  1.00 23.51 ? 159 THR A O   1 
ATOM   1182 C  CB  . THR A 1 159 ? -3.240  28.194  38.055  1.00 20.27 ? 159 THR A CB  1 
ATOM   1183 O  OG1 . THR A 1 159 ? -3.740  28.949  39.180  1.00 23.33 ? 159 THR A OG1 1 
ATOM   1184 C  CG2 . THR A 1 159 ? -3.829  28.760  36.784  1.00 22.89 ? 159 THR A CG2 1 
ATOM   1185 N  N   . VAL A 1 160 ? -1.655  26.112  39.498  1.00 19.23 ? 160 VAL A N   1 
ATOM   1186 C  CA  . VAL A 1 160 ? -0.939  25.810  40.731  1.00 20.38 ? 160 VAL A CA  1 
ATOM   1187 C  C   . VAL A 1 160 ? 0.310   26.679  40.669  1.00 21.10 ? 160 VAL A C   1 
ATOM   1188 O  O   . VAL A 1 160 ? 0.893   26.852  39.594  1.00 20.07 ? 160 VAL A O   1 
ATOM   1189 C  CB  . VAL A 1 160 ? -0.592  24.270  40.873  1.00 19.55 ? 160 VAL A CB  1 
ATOM   1190 C  CG1 . VAL A 1 160 ? 0.337   23.791  39.751  1.00 19.74 ? 160 VAL A CG1 1 
ATOM   1191 C  CG2 . VAL A 1 160 ? 0.024   24.006  42.232  1.00 25.44 ? 160 VAL A CG2 1 
ATOM   1192 N  N   . LYS A 1 161 ? 0.703   27.272  41.792  1.00 18.68 ? 161 LYS A N   1 
ATOM   1193 C  CA  . LYS A 1 161 ? 1.914   28.090  41.787  1.00 21.08 ? 161 LYS A CA  1 
ATOM   1194 C  C   . LYS A 1 161 ? 3.111   27.213  41.446  1.00 20.57 ? 161 LYS A C   1 
ATOM   1195 O  O   . LYS A 1 161 ? 3.226   26.072  41.925  1.00 20.62 ? 161 LYS A O   1 
ATOM   1196 C  CB  . LYS A 1 161 ? 2.155   28.731  43.153  1.00 25.29 ? 161 LYS A CB  1 
ATOM   1197 C  CG  . LYS A 1 161 ? 3.387   29.631  43.174  1.00 26.84 ? 161 LYS A CG  1 
ATOM   1198 C  CD  . LYS A 1 161 ? 3.755   29.992  44.600  1.00 40.57 ? 161 LYS A CD  1 
ATOM   1199 C  CE  . LYS A 1 161 ? 4.916   30.965  44.645  1.00 39.47 ? 161 LYS A CE  1 
ATOM   1200 N  NZ  . LYS A 1 161 ? 6.102   30.384  43.979  1.00 44.48 ? 161 LYS A NZ  1 
ATOM   1201 N  N   . TRP A 1 162 ? 4.015   27.755  40.642  1.00 18.59 ? 162 TRP A N   1 
ATOM   1202 C  CA  . TRP A 1 162 ? 5.186   27.020  40.196  1.00 20.25 ? 162 TRP A CA  1 
ATOM   1203 C  C   . TRP A 1 162 ? 6.441   27.900  40.299  1.00 23.91 ? 162 TRP A C   1 
ATOM   1204 O  O   . TRP A 1 162 ? 6.344   29.112  40.367  1.00 27.65 ? 162 TRP A O   1 
ATOM   1205 C  CB  . TRP A 1 162 ? 4.903   26.546  38.745  1.00 21.26 ? 162 TRP A CB  1 
ATOM   1206 C  CG  . TRP A 1 162 ? 6.044   25.926  37.976  1.00 22.36 ? 162 TRP A CG  1 
ATOM   1207 C  CD1 . TRP A 1 162 ? 6.776   24.810  38.308  1.00 23.16 ? 162 TRP A CD1 1 
ATOM   1208 C  CD2 . TRP A 1 162 ? 6.568   26.398  36.735  1.00 20.20 ? 162 TRP A CD2 1 
ATOM   1209 N  NE1 . TRP A 1 162 ? 7.734   24.571  37.336  1.00 20.18 ? 162 TRP A NE1 1 
ATOM   1210 C  CE2 . TRP A 1 162 ? 7.626   25.531  36.365  1.00 19.20 ? 162 TRP A CE2 1 
ATOM   1211 C  CE3 . TRP A 1 162 ? 6.243   27.482  35.889  1.00 21.69 ? 162 TRP A CE3 1 
ATOM   1212 C  CZ2 . TRP A 1 162 ? 8.372   25.715  35.180  1.00 20.62 ? 162 TRP A CZ2 1 
ATOM   1213 C  CZ3 . TRP A 1 162 ? 6.984   27.663  34.712  1.00 21.27 ? 162 TRP A CZ3 1 
ATOM   1214 C  CH2 . TRP A 1 162 ? 8.034   26.782  34.376  1.00 20.98 ? 162 TRP A CH2 1 
ATOM   1215 N  N   . ASP A 1 163 ? 7.611   27.273  40.352  1.00 23.19 ? 163 ASP A N   1 
ATOM   1216 C  CA  . ASP A 1 163 ? 8.872   27.987  40.436  1.00 22.73 ? 163 ASP A CA  1 
ATOM   1217 C  C   . ASP A 1 163 ? 9.667   27.767  39.153  1.00 23.21 ? 163 ASP A C   1 
ATOM   1218 O  O   . ASP A 1 163 ? 9.877   26.625  38.732  1.00 25.22 ? 163 ASP A O   1 
ATOM   1219 C  CB  . ASP A 1 163 ? 9.689   27.441  41.617  1.00 24.10 ? 163 ASP A CB  1 
ATOM   1220 C  CG  . ASP A 1 163 ? 8.899   27.443  42.911  1.00 30.34 ? 163 ASP A CG  1 
ATOM   1221 O  OD1 . ASP A 1 163 ? 8.485   28.542  43.343  1.00 33.70 ? 163 ASP A OD1 1 
ATOM   1222 O  OD2 . ASP A 1 163 ? 8.672   26.352  43.480  1.00 33.56 ? 163 ASP A OD2 1 
ATOM   1223 N  N   . ARG A 1 164 ? 10.116  28.851  38.544  1.00 21.73 ? 164 ARG A N   1 
ATOM   1224 C  CA  . ARG A 1 164 ? 10.928  28.765  37.329  1.00 21.18 ? 164 ARG A CA  1 
ATOM   1225 C  C   . ARG A 1 164 ? 12.382  28.624  37.794  1.00 24.29 ? 164 ARG A C   1 
ATOM   1226 O  O   . ARG A 1 164 ? 12.834  29.394  38.654  1.00 23.91 ? 164 ARG A O   1 
ATOM   1227 C  CB  . ARG A 1 164 ? 10.768  30.057  36.516  1.00 22.11 ? 164 ARG A CB  1 
ATOM   1228 C  CG  . ARG A 1 164 ? 11.644  30.140  35.276  1.00 25.75 ? 164 ARG A CG  1 
ATOM   1229 C  CD  . ARG A 1 164 ? 11.558  31.513  34.621  1.00 28.30 ? 164 ARG A CD  1 
ATOM   1230 N  NE  . ARG A 1 164 ? 12.362  31.579  33.404  1.00 29.35 ? 164 ARG A NE  1 
ATOM   1231 C  CZ  . ARG A 1 164 ? 13.693  31.553  33.357  1.00 30.82 ? 164 ARG A CZ  1 
ATOM   1232 N  NH1 . ARG A 1 164 ? 14.307  31.613  32.183  1.00 30.10 ? 164 ARG A NH1 1 
ATOM   1233 N  NH2 . ARG A 1 164 ? 14.414  31.509  34.474  1.00 33.00 ? 164 ARG A NH2 1 
ATOM   1234 N  N   . ARG A 1 165 ? 13.106  27.640  37.272  1.00 21.07 ? 165 ARG A N   1 
ATOM   1235 C  CA  . ARG A 1 165 ? 14.518  27.468  37.646  1.00 24.72 ? 165 ARG A CA  1 
ATOM   1236 C  C   . ARG A 1 165 ? 15.333  27.525  36.363  1.00 26.97 ? 165 ARG A C   1 
ATOM   1237 O  O   . ARG A 1 165 ? 15.291  26.610  35.548  1.00 23.95 ? 165 ARG A O   1 
ATOM   1238 C  CB  . ARG A 1 165 ? 14.743  26.133  38.341  1.00 26.38 ? 165 ARG A CB  1 
ATOM   1239 C  CG  . ARG A 1 165 ? 14.028  26.006  39.654  1.00 28.50 ? 165 ARG A CG  1 
ATOM   1240 C  CD  . ARG A 1 165 ? 14.474  24.757  40.365  1.00 30.14 ? 165 ARG A CD  1 
ATOM   1241 N  NE  . ARG A 1 165 ? 13.755  24.572  41.612  1.00 31.08 ? 165 ARG A NE  1 
ATOM   1242 C  CZ  . ARG A 1 165 ? 13.853  23.483  42.366  1.00 34.41 ? 165 ARG A CZ  1 
ATOM   1243 N  NH1 . ARG A 1 165 ? 13.154  23.397  43.490  1.00 32.78 ? 165 ARG A NH1 1 
ATOM   1244 N  NH2 . ARG A 1 165 ? 14.645  22.486  41.990  1.00 32.26 ? 165 ARG A NH2 1 
ATOM   1245 N  N   . ASP A 1 166 ? 16.082  28.602  36.184  1.00 24.96 ? 166 ASP A N   1 
ATOM   1246 C  CA  . ASP A 1 166 ? 16.866  28.766  34.967  1.00 25.98 ? 166 ASP A CA  1 
ATOM   1247 C  C   . ASP A 1 166 ? 17.806  27.598  34.675  1.00 27.20 ? 166 ASP A C   1 
ATOM   1248 O  O   . ASP A 1 166 ? 18.569  27.167  35.533  1.00 27.26 ? 166 ASP A O   1 
ATOM   1249 C  CB  . ASP A 1 166 ? 17.668  30.071  35.045  1.00 27.91 ? 166 ASP A CB  1 
ATOM   1250 C  CG  . ASP A 1 166 ? 18.058  30.595  33.680  1.00 34.26 ? 166 ASP A CG  1 
ATOM   1251 O  OD1 . ASP A 1 166 ? 17.213  31.245  33.021  1.00 35.75 ? 166 ASP A OD1 1 
ATOM   1252 O  OD2 . ASP A 1 166 ? 19.202  30.337  33.249  1.00 40.44 ? 166 ASP A OD2 1 
ATOM   1253 N  N   . GLY A 1 167 ? 17.724  27.072  33.455  1.00 28.67 ? 167 GLY A N   1 
ATOM   1254 C  CA  . GLY A 1 167 ? 18.585  25.972  33.059  1.00 29.23 ? 167 GLY A CA  1 
ATOM   1255 C  C   . GLY A 1 167 ? 18.317  24.583  33.610  1.00 31.79 ? 167 GLY A C   1 
ATOM   1256 O  O   . GLY A 1 167 ? 19.036  23.650  33.248  1.00 34.98 ? 167 GLY A O   1 
ATOM   1257 N  N   . GLN A 1 168 ? 17.321  24.406  34.477  1.00 28.06 ? 168 GLN A N   1 
ATOM   1258 C  CA  . GLN A 1 168 ? 17.049  23.080  35.015  1.00 26.21 ? 168 GLN A CA  1 
ATOM   1259 C  C   . GLN A 1 168 ? 15.897  22.400  34.286  1.00 23.90 ? 168 GLN A C   1 
ATOM   1260 O  O   . GLN A 1 168 ? 14.871  23.026  34.036  1.00 23.45 ? 168 GLN A O   1 
ATOM   1261 C  CB  . GLN A 1 168 ? 16.716  23.158  36.489  1.00 29.32 ? 168 GLN A CB  1 
ATOM   1262 C  CG  . GLN A 1 168 ? 17.924  23.509  37.327  1.00 39.23 ? 168 GLN A CG  1 
ATOM   1263 C  CD  . GLN A 1 168 ? 17.591  23.512  38.795  1.00 45.96 ? 168 GLN A CD  1 
ATOM   1264 O  OE1 . GLN A 1 168 ? 17.013  22.548  39.308  1.00 45.98 ? 168 GLN A OE1 1 
ATOM   1265 N  NE2 . GLN A 1 168 ? 17.951  24.599  39.491  1.00 51.24 ? 168 GLN A NE2 1 
ATOM   1266 N  N   . SER A 1 169 ? 16.071  21.124  33.953  1.00 20.05 ? 169 SER A N   1 
ATOM   1267 C  CA  . SER A 1 169 ? 15.007  20.403  33.237  1.00 19.21 ? 169 SER A CA  1 
ATOM   1268 C  C   . SER A 1 169 ? 13.837  20.030  34.153  1.00 18.17 ? 169 SER A C   1 
ATOM   1269 O  O   . SER A 1 169 ? 14.045  19.557  35.280  1.00 20.51 ? 169 SER A O   1 
ATOM   1270 C  CB  . SER A 1 169 ? 15.580  19.117  32.630  1.00 22.33 ? 169 SER A CB  1 
ATOM   1271 O  OG  . SER A 1 169 ? 16.644  19.443  31.767  1.00 28.44 ? 169 SER A OG  1 
ATOM   1272 N  N   . LEU A 1 170 ? 12.606  20.220  33.668  1.00 16.15 ? 170 LEU A N   1 
ATOM   1273 C  CA  . LEU A 1 170 ? 11.428  19.851  34.448  1.00 16.16 ? 170 LEU A CA  1 
ATOM   1274 C  C   . LEU A 1 170 ? 10.859  18.628  33.757  1.00 15.94 ? 170 LEU A C   1 
ATOM   1275 O  O   . LEU A 1 170 ? 10.691  18.638  32.540  1.00 17.98 ? 170 LEU A O   1 
ATOM   1276 C  CB  . LEU A 1 170 ? 10.363  20.953  34.400  1.00 14.46 ? 170 LEU A CB  1 
ATOM   1277 C  CG  . LEU A 1 170 ? 9.091   20.738  35.222  1.00 22.08 ? 170 LEU A CG  1 
ATOM   1278 C  CD1 . LEU A 1 170 ? 9.370   20.858  36.722  1.00 19.25 ? 170 LEU A CD1 1 
ATOM   1279 C  CD2 . LEU A 1 170 ? 8.094   21.829  34.818  1.00 18.94 ? 170 LEU A CD2 1 
ATOM   1280 N  N   . ASN A 1 171 ? 10.569  17.591  34.526  1.00 16.53 ? 171 ASN A N   1 
ATOM   1281 C  CA  . ASN A 1 171 ? 10.015  16.374  33.968  1.00 17.73 ? 171 ASN A CA  1 
ATOM   1282 C  C   . ASN A 1 171 ? 8.525   16.420  34.217  1.00 17.65 ? 171 ASN A C   1 
ATOM   1283 O  O   . ASN A 1 171 ? 8.088   16.668  35.330  1.00 18.47 ? 171 ASN A O   1 
ATOM   1284 C  CB  . ASN A 1 171 ? 10.642  15.159  34.622  1.00 17.77 ? 171 ASN A CB  1 
ATOM   1285 C  CG  A ASN A 1 171 ? 10.483  13.927  33.780  0.50 25.07 ? 171 ASN A CG  1 
ATOM   1286 C  CG  B ASN A 1 171 ? 12.125  15.082  34.363  0.50 22.85 ? 171 ASN A CG  1 
ATOM   1287 O  OD1 A ASN A 1 171 ? 9.382   13.400  33.629  0.50 31.17 ? 171 ASN A OD1 1 
ATOM   1288 O  OD1 B ASN A 1 171 ? 12.564  15.150  33.224  0.50 26.71 ? 171 ASN A OD1 1 
ATOM   1289 N  ND2 A ASN A 1 171 ? 11.585  13.476  33.184  0.50 28.02 ? 171 ASN A ND2 1 
ATOM   1290 N  ND2 B ASN A 1 171 ? 12.907  14.941  35.416  0.50 30.77 ? 171 ASN A ND2 1 
ATOM   1291 N  N   . VAL A 1 172 ? 7.758   16.183  33.161  1.00 13.82 ? 172 VAL A N   1 
ATOM   1292 C  CA  . VAL A 1 172 ? 6.302   16.286  33.241  1.00 13.24 ? 172 VAL A CA  1 
ATOM   1293 C  C   . VAL A 1 172 ? 5.577   15.055  32.734  1.00 17.06 ? 172 VAL A C   1 
ATOM   1294 O  O   . VAL A 1 172 ? 5.957   14.475  31.702  1.00 15.92 ? 172 VAL A O   1 
ATOM   1295 C  CB  . VAL A 1 172 ? 5.787   17.483  32.370  1.00 15.78 ? 172 VAL A CB  1 
ATOM   1296 C  CG1 . VAL A 1 172 ? 4.287   17.747  32.678  1.00 16.67 ? 172 VAL A CG1 1 
ATOM   1297 C  CG2 . VAL A 1 172 ? 6.662   18.739  32.634  1.00 13.28 ? 172 VAL A CG2 1 
ATOM   1298 N  N   . LEU A 1 173 ? 4.533   14.667  33.469  1.00 12.61 ? 173 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 173 ? 3.686   13.575  33.053  1.00 14.11 ? 173 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 173 ? 2.268   14.155  32.978  1.00 15.73 ? 173 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 173 ? 1.778   14.722  33.973  1.00 17.80 ? 173 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 173 ? 3.694   12.468  34.095  1.00 17.52 ? 173 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 173 ? 2.832   11.254  33.772  1.00 26.52 ? 173 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 173 ? 3.379   10.593  32.493  1.00 28.08 ? 173 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 173 ? 2.873   10.279  34.957  1.00 26.25 ? 173 LEU A CD2 1 
ATOM   1306 N  N   . VAL A 1 174 ? 1.628   14.042  31.819  1.00 14.45 ? 174 VAL A N   1 
ATOM   1307 C  CA  . VAL A 1 174 ? 0.233   14.503  31.672  1.00 13.85 ? 174 VAL A CA  1 
ATOM   1308 C  C   . VAL A 1 174 ? -0.572  13.254  31.333  1.00 16.97 ? 174 VAL A C   1 
ATOM   1309 O  O   . VAL A 1 174 ? -0.226  12.520  30.398  1.00 16.52 ? 174 VAL A O   1 
ATOM   1310 C  CB  . VAL A 1 174 ? 0.090   15.514  30.522  1.00 16.30 ? 174 VAL A CB  1 
ATOM   1311 C  CG1 . VAL A 1 174 ? -1.400  15.864  30.299  1.00 16.85 ? 174 VAL A CG1 1 
ATOM   1312 C  CG2 . VAL A 1 174 ? 0.880   16.784  30.853  1.00 17.17 ? 174 VAL A CG2 1 
ATOM   1313 N  N   . THR A 1 175 ? -1.637  12.983  32.086  1.00 14.32 ? 175 THR A N   1 
ATOM   1314 C  CA  . THR A 1 175 ? -2.416  11.777  31.827  1.00 15.32 ? 175 THR A CA  1 
ATOM   1315 C  C   . THR A 1 175 ? -3.902  12.137  31.761  1.00 16.72 ? 175 THR A C   1 
ATOM   1316 O  O   . THR A 1 175 ? -4.347  13.065  32.434  1.00 19.97 ? 175 THR A O   1 
ATOM   1317 C  CB  . THR A 1 175 ? -2.258  10.734  32.968  1.00 20.01 ? 175 THR A CB  1 
ATOM   1318 O  OG1 . THR A 1 175 ? -2.707  11.303  34.196  1.00 29.46 ? 175 THR A OG1 1 
ATOM   1319 C  CG2 . THR A 1 175 ? -0.776  10.326  33.177  1.00 20.75 ? 175 THR A CG2 1 
ATOM   1320 N  N   . PHE A 1 176 ? -4.650  11.420  30.932  1.00 16.32 ? 176 PHE A N   1 
ATOM   1321 C  CA  . PHE A 1 176 ? -6.099  11.619  30.885  1.00 15.57 ? 176 PHE A CA  1 
ATOM   1322 C  C   . PHE A 1 176 ? -6.729  10.231  31.043  1.00 16.78 ? 176 PHE A C   1 
ATOM   1323 O  O   . PHE A 1 176 ? -6.400  9.292   30.304  1.00 17.91 ? 176 PHE A O   1 
ATOM   1324 C  CB  . PHE A 1 176 ? -6.570  12.251  29.573  1.00 15.36 ? 176 PHE A CB  1 
ATOM   1325 C  CG  . PHE A 1 176 ? -8.074  12.401  29.499  1.00 18.97 ? 176 PHE A CG  1 
ATOM   1326 C  CD1 . PHE A 1 176 ? -8.723  13.322  30.317  1.00 20.37 ? 176 PHE A CD1 1 
ATOM   1327 C  CD2 . PHE A 1 176 ? -8.840  11.590  28.663  1.00 17.45 ? 176 PHE A CD2 1 
ATOM   1328 C  CE1 . PHE A 1 176 ? -10.137 13.443  30.311  1.00 22.65 ? 176 PHE A CE1 1 
ATOM   1329 C  CE2 . PHE A 1 176 ? -10.261 11.702  28.647  1.00 21.28 ? 176 PHE A CE2 1 
ATOM   1330 C  CZ  . PHE A 1 176 ? -10.899 12.630  29.474  1.00 20.50 ? 176 PHE A CZ  1 
ATOM   1331 N  N   . ASN A 1 177 ? -7.649  10.116  32.000  1.00 17.42 ? 177 ASN A N   1 
ATOM   1332 C  CA  . ASN A 1 177 ? -8.318  8.858   32.305  1.00 21.89 ? 177 ASN A CA  1 
ATOM   1333 C  C   . ASN A 1 177 ? -9.808  9.049   31.904  1.00 24.00 ? 177 ASN A C   1 
ATOM   1334 O  O   . ASN A 1 177 ? -10.547 9.830   32.525  1.00 23.42 ? 177 ASN A O   1 
ATOM   1335 C  CB  . ASN A 1 177 ? -8.169  8.606   33.795  1.00 20.12 ? 177 ASN A CB  1 
ATOM   1336 C  CG  . ASN A 1 177 ? -8.811  7.273   34.238  1.00 27.99 ? 177 ASN A CG  1 
ATOM   1337 O  OD1 . ASN A 1 177 ? -9.819  6.857   33.691  1.00 29.36 ? 177 ASN A OD1 1 
ATOM   1338 N  ND2 . ASN A 1 177 ? -8.230  6.631   35.248  1.00 32.69 ? 177 ASN A ND2 1 
ATOM   1339 N  N   . PRO A 1 178 ? -10.249 8.367   30.848  1.00 21.98 ? 178 PRO A N   1 
ATOM   1340 C  CA  . PRO A 1 178 ? -11.637 8.511   30.396  1.00 26.36 ? 178 PRO A CA  1 
ATOM   1341 C  C   . PRO A 1 178 ? -12.686 8.015   31.404  1.00 26.88 ? 178 PRO A C   1 
ATOM   1342 O  O   . PRO A 1 178 ? -13.835 8.443   31.380  1.00 29.97 ? 178 PRO A O   1 
ATOM   1343 C  CB  . PRO A 1 178 ? -11.645 7.708   29.087  1.00 27.53 ? 178 PRO A CB  1 
ATOM   1344 C  CG  . PRO A 1 178 ? -10.687 6.590   29.407  1.00 29.25 ? 178 PRO A CG  1 
ATOM   1345 C  CD  . PRO A 1 178 ? -9.532  7.396   30.001  1.00 25.22 ? 178 PRO A CD  1 
ATOM   1346 N  N   . SER A 1 179 ? -12.275 7.121   32.281  1.00 28.19 ? 179 SER A N   1 
ATOM   1347 C  CA  . SER A 1 179 ? -13.167 6.553   33.266  1.00 33.53 ? 179 SER A CA  1 
ATOM   1348 C  C   . SER A 1 179 ? -13.652 7.658   34.217  1.00 37.35 ? 179 SER A C   1 
ATOM   1349 O  O   . SER A 1 179 ? -14.866 7.843   34.433  1.00 35.16 ? 179 SER A O   1 
ATOM   1350 C  CB  . SER A 1 179 ? -12.401 5.455   34.010  1.00 36.31 ? 179 SER A CB  1 
ATOM   1351 O  OG  . SER A 1 179 ? -13.266 4.636   34.760  1.00 48.11 ? 179 SER A OG  1 
ATOM   1352 N  N   . THR A 1 180 ? -12.698 8.428   34.737  1.00 31.87 ? 180 THR A N   1 
ATOM   1353 C  CA  . THR A 1 180 ? -12.982 9.525   35.673  1.00 29.92 ? 180 THR A CA  1 
ATOM   1354 C  C   . THR A 1 180 ? -13.033 10.900  35.016  1.00 29.37 ? 180 THR A C   1 
ATOM   1355 O  O   . THR A 1 180 ? -13.510 11.862  35.626  1.00 30.40 ? 180 THR A O   1 
ATOM   1356 C  CB  . THR A 1 180 ? -11.895 9.571   36.738  1.00 31.15 ? 180 THR A CB  1 
ATOM   1357 O  OG1 . THR A 1 180 ? -10.623 9.779   36.099  1.00 25.47 ? 180 THR A OG1 1 
ATOM   1358 C  CG2 . THR A 1 180 ? -11.845 8.252   37.506  1.00 30.42 ? 180 THR A CG2 1 
ATOM   1359 N  N   . ARG A 1 181 ? -12.543 10.998  33.779  1.00 24.92 ? 181 ARG A N   1 
ATOM   1360 C  CA  . ARG A 1 181 ? -12.471 12.258  33.034  1.00 23.51 ? 181 ARG A CA  1 
ATOM   1361 C  C   . ARG A 1 181 ? -11.473 13.247  33.641  1.00 23.89 ? 181 ARG A C   1 
ATOM   1362 O  O   . ARG A 1 181 ? -11.534 14.457  33.380  1.00 25.20 ? 181 ARG A O   1 
ATOM   1363 C  CB  . ARG A 1 181 ? -13.863 12.910  32.901  1.00 29.68 ? 181 ARG A CB  1 
ATOM   1364 C  CG  . ARG A 1 181 ? -14.811 12.080  31.993  1.00 29.48 ? 181 ARG A CG  1 
ATOM   1365 C  CD  . ARG A 1 181 ? -16.140 12.767  31.691  1.00 31.40 ? 181 ARG A CD  1 
ATOM   1366 N  N   . ASN A 1 182 ? -10.543 12.732  34.434  1.00 22.63 ? 182 ASN A N   1 
ATOM   1367 C  CA  . ASN A 1 182 ? -9.531  13.571  35.046  1.00 20.60 ? 182 ASN A CA  1 
ATOM   1368 C  C   . ASN A 1 182 ? -8.279  13.742  34.186  1.00 20.88 ? 182 ASN A C   1 
ATOM   1369 O  O   . ASN A 1 182 ? -7.695  12.745  33.729  1.00 18.90 ? 182 ASN A O   1 
ATOM   1370 C  CB  . ASN A 1 182 ? -9.090  13.004  36.403  1.00 26.50 ? 182 ASN A CB  1 
ATOM   1371 C  CG  . ASN A 1 182 ? -10.092 13.289  37.510  1.00 39.00 ? 182 ASN A CG  1 
ATOM   1372 O  OD1 . ASN A 1 182 ? -10.723 14.340  37.517  1.00 41.67 ? 182 ASN A OD1 1 
ATOM   1373 N  ND2 . ASN A 1 182 ? -10.215 12.368  38.467  1.00 38.57 ? 182 ASN A ND2 1 
ATOM   1374 N  N   . LEU A 1 183 ? -7.908  14.998  33.943  1.00 15.03 ? 183 LEU A N   1 
ATOM   1375 C  CA  . LEU A 1 183 ? -6.671  15.306  33.224  1.00 17.34 ? 183 LEU A CA  1 
ATOM   1376 C  C   . LEU A 1 183 ? -5.733  15.673  34.386  1.00 17.73 ? 183 LEU A C   1 
ATOM   1377 O  O   . LEU A 1 183 ? -5.974  16.673  35.109  1.00 20.66 ? 183 LEU A O   1 
ATOM   1378 C  CB  . LEU A 1 183 ? -6.896  16.488  32.300  1.00 17.31 ? 183 LEU A CB  1 
ATOM   1379 C  CG  . LEU A 1 183 ? -5.658  17.088  31.622  1.00 25.59 ? 183 LEU A CG  1 
ATOM   1380 C  CD1 . LEU A 1 183 ? -5.138  16.131  30.600  1.00 27.07 ? 183 LEU A CD1 1 
ATOM   1381 C  CD2 . LEU A 1 183 ? -6.054  18.393  30.916  1.00 29.13 ? 183 LEU A CD2 1 
ATOM   1382 N  N   . ASP A 1 184 ? -4.706  14.858  34.610  1.00 17.04 ? 184 ASP A N   1 
ATOM   1383 C  CA  . ASP A 1 184 ? -3.768  15.070  35.712  1.00 18.69 ? 184 ASP A CA  1 
ATOM   1384 C  C   . ASP A 1 184 ? -2.411  15.488  35.212  1.00 17.65 ? 184 ASP A C   1 
ATOM   1385 O  O   . ASP A 1 184 ? -1.917  14.963  34.199  1.00 15.71 ? 184 ASP A O   1 
ATOM   1386 C  CB  . ASP A 1 184 ? -3.563  13.800  36.545  1.00 22.18 ? 184 ASP A CB  1 
ATOM   1387 C  CG  . ASP A 1 184 ? -4.825  13.337  37.245  1.00 31.92 ? 184 ASP A CG  1 
ATOM   1388 O  OD1 . ASP A 1 184 ? -5.553  14.183  37.800  1.00 35.50 ? 184 ASP A OD1 1 
ATOM   1389 O  OD2 . ASP A 1 184 ? -5.080  12.118  37.257  1.00 38.26 ? 184 ASP A OD2 1 
ATOM   1390 N  N   . VAL A 1 185 ? -1.796  16.416  35.932  1.00 14.01 ? 185 VAL A N   1 
ATOM   1391 C  CA  . VAL A 1 185 ? -0.480  16.890  35.559  1.00 15.55 ? 185 VAL A CA  1 
ATOM   1392 C  C   . VAL A 1 185 ? 0.441   16.774  36.769  1.00 18.27 ? 185 VAL A C   1 
ATOM   1393 O  O   . VAL A 1 185 ? 0.091   17.205  37.877  1.00 17.78 ? 185 VAL A O   1 
ATOM   1394 C  CB  . VAL A 1 185 ? -0.498  18.368  35.166  1.00 16.93 ? 185 VAL A CB  1 
ATOM   1395 C  CG1 . VAL A 1 185 ? 0.918   18.813  34.764  1.00 17.31 ? 185 VAL A CG1 1 
ATOM   1396 C  CG2 . VAL A 1 185 ? -1.453  18.600  34.002  1.00 20.22 ? 185 VAL A CG2 1 
ATOM   1397 N  N   . VAL A 1 186 ? 1.607   16.182  36.566  1.00 16.70 ? 186 VAL A N   1 
ATOM   1398 C  CA  . VAL A 1 186 ? 2.591   16.048  37.639  1.00 15.87 ? 186 VAL A CA  1 
ATOM   1399 C  C   . VAL A 1 186 ? 3.921   16.519  37.041  1.00 17.89 ? 186 VAL A C   1 
ATOM   1400 O  O   . VAL A 1 186 ? 4.353   16.013  36.006  1.00 16.89 ? 186 VAL A O   1 
ATOM   1401 C  CB  . VAL A 1 186 ? 2.715   14.575  38.097  1.00 18.15 ? 186 VAL A CB  1 
ATOM   1402 C  CG1 . VAL A 1 186 ? 3.892   14.428  39.105  1.00 22.60 ? 186 VAL A CG1 1 
ATOM   1403 C  CG2 . VAL A 1 186 ? 1.402   14.115  38.710  1.00 26.34 ? 186 VAL A CG2 1 
ATOM   1404 N  N   . ALA A 1 187 ? 4.557   17.497  37.670  1.00 14.92 ? 187 ALA A N   1 
ATOM   1405 C  CA  . ALA A 1 187 ? 5.817   18.005  37.154  1.00 14.56 ? 187 ALA A CA  1 
ATOM   1406 C  C   . ALA A 1 187 ? 6.849   17.954  38.268  1.00 19.63 ? 187 ALA A C   1 
ATOM   1407 O  O   . ALA A 1 187 ? 6.544   18.334  39.396  1.00 16.99 ? 187 ALA A O   1 
ATOM   1408 C  CB  . ALA A 1 187 ? 5.645   19.436  36.705  1.00 15.78 ? 187 ALA A CB  1 
ATOM   1409 N  N   . THR A 1 188 ? 8.067   17.517  37.957  1.00 16.40 ? 188 THR A N   1 
ATOM   1410 C  CA  . THR A 1 188 ? 9.085   17.426  38.996  1.00 16.97 ? 188 THR A CA  1 
ATOM   1411 C  C   . THR A 1 188 ? 10.484  17.856  38.553  1.00 20.21 ? 188 THR A C   1 
ATOM   1412 O  O   . THR A 1 188 ? 10.891  17.642  37.401  1.00 19.10 ? 188 THR A O   1 
ATOM   1413 C  CB  . THR A 1 188 ? 9.209   15.983  39.523  1.00 24.23 ? 188 THR A CB  1 
ATOM   1414 O  OG1 . THR A 1 188 ? 9.766   15.166  38.497  1.00 30.73 ? 188 THR A OG1 1 
ATOM   1415 C  CG2 . THR A 1 188 ? 7.837   15.385  39.880  1.00 23.58 ? 188 THR A CG2 1 
ATOM   1416 N  N   . TYR A 1 189 ? 11.213  18.502  39.459  1.00 19.77 ? 189 TYR A N   1 
ATOM   1417 C  CA  . TYR A 1 189 ? 12.609  18.849  39.174  1.00 18.69 ? 189 TYR A CA  1 
ATOM   1418 C  C   . TYR A 1 189 ? 13.427  17.654  39.703  1.00 19.95 ? 189 TYR A C   1 
ATOM   1419 O  O   . TYR A 1 189 ? 12.914  16.832  40.486  1.00 20.77 ? 189 TYR A O   1 
ATOM   1420 C  CB  . TYR A 1 189 ? 13.023  20.153  39.884  1.00 20.82 ? 189 TYR A CB  1 
ATOM   1421 C  CG  . TYR A 1 189 ? 12.512  21.384  39.191  1.00 19.49 ? 189 TYR A CG  1 
ATOM   1422 C  CD1 . TYR A 1 189 ? 11.570  22.214  39.797  1.00 19.21 ? 189 TYR A CD1 1 
ATOM   1423 C  CD2 . TYR A 1 189 ? 12.977  21.727  37.923  1.00 21.90 ? 189 TYR A CD2 1 
ATOM   1424 C  CE1 . TYR A 1 189 ? 11.102  23.356  39.172  1.00 17.35 ? 189 TYR A CE1 1 
ATOM   1425 C  CE2 . TYR A 1 189 ? 12.522  22.867  37.277  1.00 19.22 ? 189 TYR A CE2 1 
ATOM   1426 C  CZ  . TYR A 1 189 ? 11.584  23.679  37.907  1.00 20.70 ? 189 TYR A CZ  1 
ATOM   1427 O  OH  . TYR A 1 189 ? 11.118  24.799  37.291  1.00 21.66 ? 189 TYR A OH  1 
ATOM   1428 N  N   . SER A 1 190 ? 14.693  17.571  39.304  1.00 22.33 ? 190 SER A N   1 
ATOM   1429 C  CA  . SER A 1 190 ? 15.529  16.433  39.693  1.00 29.74 ? 190 SER A CA  1 
ATOM   1430 C  C   . SER A 1 190 ? 15.749  16.266  41.190  1.00 28.83 ? 190 SER A C   1 
ATOM   1431 O  O   . SER A 1 190 ? 16.094  15.169  41.637  1.00 31.72 ? 190 SER A O   1 
ATOM   1432 C  CB  . SER A 1 190 ? 16.886  16.504  38.999  1.00 29.17 ? 190 SER A CB  1 
ATOM   1433 O  OG  . SER A 1 190 ? 17.633  17.593  39.499  1.00 37.47 ? 190 SER A OG  1 
ATOM   1434 N  N   . ASP A 1 191 ? 15.530  17.327  41.964  1.00 26.10 ? 191 ASP A N   1 
ATOM   1435 C  CA  . ASP A 1 191 ? 15.730  17.236  43.406  1.00 24.57 ? 191 ASP A CA  1 
ATOM   1436 C  C   . ASP A 1 191 ? 14.494  16.701  44.126  1.00 26.53 ? 191 ASP A C   1 
ATOM   1437 O  O   . ASP A 1 191 ? 14.484  16.548  45.350  1.00 28.75 ? 191 ASP A O   1 
ATOM   1438 C  CB  . ASP A 1 191 ? 16.135  18.599  43.983  1.00 24.02 ? 191 ASP A CB  1 
ATOM   1439 C  CG  . ASP A 1 191 ? 15.051  19.661  43.845  1.00 29.96 ? 191 ASP A CG  1 
ATOM   1440 O  OD1 . ASP A 1 191 ? 13.923  19.360  43.374  1.00 24.05 ? 191 ASP A OD1 1 
ATOM   1441 O  OD2 . ASP A 1 191 ? 15.343  20.818  44.222  1.00 29.63 ? 191 ASP A OD2 1 
ATOM   1442 N  N   . GLY A 1 192 ? 13.456  16.388  43.357  1.00 23.41 ? 192 GLY A N   1 
ATOM   1443 C  CA  . GLY A 1 192 ? 12.233  15.859  43.941  1.00 23.08 ? 192 GLY A CA  1 
ATOM   1444 C  C   . GLY A 1 192 ? 11.117  16.877  44.153  1.00 21.03 ? 192 GLY A C   1 
ATOM   1445 O  O   . GLY A 1 192 ? 9.998   16.511  44.537  1.00 21.29 ? 192 GLY A O   1 
ATOM   1446 N  N   . THR A 1 193 ? 11.386  18.151  43.890  1.00 20.01 ? 193 THR A N   1 
ATOM   1447 C  CA  . THR A 1 193 ? 10.342  19.148  44.067  1.00 20.67 ? 193 THR A CA  1 
ATOM   1448 C  C   . THR A 1 193 ? 9.248   18.845  43.037  1.00 21.18 ? 193 THR A C   1 
ATOM   1449 O  O   . THR A 1 193 ? 9.521   18.811  41.834  1.00 22.28 ? 193 THR A O   1 
ATOM   1450 C  CB  . THR A 1 193 ? 10.922  20.533  43.846  1.00 22.82 ? 193 THR A CB  1 
ATOM   1451 O  OG1 . THR A 1 193 ? 12.038  20.709  44.726  1.00 26.94 ? 193 THR A OG1 1 
ATOM   1452 C  CG2 . THR A 1 193 ? 9.866   21.603  44.157  1.00 20.53 ? 193 THR A CG2 1 
ATOM   1453 N  N   . ARG A 1 194 ? 8.014   18.693  43.514  1.00 17.21 ? 194 ARG A N   1 
ATOM   1454 C  CA  . ARG A 1 194 ? 6.895   18.284  42.705  1.00 19.15 ? 194 ARG A CA  1 
ATOM   1455 C  C   . ARG A 1 194 ? 5.712   19.263  42.707  1.00 21.31 ? 194 ARG A C   1 
ATOM   1456 O  O   . ARG A 1 194 ? 5.448   19.959  43.700  1.00 19.28 ? 194 ARG A O   1 
ATOM   1457 C  CB  . ARG A 1 194 ? 6.492   16.915  43.245  1.00 21.74 ? 194 ARG A CB  1 
ATOM   1458 C  CG  . ARG A 1 194 ? 5.243   16.251  42.726  1.00 25.17 ? 194 ARG A CG  1 
ATOM   1459 C  CD  . ARG A 1 194 ? 5.188   14.834  43.354  1.00 29.63 ? 194 ARG A CD  1 
ATOM   1460 N  NE  . ARG A 1 194 ? 3.925   14.143  43.106  1.00 33.76 ? 194 ARG A NE  1 
ATOM   1461 C  CZ  . ARG A 1 194 ? 3.809   12.988  42.454  1.00 38.33 ? 194 ARG A CZ  1 
ATOM   1462 N  NH1 . ARG A 1 194 ? 4.885   12.377  41.971  1.00 34.25 ? 194 ARG A NH1 1 
ATOM   1463 N  NH2 . ARG A 1 194 ? 2.604   12.446  42.279  1.00 40.36 ? 194 ARG A NH2 1 
ATOM   1464 N  N   . TYR A 1 195 ? 5.040   19.342  41.564  1.00 18.39 ? 195 TYR A N   1 
ATOM   1465 C  CA  . TYR A 1 195 ? 3.870   20.208  41.416  1.00 18.47 ? 195 TYR A CA  1 
ATOM   1466 C  C   . TYR A 1 195 ? 2.772   19.356  40.801  1.00 20.53 ? 195 TYR A C   1 
ATOM   1467 O  O   . TYR A 1 195 ? 3.025   18.562  39.875  1.00 19.79 ? 195 TYR A O   1 
ATOM   1468 C  CB  . TYR A 1 195 ? 4.158   21.396  40.488  1.00 15.06 ? 195 TYR A CB  1 
ATOM   1469 C  CG  . TYR A 1 195 ? 5.402   22.149  40.840  1.00 19.95 ? 195 TYR A CG  1 
ATOM   1470 C  CD1 . TYR A 1 195 ? 6.652   21.704  40.412  1.00 17.78 ? 195 TYR A CD1 1 
ATOM   1471 C  CD2 . TYR A 1 195 ? 5.340   23.291  41.647  1.00 21.97 ? 195 TYR A CD2 1 
ATOM   1472 C  CE1 . TYR A 1 195 ? 7.811   22.378  40.777  1.00 19.43 ? 195 TYR A CE1 1 
ATOM   1473 C  CE2 . TYR A 1 195 ? 6.498   23.975  42.024  1.00 19.75 ? 195 TYR A CE2 1 
ATOM   1474 C  CZ  . TYR A 1 195 ? 7.723   23.512  41.582  1.00 21.09 ? 195 TYR A CZ  1 
ATOM   1475 O  OH  . TYR A 1 195 ? 8.859   24.201  41.918  1.00 23.73 ? 195 TYR A OH  1 
ATOM   1476 N  N   . GLU A 1 196 ? 1.544   19.528  41.286  1.00 18.32 ? 196 GLU A N   1 
ATOM   1477 C  CA  . GLU A 1 196 ? 0.446   18.742  40.764  1.00 19.23 ? 196 GLU A CA  1 
ATOM   1478 C  C   . GLU A 1 196 ? -0.783  19.590  40.531  1.00 20.51 ? 196 GLU A C   1 
ATOM   1479 O  O   . GLU A 1 196 ? -1.088  20.464  41.337  1.00 18.75 ? 196 GLU A O   1 
ATOM   1480 C  CB  . GLU A 1 196 ? 0.087   17.644  41.752  1.00 18.83 ? 196 GLU A CB  1 
ATOM   1481 C  CG  . GLU A 1 196 ? 1.204   16.666  41.977  1.00 26.14 ? 196 GLU A CG  1 
ATOM   1482 C  CD  . GLU A 1 196 ? 0.824   15.578  42.957  1.00 35.32 ? 196 GLU A CD  1 
ATOM   1483 O  OE1 . GLU A 1 196 ? -0.337  15.121  42.925  1.00 42.14 ? 196 GLU A OE1 1 
ATOM   1484 O  OE2 . GLU A 1 196 ? 1.692   15.158  43.736  1.00 38.08 ? 196 GLU A OE2 1 
ATOM   1485 N  N   . VAL A 1 197 ? -1.467  19.356  39.413  1.00 18.07 ? 197 VAL A N   1 
ATOM   1486 C  CA  . VAL A 1 197 ? -2.715  20.092  39.135  1.00 19.07 ? 197 VAL A CA  1 
ATOM   1487 C  C   . VAL A 1 197 ? -3.582  19.144  38.313  1.00 21.74 ? 197 VAL A C   1 
ATOM   1488 O  O   . VAL A 1 197 ? -3.095  18.368  37.478  1.00 19.56 ? 197 VAL A O   1 
ATOM   1489 C  CB  . VAL A 1 197 ? -2.485  21.464  38.432  1.00 22.82 ? 197 VAL A CB  1 
ATOM   1490 C  CG1 . VAL A 1 197 ? -1.876  21.310  37.049  1.00 23.33 ? 197 VAL A CG1 1 
ATOM   1491 C  CG2 . VAL A 1 197 ? -3.823  22.230  38.350  1.00 26.12 ? 197 VAL A CG2 1 
ATOM   1492 N  N   . SER A 1 198 ? -4.877  19.195  38.569  1.00 20.10 ? 198 SER A N   1 
ATOM   1493 C  CA  . SER A 1 198 ? -5.808  18.288  37.917  1.00 20.53 ? 198 SER A CA  1 
ATOM   1494 C  C   . SER A 1 198 ? -7.132  18.985  37.647  1.00 25.14 ? 198 SER A C   1 
ATOM   1495 O  O   . SER A 1 198 ? -7.486  19.951  38.325  1.00 22.15 ? 198 SER A O   1 
ATOM   1496 C  CB  . SER A 1 198 ? -6.022  17.085  38.836  1.00 23.69 ? 198 SER A CB  1 
ATOM   1497 O  OG  . SER A 1 198 ? -7.120  16.324  38.421  1.00 38.42 ? 198 SER A OG  1 
ATOM   1498 N  N   . TYR A 1 199 ? -7.869  18.480  36.670  1.00 19.58 ? 199 TYR A N   1 
ATOM   1499 C  CA  . TYR A 1 199 ? -9.150  19.071  36.304  1.00 19.37 ? 199 TYR A CA  1 
ATOM   1500 C  C   . TYR A 1 199 ? -10.006 18.036  35.583  1.00 23.78 ? 199 TYR A C   1 
ATOM   1501 O  O   . TYR A 1 199 ? -9.500  17.254  34.756  1.00 20.18 ? 199 TYR A O   1 
ATOM   1502 C  CB  . TYR A 1 199 ? -8.916  20.265  35.386  1.00 23.01 ? 199 TYR A CB  1 
ATOM   1503 C  CG  . TYR A 1 199 ? -10.178 20.993  34.947  1.00 26.73 ? 199 TYR A CG  1 
ATOM   1504 C  CD1 . TYR A 1 199 ? -10.653 20.875  33.645  1.00 31.72 ? 199 TYR A CD1 1 
ATOM   1505 C  CD2 . TYR A 1 199 ? -10.884 21.795  35.837  1.00 32.88 ? 199 TYR A CD2 1 
ATOM   1506 C  CE1 . TYR A 1 199 ? -11.804 21.542  33.229  1.00 36.11 ? 199 TYR A CE1 1 
ATOM   1507 C  CE2 . TYR A 1 199 ? -12.045 22.472  35.435  1.00 30.98 ? 199 TYR A CE2 1 
ATOM   1508 C  CZ  . TYR A 1 199 ? -12.489 22.338  34.135  1.00 32.67 ? 199 TYR A CZ  1 
ATOM   1509 O  OH  . TYR A 1 199 ? -13.607 22.999  33.709  1.00 40.30 ? 199 TYR A OH  1 
ATOM   1510 N  N   . GLU A 1 200 ? -11.305 18.051  35.874  1.00 21.08 ? 200 GLU A N   1 
ATOM   1511 C  CA  . GLU A 1 200 ? -12.211 17.107  35.245  1.00 25.15 ? 200 GLU A CA  1 
ATOM   1512 C  C   . GLU A 1 200 ? -12.733 17.726  33.959  1.00 27.01 ? 200 GLU A C   1 
ATOM   1513 O  O   . GLU A 1 200 ? -13.262 18.834  33.977  1.00 26.42 ? 200 GLU A O   1 
ATOM   1514 C  CB  . GLU A 1 200 ? -13.366 16.791  36.197  1.00 29.09 ? 200 GLU A CB  1 
ATOM   1515 C  CG  . GLU A 1 200 ? -14.133 15.549  35.793  1.00 38.85 ? 200 GLU A CG  1 
ATOM   1516 C  CD  . GLU A 1 200 ? -15.325 15.264  36.687  1.00 42.56 ? 200 GLU A CD  1 
ATOM   1517 O  OE1 . GLU A 1 200 ? -15.173 15.326  37.928  1.00 43.50 ? 200 GLU A OE1 1 
ATOM   1518 O  OE2 . GLU A 1 200 ? -16.404 14.955  36.134  1.00 48.57 ? 200 GLU A OE2 1 
ATOM   1519 N  N   . VAL A 1 201 ? -12.578 17.032  32.834  1.00 25.97 ? 201 VAL A N   1 
ATOM   1520 C  CA  . VAL A 1 201 ? -13.044 17.571  31.571  1.00 25.82 ? 201 VAL A CA  1 
ATOM   1521 C  C   . VAL A 1 201 ? -13.492 16.463  30.638  1.00 30.18 ? 201 VAL A C   1 
ATOM   1522 O  O   . VAL A 1 201 ? -12.852 15.414  30.553  1.00 25.85 ? 201 VAL A O   1 
ATOM   1523 C  CB  . VAL A 1 201 ? -11.948 18.402  30.873  1.00 27.99 ? 201 VAL A CB  1 
ATOM   1524 C  CG1 . VAL A 1 201 ? -10.697 17.556  30.660  1.00 28.22 ? 201 VAL A CG1 1 
ATOM   1525 C  CG2 . VAL A 1 201 ? -12.446 18.920  29.534  1.00 28.89 ? 201 VAL A CG2 1 
ATOM   1526 N  N   . ASP A 1 202 ? -14.602 16.697  29.942  1.00 27.76 ? 202 ASP A N   1 
ATOM   1527 C  CA  . ASP A 1 202 ? -15.122 15.720  28.985  1.00 29.07 ? 202 ASP A CA  1 
ATOM   1528 C  C   . ASP A 1 202 ? -14.534 16.139  27.657  1.00 26.00 ? 202 ASP A C   1 
ATOM   1529 O  O   . ASP A 1 202 ? -15.011 17.089  27.027  1.00 25.50 ? 202 ASP A O   1 
ATOM   1530 C  CB  . ASP A 1 202 ? -16.644 15.798  28.923  1.00 32.72 ? 202 ASP A CB  1 
ATOM   1531 C  CG  . ASP A 1 202 ? -17.251 14.717  28.045  1.00 36.72 ? 202 ASP A CG  1 
ATOM   1532 O  OD1 . ASP A 1 202 ? -16.508 13.942  27.384  1.00 31.07 ? 202 ASP A OD1 1 
ATOM   1533 O  OD2 . ASP A 1 202 ? -18.496 14.657  28.019  1.00 40.18 ? 202 ASP A OD2 1 
ATOM   1534 N  N   . VAL A 1 203 ? -13.491 15.442  27.216  1.00 23.51 ? 203 VAL A N   1 
ATOM   1535 C  CA  . VAL A 1 203 ? -12.848 15.854  25.975  1.00 23.28 ? 203 VAL A CA  1 
ATOM   1536 C  C   . VAL A 1 203 ? -13.767 15.786  24.779  1.00 22.62 ? 203 VAL A C   1 
ATOM   1537 O  O   . VAL A 1 203 ? -13.550 16.483  23.797  1.00 25.96 ? 203 VAL A O   1 
ATOM   1538 C  CB  . VAL A 1 203 ? -11.560 15.032  25.706  1.00 24.63 ? 203 VAL A CB  1 
ATOM   1539 C  CG1 . VAL A 1 203 ? -10.644 15.135  26.924  1.00 25.44 ? 203 VAL A CG1 1 
ATOM   1540 C  CG2 . VAL A 1 203 ? -11.902 13.575  25.436  1.00 22.99 ? 203 VAL A CG2 1 
ATOM   1541 N  N   . ARG A 1 204 ? -14.791 14.944  24.846  1.00 26.51 ? 204 ARG A N   1 
ATOM   1542 C  CA  . ARG A 1 204 ? -15.732 14.818  23.733  1.00 30.39 ? 204 ARG A CA  1 
ATOM   1543 C  C   . ARG A 1 204 ? -16.498 16.095  23.425  1.00 30.99 ? 204 ARG A C   1 
ATOM   1544 O  O   . ARG A 1 204 ? -16.917 16.307  22.289  1.00 31.29 ? 204 ARG A O   1 
ATOM   1545 C  CB  . ARG A 1 204 ? -16.755 13.721  24.005  1.00 30.39 ? 204 ARG A CB  1 
ATOM   1546 C  CG  . ARG A 1 204 ? -16.171 12.344  24.077  1.00 35.44 ? 204 ARG A CG  1 
ATOM   1547 C  CD  . ARG A 1 204 ? -17.252 11.361  24.406  1.00 40.71 ? 204 ARG A CD  1 
ATOM   1548 N  NE  . ARG A 1 204 ? -17.871 11.698  25.685  1.00 44.32 ? 204 ARG A NE  1 
ATOM   1549 C  CZ  . ARG A 1 204 ? -18.845 10.990  26.245  1.00 49.84 ? 204 ARG A CZ  1 
ATOM   1550 N  NH1 . ARG A 1 204 ? -19.305 9.906   25.634  1.00 51.97 ? 204 ARG A NH1 1 
ATOM   1551 N  NH2 . ARG A 1 204 ? -19.362 11.367  27.409  1.00 52.40 ? 204 ARG A NH2 1 
ATOM   1552 N  N   . SER A 1 205 ? -16.710 16.940  24.422  1.00 30.22 ? 205 SER A N   1 
ATOM   1553 C  CA  . SER A 1 205 ? -17.449 18.167  24.145  1.00 33.98 ? 205 SER A CA  1 
ATOM   1554 C  C   . SER A 1 205 ? -16.564 19.365  23.808  1.00 34.00 ? 205 SER A C   1 
ATOM   1555 O  O   . SER A 1 205 ? -17.063 20.473  23.611  1.00 36.09 ? 205 SER A O   1 
ATOM   1556 C  CB  . SER A 1 205 ? -18.356 18.511  25.323  1.00 38.10 ? 205 SER A CB  1 
ATOM   1557 O  OG  . SER A 1 205 ? -17.591 18.751  26.484  1.00 46.40 ? 205 SER A OG  1 
ATOM   1558 N  N   . VAL A 1 206 ? -15.257 19.137  23.712  1.00 29.49 ? 206 VAL A N   1 
ATOM   1559 C  CA  . VAL A 1 206 ? -14.305 20.206  23.426  1.00 28.03 ? 206 VAL A CA  1 
ATOM   1560 C  C   . VAL A 1 206 ? -13.557 20.023  22.131  1.00 25.90 ? 206 VAL A C   1 
ATOM   1561 O  O   . VAL A 1 206 ? -13.306 20.969  21.399  1.00 28.02 ? 206 VAL A O   1 
ATOM   1562 C  CB  . VAL A 1 206 ? -13.250 20.314  24.600  1.00 28.19 ? 206 VAL A CB  1 
ATOM   1563 C  CG1 . VAL A 1 206 ? -12.166 21.350  24.258  1.00 30.07 ? 206 VAL A CG1 1 
ATOM   1564 C  CG2 . VAL A 1 206 ? -13.973 20.702  25.892  1.00 33.00 ? 206 VAL A CG2 1 
ATOM   1565 N  N   . LEU A 1 207 ? -13.201 18.783  21.835  1.00 25.91 ? 207 LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 207 ? -12.407 18.494  20.661  1.00 23.31 ? 207 LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 207 ? -13.038 17.483  19.713  1.00 21.40 ? 207 LEU A C   1 
ATOM   1568 O  O   . LEU A 1 207 ? -13.874 16.691  20.112  1.00 25.38 ? 207 LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 207 ? -11.051 17.929  21.109  1.00 23.03 ? 207 LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 207 ? -10.114 18.846  21.898  1.00 25.00 ? 207 LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 207 ? -8.995  18.018  22.515  1.00 23.66 ? 207 LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 207 ? -9.568  19.915  20.965  1.00 24.27 ? 207 LEU A CD2 1 
ATOM   1573 N  N   . PRO A 1 208 ? -12.641 17.522  18.444  1.00 24.12 ? 208 PRO A N   1 
ATOM   1574 C  CA  . PRO A 1 208 ? -13.176 16.582  17.456  1.00 24.69 ? 208 PRO A CA  1 
ATOM   1575 C  C   . PRO A 1 208 ? -12.628 15.168  17.740  1.00 26.01 ? 208 PRO A C   1 
ATOM   1576 O  O   . PRO A 1 208 ? -11.752 14.979  18.601  1.00 21.91 ? 208 PRO A O   1 
ATOM   1577 C  CB  . PRO A 1 208 ? -12.678 17.170  16.131  1.00 24.40 ? 208 PRO A CB  1 
ATOM   1578 C  CG  . PRO A 1 208 ? -11.329 17.782  16.537  1.00 27.36 ? 208 PRO A CG  1 
ATOM   1579 C  CD  . PRO A 1 208 ? -11.734 18.496  17.802  1.00 23.74 ? 208 PRO A CD  1 
ATOM   1580 N  N   . GLU A 1 209 ? -13.146 14.178  17.018  1.00 23.16 ? 209 GLU A N   1 
ATOM   1581 C  CA  . GLU A 1 209 ? -12.719 12.796  17.200  1.00 21.70 ? 209 GLU A CA  1 
ATOM   1582 C  C   . GLU A 1 209 ? -11.236 12.576  16.920  1.00 19.82 ? 209 GLU A C   1 
ATOM   1583 O  O   . GLU A 1 209 ? -10.594 11.765  17.599  1.00 20.33 ? 209 GLU A O   1 
ATOM   1584 C  CB  . GLU A 1 209 ? -13.550 11.874  16.303  1.00 23.81 ? 209 GLU A CB  1 
ATOM   1585 C  CG  . GLU A 1 209 ? -15.001 11.780  16.763  1.00 33.16 ? 209 GLU A CG  1 
ATOM   1586 C  CD  . GLU A 1 209 ? -15.838 10.906  15.847  1.00 38.65 ? 209 GLU A CD  1 
ATOM   1587 O  OE1 . GLU A 1 209 ? -16.281 9.821   16.284  1.00 39.09 ? 209 GLU A OE1 1 
ATOM   1588 O  OE2 . GLU A 1 209 ? -16.035 11.312  14.687  1.00 41.63 ? 209 GLU A OE2 1 
ATOM   1589 N  N   . TRP A 1 210 ? -10.718 13.255  15.903  1.00 19.19 ? 210 TRP A N   1 
ATOM   1590 C  CA  . TRP A 1 210 ? -9.310  13.139  15.538  1.00 18.20 ? 210 TRP A CA  1 
ATOM   1591 C  C   . TRP A 1 210 ? -8.596  14.459  15.802  1.00 23.33 ? 210 TRP A C   1 
ATOM   1592 O  O   . TRP A 1 210 ? -9.088  15.524  15.423  1.00 20.23 ? 210 TRP A O   1 
ATOM   1593 C  CB  . TRP A 1 210 ? -9.119  12.782  14.063  1.00 17.99 ? 210 TRP A CB  1 
ATOM   1594 C  CG  . TRP A 1 210 ? -9.613  11.414  13.692  1.00 23.15 ? 210 TRP A CG  1 
ATOM   1595 C  CD1 . TRP A 1 210 ? -10.894 11.064  13.325  1.00 24.91 ? 210 TRP A CD1 1 
ATOM   1596 C  CD2 . TRP A 1 210 ? -8.833  10.217  13.617  1.00 23.35 ? 210 TRP A CD2 1 
ATOM   1597 N  NE1 . TRP A 1 210 ? -10.943 9.728   13.023  1.00 22.43 ? 210 TRP A NE1 1 
ATOM   1598 C  CE2 . TRP A 1 210 ? -9.695  9.181   13.192  1.00 25.08 ? 210 TRP A CE2 1 
ATOM   1599 C  CE3 . TRP A 1 210 ? -7.486  9.918   13.864  1.00 20.80 ? 210 TRP A CE3 1 
ATOM   1600 C  CZ2 . TRP A 1 210 ? -9.253  7.860   13.010  1.00 25.34 ? 210 TRP A CZ2 1 
ATOM   1601 C  CZ3 . TRP A 1 210 ? -7.042  8.604   13.674  1.00 23.76 ? 210 TRP A CZ3 1 
ATOM   1602 C  CH2 . TRP A 1 210 ? -7.929  7.594   13.251  1.00 25.36 ? 210 TRP A CH2 1 
ATOM   1603 N  N   . VAL A 1 211 ? -7.408  14.373  16.406  1.00 21.63 ? 211 VAL A N   1 
ATOM   1604 C  CA  . VAL A 1 211 ? -6.661  15.571  16.774  1.00 19.24 ? 211 VAL A CA  1 
ATOM   1605 C  C   . VAL A 1 211 ? -5.181  15.429  16.528  1.00 20.75 ? 211 VAL A C   1 
ATOM   1606 O  O   . VAL A 1 211 ? -4.694  14.363  16.148  1.00 19.80 ? 211 VAL A O   1 
ATOM   1607 C  CB  . VAL A 1 211 ? -6.839  15.873  18.312  1.00 17.31 ? 211 VAL A CB  1 
ATOM   1608 C  CG1 . VAL A 1 211 ? -8.317  16.065  18.649  1.00 20.18 ? 211 VAL A CG1 1 
ATOM   1609 C  CG2 . VAL A 1 211 ? -6.247  14.681  19.186  1.00 16.86 ? 211 VAL A CG2 1 
ATOM   1610 N  N   . ARG A 1 212 ? -4.444  16.518  16.705  1.00 16.69 ? 212 ARG A N   1 
ATOM   1611 C  CA  . ARG A 1 212 ? -2.983  16.383  16.654  1.00 18.08 ? 212 ARG A CA  1 
ATOM   1612 C  C   . ARG A 1 212 ? -2.467  16.891  17.990  1.00 16.37 ? 212 ARG A C   1 
ATOM   1613 O  O   . ARG A 1 212 ? -3.134  17.690  18.640  1.00 16.80 ? 212 ARG A O   1 
ATOM   1614 C  CB  . ARG A 1 212 ? -2.335  17.178  15.528  1.00 19.98 ? 212 ARG A CB  1 
ATOM   1615 C  CG  . ARG A 1 212 ? -2.348  16.424  14.202  1.00 19.30 ? 212 ARG A CG  1 
ATOM   1616 C  CD  . ARG A 1 212 ? -1.537  17.134  13.128  1.00 18.48 ? 212 ARG A CD  1 
ATOM   1617 N  NE  . ARG A 1 212 ? -1.314  16.217  11.998  1.00 23.10 ? 212 ARG A NE  1 
ATOM   1618 C  CZ  . ARG A 1 212 ? -1.752  16.415  10.761  1.00 30.14 ? 212 ARG A CZ  1 
ATOM   1619 N  NH1 . ARG A 1 212 ? -2.445  17.509  10.472  1.00 29.89 ? 212 ARG A NH1 1 
ATOM   1620 N  NH2 . ARG A 1 212 ? -1.513  15.501  9.815   1.00 25.96 ? 212 ARG A NH2 1 
ATOM   1621 N  N   . VAL A 1 213 ? -1.303  16.404  18.415  1.00 15.16 ? 213 VAL A N   1 
ATOM   1622 C  CA  . VAL A 1 213 ? -0.759  16.831  19.694  1.00 14.07 ? 213 VAL A CA  1 
ATOM   1623 C  C   . VAL A 1 213 ? 0.606   17.441  19.461  1.00 16.35 ? 213 VAL A C   1 
ATOM   1624 O  O   . VAL A 1 213 ? 1.308   17.082  18.505  1.00 15.86 ? 213 VAL A O   1 
ATOM   1625 C  CB  . VAL A 1 213 ? -0.605  15.649  20.649  1.00 14.54 ? 213 VAL A CB  1 
ATOM   1626 C  CG1 . VAL A 1 213 ? -2.000  15.100  21.014  1.00 19.49 ? 213 VAL A CG1 1 
ATOM   1627 C  CG2 . VAL A 1 213 ? 0.213   14.555  19.973  1.00 15.71 ? 213 VAL A CG2 1 
ATOM   1628 N  N   . GLY A 1 214 ? 0.986   18.376  20.322  1.00 13.73 ? 214 GLY A N   1 
ATOM   1629 C  CA  . GLY A 1 214 ? 2.282   19.009  20.132  1.00 16.01 ? 214 GLY A CA  1 
ATOM   1630 C  C   . GLY A 1 214 ? 2.629   20.013  21.223  1.00 15.78 ? 214 GLY A C   1 
ATOM   1631 O  O   . GLY A 1 214 ? 2.107   19.937  22.342  1.00 14.23 ? 214 GLY A O   1 
ATOM   1632 N  N   . PHE A 1 215 ? 3.541   20.936  20.911  1.00 13.20 ? 215 PHE A N   1 
ATOM   1633 C  CA  . PHE A 1 215 ? 3.975   21.937  21.906  1.00 14.01 ? 215 PHE A CA  1 
ATOM   1634 C  C   . PHE A 1 215 ? 4.037   23.300  21.259  1.00 15.76 ? 215 PHE A C   1 
ATOM   1635 O  O   . PHE A 1 215 ? 4.301   23.406  20.064  1.00 17.53 ? 215 PHE A O   1 
ATOM   1636 C  CB  . PHE A 1 215 ? 5.375   21.636  22.400  1.00 14.49 ? 215 PHE A CB  1 
ATOM   1637 C  CG  . PHE A 1 215 ? 5.466   20.362  23.174  1.00 18.81 ? 215 PHE A CG  1 
ATOM   1638 C  CD1 . PHE A 1 215 ? 5.586   19.135  22.522  1.00 17.70 ? 215 PHE A CD1 1 
ATOM   1639 C  CD2 . PHE A 1 215 ? 5.371   20.386  24.554  1.00 19.84 ? 215 PHE A CD2 1 
ATOM   1640 C  CE1 . PHE A 1 215 ? 5.611   17.947  23.259  1.00 17.92 ? 215 PHE A CE1 1 
ATOM   1641 C  CE2 . PHE A 1 215 ? 5.394   19.192  25.296  1.00 19.87 ? 215 PHE A CE2 1 
ATOM   1642 C  CZ  . PHE A 1 215 ? 5.515   17.986  24.642  1.00 20.22 ? 215 PHE A CZ  1 
ATOM   1643 N  N   . SER A 1 216 ? 3.853   24.335  22.075  1.00 16.07 ? 216 SER A N   1 
ATOM   1644 C  CA  . SER A 1 216 ? 3.908   25.684  21.560  1.00 16.25 ? 216 SER A CA  1 
ATOM   1645 C  C   . SER A 1 216 ? 4.650   26.537  22.566  1.00 21.24 ? 216 SER A C   1 
ATOM   1646 O  O   . SER A 1 216 ? 4.619   26.258  23.767  1.00 17.62 ? 216 SER A O   1 
ATOM   1647 C  CB  . SER A 1 216 ? 2.490   26.221  21.382  1.00 17.68 ? 216 SER A CB  1 
ATOM   1648 O  OG  . SER A 1 216 ? 2.478   27.538  20.839  1.00 23.50 ? 216 SER A OG  1 
ATOM   1649 N  N   . ALA A 1 217 ? 5.365   27.541  22.081  1.00 17.76 ? 217 ALA A N   1 
ATOM   1650 C  CA  . ALA A 1 217 ? 6.051   28.450  23.008  1.00 19.92 ? 217 ALA A CA  1 
ATOM   1651 C  C   . ALA A 1 217 ? 6.179   29.807  22.341  1.00 19.40 ? 217 ALA A C   1 
ATOM   1652 O  O   . ALA A 1 217 ? 6.157   29.924  21.099  1.00 19.13 ? 217 ALA A O   1 
ATOM   1653 C  CB  . ALA A 1 217 ? 7.425   27.930  23.385  1.00 19.48 ? 217 ALA A CB  1 
ATOM   1654 N  N   . ALA A 1 218 ? 6.287   30.843  23.172  1.00 20.83 ? 218 ALA A N   1 
ATOM   1655 C  CA  . ALA A 1 218 ? 6.430   32.198  22.643  1.00 19.70 ? 218 ALA A CA  1 
ATOM   1656 C  C   . ALA A 1 218 ? 7.213   33.114  23.583  1.00 22.08 ? 218 ALA A C   1 
ATOM   1657 O  O   . ALA A 1 218 ? 7.356   32.830  24.783  1.00 20.44 ? 218 ALA A O   1 
ATOM   1658 C  CB  . ALA A 1 218 ? 5.042   32.788  22.417  1.00 18.43 ? 218 ALA A CB  1 
ATOM   1659 N  N   . SER A 1 219 ? 7.757   34.184  23.017  1.00 23.10 ? 219 SER A N   1 
ATOM   1660 C  CA  . SER A 1 219 ? 8.436   35.227  23.809  1.00 23.69 ? 219 SER A CA  1 
ATOM   1661 C  C   . SER A 1 219 ? 7.951   36.544  23.200  1.00 25.76 ? 219 SER A C   1 
ATOM   1662 O  O   . SER A 1 219 ? 7.905   36.673  21.975  1.00 27.21 ? 219 SER A O   1 
ATOM   1663 C  CB  . SER A 1 219 ? 9.953   35.145  23.708  1.00 22.15 ? 219 SER A CB  1 
ATOM   1664 O  OG  . SER A 1 219 ? 10.478  34.046  24.432  1.00 23.32 ? 219 SER A OG  1 
ATOM   1665 N  N   . GLY A 1 220 ? 7.540   37.498  24.040  1.00 25.94 ? 220 GLY A N   1 
ATOM   1666 C  CA  . GLY A 1 220 ? 7.092   38.795  23.529  1.00 27.12 ? 220 GLY A CA  1 
ATOM   1667 C  C   . GLY A 1 220 ? 8.244   39.773  23.744  1.00 27.67 ? 220 GLY A C   1 
ATOM   1668 O  O   . GLY A 1 220 ? 9.304   39.590  23.160  1.00 28.34 ? 220 GLY A O   1 
ATOM   1669 N  N   . GLU A 1 221 ? 8.069   40.796  24.582  1.00 31.00 ? 221 GLU A N   1 
ATOM   1670 C  CA  . GLU A 1 221 ? 9.178   41.725  24.847  1.00 30.49 ? 221 GLU A CA  1 
ATOM   1671 C  C   . GLU A 1 221 ? 10.237  41.129  25.776  1.00 31.51 ? 221 GLU A C   1 
ATOM   1672 O  O   . GLU A 1 221 ? 11.415  41.507  25.714  1.00 31.32 ? 221 GLU A O   1 
ATOM   1673 C  CB  . GLU A 1 221 ? 8.647   43.035  25.407  1.00 33.51 ? 221 GLU A CB  1 
ATOM   1674 C  CG  . GLU A 1 221 ? 7.860   43.793  24.367  1.00 41.06 ? 221 GLU A CG  1 
ATOM   1675 C  CD  . GLU A 1 221 ? 7.423   45.146  24.854  1.00 47.26 ? 221 GLU A CD  1 
ATOM   1676 O  OE1 . GLU A 1 221 ? 8.281   45.858  25.429  1.00 50.59 ? 221 GLU A OE1 1 
ATOM   1677 O  OE2 . GLU A 1 221 ? 6.239   45.498  24.648  1.00 49.18 ? 221 GLU A OE2 1 
ATOM   1678 N  N   . GLN A 1 222 ? 9.824   40.217  26.654  1.00 25.62 ? 222 GLN A N   1 
ATOM   1679 C  CA  . GLN A 1 222 ? 10.770  39.529  27.524  1.00 28.67 ? 222 GLN A CA  1 
ATOM   1680 C  C   . GLN A 1 222 ? 10.976  38.169  26.850  1.00 28.85 ? 222 GLN A C   1 
ATOM   1681 O  O   . GLN A 1 222 ? 10.116  37.718  26.091  1.00 25.53 ? 222 GLN A O   1 
ATOM   1682 C  CB  . GLN A 1 222 ? 10.239  39.368  28.951  1.00 31.57 ? 222 GLN A CB  1 
ATOM   1683 C  CG  A GLN A 1 222 ? 10.392  40.612  29.829  0.50 38.30 ? 222 GLN A CG  1 
ATOM   1684 C  CG  B GLN A 1 222 ? 9.910   40.684  29.631  0.50 39.74 ? 222 GLN A CG  1 
ATOM   1685 C  CD  A GLN A 1 222 ? 9.586   41.799  29.339  0.50 38.41 ? 222 GLN A CD  1 
ATOM   1686 C  CD  B GLN A 1 222 ? 11.064  41.657  29.588  0.50 40.74 ? 222 GLN A CD  1 
ATOM   1687 O  OE1 A GLN A 1 222 ? 8.362   41.733  29.238  0.50 40.76 ? 222 GLN A OE1 1 
ATOM   1688 O  OE1 B GLN A 1 222 ? 12.183  41.330  29.992  0.50 45.96 ? 222 GLN A OE1 1 
ATOM   1689 N  NE2 A GLN A 1 222 ? 10.272  42.898  29.037  0.50 41.11 ? 222 GLN A NE2 1 
ATOM   1690 N  NE2 B GLN A 1 222 ? 10.800  42.868  29.098  0.50 42.49 ? 222 GLN A NE2 1 
ATOM   1691 N  N   . TYR A 1 223 ? 12.099  37.519  27.124  1.00 27.89 ? 223 TYR A N   1 
ATOM   1692 C  CA  . TYR A 1 223 ? 12.405  36.287  26.427  1.00 26.21 ? 223 TYR A CA  1 
ATOM   1693 C  C   . TYR A 1 223 ? 13.242  35.280  27.198  1.00 27.10 ? 223 TYR A C   1 
ATOM   1694 O  O   . TYR A 1 223 ? 13.817  35.594  28.239  1.00 24.42 ? 223 TYR A O   1 
ATOM   1695 C  CB  . TYR A 1 223 ? 13.121  36.635  25.116  1.00 27.65 ? 223 TYR A CB  1 
ATOM   1696 C  CG  . TYR A 1 223 ? 14.201  37.678  25.336  1.00 33.51 ? 223 TYR A CG  1 
ATOM   1697 C  CD1 . TYR A 1 223 ? 13.940  39.040  25.129  1.00 33.36 ? 223 TYR A CD1 1 
ATOM   1698 C  CD2 . TYR A 1 223 ? 15.439  37.319  25.880  1.00 35.68 ? 223 TYR A CD2 1 
ATOM   1699 C  CE1 . TYR A 1 223 ? 14.896  40.023  25.472  1.00 37.29 ? 223 TYR A CE1 1 
ATOM   1700 C  CE2 . TYR A 1 223 ? 16.396  38.293  26.226  1.00 40.57 ? 223 TYR A CE2 1 
ATOM   1701 C  CZ  . TYR A 1 223 ? 16.115  39.638  26.023  1.00 40.87 ? 223 TYR A CZ  1 
ATOM   1702 O  OH  . TYR A 1 223 ? 17.055  40.591  26.401  1.00 43.11 ? 223 TYR A OH  1 
ATOM   1703 N  N   . GLN A 1 224 ? 13.303  34.060  26.656  1.00 23.36 ? 224 GLN A N   1 
ATOM   1704 C  CA  . GLN A 1 224 ? 14.042  32.948  27.245  1.00 20.95 ? 224 GLN A CA  1 
ATOM   1705 C  C   . GLN A 1 224 ? 13.924  31.841  26.207  1.00 18.95 ? 224 GLN A C   1 
ATOM   1706 O  O   . GLN A 1 224 ? 13.027  31.867  25.353  1.00 20.51 ? 224 GLN A O   1 
ATOM   1707 C  CB  . GLN A 1 224 ? 13.376  32.465  28.541  1.00 18.13 ? 224 GLN A CB  1 
ATOM   1708 C  CG  . GLN A 1 224 ? 11.981  31.842  28.330  1.00 21.86 ? 224 GLN A CG  1 
ATOM   1709 C  CD  . GLN A 1 224 ? 11.149  31.727  29.625  1.00 22.06 ? 224 GLN A CD  1 
ATOM   1710 O  OE1 . GLN A 1 224 ? 11.693  31.787  30.739  1.00 21.23 ? 224 GLN A OE1 1 
ATOM   1711 N  NE2 . GLN A 1 224 ? 9.842   31.538  29.479  1.00 21.80 ? 224 GLN A NE2 1 
ATOM   1712 N  N   . THR A 1 225 ? 14.829  30.888  26.260  1.00 23.59 ? 225 THR A N   1 
ATOM   1713 C  CA  . THR A 1 225 ? 14.729  29.780  25.326  1.00 22.98 ? 225 THR A CA  1 
ATOM   1714 C  C   . THR A 1 225 ? 13.672  28.830  25.883  1.00 23.52 ? 225 THR A C   1 
ATOM   1715 O  O   . THR A 1 225 ? 13.411  28.834  27.096  1.00 23.28 ? 225 THR A O   1 
ATOM   1716 C  CB  . THR A 1 225 ? 16.051  29.023  25.238  1.00 26.83 ? 225 THR A CB  1 
ATOM   1717 O  OG1 . THR A 1 225 ? 16.445  28.617  26.555  1.00 32.91 ? 225 THR A OG1 1 
ATOM   1718 C  CG2 . THR A 1 225 ? 17.136  29.903  24.620  1.00 30.02 ? 225 THR A CG2 1 
ATOM   1719 N  N   . HIS A 1 226 ? 13.052  28.037  25.010  1.00 20.23 ? 226 HIS A N   1 
ATOM   1720 C  CA  . HIS A 1 226 ? 12.056  27.032  25.437  1.00 20.24 ? 226 HIS A CA  1 
ATOM   1721 C  C   . HIS A 1 226 ? 12.531  25.762  24.746  1.00 18.23 ? 226 HIS A C   1 
ATOM   1722 O  O   . HIS A 1 226 ? 12.212  25.529  23.591  1.00 22.83 ? 226 HIS A O   1 
ATOM   1723 C  CB  . HIS A 1 226 ? 10.660  27.420  24.970  1.00 18.27 ? 226 HIS A CB  1 
ATOM   1724 C  CG  . HIS A 1 226 ? 10.192  28.739  25.519  1.00 22.05 ? 226 HIS A CG  1 
ATOM   1725 N  ND1 . HIS A 1 226 ? 10.460  29.944  24.897  1.00 18.56 ? 226 HIS A ND1 1 
ATOM   1726 C  CD2 . HIS A 1 226 ? 9.439   29.034  26.607  1.00 18.24 ? 226 HIS A CD2 1 
ATOM   1727 C  CE1 . HIS A 1 226 ? 9.880   30.922  25.576  1.00 21.79 ? 226 HIS A CE1 1 
ATOM   1728 N  NE2 . HIS A 1 226 ? 9.256   30.398  26.617  1.00 19.48 ? 226 HIS A NE2 1 
ATOM   1729 N  N   . THR A 1 227 ? 13.330  24.984  25.462  1.00 18.88 ? 227 THR A N   1 
ATOM   1730 C  CA  . THR A 1 227 ? 13.980  23.801  24.913  1.00 19.26 ? 227 THR A CA  1 
ATOM   1731 C  C   . THR A 1 227 ? 13.282  22.515  25.296  1.00 19.30 ? 227 THR A C   1 
ATOM   1732 O  O   . THR A 1 227 ? 13.268  22.160  26.467  1.00 19.38 ? 227 THR A O   1 
ATOM   1733 C  CB  . THR A 1 227 ? 15.438  23.761  25.401  1.00 23.40 ? 227 THR A CB  1 
ATOM   1734 O  OG1 . THR A 1 227 ? 16.047  25.024  25.097  1.00 23.85 ? 227 THR A OG1 1 
ATOM   1735 C  CG2 . THR A 1 227 ? 16.222  22.646  24.698  1.00 20.70 ? 227 THR A CG2 1 
ATOM   1736 N  N   . LEU A 1 228 ? 12.713  21.824  24.299  1.00 17.57 ? 228 LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 228 ? 12.009  20.546  24.551  1.00 18.49 ? 228 LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 228 ? 13.080  19.479  24.335  1.00 18.39 ? 228 LEU A C   1 
ATOM   1739 O  O   . LEU A 1 228 ? 13.627  19.365  23.241  1.00 21.15 ? 228 LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 228 ? 10.875  20.376  23.550  1.00 17.91 ? 228 LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 228 ? 10.056  19.097  23.712  1.00 23.04 ? 228 LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 228 ? 9.206   19.192  24.982  1.00 22.09 ? 228 LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 228 ? 9.132   18.944  22.509  1.00 22.33 ? 228 LEU A CD2 1 
ATOM   1744 N  N   . GLU A 1 229 ? 13.371  18.728  25.379  1.00 15.79 ? 229 GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 229 ? 14.449  17.751  25.359  1.00 17.58 ? 229 GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 229 ? 14.052  16.335  25.026  1.00 18.05 ? 229 GLU A C   1 
ATOM   1747 O  O   . GLU A 1 229 ? 14.831  15.600  24.463  1.00 19.64 ? 229 GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 229 ? 15.176  17.763  26.718  1.00 18.77 ? 229 GLU A CB  1 
ATOM   1749 N  N   . SER A 1 230 ? 12.855  15.940  25.426  1.00 16.11 ? 230 SER A N   1 
ATOM   1750 C  CA  . SER A 1 230 ? 12.407  14.567  25.164  1.00 15.80 ? 230 SER A CA  1 
ATOM   1751 C  C   . SER A 1 230 ? 10.889  14.555  25.231  1.00 20.03 ? 230 SER A C   1 
ATOM   1752 O  O   . SER A 1 230 ? 10.268  15.453  25.818  1.00 18.46 ? 230 SER A O   1 
ATOM   1753 C  CB  . SER A 1 230 ? 12.993  13.595  26.185  1.00 17.39 ? 230 SER A CB  1 
ATOM   1754 O  OG  . SER A 1 230 ? 12.479  13.843  27.488  1.00 23.70 ? 230 SER A OG  1 
ATOM   1755 N  N   . TRP A 1 231 ? 10.295  13.553  24.600  1.00 13.73 ? 231 TRP A N   1 
ATOM   1756 C  CA  . TRP A 1 231 ? 8.848   13.459  24.551  1.00 15.63 ? 231 TRP A CA  1 
ATOM   1757 C  C   . TRP A 1 231 ? 8.381   12.028  24.195  1.00 16.03 ? 231 TRP A C   1 
ATOM   1758 O  O   . TRP A 1 231 ? 8.871   11.450  23.219  1.00 16.66 ? 231 TRP A O   1 
ATOM   1759 C  CB  . TRP A 1 231 ? 8.315   14.455  23.490  1.00 12.77 ? 231 TRP A CB  1 
ATOM   1760 C  CG  . TRP A 1 231 ? 6.787   14.414  23.282  1.00 14.17 ? 231 TRP A CG  1 
ATOM   1761 C  CD1 . TRP A 1 231 ? 5.827   14.149  24.242  1.00 15.12 ? 231 TRP A CD1 1 
ATOM   1762 C  CD2 . TRP A 1 231 ? 6.063   14.779  22.093  1.00 14.60 ? 231 TRP A CD2 1 
ATOM   1763 N  NE1 . TRP A 1 231 ? 4.563   14.335  23.715  1.00 14.50 ? 231 TRP A NE1 1 
ATOM   1764 C  CE2 . TRP A 1 231 ? 4.679   14.726  22.405  1.00 14.43 ? 231 TRP A CE2 1 
ATOM   1765 C  CE3 . TRP A 1 231 ? 6.448   15.155  20.796  1.00 14.55 ? 231 TRP A CE3 1 
ATOM   1766 C  CZ2 . TRP A 1 231 ? 3.685   15.035  21.470  1.00 17.83 ? 231 TRP A CZ2 1 
ATOM   1767 C  CZ3 . TRP A 1 231 ? 5.450   15.472  19.854  1.00 19.18 ? 231 TRP A CZ3 1 
ATOM   1768 C  CH2 . TRP A 1 231 ? 4.087   15.409  20.201  1.00 19.49 ? 231 TRP A CH2 1 
ATOM   1769 N  N   . SER A 1 232 ? 7.454   11.475  24.992  1.00 14.85 ? 232 SER A N   1 
ATOM   1770 C  CA  . SER A 1 232 ? 6.845   10.162  24.714  1.00 17.22 ? 232 SER A CA  1 
ATOM   1771 C  C   . SER A 1 232 ? 5.330   10.353  24.798  1.00 17.09 ? 232 SER A C   1 
ATOM   1772 O  O   . SER A 1 232 ? 4.835   11.146  25.618  1.00 16.34 ? 232 SER A O   1 
ATOM   1773 C  CB  . SER A 1 232 ? 7.249   9.111   25.746  1.00 19.20 ? 232 SER A CB  1 
ATOM   1774 O  OG  . SER A 1 232 ? 8.609   8.770   25.550  1.00 38.63 ? 232 SER A OG  1 
ATOM   1775 N  N   . PHE A 1 233 ? 4.586   9.627   23.961  1.00 15.58 ? 233 PHE A N   1 
ATOM   1776 C  CA  . PHE A 1 233 ? 3.125   9.753   23.967  1.00 13.40 ? 233 PHE A CA  1 
ATOM   1777 C  C   . PHE A 1 233 ? 2.499   8.400   23.682  1.00 15.48 ? 233 PHE A C   1 
ATOM   1778 O  O   . PHE A 1 233 ? 3.013   7.665   22.859  1.00 16.39 ? 233 PHE A O   1 
ATOM   1779 C  CB  . PHE A 1 233 ? 2.697   10.749  22.870  1.00 14.45 ? 233 PHE A CB  1 
ATOM   1780 C  CG  . PHE A 1 233 ? 1.205   10.988  22.785  1.00 18.46 ? 233 PHE A CG  1 
ATOM   1781 C  CD1 . PHE A 1 233 ? 0.408   10.218  21.942  1.00 18.28 ? 233 PHE A CD1 1 
ATOM   1782 C  CD2 . PHE A 1 233 ? 0.594   11.965  23.574  1.00 18.79 ? 233 PHE A CD2 1 
ATOM   1783 C  CE1 . PHE A 1 233 ? -0.970  10.412  21.887  1.00 18.94 ? 233 PHE A CE1 1 
ATOM   1784 C  CE2 . PHE A 1 233 ? -0.792  12.165  23.522  1.00 15.80 ? 233 PHE A CE2 1 
ATOM   1785 C  CZ  . PHE A 1 233 ? -1.575  11.374  22.669  1.00 18.69 ? 233 PHE A CZ  1 
ATOM   1786 N  N   . THR A 1 234 ? 1.404   8.083   24.364  1.00 13.21 ? 234 THR A N   1 
ATOM   1787 C  CA  . THR A 1 234 ? 0.702   6.847   24.080  1.00 12.76 ? 234 THR A CA  1 
ATOM   1788 C  C   . THR A 1 234 ? -0.805  7.118   24.243  1.00 16.46 ? 234 THR A C   1 
ATOM   1789 O  O   . THR A 1 234 ? -1.208  7.855   25.147  1.00 15.69 ? 234 THR A O   1 
ATOM   1790 C  CB  . THR A 1 234 ? 1.189   5.683   24.994  1.00 18.73 ? 234 THR A CB  1 
ATOM   1791 O  OG1 . THR A 1 234 ? 0.455   4.487   24.657  1.00 24.63 ? 234 THR A OG1 1 
ATOM   1792 C  CG2 . THR A 1 234 ? 0.930   6.003   26.430  1.00 28.10 ? 234 THR A CG2 1 
ATOM   1793 N  N   . SER A 1 235 ? -1.627  6.599   23.332  1.00 12.78 ? 235 SER A N   1 
ATOM   1794 C  CA  . SER A 1 235 ? -3.062  6.784   23.428  1.00 15.17 ? 235 SER A CA  1 
ATOM   1795 C  C   . SER A 1 235 ? -3.724  5.449   23.087  1.00 18.76 ? 235 SER A C   1 
ATOM   1796 O  O   . SER A 1 235 ? -3.242  4.730   22.207  1.00 18.93 ? 235 SER A O   1 
ATOM   1797 C  CB  . SER A 1 235 ? -3.517  7.841   22.416  1.00 17.25 ? 235 SER A CB  1 
ATOM   1798 O  OG  . SER A 1 235 ? -4.904  8.012   22.507  1.00 26.65 ? 235 SER A OG  1 
ATOM   1799 N  N   . THR A 1 236 ? -4.814  5.112   23.783  1.00 15.63 ? 236 THR A N   1 
ATOM   1800 C  CA  . THR A 1 236 ? -5.518  3.858   23.513  1.00 15.40 ? 236 THR A CA  1 
ATOM   1801 C  C   . THR A 1 236 ? -7.016  4.085   23.705  1.00 17.05 ? 236 THR A C   1 
ATOM   1802 O  O   . THR A 1 236 ? -7.427  4.522   24.783  1.00 17.31 ? 236 THR A O   1 
ATOM   1803 C  CB  . THR A 1 236 ? -5.114  2.744   24.516  1.00 19.58 ? 236 THR A CB  1 
ATOM   1804 O  OG1 . THR A 1 236 ? -3.692  2.597   24.517  1.00 25.94 ? 236 THR A OG1 1 
ATOM   1805 C  CG2 . THR A 1 236 ? -5.757  1.414   24.108  1.00 22.77 ? 236 THR A CG2 1 
ATOM   1806 N  N   . LEU A 1 237 ? -7.828  3.804   22.696  1.00 15.98 ? 237 LEU A N   1 
ATOM   1807 C  CA  . LEU A 1 237 ? -9.278  3.970   22.886  1.00 17.46 ? 237 LEU A CA  1 
ATOM   1808 C  C   . LEU A 1 237 ? -9.822  2.898   23.848  1.00 22.20 ? 237 LEU A C   1 
ATOM   1809 O  O   . LEU A 1 237 ? -9.553  1.714   23.677  1.00 23.93 ? 237 LEU A O   1 
ATOM   1810 C  CB  . LEU A 1 237 ? -10.007 3.841   21.559  1.00 19.50 ? 237 LEU A CB  1 
ATOM   1811 C  CG  . LEU A 1 237 ? -10.042 5.075   20.671  1.00 25.51 ? 237 LEU A CG  1 
ATOM   1812 C  CD1 . LEU A 1 237 ? -10.676 4.708   19.319  1.00 23.26 ? 237 LEU A CD1 1 
ATOM   1813 C  CD2 . LEU A 1 237 ? -10.822 6.210   21.402  1.00 21.72 ? 237 LEU A CD2 1 
ATOM   1814 N  N   . LEU A 1 238 ? -10.606 3.309   24.841  1.00 22.61 ? 238 LEU A N   1 
ATOM   1815 C  CA  . LEU A 1 238 ? -11.187 2.367   25.815  1.00 25.99 ? 238 LEU A CA  1 
ATOM   1816 C  C   . LEU A 1 238 ? -12.693 2.549   25.990  1.00 27.20 ? 238 LEU A C   1 
ATOM   1817 O  O   . LEU A 1 238 ? -13.216 3.643   25.797  1.00 28.05 ? 238 LEU A O   1 
ATOM   1818 C  CB  . LEU A 1 238 ? -10.552 2.568   27.198  1.00 25.86 ? 238 LEU A CB  1 
ATOM   1819 C  CG  . LEU A 1 238 ? -9.082  2.193   27.329  1.00 28.35 ? 238 LEU A CG  1 
ATOM   1820 C  CD1 . LEU A 1 238 ? -8.619  2.496   28.740  1.00 36.20 ? 238 LEU A CD1 1 
ATOM   1821 C  CD2 . LEU A 1 238 ? -8.900  0.704   27.008  1.00 30.03 ? 238 LEU A CD2 1 
ATOM   1822 N  N   . TYR A 1 239 ? -13.379 1.475   26.394  1.00 29.50 ? 239 TYR A N   1 
ATOM   1823 C  CA  . TYR A 1 239 ? -14.814 1.576   26.665  1.00 35.23 ? 239 TYR A CA  1 
ATOM   1824 C  C   . TYR A 1 239 ? -14.875 1.688   28.185  1.00 38.78 ? 239 TYR A C   1 
ATOM   1825 O  O   . TYR A 1 239 ? -14.233 0.868   28.919  1.00 42.04 ? 239 TYR A O   1 
ATOM   1826 C  CB  . TYR A 1 239 ? -15.552 0.310   26.183  1.00 35.84 ? 239 TYR A CB  1 
ATOM   1827 N  N   . THR A 1 240 ? -15.582 2.680   28.709  1.00 40.30 ? 240 THR A N   1 
ATOM   1828 C  CA  . THR A 1 240 ? -15.669 2.795   30.168  1.00 45.85 ? 240 THR A CA  1 
ATOM   1829 C  C   . THR A 1 240 ? -17.124 2.725   30.642  1.00 48.77 ? 240 THR A C   1 
ATOM   1830 O  O   . THR A 1 240 ? -18.012 2.828   29.768  1.00 52.13 ? 240 THR A O   1 
ATOM   1831 C  CB  . THR A 1 240 ? -15.021 4.119   30.672  1.00 46.90 ? 240 THR A CB  1 
ATOM   1832 O  OG1 . THR A 1 240 ? -13.597 4.061   30.474  1.00 47.86 ? 240 THR A OG1 1 
ATOM   1833 C  CG2 . THR A 1 240 ? -15.321 4.328   32.160  1.00 50.27 ? 240 THR A CG2 1 
ATOM   1834 C  CA  . GLN B 1 1   ? 11.005  8.927   16.985  1.00 18.03 ? 1   GLN B CA  1 
ATOM   1835 C  C   . GLN B 1 1   ? 11.810  7.658   16.889  1.00 19.07 ? 1   GLN B C   1 
ATOM   1836 O  O   . GLN B 1 1   ? 11.844  7.020   15.830  1.00 20.81 ? 1   GLN B O   1 
ATOM   1837 C  CB  . GLN B 1 1   ? 9.551   8.620   17.307  1.00 19.32 ? 1   GLN B CB  1 
ATOM   1838 C  CG  . GLN B 1 1   ? 8.808   8.765   16.021  1.00 21.21 ? 1   GLN B CG  1 
ATOM   1839 C  CD  . GLN B 1 1   ? 9.682   9.610   15.105  1.00 16.27 ? 1   GLN B CD  1 
ATOM   1840 O  OE1 . GLN B 1 1   ? 9.268   10.080  14.051  1.00 23.09 ? 1   GLN B OE1 1 
ATOM   1841 N  NE2 . GLN B 1 1   ? 11.031  9.654   15.697  1.00 17.11 ? 1   GLN B NE2 1 
ATOM   1842 N  N   . ASP B 1 2   ? 12.455  7.287   17.988  1.00 16.89 ? 2   ASP B N   1 
ATOM   1843 C  CA  . ASP B 1 2   ? 13.228  6.055   18.055  1.00 19.06 ? 2   ASP B CA  1 
ATOM   1844 C  C   . ASP B 1 2   ? 12.236  4.884   18.128  1.00 20.66 ? 2   ASP B C   1 
ATOM   1845 O  O   . ASP B 1 2   ? 12.551  3.761   17.723  1.00 20.21 ? 2   ASP B O   1 
ATOM   1846 C  CB  . ASP B 1 2   ? 14.073  5.994   19.316  1.00 20.77 ? 2   ASP B CB  1 
ATOM   1847 C  CG  . ASP B 1 2   ? 15.304  6.896   19.261  1.00 23.67 ? 2   ASP B CG  1 
ATOM   1848 O  OD1 . ASP B 1 2   ? 15.470  7.664   18.320  1.00 26.61 ? 2   ASP B OD1 1 
ATOM   1849 O  OD2 . ASP B 1 2   ? 16.100  6.804   20.198  1.00 29.31 ? 2   ASP B OD2 1 
ATOM   1850 N  N   . SER B 1 3   ? 11.060  5.128   18.713  1.00 18.45 ? 3   SER B N   1 
ATOM   1851 C  CA  . SER B 1 3   ? 10.077  4.046   18.825  1.00 18.95 ? 3   SER B CA  1 
ATOM   1852 C  C   . SER B 1 3   ? 8.705   4.483   18.320  1.00 17.22 ? 3   SER B C   1 
ATOM   1853 O  O   . SER B 1 3   ? 8.308   5.646   18.458  1.00 17.11 ? 3   SER B O   1 
ATOM   1854 C  CB  . SER B 1 3   ? 10.014  3.550   20.268  1.00 21.57 ? 3   SER B CB  1 
ATOM   1855 O  OG  . SER B 1 3   ? 9.605   4.595   21.126  1.00 29.01 ? 3   SER B OG  1 
ATOM   1856 N  N   . LEU B 1 4   ? 7.986   3.550   17.696  1.00 14.93 ? 4   LEU B N   1 
ATOM   1857 C  CA  . LEU B 1 4   ? 6.679   3.875   17.133  1.00 15.51 ? 4   LEU B CA  1 
ATOM   1858 C  C   . LEU B 1 4   ? 5.834   2.613   17.154  1.00 17.11 ? 4   LEU B C   1 
ATOM   1859 O  O   . LEU B 1 4   ? 6.330   1.512   16.884  1.00 17.57 ? 4   LEU B O   1 
ATOM   1860 C  CB  . LEU B 1 4   ? 6.852   4.337   15.675  1.00 18.87 ? 4   LEU B CB  1 
ATOM   1861 C  CG  . LEU B 1 4   ? 5.606   4.541   14.799  1.00 21.65 ? 4   LEU B CG  1 
ATOM   1862 C  CD1 . LEU B 1 4   ? 4.750   5.646   15.347  1.00 25.09 ? 4   LEU B CD1 1 
ATOM   1863 C  CD2 . LEU B 1 4   ? 6.058   4.895   13.404  1.00 33.42 ? 4   LEU B CD2 1 
ATOM   1864 N  N   . SER B 1 5   ? 4.568   2.742   17.508  1.00 14.79 ? 5   SER B N   1 
ATOM   1865 C  CA  . SER B 1 5   ? 3.713   1.552   17.461  1.00 15.41 ? 5   SER B CA  1 
ATOM   1866 C  C   . SER B 1 5   ? 2.287   1.980   17.192  1.00 16.95 ? 5   SER B C   1 
ATOM   1867 O  O   . SER B 1 5   ? 1.893   3.098   17.533  1.00 16.55 ? 5   SER B O   1 
ATOM   1868 C  CB  . SER B 1 5   ? 3.773   0.755   18.764  1.00 18.44 ? 5   SER B CB  1 
ATOM   1869 O  OG  . SER B 1 5   ? 3.075   1.395   19.793  1.00 28.50 ? 5   SER B OG  1 
ATOM   1870 N  N   . PHE B 1 6   ? 1.524   1.114   16.536  1.00 13.77 ? 6   PHE B N   1 
ATOM   1871 C  CA  . PHE B 1 6   ? 0.120   1.425   16.293  1.00 12.40 ? 6   PHE B CA  1 
ATOM   1872 C  C   . PHE B 1 6   ? -0.628  0.111   16.176  1.00 13.21 ? 6   PHE B C   1 
ATOM   1873 O  O   . PHE B 1 6   ? -0.038  -0.918  15.862  1.00 13.23 ? 6   PHE B O   1 
ATOM   1874 C  CB  . PHE B 1 6   ? -0.056  2.291   15.036  1.00 15.94 ? 6   PHE B CB  1 
ATOM   1875 C  CG  . PHE B 1 6   ? 0.604   1.735   13.802  1.00 18.07 ? 6   PHE B CG  1 
ATOM   1876 C  CD1 . PHE B 1 6   ? -0.023  0.755   13.028  1.00 16.14 ? 6   PHE B CD1 1 
ATOM   1877 C  CD2 . PHE B 1 6   ? 1.839   2.214   13.400  1.00 19.01 ? 6   PHE B CD2 1 
ATOM   1878 C  CE1 . PHE B 1 6   ? 0.579   0.262   11.855  1.00 16.85 ? 6   PHE B CE1 1 
ATOM   1879 C  CE2 . PHE B 1 6   ? 2.452   1.724   12.220  1.00 22.68 ? 6   PHE B CE2 1 
ATOM   1880 C  CZ  . PHE B 1 6   ? 1.809   0.750   11.458  1.00 15.21 ? 6   PHE B CZ  1 
ATOM   1881 N  N   . GLY B 1 7   ? -1.927  0.165   16.456  1.00 16.03 ? 7   GLY B N   1 
ATOM   1882 C  CA  . GLY B 1 7   ? -2.728  -1.041  16.404  1.00 13.78 ? 7   GLY B CA  1 
ATOM   1883 C  C   . GLY B 1 7   ? -4.091  -0.805  15.805  1.00 16.23 ? 7   GLY B C   1 
ATOM   1884 O  O   . GLY B 1 7   ? -4.803  0.135   16.197  1.00 15.69 ? 7   GLY B O   1 
ATOM   1885 N  N   . PHE B 1 8   ? -4.436  -1.653  14.837  1.00 14.99 ? 8   PHE B N   1 
ATOM   1886 C  CA  . PHE B 1 8   ? -5.730  -1.603  14.182  1.00 15.57 ? 8   PHE B CA  1 
ATOM   1887 C  C   . PHE B 1 8   ? -6.426  -2.954  14.431  1.00 14.76 ? 8   PHE B C   1 
ATOM   1888 O  O   . PHE B 1 8   ? -6.237  -3.894  13.662  1.00 15.95 ? 8   PHE B O   1 
ATOM   1889 C  CB  . PHE B 1 8   ? -5.620  -1.444  12.646  1.00 14.89 ? 8   PHE B CB  1 
ATOM   1890 C  CG  . PHE B 1 8   ? -5.024  -0.136  12.158  1.00 15.97 ? 8   PHE B CG  1 
ATOM   1891 C  CD1 . PHE B 1 8   ? -3.627  0.010   11.976  1.00 14.10 ? 8   PHE B CD1 1 
ATOM   1892 C  CD2 . PHE B 1 8   ? -5.863  0.927   11.786  1.00 16.17 ? 8   PHE B CD2 1 
ATOM   1893 C  CE1 . PHE B 1 8   ? -3.093  1.177   11.435  1.00 17.49 ? 8   PHE B CE1 1 
ATOM   1894 C  CE2 . PHE B 1 8   ? -5.330  2.095   11.247  1.00 17.04 ? 8   PHE B CE2 1 
ATOM   1895 C  CZ  . PHE B 1 8   ? -3.941  2.219   11.072  1.00 20.19 ? 8   PHE B CZ  1 
ATOM   1896 N  N   . PRO B 1 9   ? -7.199  -3.091  15.521  1.00 14.58 ? 9   PRO B N   1 
ATOM   1897 C  CA  . PRO B 1 9   ? -7.893  -4.374  15.753  1.00 16.30 ? 9   PRO B CA  1 
ATOM   1898 C  C   . PRO B 1 9   ? -8.908  -4.630  14.623  1.00 18.90 ? 9   PRO B C   1 
ATOM   1899 O  O   . PRO B 1 9   ? -9.238  -5.782  14.343  1.00 18.17 ? 9   PRO B O   1 
ATOM   1900 C  CB  . PRO B 1 9   ? -8.606  -4.162  17.097  1.00 18.63 ? 9   PRO B CB  1 
ATOM   1901 C  CG  . PRO B 1 9   ? -7.730  -3.067  17.791  1.00 20.78 ? 9   PRO B CG  1 
ATOM   1902 C  CD  . PRO B 1 9   ? -7.475  -2.125  16.615  1.00 16.17 ? 9   PRO B CD  1 
ATOM   1903 N  N   . THR B 1 10  ? -9.431  -3.534  14.054  1.00 17.62 ? 10  THR B N   1 
ATOM   1904 C  CA  . THR B 1 10  ? -10.355 -3.527  12.897  1.00 17.73 ? 10  THR B CA  1 
ATOM   1905 C  C   . THR B 1 10  ? -10.055 -2.243  12.152  1.00 19.10 ? 10  THR B C   1 
ATOM   1906 O  O   . THR B 1 10  ? -9.244  -1.423  12.615  1.00 18.52 ? 10  THR B O   1 
ATOM   1907 C  CB  . THR B 1 10  ? -11.861 -3.471  13.273  1.00 21.88 ? 10  THR B CB  1 
ATOM   1908 O  OG1 . THR B 1 10  ? -12.123 -2.217  13.909  1.00 25.75 ? 10  THR B OG1 1 
ATOM   1909 C  CG2 . THR B 1 10  ? -12.234 -4.600  14.210  1.00 25.44 ? 10  THR B CG2 1 
ATOM   1910 N  N   . PHE B 1 11  ? -10.699 -2.057  10.996  1.00 19.36 ? 11  PHE B N   1 
ATOM   1911 C  CA  . PHE B 1 11  ? -10.511 -0.881  10.180  1.00 19.40 ? 11  PHE B CA  1 
ATOM   1912 C  C   . PHE B 1 11  ? -11.816 -0.130  9.880   1.00 24.30 ? 11  PHE B C   1 
ATOM   1913 O  O   . PHE B 1 11  ? -12.436 -0.364  8.843   1.00 22.94 ? 11  PHE B O   1 
ATOM   1914 C  CB  . PHE B 1 11  ? -9.861  -1.264  8.842   1.00 18.80 ? 11  PHE B CB  1 
ATOM   1915 C  CG  . PHE B 1 11  ? -8.441  -1.729  8.963   1.00 17.84 ? 11  PHE B CG  1 
ATOM   1916 C  CD1 . PHE B 1 11  ? -7.399  -0.814  8.961   1.00 18.35 ? 11  PHE B CD1 1 
ATOM   1917 C  CD2 . PHE B 1 11  ? -8.143  -3.094  9.014   1.00 18.83 ? 11  PHE B CD2 1 
ATOM   1918 C  CE1 . PHE B 1 11  ? -6.061  -1.245  8.996   1.00 17.95 ? 11  PHE B CE1 1 
ATOM   1919 C  CE2 . PHE B 1 11  ? -6.792  -3.528  9.048   1.00 19.26 ? 11  PHE B CE2 1 
ATOM   1920 C  CZ  . PHE B 1 11  ? -5.772  -2.599  9.035   1.00 17.28 ? 11  PHE B CZ  1 
ATOM   1921 N  N   . PRO B 1 12  ? -12.256 0.753   10.796  1.00 25.73 ? 12  PRO B N   1 
ATOM   1922 C  CA  . PRO B 1 12  ? -13.485 1.546   10.596  1.00 26.83 ? 12  PRO B CA  1 
ATOM   1923 C  C   . PRO B 1 12  ? -13.300 2.454   9.375   1.00 26.83 ? 12  PRO B C   1 
ATOM   1924 O  O   . PRO B 1 12  ? -12.165 2.795   9.005   1.00 26.47 ? 12  PRO B O   1 
ATOM   1925 C  CB  . PRO B 1 12  ? -13.588 2.349   11.895  1.00 28.61 ? 12  PRO B CB  1 
ATOM   1926 C  CG  . PRO B 1 12  ? -12.939 1.404   12.914  1.00 32.22 ? 12  PRO B CG  1 
ATOM   1927 C  CD  . PRO B 1 12  ? -11.681 1.031   12.123  1.00 26.31 ? 12  PRO B CD  1 
ATOM   1928 N  N   . SER B 1 13  ? -14.408 2.852   8.742   1.00 26.35 ? 13  SER B N   1 
ATOM   1929 C  CA  . SER B 1 13  ? -14.369 3.695   7.546   1.00 30.01 ? 13  SER B CA  1 
ATOM   1930 C  C   . SER B 1 13  ? -13.625 5.019   7.698   1.00 28.37 ? 13  SER B C   1 
ATOM   1931 O  O   . SER B 1 13  ? -13.041 5.533   6.734   1.00 29.93 ? 13  SER B O   1 
ATOM   1932 C  CB  . SER B 1 13  ? -15.804 4.047   7.091   1.00 32.28 ? 13  SER B CB  1 
ATOM   1933 O  OG  . SER B 1 13  ? -16.589 2.884   6.914   1.00 46.72 ? 13  SER B OG  1 
ATOM   1934 N  N   . ASP B 1 14  ? -13.633 5.573   8.897   1.00 27.99 ? 14  ASP B N   1 
ATOM   1935 C  CA  . ASP B 1 14  ? -13.022 6.885   9.076   1.00 33.88 ? 14  ASP B CA  1 
ATOM   1936 C  C   . ASP B 1 14  ? -11.529 6.826   9.413   1.00 32.98 ? 14  ASP B C   1 
ATOM   1937 O  O   . ASP B 1 14  ? -11.141 6.860   10.569  1.00 38.94 ? 14  ASP B O   1 
ATOM   1938 C  CB  . ASP B 1 14  ? -13.853 7.648   10.127  1.00 37.54 ? 14  ASP B CB  1 
ATOM   1939 C  CG  A ASP B 1 14  ? -13.378 9.050   10.359  0.50 36.90 ? 14  ASP B CG  1 
ATOM   1940 C  CG  B ASP B 1 14  ? -13.751 7.058   11.504  0.50 38.32 ? 14  ASP B CG  1 
ATOM   1941 O  OD1 A ASP B 1 14  ? -13.215 9.791   9.373   0.50 37.23 ? 14  ASP B OD1 1 
ATOM   1942 O  OD1 B ASP B 1 14  ? -13.982 5.844   11.654  0.50 43.83 ? 14  ASP B OD1 1 
ATOM   1943 O  OD2 A ASP B 1 14  ? -13.195 9.409   11.540  0.50 40.03 ? 14  ASP B OD2 1 
ATOM   1944 O  OD2 B ASP B 1 14  ? -13.456 7.828   12.445  0.50 42.70 ? 14  ASP B OD2 1 
ATOM   1945 N  N   . GLN B 1 15  ? -10.703 6.738   8.373   1.00 29.84 ? 15  GLN B N   1 
ATOM   1946 C  CA  . GLN B 1 15  ? -9.251  6.635   8.533   1.00 28.85 ? 15  GLN B CA  1 
ATOM   1947 C  C   . GLN B 1 15  ? -8.549  7.927   8.203   1.00 24.55 ? 15  GLN B C   1 
ATOM   1948 O  O   . GLN B 1 15  ? -8.930  8.625   7.260   1.00 28.98 ? 15  GLN B O   1 
ATOM   1949 C  CB  . GLN B 1 15  ? -8.704  5.539   7.611   1.00 30.59 ? 15  GLN B CB  1 
ATOM   1950 C  CG  . GLN B 1 15  ? -9.145  4.137   7.967   1.00 30.00 ? 15  GLN B CG  1 
ATOM   1951 C  CD  . GLN B 1 15  ? -8.778  3.771   9.387   1.00 29.30 ? 15  GLN B CD  1 
ATOM   1952 O  OE1 . GLN B 1 15  ? -7.699  4.127   9.871   1.00 32.46 ? 15  GLN B OE1 1 
ATOM   1953 N  NE2 . GLN B 1 15  ? -9.654  3.047   10.058  1.00 27.60 ? 15  GLN B NE2 1 
ATOM   1954 N  N   . LYS B 1 16  ? -7.506  8.246   8.956   1.00 21.36 ? 16  LYS B N   1 
ATOM   1955 C  CA  . LYS B 1 16  ? -6.747  9.457   8.706   1.00 20.82 ? 16  LYS B CA  1 
ATOM   1956 C  C   . LYS B 1 16  ? -5.271  9.205   8.465   1.00 20.78 ? 16  LYS B C   1 
ATOM   1957 O  O   . LYS B 1 16  ? -4.611  10.025  7.845   1.00 20.90 ? 16  LYS B O   1 
ATOM   1958 C  CB  . LYS B 1 16  ? -6.817  10.426  9.900   1.00 22.48 ? 16  LYS B CB  1 
ATOM   1959 C  CG  . LYS B 1 16  ? -8.216  10.812  10.351  1.00 24.29 ? 16  LYS B CG  1 
ATOM   1960 C  CD  . LYS B 1 16  ? -8.996  11.567  9.281   1.00 30.68 ? 16  LYS B CD  1 
ATOM   1961 C  CE  . LYS B 1 16  ? -10.386 11.923  9.825   1.00 36.64 ? 16  LYS B CE  1 
ATOM   1962 N  NZ  . LYS B 1 16  ? -11.282 12.512  8.785   1.00 38.84 ? 16  LYS B NZ  1 
ATOM   1963 N  N   . ASN B 1 17  ? -4.747  8.098   8.994   1.00 18.78 ? 17  ASN B N   1 
ATOM   1964 C  CA  . ASN B 1 17  ? -3.323  7.806   8.898   1.00 17.79 ? 17  ASN B CA  1 
ATOM   1965 C  C   . ASN B 1 17  ? -2.917  6.724   7.907   1.00 18.97 ? 17  ASN B C   1 
ATOM   1966 O  O   . ASN B 1 17  ? -1.819  6.195   7.994   1.00 19.40 ? 17  ASN B O   1 
ATOM   1967 C  CB  . ASN B 1 17  ? -2.774  7.446   10.291  1.00 16.74 ? 17  ASN B CB  1 
ATOM   1968 C  CG  . ASN B 1 17  ? -2.895  8.610   11.272  1.00 19.71 ? 17  ASN B CG  1 
ATOM   1969 O  OD1 . ASN B 1 17  ? -2.619  9.752   10.905  1.00 19.27 ? 17  ASN B OD1 1 
ATOM   1970 N  ND2 . ASN B 1 17  ? -3.306  8.320   12.515  1.00 19.26 ? 17  ASN B ND2 1 
ATOM   1971 N  N   . LEU B 1 18  ? -3.807  6.399   6.976   1.00 20.35 ? 18  LEU B N   1 
ATOM   1972 C  CA  . LEU B 1 18  ? -3.469  5.410   5.963   1.00 17.93 ? 18  LEU B CA  1 
ATOM   1973 C  C   . LEU B 1 18  ? -3.356  6.075   4.594   1.00 19.39 ? 18  LEU B C   1 
ATOM   1974 O  O   . LEU B 1 18  ? -4.146  6.955   4.260   1.00 19.29 ? 18  LEU B O   1 
ATOM   1975 C  CB  . LEU B 1 18  ? -4.526  4.318   5.902   1.00 15.13 ? 18  LEU B CB  1 
ATOM   1976 C  CG  . LEU B 1 18  ? -4.640  3.377   7.109   1.00 19.91 ? 18  LEU B CG  1 
ATOM   1977 C  CD1 . LEU B 1 18  ? -5.801  2.399   6.873   1.00 21.87 ? 18  LEU B CD1 1 
ATOM   1978 C  CD2 . LEU B 1 18  ? -3.311  2.640   7.322   1.00 22.36 ? 18  LEU B CD2 1 
ATOM   1979 N  N   . ILE B 1 19  ? -2.360  5.669   3.817   1.00 18.30 ? 19  ILE B N   1 
ATOM   1980 C  CA  . ILE B 1 19  ? -2.208  6.186   2.462   1.00 18.32 ? 19  ILE B CA  1 
ATOM   1981 C  C   . ILE B 1 19  ? -2.765  5.043   1.602   1.00 21.64 ? 19  ILE B C   1 
ATOM   1982 O  O   . ILE B 1 19  ? -2.269  3.921   1.667   1.00 20.38 ? 19  ILE B O   1 
ATOM   1983 C  CB  . ILE B 1 19  ? -0.726  6.440   2.108   1.00 21.78 ? 19  ILE B CB  1 
ATOM   1984 C  CG1 . ILE B 1 19  ? -0.162  7.569   2.996   1.00 23.95 ? 19  ILE B CG1 1 
ATOM   1985 C  CG2 . ILE B 1 19  ? -0.603  6.773   0.633   1.00 22.03 ? 19  ILE B CG2 1 
ATOM   1986 C  CD1 . ILE B 1 19  ? 1.330   7.725   2.905   1.00 26.79 ? 19  ILE B CD1 1 
ATOM   1987 N  N   . PHE B 1 20  ? -3.805  5.338   0.824   1.00 22.61 ? 20  PHE B N   1 
ATOM   1988 C  CA  . PHE B 1 20  ? -4.431  4.341   -0.047  1.00 22.62 ? 20  PHE B CA  1 
ATOM   1989 C  C   . PHE B 1 20  ? -3.904  4.502   -1.464  1.00 24.69 ? 20  PHE B C   1 
ATOM   1990 O  O   . PHE B 1 20  ? -3.871  5.623   -1.984  1.00 22.40 ? 20  PHE B O   1 
ATOM   1991 C  CB  . PHE B 1 20  ? -5.940  4.547   -0.037  1.00 22.30 ? 20  PHE B CB  1 
ATOM   1992 C  CG  . PHE B 1 20  ? -6.606  4.166   1.246   1.00 21.78 ? 20  PHE B CG  1 
ATOM   1993 C  CD1 . PHE B 1 20  ? -7.026  2.855   1.469   1.00 21.82 ? 20  PHE B CD1 1 
ATOM   1994 C  CD2 . PHE B 1 20  ? -6.839  5.120   2.235   1.00 26.32 ? 20  PHE B CD2 1 
ATOM   1995 C  CE1 . PHE B 1 20  ? -7.672  2.496   2.665   1.00 26.56 ? 20  PHE B CE1 1 
ATOM   1996 C  CE2 . PHE B 1 20  ? -7.483  4.773   3.431   1.00 26.24 ? 20  PHE B CE2 1 
ATOM   1997 C  CZ  . PHE B 1 20  ? -7.901  3.461   3.651   1.00 22.70 ? 20  PHE B CZ  1 
ATOM   1998 N  N   . GLN B 1 21  ? -3.457  3.404   -2.080  1.00 21.52 ? 21  GLN B N   1 
ATOM   1999 C  CA  . GLN B 1 21  ? -2.957  3.454   -3.452  1.00 18.83 ? 21  GLN B CA  1 
ATOM   2000 C  C   . GLN B 1 21  ? -3.715  2.449   -4.319  1.00 21.21 ? 21  GLN B C   1 
ATOM   2001 O  O   . GLN B 1 21  ? -4.128  1.382   -3.853  1.00 19.42 ? 21  GLN B O   1 
ATOM   2002 C  CB  . GLN B 1 21  ? -1.449  3.179   -3.511  1.00 22.49 ? 21  GLN B CB  1 
ATOM   2003 C  CG  . GLN B 1 21  ? -0.632  4.173   -2.654  1.00 21.77 ? 21  GLN B CG  1 
ATOM   2004 C  CD  . GLN B 1 21  ? 0.865   3.939   -2.721  1.00 26.08 ? 21  GLN B CD  1 
ATOM   2005 O  OE1 . GLN B 1 21  ? 1.325   2.795   -2.775  1.00 26.56 ? 21  GLN B OE1 1 
ATOM   2006 N  NE2 . GLN B 1 21  ? 1.642   5.025   -2.676  1.00 20.97 ? 21  GLN B NE2 1 
ATOM   2007 N  N   . GLY B 1 22  ? -3.935  2.809   -5.578  1.00 22.43 ? 22  GLY B N   1 
ATOM   2008 C  CA  . GLY B 1 22  ? -4.634  1.893   -6.462  1.00 22.15 ? 22  GLY B CA  1 
ATOM   2009 C  C   . GLY B 1 22  ? -6.084  1.718   -6.068  1.00 21.34 ? 22  GLY B C   1 
ATOM   2010 O  O   . GLY B 1 22  ? -6.767  2.679   -5.737  1.00 25.63 ? 22  GLY B O   1 
ATOM   2011 N  N   . ASP B 1 23  ? -6.550  0.479   -6.084  1.00 19.24 ? 23  ASP B N   1 
ATOM   2012 C  CA  . ASP B 1 23  ? -7.929  0.158   -5.766  1.00 19.10 ? 23  ASP B CA  1 
ATOM   2013 C  C   . ASP B 1 23  ? -8.257  -0.091  -4.307  1.00 21.90 ? 23  ASP B C   1 
ATOM   2014 O  O   . ASP B 1 23  ? -9.412  -0.340  -3.972  1.00 22.88 ? 23  ASP B O   1 
ATOM   2015 C  CB  . ASP B 1 23  ? -8.383  -1.075  -6.569  1.00 23.42 ? 23  ASP B CB  1 
ATOM   2016 C  CG  . ASP B 1 23  ? -8.261  -0.873  -8.083  1.00 27.09 ? 23  ASP B CG  1 
ATOM   2017 O  OD1 . ASP B 1 23  ? -8.561  0.240   -8.556  1.00 27.56 ? 23  ASP B OD1 1 
ATOM   2018 O  OD2 . ASP B 1 23  ? -7.896  -1.831  -8.802  1.00 25.26 ? 23  ASP B OD2 1 
ATOM   2019 N  N   . ALA B 1 24  ? -7.268  -0.020  -3.422  1.00 21.33 ? 24  ALA B N   1 
ATOM   2020 C  CA  . ALA B 1 24  ? -7.538  -0.289  -2.014  1.00 19.76 ? 24  ALA B CA  1 
ATOM   2021 C  C   . ALA B 1 24  ? -8.612  0.629   -1.394  1.00 20.15 ? 24  ALA B C   1 
ATOM   2022 O  O   . ALA B 1 24  ? -8.621  1.843   -1.627  1.00 21.51 ? 24  ALA B O   1 
ATOM   2023 C  CB  . ALA B 1 24  ? -6.208  -0.181  -1.189  1.00 17.47 ? 24  ALA B CB  1 
ATOM   2024 N  N   . GLN B 1 25  ? -9.496  0.045   -0.595  1.00 20.07 ? 25  GLN B N   1 
ATOM   2025 C  CA  . GLN B 1 25  ? -10.524 0.811   0.099   1.00 22.29 ? 25  GLN B CA  1 
ATOM   2026 C  C   . GLN B 1 25  ? -11.030 0.042   1.319   1.00 24.29 ? 25  GLN B C   1 
ATOM   2027 O  O   . GLN B 1 25  ? -10.877 -1.173  1.412   1.00 22.68 ? 25  GLN B O   1 
ATOM   2028 C  CB  . GLN B 1 25  ? -11.703 1.086   -0.840  1.00 26.43 ? 25  GLN B CB  1 
ATOM   2029 C  CG  . GLN B 1 25  ? -12.442 -0.155  -1.235  1.00 34.74 ? 25  GLN B CG  1 
ATOM   2030 N  N   . ILE B 1 26  ? -11.636 0.756   2.262   1.00 21.41 ? 26  ILE B N   1 
ATOM   2031 C  CA  . ILE B 1 26  ? -12.196 0.107   3.435   1.00 23.23 ? 26  ILE B CA  1 
ATOM   2032 C  C   . ILE B 1 26  ? -13.643 -0.290  3.136   1.00 26.29 ? 26  ILE B C   1 
ATOM   2033 O  O   . ILE B 1 26  ? -14.404 0.517   2.620   1.00 29.52 ? 26  ILE B O   1 
ATOM   2034 C  CB  . ILE B 1 26  ? -12.263 1.069   4.659   1.00 27.30 ? 26  ILE B CB  1 
ATOM   2035 C  CG1 . ILE B 1 26  ? -10.865 1.540   5.076   1.00 30.80 ? 26  ILE B CG1 1 
ATOM   2036 C  CG2 . ILE B 1 26  ? -13.024 0.392   5.800   1.00 24.38 ? 26  ILE B CG2 1 
ATOM   2037 C  CD1 . ILE B 1 26  ? -9.989  0.479   5.512   1.00 35.04 ? 26  ILE B CD1 1 
ATOM   2038 N  N   . LYS B 1 27  ? -14.015 -1.519  3.473   1.00 23.58 ? 27  LYS B N   1 
ATOM   2039 C  CA  . LYS B 1 27  ? -15.382 -2.003  3.320   1.00 27.33 ? 27  LYS B CA  1 
ATOM   2040 C  C   . LYS B 1 27  ? -15.642 -2.982  4.439   1.00 29.59 ? 27  LYS B C   1 
ATOM   2041 O  O   . LYS B 1 27  ? -14.827 -3.872  4.683   1.00 28.11 ? 27  LYS B O   1 
ATOM   2042 C  CB  . LYS B 1 27  ? -15.603 -2.723  1.985   1.00 32.35 ? 27  LYS B CB  1 
ATOM   2043 C  CG  . LYS B 1 27  ? -15.615 -1.836  0.760   1.00 39.54 ? 27  LYS B CG  1 
ATOM   2044 C  CD  . LYS B 1 27  ? -15.991 -2.643  -0.488  1.00 43.35 ? 27  LYS B CD  1 
ATOM   2045 N  N   . ASN B 1 28  ? -16.763 -2.796  5.140   1.00 28.85 ? 28  ASN B N   1 
ATOM   2046 C  CA  . ASN B 1 28  ? -17.140 -3.679  6.228   1.00 26.19 ? 28  ASN B CA  1 
ATOM   2047 C  C   . ASN B 1 28  ? -16.050 -3.860  7.307   1.00 25.79 ? 28  ASN B C   1 
ATOM   2048 O  O   . ASN B 1 28  ? -15.779 -4.978  7.736   1.00 24.61 ? 28  ASN B O   1 
ATOM   2049 C  CB  . ASN B 1 28  ? -17.541 -5.050  5.665   1.00 33.92 ? 28  ASN B CB  1 
ATOM   2050 N  N   . ASN B 1 29  ? -15.441 -2.756  7.729   1.00 24.96 ? 29  ASN B N   1 
ATOM   2051 C  CA  . ASN B 1 29  ? -14.424 -2.756  8.792   1.00 25.98 ? 29  ASN B CA  1 
ATOM   2052 C  C   . ASN B 1 29  ? -13.126 -3.515  8.492   1.00 20.44 ? 29  ASN B C   1 
ATOM   2053 O  O   . ASN B 1 29  ? -12.410 -3.942  9.423   1.00 22.56 ? 29  ASN B O   1 
ATOM   2054 C  CB  . ASN B 1 29  ? -15.020 -3.294  10.092  1.00 29.23 ? 29  ASN B CB  1 
ATOM   2055 C  CG  . ASN B 1 29  ? -16.137 -2.413  10.631  1.00 40.48 ? 29  ASN B CG  1 
ATOM   2056 O  OD1 . ASN B 1 29  ? -15.933 -1.232  10.928  1.00 44.11 ? 29  ASN B OD1 1 
ATOM   2057 N  ND2 . ASN B 1 29  ? -17.328 -2.985  10.757  1.00 46.56 ? 29  ASN B ND2 1 
ATOM   2058 N  N   . ALA B 1 30  ? -12.871 -3.744  7.213   1.00 20.63 ? 30  ALA B N   1 
ATOM   2059 C  CA  . ALA B 1 30  ? -11.636 -4.397  6.790   1.00 17.79 ? 30  ALA B CA  1 
ATOM   2060 C  C   . ALA B 1 30  ? -11.111 -3.661  5.571   1.00 21.45 ? 30  ALA B C   1 
ATOM   2061 O  O   . ALA B 1 30  ? -11.838 -2.922  4.925   1.00 23.10 ? 30  ALA B O   1 
ATOM   2062 C  CB  . ALA B 1 30  ? -11.866 -5.868  6.433   1.00 19.21 ? 30  ALA B CB  1 
ATOM   2063 N  N   . VAL B 1 31  ? -9.833  -3.853  5.258   1.00 16.88 ? 31  VAL B N   1 
ATOM   2064 C  CA  . VAL B 1 31  ? -9.284  -3.234  4.071   1.00 16.56 ? 31  VAL B CA  1 
ATOM   2065 C  C   . VAL B 1 31  ? -9.395  -4.241  2.926   1.00 18.37 ? 31  VAL B C   1 
ATOM   2066 O  O   . VAL B 1 31  ? -8.912  -5.373  3.041   1.00 18.10 ? 31  VAL B O   1 
ATOM   2067 C  CB  . VAL B 1 31  ? -7.775  -2.876  4.215   1.00 19.37 ? 31  VAL B CB  1 
ATOM   2068 C  CG1 . VAL B 1 31  ? -7.273  -2.301  2.904   1.00 20.41 ? 31  VAL B CG1 1 
ATOM   2069 C  CG2 . VAL B 1 31  ? -7.562  -1.856  5.374   1.00 19.18 ? 31  VAL B CG2 1 
ATOM   2070 N  N   . GLN B 1 32  ? -10.080 -3.843  1.854   1.00 17.25 ? 32  GLN B N   1 
ATOM   2071 C  CA  . GLN B 1 32  ? -10.182 -4.674  0.634   1.00 18.19 ? 32  GLN B CA  1 
ATOM   2072 C  C   . GLN B 1 32  ? -9.066  -4.136  -0.253  1.00 16.50 ? 32  GLN B C   1 
ATOM   2073 O  O   . GLN B 1 32  ? -9.204  -3.046  -0.837  1.00 20.31 ? 32  GLN B O   1 
ATOM   2074 C  CB  . GLN B 1 32  ? -11.533 -4.450  -0.064  1.00 20.08 ? 32  GLN B CB  1 
ATOM   2075 C  CG  . GLN B 1 32  ? -12.729 -4.928  0.729   1.00 23.46 ? 32  GLN B CG  1 
ATOM   2076 C  CD  . GLN B 1 32  ? -12.626 -6.402  1.184   1.00 30.82 ? 32  GLN B CD  1 
ATOM   2077 O  OE1 . GLN B 1 32  ? -12.011 -7.252  0.526   1.00 26.66 ? 32  GLN B OE1 1 
ATOM   2078 N  NE2 . GLN B 1 32  ? -13.264 -6.703  2.308   1.00 35.76 ? 32  GLN B NE2 1 
ATOM   2079 N  N   . LEU B 1 33  ? -7.935  -4.850  -0.351  1.00 15.53 ? 33  LEU B N   1 
ATOM   2080 C  CA  . LEU B 1 33  ? -6.821  -4.345  -1.159  1.00 16.89 ? 33  LEU B CA  1 
ATOM   2081 C  C   . LEU B 1 33  ? -7.120  -4.329  -2.638  1.00 18.78 ? 33  LEU B C   1 
ATOM   2082 O  O   . LEU B 1 33  ? -6.720  -3.398  -3.338  1.00 18.96 ? 33  LEU B O   1 
ATOM   2083 C  CB  . LEU B 1 33  ? -5.541  -5.160  -0.911  1.00 17.06 ? 33  LEU B CB  1 
ATOM   2084 C  CG  . LEU B 1 33  ? -4.997  -4.884  0.507   1.00 17.26 ? 33  LEU B CG  1 
ATOM   2085 C  CD1 . LEU B 1 33  ? -3.939  -5.922  0.865   1.00 22.75 ? 33  LEU B CD1 1 
ATOM   2086 C  CD2 . LEU B 1 33  ? -4.413  -3.468  0.549   1.00 21.84 ? 33  LEU B CD2 1 
ATOM   2087 N  N   . THR B 1 34  ? -7.808  -5.366  -3.110  1.00 19.20 ? 34  THR B N   1 
ATOM   2088 C  CA  . THR B 1 34  ? -8.170  -5.448  -4.531  1.00 19.61 ? 34  THR B CA  1 
ATOM   2089 C  C   . THR B 1 34  ? -9.638  -5.146  -4.760  1.00 20.46 ? 34  THR B C   1 
ATOM   2090 O  O   . THR B 1 34  ? -10.479 -5.327  -3.873  1.00 21.92 ? 34  THR B O   1 
ATOM   2091 C  CB  . THR B 1 34  ? -7.780  -6.815  -5.115  1.00 16.11 ? 34  THR B CB  1 
ATOM   2092 O  OG1 . THR B 1 34  ? -8.187  -7.871  -4.220  1.00 17.82 ? 34  THR B OG1 1 
ATOM   2093 C  CG2 . THR B 1 34  ? -6.252  -6.860  -5.311  1.00 20.31 ? 34  THR B CG2 1 
ATOM   2094 N  N   . LYS B 1 35  ? -9.943  -4.672  -5.962  1.00 23.88 ? 35  LYS B N   1 
ATOM   2095 C  CA  . LYS B 1 35  ? -11.299 -4.246  -6.300  1.00 25.84 ? 35  LYS B CA  1 
ATOM   2096 C  C   . LYS B 1 35  ? -12.359 -5.335  -6.255  1.00 27.02 ? 35  LYS B C   1 
ATOM   2097 O  O   . LYS B 1 35  ? -12.124 -6.458  -6.679  1.00 23.42 ? 35  LYS B O   1 
ATOM   2098 C  CB  . LYS B 1 35  ? -11.305 -3.626  -7.696  1.00 26.73 ? 35  LYS B CB  1 
ATOM   2099 C  CG  . LYS B 1 35  ? -12.608 -2.898  -8.022  1.00 29.27 ? 35  LYS B CG  1 
ATOM   2100 C  CD  . LYS B 1 35  ? -12.497 -2.244  -9.391  1.00 36.40 ? 35  LYS B CD  1 
ATOM   2101 N  N   . THR B 1 36  ? -13.538 -4.983  -5.749  1.00 29.81 ? 36  THR B N   1 
ATOM   2102 C  CA  . THR B 1 36  ? -14.667 -5.915  -5.691  1.00 33.69 ? 36  THR B CA  1 
ATOM   2103 C  C   . THR B 1 36  ? -15.835 -5.170  -6.316  1.00 38.46 ? 36  THR B C   1 
ATOM   2104 O  O   . THR B 1 36  ? -15.919 -3.940  -6.181  1.00 38.14 ? 36  THR B O   1 
ATOM   2105 C  CB  . THR B 1 36  ? -15.069 -6.275  -4.248  1.00 35.59 ? 36  THR B CB  1 
ATOM   2106 O  OG1 . THR B 1 36  ? -15.338 -5.068  -3.507  1.00 37.56 ? 36  THR B OG1 1 
ATOM   2107 C  CG2 . THR B 1 36  ? -13.970 -7.096  -3.554  1.00 28.93 ? 36  THR B CG2 1 
ATOM   2108 N  N   . ASP B 1 37  ? -16.717 -5.890  -7.012  1.00 40.76 ? 37  ASP B N   1 
ATOM   2109 C  CA  . ASP B 1 37  ? -17.878 -5.241  -7.627  1.00 42.97 ? 37  ASP B CA  1 
ATOM   2110 C  C   . ASP B 1 37  ? -18.919 -4.921  -6.561  1.00 43.88 ? 37  ASP B C   1 
ATOM   2111 O  O   . ASP B 1 37  ? -18.660 -5.052  -5.361  1.00 42.93 ? 37  ASP B O   1 
ATOM   2112 C  CB  . ASP B 1 37  ? -18.527 -6.127  -8.700  1.00 42.96 ? 37  ASP B CB  1 
ATOM   2113 C  CG  . ASP B 1 37  ? -19.052 -7.438  -8.142  1.00 40.03 ? 37  ASP B CG  1 
ATOM   2114 O  OD1 . ASP B 1 37  ? -19.469 -7.465  -6.969  1.00 41.51 ? 37  ASP B OD1 1 
ATOM   2115 O  OD2 . ASP B 1 37  ? -19.075 -8.437  -8.887  1.00 43.36 ? 37  ASP B OD2 1 
ATOM   2116 N  N   . SER B 1 38  ? -20.109 -4.525  -7.011  1.00 47.44 ? 38  SER B N   1 
ATOM   2117 C  CA  . SER B 1 38  ? -21.197 -4.164  -6.104  1.00 49.26 ? 38  SER B CA  1 
ATOM   2118 C  C   . SER B 1 38  ? -21.574 -5.266  -5.119  1.00 49.04 ? 38  SER B C   1 
ATOM   2119 O  O   . SER B 1 38  ? -21.869 -4.963  -3.958  1.00 49.81 ? 38  SER B O   1 
ATOM   2120 C  CB  . SER B 1 38  ? -22.430 -3.708  -6.905  1.00 50.65 ? 38  SER B CB  1 
ATOM   2121 O  OG  . SER B 1 38  ? -22.822 -4.677  -7.876  1.00 57.70 ? 38  SER B OG  1 
ATOM   2122 N  N   . ASN B 1 39  ? -21.561 -6.525  -5.571  1.00 47.36 ? 39  ASN B N   1 
ATOM   2123 C  CA  . ASN B 1 39  ? -21.891 -7.673  -4.710  1.00 47.75 ? 39  ASN B CA  1 
ATOM   2124 C  C   . ASN B 1 39  ? -20.737 -8.077  -3.777  1.00 47.46 ? 39  ASN B C   1 
ATOM   2125 O  O   . ASN B 1 39  ? -20.899 -8.941  -2.905  1.00 47.86 ? 39  ASN B O   1 
ATOM   2126 C  CB  . ASN B 1 39  ? -22.250 -8.900  -5.550  1.00 50.41 ? 39  ASN B CB  1 
ATOM   2127 C  CG  . ASN B 1 39  ? -23.489 -8.696  -6.413  1.00 56.00 ? 39  ASN B CG  1 
ATOM   2128 O  OD1 . ASN B 1 39  ? -24.600 -8.501  -5.896  1.00 56.36 ? 39  ASN B OD1 1 
ATOM   2129 N  ND2 . ASN B 1 39  ? -23.306 -8.749  -7.738  1.00 53.42 ? 39  ASN B ND2 1 
ATOM   2130 N  N   . GLY B 1 40  ? -19.567 -7.473  -3.959  1.00 46.22 ? 40  GLY B N   1 
ATOM   2131 C  CA  . GLY B 1 40  ? -18.446 -7.842  -3.109  1.00 42.05 ? 40  GLY B CA  1 
ATOM   2132 C  C   . GLY B 1 40  ? -17.661 -9.006  -3.703  1.00 37.02 ? 40  GLY B C   1 
ATOM   2133 O  O   . GLY B 1 40  ? -16.873 -9.664  -3.019  1.00 38.05 ? 40  GLY B O   1 
ATOM   2134 N  N   . ASN B 1 41  ? -17.885 -9.270  -4.981  1.00 35.44 ? 41  ASN B N   1 
ATOM   2135 C  CA  . ASN B 1 41  ? -17.172 -10.346 -5.665  1.00 34.86 ? 41  ASN B CA  1 
ATOM   2136 C  C   . ASN B 1 41  ? -15.912 -9.773  -6.281  1.00 31.20 ? 41  ASN B C   1 
ATOM   2137 O  O   . ASN B 1 41  ? -15.899 -8.622  -6.735  1.00 29.73 ? 41  ASN B O   1 
ATOM   2138 C  CB  . ASN B 1 41  ? -18.037 -10.947 -6.762  1.00 40.22 ? 41  ASN B CB  1 
ATOM   2139 C  CG  . ASN B 1 41  ? -19.177 -11.780 -6.208  1.00 41.66 ? 41  ASN B CG  1 
ATOM   2140 O  OD1 . ASN B 1 41  ? -20.180 -11.974 -6.877  1.00 47.92 ? 41  ASN B OD1 1 
ATOM   2141 N  ND2 . ASN B 1 41  ? -19.007 -12.302 -4.993  1.00 44.98 ? 41  ASN B ND2 1 
ATOM   2142 N  N   . PRO B 1 42  ? -14.831 -10.565 -6.297  1.00 26.68 ? 42  PRO B N   1 
ATOM   2143 C  CA  . PRO B 1 42  ? -13.554 -10.118 -6.869  1.00 24.62 ? 42  PRO B CA  1 
ATOM   2144 C  C   . PRO B 1 42  ? -13.595 -9.981  -8.389  1.00 27.70 ? 42  PRO B C   1 
ATOM   2145 O  O   . PRO B 1 42  ? -14.329 -10.706 -9.074  1.00 26.78 ? 42  PRO B O   1 
ATOM   2146 C  CB  . PRO B 1 42  ? -12.585 -11.209 -6.415  1.00 23.14 ? 42  PRO B CB  1 
ATOM   2147 C  CG  . PRO B 1 42  ? -13.487 -12.479 -6.468  1.00 25.65 ? 42  PRO B CG  1 
ATOM   2148 C  CD  . PRO B 1 42  ? -14.708 -11.913 -5.714  1.00 25.62 ? 42  PRO B CD  1 
ATOM   2149 N  N   . VAL B 1 43  ? -12.790 -9.065  -8.915  1.00 26.66 ? 43  VAL B N   1 
ATOM   2150 C  CA  . VAL B 1 43  ? -12.723 -8.849  -10.357 1.00 29.04 ? 43  VAL B CA  1 
ATOM   2151 C  C   . VAL B 1 43  ? -11.266 -8.911  -10.789 1.00 28.14 ? 43  VAL B C   1 
ATOM   2152 O  O   . VAL B 1 43  ? -10.347 -8.725  -9.982  1.00 24.63 ? 43  VAL B O   1 
ATOM   2153 C  CB  . VAL B 1 43  ? -13.330 -7.481  -10.769 1.00 29.36 ? 43  VAL B CB  1 
ATOM   2154 C  CG1 . VAL B 1 43  ? -14.745 -7.365  -10.243 1.00 32.26 ? 43  VAL B CG1 1 
ATOM   2155 C  CG2 . VAL B 1 43  ? -12.476 -6.327  -10.252 1.00 32.22 ? 43  VAL B CG2 1 
ATOM   2156 N  N   . ALA B 1 44  ? -11.056 -9.200  -12.060 1.00 25.57 ? 44  ALA B N   1 
ATOM   2157 C  CA  . ALA B 1 44  ? -9.711  -9.280  -12.594 1.00 24.65 ? 44  ALA B CA  1 
ATOM   2158 C  C   . ALA B 1 44  ? -9.054  -7.913  -12.770 1.00 24.87 ? 44  ALA B C   1 
ATOM   2159 O  O   . ALA B 1 44  ? -9.702  -6.862  -12.696 1.00 23.83 ? 44  ALA B O   1 
ATOM   2160 C  CB  . ALA B 1 44  ? -9.738  -10.003 -13.939 1.00 29.13 ? 44  ALA B CB  1 
ATOM   2161 N  N   . SER B 1 45  ? -7.742  -7.963  -12.957 1.00 21.38 ? 45  SER B N   1 
ATOM   2162 C  CA  . SER B 1 45  ? -6.942  -6.811  -13.277 1.00 24.14 ? 45  SER B CA  1 
ATOM   2163 C  C   . SER B 1 45  ? -7.048  -5.647  -12.303 1.00 25.84 ? 45  SER B C   1 
ATOM   2164 O  O   . SER B 1 45  ? -7.501  -4.555  -12.673 1.00 23.68 ? 45  SER B O   1 
ATOM   2165 C  CB  . SER B 1 45  ? -7.330  -6.374  -14.700 1.00 30.12 ? 45  SER B CB  1 
ATOM   2166 O  OG  . SER B 1 45  ? -6.378  -5.484  -15.237 1.00 41.01 ? 45  SER B OG  1 
ATOM   2167 N  N   . THR B 1 46  ? -6.631  -5.881  -11.058 1.00 21.54 ? 46  THR B N   1 
ATOM   2168 C  CA  . THR B 1 46  ? -6.700  -4.839  -10.030 1.00 18.95 ? 46  THR B CA  1 
ATOM   2169 C  C   . THR B 1 46  ? -5.456  -4.919  -9.124  1.00 21.00 ? 46  THR B C   1 
ATOM   2170 O  O   . THR B 1 46  ? -4.877  -5.980  -8.945  1.00 19.34 ? 46  THR B O   1 
ATOM   2171 C  CB  . THR B 1 46  ? -8.003  -4.993  -9.172  1.00 20.62 ? 46  THR B CB  1 
ATOM   2172 O  OG1 . THR B 1 46  ? -7.908  -4.188  -7.987  1.00 20.24 ? 46  THR B OG1 1 
ATOM   2173 C  CG2 . THR B 1 46  ? -8.236  -6.470  -8.773  1.00 21.83 ? 46  THR B CG2 1 
ATOM   2174 N  N   . VAL B 1 47  ? -5.059  -3.780  -8.578  1.00 19.16 ? 47  VAL B N   1 
ATOM   2175 C  CA  . VAL B 1 47  ? -3.909  -3.698  -7.685  1.00 20.67 ? 47  VAL B CA  1 
ATOM   2176 C  C   . VAL B 1 47  ? -4.266  -2.654  -6.634  1.00 19.24 ? 47  VAL B C   1 
ATOM   2177 O  O   . VAL B 1 47  ? -4.923  -1.659  -6.930  1.00 22.21 ? 47  VAL B O   1 
ATOM   2178 C  CB  . VAL B 1 47  ? -2.633  -3.216  -8.453  1.00 22.83 ? 47  VAL B CB  1 
ATOM   2179 C  CG1 . VAL B 1 47  ? -1.449  -3.109  -7.513  1.00 22.60 ? 47  VAL B CG1 1 
ATOM   2180 C  CG2 . VAL B 1 47  ? -2.282  -4.187  -9.547  1.00 26.29 ? 47  VAL B CG2 1 
ATOM   2181 N  N   . GLY B 1 48  ? -3.828  -2.867  -5.410  1.00 18.27 ? 48  GLY B N   1 
ATOM   2182 C  CA  . GLY B 1 48  ? -4.111  -1.899  -4.361  1.00 17.64 ? 48  GLY B CA  1 
ATOM   2183 C  C   . GLY B 1 48  ? -3.091  -2.097  -3.253  1.00 16.83 ? 48  GLY B C   1 
ATOM   2184 O  O   . GLY B 1 48  ? -2.601  -3.204  -3.064  1.00 17.23 ? 48  GLY B O   1 
ATOM   2185 N  N   . ARG B 1 49  ? -2.747  -1.006  -2.562  1.00 13.70 ? 49  ARG B N   1 
ATOM   2186 C  CA  . ARG B 1 49  ? -1.774  -1.062  -1.472  1.00 13.89 ? 49  ARG B CA  1 
ATOM   2187 C  C   . ARG B 1 49  ? -2.206  -0.036  -0.426  1.00 14.88 ? 49  ARG B C   1 
ATOM   2188 O  O   . ARG B 1 49  ? -2.977  0.891   -0.742  1.00 18.12 ? 49  ARG B O   1 
ATOM   2189 C  CB  . ARG B 1 49  ? -0.363  -0.652  -1.958  1.00 13.72 ? 49  ARG B CB  1 
ATOM   2190 C  CG  . ARG B 1 49  ? 0.027   -1.229  -3.348  1.00 16.02 ? 49  ARG B CG  1 
ATOM   2191 C  CD  . ARG B 1 49  ? 1.523   -1.216  -3.655  1.00 18.90 ? 49  ARG B CD  1 
ATOM   2192 N  NE  . ARG B 1 49  ? 2.149   0.088   -3.469  1.00 18.92 ? 49  ARG B NE  1 
ATOM   2193 C  CZ  . ARG B 1 49  ? 3.432   0.304   -3.719  1.00 22.02 ? 49  ARG B CZ  1 
ATOM   2194 N  NH1 . ARG B 1 49  ? 4.181   -0.701  -4.173  1.00 21.44 ? 49  ARG B NH1 1 
ATOM   2195 N  NH2 . ARG B 1 49  ? 3.985   1.489   -3.424  1.00 20.46 ? 49  ARG B NH2 1 
ATOM   2196 N  N   . ILE B 1 50  ? -1.788  -0.250  0.826   1.00 17.06 ? 50  ILE B N   1 
ATOM   2197 C  CA  . ILE B 1 50  ? -2.016  0.779   1.849   1.00 14.76 ? 50  ILE B CA  1 
ATOM   2198 C  C   . ILE B 1 50  ? -0.671  0.927   2.536   1.00 17.24 ? 50  ILE B C   1 
ATOM   2199 O  O   . ILE B 1 50  ? 0.120   -0.016  2.590   1.00 17.51 ? 50  ILE B O   1 
ATOM   2200 C  CB  . ILE B 1 50  ? -3.059  0.408   2.942   1.00 17.95 ? 50  ILE B CB  1 
ATOM   2201 C  CG1 . ILE B 1 50  ? -2.731  -0.951  3.579   1.00 19.62 ? 50  ILE B CG1 1 
ATOM   2202 C  CG2 . ILE B 1 50  ? -4.456  0.514   2.377   1.00 20.38 ? 50  ILE B CG2 1 
ATOM   2203 C  CD1 . ILE B 1 50  ? -3.360  -1.100  4.988   1.00 22.75 ? 50  ILE B CD1 1 
ATOM   2204 N  N   . LEU B 1 51  ? -0.395  2.123   3.052   1.00 17.91 ? 51  LEU B N   1 
ATOM   2205 C  CA  . LEU B 1 51  ? 0.837   2.346   3.806   1.00 16.68 ? 51  LEU B CA  1 
ATOM   2206 C  C   . LEU B 1 51  ? 0.467   3.142   5.067   1.00 18.23 ? 51  LEU B C   1 
ATOM   2207 O  O   . LEU B 1 51  ? -0.457  3.944   5.037   1.00 16.98 ? 51  LEU B O   1 
ATOM   2208 C  CB  . LEU B 1 51  ? 1.826   3.190   3.013   1.00 17.21 ? 51  LEU B CB  1 
ATOM   2209 C  CG  . LEU B 1 51  ? 2.403   2.608   1.715   1.00 20.50 ? 51  LEU B CG  1 
ATOM   2210 C  CD1 . LEU B 1 51  ? 2.975   3.700   0.861   1.00 33.44 ? 51  LEU B CD1 1 
ATOM   2211 C  CD2 . LEU B 1 51  ? 3.466   1.607   2.070   1.00 23.34 ? 51  LEU B CD2 1 
ATOM   2212 N  N   . PHE B 1 52  ? 1.194   2.924   6.162   1.00 15.92 ? 52  PHE B N   1 
ATOM   2213 C  CA  . PHE B 1 52  ? 0.907   3.772   7.325   1.00 17.59 ? 52  PHE B CA  1 
ATOM   2214 C  C   . PHE B 1 52  ? 1.577   5.119   6.988   1.00 18.10 ? 52  PHE B C   1 
ATOM   2215 O  O   . PHE B 1 52  ? 2.682   5.164   6.440   1.00 18.18 ? 52  PHE B O   1 
ATOM   2216 C  CB  . PHE B 1 52  ? 1.505   3.204   8.599   1.00 14.51 ? 52  PHE B CB  1 
ATOM   2217 C  CG  . PHE B 1 52  ? 1.039   3.944   9.835   1.00 17.34 ? 52  PHE B CG  1 
ATOM   2218 C  CD1 . PHE B 1 52  ? -0.300  3.885   10.202  1.00 17.96 ? 52  PHE B CD1 1 
ATOM   2219 C  CD2 . PHE B 1 52  ? 1.924   4.702   10.598  1.00 19.71 ? 52  PHE B CD2 1 
ATOM   2220 C  CE1 . PHE B 1 52  ? -0.766  4.560   11.319  1.00 19.71 ? 52  PHE B CE1 1 
ATOM   2221 C  CE2 . PHE B 1 52  ? 1.467   5.398   11.730  1.00 18.41 ? 52  PHE B CE2 1 
ATOM   2222 C  CZ  . PHE B 1 52  ? 0.137   5.323   12.088  1.00 18.58 ? 52  PHE B CZ  1 
ATOM   2223 N  N   . SER B 1 53  ? 0.929   6.217   7.356   1.00 18.16 ? 53  SER B N   1 
ATOM   2224 C  CA  . SER B 1 53  ? 1.462   7.520   6.985   1.00 18.09 ? 53  SER B CA  1 
ATOM   2225 C  C   . SER B 1 53  ? 2.754   7.910   7.665   1.00 20.96 ? 53  SER B C   1 
ATOM   2226 O  O   . SER B 1 53  ? 3.646   8.432   7.003   1.00 21.08 ? 53  SER B O   1 
ATOM   2227 C  CB  . SER B 1 53  ? 0.410   8.615   7.196   1.00 23.27 ? 53  SER B CB  1 
ATOM   2228 O  OG  . SER B 1 53  ? 0.168   8.800   8.568   1.00 28.19 ? 53  SER B OG  1 
ATOM   2229 N  N   . ALA B 1 54  ? 2.891   7.645   8.963   1.00 18.72 ? 54  ALA B N   1 
ATOM   2230 C  CA  . ALA B 1 54  ? 4.140   8.045   9.624   1.00 20.71 ? 54  ALA B CA  1 
ATOM   2231 C  C   . ALA B 1 54  ? 5.323   7.191   9.163   1.00 21.46 ? 54  ALA B C   1 
ATOM   2232 O  O   . ALA B 1 54  ? 5.205   5.964   8.978   1.00 19.33 ? 54  ALA B O   1 
ATOM   2233 C  CB  . ALA B 1 54  ? 3.999   7.969   11.136  1.00 19.91 ? 54  ALA B CB  1 
ATOM   2234 N  N   . GLN B 1 55  ? 6.463   7.840   8.958   1.00 18.31 ? 55  GLN B N   1 
ATOM   2235 C  CA  . GLN B 1 55  ? 7.649   7.112   8.532   1.00 19.09 ? 55  GLN B CA  1 
ATOM   2236 C  C   . GLN B 1 55  ? 8.282   6.369   9.709   1.00 19.76 ? 55  GLN B C   1 
ATOM   2237 O  O   . GLN B 1 55  ? 8.238   6.843   10.860  1.00 18.01 ? 55  GLN B O   1 
ATOM   2238 C  CB  . GLN B 1 55  ? 8.626   8.099   7.870   1.00 19.81 ? 55  GLN B CB  1 
ATOM   2239 C  CG  . GLN B 1 55  ? 8.035   8.661   6.582   1.00 25.30 ? 55  GLN B CG  1 
ATOM   2240 C  CD  . GLN B 1 55  ? 8.952   9.609   5.848   1.00 23.00 ? 55  GLN B CD  1 
ATOM   2241 O  OE1 . GLN B 1 55  ? 10.150  9.379   5.754   1.00 26.17 ? 55  GLN B OE1 1 
ATOM   2242 N  NE2 . GLN B 1 55  ? 8.386   10.666  5.305   1.00 27.02 ? 55  GLN B NE2 1 
ATOM   2243 N  N   . VAL B 1 56  ? 8.833   5.188   9.436   1.00 18.81 ? 56  VAL B N   1 
ATOM   2244 C  CA  . VAL B 1 56  ? 9.473   4.369   10.482  1.00 16.25 ? 56  VAL B CA  1 
ATOM   2245 C  C   . VAL B 1 56  ? 10.989  4.539   10.418  1.00 18.08 ? 56  VAL B C   1 
ATOM   2246 O  O   . VAL B 1 56  ? 11.569  4.465   9.350   1.00 19.22 ? 56  VAL B O   1 
ATOM   2247 C  CB  . VAL B 1 56  ? 9.172   2.847   10.306  1.00 18.30 ? 56  VAL B CB  1 
ATOM   2248 C  CG1 . VAL B 1 56  ? 9.891   2.045   11.381  1.00 18.87 ? 56  VAL B CG1 1 
ATOM   2249 C  CG2 . VAL B 1 56  ? 7.651   2.607   10.355  1.00 22.07 ? 56  VAL B CG2 1 
ATOM   2250 N  N   . HIS B 1 57  ? 11.637  4.746   11.561  1.00 17.79 ? 57  HIS B N   1 
ATOM   2251 C  CA  . HIS B 1 57  ? 13.101  4.916   11.564  1.00 18.65 ? 57  HIS B CA  1 
ATOM   2252 C  C   . HIS B 1 57  ? 13.669  3.511   11.713  1.00 20.38 ? 57  HIS B C   1 
ATOM   2253 O  O   . HIS B 1 57  ? 13.767  2.988   12.836  1.00 19.66 ? 57  HIS B O   1 
ATOM   2254 C  CB  . HIS B 1 57  ? 13.510  5.822   12.757  1.00 22.10 ? 57  HIS B CB  1 
ATOM   2255 C  CG  . HIS B 1 57  ? 14.816  6.537   12.567  1.00 25.48 ? 57  HIS B CG  1 
ATOM   2256 N  ND1 . HIS B 1 57  ? 15.573  6.430   11.421  1.00 32.77 ? 57  HIS B ND1 1 
ATOM   2257 C  CD2 . HIS B 1 57  ? 15.483  7.398   13.376  1.00 22.43 ? 57  HIS B CD2 1 
ATOM   2258 C  CE1 . HIS B 1 57  ? 16.654  7.190   11.532  1.00 29.93 ? 57  HIS B CE1 1 
ATOM   2259 N  NE2 . HIS B 1 57  ? 16.620  7.787   12.711  1.00 29.77 ? 57  HIS B NE2 1 
ATOM   2260 N  N   . LEU B 1 58  ? 14.017  2.888   10.572  1.00 19.84 ? 58  LEU B N   1 
ATOM   2261 C  CA  . LEU B 1 58  ? 14.533  1.522   10.529  1.00 21.18 ? 58  LEU B CA  1 
ATOM   2262 C  C   . LEU B 1 58  ? 15.982  1.386   11.025  1.00 19.46 ? 58  LEU B C   1 
ATOM   2263 O  O   . LEU B 1 58  ? 16.325  0.422   11.674  1.00 20.20 ? 58  LEU B O   1 
ATOM   2264 C  CB  . LEU B 1 58  ? 14.402  0.993   9.095   1.00 19.53 ? 58  LEU B CB  1 
ATOM   2265 C  CG  . LEU B 1 58  ? 14.736  -0.467  8.823   1.00 26.07 ? 58  LEU B CG  1 
ATOM   2266 C  CD1 . LEU B 1 58  ? 13.754  -1.378  9.538   1.00 25.51 ? 58  LEU B CD1 1 
ATOM   2267 C  CD2 . LEU B 1 58  ? 14.661  -0.704  7.325   1.00 24.41 ? 58  LEU B CD2 1 
ATOM   2268 N  N   . TRP B 1 59  ? 16.840  2.335   10.680  1.00 19.07 ? 59  TRP B N   1 
ATOM   2269 C  CA  . TRP B 1 59  ? 18.210  2.291   11.187  1.00 23.25 ? 59  TRP B CA  1 
ATOM   2270 C  C   . TRP B 1 59  ? 18.772  3.695   11.160  1.00 25.10 ? 59  TRP B C   1 
ATOM   2271 O  O   . TRP B 1 59  ? 18.240  4.578   10.471  1.00 24.06 ? 59  TRP B O   1 
ATOM   2272 C  CB  . TRP B 1 59  ? 19.119  1.313   10.418  1.00 21.41 ? 59  TRP B CB  1 
ATOM   2273 C  CG  . TRP B 1 59  ? 19.294  1.572   8.974   1.00 25.62 ? 59  TRP B CG  1 
ATOM   2274 C  CD1 . TRP B 1 59  ? 18.417  1.278   7.964   1.00 24.17 ? 59  TRP B CD1 1 
ATOM   2275 C  CD2 . TRP B 1 59  ? 20.448  2.155   8.352   1.00 29.38 ? 59  TRP B CD2 1 
ATOM   2276 N  NE1 . TRP B 1 59  ? 18.961  1.643   6.744   1.00 28.07 ? 59  TRP B NE1 1 
ATOM   2277 C  CE2 . TRP B 1 59  ? 20.206  2.183   6.960   1.00 31.84 ? 59  TRP B CE2 1 
ATOM   2278 C  CE3 . TRP B 1 59  ? 21.666  2.655   8.842   1.00 32.85 ? 59  TRP B CE3 1 
ATOM   2279 C  CZ2 . TRP B 1 59  ? 21.140  2.694   6.046   1.00 34.74 ? 59  TRP B CZ2 1 
ATOM   2280 C  CZ3 . TRP B 1 59  ? 22.595  3.160   7.934   1.00 33.75 ? 59  TRP B CZ3 1 
ATOM   2281 C  CH2 . TRP B 1 59  ? 22.324  3.175   6.555   1.00 32.31 ? 59  TRP B CH2 1 
ATOM   2282 N  N   . GLU B 1 60  ? 19.833  3.906   11.930  1.00 28.26 ? 60  GLU B N   1 
ATOM   2283 C  CA  . GLU B 1 60  ? 20.418  5.243   12.046  1.00 32.36 ? 60  GLU B CA  1 
ATOM   2284 C  C   . GLU B 1 60  ? 21.933  5.152   11.921  1.00 32.20 ? 60  GLU B C   1 
ATOM   2285 O  O   . GLU B 1 60  ? 22.611  4.617   12.797  1.00 35.41 ? 60  GLU B O   1 
ATOM   2286 C  CB  . GLU B 1 60  ? 20.015  5.838   13.396  1.00 34.43 ? 60  GLU B CB  1 
ATOM   2287 C  CG  . GLU B 1 60  ? 20.390  7.291   13.597  1.00 38.00 ? 60  GLU B CG  1 
ATOM   2288 C  CD  . GLU B 1 60  ? 19.909  7.822   14.947  1.00 41.96 ? 60  GLU B CD  1 
ATOM   2289 O  OE1 . GLU B 1 60  ? 20.367  7.318   15.995  1.00 40.09 ? 60  GLU B OE1 1 
ATOM   2290 O  OE2 . GLU B 1 60  ? 19.057  8.734   14.955  1.00 44.34 ? 60  GLU B OE2 1 
ATOM   2291 N  N   . LYS B 1 61  ? 22.451  5.682   10.824  1.00 35.42 ? 61  LYS B N   1 
ATOM   2292 C  CA  . LYS B 1 61  ? 23.882  5.622   10.569  1.00 40.27 ? 61  LYS B CA  1 
ATOM   2293 C  C   . LYS B 1 61  ? 24.697  6.286   11.685  1.00 41.59 ? 61  LYS B C   1 
ATOM   2294 O  O   . LYS B 1 61  ? 25.599  5.680   12.261  1.00 44.51 ? 61  LYS B O   1 
ATOM   2295 C  CB  . LYS B 1 61  ? 24.177  6.269   9.222   1.00 40.51 ? 61  LYS B CB  1 
ATOM   2296 C  CG  . LYS B 1 61  ? 25.583  6.019   8.711   1.00 46.01 ? 61  LYS B CG  1 
ATOM   2297 C  CD  . LYS B 1 61  ? 25.763  6.633   7.323   1.00 47.31 ? 61  LYS B CD  1 
ATOM   2298 N  N   . SER B 1 62  ? 24.340  7.510   12.033  1.00 42.49 ? 62  SER B N   1 
ATOM   2299 C  CA  . SER B 1 62  ? 25.071  8.243   13.060  1.00 44.70 ? 62  SER B CA  1 
ATOM   2300 C  C   . SER B 1 62  ? 25.262  7.530   14.392  1.00 45.09 ? 62  SER B C   1 
ATOM   2301 O  O   . SER B 1 62  ? 26.190  7.847   15.132  1.00 45.94 ? 62  SER B O   1 
ATOM   2302 C  CB  . SER B 1 62  ? 24.395  9.583   13.334  1.00 42.01 ? 62  SER B CB  1 
ATOM   2303 O  OG  . SER B 1 62  ? 23.157  9.386   13.984  1.00 48.35 ? 62  SER B OG  1 
ATOM   2304 N  N   . SER B 1 63  ? 24.399  6.577   14.723  1.00 43.56 ? 63  SER B N   1 
ATOM   2305 C  CA  . SER B 1 63  ? 24.545  5.911   16.004  1.00 39.47 ? 63  SER B CA  1 
ATOM   2306 C  C   . SER B 1 63  ? 24.693  4.401   15.897  1.00 38.97 ? 63  SER B C   1 
ATOM   2307 O  O   . SER B 1 63  ? 24.732  3.705   16.915  1.00 40.55 ? 63  SER B O   1 
ATOM   2308 C  CB  . SER B 1 63  ? 23.351  6.260   16.902  1.00 43.43 ? 63  SER B CB  1 
ATOM   2309 O  OG  . SER B 1 63  ? 22.133  5.802   16.322  1.00 44.43 ? 63  SER B OG  1 
ATOM   2310 N  N   . SER B 1 64  ? 24.784  3.892   14.672  1.00 38.37 ? 64  SER B N   1 
ATOM   2311 C  CA  . SER B 1 64  ? 24.920  2.456   14.462  1.00 39.24 ? 64  SER B CA  1 
ATOM   2312 C  C   . SER B 1 64  ? 23.764  1.645   15.081  1.00 35.74 ? 64  SER B C   1 
ATOM   2313 O  O   . SER B 1 64  ? 23.959  0.507   15.504  1.00 38.23 ? 64  SER B O   1 
ATOM   2314 C  CB  . SER B 1 64  ? 26.249  1.961   15.048  1.00 45.40 ? 64  SER B CB  1 
ATOM   2315 O  OG  . SER B 1 64  ? 27.356  2.600   14.427  1.00 53.04 ? 64  SER B OG  1 
ATOM   2316 N  N   . ARG B 1 65  ? 22.571  2.228   15.166  1.00 30.14 ? 65  ARG B N   1 
ATOM   2317 C  CA  . ARG B 1 65  ? 21.449  1.473   15.709  1.00 25.75 ? 65  ARG B CA  1 
ATOM   2318 C  C   . ARG B 1 65  ? 20.573  0.942   14.565  1.00 20.86 ? 65  ARG B C   1 
ATOM   2319 O  O   . ARG B 1 65  ? 20.528  1.525   13.481  1.00 22.58 ? 65  ARG B O   1 
ATOM   2320 C  CB  . ARG B 1 65  ? 20.609  2.342   16.657  1.00 29.89 ? 65  ARG B CB  1 
ATOM   2321 C  CG  . ARG B 1 65  ? 21.305  2.695   17.967  1.00 29.52 ? 65  ARG B CG  1 
ATOM   2322 C  CD  . ARG B 1 65  ? 20.359  3.429   18.903  1.00 30.70 ? 65  ARG B CD  1 
ATOM   2323 N  NE  . ARG B 1 65  ? 19.937  4.710   18.355  1.00 31.75 ? 65  ARG B NE  1 
ATOM   2324 C  CZ  . ARG B 1 65  ? 18.939  5.432   18.862  1.00 31.85 ? 65  ARG B CZ  1 
ATOM   2325 N  NH1 . ARG B 1 65  ? 18.283  4.981   19.920  1.00 28.70 ? 65  ARG B NH1 1 
ATOM   2326 N  NH2 . ARG B 1 65  ? 18.591  6.579   18.297  1.00 30.79 ? 65  ARG B NH2 1 
ATOM   2327 N  N   . VAL B 1 66  ? 19.878  -0.153  14.838  1.00 23.99 ? 66  VAL B N   1 
ATOM   2328 C  CA  . VAL B 1 66  ? 18.962  -0.777  13.880  1.00 20.90 ? 66  VAL B CA  1 
ATOM   2329 C  C   . VAL B 1 66  ? 17.713  -1.171  14.677  1.00 20.21 ? 66  VAL B C   1 
ATOM   2330 O  O   . VAL B 1 66  ? 17.802  -1.639  15.801  1.00 21.31 ? 66  VAL B O   1 
ATOM   2331 C  CB  . VAL B 1 66  ? 19.555  -2.054  13.275  1.00 22.38 ? 66  VAL B CB  1 
ATOM   2332 C  CG1 . VAL B 1 66  ? 18.590  -2.617  12.212  1.00 19.96 ? 66  VAL B CG1 1 
ATOM   2333 C  CG2 . VAL B 1 66  ? 20.924  -1.748  12.665  1.00 22.40 ? 66  VAL B CG2 1 
ATOM   2334 N  N   . ALA B 1 67  ? 16.552  -1.014  14.068  1.00 19.62 ? 67  ALA B N   1 
ATOM   2335 C  CA  . ALA B 1 67  ? 15.327  -1.339  14.778  1.00 19.21 ? 67  ALA B CA  1 
ATOM   2336 C  C   . ALA B 1 67  ? 14.959  -2.799  14.925  1.00 20.80 ? 67  ALA B C   1 
ATOM   2337 O  O   . ALA B 1 67  ? 15.222  -3.629  14.066  1.00 22.81 ? 67  ALA B O   1 
ATOM   2338 C  CB  . ALA B 1 67  ? 14.173  -0.618  14.129  1.00 20.44 ? 67  ALA B CB  1 
ATOM   2339 N  N   . ASN B 1 68  ? 14.343  -3.093  16.053  1.00 17.30 ? 68  ASN B N   1 
ATOM   2340 C  CA  . ASN B 1 68  ? 13.762  -4.391  16.301  1.00 17.86 ? 68  ASN B CA  1 
ATOM   2341 C  C   . ASN B 1 68  ? 12.290  -4.081  15.908  1.00 20.52 ? 68  ASN B C   1 
ATOM   2342 O  O   . ASN B 1 68  ? 11.719  -3.101  16.410  1.00 19.99 ? 68  ASN B O   1 
ATOM   2343 C  CB  . ASN B 1 68  ? 13.831  -4.704  17.797  1.00 23.12 ? 68  ASN B CB  1 
ATOM   2344 C  CG  . ASN B 1 68  ? 13.470  -6.130  18.113  1.00 35.72 ? 68  ASN B CG  1 
ATOM   2345 O  OD1 . ASN B 1 68  ? 14.323  -6.911  18.544  1.00 46.55 ? 68  ASN B OD1 1 
ATOM   2346 N  ND2 . ASN B 1 68  ? 12.209  -6.493  17.889  1.00 33.35 ? 68  ASN B ND2 1 
ATOM   2347 N  N   . PHE B 1 69  ? 11.669  -4.823  14.993  1.00 16.08 ? 69  PHE B N   1 
ATOM   2348 C  CA  . PHE B 1 69  ? 10.251  -4.533  14.729  1.00 17.30 ? 69  PHE B CA  1 
ATOM   2349 C  C   . PHE B 1 69  ? 9.416   -5.795  14.703  1.00 16.70 ? 69  PHE B C   1 
ATOM   2350 O  O   . PHE B 1 69  ? 9.938   -6.912  14.512  1.00 15.52 ? 69  PHE B O   1 
ATOM   2351 C  CB  . PHE B 1 69  ? 10.022  -3.725  13.438  1.00 15.62 ? 69  PHE B CB  1 
ATOM   2352 C  CG  . PHE B 1 69  ? 10.430  -4.433  12.145  1.00 22.41 ? 69  PHE B CG  1 
ATOM   2353 C  CD1 . PHE B 1 69  ? 9.587   -5.363  11.538  1.00 24.68 ? 69  PHE B CD1 1 
ATOM   2354 C  CD2 . PHE B 1 69  ? 11.646  -4.119  11.525  1.00 24.12 ? 69  PHE B CD2 1 
ATOM   2355 C  CE1 . PHE B 1 69  ? 9.946   -5.982  10.313  1.00 25.18 ? 69  PHE B CE1 1 
ATOM   2356 C  CE2 . PHE B 1 69  ? 12.015  -4.726  10.309  1.00 26.68 ? 69  PHE B CE2 1 
ATOM   2357 C  CZ  . PHE B 1 69  ? 11.160  -5.659  9.706   1.00 22.15 ? 69  PHE B CZ  1 
ATOM   2358 N  N   . GLN B 1 70  ? 8.121   -5.632  14.953  1.00 15.49 ? 70  GLN B N   1 
ATOM   2359 C  CA  . GLN B 1 70  ? 7.217   -6.809  14.911  1.00 14.98 ? 70  GLN B CA  1 
ATOM   2360 C  C   . GLN B 1 70  ? 5.941   -6.335  14.234  1.00 16.14 ? 70  GLN B C   1 
ATOM   2361 O  O   . GLN B 1 70  ? 5.440   -5.235  14.539  1.00 15.19 ? 70  GLN B O   1 
ATOM   2362 C  CB  . GLN B 1 70  ? 6.868   -7.313  16.317  1.00 20.43 ? 70  GLN B CB  1 
ATOM   2363 C  CG  . GLN B 1 70  ? 8.018   -7.927  17.068  1.00 32.27 ? 70  GLN B CG  1 
ATOM   2364 C  CD  . GLN B 1 70  ? 7.595   -8.363  18.448  1.00 42.22 ? 70  GLN B CD  1 
ATOM   2365 O  OE1 . GLN B 1 70  ? 6.533   -8.977  18.617  1.00 44.97 ? 70  GLN B OE1 1 
ATOM   2366 N  NE2 . GLN B 1 70  ? 8.419   -8.052  19.450  1.00 48.08 ? 70  GLN B NE2 1 
ATOM   2367 N  N   . SER B 1 71  ? 5.415   -7.152  13.314  1.00 12.99 ? 71  SER B N   1 
ATOM   2368 C  CA  . SER B 1 71  ? 4.194   -6.777  12.622  1.00 11.46 ? 71  SER B CA  1 
ATOM   2369 C  C   . SER B 1 71  ? 3.267   -7.986  12.731  1.00 14.58 ? 71  SER B C   1 
ATOM   2370 O  O   . SER B 1 71  ? 3.620   -9.075  12.288  1.00 16.56 ? 71  SER B O   1 
ATOM   2371 C  CB  . SER B 1 71  ? 4.498   -6.508  11.155  1.00 18.84 ? 71  SER B CB  1 
ATOM   2372 O  OG  . SER B 1 71  ? 3.348   -6.048  10.462  1.00 19.06 ? 71  SER B OG  1 
ATOM   2373 N  N   . GLN B 1 72  ? 2.095   -7.804  13.334  1.00 12.19 ? 72  GLN B N   1 
ATOM   2374 C  CA  . GLN B 1 72  ? 1.138   -8.908  13.504  1.00 14.31 ? 72  GLN B CA  1 
ATOM   2375 C  C   . GLN B 1 72  ? -0.083  -8.537  12.665  1.00 13.77 ? 72  GLN B C   1 
ATOM   2376 O  O   . GLN B 1 72  ? -0.542  -7.391  12.680  1.00 12.58 ? 72  GLN B O   1 
ATOM   2377 C  CB  . GLN B 1 72  ? 0.740   -9.053  14.988  1.00 14.87 ? 72  GLN B CB  1 
ATOM   2378 C  CG  . GLN B 1 72  ? 0.130   -10.404 15.357  1.00 24.95 ? 72  GLN B CG  1 
ATOM   2379 C  CD  . GLN B 1 72  ? -1.272  -10.651 14.798  1.00 33.23 ? 72  GLN B CD  1 
ATOM   2380 O  OE1 . GLN B 1 72  ? -1.632  -11.797 14.500  1.00 35.18 ? 72  GLN B OE1 1 
ATOM   2381 N  NE2 . GLN B 1 72  ? -2.071  -9.600  14.691  1.00 25.24 ? 72  GLN B NE2 1 
ATOM   2382 N  N   . PHE B 1 73  ? -0.602  -9.478  11.881  1.00 10.12 ? 73  PHE B N   1 
ATOM   2383 C  CA  . PHE B 1 73  ? -1.755  -9.115  11.072  1.00 11.63 ? 73  PHE B CA  1 
ATOM   2384 C  C   . PHE B 1 73  ? -2.549  -10.359 10.668  1.00 12.13 ? 73  PHE B C   1 
ATOM   2385 O  O   . PHE B 1 73  ? -2.061  -11.477 10.800  1.00 12.88 ? 73  PHE B O   1 
ATOM   2386 C  CB  . PHE B 1 73  ? -1.299  -8.314  9.820   1.00 11.39 ? 73  PHE B CB  1 
ATOM   2387 C  CG  . PHE B 1 73  ? -0.272  -9.029  8.945   1.00 11.53 ? 73  PHE B CG  1 
ATOM   2388 C  CD1 . PHE B 1 73  ? -0.681  -9.851  7.879   1.00 14.15 ? 73  PHE B CD1 1 
ATOM   2389 C  CD2 . PHE B 1 73  ? 1.097   -8.839  9.174   1.00 14.91 ? 73  PHE B CD2 1 
ATOM   2390 C  CE1 . PHE B 1 73  ? 0.288   -10.472 7.043   1.00 14.15 ? 73  PHE B CE1 1 
ATOM   2391 C  CE2 . PHE B 1 73  ? 2.072   -9.446  8.351   1.00 17.60 ? 73  PHE B CE2 1 
ATOM   2392 C  CZ  . PHE B 1 73  ? 1.672   -10.251 7.296   1.00 13.12 ? 73  PHE B CZ  1 
ATOM   2393 N  N   . SER B 1 74  ? -3.793  -10.152 10.258  1.00 11.90 ? 74  SER B N   1 
ATOM   2394 C  CA  . SER B 1 74  ? -4.586  -11.296 9.812   1.00 12.72 ? 74  SER B CA  1 
ATOM   2395 C  C   . SER B 1 74  ? -5.266  -10.920 8.503   1.00 12.82 ? 74  SER B C   1 
ATOM   2396 O  O   . SER B 1 74  ? -5.595  -9.770  8.273   1.00 12.95 ? 74  SER B O   1 
ATOM   2397 C  CB  . SER B 1 74  ? -5.626  -11.703 10.881  1.00 17.03 ? 74  SER B CB  1 
ATOM   2398 O  OG  . SER B 1 74  ? -6.540  -10.661 11.088  1.00 22.60 ? 74  SER B OG  1 
ATOM   2399 N  N   . PHE B 1 75  ? -5.432  -11.897 7.611   1.00 11.53 ? 75  PHE B N   1 
ATOM   2400 C  CA  . PHE B 1 75  ? -6.092  -11.613 6.329   1.00 11.80 ? 75  PHE B CA  1 
ATOM   2401 C  C   . PHE B 1 75  ? -6.831  -12.864 5.873   1.00 9.94  ? 75  PHE B C   1 
ATOM   2402 O  O   . PHE B 1 75  ? -6.624  -13.937 6.418   1.00 13.43 ? 75  PHE B O   1 
ATOM   2403 C  CB  . PHE B 1 75  ? -5.085  -11.198 5.224   1.00 13.81 ? 75  PHE B CB  1 
ATOM   2404 C  CG  . PHE B 1 75  ? -4.129  -12.308 4.786   1.00 12.33 ? 75  PHE B CG  1 
ATOM   2405 C  CD1 . PHE B 1 75  ? -2.854  -12.434 5.372   1.00 15.28 ? 75  PHE B CD1 1 
ATOM   2406 C  CD2 . PHE B 1 75  ? -4.510  -13.240 3.822   1.00 12.32 ? 75  PHE B CD2 1 
ATOM   2407 C  CE1 . PHE B 1 75  ? -1.987  -13.462 5.001   1.00 15.83 ? 75  PHE B CE1 1 
ATOM   2408 C  CE2 . PHE B 1 75  ? -3.647  -14.293 3.433   1.00 17.43 ? 75  PHE B CE2 1 
ATOM   2409 C  CZ  . PHE B 1 75  ? -2.383  -14.416 4.014   1.00 16.42 ? 75  PHE B CZ  1 
ATOM   2410 N  N   . SER B 1 76  ? -7.729  -12.693 4.905   1.00 11.98 ? 76  SER B N   1 
ATOM   2411 C  CA  . SER B 1 76  ? -8.412  -13.840 4.343   1.00 11.68 ? 76  SER B CA  1 
ATOM   2412 C  C   . SER B 1 76  ? -8.568  -13.577 2.852   1.00 12.35 ? 76  SER B C   1 
ATOM   2413 O  O   . SER B 1 76  ? -8.645  -12.421 2.382   1.00 13.34 ? 76  SER B O   1 
ATOM   2414 C  CB  . SER B 1 76  ? -9.780  -14.085 5.033   1.00 17.26 ? 76  SER B CB  1 
ATOM   2415 O  OG  . SER B 1 76  ? -10.608 -12.970 4.841   1.00 20.16 ? 76  SER B OG  1 
ATOM   2416 N  N   . LEU B 1 77  ? -8.630  -14.671 2.101   1.00 12.97 ? 77  LEU B N   1 
ATOM   2417 C  CA  . LEU B 1 77  ? -8.747  -14.601 0.647   1.00 13.97 ? 77  LEU B CA  1 
ATOM   2418 C  C   . LEU B 1 77  ? -9.975  -15.424 0.242   1.00 14.25 ? 77  LEU B C   1 
ATOM   2419 O  O   . LEU B 1 77  ? -10.184 -16.501 0.798   1.00 16.84 ? 77  LEU B O   1 
ATOM   2420 C  CB  . LEU B 1 77  ? -7.548  -15.276 -0.012  1.00 13.99 ? 77  LEU B CB  1 
ATOM   2421 C  CG  . LEU B 1 77  ? -6.155  -14.830 0.484   1.00 16.75 ? 77  LEU B CG  1 
ATOM   2422 C  CD1 . LEU B 1 77  ? -5.083  -15.724 -0.162  1.00 15.82 ? 77  LEU B CD1 1 
ATOM   2423 C  CD2 . LEU B 1 77  ? -5.923  -13.368 0.157   1.00 13.41 ? 77  LEU B CD2 1 
ATOM   2424 N  N   . LYS B 1 78  ? -10.736 -14.932 -0.725  1.00 15.09 ? 78  LYS B N   1 
ATOM   2425 C  CA  . LYS B 1 78  ? -11.920 -15.678 -1.172  1.00 17.18 ? 78  LYS B CA  1 
ATOM   2426 C  C   . LYS B 1 78  ? -12.048 -15.599 -2.676  1.00 14.72 ? 78  LYS B C   1 
ATOM   2427 O  O   . LYS B 1 78  ? -11.866 -14.533 -3.264  1.00 15.77 ? 78  LYS B O   1 
ATOM   2428 C  CB  . LYS B 1 78  ? -13.228 -15.098 -0.573  1.00 21.11 ? 78  LYS B CB  1 
ATOM   2429 C  CG  . LYS B 1 78  ? -13.600 -15.653 0.793   1.00 34.96 ? 78  LYS B CG  1 
ATOM   2430 C  CD  . LYS B 1 78  ? -15.019 -15.175 1.209   1.00 34.89 ? 78  LYS B CD  1 
ATOM   2431 C  CE  . LYS B 1 78  ? -15.114 -13.629 1.324   1.00 43.30 ? 78  LYS B CE  1 
ATOM   2432 N  NZ  . LYS B 1 78  ? -14.388 -12.953 2.532   1.00 44.76 ? 78  LYS B NZ  1 
ATOM   2433 N  N   . SER B 1 79  ? -12.410 -16.714 -3.299  1.00 15.93 ? 79  SER B N   1 
ATOM   2434 C  CA  . SER B 1 79  ? -12.605 -16.685 -4.744  1.00 15.92 ? 79  SER B CA  1 
ATOM   2435 C  C   . SER B 1 79  ? -13.484 -17.847 -5.187  1.00 17.04 ? 79  SER B C   1 
ATOM   2436 O  O   . SER B 1 79  ? -13.381 -18.926 -4.640  1.00 15.65 ? 79  SER B O   1 
ATOM   2437 C  CB  . SER B 1 79  ? -11.287 -16.828 -5.490  1.00 18.28 ? 79  SER B CB  1 
ATOM   2438 O  OG  . SER B 1 79  ? -11.517 -16.716 -6.894  1.00 19.44 ? 79  SER B OG  1 
ATOM   2439 N  N   . PRO B 1 80  ? -14.414 -17.599 -6.111  1.00 21.02 ? 80  PRO B N   1 
ATOM   2440 C  CA  . PRO B 1 80  ? -15.260 -18.703 -6.589  1.00 20.72 ? 80  PRO B CA  1 
ATOM   2441 C  C   . PRO B 1 80  ? -14.431 -19.573 -7.562  1.00 21.68 ? 80  PRO B C   1 
ATOM   2442 O  O   . PRO B 1 80  ? -14.809 -20.699 -7.856  1.00 21.73 ? 80  PRO B O   1 
ATOM   2443 C  CB  . PRO B 1 80  ? -16.387 -17.970 -7.319  1.00 21.08 ? 80  PRO B CB  1 
ATOM   2444 C  CG  . PRO B 1 80  ? -15.659 -16.796 -7.904  1.00 24.71 ? 80  PRO B CG  1 
ATOM   2445 C  CD  . PRO B 1 80  ? -14.875 -16.319 -6.682  1.00 18.81 ? 80  PRO B CD  1 
ATOM   2446 N  N   . LEU B 1 81  ? -13.320 -19.038 -8.068  1.00 18.99 ? 81  LEU B N   1 
ATOM   2447 C  CA  . LEU B 1 81  ? -12.447 -19.788 -8.999  1.00 19.30 ? 81  LEU B CA  1 
ATOM   2448 C  C   . LEU B 1 81  ? -11.610 -20.865 -8.321  1.00 21.02 ? 81  LEU B C   1 
ATOM   2449 O  O   . LEU B 1 81  ? -11.332 -20.803 -7.122  1.00 19.93 ? 81  LEU B O   1 
ATOM   2450 C  CB  . LEU B 1 81  ? -11.456 -18.851 -9.716  1.00 18.50 ? 81  LEU B CB  1 
ATOM   2451 C  CG  . LEU B 1 81  ? -11.995 -17.611 -10.406 1.00 24.13 ? 81  LEU B CG  1 
ATOM   2452 C  CD1 . LEU B 1 81  ? -10.826 -16.788 -10.980 1.00 23.27 ? 81  LEU B CD1 1 
ATOM   2453 C  CD2 . LEU B 1 81  ? -12.983 -18.051 -11.482 1.00 27.00 ? 81  LEU B CD2 1 
ATOM   2454 N  N   . SER B 1 82  ? -11.162 -21.855 -9.089  1.00 18.29 ? 82  SER B N   1 
ATOM   2455 C  CA  . SER B 1 82  ? -10.324 -22.894 -8.506  1.00 19.54 ? 82  SER B CA  1 
ATOM   2456 C  C   . SER B 1 82  ? -8.867  -22.406 -8.325  1.00 20.87 ? 82  SER B C   1 
ATOM   2457 O  O   . SER B 1 82  ? -8.089  -23.008 -7.572  1.00 22.33 ? 82  SER B O   1 
ATOM   2458 C  CB  . SER B 1 82  ? -10.296 -24.138 -9.411  1.00 22.55 ? 82  SER B CB  1 
ATOM   2459 O  OG  . SER B 1 82  ? -9.789  -23.749 -10.680 1.00 24.06 ? 82  SER B OG  1 
ATOM   2460 N  N   . ASN B 1 83  ? -8.506  -21.338 -9.013  1.00 21.49 ? 83  ASN B N   1 
ATOM   2461 C  CA  . ASN B 1 83  ? -7.128  -20.849 -8.925  1.00 24.04 ? 83  ASN B CA  1 
ATOM   2462 C  C   . ASN B 1 83  ? -7.067  -19.361 -8.668  1.00 21.14 ? 83  ASN B C   1 
ATOM   2463 O  O   . ASN B 1 83  ? -6.571  -18.594 -9.501  1.00 22.99 ? 83  ASN B O   1 
ATOM   2464 C  CB  . ASN B 1 83  ? -6.376  -21.214 -10.224 1.00 27.84 ? 83  ASN B CB  1 
ATOM   2465 C  CG  . ASN B 1 83  ? -7.154  -20.823 -11.493 1.00 42.58 ? 83  ASN B CG  1 
ATOM   2466 O  OD1 . ASN B 1 83  ? -8.324  -20.397 -11.428 1.00 41.88 ? 83  ASN B OD1 1 
ATOM   2467 N  ND2 . ASN B 1 83  ? -6.513  -20.989 -12.659 1.00 42.73 ? 83  ASN B ND2 1 
ATOM   2468 N  N   . GLY B 1 84  ? -7.549  -18.960 -7.496  1.00 19.55 ? 84  GLY B N   1 
ATOM   2469 C  CA  . GLY B 1 84  ? -7.528  -17.555 -7.120  1.00 20.36 ? 84  GLY B CA  1 
ATOM   2470 C  C   . GLY B 1 84  ? -6.111  -17.003 -7.163  1.00 15.69 ? 84  GLY B C   1 
ATOM   2471 O  O   . GLY B 1 84  ? -5.155  -17.688 -6.782  1.00 18.61 ? 84  GLY B O   1 
ATOM   2472 N  N   . ALA B 1 85  ? -6.014  -15.745 -7.559  1.00 15.72 ? 85  ALA B N   1 
ATOM   2473 C  CA  . ALA B 1 85  ? -4.755  -15.039 -7.741  1.00 16.29 ? 85  ALA B CA  1 
ATOM   2474 C  C   . ALA B 1 85  ? -4.896  -13.569 -7.367  1.00 15.29 ? 85  ALA B C   1 
ATOM   2475 O  O   . ALA B 1 85  ? -6.001  -13.039 -7.352  1.00 16.33 ? 85  ALA B O   1 
ATOM   2476 C  CB  . ALA B 1 85  ? -4.334  -15.172 -9.217  1.00 16.36 ? 85  ALA B CB  1 
ATOM   2477 N  N   . ASP B 1 86  ? -3.780  -12.881 -7.106  1.00 15.62 ? 86  ASP B N   1 
ATOM   2478 C  CA  . ASP B 1 86  ? -2.427  -13.447 -7.160  1.00 14.35 ? 86  ASP B CA  1 
ATOM   2479 C  C   . ASP B 1 86  ? -1.741  -13.561 -5.805  1.00 15.12 ? 86  ASP B C   1 
ATOM   2480 O  O   . ASP B 1 86  ? -0.786  -14.314 -5.676  1.00 14.74 ? 86  ASP B O   1 
ATOM   2481 C  CB  . ASP B 1 86  ? -1.517  -12.588 -8.048  1.00 14.55 ? 86  ASP B CB  1 
ATOM   2482 C  CG  . ASP B 1 86  ? -1.665  -12.937 -9.521  1.00 17.28 ? 86  ASP B CG  1 
ATOM   2483 O  OD1 . ASP B 1 86  ? -2.544  -12.376 -10.208 1.00 16.53 ? 86  ASP B OD1 1 
ATOM   2484 O  OD2 . ASP B 1 86  ? -0.896  -13.820 -9.950  1.00 18.34 ? 86  ASP B OD2 1 
ATOM   2485 N  N   . GLY B 1 87  ? -2.193  -12.792 -4.813  1.00 16.82 ? 87  GLY B N   1 
ATOM   2486 C  CA  . GLY B 1 87  ? -1.569  -12.886 -3.502  1.00 15.09 ? 87  GLY B CA  1 
ATOM   2487 C  C   . GLY B 1 87  ? -1.482  -11.528 -2.815  1.00 12.99 ? 87  GLY B C   1 
ATOM   2488 O  O   . GLY B 1 87  ? -1.756  -10.476 -3.409  1.00 14.32 ? 87  GLY B O   1 
ATOM   2489 N  N   . ILE B 1 88  ? -1.069  -11.572 -1.555  1.00 14.75 ? 88  ILE B N   1 
ATOM   2490 C  CA  . ILE B 1 88  ? -0.960  -10.371 -0.745  1.00 12.79 ? 88  ILE B CA  1 
ATOM   2491 C  C   . ILE B 1 88  ? 0.420   -10.342 -0.132  1.00 11.64 ? 88  ILE B C   1 
ATOM   2492 O  O   . ILE B 1 88  ? 1.013   -11.391 0.129   1.00 12.78 ? 88  ILE B O   1 
ATOM   2493 C  CB  . ILE B 1 88  ? -2.068  -10.402 0.362   1.00 13.02 ? 88  ILE B CB  1 
ATOM   2494 C  CG1 . ILE B 1 88  ? -1.930  -9.200  1.281   1.00 14.53 ? 88  ILE B CG1 1 
ATOM   2495 C  CG2 . ILE B 1 88  ? -1.964  -11.688 1.215   1.00 14.56 ? 88  ILE B CG2 1 
ATOM   2496 C  CD1 . ILE B 1 88  ? -3.090  -9.114  2.297   1.00 21.04 ? 88  ILE B CD1 1 
ATOM   2497 N  N   . ALA B 1 89  ? 0.946   -9.149  0.095   1.00 13.38 ? 89  ALA B N   1 
ATOM   2498 C  CA  . ALA B 1 89  ? 2.251   -9.069  0.722   1.00 11.84 ? 89  ALA B CA  1 
ATOM   2499 C  C   . ALA B 1 89  ? 2.329   -7.952  1.761   1.00 12.78 ? 89  ALA B C   1 
ATOM   2500 O  O   . ALA B 1 89  ? 1.735   -6.907  1.567   1.00 13.77 ? 89  ALA B O   1 
ATOM   2501 C  CB  . ALA B 1 89  ? 3.329   -8.785  -0.341  1.00 11.80 ? 89  ALA B CB  1 
ATOM   2502 N  N   . PHE B 1 90  ? 3.115   -8.210  2.814   1.00 12.26 ? 90  PHE B N   1 
ATOM   2503 C  CA  . PHE B 1 90  ? 3.455   -7.182  3.810   1.00 13.97 ? 90  PHE B CA  1 
ATOM   2504 C  C   . PHE B 1 90  ? 4.793   -6.673  3.252   1.00 13.93 ? 90  PHE B C   1 
ATOM   2505 O  O   . PHE B 1 90  ? 5.651   -7.502  2.886   1.00 14.79 ? 90  PHE B O   1 
ATOM   2506 C  CB  . PHE B 1 90  ? 3.689   -7.817  5.176   1.00 13.35 ? 90  PHE B CB  1 
ATOM   2507 C  CG  . PHE B 1 90  ? 4.359   -6.885  6.151   1.00 14.12 ? 90  PHE B CG  1 
ATOM   2508 C  CD1 . PHE B 1 90  ? 3.753   -5.691  6.512   1.00 14.15 ? 90  PHE B CD1 1 
ATOM   2509 C  CD2 . PHE B 1 90  ? 5.631   -7.190  6.643   1.00 18.46 ? 90  PHE B CD2 1 
ATOM   2510 C  CE1 . PHE B 1 90  ? 4.405   -4.779  7.357   1.00 17.84 ? 90  PHE B CE1 1 
ATOM   2511 C  CE2 . PHE B 1 90  ? 6.309   -6.297  7.490   1.00 22.00 ? 90  PHE B CE2 1 
ATOM   2512 C  CZ  . PHE B 1 90  ? 5.699   -5.097  7.845   1.00 17.79 ? 90  PHE B CZ  1 
ATOM   2513 N  N   . PHE B 1 91  ? 5.004   -5.359  3.190   1.00 11.86 ? 91  PHE B N   1 
ATOM   2514 C  CA  . PHE B 1 91  ? 6.260   -4.852  2.620   1.00 12.86 ? 91  PHE B CA  1 
ATOM   2515 C  C   . PHE B 1 91  ? 6.788   -3.610  3.313   1.00 14.63 ? 91  PHE B C   1 
ATOM   2516 O  O   . PHE B 1 91  ? 6.055   -2.895  4.017   1.00 14.84 ? 91  PHE B O   1 
ATOM   2517 C  CB  . PHE B 1 91  ? 6.144   -4.577  1.090   1.00 14.05 ? 91  PHE B CB  1 
ATOM   2518 C  CG  . PHE B 1 91  ? 5.344   -3.369  0.709   1.00 13.72 ? 91  PHE B CG  1 
ATOM   2519 C  CD1 . PHE B 1 91  ? 3.944   -3.347  0.795   1.00 15.28 ? 91  PHE B CD1 1 
ATOM   2520 C  CD2 . PHE B 1 91  ? 5.983   -2.252  0.167   1.00 19.84 ? 91  PHE B CD2 1 
ATOM   2521 C  CE1 . PHE B 1 91  ? 3.191   -2.250  0.340   1.00 17.22 ? 91  PHE B CE1 1 
ATOM   2522 C  CE2 . PHE B 1 91  ? 5.232   -1.136  -0.292  1.00 22.61 ? 91  PHE B CE2 1 
ATOM   2523 C  CZ  . PHE B 1 91  ? 3.822   -1.155  -0.199  1.00 19.40 ? 91  PHE B CZ  1 
ATOM   2524 N  N   . ILE B 1 92  ? 8.081   -3.379  3.108   1.00 14.35 ? 92  ILE B N   1 
ATOM   2525 C  CA  . ILE B 1 92  ? 8.783   -2.238  3.691   1.00 15.23 ? 92  ILE B CA  1 
ATOM   2526 C  C   . ILE B 1 92  ? 9.534   -1.622  2.509   1.00 17.86 ? 92  ILE B C   1 
ATOM   2527 O  O   . ILE B 1 92  ? 10.254  -2.314  1.805   1.00 20.28 ? 92  ILE B O   1 
ATOM   2528 C  CB  . ILE B 1 92  ? 9.789   -2.716  4.725   1.00 14.90 ? 92  ILE B CB  1 
ATOM   2529 C  CG1 . ILE B 1 92  ? 9.073   -3.646  5.736   1.00 15.93 ? 92  ILE B CG1 1 
ATOM   2530 C  CG2 . ILE B 1 92  ? 10.404  -1.463  5.427   1.00 18.07 ? 92  ILE B CG2 1 
ATOM   2531 C  CD1 . ILE B 1 92  ? 10.022  -4.407  6.609   1.00 25.53 ? 92  ILE B CD1 1 
ATOM   2532 N  N   . ALA B 1 93  ? 9.360   -0.327  2.300   1.00 18.95 ? 93  ALA B N   1 
ATOM   2533 C  CA  . ALA B 1 93  ? 9.977   0.323   1.149   1.00 18.57 ? 93  ALA B CA  1 
ATOM   2534 C  C   . ALA B 1 93  ? 10.288  1.783   1.483   1.00 22.29 ? 93  ALA B C   1 
ATOM   2535 O  O   . ALA B 1 93  ? 9.973   2.270   2.596   1.00 19.51 ? 93  ALA B O   1 
ATOM   2536 C  CB  . ALA B 1 93  ? 9.005   0.282   -0.028  1.00 17.21 ? 93  ALA B CB  1 
ATOM   2537 N  N   . PRO B 1 94  ? 10.932  2.495   0.541   1.00 22.62 ? 94  PRO B N   1 
ATOM   2538 C  CA  . PRO B 1 94  ? 11.242  3.903   0.794   1.00 21.58 ? 94  PRO B CA  1 
ATOM   2539 C  C   . PRO B 1 94  ? 9.914   4.642   0.912   1.00 22.03 ? 94  PRO B C   1 
ATOM   2540 O  O   . PRO B 1 94  ? 8.908   4.269   0.291   1.00 21.31 ? 94  PRO B O   1 
ATOM   2541 C  CB  . PRO B 1 94  ? 12.079  4.299   -0.435  1.00 21.33 ? 94  PRO B CB  1 
ATOM   2542 C  CG  . PRO B 1 94  ? 12.709  2.971   -0.854  1.00 25.88 ? 94  PRO B CG  1 
ATOM   2543 C  CD  . PRO B 1 94  ? 11.470  2.084   -0.767  1.00 24.17 ? 94  PRO B CD  1 
ATOM   2544 N  N   . PRO B 1 95  ? 9.892   5.742   1.677   1.00 23.05 ? 95  PRO B N   1 
ATOM   2545 C  CA  . PRO B 1 95  ? 8.683   6.533   1.907   1.00 21.65 ? 95  PRO B CA  1 
ATOM   2546 C  C   . PRO B 1 95  ? 7.885   7.006   0.711   1.00 22.62 ? 95  PRO B C   1 
ATOM   2547 O  O   . PRO B 1 95  ? 6.671   7.121   0.789   1.00 25.01 ? 95  PRO B O   1 
ATOM   2548 C  CB  . PRO B 1 95  ? 9.213   7.714   2.735   1.00 25.20 ? 95  PRO B CB  1 
ATOM   2549 C  CG  . PRO B 1 95  ? 10.343  7.120   3.458   1.00 24.70 ? 95  PRO B CG  1 
ATOM   2550 C  CD  . PRO B 1 95  ? 11.041  6.415   2.312   1.00 22.76 ? 95  PRO B CD  1 
ATOM   2551 N  N   . ASP B 1 96  ? 8.566   7.280   -0.396  1.00 22.34 ? 96  ASP B N   1 
ATOM   2552 C  CA  . ASP B 1 96  ? 7.896   7.786   -1.582  1.00 26.76 ? 96  ASP B CA  1 
ATOM   2553 C  C   . ASP B 1 96  ? 7.380   6.704   -2.527  1.00 26.41 ? 96  ASP B C   1 
ATOM   2554 O  O   . ASP B 1 96  ? 6.913   7.009   -3.624  1.00 25.13 ? 96  ASP B O   1 
ATOM   2555 C  CB  . ASP B 1 96  ? 8.829   8.740   -2.358  1.00 32.85 ? 96  ASP B CB  1 
ATOM   2556 C  CG  . ASP B 1 96  ? 10.145  8.086   -2.773  1.00 41.55 ? 96  ASP B CG  1 
ATOM   2557 O  OD1 . ASP B 1 96  ? 10.886  8.694   -3.581  1.00 48.17 ? 96  ASP B OD1 1 
ATOM   2558 O  OD2 . ASP B 1 96  ? 10.463  6.983   -2.293  1.00 45.08 ? 96  ASP B OD2 1 
ATOM   2559 N  N   . THR B 1 97  ? 7.437   5.449   -2.092  1.00 25.01 ? 97  THR B N   1 
ATOM   2560 C  CA  . THR B 1 97  ? 6.976   4.336   -2.933  1.00 25.04 ? 97  THR B CA  1 
ATOM   2561 C  C   . THR B 1 97  ? 5.540   4.466   -3.497  1.00 23.41 ? 97  THR B C   1 
ATOM   2562 O  O   . THR B 1 97  ? 4.595   4.866   -2.813  1.00 23.36 ? 97  THR B O   1 
ATOM   2563 C  CB  . THR B 1 97  ? 7.104   3.004   -2.166  1.00 25.35 ? 97  THR B CB  1 
ATOM   2564 O  OG1 . THR B 1 97  ? 6.811   1.914   -3.046  1.00 25.38 ? 97  THR B OG1 1 
ATOM   2565 C  CG2 . THR B 1 97  ? 6.122   2.988   -0.954  1.00 22.48 ? 97  THR B CG2 1 
ATOM   2566 N  N   . THR B 1 98  ? 5.396   4.128   -4.774  1.00 24.33 ? 98  THR B N   1 
ATOM   2567 C  CA  . THR B 1 98  ? 4.101   4.175   -5.451  1.00 23.67 ? 98  THR B CA  1 
ATOM   2568 C  C   . THR B 1 98  ? 3.980   2.890   -6.270  1.00 23.82 ? 98  THR B C   1 
ATOM   2569 O  O   . THR B 1 98  ? 4.956   2.159   -6.440  1.00 22.71 ? 98  THR B O   1 
ATOM   2570 C  CB  . THR B 1 98  ? 3.958   5.378   -6.443  1.00 28.78 ? 98  THR B CB  1 
ATOM   2571 O  OG1 . THR B 1 98  ? 5.071   5.390   -7.353  1.00 31.28 ? 98  THR B OG1 1 
ATOM   2572 C  CG2 . THR B 1 98  ? 3.866   6.690   -5.698  1.00 28.95 ? 98  THR B CG2 1 
ATOM   2573 N  N   . ILE B 1 99  ? 2.789   2.620   -6.773  1.00 22.29 ? 99  ILE B N   1 
ATOM   2574 C  CA  . ILE B 1 99  ? 2.589   1.414   -7.556  1.00 25.43 ? 99  ILE B CA  1 
ATOM   2575 C  C   . ILE B 1 99  ? 3.312   1.535   -8.884  1.00 24.50 ? 99  ILE B C   1 
ATOM   2576 O  O   . ILE B 1 99  ? 3.060   2.469   -9.625  1.00 25.89 ? 99  ILE B O   1 
ATOM   2577 C  CB  . ILE B 1 99  ? 1.100   1.190   -7.838  1.00 25.73 ? 99  ILE B CB  1 
ATOM   2578 C  CG1 . ILE B 1 99  ? 0.367   0.980   -6.495  1.00 27.94 ? 99  ILE B CG1 1 
ATOM   2579 C  CG2 . ILE B 1 99  ? 0.921   -0.015  -8.804  1.00 23.51 ? 99  ILE B CG2 1 
ATOM   2580 C  CD1 . ILE B 1 99  ? -1.157  0.905   -6.595  1.00 28.06 ? 99  ILE B CD1 1 
ATOM   2581 N  N   . PRO B 1 100 ? 4.233   0.607   -9.177  1.00 27.43 ? 100 PRO B N   1 
ATOM   2582 C  CA  . PRO B 1 100 ? 4.984   0.622   -10.435 1.00 27.87 ? 100 PRO B CA  1 
ATOM   2583 C  C   . PRO B 1 100 ? 4.046   0.326   -11.621 1.00 30.40 ? 100 PRO B C   1 
ATOM   2584 O  O   . PRO B 1 100 ? 3.081   -0.444  -11.510 1.00 27.15 ? 100 PRO B O   1 
ATOM   2585 C  CB  . PRO B 1 100 ? 6.018   -0.488  -10.227 1.00 30.20 ? 100 PRO B CB  1 
ATOM   2586 C  CG  . PRO B 1 100 ? 6.145   -0.575  -8.714  1.00 33.64 ? 100 PRO B CG  1 
ATOM   2587 C  CD  . PRO B 1 100 ? 4.685   -0.523  -8.349  1.00 28.46 ? 100 PRO B CD  1 
ATOM   2588 N  N   . SER B 1 101 ? 4.317   0.959   -12.753 1.00 32.30 ? 101 SER B N   1 
ATOM   2589 C  CA  . SER B 1 101 ? 3.511   0.728   -13.943 1.00 33.65 ? 101 SER B CA  1 
ATOM   2590 C  C   . SER B 1 101 ? 3.655   -0.727  -14.368 1.00 30.92 ? 101 SER B C   1 
ATOM   2591 O  O   . SER B 1 101 ? 4.768   -1.227  -14.476 1.00 33.11 ? 101 SER B O   1 
ATOM   2592 C  CB  . SER B 1 101 ? 4.000   1.639   -15.066 1.00 37.61 ? 101 SER B CB  1 
ATOM   2593 O  OG  . SER B 1 101 ? 3.223   1.398   -16.215 1.00 45.38 ? 101 SER B OG  1 
ATOM   2594 N  N   . GLY B 1 102 ? 2.527   -1.401  -14.584 1.00 32.50 ? 102 GLY B N   1 
ATOM   2595 C  CA  . GLY B 1 102 ? 2.529   -2.795  -14.999 1.00 29.56 ? 102 GLY B CA  1 
ATOM   2596 C  C   . GLY B 1 102 ? 2.820   -3.818  -13.907 1.00 31.35 ? 102 GLY B C   1 
ATOM   2597 O  O   . GLY B 1 102 ? 3.090   -4.980  -14.191 1.00 27.78 ? 102 GLY B O   1 
ATOM   2598 N  N   . SER B 1 103 ? 2.756   -3.400  -12.645 1.00 28.68 ? 103 SER B N   1 
ATOM   2599 C  CA  . SER B 1 103 ? 3.067   -4.317  -11.550 1.00 27.39 ? 103 SER B CA  1 
ATOM   2600 C  C   . SER B 1 103 ? 1.921   -5.214  -11.100 1.00 27.02 ? 103 SER B C   1 
ATOM   2601 O  O   . SER B 1 103 ? 2.008   -5.840  -10.047 1.00 26.62 ? 103 SER B O   1 
ATOM   2602 C  CB  . SER B 1 103 ? 3.566   -3.519  -10.346 1.00 23.39 ? 103 SER B CB  1 
ATOM   2603 O  OG  . SER B 1 103 ? 2.574   -2.582  -9.971  1.00 25.25 ? 103 SER B OG  1 
ATOM   2604 N  N   . GLY B 1 104 ? 0.854   -5.276  -11.881 1.00 25.01 ? 104 GLY B N   1 
ATOM   2605 C  CA  . GLY B 1 104 ? -0.269  -6.116  -11.507 1.00 25.47 ? 104 GLY B CA  1 
ATOM   2606 C  C   . GLY B 1 104 ? 0.046   -7.595  -11.590 1.00 20.82 ? 104 GLY B C   1 
ATOM   2607 O  O   . GLY B 1 104 ? 1.197   -7.996  -11.770 1.00 23.09 ? 104 GLY B O   1 
ATOM   2608 N  N   . GLY B 1 105 ? -0.978  -8.429  -11.439 1.00 21.31 ? 105 GLY B N   1 
ATOM   2609 C  CA  . GLY B 1 105 ? -0.765  -9.869  -11.508 1.00 18.79 ? 105 GLY B CA  1 
ATOM   2610 C  C   . GLY B 1 105 ? 0.268   -10.443 -10.552 1.00 21.08 ? 105 GLY B C   1 
ATOM   2611 O  O   . GLY B 1 105 ? 0.332   -10.068 -9.386  1.00 20.38 ? 105 GLY B O   1 
ATOM   2612 N  N   . GLY B 1 106 ? 1.103   -11.337 -11.065 1.00 18.46 ? 106 GLY B N   1 
ATOM   2613 C  CA  . GLY B 1 106 ? 2.109   -11.981 -10.257 1.00 15.96 ? 106 GLY B CA  1 
ATOM   2614 C  C   . GLY B 1 106 ? 3.188   -11.043 -9.733  1.00 15.12 ? 106 GLY B C   1 
ATOM   2615 O  O   . GLY B 1 106 ? 4.044   -11.505 -8.984  1.00 20.49 ? 106 GLY B O   1 
ATOM   2616 N  N   . LEU B 1 107 ? 3.178   -9.770  -10.136 1.00 15.30 ? 107 LEU B N   1 
ATOM   2617 C  CA  . LEU B 1 107 ? 4.192   -8.856  -9.600  1.00 17.47 ? 107 LEU B CA  1 
ATOM   2618 C  C   . LEU B 1 107 ? 3.691   -8.229  -8.284  1.00 18.47 ? 107 LEU B C   1 
ATOM   2619 O  O   . LEU B 1 107 ? 4.386   -7.445  -7.662  1.00 18.70 ? 107 LEU B O   1 
ATOM   2620 C  CB  . LEU B 1 107 ? 4.577   -7.779  -10.623 1.00 18.25 ? 107 LEU B CB  1 
ATOM   2621 C  CG  . LEU B 1 107 ? 5.239   -8.417  -11.862 1.00 23.98 ? 107 LEU B CG  1 
ATOM   2622 C  CD1 . LEU B 1 107 ? 5.727   -7.332  -12.781 1.00 24.66 ? 107 LEU B CD1 1 
ATOM   2623 C  CD2 . LEU B 1 107 ? 6.389   -9.348  -11.447 1.00 22.83 ? 107 LEU B CD2 1 
ATOM   2624 N  N   . LEU B 1 108 ? 2.464   -8.571  -7.912  1.00 17.72 ? 108 LEU B N   1 
ATOM   2625 C  CA  . LEU B 1 108 ? 1.874   -8.189  -6.628  1.00 19.05 ? 108 LEU B CA  1 
ATOM   2626 C  C   . LEU B 1 108 ? 1.820   -6.715  -6.263  1.00 21.72 ? 108 LEU B C   1 
ATOM   2627 O  O   . LEU B 1 108 ? 1.663   -6.377  -5.071  1.00 20.42 ? 108 LEU B O   1 
ATOM   2628 C  CB  . LEU B 1 108 ? 2.613   -8.958  -5.499  1.00 18.31 ? 108 LEU B CB  1 
ATOM   2629 C  CG  . LEU B 1 108 ? 2.648   -10.482 -5.590  1.00 19.28 ? 108 LEU B CG  1 
ATOM   2630 C  CD1 . LEU B 1 108 ? 3.422   -11.113 -4.402  1.00 17.91 ? 108 LEU B CD1 1 
ATOM   2631 C  CD2 . LEU B 1 108 ? 1.205   -10.994 -5.615  1.00 23.60 ? 108 LEU B CD2 1 
ATOM   2632 N  N   . GLY B 1 109 ? 1.922   -5.844  -7.274  1.00 16.96 ? 109 GLY B N   1 
ATOM   2633 C  CA  . GLY B 1 109 ? 1.906   -4.408  -7.045  1.00 18.34 ? 109 GLY B CA  1 
ATOM   2634 C  C   . GLY B 1 109 ? 3.212   -3.889  -6.454  1.00 18.31 ? 109 GLY B C   1 
ATOM   2635 O  O   . GLY B 1 109 ? 3.280   -2.736  -6.026  1.00 19.96 ? 109 GLY B O   1 
ATOM   2636 N  N   . LEU B 1 110 ? 4.251   -4.721  -6.459  1.00 18.14 ? 110 LEU B N   1 
ATOM   2637 C  CA  . LEU B 1 110 ? 5.544   -4.359  -5.886  1.00 18.48 ? 110 LEU B CA  1 
ATOM   2638 C  C   . LEU B 1 110 ? 6.668   -4.105  -6.878  1.00 25.07 ? 110 LEU B C   1 
ATOM   2639 O  O   . LEU B 1 110 ? 7.599   -3.326  -6.591  1.00 21.71 ? 110 LEU B O   1 
ATOM   2640 C  CB  . LEU B 1 110 ? 6.021   -5.450  -4.930  1.00 18.06 ? 110 LEU B CB  1 
ATOM   2641 C  CG  . LEU B 1 110 ? 5.141   -5.673  -3.677  1.00 21.57 ? 110 LEU B CG  1 
ATOM   2642 C  CD1 . LEU B 1 110 ? 5.707   -6.803  -2.844  1.00 24.30 ? 110 LEU B CD1 1 
ATOM   2643 C  CD2 . LEU B 1 110 ? 5.107   -4.392  -2.849  1.00 27.32 ? 110 LEU B CD2 1 
ATOM   2644 N  N   . PHE B 1 111 ? 6.610   -4.787  -8.024  1.00 22.40 ? 111 PHE B N   1 
ATOM   2645 C  CA  . PHE B 1 111 ? 7.675   -4.657  -9.006  1.00 26.16 ? 111 PHE B CA  1 
ATOM   2646 C  C   . PHE B 1 111 ? 7.212   -4.308  -10.409 1.00 29.20 ? 111 PHE B C   1 
ATOM   2647 O  O   . PHE B 1 111 ? 6.066   -4.558  -10.783 1.00 29.11 ? 111 PHE B O   1 
ATOM   2648 C  CB  . PHE B 1 111 ? 8.482   -5.957  -9.089  1.00 23.88 ? 111 PHE B CB  1 
ATOM   2649 C  CG  . PHE B 1 111 ? 9.049   -6.415  -7.784  1.00 27.85 ? 111 PHE B CG  1 
ATOM   2650 C  CD1 . PHE B 1 111 ? 8.366   -7.340  -6.996  1.00 25.38 ? 111 PHE B CD1 1 
ATOM   2651 C  CD2 . PHE B 1 111 ? 10.283  -5.936  -7.338  1.00 27.34 ? 111 PHE B CD2 1 
ATOM   2652 C  CE1 . PHE B 1 111 ? 8.902   -7.786  -5.792  1.00 24.83 ? 111 PHE B CE1 1 
ATOM   2653 C  CE2 . PHE B 1 111 ? 10.829  -6.371  -6.128  1.00 26.79 ? 111 PHE B CE2 1 
ATOM   2654 C  CZ  . PHE B 1 111 ? 10.145  -7.299  -5.349  1.00 27.14 ? 111 PHE B CZ  1 
ATOM   2655 N  N   . ALA B 1 112 ? 8.132   -3.715  -11.174 1.00 32.15 ? 112 ALA B N   1 
ATOM   2656 C  CA  . ALA B 1 112 ? 7.900   -3.367  -12.571 1.00 30.92 ? 112 ALA B CA  1 
ATOM   2657 C  C   . ALA B 1 112 ? 8.401   -4.587  -13.355 1.00 29.62 ? 112 ALA B C   1 
ATOM   2658 O  O   . ALA B 1 112 ? 9.402   -5.213  -12.993 1.00 28.58 ? 112 ALA B O   1 
ATOM   2659 C  CB  . ALA B 1 112 ? 8.709   -2.111  -12.946 1.00 32.93 ? 112 ALA B CB  1 
ATOM   2660 N  N   . PRO B 1 113 ? 7.723   -4.932  -14.452 1.00 28.82 ? 113 PRO B N   1 
ATOM   2661 C  CA  . PRO B 1 113 ? 8.119   -6.089  -15.264 1.00 34.43 ? 113 PRO B CA  1 
ATOM   2662 C  C   . PRO B 1 113 ? 9.592   -6.117  -15.686 1.00 34.34 ? 113 PRO B C   1 
ATOM   2663 O  O   . PRO B 1 113 ? 10.279  -7.135  -15.551 1.00 37.52 ? 113 PRO B O   1 
ATOM   2664 C  CB  . PRO B 1 113 ? 7.185   -5.987  -16.466 1.00 35.07 ? 113 PRO B CB  1 
ATOM   2665 C  CG  . PRO B 1 113 ? 5.946   -5.357  -15.867 1.00 36.13 ? 113 PRO B CG  1 
ATOM   2666 C  CD  . PRO B 1 113 ? 6.586   -4.232  -15.073 1.00 30.53 ? 113 PRO B CD  1 
ATOM   2667 N  N   . GLY B 1 114 ? 10.077  -4.986  -16.175 1.00 36.05 ? 114 GLY B N   1 
ATOM   2668 C  CA  . GLY B 1 114 ? 11.447  -4.923  -16.657 1.00 38.04 ? 114 GLY B CA  1 
ATOM   2669 C  C   . GLY B 1 114 ? 12.560  -5.144  -15.659 1.00 38.69 ? 114 GLY B C   1 
ATOM   2670 O  O   . GLY B 1 114 ? 13.656  -5.571  -16.033 1.00 42.34 ? 114 GLY B O   1 
ATOM   2671 N  N   . THR B 1 115 ? 12.286  -4.881  -14.390 1.00 36.32 ? 115 THR B N   1 
ATOM   2672 C  CA  . THR B 1 115 ? 13.297  -5.001  -13.347 1.00 34.42 ? 115 THR B CA  1 
ATOM   2673 C  C   . THR B 1 115 ? 12.888  -5.857  -12.165 1.00 33.05 ? 115 THR B C   1 
ATOM   2674 O  O   . THR B 1 115 ? 13.529  -5.793  -11.119 1.00 30.88 ? 115 THR B O   1 
ATOM   2675 C  CB  . THR B 1 115 ? 13.638  -3.614  -12.800 1.00 38.78 ? 115 THR B CB  1 
ATOM   2676 O  OG1 . THR B 1 115 ? 12.416  -2.917  -12.516 1.00 38.17 ? 115 THR B OG1 1 
ATOM   2677 C  CG2 . THR B 1 115 ? 14.465  -2.812  -13.812 1.00 40.25 ? 115 THR B CG2 1 
ATOM   2678 N  N   . ALA B 1 116 ? 11.836  -6.660  -12.338 1.00 33.87 ? 116 ALA B N   1 
ATOM   2679 C  CA  . ALA B 1 116 ? 11.296  -7.512  -11.267 1.00 29.05 ? 116 ALA B CA  1 
ATOM   2680 C  C   . ALA B 1 116 ? 12.278  -8.498  -10.674 1.00 30.17 ? 116 ALA B C   1 
ATOM   2681 O  O   . ALA B 1 116 ? 12.130  -8.898  -9.515  1.00 27.26 ? 116 ALA B O   1 
ATOM   2682 C  CB  . ALA B 1 116 ? 10.051  -8.256  -11.770 1.00 26.28 ? 116 ALA B CB  1 
ATOM   2683 N  N   . GLN B 1 117 ? 13.272  -8.919  -11.456 1.00 29.11 ? 117 GLN B N   1 
ATOM   2684 C  CA  . GLN B 1 117 ? 14.238  -9.857  -10.928 1.00 30.80 ? 117 GLN B CA  1 
ATOM   2685 C  C   . GLN B 1 117 ? 15.643  -9.282  -10.878 1.00 33.55 ? 117 GLN B C   1 
ATOM   2686 O  O   . GLN B 1 117 ? 16.621  -10.030 -10.754 1.00 34.85 ? 117 GLN B O   1 
ATOM   2687 C  CB  . GLN B 1 117 ? 14.224  -11.154 -11.733 1.00 37.33 ? 117 GLN B CB  1 
ATOM   2688 C  CG  . GLN B 1 117 ? 12.896  -11.894 -11.671 1.00 35.77 ? 117 GLN B CG  1 
ATOM   2689 C  CD  . GLN B 1 117 ? 12.952  -13.248 -12.341 1.00 36.81 ? 117 GLN B CD  1 
ATOM   2690 O  OE1 . GLN B 1 117 ? 13.672  -14.155 -11.899 1.00 39.53 ? 117 GLN B OE1 1 
ATOM   2691 N  NE2 . GLN B 1 117 ? 12.192  -13.397 -13.406 1.00 34.92 ? 117 GLN B NE2 1 
ATOM   2692 N  N   . ASN B 1 118 ? 15.736  -7.961  -10.970 1.00 30.12 ? 118 ASN B N   1 
ATOM   2693 C  CA  . ASN B 1 118 ? 17.029  -7.289  -10.910 1.00 34.43 ? 118 ASN B CA  1 
ATOM   2694 C  C   . ASN B 1 118 ? 17.208  -6.706  -9.508  1.00 29.87 ? 118 ASN B C   1 
ATOM   2695 O  O   . ASN B 1 118 ? 16.690  -5.630  -9.212  1.00 32.64 ? 118 ASN B O   1 
ATOM   2696 C  CB  . ASN B 1 118 ? 17.079  -6.161  -11.935 1.00 34.85 ? 118 ASN B CB  1 
ATOM   2697 C  CG  . ASN B 1 118 ? 18.449  -5.480  -11.991 1.00 39.95 ? 118 ASN B CG  1 
ATOM   2698 O  OD1 . ASN B 1 118 ? 19.175  -5.423  -10.991 1.00 39.21 ? 118 ASN B OD1 1 
ATOM   2699 N  ND2 . ASN B 1 118 ? 18.792  -4.937  -13.153 1.00 45.18 ? 118 ASN B ND2 1 
ATOM   2700 N  N   . THR B 1 119 ? 17.956  -7.396  -8.653  1.00 34.61 ? 119 THR B N   1 
ATOM   2701 C  CA  . THR B 1 119 ? 18.138  -6.927  -7.278  1.00 37.37 ? 119 THR B CA  1 
ATOM   2702 C  C   . THR B 1 119 ? 18.786  -5.551  -7.093  1.00 39.84 ? 119 THR B C   1 
ATOM   2703 O  O   . THR B 1 119 ? 18.632  -4.930  -6.038  1.00 39.42 ? 119 THR B O   1 
ATOM   2704 C  CB  . THR B 1 119 ? 18.887  -7.971  -6.430  1.00 38.47 ? 119 THR B CB  1 
ATOM   2705 O  OG1 . THR B 1 119 ? 20.184  -8.232  -6.992  1.00 42.37 ? 119 THR B OG1 1 
ATOM   2706 C  CG2 . THR B 1 119 ? 18.097  -9.255  -6.384  1.00 36.25 ? 119 THR B CG2 1 
ATOM   2707 N  N   . SER B 1 120 ? 19.481  -5.052  -8.116  1.00 40.27 ? 120 SER B N   1 
ATOM   2708 C  CA  . SER B 1 120 ? 20.119  -3.731  -8.025  1.00 39.55 ? 120 SER B CA  1 
ATOM   2709 C  C   . SER B 1 120 ? 19.152  -2.601  -8.348  1.00 38.77 ? 120 SER B C   1 
ATOM   2710 O  O   . SER B 1 120 ? 19.401  -1.444  -8.016  1.00 40.25 ? 120 SER B O   1 
ATOM   2711 C  CB  . SER B 1 120 ? 21.312  -3.643  -8.992  1.00 41.13 ? 120 SER B CB  1 
ATOM   2712 O  OG  . SER B 1 120 ? 22.273  -4.629  -8.667  1.00 43.73 ? 120 SER B OG  1 
ATOM   2713 N  N   . ALA B 1 121 ? 18.031  -2.930  -8.975  1.00 37.21 ? 121 ALA B N   1 
ATOM   2714 C  CA  . ALA B 1 121 ? 17.072  -1.903  -9.363  1.00 35.61 ? 121 ALA B CA  1 
ATOM   2715 C  C   . ALA B 1 121 ? 15.933  -1.649  -8.369  1.00 35.93 ? 121 ALA B C   1 
ATOM   2716 O  O   . ALA B 1 121 ? 15.095  -0.761  -8.592  1.00 37.62 ? 121 ALA B O   1 
ATOM   2717 C  CB  . ALA B 1 121 ? 16.482  -2.260  -10.725 1.00 38.07 ? 121 ALA B CB  1 
ATOM   2718 N  N   . ASN B 1 122 ? 15.905  -2.408  -7.281  1.00 32.22 ? 122 ASN B N   1 
ATOM   2719 C  CA  . ASN B 1 122 ? 14.814  -2.271  -6.312  1.00 32.16 ? 122 ASN B CA  1 
ATOM   2720 C  C   . ASN B 1 122 ? 15.287  -2.100  -4.871  1.00 31.26 ? 122 ASN B C   1 
ATOM   2721 O  O   . ASN B 1 122 ? 16.428  -2.441  -4.516  1.00 31.24 ? 122 ASN B O   1 
ATOM   2722 C  CB  . ASN B 1 122 ? 13.915  -3.527  -6.361  1.00 32.42 ? 122 ASN B CB  1 
ATOM   2723 C  CG  . ASN B 1 122 ? 13.332  -3.788  -7.748  1.00 31.30 ? 122 ASN B CG  1 
ATOM   2724 O  OD1 . ASN B 1 122 ? 12.504  -3.019  -8.235  1.00 36.88 ? 122 ASN B OD1 1 
ATOM   2725 N  ND2 . ASN B 1 122 ? 13.775  -4.867  -8.392  1.00 29.04 ? 122 ASN B ND2 1 
ATOM   2726 N  N   . GLN B 1 123 ? 14.379  -1.577  -4.041  1.00 26.41 ? 123 GLN B N   1 
ATOM   2727 C  CA  . GLN B 1 123 ? 14.629  -1.419  -2.614  1.00 26.61 ? 123 GLN B CA  1 
ATOM   2728 C  C   . GLN B 1 123 ? 13.325  -1.792  -1.938  1.00 24.15 ? 123 GLN B C   1 
ATOM   2729 O  O   . GLN B 1 123 ? 12.465  -0.946  -1.735  1.00 24.93 ? 123 GLN B O   1 
ATOM   2730 C  CB  . GLN B 1 123 ? 14.972  0.021   -2.243  1.00 29.20 ? 123 GLN B CB  1 
ATOM   2731 C  CG  . GLN B 1 123 ? 16.349  0.449   -2.638  1.00 33.69 ? 123 GLN B CG  1 
ATOM   2732 C  CD  . GLN B 1 123 ? 16.659  1.820   -2.086  1.00 35.49 ? 123 GLN B CD  1 
ATOM   2733 O  OE1 . GLN B 1 123 ? 16.083  2.812   -2.518  1.00 41.35 ? 123 GLN B OE1 1 
ATOM   2734 N  NE2 . GLN B 1 123 ? 17.544  1.874   -1.096  1.00 38.19 ? 123 GLN B NE2 1 
ATOM   2735 N  N   . VAL B 1 124 ? 13.177  -3.068  -1.627  1.00 24.66 ? 124 VAL B N   1 
ATOM   2736 C  CA  . VAL B 1 124 ? 11.958  -3.543  -0.969  1.00 22.99 ? 124 VAL B CA  1 
ATOM   2737 C  C   . VAL B 1 124 ? 12.202  -4.864  -0.268  1.00 21.83 ? 124 VAL B C   1 
ATOM   2738 O  O   . VAL B 1 124 ? 12.943  -5.733  -0.768  1.00 20.63 ? 124 VAL B O   1 
ATOM   2739 C  CB  . VAL B 1 124 ? 10.788  -3.728  -1.995  1.00 25.60 ? 124 VAL B CB  1 
ATOM   2740 C  CG1 . VAL B 1 124 ? 11.220  -4.652  -3.107  1.00 27.64 ? 124 VAL B CG1 1 
ATOM   2741 C  CG2 . VAL B 1 124 ? 9.548   -4.329  -1.307  1.00 23.87 ? 124 VAL B CG2 1 
ATOM   2742 N  N   . ILE B 1 125 ? 11.642  -5.004  0.934   1.00 17.49 ? 125 ILE B N   1 
ATOM   2743 C  CA  . ILE B 1 125 ? 11.682  -6.284  1.612   1.00 15.52 ? 125 ILE B CA  1 
ATOM   2744 C  C   . ILE B 1 125 ? 10.188  -6.602  1.751   1.00 17.18 ? 125 ILE B C   1 
ATOM   2745 O  O   . ILE B 1 125 ? 9.405   -5.760  2.195   1.00 18.13 ? 125 ILE B O   1 
ATOM   2746 C  CB  . ILE B 1 125 ? 12.352  -6.217  2.970   1.00 19.48 ? 125 ILE B CB  1 
ATOM   2747 C  CG1 . ILE B 1 125 ? 13.865  -5.998  2.761   1.00 20.45 ? 125 ILE B CG1 1 
ATOM   2748 C  CG2 . ILE B 1 125 ? 12.091  -7.499  3.751   1.00 18.81 ? 125 ILE B CG2 1 
ATOM   2749 C  CD1 . ILE B 1 125 ? 14.645  -5.849  4.060   1.00 23.95 ? 125 ILE B CD1 1 
ATOM   2750 N  N   . ALA B 1 126 ? 9.785   -7.793  1.321   1.00 15.50 ? 126 ALA B N   1 
ATOM   2751 C  CA  . ALA B 1 126 ? 8.358   -8.142  1.429   1.00 15.74 ? 126 ALA B CA  1 
ATOM   2752 C  C   . ALA B 1 126 ? 8.194   -9.588  1.821   1.00 15.31 ? 126 ALA B C   1 
ATOM   2753 O  O   . ALA B 1 126 ? 9.085   -10.429 1.584   1.00 18.21 ? 126 ALA B O   1 
ATOM   2754 C  CB  . ALA B 1 126 ? 7.627   -7.868  0.093   1.00 17.03 ? 126 ALA B CB  1 
ATOM   2755 N  N   . VAL B 1 127 ? 7.068   -9.875  2.470   1.00 12.87 ? 127 VAL B N   1 
ATOM   2756 C  CA  . VAL B 1 127 ? 6.735   -11.241 2.849   1.00 12.86 ? 127 VAL B CA  1 
ATOM   2757 C  C   . VAL B 1 127 ? 5.460   -11.478 2.027   1.00 14.94 ? 127 VAL B C   1 
ATOM   2758 O  O   . VAL B 1 127 ? 4.457   -10.810 2.245   1.00 14.36 ? 127 VAL B O   1 
ATOM   2759 C  CB  . VAL B 1 127 ? 6.402   -11.400 4.354   1.00 13.12 ? 127 VAL B CB  1 
ATOM   2760 C  CG1 . VAL B 1 127 ? 5.960   -12.813 4.598   1.00 16.84 ? 127 VAL B CG1 1 
ATOM   2761 C  CG2 . VAL B 1 127 ? 7.671   -11.119 5.228   1.00 15.16 ? 127 VAL B CG2 1 
ATOM   2762 N  N   . GLU B 1 128 ? 5.532   -12.420 1.085   1.00 13.54 ? 128 GLU B N   1 
ATOM   2763 C  CA  . GLU B 1 128 ? 4.401   -12.707 0.198   1.00 12.77 ? 128 GLU B CA  1 
ATOM   2764 C  C   . GLU B 1 128 ? 3.670   -14.002 0.524   1.00 10.84 ? 128 GLU B C   1 
ATOM   2765 O  O   . GLU B 1 128 ? 4.265   -14.934 1.024   1.00 13.16 ? 128 GLU B O   1 
ATOM   2766 C  CB  . GLU B 1 128 ? 4.892   -12.747 -1.265  1.00 15.34 ? 128 GLU B CB  1 
ATOM   2767 C  CG  . GLU B 1 128 ? 5.914   -13.847 -1.540  1.00 14.09 ? 128 GLU B CG  1 
ATOM   2768 C  CD  . GLU B 1 128 ? 6.150   -14.077 -3.053  1.00 15.63 ? 128 GLU B CD  1 
ATOM   2769 O  OE1 . GLU B 1 128 ? 5.947   -15.222 -3.460  1.00 14.93 ? 128 GLU B OE1 1 
ATOM   2770 O  OE2 . GLU B 1 128 ? 6.510   -13.137 -3.791  1.00 15.52 ? 128 GLU B OE2 1 
ATOM   2771 N  N   . PHE B 1 129 ? 2.354   -13.999 0.276   1.00 11.55 ? 129 PHE B N   1 
ATOM   2772 C  CA  . PHE B 1 129 ? 1.479   -15.154 0.450   1.00 14.51 ? 129 PHE B CA  1 
ATOM   2773 C  C   . PHE B 1 129 ? 0.958   -15.229 -0.984  1.00 15.12 ? 129 PHE B C   1 
ATOM   2774 O  O   . PHE B 1 129 ? 0.055   -14.500 -1.395  1.00 15.24 ? 129 PHE B O   1 
ATOM   2775 C  CB  . PHE B 1 129 ? 0.396   -14.836 1.485   1.00 13.31 ? 129 PHE B CB  1 
ATOM   2776 C  CG  . PHE B 1 129 ? 0.975   -14.573 2.835   1.00 13.58 ? 129 PHE B CG  1 
ATOM   2777 C  CD1 . PHE B 1 129 ? 1.518   -13.323 3.134   1.00 13.51 ? 129 PHE B CD1 1 
ATOM   2778 C  CD2 . PHE B 1 129 ? 1.086   -15.609 3.757   1.00 16.10 ? 129 PHE B CD2 1 
ATOM   2779 C  CE1 . PHE B 1 129 ? 2.189   -13.098 4.370   1.00 17.47 ? 129 PHE B CE1 1 
ATOM   2780 C  CE2 . PHE B 1 129 ? 1.758   -15.385 4.995   1.00 18.85 ? 129 PHE B CE2 1 
ATOM   2781 C  CZ  . PHE B 1 129 ? 2.293   -14.149 5.287   1.00 13.35 ? 129 PHE B CZ  1 
ATOM   2782 N  N   . ASP B 1 130 ? 1.569   -16.157 -1.717  1.00 14.87 ? 130 ASP B N   1 
ATOM   2783 C  CA  . ASP B 1 130 ? 1.421   -16.248 -3.168  1.00 12.92 ? 130 ASP B CA  1 
ATOM   2784 C  C   . ASP B 1 130 ? 0.619   -17.466 -3.532  1.00 13.42 ? 130 ASP B C   1 
ATOM   2785 O  O   . ASP B 1 130 ? 1.037   -18.566 -3.269  1.00 14.83 ? 130 ASP B O   1 
ATOM   2786 C  CB  . ASP B 1 130 ? 2.866   -16.319 -3.748  1.00 15.38 ? 130 ASP B CB  1 
ATOM   2787 C  CG  . ASP B 1 130 ? 2.920   -16.168 -5.255  1.00 19.20 ? 130 ASP B CG  1 
ATOM   2788 O  OD1 . ASP B 1 130 ? 1.852   -16.276 -5.892  1.00 16.07 ? 130 ASP B OD1 1 
ATOM   2789 O  OD2 . ASP B 1 130 ? 4.034   -15.972 -5.804  1.00 14.50 ? 130 ASP B OD2 1 
ATOM   2790 N  N   . THR B 1 131 ? -0.549  -17.243 -4.130  1.00 15.77 ? 131 THR B N   1 
ATOM   2791 C  CA  . THR B 1 131 ? -1.437  -18.351 -4.437  1.00 16.05 ? 131 THR B CA  1 
ATOM   2792 C  C   . THR B 1 131 ? -1.464  -18.773 -5.893  1.00 17.94 ? 131 THR B C   1 
ATOM   2793 O  O   . THR B 1 131 ? -2.174  -19.736 -6.231  1.00 18.82 ? 131 THR B O   1 
ATOM   2794 C  CB  . THR B 1 131 ? -2.884  -18.008 -4.060  1.00 13.56 ? 131 THR B CB  1 
ATOM   2795 O  OG1 . THR B 1 131 ? -3.321  -16.902 -4.851  1.00 14.20 ? 131 THR B OG1 1 
ATOM   2796 C  CG2 . THR B 1 131 ? -2.974  -17.622 -2.585  1.00 14.08 ? 131 THR B CG2 1 
ATOM   2797 N  N   . PHE B 1 132 ? -0.718  -18.088 -6.752  1.00 17.01 ? 132 PHE B N   1 
ATOM   2798 C  CA  . PHE B 1 132 ? -0.784  -18.428 -8.179  1.00 19.03 ? 132 PHE B CA  1 
ATOM   2799 C  C   . PHE B 1 132 ? 0.640   -18.672 -8.653  1.00 21.51 ? 132 PHE B C   1 
ATOM   2800 O  O   . PHE B 1 132 ? 1.500   -17.795 -8.526  1.00 17.06 ? 132 PHE B O   1 
ATOM   2801 C  CB  . PHE B 1 132 ? -1.451  -17.289 -8.947  1.00 19.56 ? 132 PHE B CB  1 
ATOM   2802 C  CG  . PHE B 1 132 ? -1.716  -17.628 -10.391 1.00 22.64 ? 132 PHE B CG  1 
ATOM   2803 C  CD1 . PHE B 1 132 ? -2.868  -18.319 -10.761 1.00 23.64 ? 132 PHE B CD1 1 
ATOM   2804 C  CD2 . PHE B 1 132 ? -0.760  -17.326 -11.365 1.00 25.00 ? 132 PHE B CD2 1 
ATOM   2805 C  CE1 . PHE B 1 132 ? -3.070  -18.709 -12.098 1.00 27.93 ? 132 PHE B CE1 1 
ATOM   2806 C  CE2 . PHE B 1 132 ? -0.958  -17.720 -12.714 1.00 26.98 ? 132 PHE B CE2 1 
ATOM   2807 C  CZ  . PHE B 1 132 ? -2.117  -18.408 -13.062 1.00 24.92 ? 132 PHE B CZ  1 
ATOM   2808 N  N   . TYR B 1 133 ? 0.882   -19.870 -9.199  1.00 21.61 ? 133 TYR B N   1 
ATOM   2809 C  CA  . TYR B 1 133 ? 2.235   -20.266 -9.583  1.00 22.26 ? 133 TYR B CA  1 
ATOM   2810 C  C   . TYR B 1 133 ? 2.386   -20.977 -10.941 1.00 26.78 ? 133 TYR B C   1 
ATOM   2811 O  O   . TYR B 1 133 ? 3.323   -21.747 -11.129 1.00 29.85 ? 133 TYR B O   1 
ATOM   2812 C  CB  . TYR B 1 133 ? 2.769   -21.168 -8.486  1.00 20.99 ? 133 TYR B CB  1 
ATOM   2813 C  CG  . TYR B 1 133 ? 1.744   -22.223 -8.085  1.00 25.24 ? 133 TYR B CG  1 
ATOM   2814 C  CD1 . TYR B 1 133 ? 0.680   -21.911 -7.231  1.00 27.38 ? 133 TYR B CD1 1 
ATOM   2815 C  CD2 . TYR B 1 133 ? 1.759   -23.494 -8.676  1.00 29.59 ? 133 TYR B CD2 1 
ATOM   2816 C  CE1 . TYR B 1 133 ? -0.341  -22.830 -6.986  1.00 27.00 ? 133 TYR B CE1 1 
ATOM   2817 C  CE2 . TYR B 1 133 ? 0.741   -24.420 -8.437  1.00 30.42 ? 133 TYR B CE2 1 
ATOM   2818 C  CZ  . TYR B 1 133 ? -0.304  -24.079 -7.599  1.00 31.71 ? 133 TYR B CZ  1 
ATOM   2819 O  OH  . TYR B 1 133 ? -1.317  -24.982 -7.402  1.00 38.56 ? 133 TYR B OH  1 
ATOM   2820 N  N   . ALA B 1 134 ? 1.484   -20.710 -11.875 1.00 27.80 ? 134 ALA B N   1 
ATOM   2821 C  CA  . ALA B 1 134 ? 1.564   -21.331 -13.203 1.00 29.08 ? 134 ALA B CA  1 
ATOM   2822 C  C   . ALA B 1 134 ? 2.947   -21.045 -13.777 1.00 32.36 ? 134 ALA B C   1 
ATOM   2823 O  O   . ALA B 1 134 ? 3.329   -19.889 -14.011 1.00 31.79 ? 134 ALA B O   1 
ATOM   2824 C  CB  . ALA B 1 134 ? 0.497   -20.758 -14.112 1.00 29.30 ? 134 ALA B CB  1 
ATOM   2825 N  N   . GLN B 1 135 ? 3.680   -22.121 -14.018 1.00 35.96 ? 135 GLN B N   1 
ATOM   2826 C  CA  . GLN B 1 135 ? 5.036   -22.058 -14.530 1.00 37.40 ? 135 GLN B CA  1 
ATOM   2827 C  C   . GLN B 1 135 ? 5.215   -21.340 -15.866 1.00 39.00 ? 135 GLN B C   1 
ATOM   2828 O  O   . GLN B 1 135 ? 6.340   -21.004 -16.246 1.00 38.16 ? 135 GLN B O   1 
ATOM   2829 C  CB  . GLN B 1 135 ? 5.568   -23.483 -14.597 1.00 36.33 ? 135 GLN B CB  1 
ATOM   2830 C  CG  . GLN B 1 135 ? 5.560   -24.144 -13.232 1.00 34.37 ? 135 GLN B CG  1 
ATOM   2831 C  CD  . GLN B 1 135 ? 6.498   -23.449 -12.263 1.00 39.57 ? 135 GLN B CD  1 
ATOM   2832 O  OE1 . GLN B 1 135 ? 7.716   -23.444 -12.477 1.00 41.81 ? 135 GLN B OE1 1 
ATOM   2833 N  NE2 . GLN B 1 135 ? 5.944   -22.844 -11.195 1.00 31.87 ? 135 GLN B NE2 1 
ATOM   2834 N  N   . ASP B 1 136 ? 4.113   -21.080 -16.562 1.00 38.13 ? 136 ASP B N   1 
ATOM   2835 C  CA  . ASP B 1 136 ? 4.190   -20.413 -17.858 1.00 41.01 ? 136 ASP B CA  1 
ATOM   2836 C  C   . ASP B 1 136 ? 4.173   -18.893 -17.767 1.00 39.21 ? 136 ASP B C   1 
ATOM   2837 O  O   . ASP B 1 136 ? 4.617   -18.209 -18.696 1.00 40.40 ? 136 ASP B O   1 
ATOM   2838 C  CB  . ASP B 1 136 ? 3.052   -20.896 -18.767 1.00 46.62 ? 136 ASP B CB  1 
ATOM   2839 C  CG  . ASP B 1 136 ? 1.675   -20.531 -18.227 1.00 51.71 ? 136 ASP B CG  1 
ATOM   2840 O  OD1 . ASP B 1 136 ? 1.347   -19.321 -18.196 1.00 56.13 ? 136 ASP B OD1 1 
ATOM   2841 O  OD2 . ASP B 1 136 ? 0.924   -21.454 -17.831 1.00 58.20 ? 136 ASP B OD2 1 
ATOM   2842 N  N   . SER B 1 137 ? 3.645   -18.352 -16.670 1.00 35.59 ? 137 SER B N   1 
ATOM   2843 C  CA  . SER B 1 137 ? 3.623   -16.898 -16.507 1.00 33.05 ? 137 SER B CA  1 
ATOM   2844 C  C   . SER B 1 137 ? 4.443   -16.505 -15.282 1.00 32.27 ? 137 SER B C   1 
ATOM   2845 O  O   . SER B 1 137 ? 5.212   -15.549 -15.332 1.00 38.38 ? 137 SER B O   1 
ATOM   2846 C  CB  . SER B 1 137 ? 2.184   -16.363 -16.366 1.00 36.50 ? 137 SER B CB  1 
ATOM   2847 O  OG  . SER B 1 137 ? 1.507   -16.981 -15.288 1.00 29.71 ? 137 SER B OG  1 
ATOM   2848 N  N   . ASN B 1 138 ? 4.276   -17.237 -14.181 1.00 29.38 ? 138 ASN B N   1 
ATOM   2849 C  CA  . ASN B 1 138 ? 5.031   -16.937 -12.953 1.00 26.49 ? 138 ASN B CA  1 
ATOM   2850 C  C   . ASN B 1 138 ? 6.243   -17.874 -12.927 1.00 23.17 ? 138 ASN B C   1 
ATOM   2851 O  O   . ASN B 1 138 ? 6.390   -18.757 -12.061 1.00 23.17 ? 138 ASN B O   1 
ATOM   2852 C  CB  . ASN B 1 138 ? 4.151   -17.157 -11.708 1.00 24.76 ? 138 ASN B CB  1 
ATOM   2853 C  CG  . ASN B 1 138 ? 3.064   -16.080 -11.533 1.00 25.09 ? 138 ASN B CG  1 
ATOM   2854 O  OD1 . ASN B 1 138 ? 2.832   -15.649 -10.413 1.00 21.65 ? 138 ASN B OD1 1 
ATOM   2855 N  ND2 . ASN B 1 138 ? 2.383   -15.661 -12.625 1.00 23.62 ? 138 ASN B ND2 1 
ATOM   2856 N  N   . THR B 1 139 ? 7.132   -17.657 -13.892 1.00 25.23 ? 139 THR B N   1 
ATOM   2857 C  CA  . THR B 1 139 ? 8.294   -18.517 -14.076 1.00 29.24 ? 139 THR B CA  1 
ATOM   2858 C  C   . THR B 1 139 ? 9.267   -18.563 -12.916 1.00 26.45 ? 139 THR B C   1 
ATOM   2859 O  O   . THR B 1 139 ? 10.036  -19.517 -12.802 1.00 29.31 ? 139 THR B O   1 
ATOM   2860 C  CB  . THR B 1 139 ? 9.080   -18.118 -15.370 1.00 26.68 ? 139 THR B CB  1 
ATOM   2861 O  OG1 . THR B 1 139 ? 9.510   -16.763 -15.260 1.00 30.62 ? 139 THR B OG1 1 
ATOM   2862 C  CG2 . THR B 1 139 ? 8.180   -18.218 -16.602 1.00 30.18 ? 139 THR B CG2 1 
ATOM   2863 N  N   . TRP B 1 140 ? 9.260   -17.529 -12.085 1.00 22.08 ? 140 TRP B N   1 
ATOM   2864 C  CA  . TRP B 1 140 ? 10.146  -17.462 -10.919 1.00 21.99 ? 140 TRP B CA  1 
ATOM   2865 C  C   . TRP B 1 140 ? 9.652   -18.235 -9.699  1.00 22.78 ? 140 TRP B C   1 
ATOM   2866 O  O   . TRP B 1 140 ? 10.399  -18.462 -8.742  1.00 24.10 ? 140 TRP B O   1 
ATOM   2867 C  CB  . TRP B 1 140 ? 10.338  -15.997 -10.552 1.00 24.69 ? 140 TRP B CB  1 
ATOM   2868 C  CG  . TRP B 1 140 ? 9.032   -15.340 -10.342 1.00 25.28 ? 140 TRP B CG  1 
ATOM   2869 C  CD1 . TRP B 1 140 ? 8.219   -15.458 -9.241  1.00 24.58 ? 140 TRP B CD1 1 
ATOM   2870 C  CD2 . TRP B 1 140 ? 8.285   -14.609 -11.311 1.00 25.34 ? 140 TRP B CD2 1 
ATOM   2871 N  NE1 . TRP B 1 140 ? 7.018   -14.848 -9.478  1.00 25.57 ? 140 TRP B NE1 1 
ATOM   2872 C  CE2 . TRP B 1 140 ? 7.024   -14.317 -10.737 1.00 23.49 ? 140 TRP B CE2 1 
ATOM   2873 C  CE3 . TRP B 1 140 ? 8.550   -14.172 -12.608 1.00 27.77 ? 140 TRP B CE3 1 
ATOM   2874 C  CZ2 . TRP B 1 140 ? 6.034   -13.609 -11.420 1.00 27.02 ? 140 TRP B CZ2 1 
ATOM   2875 C  CZ3 . TRP B 1 140 ? 7.557   -13.463 -13.291 1.00 30.58 ? 140 TRP B CZ3 1 
ATOM   2876 C  CH2 . TRP B 1 140 ? 6.317   -13.192 -12.693 1.00 31.03 ? 140 TRP B CH2 1 
ATOM   2877 N  N   . ASP B 1 141 ? 8.380   -18.635 -9.712  1.00 21.80 ? 141 ASP B N   1 
ATOM   2878 C  CA  . ASP B 1 141 ? 7.787   -19.353 -8.577  1.00 21.99 ? 141 ASP B CA  1 
ATOM   2879 C  C   . ASP B 1 141 ? 7.968   -20.855 -8.506  1.00 24.67 ? 141 ASP B C   1 
ATOM   2880 O  O   . ASP B 1 141 ? 8.114   -21.534 -9.535  1.00 25.92 ? 141 ASP B O   1 
ATOM   2881 C  CB  . ASP B 1 141 ? 6.242   -19.205 -8.555  1.00 19.18 ? 141 ASP B CB  1 
ATOM   2882 C  CG  . ASP B 1 141 ? 5.768   -17.880 -8.026  1.00 19.41 ? 141 ASP B CG  1 
ATOM   2883 O  OD1 . ASP B 1 141 ? 6.483   -17.344 -7.176  1.00 16.07 ? 141 ASP B OD1 1 
ATOM   2884 O  OD2 . ASP B 1 141 ? 4.687   -17.405 -8.424  1.00 20.85 ? 141 ASP B OD2 1 
ATOM   2885 N  N   . PRO B 1 142 ? 7.962   -21.402 -7.281  1.00 25.32 ? 142 PRO B N   1 
ATOM   2886 C  CA  . PRO B 1 142 ? 8.061   -22.848 -7.097  1.00 24.76 ? 142 PRO B CA  1 
ATOM   2887 C  C   . PRO B 1 142 ? 6.665   -23.310 -7.580  1.00 29.59 ? 142 PRO B C   1 
ATOM   2888 O  O   . PRO B 1 142 ? 5.737   -22.492 -7.721  1.00 26.70 ? 142 PRO B O   1 
ATOM   2889 C  CB  . PRO B 1 142 ? 8.209   -23.000 -5.590  1.00 30.71 ? 142 PRO B CB  1 
ATOM   2890 C  CG  . PRO B 1 142 ? 7.417   -21.786 -5.064  1.00 24.42 ? 142 PRO B CG  1 
ATOM   2891 C  CD  . PRO B 1 142 ? 7.991   -20.719 -5.972  1.00 24.06 ? 142 PRO B CD  1 
ATOM   2892 N  N   . ASN B 1 143 ? 6.482   -24.605 -7.805  1.00 27.16 ? 143 ASN B N   1 
ATOM   2893 C  CA  . ASN B 1 143 ? 5.205   -25.076 -8.335  1.00 29.68 ? 143 ASN B CA  1 
ATOM   2894 C  C   . ASN B 1 143 ? 4.146   -25.483 -7.306  1.00 29.81 ? 143 ASN B C   1 
ATOM   2895 O  O   . ASN B 1 143 ? 3.630   -26.597 -7.319  1.00 28.44 ? 143 ASN B O   1 
ATOM   2896 C  CB  . ASN B 1 143 ? 5.486   -26.219 -9.336  1.00 33.61 ? 143 ASN B CB  1 
ATOM   2897 C  CG  . ASN B 1 143 ? 4.282   -26.546 -10.212 1.00 37.38 ? 143 ASN B CG  1 
ATOM   2898 O  OD1 . ASN B 1 143 ? 3.625   -25.646 -10.748 1.00 38.87 ? 143 ASN B OD1 1 
ATOM   2899 N  ND2 . ASN B 1 143 ? 4.008   -27.844 -10.392 1.00 43.76 ? 143 ASN B ND2 1 
ATOM   2900 N  N   . TYR B 1 144 ? 3.820   -24.552 -6.406  1.00 26.40 ? 144 TYR B N   1 
ATOM   2901 C  CA  . TYR B 1 144 ? 2.809   -24.774 -5.374  1.00 21.57 ? 144 TYR B CA  1 
ATOM   2902 C  C   . TYR B 1 144 ? 2.607   -23.436 -4.663  1.00 20.85 ? 144 TYR B C   1 
ATOM   2903 O  O   . TYR B 1 144 ? 3.451   -22.539 -4.815  1.00 19.10 ? 144 TYR B O   1 
ATOM   2904 C  CB  . TYR B 1 144 ? 3.279   -25.833 -4.367  1.00 23.45 ? 144 TYR B CB  1 
ATOM   2905 C  CG  . TYR B 1 144 ? 4.711   -25.727 -3.903  1.00 29.21 ? 144 TYR B CG  1 
ATOM   2906 C  CD1 . TYR B 1 144 ? 5.130   -24.715 -3.026  1.00 28.12 ? 144 TYR B CD1 1 
ATOM   2907 C  CD2 . TYR B 1 144 ? 5.665   -26.647 -4.351  1.00 34.23 ? 144 TYR B CD2 1 
ATOM   2908 C  CE1 . TYR B 1 144 ? 6.453   -24.623 -2.618  1.00 32.18 ? 144 TYR B CE1 1 
ATOM   2909 C  CE2 . TYR B 1 144 ? 6.990   -26.560 -3.945  1.00 36.88 ? 144 TYR B CE2 1 
ATOM   2910 C  CZ  . TYR B 1 144 ? 7.378   -25.550 -3.087  1.00 36.80 ? 144 TYR B CZ  1 
ATOM   2911 O  OH  . TYR B 1 144 ? 8.697   -25.451 -2.724  1.00 43.02 ? 144 TYR B OH  1 
ATOM   2912 N  N   . PRO B 1 145 ? 1.462   -23.255 -3.975  1.00 21.72 ? 145 PRO B N   1 
ATOM   2913 C  CA  . PRO B 1 145 ? 1.230   -21.990 -3.253  1.00 18.50 ? 145 PRO B CA  1 
ATOM   2914 C  C   . PRO B 1 145 ? 2.303   -21.922 -2.151  1.00 16.07 ? 145 PRO B C   1 
ATOM   2915 O  O   . PRO B 1 145 ? 2.710   -22.952 -1.598  1.00 17.71 ? 145 PRO B O   1 
ATOM   2916 C  CB  . PRO B 1 145 ? -0.205  -22.140 -2.747  1.00 19.20 ? 145 PRO B CB  1 
ATOM   2917 C  CG  . PRO B 1 145 ? -0.360  -23.641 -2.608  1.00 27.42 ? 145 PRO B CG  1 
ATOM   2918 C  CD  . PRO B 1 145 ? 0.273   -24.131 -3.871  1.00 23.42 ? 145 PRO B CD  1 
ATOM   2919 N  N   . HIS B 1 146 ? 2.748   -20.713 -1.831  1.00 16.32 ? 146 HIS B N   1 
ATOM   2920 C  CA  . HIS B 1 146 ? 3.849   -20.579 -0.907  1.00 14.56 ? 146 HIS B CA  1 
ATOM   2921 C  C   . HIS B 1 146 ? 3.908   -19.260 -0.172  1.00 14.92 ? 146 HIS B C   1 
ATOM   2922 O  O   . HIS B 1 146 ? 3.280   -18.295 -0.589  1.00 14.61 ? 146 HIS B O   1 
ATOM   2923 C  CB  . HIS B 1 146 ? 5.167   -20.695 -1.689  1.00 13.49 ? 146 HIS B CB  1 
ATOM   2924 C  CG  . HIS B 1 146 ? 5.226   -19.822 -2.906  1.00 15.68 ? 146 HIS B CG  1 
ATOM   2925 N  ND1 . HIS B 1 146 ? 4.595   -20.141 -4.093  1.00 16.36 ? 146 HIS B ND1 1 
ATOM   2926 C  CD2 . HIS B 1 146 ? 5.803   -18.611 -3.101  1.00 13.69 ? 146 HIS B CD2 1 
ATOM   2927 C  CE1 . HIS B 1 146 ? 4.777   -19.157 -4.962  1.00 17.76 ? 146 HIS B CE1 1 
ATOM   2928 N  NE2 . HIS B 1 146 ? 5.511   -18.213 -4.384  1.00 16.95 ? 146 HIS B NE2 1 
ATOM   2929 N  N   . ILE B 1 147 ? 4.665   -19.269 0.917   1.00 14.66 ? 147 ILE B N   1 
ATOM   2930 C  CA  . ILE B 1 147 ? 4.974   -18.042 1.645   1.00 15.60 ? 147 ILE B CA  1 
ATOM   2931 C  C   . ILE B 1 147 ? 6.407   -17.788 1.186   1.00 14.29 ? 147 ILE B C   1 
ATOM   2932 O  O   . ILE B 1 147 ? 7.223   -18.721 1.124   1.00 18.28 ? 147 ILE B O   1 
ATOM   2933 C  CB  . ILE B 1 147 ? 4.961   -18.229 3.143   1.00 13.99 ? 147 ILE B CB  1 
ATOM   2934 C  CG1 . ILE B 1 147 ? 3.517   -18.489 3.611   1.00 15.04 ? 147 ILE B CG1 1 
ATOM   2935 C  CG2 . ILE B 1 147 ? 5.534   -16.958 3.817   1.00 13.95 ? 147 ILE B CG2 1 
ATOM   2936 C  CD1 . ILE B 1 147 ? 3.403   -18.902 5.068   1.00 20.30 ? 147 ILE B CD1 1 
ATOM   2937 N  N   . GLY B 1 148 ? 6.709   -16.555 0.828   1.00 13.87 ? 148 GLY B N   1 
ATOM   2938 C  CA  . GLY B 1 148 ? 8.071   -16.266 0.374   1.00 16.26 ? 148 GLY B CA  1 
ATOM   2939 C  C   . GLY B 1 148 ? 8.600   -14.981 0.976   1.00 18.56 ? 148 GLY B C   1 
ATOM   2940 O  O   . GLY B 1 148 ? 7.825   -14.117 1.395   1.00 18.09 ? 148 GLY B O   1 
ATOM   2941 N  N   . ILE B 1 149 ? 9.920   -14.883 1.080   1.00 16.60 ? 149 ILE B N   1 
ATOM   2942 C  CA  . ILE B 1 149 ? 10.556  -13.668 1.611   1.00 15.69 ? 149 ILE B CA  1 
ATOM   2943 C  C   . ILE B 1 149 ? 11.224  -13.079 0.374   1.00 18.03 ? 149 ILE B C   1 
ATOM   2944 O  O   . ILE B 1 149 ? 12.015  -13.758 -0.316  1.00 18.76 ? 149 ILE B O   1 
ATOM   2945 C  CB  . ILE B 1 149 ? 11.606  -14.007 2.706   1.00 14.79 ? 149 ILE B CB  1 
ATOM   2946 C  CG1 . ILE B 1 149 ? 10.893  -14.489 3.980   1.00 20.09 ? 149 ILE B CG1 1 
ATOM   2947 C  CG2 . ILE B 1 149 ? 12.438  -12.738 3.015   1.00 18.69 ? 149 ILE B CG2 1 
ATOM   2948 C  CD1 . ILE B 1 149 ? 11.813  -14.944 5.121   1.00 27.29 ? 149 ILE B CD1 1 
ATOM   2949 N  N   . ASP B 1 150 ? 10.862  -11.855 0.050   1.00 14.57 ? 150 ASP B N   1 
ATOM   2950 C  CA  . ASP B 1 150 ? 11.376  -11.194 -1.133  1.00 16.16 ? 150 ASP B CA  1 
ATOM   2951 C  C   . ASP B 1 150 ? 12.311  -10.054 -0.755  1.00 19.04 ? 150 ASP B C   1 
ATOM   2952 O  O   . ASP B 1 150 ? 11.937  -9.155  0.023   1.00 20.73 ? 150 ASP B O   1 
ATOM   2953 C  CB  . ASP B 1 150 ? 10.231  -10.610 -1.972  1.00 17.87 ? 150 ASP B CB  1 
ATOM   2954 C  CG  . ASP B 1 150 ? 9.230   -11.677 -2.441  1.00 21.12 ? 150 ASP B CG  1 
ATOM   2955 O  OD1 . ASP B 1 150 ? 8.119   -11.321 -2.923  1.00 18.25 ? 150 ASP B OD1 1 
ATOM   2956 O  OD2 . ASP B 1 150 ? 9.575   -12.862 -2.328  1.00 20.53 ? 150 ASP B OD2 1 
ATOM   2957 N  N   . VAL B 1 151 ? 13.520  -10.073 -1.321  1.00 17.70 ? 151 VAL B N   1 
ATOM   2958 C  CA  . VAL B 1 151 ? 14.459  -8.999  -1.050  1.00 20.00 ? 151 VAL B CA  1 
ATOM   2959 C  C   . VAL B 1 151 ? 14.885  -8.450  -2.393  1.00 20.57 ? 151 VAL B C   1 
ATOM   2960 O  O   . VAL B 1 151 ? 15.677  -9.081  -3.095  1.00 24.21 ? 151 VAL B O   1 
ATOM   2961 C  CB  . VAL B 1 151 ? 15.698  -9.493  -0.277  1.00 18.48 ? 151 VAL B CB  1 
ATOM   2962 C  CG1 . VAL B 1 151 ? 16.628  -8.327  -0.026  1.00 25.14 ? 151 VAL B CG1 1 
ATOM   2963 C  CG2 . VAL B 1 151 ? 15.305  -10.126 1.062   1.00 22.71 ? 151 VAL B CG2 1 
ATOM   2964 N  N   . ASN B 1 152 ? 14.328  -7.305  -2.769  1.00 19.23 ? 152 ASN B N   1 
ATOM   2965 C  CA  . ASN B 1 152 ? 14.629  -6.632  -4.026  1.00 22.80 ? 152 ASN B CA  1 
ATOM   2966 C  C   . ASN B 1 152 ? 14.320  -7.428  -5.284  1.00 23.87 ? 152 ASN B C   1 
ATOM   2967 O  O   . ASN B 1 152 ? 14.819  -7.082  -6.343  1.00 23.93 ? 152 ASN B O   1 
ATOM   2968 C  CB  . ASN B 1 152 ? 16.112  -6.198  -4.076  1.00 23.27 ? 152 ASN B CB  1 
ATOM   2969 C  CG  . ASN B 1 152 ? 16.440  -5.204  -3.012  1.00 30.00 ? 152 ASN B CG  1 
ATOM   2970 O  OD1 . ASN B 1 152 ? 15.561  -4.441  -2.591  1.00 25.80 ? 152 ASN B OD1 1 
ATOM   2971 N  ND2 . ASN B 1 152 ? 17.711  -5.167  -2.580  1.00 26.79 ? 152 ASN B ND2 1 
ATOM   2972 N  N   . SER B 1 153 ? 13.530  -8.502  -5.172  1.00 22.23 ? 153 SER B N   1 
ATOM   2973 C  CA  . SER B 1 153 ? 13.188  -9.303  -6.360  1.00 23.33 ? 153 SER B CA  1 
ATOM   2974 C  C   . SER B 1 153 ? 11.920  -10.127 -6.133  1.00 22.64 ? 153 SER B C   1 
ATOM   2975 O  O   . SER B 1 153 ? 11.693  -10.593 -5.005  1.00 17.80 ? 153 SER B O   1 
ATOM   2976 C  CB  . SER B 1 153 ? 14.317  -10.282 -6.693  1.00 24.90 ? 153 SER B CB  1 
ATOM   2977 O  OG  . SER B 1 153 ? 13.925  -11.106 -7.783  1.00 24.48 ? 153 SER B OG  1 
ATOM   2978 N  N   . ILE B 1 154 ? 11.122  -10.321 -7.189  1.00 21.40 ? 154 ILE B N   1 
ATOM   2979 C  CA  . ILE B 1 154 ? 9.903   -11.147 -7.072  1.00 20.81 ? 154 ILE B CA  1 
ATOM   2980 C  C   . ILE B 1 154 ? 10.292  -12.643 -6.960  1.00 22.39 ? 154 ILE B C   1 
ATOM   2981 O  O   . ILE B 1 154 ? 9.492   -13.494 -6.554  1.00 20.07 ? 154 ILE B O   1 
ATOM   2982 C  CB  . ILE B 1 154 ? 8.931   -10.876 -8.262  1.00 21.94 ? 154 ILE B CB  1 
ATOM   2983 C  CG1 . ILE B 1 154 ? 7.561   -11.536 -8.012  1.00 20.02 ? 154 ILE B CG1 1 
ATOM   2984 C  CG2 . ILE B 1 154 ? 9.542   -11.415 -9.577  1.00 24.37 ? 154 ILE B CG2 1 
ATOM   2985 C  CD1 . ILE B 1 154 ? 6.787   -10.929 -6.812  1.00 19.27 ? 154 ILE B CD1 1 
ATOM   2986 N  N   . ARG B 1 155 ? 11.531  -12.985 -7.319  1.00 22.99 ? 155 ARG B N   1 
ATOM   2987 C  CA  . ARG B 1 155 ? 11.974  -14.359 -7.144  1.00 22.56 ? 155 ARG B CA  1 
ATOM   2988 C  C   . ARG B 1 155 ? 12.478  -14.424 -5.706  1.00 23.55 ? 155 ARG B C   1 
ATOM   2989 O  O   . ARG B 1 155 ? 13.590  -13.977 -5.406  1.00 22.11 ? 155 ARG B O   1 
ATOM   2990 C  CB  . ARG B 1 155 ? 13.113  -14.738 -8.140  1.00 26.39 ? 155 ARG B CB  1 
ATOM   2991 C  CG  . ARG B 1 155 ? 13.654  -16.179 -7.879  1.00 26.35 ? 155 ARG B CG  1 
ATOM   2992 C  CD  . ARG B 1 155 ? 14.945  -16.449 -8.688  1.00 32.92 ? 155 ARG B CD  1 
ATOM   2993 N  NE  . ARG B 1 155 ? 14.653  -16.375 -10.111 1.00 36.94 ? 155 ARG B NE  1 
ATOM   2994 C  CZ  . ARG B 1 155 ? 14.188  -17.402 -10.819 1.00 41.28 ? 155 ARG B CZ  1 
ATOM   2995 N  NH1 . ARG B 1 155 ? 13.931  -17.264 -12.116 1.00 41.40 ? 155 ARG B NH1 1 
ATOM   2996 N  NH2 . ARG B 1 155 ? 14.039  -18.587 -10.240 1.00 40.50 ? 155 ARG B NH2 1 
ATOM   2997 N  N   . SER B 1 156 ? 11.655  -14.985 -4.815  1.00 19.27 ? 156 SER B N   1 
ATOM   2998 C  CA  . SER B 1 156 ? 11.936  -15.090 -3.397  1.00 20.61 ? 156 SER B CA  1 
ATOM   2999 C  C   . SER B 1 156 ? 13.305  -15.671 -3.035  1.00 21.83 ? 156 SER B C   1 
ATOM   3000 O  O   . SER B 1 156 ? 13.768  -16.628 -3.667  1.00 22.72 ? 156 SER B O   1 
ATOM   3001 C  CB  . SER B 1 156 ? 10.837  -15.951 -2.725  1.00 18.40 ? 156 SER B CB  1 
ATOM   3002 O  OG  . SER B 1 156 ? 9.559   -15.403 -3.024  1.00 18.26 ? 156 SER B OG  1 
ATOM   3003 N  N   . VAL B 1 157 ? 13.931  -15.128 -1.990  1.00 18.64 ? 157 VAL B N   1 
ATOM   3004 C  CA  . VAL B 1 157 ? 15.222  -15.657 -1.576  1.00 20.11 ? 157 VAL B CA  1 
ATOM   3005 C  C   . VAL B 1 157 ? 14.936  -16.954 -0.875  1.00 23.61 ? 157 VAL B C   1 
ATOM   3006 O  O   . VAL B 1 157 ? 15.817  -17.805 -0.709  1.00 24.47 ? 157 VAL B O   1 
ATOM   3007 C  CB  . VAL B 1 157 ? 15.993  -14.665 -0.650  1.00 18.38 ? 157 VAL B CB  1 
ATOM   3008 C  CG1 . VAL B 1 157 ? 16.311  -13.425 -1.446  1.00 19.75 ? 157 VAL B CG1 1 
ATOM   3009 C  CG2 . VAL B 1 157 ? 15.155  -14.281 0.593   1.00 21.92 ? 157 VAL B CG2 1 
ATOM   3010 N  N   . LYS B 1 158 ? 13.677  -17.120 -0.462  1.00 21.88 ? 158 LYS B N   1 
ATOM   3011 C  CA  . LYS B 1 158 ? 13.287  -18.346 0.191   1.00 23.53 ? 158 LYS B CA  1 
ATOM   3012 C  C   . LYS B 1 158 ? 11.775  -18.526 0.162   1.00 22.63 ? 158 LYS B C   1 
ATOM   3013 O  O   . LYS B 1 158 ? 11.054  -17.550 0.262   1.00 20.59 ? 158 LYS B O   1 
ATOM   3014 C  CB  . LYS B 1 158 ? 13.708  -18.338 1.649   1.00 24.35 ? 158 LYS B CB  1 
ATOM   3015 C  CG  . LYS B 1 158 ? 13.345  -19.629 2.339   1.00 37.15 ? 158 LYS B CG  1 
ATOM   3016 C  CD  . LYS B 1 158 ? 13.931  -19.735 3.741   1.00 33.03 ? 158 LYS B CD  1 
ATOM   3017 C  CE  . LYS B 1 158 ? 15.422  -19.682 3.728   1.00 27.83 ? 158 LYS B CE  1 
ATOM   3018 N  NZ  . LYS B 1 158 ? 15.899  -20.062 5.075   1.00 24.00 ? 158 LYS B NZ  1 
ATOM   3019 N  N   . THR B 1 159 ? 11.321  -19.772 0.056   1.00 24.00 ? 159 THR B N   1 
ATOM   3020 C  CA  . THR B 1 159 ? 9.877   -20.064 0.099   1.00 21.51 ? 159 THR B CA  1 
ATOM   3021 C  C   . THR B 1 159 ? 9.627   -21.337 0.907   1.00 23.81 ? 159 THR B C   1 
ATOM   3022 O  O   . THR B 1 159 ? 10.534  -22.166 1.115   1.00 23.14 ? 159 THR B O   1 
ATOM   3023 C  CB  . THR B 1 159 ? 9.243   -20.297 -1.318  1.00 21.24 ? 159 THR B CB  1 
ATOM   3024 O  OG1 . THR B 1 159 ? 9.817   -21.463 -1.927  1.00 24.52 ? 159 THR B OG1 1 
ATOM   3025 C  CG2 . THR B 1 159 ? 9.450   -19.102 -2.246  1.00 21.66 ? 159 THR B CG2 1 
ATOM   3026 N  N   . VAL B 1 160 ? 8.405   -21.478 1.420   1.00 19.48 ? 160 VAL B N   1 
ATOM   3027 C  CA  . VAL B 1 160 ? 7.997   -22.711 2.088   1.00 17.99 ? 160 VAL B CA  1 
ATOM   3028 C  C   . VAL B 1 160 ? 6.598   -22.996 1.563   1.00 17.27 ? 160 VAL B C   1 
ATOM   3029 O  O   . VAL B 1 160 ? 5.871   -22.071 1.171   1.00 17.85 ? 160 VAL B O   1 
ATOM   3030 C  CB  . VAL B 1 160 ? 7.978   -22.633 3.637   1.00 20.00 ? 160 VAL B CB  1 
ATOM   3031 C  CG1 . VAL B 1 160 ? 9.432   -22.543 4.162   1.00 20.71 ? 160 VAL B CG1 1 
ATOM   3032 C  CG2 . VAL B 1 160 ? 7.136   -21.424 4.099   1.00 22.00 ? 160 VAL B CG2 1 
ATOM   3033 N  N   . LYS B 1 161 ? 6.241   -24.276 1.521   1.00 16.21 ? 161 LYS B N   1 
ATOM   3034 C  CA  . LYS B 1 161 ? 4.931   -24.681 1.021   1.00 20.44 ? 161 LYS B CA  1 
ATOM   3035 C  C   . LYS B 1 161 ? 3.860   -24.129 1.963   1.00 20.24 ? 161 LYS B C   1 
ATOM   3036 O  O   . LYS B 1 161 ? 4.036   -24.128 3.186   1.00 20.40 ? 161 LYS B O   1 
ATOM   3037 C  CB  . LYS B 1 161 ? 4.829   -26.209 0.949   1.00 23.92 ? 161 LYS B CB  1 
ATOM   3038 C  CG  . LYS B 1 161 ? 3.477   -26.692 0.362   1.00 34.66 ? 161 LYS B CG  1 
ATOM   3039 C  CD  . LYS B 1 161 ? 3.390   -28.220 0.220   1.00 39.40 ? 161 LYS B CD  1 
ATOM   3040 N  N   . TRP B 1 162 ? 2.744   -23.694 1.381   1.00 18.28 ? 162 TRP B N   1 
ATOM   3041 C  CA  . TRP B 1 162 ? 1.654   -23.105 2.152   1.00 17.19 ? 162 TRP B CA  1 
ATOM   3042 C  C   . TRP B 1 162 ? 0.333   -23.594 1.557   1.00 21.21 ? 162 TRP B C   1 
ATOM   3043 O  O   . TRP B 1 162 ? 0.283   -23.893 0.366   1.00 25.04 ? 162 TRP B O   1 
ATOM   3044 C  CB  . TRP B 1 162 ? 1.773   -21.591 2.057   1.00 17.25 ? 162 TRP B CB  1 
ATOM   3045 C  CG  . TRP B 1 162 ? 0.619   -20.803 2.679   1.00 18.33 ? 162 TRP B CG  1 
ATOM   3046 C  CD1 . TRP B 1 162 ? 0.146   -20.891 3.961   1.00 16.77 ? 162 TRP B CD1 1 
ATOM   3047 C  CD2 . TRP B 1 162 ? -0.185  -19.827 2.017   1.00 17.38 ? 162 TRP B CD2 1 
ATOM   3048 N  NE1 . TRP B 1 162 ? -0.927  -20.018 4.133   1.00 15.76 ? 162 TRP B NE1 1 
ATOM   3049 C  CE2 . TRP B 1 162 ? -1.146  -19.358 2.955   1.00 14.77 ? 162 TRP B CE2 1 
ATOM   3050 C  CE3 . TRP B 1 162 ? -0.189  -19.295 0.719   1.00 18.72 ? 162 TRP B CE3 1 
ATOM   3051 C  CZ2 . TRP B 1 162 ? -2.102  -18.385 2.628   1.00 18.37 ? 162 TRP B CZ2 1 
ATOM   3052 C  CZ3 . TRP B 1 162 ? -1.134  -18.328 0.391   1.00 19.39 ? 162 TRP B CZ3 1 
ATOM   3053 C  CH2 . TRP B 1 162 ? -2.083  -17.880 1.343   1.00 21.59 ? 162 TRP B CH2 1 
ATOM   3054 N  N   . ASP B 1 163 ? -0.711  -23.708 2.381   1.00 16.94 ? 163 ASP B N   1 
ATOM   3055 C  CA  . ASP B 1 163 ? -2.020  -24.183 1.918   1.00 18.86 ? 163 ASP B CA  1 
ATOM   3056 C  C   . ASP B 1 163 ? -2.953  -22.958 1.884   1.00 20.52 ? 163 ASP B C   1 
ATOM   3057 O  O   . ASP B 1 163 ? -3.047  -22.238 2.890   1.00 17.47 ? 163 ASP B O   1 
ATOM   3058 C  CB  . ASP B 1 163 ? -2.552  -25.208 2.933   1.00 23.62 ? 163 ASP B CB  1 
ATOM   3059 C  CG  A ASP B 1 163 ? -3.769  -25.973 2.437   0.50 34.93 ? 163 ASP B CG  1 
ATOM   3060 C  CG  B ASP B 1 163 ? -1.604  -26.356 3.131   0.50 29.12 ? 163 ASP B CG  1 
ATOM   3061 O  OD1 A ASP B 1 163 ? -4.539  -26.479 3.288   0.50 38.29 ? 163 ASP B OD1 1 
ATOM   3062 O  OD1 B ASP B 1 163 ? -1.103  -26.526 4.263   0.50 31.96 ? 163 ASP B OD1 1 
ATOM   3063 O  OD2 A ASP B 1 163 ? -3.939  -26.095 1.208   0.50 39.33 ? 163 ASP B OD2 1 
ATOM   3064 O  OD2 B ASP B 1 163 ? -1.357  -27.080 2.146   0.50 32.25 ? 163 ASP B OD2 1 
ATOM   3065 N  N   . ARG B 1 164 ? -3.589  -22.692 0.740   1.00 17.28 ? 164 ARG B N   1 
ATOM   3066 C  CA  . ARG B 1 164 ? -4.541  -21.584 0.623   1.00 18.57 ? 164 ARG B CA  1 
ATOM   3067 C  C   . ARG B 1 164 ? -5.862  -22.172 1.138   1.00 19.78 ? 164 ARG B C   1 
ATOM   3068 O  O   . ARG B 1 164 ? -6.204  -23.287 0.761   1.00 20.92 ? 164 ARG B O   1 
ATOM   3069 C  CB  . ARG B 1 164 ? -4.750  -21.193 -0.849  1.00 19.23 ? 164 ARG B CB  1 
ATOM   3070 C  CG  . ARG B 1 164 ? -5.789  -20.111 -1.084  1.00 18.61 ? 164 ARG B CG  1 
ATOM   3071 C  CD  . ARG B 1 164 ? -6.059  -19.939 -2.597  1.00 16.19 ? 164 ARG B CD  1 
ATOM   3072 N  NE  . ARG B 1 164 ? -6.934  -18.795 -2.859  1.00 19.76 ? 164 ARG B NE  1 
ATOM   3073 C  CZ  . ARG B 1 164 ? -8.243  -18.734 -2.566  1.00 17.05 ? 164 ARG B CZ  1 
ATOM   3074 N  NH1 . ARG B 1 164 ? -8.930  -17.623 -2.848  1.00 17.81 ? 164 ARG B NH1 1 
ATOM   3075 N  NH2 . ARG B 1 164 ? -8.864  -19.785 -2.051  1.00 18.10 ? 164 ARG B NH2 1 
ATOM   3076 N  N   . ARG B 1 165 ? -6.575  -21.470 2.015   1.00 17.83 ? 165 ARG B N   1 
ATOM   3077 C  CA  . ARG B 1 165 ? -7.854  -21.968 2.506   1.00 15.79 ? 165 ARG B CA  1 
ATOM   3078 C  C   . ARG B 1 165 ? -8.865  -20.846 2.297   1.00 18.57 ? 165 ARG B C   1 
ATOM   3079 O  O   . ARG B 1 165 ? -8.780  -19.774 2.902   1.00 18.17 ? 165 ARG B O   1 
ATOM   3080 C  CB  . ARG B 1 165 ? -7.783  -22.347 3.975   1.00 15.64 ? 165 ARG B CB  1 
ATOM   3081 C  CG  . ARG B 1 165 ? -6.827  -23.444 4.257   1.00 18.51 ? 165 ARG B CG  1 
ATOM   3082 C  CD  . ARG B 1 165 ? -7.000  -23.915 5.689   1.00 18.53 ? 165 ARG B CD  1 
ATOM   3083 N  NE  . ARG B 1 165 ? -6.082  -24.993 5.997   1.00 20.56 ? 165 ARG B NE  1 
ATOM   3084 C  CZ  . ARG B 1 165 ? -5.902  -25.469 7.225   1.00 24.67 ? 165 ARG B CZ  1 
ATOM   3085 N  NH1 . ARG B 1 165 ? -5.039  -26.459 7.426   1.00 26.33 ? 165 ARG B NH1 1 
ATOM   3086 N  NH2 . ARG B 1 165 ? -6.579  -24.944 8.243   1.00 23.12 ? 165 ARG B NH2 1 
ATOM   3087 N  N   . ASP B 1 166 ? -9.811  -21.085 1.402   1.00 15.86 ? 166 ASP B N   1 
ATOM   3088 C  CA  . ASP B 1 166 ? -10.775 -20.066 1.030   1.00 13.96 ? 166 ASP B CA  1 
ATOM   3089 C  C   . ASP B 1 166 ? -11.604 -19.592 2.202   1.00 17.57 ? 166 ASP B C   1 
ATOM   3090 O  O   . ASP B 1 166 ? -12.135 -20.411 2.957   1.00 18.51 ? 166 ASP B O   1 
ATOM   3091 C  CB  . ASP B 1 166 ? -11.723 -20.613 -0.046  1.00 15.50 ? 166 ASP B CB  1 
ATOM   3092 C  CG  . ASP B 1 166 ? -12.312 -19.522 -0.901  1.00 16.58 ? 166 ASP B CG  1 
ATOM   3093 O  OD1 . ASP B 1 166 ? -11.623 -19.036 -1.816  1.00 18.16 ? 166 ASP B OD1 1 
ATOM   3094 O  OD2 . ASP B 1 166 ? -13.464 -19.147 -0.638  1.00 22.10 ? 166 ASP B OD2 1 
ATOM   3095 N  N   . GLY B 1 167 ? -11.661 -18.272 2.367   1.00 18.69 ? 167 GLY B N   1 
ATOM   3096 C  CA  . GLY B 1 167 ? -12.475 -17.695 3.429   1.00 20.53 ? 167 GLY B CA  1 
ATOM   3097 C  C   . GLY B 1 167 ? -12.016 -17.886 4.861   1.00 22.26 ? 167 GLY B C   1 
ATOM   3098 O  O   . GLY B 1 167 ? -12.757 -17.528 5.780   1.00 27.86 ? 167 GLY B O   1 
ATOM   3099 N  N   . GLN B 1 168 ? -10.834 -18.437 5.076   1.00 16.52 ? 168 GLN B N   1 
ATOM   3100 C  CA  . GLN B 1 168 ? -10.335 -18.657 6.428   1.00 17.16 ? 168 GLN B CA  1 
ATOM   3101 C  C   . GLN B 1 168 ? -9.240  -17.645 6.769   1.00 19.30 ? 168 GLN B C   1 
ATOM   3102 O  O   . GLN B 1 168 ? -8.356  -17.388 5.950   1.00 20.79 ? 168 GLN B O   1 
ATOM   3103 C  CB  . GLN B 1 168 ? -9.758  -20.057 6.574   1.00 16.99 ? 168 GLN B CB  1 
ATOM   3104 C  CG  . GLN B 1 168 ? -10.788 -21.173 6.508   1.00 31.08 ? 168 GLN B CG  1 
ATOM   3105 C  CD  . GLN B 1 168 ? -10.186 -22.481 6.959   1.00 37.03 ? 168 GLN B CD  1 
ATOM   3106 O  OE1 . GLN B 1 168 ? -9.262  -22.506 7.815   1.00 42.65 ? 168 GLN B OE1 1 
ATOM   3107 N  NE2 . GLN B 1 168 ? -10.713 -23.588 6.432   1.00 40.15 ? 168 GLN B NE2 1 
ATOM   3108 N  N   . SER B 1 169 ? -9.283  -17.077 7.969   1.00 14.18 ? 169 SER B N   1 
ATOM   3109 C  CA  . SER B 1 169 ? -8.246  -16.086 8.321   1.00 14.22 ? 169 SER B CA  1 
ATOM   3110 C  C   . SER B 1 169 ? -6.899  -16.712 8.690   1.00 12.13 ? 169 SER B C   1 
ATOM   3111 O  O   . SER B 1 169 ? -6.836  -17.694 9.409   1.00 15.17 ? 169 SER B O   1 
ATOM   3112 C  CB  . SER B 1 169 ? -8.711  -15.205 9.496   1.00 15.79 ? 169 SER B CB  1 
ATOM   3113 O  OG  . SER B 1 169 ? -9.918  -14.569 9.126   1.00 23.24 ? 169 SER B OG  1 
ATOM   3114 N  N   . LEU B 1 170 ? -5.828  -16.104 8.179   1.00 12.30 ? 170 LEU B N   1 
ATOM   3115 C  CA  . LEU B 1 170 ? -4.481  -16.553 8.518   1.00 12.68 ? 170 LEU B CA  1 
ATOM   3116 C  C   . LEU B 1 170 ? -3.918  -15.460 9.436   1.00 13.42 ? 170 LEU B C   1 
ATOM   3117 O  O   . LEU B 1 170 ? -3.984  -14.264 9.096   1.00 12.38 ? 170 LEU B O   1 
ATOM   3118 C  CB  . LEU B 1 170 ? -3.609  -16.641 7.246   1.00 13.43 ? 170 LEU B CB  1 
ATOM   3119 C  CG  . LEU B 1 170 ? -2.208  -17.222 7.473   1.00 17.41 ? 170 LEU B CG  1 
ATOM   3120 C  CD1 . LEU B 1 170 ? -2.312  -18.732 7.769   1.00 14.53 ? 170 LEU B CD1 1 
ATOM   3121 C  CD2 . LEU B 1 170 ? -1.337  -16.986 6.249   1.00 14.83 ? 170 LEU B CD2 1 
ATOM   3122 N  N   . ASN B 1 171 ? -3.368  -15.863 10.578  1.00 13.16 ? 171 ASN B N   1 
ATOM   3123 C  CA  . ASN B 1 171 ? -2.728  -14.903 11.479  1.00 14.55 ? 171 ASN B CA  1 
ATOM   3124 C  C   . ASN B 1 171 ? -1.230  -15.010 11.269  1.00 12.54 ? 171 ASN B C   1 
ATOM   3125 O  O   . ASN B 1 171 ? -0.695  -16.102 11.250  1.00 15.00 ? 171 ASN B O   1 
ATOM   3126 C  CB  . ASN B 1 171 ? -3.113  -15.179 12.926  1.00 14.63 ? 171 ASN B CB  1 
ATOM   3127 C  CG  . ASN B 1 171 ? -4.424  -14.476 13.274  1.00 24.37 ? 171 ASN B CG  1 
ATOM   3128 O  OD1 . ASN B 1 171 ? -5.508  -14.969 12.969  1.00 31.39 ? 171 ASN B OD1 1 
ATOM   3129 N  ND2 . ASN B 1 171 ? -4.318  -13.276 13.820  1.00 22.14 ? 171 ASN B ND2 1 
ATOM   3130 N  N   . VAL B 1 172 ? -0.584  -13.865 11.122  1.00 11.79 ? 172 VAL B N   1 
ATOM   3131 C  CA  . VAL B 1 172 ? 0.852   -13.830 10.820  1.00 12.03 ? 172 VAL B CA  1 
ATOM   3132 C  C   . VAL B 1 172 ? 1.604   -12.931 11.771  1.00 12.48 ? 172 VAL B C   1 
ATOM   3133 O  O   . VAL B 1 172 ? 1.103   -11.854 12.143  1.00 14.81 ? 172 VAL B O   1 
ATOM   3134 C  CB  . VAL B 1 172 ? 1.069   -13.261 9.376   1.00 13.48 ? 172 VAL B CB  1 
ATOM   3135 C  CG1 . VAL B 1 172 ? 2.547   -13.354 8.981   1.00 15.67 ? 172 VAL B CG1 1 
ATOM   3136 C  CG2 . VAL B 1 172 ? 0.161   -14.043 8.322   1.00 10.48 ? 172 VAL B CG2 1 
ATOM   3137 N  N   . LEU B 1 173 ? 2.785   -13.389 12.178  1.00 13.06 ? 173 LEU B N   1 
ATOM   3138 C  CA  . LEU B 1 173 ? 3.658   -12.542 12.988  1.00 13.26 ? 173 LEU B CA  1 
ATOM   3139 C  C   . LEU B 1 173 ? 4.997   -12.466 12.217  1.00 13.49 ? 173 LEU B C   1 
ATOM   3140 O  O   . LEU B 1 173 ? 5.585   -13.520 11.924  1.00 14.32 ? 173 LEU B O   1 
ATOM   3141 C  CB  . LEU B 1 173 ? 3.901   -13.179 14.348  1.00 15.09 ? 173 LEU B CB  1 
ATOM   3142 C  CG  . LEU B 1 173 ? 4.840   -12.335 15.227  1.00 19.48 ? 173 LEU B CG  1 
ATOM   3143 C  CD1 . LEU B 1 173 ? 4.232   -10.953 15.503  1.00 22.43 ? 173 LEU B CD1 1 
ATOM   3144 C  CD2 . LEU B 1 173 ? 5.082   -13.080 16.501  1.00 22.07 ? 173 LEU B CD2 1 
ATOM   3145 N  N   . VAL B 1 174 ? 5.437   -11.256 11.875  1.00 11.96 ? 174 VAL B N   1 
ATOM   3146 C  CA  . VAL B 1 174 ? 6.721   -11.047 11.175  1.00 13.45 ? 174 VAL B CA  1 
ATOM   3147 C  C   . VAL B 1 174 ? 7.599   -10.280 12.166  1.00 15.48 ? 174 VAL B C   1 
ATOM   3148 O  O   . VAL B 1 174 ? 7.175   -9.236  12.684  1.00 16.19 ? 174 VAL B O   1 
ATOM   3149 C  CB  . VAL B 1 174 ? 6.557   -10.187 9.898   1.00 17.08 ? 174 VAL B CB  1 
ATOM   3150 C  CG1 . VAL B 1 174 ? 7.963   -9.960  9.243   1.00 17.66 ? 174 VAL B CG1 1 
ATOM   3151 C  CG2 . VAL B 1 174 ? 5.648   -10.917 8.883   1.00 16.60 ? 174 VAL B CG2 1 
ATOM   3152 N  N   . THR B 1 175 ? 8.790   -10.799 12.467  1.00 15.10 ? 175 THR B N   1 
ATOM   3153 C  CA  . THR B 1 175 ? 9.646   -10.074 13.409  1.00 17.17 ? 175 THR B CA  1 
ATOM   3154 C  C   . THR B 1 175 ? 11.054  -9.992  12.841  1.00 19.64 ? 175 THR B C   1 
ATOM   3155 O  O   . THR B 1 175 ? 11.458  -10.842 12.033  1.00 16.04 ? 175 THR B O   1 
ATOM   3156 C  CB  . THR B 1 175 ? 9.743   -10.766 14.762  1.00 18.65 ? 175 THR B CB  1 
ATOM   3157 O  OG1 . THR B 1 175 ? 10.387  -12.022 14.599  1.00 24.16 ? 175 THR B OG1 1 
ATOM   3158 C  CG2 . THR B 1 175 ? 8.371   -11.047 15.355  1.00 18.12 ? 175 THR B CG2 1 
ATOM   3159 N  N   . PHE B 1 176 ? 11.758  -8.928  13.225  1.00 18.72 ? 176 PHE B N   1 
ATOM   3160 C  CA  . PHE B 1 176 ? 13.151  -8.711  12.813  1.00 17.46 ? 176 PHE B CA  1 
ATOM   3161 C  C   . PHE B 1 176 ? 13.945  -8.439  14.088  1.00 19.10 ? 176 PHE B C   1 
ATOM   3162 O  O   . PHE B 1 176 ? 13.598  -7.543  14.859  1.00 18.55 ? 176 PHE B O   1 
ATOM   3163 C  CB  . PHE B 1 176 ? 13.282  -7.515  11.880  1.00 17.84 ? 176 PHE B CB  1 
ATOM   3164 C  CG  . PHE B 1 176 ? 14.705  -7.282  11.422  1.00 21.58 ? 176 PHE B CG  1 
ATOM   3165 C  CD1 . PHE B 1 176 ? 15.332  -8.205  10.579  1.00 20.80 ? 176 PHE B CD1 1 
ATOM   3166 C  CD2 . PHE B 1 176 ? 15.426  -6.173  11.862  1.00 21.56 ? 176 PHE B CD2 1 
ATOM   3167 C  CE1 . PHE B 1 176 ? 16.682  -8.029  10.174  1.00 26.29 ? 176 PHE B CE1 1 
ATOM   3168 C  CE2 . PHE B 1 176 ? 16.766  -5.988  11.460  1.00 23.38 ? 176 PHE B CE2 1 
ATOM   3169 C  CZ  . PHE B 1 176 ? 17.391  -6.923  10.614  1.00 24.20 ? 176 PHE B CZ  1 
ATOM   3170 N  N   . ASN B 1 177 ? 14.999  -9.229  14.320  1.00 17.09 ? 177 ASN B N   1 
ATOM   3171 C  CA  . ASN B 1 177 ? 15.844  -9.086  15.518  1.00 20.49 ? 177 ASN B CA  1 
ATOM   3172 C  C   . ASN B 1 177 ? 17.187  -8.594  14.953  1.00 22.50 ? 177 ASN B C   1 
ATOM   3173 O  O   . ASN B 1 177 ? 17.876  -9.355  14.267  1.00 21.98 ? 177 ASN B O   1 
ATOM   3174 C  CB  . ASN B 1 177 ? 16.042  -10.443 16.181  1.00 22.59 ? 177 ASN B CB  1 
ATOM   3175 C  CG  . ASN B 1 177 ? 16.954  -10.360 17.417  1.00 28.60 ? 177 ASN B CG  1 
ATOM   3176 O  OD1 . ASN B 1 177 ? 17.829  -9.503  17.494  1.00 32.31 ? 177 ASN B OD1 1 
ATOM   3177 N  ND2 . ASN B 1 177 ? 16.765  -11.263 18.352  1.00 31.21 ? 177 ASN B ND2 1 
ATOM   3178 N  N   . PRO B 1 178 ? 17.547  -7.322  15.199  1.00 21.66 ? 178 PRO B N   1 
ATOM   3179 C  CA  . PRO B 1 178 ? 18.800  -6.761  14.682  1.00 23.94 ? 178 PRO B CA  1 
ATOM   3180 C  C   . PRO B 1 178 ? 20.092  -7.389  15.187  1.00 24.47 ? 178 PRO B C   1 
ATOM   3181 O  O   . PRO B 1 178 ? 21.132  -7.240  14.549  1.00 27.77 ? 178 PRO B O   1 
ATOM   3182 C  CB  . PRO B 1 178 ? 18.674  -5.274  15.017  1.00 25.65 ? 178 PRO B CB  1 
ATOM   3183 C  CG  . PRO B 1 178 ? 17.895  -5.309  16.323  1.00 27.40 ? 178 PRO B CG  1 
ATOM   3184 C  CD  . PRO B 1 178 ? 16.791  -6.284  15.939  1.00 25.92 ? 178 PRO B CD  1 
ATOM   3185 N  N   . SER B 1 179 ? 20.030  -8.096  16.307  1.00 25.55 ? 179 SER B N   1 
ATOM   3186 C  CA  . SER B 1 179 ? 21.235  -8.725  16.838  1.00 31.67 ? 179 SER B CA  1 
ATOM   3187 C  C   . SER B 1 179 ? 21.641  -9.932  15.999  1.00 33.28 ? 179 SER B C   1 
ATOM   3188 O  O   . SER B 1 179 ? 22.825  -10.120 15.670  1.00 34.58 ? 179 SER B O   1 
ATOM   3189 C  CB  . SER B 1 179 ? 21.011  -9.144  18.276  1.00 31.59 ? 179 SER B CB  1 
ATOM   3190 O  OG  . SER B 1 179 ? 20.867  -7.987  19.075  1.00 43.40 ? 179 SER B OG  1 
ATOM   3191 N  N   . THR B 1 180 ? 20.651  -10.734 15.629  1.00 29.59 ? 180 THR B N   1 
ATOM   3192 C  CA  . THR B 1 180 ? 20.905  -11.924 14.816  1.00 26.77 ? 180 THR B CA  1 
ATOM   3193 C  C   . THR B 1 180 ? 20.670  -11.637 13.343  1.00 25.84 ? 180 THR B C   1 
ATOM   3194 O  O   . THR B 1 180 ? 21.100  -12.398 12.472  1.00 25.54 ? 180 THR B O   1 
ATOM   3195 C  CB  . THR B 1 180 ? 19.991  -13.059 15.252  1.00 26.50 ? 180 THR B CB  1 
ATOM   3196 O  OG1 . THR B 1 180 ? 18.627  -12.647 15.073  1.00 27.46 ? 180 THR B OG1 1 
ATOM   3197 C  CG2 . THR B 1 180 ? 20.226  -13.397 16.724  1.00 29.47 ? 180 THR B CG2 1 
ATOM   3198 N  N   . ARG B 1 181 ? 20.007  -10.518 13.068  1.00 18.88 ? 181 ARG B N   1 
ATOM   3199 C  CA  . ARG B 1 181 ? 19.647  -10.108 11.719  1.00 20.04 ? 181 ARG B CA  1 
ATOM   3200 C  C   . ARG B 1 181 ? 18.675  -11.118 11.099  1.00 19.07 ? 181 ARG B C   1 
ATOM   3201 O  O   . ARG B 1 181 ? 18.601  -11.231 9.895   1.00 22.34 ? 181 ARG B O   1 
ATOM   3202 C  CB  . ARG B 1 181 ? 20.871  -9.958  10.808  1.00 25.20 ? 181 ARG B CB  1 
ATOM   3203 C  CG  . ARG B 1 181 ? 21.742  -8.749  11.133  1.00 26.34 ? 181 ARG B CG  1 
ATOM   3204 C  CD  . ARG B 1 181 ? 22.877  -8.620  10.144  1.00 34.79 ? 181 ARG B CD  1 
ATOM   3205 N  NE  . ARG B 1 181 ? 23.673  -7.428  10.405  1.00 46.71 ? 181 ARG B NE  1 
ATOM   3206 N  N   . ASN B 1 182 ? 17.934  -11.838 11.930  1.00 19.46 ? 182 ASN B N   1 
ATOM   3207 C  CA  . ASN B 1 182 ? 16.958  -12.784 11.385  1.00 16.63 ? 182 ASN B CA  1 
ATOM   3208 C  C   . ASN B 1 182 ? 15.591  -12.125 11.200  1.00 19.53 ? 182 ASN B C   1 
ATOM   3209 O  O   . ASN B 1 182 ? 15.087  -11.420 12.112  1.00 18.03 ? 182 ASN B O   1 
ATOM   3210 C  CB  . ASN B 1 182 ? 16.741  -13.965 12.298  1.00 21.05 ? 182 ASN B CB  1 
ATOM   3211 C  CG  . ASN B 1 182 ? 17.888  -14.975 12.275  1.00 32.33 ? 182 ASN B CG  1 
ATOM   3212 O  OD1 . ASN B 1 182 ? 17.775  -16.040 12.878  1.00 35.14 ? 182 ASN B OD1 1 
ATOM   3213 N  ND2 . ASN B 1 182 ? 18.980  -14.647 11.602  1.00 31.63 ? 182 ASN B ND2 1 
ATOM   3214 N  N   . LEU B 1 183 ? 14.999  -12.367 10.039  1.00 15.33 ? 183 LEU B N   1 
ATOM   3215 C  CA  . LEU B 1 183 ? 13.638  -11.908 9.749   1.00 15.37 ? 183 LEU B CA  1 
ATOM   3216 C  C   . LEU B 1 183 ? 12.866  -13.231 9.882   1.00 19.12 ? 183 LEU B C   1 
ATOM   3217 O  O   . LEU B 1 183 ? 13.109  -14.168 9.114   1.00 18.28 ? 183 LEU B O   1 
ATOM   3218 C  CB  . LEU B 1 183 ? 13.537  -11.363 8.328   1.00 16.31 ? 183 LEU B CB  1 
ATOM   3219 C  CG  . LEU B 1 183 ? 12.096  -10.960 7.932   1.00 21.05 ? 183 LEU B CG  1 
ATOM   3220 C  CD1 . LEU B 1 183 ? 11.692  -9.712  8.696   1.00 21.26 ? 183 LEU B CD1 1 
ATOM   3221 C  CD2 . LEU B 1 183 ? 11.989  -10.670 6.465   1.00 24.40 ? 183 LEU B CD2 1 
ATOM   3222 N  N   . ASP B 1 184 ? 11.974  -13.340 10.874  1.00 15.89 ? 184 ASP B N   1 
ATOM   3223 C  CA  . ASP B 1 184 ? 11.231  -14.569 11.092  1.00 14.84 ? 184 ASP B CA  1 
ATOM   3224 C  C   . ASP B 1 184 ? 9.757   -14.380 10.739  1.00 17.60 ? 184 ASP B C   1 
ATOM   3225 O  O   . ASP B 1 184 ? 9.174   -13.329 11.031  1.00 16.44 ? 184 ASP B O   1 
ATOM   3226 C  CB  . ASP B 1 184 ? 11.274  -14.998 12.560  1.00 17.59 ? 184 ASP B CB  1 
ATOM   3227 C  CG  . ASP B 1 184 ? 12.642  -15.426 13.020  1.00 27.90 ? 184 ASP B CG  1 
ATOM   3228 O  OD1 . ASP B 1 184 ? 13.397  -16.035 12.239  1.00 28.90 ? 184 ASP B OD1 1 
ATOM   3229 O  OD2 . ASP B 1 184 ? 12.947  -15.195 14.198  1.00 31.90 ? 184 ASP B OD2 1 
ATOM   3230 N  N   . VAL B 1 185 ? 9.158   -15.394 10.130  1.00 14.03 ? 185 VAL B N   1 
ATOM   3231 C  CA  . VAL B 1 185 ? 7.731   -15.311 9.793   1.00 14.93 ? 185 VAL B CA  1 
ATOM   3232 C  C   . VAL B 1 185 ? 7.057   -16.541 10.381  1.00 16.31 ? 185 VAL B C   1 
ATOM   3233 O  O   . VAL B 1 185 ? 7.540   -17.683 10.181  1.00 15.45 ? 185 VAL B O   1 
ATOM   3234 C  CB  . VAL B 1 185 ? 7.499   -15.338 8.240   1.00 17.25 ? 185 VAL B CB  1 
ATOM   3235 C  CG1 . VAL B 1 185 ? 5.992   -15.357 7.937   1.00 16.34 ? 185 VAL B CG1 1 
ATOM   3236 C  CG2 . VAL B 1 185 ? 8.163   -14.111 7.579   1.00 19.03 ? 185 VAL B CG2 1 
ATOM   3237 N  N   . VAL B 1 186 ? 5.944   -16.339 11.102  1.00 13.88 ? 186 VAL B N   1 
ATOM   3238 C  CA  . VAL B 1 186 ? 5.197   -17.470 11.649  1.00 15.15 ? 186 VAL B CA  1 
ATOM   3239 C  C   . VAL B 1 186 ? 3.730   -17.202 11.274  1.00 15.84 ? 186 VAL B C   1 
ATOM   3240 O  O   . VAL B 1 186 ? 3.231   -16.136 11.577  1.00 14.73 ? 186 VAL B O   1 
ATOM   3241 C  CB  . VAL B 1 186 ? 5.264   -17.570 13.182  1.00 17.08 ? 186 VAL B CB  1 
ATOM   3242 C  CG1 . VAL B 1 186 ? 4.426   -18.775 13.657  1.00 20.05 ? 186 VAL B CG1 1 
ATOM   3243 C  CG2 . VAL B 1 186 ? 6.705   -17.745 13.643  1.00 22.26 ? 186 VAL B CG2 1 
ATOM   3244 N  N   . ALA B 1 187 ? 3.066   -18.155 10.622  1.00 11.07 ? 187 ALA B N   1 
ATOM   3245 C  CA  . ALA B 1 187 ? 1.668   -17.946 10.217  1.00 14.19 ? 187 ALA B CA  1 
ATOM   3246 C  C   . ALA B 1 187 ? 0.853   -19.143 10.700  1.00 14.90 ? 187 ALA B C   1 
ATOM   3247 O  O   . ALA B 1 187 ? 1.332   -20.288 10.648  1.00 14.45 ? 187 ALA B O   1 
ATOM   3248 C  CB  . ALA B 1 187 ? 1.563   -17.836 8.664   1.00 15.03 ? 187 ALA B CB  1 
ATOM   3249 N  N   . THR B 1 188 ? -0.377  -18.887 11.145  1.00 13.86 ? 188 THR B N   1 
ATOM   3250 C  CA  . THR B 1 188 ? -1.200  -19.987 11.639  1.00 13.33 ? 188 THR B CA  1 
ATOM   3251 C  C   . THR B 1 188 ? -2.653  -19.824 11.229  1.00 13.87 ? 188 THR B C   1 
ATOM   3252 O  O   . THR B 1 188 ? -3.160  -18.705 11.082  1.00 13.83 ? 188 THR B O   1 
ATOM   3253 C  CB  . THR B 1 188 ? -1.195  -20.057 13.196  1.00 17.84 ? 188 THR B CB  1 
ATOM   3254 O  OG1 . THR B 1 188 ? -1.616  -18.778 13.718  1.00 18.63 ? 188 THR B OG1 1 
ATOM   3255 C  CG2 . THR B 1 188 ? 0.238   -20.356 13.732  1.00 19.37 ? 188 THR B CG2 1 
ATOM   3256 N  N   . TYR B 1 189 ? -3.304  -20.968 11.015  1.00 14.74 ? 189 TYR B N   1 
ATOM   3257 C  CA  . TYR B 1 189 ? -4.739  -20.971 10.770  1.00 13.31 ? 189 TYR B CA  1 
ATOM   3258 C  C   . TYR B 1 189 ? -5.372  -21.290 12.144  1.00 15.89 ? 189 TYR B C   1 
ATOM   3259 O  O   . TYR B 1 189 ? -4.686  -21.745 13.067  1.00 19.00 ? 189 TYR B O   1 
ATOM   3260 C  CB  . TYR B 1 189 ? -5.159  -22.053 9.748   1.00 14.73 ? 189 TYR B CB  1 
ATOM   3261 C  CG  . TYR B 1 189 ? -4.912  -21.621 8.322   1.00 13.34 ? 189 TYR B CG  1 
ATOM   3262 C  CD1 . TYR B 1 189 ? -3.979  -22.289 7.508   1.00 12.95 ? 189 TYR B CD1 1 
ATOM   3263 C  CD2 . TYR B 1 189 ? -5.630  -20.558 7.776   1.00 13.21 ? 189 TYR B CD2 1 
ATOM   3264 C  CE1 . TYR B 1 189 ? -3.797  -21.880 6.162   1.00 12.48 ? 189 TYR B CE1 1 
ATOM   3265 C  CE2 . TYR B 1 189 ? -5.447  -20.138 6.425   1.00 15.74 ? 189 TYR B CE2 1 
ATOM   3266 C  CZ  . TYR B 1 189 ? -4.523  -20.824 5.641   1.00 16.62 ? 189 TYR B CZ  1 
ATOM   3267 O  OH  . TYR B 1 189 ? -4.339  -20.424 4.349   1.00 16.83 ? 189 TYR B OH  1 
ATOM   3268 N  N   . SER B 1 190 ? -6.680  -21.091 12.255  1.00 16.19 ? 190 SER B N   1 
ATOM   3269 C  CA  . SER B 1 190 ? -7.346  -21.276 13.546  1.00 18.57 ? 190 SER B CA  1 
ATOM   3270 C  C   . SER B 1 190 ? -7.390  -22.705 14.066  1.00 19.78 ? 190 SER B C   1 
ATOM   3271 O  O   . SER B 1 190 ? -7.749  -22.921 15.214  1.00 24.59 ? 190 SER B O   1 
ATOM   3272 C  CB  . SER B 1 190 ? -8.748  -20.694 13.474  1.00 20.28 ? 190 SER B CB  1 
ATOM   3273 O  OG  . SER B 1 190 ? -9.523  -21.544 12.664  1.00 25.64 ? 190 SER B OG  1 
ATOM   3274 N  N   . ASP B 1 191 ? -7.064  -23.693 13.236  1.00 17.28 ? 191 ASP B N   1 
ATOM   3275 C  CA  . ASP B 1 191 ? -7.033  -25.068 13.736  1.00 20.39 ? 191 ASP B CA  1 
ATOM   3276 C  C   . ASP B 1 191 ? -5.639  -25.447 14.209  1.00 20.45 ? 191 ASP B C   1 
ATOM   3277 O  O   . ASP B 1 191 ? -5.376  -26.617 14.487  1.00 21.90 ? 191 ASP B O   1 
ATOM   3278 C  CB  . ASP B 1 191 ? -7.461  -26.055 12.650  1.00 23.71 ? 191 ASP B CB  1 
ATOM   3279 C  CG  . ASP B 1 191 ? -6.530  -26.060 11.444  1.00 28.90 ? 191 ASP B CG  1 
ATOM   3280 O  OD1 . ASP B 1 191 ? -5.522  -25.304 11.414  1.00 24.77 ? 191 ASP B OD1 1 
ATOM   3281 O  OD2 . ASP B 1 191 ? -6.814  -26.835 10.505  1.00 30.55 ? 191 ASP B OD2 1 
ATOM   3282 N  N   . GLY B 1 192 ? -4.731  -24.467 14.263  1.00 23.45 ? 192 GLY B N   1 
ATOM   3283 C  CA  . GLY B 1 192 ? -3.373  -24.734 14.721  1.00 22.26 ? 192 GLY B CA  1 
ATOM   3284 C  C   . GLY B 1 192 ? -2.333  -25.082 13.664  1.00 24.76 ? 192 GLY B C   1 
ATOM   3285 O  O   . GLY B 1 192 ? -1.153  -25.270 14.000  1.00 24.23 ? 192 GLY B O   1 
ATOM   3286 N  N   . THR B 1 193 ? -2.740  -25.172 12.393  1.00 20.67 ? 193 THR B N   1 
ATOM   3287 C  CA  . THR B 1 193 ? -1.778  -25.498 11.330  1.00 17.32 ? 193 THR B CA  1 
ATOM   3288 C  C   . THR B 1 193 ? -0.814  -24.318 11.287  1.00 18.88 ? 193 THR B C   1 
ATOM   3289 O  O   . THR B 1 193 ? -1.241  -23.169 11.220  1.00 18.67 ? 193 THR B O   1 
ATOM   3290 C  CB  . THR B 1 193 ? -2.498  -25.627 9.991   1.00 20.08 ? 193 THR B CB  1 
ATOM   3291 O  OG1 . THR B 1 193 ? -3.491  -26.653 10.102  1.00 21.40 ? 193 THR B OG1 1 
ATOM   3292 C  CG2 . THR B 1 193 ? -1.497  -25.949 8.872   1.00 18.33 ? 193 THR B CG2 1 
ATOM   3293 N  N   . ARG B 1 194 ? 0.482   -24.603 11.283  1.00 18.29 ? 194 ARG B N   1 
ATOM   3294 C  CA  . ARG B 1 194 ? 1.495   -23.558 11.385  1.00 17.32 ? 194 ARG B CA  1 
ATOM   3295 C  C   . ARG B 1 194 ? 2.524   -23.630 10.272  1.00 18.04 ? 194 ARG B C   1 
ATOM   3296 O  O   . ARG B 1 194 ? 2.857   -24.731 9.817   1.00 18.48 ? 194 ARG B O   1 
ATOM   3297 C  CB  . ARG B 1 194 ? 2.182   -23.743 12.752  1.00 20.94 ? 194 ARG B CB  1 
ATOM   3298 C  CG  . ARG B 1 194 ? 3.311   -22.764 13.094  1.00 28.66 ? 194 ARG B CG  1 
ATOM   3299 C  CD  . ARG B 1 194 ? 4.094   -23.210 14.368  1.00 33.54 ? 194 ARG B CD  1 
ATOM   3300 N  NE  . ARG B 1 194 ? 4.682   -24.566 14.254  1.00 45.58 ? 194 ARG B NE  1 
ATOM   3301 C  CZ  . ARG B 1 194 ? 5.518   -25.014 13.285  1.00 47.47 ? 194 ARG B CZ  1 
ATOM   3302 N  NH1 . ARG B 1 194 ? 5.972   -26.278 13.321  1.00 49.43 ? 194 ARG B NH1 1 
ATOM   3303 N  NH2 . ARG B 1 194 ? 5.888   -24.242 12.245  1.00 49.34 ? 194 ARG B NH2 1 
ATOM   3304 N  N   . TYR B 1 195 ? 3.000   -22.464 9.826   1.00 14.65 ? 195 TYR B N   1 
ATOM   3305 C  CA  . TYR B 1 195 ? 4.034   -22.339 8.788   1.00 13.25 ? 195 TYR B CA  1 
ATOM   3306 C  C   . TYR B 1 195 ? 5.102   -21.411 9.352   1.00 18.38 ? 195 TYR B C   1 
ATOM   3307 O  O   . TYR B 1 195 ? 4.774   -20.386 9.985   1.00 16.94 ? 195 TYR B O   1 
ATOM   3308 C  CB  . TYR B 1 195 ? 3.484   -21.718 7.494   1.00 11.40 ? 195 TYR B CB  1 
ATOM   3309 C  CG  . TYR B 1 195 ? 2.235   -22.414 7.003   1.00 16.99 ? 195 TYR B CG  1 
ATOM   3310 C  CD1 . TYR B 1 195 ? 0.972   -22.015 7.459   1.00 17.74 ? 195 TYR B CD1 1 
ATOM   3311 C  CD2 . TYR B 1 195 ? 2.307   -23.533 6.139   1.00 18.34 ? 195 TYR B CD2 1 
ATOM   3312 C  CE1 . TYR B 1 195 ? -0.191  -22.699 7.071   1.00 19.41 ? 195 TYR B CE1 1 
ATOM   3313 C  CE2 . TYR B 1 195 ? 1.150   -24.222 5.745   1.00 20.37 ? 195 TYR B CE2 1 
ATOM   3314 C  CZ  . TYR B 1 195 ? -0.095  -23.791 6.214   1.00 18.53 ? 195 TYR B CZ  1 
ATOM   3315 O  OH  . TYR B 1 195 ? -1.254  -24.386 5.792   1.00 22.16 ? 195 TYR B OH  1 
ATOM   3316 N  N   . GLU B 1 196 ? 6.371   -21.750 9.124   1.00 15.93 ? 196 GLU B N   1 
ATOM   3317 C  CA  . GLU B 1 196 ? 7.468   -20.932 9.631   1.00 16.00 ? 196 GLU B CA  1 
ATOM   3318 C  C   . GLU B 1 196 ? 8.582   -20.810 8.594   1.00 18.49 ? 196 GLU B C   1 
ATOM   3319 O  O   . GLU B 1 196 ? 8.916   -21.788 7.927   1.00 18.98 ? 196 GLU B O   1 
ATOM   3320 C  CB  . GLU B 1 196 ? 8.093   -21.560 10.876  1.00 19.27 ? 196 GLU B CB  1 
ATOM   3321 C  CG  . GLU B 1 196 ? 7.161   -21.696 12.077  1.00 29.43 ? 196 GLU B CG  1 
ATOM   3322 N  N   . VAL B 1 197 ? 9.141   -19.615 8.456   1.00 16.74 ? 197 VAL B N   1 
ATOM   3323 C  CA  . VAL B 1 197 ? 10.257  -19.420 7.539   1.00 16.31 ? 197 VAL B CA  1 
ATOM   3324 C  C   . VAL B 1 197 ? 11.108  -18.270 8.074   1.00 20.63 ? 197 VAL B C   1 
ATOM   3325 O  O   . VAL B 1 197 ? 10.580  -17.279 8.601   1.00 18.74 ? 197 VAL B O   1 
ATOM   3326 C  CB  . VAL B 1 197 ? 9.769   -19.184 6.074   1.00 22.54 ? 197 VAL B CB  1 
ATOM   3327 C  CG1 . VAL B 1 197 ? 8.945   -17.916 5.965   1.00 21.10 ? 197 VAL B CG1 1 
ATOM   3328 C  CG2 . VAL B 1 197 ? 10.963  -19.143 5.124   1.00 24.11 ? 197 VAL B CG2 1 
ATOM   3329 N  N   . SER B 1 198 ? 12.436  -18.413 7.976   1.00 15.59 ? 198 SER B N   1 
ATOM   3330 C  CA  . SER B 1 198 ? 13.341  -17.378 8.500   1.00 16.51 ? 198 SER B CA  1 
ATOM   3331 C  C   . SER B 1 198 ? 14.474  -17.097 7.516   1.00 20.03 ? 198 SER B C   1 
ATOM   3332 O  O   . SER B 1 198 ? 14.889  -17.984 6.775   1.00 17.57 ? 198 SER B O   1 
ATOM   3333 C  CB  . SER B 1 198 ? 13.954  -17.841 9.816   1.00 16.21 ? 198 SER B CB  1 
ATOM   3334 O  OG  A SER B 1 198 ? 14.977  -16.960 10.259  0.50 17.41 ? 198 SER B OG  1 
ATOM   3335 O  OG  B SER B 1 198 ? 12.972  -18.158 10.783  0.50 22.15 ? 198 SER B OG  1 
ATOM   3336 N  N   . TYR B 1 199 ? 14.973  -15.869 7.521   1.00 17.10 ? 199 TYR B N   1 
ATOM   3337 C  CA  . TYR B 1 199 ? 16.050  -15.505 6.628   1.00 17.50 ? 199 TYR B CA  1 
ATOM   3338 C  C   . TYR B 1 199 ? 16.929  -14.481 7.295   1.00 20.24 ? 199 TYR B C   1 
ATOM   3339 O  O   . TYR B 1 199 ? 16.415  -13.604 7.998   1.00 20.33 ? 199 TYR B O   1 
ATOM   3340 C  CB  . TYR B 1 199 ? 15.487  -14.906 5.349   1.00 17.97 ? 199 TYR B CB  1 
ATOM   3341 C  CG  . TYR B 1 199 ? 16.538  -14.584 4.304   1.00 20.03 ? 199 TYR B CG  1 
ATOM   3342 C  CD1 . TYR B 1 199 ? 16.775  -13.259 3.922   1.00 20.75 ? 199 TYR B CD1 1 
ATOM   3343 C  CD2 . TYR B 1 199 ? 17.249  -15.598 3.653   1.00 21.28 ? 199 TYR B CD2 1 
ATOM   3344 C  CE1 . TYR B 1 199 ? 17.687  -12.943 2.898   1.00 26.52 ? 199 TYR B CE1 1 
ATOM   3345 C  CE2 . TYR B 1 199 ? 18.164  -15.288 2.632   1.00 18.54 ? 199 TYR B CE2 1 
ATOM   3346 C  CZ  . TYR B 1 199 ? 18.369  -13.967 2.259   1.00 23.69 ? 199 TYR B CZ  1 
ATOM   3347 O  OH  . TYR B 1 199 ? 19.205  -13.632 1.220   1.00 24.91 ? 199 TYR B OH  1 
ATOM   3348 N  N   . GLU B 1 200 ? 18.239  -14.577 7.082   1.00 16.94 ? 200 GLU B N   1 
ATOM   3349 C  CA  . GLU B 1 200 ? 19.138  -13.589 7.671   1.00 18.88 ? 200 GLU B CA  1 
ATOM   3350 C  C   . GLU B 1 200 ? 19.391  -12.491 6.652   1.00 20.90 ? 200 GLU B C   1 
ATOM   3351 O  O   . GLU B 1 200 ? 19.810  -12.767 5.518   1.00 21.72 ? 200 GLU B O   1 
ATOM   3352 C  CB  . GLU B 1 200 ? 20.472  -14.240 8.056   1.00 24.01 ? 200 GLU B CB  1 
ATOM   3353 C  CG  . GLU B 1 200 ? 21.394  -13.303 8.856   1.00 30.37 ? 200 GLU B CG  1 
ATOM   3354 C  CD  . GLU B 1 200 ? 22.791  -13.905 9.117   1.00 35.14 ? 200 GLU B CD  1 
ATOM   3355 O  OE1 . GLU B 1 200 ? 22.906  -15.126 9.284   1.00 34.52 ? 200 GLU B OE1 1 
ATOM   3356 O  OE2 . GLU B 1 200 ? 23.772  -13.137 9.182   1.00 43.15 ? 200 GLU B OE2 1 
ATOM   3357 N  N   . VAL B 1 201 ? 19.133  -11.238 7.034   1.00 20.28 ? 201 VAL B N   1 
ATOM   3358 C  CA  . VAL B 1 201 ? 19.336  -10.136 6.132   1.00 22.19 ? 201 VAL B CA  1 
ATOM   3359 C  C   . VAL B 1 201 ? 19.722  -8.872  6.901   1.00 25.85 ? 201 VAL B C   1 
ATOM   3360 O  O   . VAL B 1 201 ? 19.147  -8.580  7.946   1.00 22.50 ? 201 VAL B O   1 
ATOM   3361 C  CB  . VAL B 1 201 ? 18.060  -9.862  5.283   1.00 24.73 ? 201 VAL B CB  1 
ATOM   3362 C  CG1 . VAL B 1 201 ? 16.845  -9.626  6.198   1.00 26.05 ? 201 VAL B CG1 1 
ATOM   3363 C  CG2 . VAL B 1 201 ? 18.284  -8.681  4.380   1.00 27.23 ? 201 VAL B CG2 1 
ATOM   3364 N  N   . ASP B 1 202 ? 20.714  -8.144  6.380   1.00 23.94 ? 202 ASP B N   1 
ATOM   3365 C  CA  . ASP B 1 202 ? 21.156  -6.886  7.001   1.00 26.08 ? 202 ASP B CA  1 
ATOM   3366 C  C   . ASP B 1 202 ? 20.276  -5.842  6.335   1.00 22.53 ? 202 ASP B C   1 
ATOM   3367 O  O   . ASP B 1 202 ? 20.498  -5.496  5.169   1.00 22.15 ? 202 ASP B O   1 
ATOM   3368 C  CB  . ASP B 1 202 ? 22.615  -6.594  6.639   1.00 27.29 ? 202 ASP B CB  1 
ATOM   3369 C  CG  . ASP B 1 202 ? 23.165  -5.393  7.376   1.00 36.23 ? 202 ASP B CG  1 
ATOM   3370 O  OD1 . ASP B 1 202 ? 22.373  -4.514  7.788   1.00 31.64 ? 202 ASP B OD1 1 
ATOM   3371 O  OD2 . ASP B 1 202 ? 24.407  -5.319  7.519   1.00 42.50 ? 202 ASP B OD2 1 
ATOM   3372 N  N   . VAL B 1 203 ? 19.256  -5.350  7.039   1.00 22.03 ? 203 VAL B N   1 
ATOM   3373 C  CA  . VAL B 1 203 ? 18.360  -4.393  6.400   1.00 21.55 ? 203 VAL B CA  1 
ATOM   3374 C  C   . VAL B 1 203 ? 19.074  -3.090  5.991   1.00 21.45 ? 203 VAL B C   1 
ATOM   3375 O  O   . VAL B 1 203 ? 18.617  -2.400  5.096   1.00 21.24 ? 203 VAL B O   1 
ATOM   3376 C  CB  . VAL B 1 203 ? 17.131  -4.075  7.313   1.00 20.04 ? 203 VAL B CB  1 
ATOM   3377 C  CG1 . VAL B 1 203 ? 16.382  -5.384  7.630   1.00 20.11 ? 203 VAL B CG1 1 
ATOM   3378 C  CG2 . VAL B 1 203 ? 17.584  -3.389  8.626   1.00 28.10 ? 203 VAL B CG2 1 
ATOM   3379 N  N   . ARG B 1 204 ? 20.201  -2.791  6.629   1.00 24.12 ? 204 ARG B N   1 
ATOM   3380 C  CA  . ARG B 1 204 ? 20.944  -1.568  6.338   1.00 26.28 ? 204 ARG B CA  1 
ATOM   3381 C  C   . ARG B 1 204 ? 21.517  -1.543  4.925   1.00 28.21 ? 204 ARG B C   1 
ATOM   3382 O  O   . ARG B 1 204 ? 21.750  -0.475  4.385   1.00 31.21 ? 204 ARG B O   1 
ATOM   3383 C  CB  . ARG B 1 204 ? 22.107  -1.367  7.336   1.00 30.07 ? 204 ARG B CB  1 
ATOM   3384 C  CG  . ARG B 1 204 ? 21.739  -1.325  8.792   1.00 31.15 ? 204 ARG B CG  1 
ATOM   3385 C  CD  . ARG B 1 204 ? 23.000  -1.150  9.643   1.00 31.81 ? 204 ARG B CD  1 
ATOM   3386 N  NE  . ARG B 1 204 ? 23.918  -2.273  9.495   1.00 32.54 ? 204 ARG B NE  1 
ATOM   3387 N  N   . SER B 1 205 ? 21.734  -2.709  4.318   1.00 28.89 ? 205 SER B N   1 
ATOM   3388 C  CA  . SER B 1 205 ? 22.287  -2.732  2.971   1.00 31.59 ? 205 SER B CA  1 
ATOM   3389 C  C   . SER B 1 205 ? 21.212  -2.787  1.900   1.00 31.04 ? 205 SER B C   1 
ATOM   3390 O  O   . SER B 1 205 ? 21.501  -2.728  0.709   1.00 31.53 ? 205 SER B O   1 
ATOM   3391 C  CB  . SER B 1 205 ? 23.237  -3.920  2.804   1.00 34.11 ? 205 SER B CB  1 
ATOM   3392 O  OG  . SER B 1 205 ? 22.538  -5.144  2.862   1.00 41.64 ? 205 SER B OG  1 
ATOM   3393 N  N   . VAL B 1 206 ? 19.958  -2.867  2.335   1.00 25.78 ? 206 VAL B N   1 
ATOM   3394 C  CA  . VAL B 1 206 ? 18.847  -2.953  1.408   1.00 23.26 ? 206 VAL B CA  1 
ATOM   3395 C  C   . VAL B 1 206 ? 17.916  -1.751  1.387   1.00 19.32 ? 206 VAL B C   1 
ATOM   3396 O  O   . VAL B 1 206 ? 17.413  -1.331  0.327   1.00 23.68 ? 206 VAL B O   1 
ATOM   3397 C  CB  . VAL B 1 206 ? 17.972  -4.198  1.743   1.00 26.15 ? 206 VAL B CB  1 
ATOM   3398 C  CG1 . VAL B 1 206 ? 16.770  -4.228  0.831   1.00 28.20 ? 206 VAL B CG1 1 
ATOM   3399 C  CG2 . VAL B 1 206 ? 18.796  -5.461  1.637   1.00 32.86 ? 206 VAL B CG2 1 
ATOM   3400 N  N   . LEU B 1 207 ? 17.681  -1.182  2.564   1.00 21.25 ? 207 LEU B N   1 
ATOM   3401 C  CA  . LEU B 1 207 ? 16.733  -0.095  2.679   1.00 19.82 ? 207 LEU B CA  1 
ATOM   3402 C  C   . LEU B 1 207 ? 17.294  1.202   3.270   1.00 20.69 ? 207 LEU B C   1 
ATOM   3403 O  O   . LEU B 1 207 ? 18.303  1.182   3.977   1.00 21.39 ? 207 LEU B O   1 
ATOM   3404 C  CB  . LEU B 1 207 ? 15.571  -0.571  3.568   1.00 19.98 ? 207 LEU B CB  1 
ATOM   3405 C  CG  . LEU B 1 207 ? 14.644  -1.674  3.026   1.00 22.07 ? 207 LEU B CG  1 
ATOM   3406 C  CD1 . LEU B 1 207 ? 13.881  -2.308  4.169   1.00 21.77 ? 207 LEU B CD1 1 
ATOM   3407 C  CD2 . LEU B 1 207 ? 13.702  -1.110  1.994   1.00 23.52 ? 207 LEU B CD2 1 
ATOM   3408 N  N   . PRO B 1 208 ? 16.664  2.337   2.966   1.00 22.39 ? 208 PRO B N   1 
ATOM   3409 C  CA  . PRO B 1 208 ? 17.168  3.593   3.542   1.00 23.12 ? 208 PRO B CA  1 
ATOM   3410 C  C   . PRO B 1 208 ? 16.806  3.675   5.046   1.00 26.04 ? 208 PRO B C   1 
ATOM   3411 O  O   . PRO B 1 208 ? 16.024  2.851   5.569   1.00 20.13 ? 208 PRO B O   1 
ATOM   3412 C  CB  . PRO B 1 208 ? 16.460  4.651   2.705   1.00 22.21 ? 208 PRO B CB  1 
ATOM   3413 C  CG  . PRO B 1 208 ? 15.116  3.970   2.416   1.00 25.85 ? 208 PRO B CG  1 
ATOM   3414 C  CD  . PRO B 1 208 ? 15.574  2.611   2.010   1.00 23.00 ? 208 PRO B CD  1 
ATOM   3415 N  N   . GLU B 1 209 ? 17.371  4.667   5.739   1.00 23.33 ? 209 GLU B N   1 
ATOM   3416 C  CA  . GLU B 1 209 ? 17.146  4.839   7.171   1.00 21.73 ? 209 GLU B CA  1 
ATOM   3417 C  C   . GLU B 1 209 ? 15.692  4.998   7.570   1.00 19.14 ? 209 GLU B C   1 
ATOM   3418 O  O   . GLU B 1 209 ? 15.293  4.518   8.624   1.00 19.55 ? 209 GLU B O   1 
ATOM   3419 C  CB  . GLU B 1 209 ? 17.918  6.058   7.692   1.00 22.66 ? 209 GLU B CB  1 
ATOM   3420 C  CG  . GLU B 1 209 ? 19.432  5.861   7.555   1.00 29.13 ? 209 GLU B CG  1 
ATOM   3421 C  CD  . GLU B 1 209 ? 20.222  7.110   7.916   1.00 33.80 ? 209 GLU B CD  1 
ATOM   3422 O  OE1 . GLU B 1 209 ? 20.553  7.294   9.106   1.00 35.64 ? 209 GLU B OE1 1 
ATOM   3423 O  OE2 . GLU B 1 209 ? 20.480  7.900   6.992   1.00 38.09 ? 209 GLU B OE2 1 
ATOM   3424 N  N   . TRP B 1 210 ? 14.939  5.733   6.771   1.00 17.65 ? 210 TRP B N   1 
ATOM   3425 C  CA  . TRP B 1 210 ? 13.522  5.921   7.047   1.00 20.52 ? 210 TRP B CA  1 
ATOM   3426 C  C   . TRP B 1 210 ? 12.715  5.222   5.958   1.00 20.05 ? 210 TRP B C   1 
ATOM   3427 O  O   . TRP B 1 210 ? 13.028  5.342   4.773   1.00 17.35 ? 210 TRP B O   1 
ATOM   3428 C  CB  . TRP B 1 210 ? 13.154  7.394   7.067   1.00 21.87 ? 210 TRP B CB  1 
ATOM   3429 C  CG  . TRP B 1 210 ? 13.762  8.161   8.205   1.00 25.82 ? 210 TRP B CG  1 
ATOM   3430 C  CD1 . TRP B 1 210 ? 15.003  8.753   8.242   1.00 28.64 ? 210 TRP B CD1 1 
ATOM   3431 C  CD2 . TRP B 1 210 ? 13.135  8.460   9.460   1.00 24.69 ? 210 TRP B CD2 1 
ATOM   3432 N  NE1 . TRP B 1 210 ? 15.175  9.411   9.446   1.00 25.60 ? 210 TRP B NE1 1 
ATOM   3433 C  CE2 . TRP B 1 210 ? 14.047  9.249   10.207  1.00 26.08 ? 210 TRP B CE2 1 
ATOM   3434 C  CE3 . TRP B 1 210 ? 11.888  8.143   10.025  1.00 20.65 ? 210 TRP B CE3 1 
ATOM   3435 C  CZ2 . TRP B 1 210 ? 13.751  9.728   11.487  1.00 24.68 ? 210 TRP B CZ2 1 
ATOM   3436 C  CZ3 . TRP B 1 210 ? 11.588  8.622   11.298  1.00 23.86 ? 210 TRP B CZ3 1 
ATOM   3437 C  CH2 . TRP B 1 210 ? 12.523  9.411   12.016  1.00 25.99 ? 210 TRP B CH2 1 
ATOM   3438 N  N   . VAL B 1 211 ? 11.653  4.521   6.359   1.00 19.19 ? 211 VAL B N   1 
ATOM   3439 C  CA  . VAL B 1 211 ? 10.843  3.773   5.388   1.00 18.52 ? 211 VAL B CA  1 
ATOM   3440 C  C   . VAL B 1 211 ? 9.372   3.849   5.736   1.00 20.12 ? 211 VAL B C   1 
ATOM   3441 O  O   . VAL B 1 211 ? 9.005   4.411   6.775   1.00 17.36 ? 211 VAL B O   1 
ATOM   3442 C  CB  . VAL B 1 211 ? 11.190  2.284   5.453   1.00 16.52 ? 211 VAL B CB  1 
ATOM   3443 C  CG1 . VAL B 1 211 ? 12.641  2.033   5.065   1.00 19.44 ? 211 VAL B CG1 1 
ATOM   3444 C  CG2 . VAL B 1 211 ? 10.930  1.761   6.879   1.00 15.55 ? 211 VAL B CG2 1 
ATOM   3445 N  N   . ARG B 1 212 ? 8.526   3.307   4.861   1.00 14.52 ? 212 ARG B N   1 
ATOM   3446 C  CA  . ARG B 1 212 ? 7.109   3.194   5.183   1.00 15.60 ? 212 ARG B CA  1 
ATOM   3447 C  C   . ARG B 1 212 ? 6.775   1.698   5.116   1.00 16.34 ? 212 ARG B C   1 
ATOM   3448 O  O   . ARG B 1 212 ? 7.456   0.910   4.440   1.00 17.02 ? 212 ARG B O   1 
ATOM   3449 C  CB  . ARG B 1 212 ? 6.189   4.010   4.269   1.00 17.98 ? 212 ARG B CB  1 
ATOM   3450 C  CG  . ARG B 1 212 ? 6.025   5.469   4.752   1.00 18.71 ? 212 ARG B CG  1 
ATOM   3451 C  CD  . ARG B 1 212 ? 4.955   6.245   3.993   1.00 18.87 ? 212 ARG B CD  1 
ATOM   3452 N  NE  . ARG B 1 212 ? 4.656   7.563   4.588   1.00 22.15 ? 212 ARG B NE  1 
ATOM   3453 C  CZ  . ARG B 1 212 ? 4.963   8.743   4.051   1.00 28.34 ? 212 ARG B CZ  1 
ATOM   3454 N  NH1 . ARG B 1 212 ? 5.590   8.817   2.889   1.00 28.43 ? 212 ARG B NH1 1 
ATOM   3455 N  NH2 . ARG B 1 212 ? 4.641   9.868   4.683   1.00 28.08 ? 212 ARG B NH2 1 
ATOM   3456 N  N   . VAL B 1 213 ? 5.775   1.300   5.885   1.00 14.11 ? 213 VAL B N   1 
ATOM   3457 C  CA  . VAL B 1 213 ? 5.385   -0.093  5.910   1.00 14.14 ? 213 VAL B CA  1 
ATOM   3458 C  C   . VAL B 1 213 ? 3.944   -0.208  5.471   1.00 14.41 ? 213 VAL B C   1 
ATOM   3459 O  O   . VAL B 1 213 ? 3.146   0.716   5.659   1.00 16.07 ? 213 VAL B O   1 
ATOM   3460 C  CB  . VAL B 1 213 ? 5.553   -0.714  7.333   1.00 15.82 ? 213 VAL B CB  1 
ATOM   3461 C  CG1 . VAL B 1 213 ? 7.031   -0.731  7.705   1.00 20.25 ? 213 VAL B CG1 1 
ATOM   3462 C  CG2 . VAL B 1 213 ? 4.778   0.113   8.389   1.00 19.36 ? 213 VAL B CG2 1 
ATOM   3463 N  N   . GLY B 1 214 ? 3.605   -1.340  4.861   1.00 13.57 ? 214 GLY B N   1 
ATOM   3464 C  CA  . GLY B 1 214 ? 2.237   -1.511  4.425   1.00 13.45 ? 214 GLY B CA  1 
ATOM   3465 C  C   . GLY B 1 214 ? 1.975   -2.875  3.789   1.00 12.97 ? 214 GLY B C   1 
ATOM   3466 O  O   . GLY B 1 214 ? 2.707   -3.857  4.036   1.00 12.80 ? 214 GLY B O   1 
ATOM   3467 N  N   . PHE B 1 215 ? 0.896   -2.926  3.003   1.00 12.71 ? 215 PHE B N   1 
ATOM   3468 C  CA  . PHE B 1 215 ? 0.480   -4.164  2.334   1.00 12.52 ? 215 PHE B CA  1 
ATOM   3469 C  C   . PHE B 1 215 ? 0.150   -3.887  0.889   1.00 13.75 ? 215 PHE B C   1 
ATOM   3470 O  O   . PHE B 1 215 ? -0.286  -2.795  0.552   1.00 13.74 ? 215 PHE B O   1 
ATOM   3471 C  CB  . PHE B 1 215 ? -0.770  -4.724  2.996   1.00 11.19 ? 215 PHE B CB  1 
ATOM   3472 C  CG  . PHE B 1 215 ? -0.540  -5.180  4.407   1.00 13.29 ? 215 PHE B CG  1 
ATOM   3473 C  CD1 . PHE B 1 215 ? -0.600  -4.272  5.460   1.00 15.76 ? 215 PHE B CD1 1 
ATOM   3474 C  CD2 . PHE B 1 215 ? -0.201  -6.512  4.684   1.00 13.98 ? 215 PHE B CD2 1 
ATOM   3475 C  CE1 . PHE B 1 215 ? -0.329  -4.685  6.790   1.00 15.96 ? 215 PHE B CE1 1 
ATOM   3476 C  CE2 . PHE B 1 215 ? 0.077   -6.927  6.033   1.00 11.77 ? 215 PHE B CE2 1 
ATOM   3477 C  CZ  . PHE B 1 215 ? 0.009   -6.018  7.057   1.00 14.84 ? 215 PHE B CZ  1 
ATOM   3478 N  N   . SER B 1 216 ? 0.347   -4.899  0.052   1.00 13.70 ? 216 SER B N   1 
ATOM   3479 C  CA  . SER B 1 216 ? 0.058   -4.777  -1.358  1.00 14.09 ? 216 SER B CA  1 
ATOM   3480 C  C   . SER B 1 216 ? -0.594  -6.092  -1.813  1.00 14.65 ? 216 SER B C   1 
ATOM   3481 O  O   . SER B 1 216 ? -0.304  -7.143  -1.263  1.00 15.51 ? 216 SER B O   1 
ATOM   3482 C  CB  . SER B 1 216 ? 1.382   -4.570  -2.127  1.00 17.66 ? 216 SER B CB  1 
ATOM   3483 O  OG  . SER B 1 216 ? 1.160   -4.354  -3.503  1.00 20.42 ? 216 SER B OG  1 
ATOM   3484 N  N   . ALA B 1 217 ? -1.504  -6.021  -2.786  1.00 15.14 ? 217 ALA B N   1 
ATOM   3485 C  CA  . ALA B 1 217 ? -2.104  -7.238  -3.341  1.00 14.49 ? 217 ALA B CA  1 
ATOM   3486 C  C   . ALA B 1 217 ? -2.473  -6.929  -4.788  1.00 14.79 ? 217 ALA B C   1 
ATOM   3487 O  O   . ALA B 1 217 ? -2.608  -5.760  -5.179  1.00 16.42 ? 217 ALA B O   1 
ATOM   3488 C  CB  . ALA B 1 217 ? -3.341  -7.667  -2.552  1.00 15.35 ? 217 ALA B CB  1 
ATOM   3489 N  N   . ALA B 1 218 ? -2.609  -7.979  -5.594  1.00 16.13 ? 218 ALA B N   1 
ATOM   3490 C  CA  . ALA B 1 218 ? -2.990  -7.777  -6.979  1.00 16.99 ? 218 ALA B CA  1 
ATOM   3491 C  C   . ALA B 1 218 ? -3.687  -9.015  -7.506  1.00 16.86 ? 218 ALA B C   1 
ATOM   3492 O  O   . ALA B 1 218 ? -3.583  -10.113 -6.922  1.00 15.37 ? 218 ALA B O   1 
ATOM   3493 C  CB  . ALA B 1 218 ? -1.721  -7.486  -7.844  1.00 18.92 ? 218 ALA B CB  1 
ATOM   3494 N  N   . SER B 1 219 ? -4.427  -8.814  -8.594  1.00 17.75 ? 219 SER B N   1 
ATOM   3495 C  CA  . SER B 1 219 ? -5.066  -9.918  -9.318  1.00 15.98 ? 219 SER B CA  1 
ATOM   3496 C  C   . SER B 1 219 ? -4.842  -9.586  -10.820 1.00 20.49 ? 219 SER B C   1 
ATOM   3497 O  O   . SER B 1 219 ? -4.979  -8.437  -11.225 1.00 23.11 ? 219 SER B O   1 
ATOM   3498 C  CB  . SER B 1 219 ? -6.563  -9.982  -9.051  1.00 16.03 ? 219 SER B CB  1 
ATOM   3499 O  OG  . SER B 1 219 ? -6.847  -10.479 -7.755  1.00 17.76 ? 219 SER B OG  1 
ATOM   3500 N  N   . GLY B 1 220 ? -4.484  -10.591 -11.606 1.00 19.15 ? 220 GLY B N   1 
ATOM   3501 C  CA  . GLY B 1 220 ? -4.269  -10.392 -13.029 1.00 21.62 ? 220 GLY B CA  1 
ATOM   3502 C  C   . GLY B 1 220 ? -5.472  -10.988 -13.757 1.00 23.20 ? 220 GLY B C   1 
ATOM   3503 O  O   . GLY B 1 220 ? -6.587  -10.499 -13.591 1.00 23.07 ? 220 GLY B O   1 
ATOM   3504 N  N   . GLU B 1 221 ? -5.254  -12.033 -14.556 1.00 22.88 ? 221 GLU B N   1 
ATOM   3505 C  CA  . GLU B 1 221 ? -6.366  -12.670 -15.267 1.00 25.52 ? 221 GLU B CA  1 
ATOM   3506 C  C   . GLU B 1 221 ? -7.247  -13.471 -14.295 1.00 25.48 ? 221 GLU B C   1 
ATOM   3507 O  O   . GLU B 1 221 ? -8.458  -13.594 -14.512 1.00 25.00 ? 221 GLU B O   1 
ATOM   3508 C  CB  . GLU B 1 221 ? -5.846  -13.592 -16.390 1.00 28.47 ? 221 GLU B CB  1 
ATOM   3509 C  CG  . GLU B 1 221 ? -5.132  -12.833 -17.510 1.00 39.08 ? 221 GLU B CG  1 
ATOM   3510 C  CD  . GLU B 1 221 ? -4.799  -13.696 -18.735 1.00 44.56 ? 221 GLU B CD  1 
ATOM   3511 O  OE1 . GLU B 1 221 ? -3.991  -14.648 -18.629 1.00 46.99 ? 221 GLU B OE1 1 
ATOM   3512 O  OE2 . GLU B 1 221 ? -5.363  -13.407 -19.810 1.00 50.92 ? 221 GLU B OE2 1 
ATOM   3513 N  N   . GLN B 1 222 ? -6.638  -14.053 -13.259 1.00 23.09 ? 222 GLN B N   1 
ATOM   3514 C  CA  . GLN B 1 222 ? -7.407  -14.799 -12.256 1.00 23.38 ? 222 GLN B CA  1 
ATOM   3515 C  C   . GLN B 1 222 ? -7.509  -13.852 -11.054 1.00 23.70 ? 222 GLN B C   1 
ATOM   3516 O  O   . GLN B 1 222 ? -6.701  -12.942 -10.912 1.00 22.40 ? 222 GLN B O   1 
ATOM   3517 C  CB  . GLN B 1 222 ? -6.714  -16.089 -11.864 1.00 26.23 ? 222 GLN B CB  1 
ATOM   3518 C  CG  A GLN B 1 222 ? -6.401  -16.960 -13.080 0.50 38.08 ? 222 GLN B CG  1 
ATOM   3519 C  CG  B GLN B 1 222 ? -6.774  -17.250 -12.870 0.50 36.31 ? 222 GLN B CG  1 
ATOM   3520 C  CD  A GLN B 1 222 ? -7.619  -17.215 -13.955 0.50 40.27 ? 222 GLN B CD  1 
ATOM   3521 C  CD  B GLN B 1 222 ? -6.175  -16.919 -14.224 0.50 39.65 ? 222 GLN B CD  1 
ATOM   3522 O  OE1 A GLN B 1 222 ? -7.487  -17.558 -15.132 0.50 40.80 ? 222 GLN B OE1 1 
ATOM   3523 O  OE1 B GLN B 1 222 ? -6.880  -16.509 -15.148 0.50 44.23 ? 222 GLN B OE1 1 
ATOM   3524 N  NE2 A GLN B 1 222 ? -8.810  -17.065 -13.382 0.50 43.85 ? 222 GLN B NE2 1 
ATOM   3525 N  NE2 B GLN B 1 222 ? -4.866  -17.078 -14.341 0.50 41.60 ? 222 GLN B NE2 1 
ATOM   3526 N  N   . TYR B 1 223 ? -8.471  -14.089 -10.177 1.00 21.63 ? 223 TYR B N   1 
ATOM   3527 C  CA  . TYR B 1 223 ? -8.730  -13.137 -9.102  1.00 19.03 ? 223 TYR B CA  1 
ATOM   3528 C  C   . TYR B 1 223 ? -9.304  -13.717 -7.840  1.00 18.25 ? 223 TYR B C   1 
ATOM   3529 O  O   . TYR B 1 223 ? -9.822  -14.840 -7.839  1.00 17.10 ? 223 TYR B O   1 
ATOM   3530 C  CB  . TYR B 1 223 ? -9.691  -12.084 -9.658  1.00 20.93 ? 223 TYR B CB  1 
ATOM   3531 C  CG  . TYR B 1 223 ? -10.861 -12.692 -10.418 1.00 23.03 ? 223 TYR B CG  1 
ATOM   3532 C  CD1 . TYR B 1 223 ? -11.920 -13.289 -9.749  1.00 25.32 ? 223 TYR B CD1 1 
ATOM   3533 C  CD2 . TYR B 1 223 ? -10.880 -12.689 -11.820 1.00 28.64 ? 223 TYR B CD2 1 
ATOM   3534 C  CE1 . TYR B 1 223 ? -12.978 -13.868 -10.445 1.00 30.73 ? 223 TYR B CE1 1 
ATOM   3535 C  CE2 . TYR B 1 223 ? -11.935 -13.266 -12.529 1.00 33.01 ? 223 TYR B CE2 1 
ATOM   3536 C  CZ  . TYR B 1 223 ? -12.977 -13.850 -11.829 1.00 32.89 ? 223 TYR B CZ  1 
ATOM   3537 O  OH  . TYR B 1 223 ? -14.034 -14.428 -12.519 1.00 36.78 ? 223 TYR B OH  1 
ATOM   3538 N  N   . GLN B 1 224 ? -9.229  -12.924 -6.764  1.00 16.48 ? 224 GLN B N   1 
ATOM   3539 C  CA  . GLN B 1 224 ? -9.739  -13.314 -5.450  1.00 14.78 ? 224 GLN B CA  1 
ATOM   3540 C  C   . GLN B 1 224 ? -9.726  -12.043 -4.592  1.00 15.78 ? 224 GLN B C   1 
ATOM   3541 O  O   . GLN B 1 224 ? -9.016  -11.102 -4.922  1.00 15.72 ? 224 GLN B O   1 
ATOM   3542 C  CB  . GLN B 1 224 ? -8.816  -14.350 -4.791  1.00 15.37 ? 224 GLN B CB  1 
ATOM   3543 C  CG  . GLN B 1 224 ? -7.414  -13.790 -4.397  1.00 16.34 ? 224 GLN B CG  1 
ATOM   3544 C  CD  . GLN B 1 224 ? -6.389  -14.909 -4.137  1.00 13.29 ? 224 GLN B CD  1 
ATOM   3545 O  OE1 . GLN B 1 224 ? -6.763  -16.088 -3.887  1.00 15.84 ? 224 GLN B OE1 1 
ATOM   3546 N  NE2 . GLN B 1 224 ? -5.114  -14.560 -4.165  1.00 14.87 ? 224 GLN B NE2 1 
ATOM   3547 N  N   . THR B 1 225 ? -10.517 -11.990 -3.524  1.00 14.26 ? 225 THR B N   1 
ATOM   3548 C  CA  . THR B 1 225 ? -10.443 -10.791 -2.672  1.00 14.70 ? 225 THR B CA  1 
ATOM   3549 C  C   . THR B 1 225 ? -9.188  -10.972 -1.792  1.00 16.48 ? 225 THR B C   1 
ATOM   3550 O  O   . THR B 1 225 ? -8.739  -12.111 -1.552  1.00 16.65 ? 225 THR B O   1 
ATOM   3551 C  CB  . THR B 1 225 ? -11.655 -10.687 -1.734  1.00 19.52 ? 225 THR B CB  1 
ATOM   3552 O  OG1 . THR B 1 225 ? -11.795 -11.923 -1.033  1.00 22.38 ? 225 THR B OG1 1 
ATOM   3553 C  CG2 . THR B 1 225 ? -12.934 -10.413 -2.510  1.00 23.96 ? 225 THR B CG2 1 
ATOM   3554 N  N   . HIS B 1 226 ? -8.614  -9.859  -1.324  1.00 15.01 ? 226 HIS B N   1 
ATOM   3555 C  CA  . HIS B 1 226 ? -7.431  -9.910  -0.450  1.00 14.74 ? 226 HIS B CA  1 
ATOM   3556 C  C   . HIS B 1 226 ? -7.851  -8.945  0.652   1.00 13.67 ? 226 HIS B C   1 
ATOM   3557 O  O   . HIS B 1 226 ? -7.750  -7.731  0.485   1.00 16.99 ? 226 HIS B O   1 
ATOM   3558 C  CB  . HIS B 1 226 ? -6.190  -9.373  -1.153  1.00 15.22 ? 226 HIS B CB  1 
ATOM   3559 C  CG  . HIS B 1 226 ? -5.792  -10.159 -2.366  1.00 14.63 ? 226 HIS B CG  1 
ATOM   3560 N  ND1 . HIS B 1 226 ? -6.297  -9.891  -3.618  1.00 15.04 ? 226 HIS B ND1 1 
ATOM   3561 C  CD2 . HIS B 1 226 ? -4.905  -11.171 -2.523  1.00 14.64 ? 226 HIS B CD2 1 
ATOM   3562 C  CE1 . HIS B 1 226 ? -5.735  -10.704 -4.501  1.00 16.00 ? 226 HIS B CE1 1 
ATOM   3563 N  NE2 . HIS B 1 226 ? -4.886  -11.491 -3.862  1.00 15.42 ? 226 HIS B NE2 1 
ATOM   3564 N  N   . THR B 1 227 ? -8.380  -9.504  1.730   1.00 15.29 ? 227 THR B N   1 
ATOM   3565 C  CA  . THR B 1 227 ? -8.952  -8.720  2.811   1.00 14.44 ? 227 THR B CA  1 
ATOM   3566 C  C   . THR B 1 227 ? -8.062  -8.663  4.051   1.00 13.20 ? 227 THR B C   1 
ATOM   3567 O  O   . THR B 1 227 ? -7.849  -9.663  4.691   1.00 15.10 ? 227 THR B O   1 
ATOM   3568 C  CB  . THR B 1 227 ? -10.318 -9.334  3.196   1.00 17.17 ? 227 THR B CB  1 
ATOM   3569 O  OG1 . THR B 1 227 ? -11.123 -9.450  1.999   1.00 17.47 ? 227 THR B OG1 1 
ATOM   3570 C  CG2 . THR B 1 227 ? -11.037 -8.465  4.228   1.00 19.11 ? 227 THR B CG2 1 
ATOM   3571 N  N   . LEU B 1 228 ? -7.564  -7.472  4.380   1.00 14.53 ? 228 LEU B N   1 
ATOM   3572 C  CA  . LEU B 1 228 ? -6.715  -7.319  5.573   1.00 14.11 ? 228 LEU B CA  1 
ATOM   3573 C  C   . LEU B 1 228 ? -7.690  -6.999  6.695   1.00 15.93 ? 228 LEU B C   1 
ATOM   3574 O  O   . LEU B 1 228 ? -8.389  -5.988  6.630   1.00 15.83 ? 228 LEU B O   1 
ATOM   3575 C  CB  . LEU B 1 228 ? -5.765  -6.157  5.382   1.00 13.67 ? 228 LEU B CB  1 
ATOM   3576 C  CG  . LEU B 1 228 ? -4.767  -5.873  6.517   1.00 17.20 ? 228 LEU B CG  1 
ATOM   3577 C  CD1 . LEU B 1 228 ? -3.744  -7.040  6.652   1.00 18.53 ? 228 LEU B CD1 1 
ATOM   3578 C  CD2 . LEU B 1 228 ? -4.049  -4.591  6.155   1.00 18.47 ? 228 LEU B CD2 1 
ATOM   3579 N  N   . GLU B 1 229 ? -7.707  -7.863  7.709   1.00 13.14 ? 229 GLU B N   1 
ATOM   3580 C  CA  . GLU B 1 229 ? -8.650  -7.790  8.832   1.00 13.67 ? 229 GLU B CA  1 
ATOM   3581 C  C   . GLU B 1 229 ? -8.149  -7.052  10.076  1.00 17.55 ? 229 GLU B C   1 
ATOM   3582 O  O   . GLU B 1 229 ? -8.919  -6.418  10.763  1.00 16.58 ? 229 GLU B O   1 
ATOM   3583 C  CB  . GLU B 1 229 ? -9.060  -9.219  9.183   1.00 17.32 ? 229 GLU B CB  1 
ATOM   3584 C  CG  . GLU B 1 229 ? -9.829  -9.867  8.000   1.00 19.19 ? 229 GLU B CG  1 
ATOM   3585 C  CD  . GLU B 1 229 ? -9.990  -11.368 8.117   1.00 26.61 ? 229 GLU B CD  1 
ATOM   3586 O  OE1 . GLU B 1 229 ? -10.862 -11.918 7.414   1.00 27.21 ? 229 GLU B OE1 1 
ATOM   3587 O  OE2 . GLU B 1 229 ? -9.241  -12.004 8.881   1.00 27.80 ? 229 GLU B OE2 1 
ATOM   3588 N  N   . SER B 1 230 ? -6.859  -7.110  10.342  1.00 13.54 ? 230 SER B N   1 
ATOM   3589 C  CA  . SER B 1 230 ? -6.313  -6.438  11.539  1.00 14.90 ? 230 SER B CA  1 
ATOM   3590 C  C   . SER B 1 230 ? -4.810  -6.278  11.340  1.00 15.61 ? 230 SER B C   1 
ATOM   3591 O  O   . SER B 1 230 ? -4.211  -6.997  10.558  1.00 14.65 ? 230 SER B O   1 
ATOM   3592 C  CB  . SER B 1 230 ? -6.559  -7.280  12.801  1.00 12.96 ? 230 SER B CB  1 
ATOM   3593 O  OG  . SER B 1 230 ? -5.880  -8.530  12.740  1.00 20.59 ? 230 SER B OG  1 
ATOM   3594 N  N   . TRP B 1 231 ? -4.205  -5.351  12.080  1.00 12.46 ? 231 TRP B N   1 
ATOM   3595 C  CA  . TRP B 1 231 ? -2.763  -5.130  11.930  1.00 12.13 ? 231 TRP B CA  1 
ATOM   3596 C  C   . TRP B 1 231 ? -2.228  -4.358  13.136  1.00 13.68 ? 231 TRP B C   1 
ATOM   3597 O  O   . TRP B 1 231 ? -2.821  -3.350  13.523  1.00 15.35 ? 231 TRP B O   1 
ATOM   3598 C  CB  . TRP B 1 231 ? -2.521  -4.287  10.690  1.00 12.32 ? 231 TRP B CB  1 
ATOM   3599 C  CG  . TRP B 1 231 ? -1.064  -3.910  10.399  1.00 15.48 ? 231 TRP B CG  1 
ATOM   3600 C  CD1 . TRP B 1 231 ? 0.061   -4.599  10.741  1.00 14.82 ? 231 TRP B CD1 1 
ATOM   3601 C  CD2 . TRP B 1 231 ? -0.628  -2.791  9.634   1.00 13.56 ? 231 TRP B CD2 1 
ATOM   3602 N  NE1 . TRP B 1 231 ? 1.188   -3.969  10.229  1.00 14.56 ? 231 TRP B NE1 1 
ATOM   3603 C  CE2 . TRP B 1 231 ? 0.789   -2.861  9.542   1.00 12.33 ? 231 TRP B CE2 1 
ATOM   3604 C  CE3 . TRP B 1 231 ? -1.296  -1.727  9.007   1.00 13.72 ? 231 TRP B CE3 1 
ATOM   3605 C  CZ2 . TRP B 1 231 ? 1.553   -1.902  8.841   1.00 17.38 ? 231 TRP B CZ2 1 
ATOM   3606 C  CZ3 . TRP B 1 231 ? -0.537  -0.780  8.307   1.00 13.35 ? 231 TRP B CZ3 1 
ATOM   3607 C  CH2 . TRP B 1 231 ? 0.869   -0.874  8.229   1.00 13.49 ? 231 TRP B CH2 1 
ATOM   3608 N  N   . SER B 1 232 ? -1.112  -4.814  13.708  1.00 11.56 ? 232 SER B N   1 
ATOM   3609 C  CA  . SER B 1 232 ? -0.483  -4.021  14.771  1.00 11.16 ? 232 SER B CA  1 
ATOM   3610 C  C   . SER B 1 232 ? 0.992   -4.036  14.410  1.00 14.76 ? 232 SER B C   1 
ATOM   3611 O  O   . SER B 1 232 ? 1.492   -4.995  13.816  1.00 13.53 ? 232 SER B O   1 
ATOM   3612 C  CB  . SER B 1 232 ? -0.730  -4.629  16.171  1.00 16.25 ? 232 SER B CB  1 
ATOM   3613 O  OG  . SER B 1 232 ? -0.029  -5.821  16.360  1.00 25.19 ? 232 SER B OG  1 
ATOM   3614 N  N   . PHE B 1 233 ? 1.691   -2.970  14.773  1.00 13.57 ? 233 PHE B N   1 
ATOM   3615 C  CA  . PHE B 1 233 ? 3.095   -2.844  14.398  1.00 13.78 ? 233 PHE B CA  1 
ATOM   3616 C  C   . PHE B 1 233 ? 3.848   -2.123  15.500  1.00 16.38 ? 233 PHE B C   1 
ATOM   3617 O  O   . PHE B 1 233 ? 3.299   -1.236  16.145  1.00 16.87 ? 233 PHE B O   1 
ATOM   3618 C  CB  . PHE B 1 233 ? 3.193   -2.023  13.097  1.00 13.32 ? 233 PHE B CB  1 
ATOM   3619 C  CG  . PHE B 1 233 ? 4.599   -1.816  12.617  1.00 14.21 ? 233 PHE B CG  1 
ATOM   3620 C  CD1 . PHE B 1 233 ? 5.329   -0.709  13.016  1.00 18.84 ? 233 PHE B CD1 1 
ATOM   3621 C  CD2 . PHE B 1 233 ? 5.208   -2.746  11.768  1.00 15.88 ? 233 PHE B CD2 1 
ATOM   3622 C  CE1 . PHE B 1 233 ? 6.637   -0.518  12.582  1.00 19.39 ? 233 PHE B CE1 1 
ATOM   3623 C  CE2 . PHE B 1 233 ? 6.526   -2.557  11.332  1.00 17.20 ? 233 PHE B CE2 1 
ATOM   3624 C  CZ  . PHE B 1 233 ? 7.232   -1.440  11.743  1.00 18.45 ? 233 PHE B CZ  1 
ATOM   3625 N  N   . THR B 1 234 ? 5.079   -2.535  15.750  1.00 13.04 ? 234 THR B N   1 
ATOM   3626 C  CA  . THR B 1 234 ? 5.873   -1.832  16.756  1.00 12.73 ? 234 THR B CA  1 
ATOM   3627 C  C   . THR B 1 234 ? 7.315   -1.869  16.253  1.00 17.24 ? 234 THR B C   1 
ATOM   3628 O  O   . THR B 1 234 ? 7.750   -2.859  15.651  1.00 14.96 ? 234 THR B O   1 
ATOM   3629 C  CB  . THR B 1 234 ? 5.750   -2.479  18.170  1.00 20.10 ? 234 THR B CB  1 
ATOM   3630 O  OG1 . THR B 1 234 ? 6.543   -1.716  19.091  1.00 27.96 ? 234 THR B OG1 1 
ATOM   3631 C  CG2 . THR B 1 234 ? 6.244   -3.915  18.198  1.00 24.27 ? 234 THR B CG2 1 
ATOM   3632 N  N   . SER B 1 235 ? 8.033   -0.779  16.456  1.00 13.18 ? 235 SER B N   1 
ATOM   3633 C  CA  . SER B 1 235 ? 9.433   -0.727  16.044  1.00 12.97 ? 235 SER B CA  1 
ATOM   3634 C  C   . SER B 1 235 ? 10.192  0.092   17.089  1.00 19.81 ? 235 SER B C   1 
ATOM   3635 O  O   . SER B 1 235 ? 9.671   1.105   17.588  1.00 17.62 ? 235 SER B O   1 
ATOM   3636 C  CB  . SER B 1 235 ? 9.568   -0.036  14.690  1.00 14.80 ? 235 SER B CB  1 
ATOM   3637 O  OG  A SER B 1 235 ? 9.065   1.278   14.732  0.50 24.85 ? 235 SER B OG  1 
ATOM   3638 O  OG  B SER B 1 235 ? 10.920  0.060   14.273  0.50 11.96 ? 235 SER B OG  1 
ATOM   3639 N  N   . THR B 1 236 ? 11.397  -0.364  17.439  1.00 16.44 ? 236 THR B N   1 
ATOM   3640 C  CA  . THR B 1 236 ? 12.193  0.420   18.365  1.00 20.32 ? 236 THR B CA  1 
ATOM   3641 C  C   . THR B 1 236 ? 13.679  0.300   18.021  1.00 21.78 ? 236 THR B C   1 
ATOM   3642 O  O   . THR B 1 236 ? 14.173  -0.808  17.773  1.00 18.67 ? 236 THR B O   1 
ATOM   3643 C  CB  . THR B 1 236 ? 11.950  0.006   19.829  1.00 24.92 ? 236 THR B CB  1 
ATOM   3644 O  OG1 . THR B 1 236 ? 12.672  0.923   20.675  1.00 32.84 ? 236 THR B OG1 1 
ATOM   3645 C  CG2 . THR B 1 236 ? 12.448  -1.406  20.103  1.00 29.27 ? 236 THR B CG2 1 
ATOM   3646 N  N   . LEU B 1 237 ? 14.379  1.438   17.973  1.00 20.57 ? 237 LEU B N   1 
ATOM   3647 C  CA  . LEU B 1 237 ? 15.818  1.431   17.665  1.00 24.06 ? 237 LEU B CA  1 
ATOM   3648 C  C   . LEU B 1 237 ? 16.655  0.868   18.815  1.00 28.31 ? 237 LEU B C   1 
ATOM   3649 O  O   . LEU B 1 237 ? 16.498  1.304   19.961  1.00 28.85 ? 237 LEU B O   1 
ATOM   3650 C  CB  . LEU B 1 237 ? 16.294  2.863   17.340  1.00 23.71 ? 237 LEU B CB  1 
ATOM   3651 C  CG  . LEU B 1 237 ? 15.909  3.374   15.967  1.00 23.81 ? 237 LEU B CG  1 
ATOM   3652 C  CD1 . LEU B 1 237 ? 16.326  4.833   15.815  1.00 27.18 ? 237 LEU B CD1 1 
ATOM   3653 C  CD2 . LEU B 1 237 ? 16.603  2.484   14.876  1.00 27.89 ? 237 LEU B CD2 1 
ATOM   3654 N  N   . LEU B 1 238 ? 17.520  -0.113  18.512  1.00 29.95 ? 238 LEU B N   1 
ATOM   3655 C  CA  . LEU B 1 238 ? 18.396  -0.743  19.510  1.00 32.96 ? 238 LEU B CA  1 
ATOM   3656 C  C   . LEU B 1 238 ? 19.877  -0.648  19.171  1.00 37.05 ? 238 LEU B C   1 
ATOM   3657 O  O   . LEU B 1 238 ? 20.273  -0.656  18.003  1.00 36.62 ? 238 LEU B O   1 
ATOM   3658 C  CB  . LEU B 1 238 ? 18.103  -2.242  19.680  1.00 34.72 ? 238 LEU B CB  1 
ATOM   3659 C  CG  . LEU B 1 238 ? 16.789  -2.804  20.212  1.00 39.79 ? 238 LEU B CG  1 
ATOM   3660 C  CD1 . LEU B 1 238 ? 16.383  -2.084  21.514  1.00 39.97 ? 238 LEU B CD1 1 
ATOM   3661 C  CD2 . LEU B 1 238 ? 15.738  -2.621  19.161  1.00 44.61 ? 238 LEU B CD2 1 
ATOM   3662 N  N   . TYR B 1 239 ? 20.710  -0.593  20.208  1.00 39.50 ? 239 TYR B N   1 
ATOM   3663 C  CA  . TYR B 1 239 ? 22.156  -0.558  19.976  1.00 43.66 ? 239 TYR B CA  1 
ATOM   3664 C  C   . TYR B 1 239 ? 22.562  -1.966  19.537  1.00 45.45 ? 239 TYR B C   1 
ATOM   3665 O  O   . TYR B 1 239 ? 22.187  -2.996  20.189  1.00 45.84 ? 239 TYR B O   1 
ATOM   3666 C  CB  . TYR B 1 239 ? 22.910  -0.132  21.268  1.00 40.88 ? 239 TYR B CB  1 
ATOM   3667 C  CG  . TYR B 1 239 ? 22.379  1.149   21.932  1.00 40.70 ? 239 TYR B CG  1 
ATOM   3668 C  CD1 . TYR B 1 239 ? 21.218  1.113   22.731  1.00 43.13 ? 239 TYR B CD1 1 
ATOM   3669 C  CD2 . TYR B 1 239 ? 23.027  2.390   21.763  1.00 43.24 ? 239 TYR B CD2 1 
ATOM   3670 C  CE1 . TYR B 1 239 ? 20.713  2.271   23.347  1.00 45.35 ? 239 TYR B CE1 1 
ATOM   3671 C  CE2 . TYR B 1 239 ? 22.533  3.573   22.375  1.00 42.70 ? 239 TYR B CE2 1 
ATOM   3672 C  CZ  . TYR B 1 239 ? 21.373  3.495   23.166  1.00 46.66 ? 239 TYR B CZ  1 
ATOM   3673 O  OH  . TYR B 1 239 ? 20.841  4.613   23.803  1.00 51.66 ? 239 TYR B OH  1 
ATOM   3674 N  N   . THR B 1 240 ? 23.282  -2.025  18.422  1.00 46.73 ? 240 THR B N   1 
ATOM   3675 C  CA  . THR B 1 240 ? 23.760  -3.277  17.861  1.00 50.04 ? 240 THR B CA  1 
ATOM   3676 C  C   . THR B 1 240 ? 25.099  -2.972  17.187  1.00 53.28 ? 240 THR B C   1 
ATOM   3677 O  O   . THR B 1 240 ? 25.161  -3.048  15.934  1.00 55.88 ? 240 THR B O   1 
ATOM   3678 C  CB  . THR B 1 240 ? 22.769  -3.854  16.801  1.00 53.39 ? 240 THR B CB  1 
ATOM   3679 O  OG1 . THR B 1 240 ? 21.501  -4.137  17.421  1.00 58.35 ? 240 THR B OG1 1 
ATOM   3680 C  CG2 . THR B 1 240 ? 23.334  -5.139  16.175  1.00 53.66 ? 240 THR B CG2 1 
HETATM 3681 C  C1  . MAN C 2 .   ? 4.510   42.124  25.764  1.00 29.08 ? 1   MAN C C1  1 
HETATM 3682 C  C2  . MAN C 2 .   ? 3.319   41.280  25.308  1.00 31.42 ? 1   MAN C C2  1 
HETATM 3683 C  C3  . MAN C 2 .   ? 2.896   40.301  26.420  1.00 26.88 ? 1   MAN C C3  1 
HETATM 3684 C  C4  . MAN C 2 .   ? 4.075   39.460  26.883  1.00 23.33 ? 1   MAN C C4  1 
HETATM 3685 C  C5  . MAN C 2 .   ? 5.205   40.406  27.328  1.00 23.79 ? 1   MAN C C5  1 
HETATM 3686 C  C6  . MAN C 2 .   ? 6.458   39.671  27.771  1.00 24.69 ? 1   MAN C C6  1 
HETATM 3687 O  O1  . MAN C 2 .   ? 4.109   42.956  26.804  1.00 34.13 ? 1   MAN C O1  1 
HETATM 3688 O  O2  . MAN C 2 .   ? 3.657   40.568  24.106  1.00 31.29 ? 1   MAN C O2  1 
HETATM 3689 O  O3  . MAN C 2 .   ? 1.842   39.472  25.975  1.00 25.60 ? 1   MAN C O3  1 
HETATM 3690 O  O4  . MAN C 2 .   ? 3.650   38.652  27.973  1.00 22.77 ? 1   MAN C O4  1 
HETATM 3691 O  O5  . MAN C 2 .   ? 5.591   41.284  26.226  1.00 25.15 ? 1   MAN C O5  1 
HETATM 3692 O  O6  . MAN C 2 .   ? 7.070   39.008  26.669  1.00 22.18 ? 1   MAN C O6  1 
HETATM 3693 C  C1  . NAG C 2 .   ? 2.811   40.806  23.047  1.00 31.27 ? 2   NAG C C1  1 
HETATM 3694 C  C2  . NAG C 2 .   ? 3.555   40.530  21.731  1.00 36.01 ? 2   NAG C C2  1 
HETATM 3695 C  C3  . NAG C 2 .   ? 2.582   40.594  20.548  1.00 35.36 ? 2   NAG C C3  1 
HETATM 3696 C  C4  . NAG C 2 .   ? 1.311   39.775  20.823  1.00 37.02 ? 2   NAG C C4  1 
HETATM 3697 C  C5  . NAG C 2 .   ? 0.695   40.144  22.165  1.00 36.25 ? 2   NAG C C5  1 
HETATM 3698 C  C6  . NAG C 2 .   ? -0.503  39.272  22.501  1.00 41.51 ? 2   NAG C C6  1 
HETATM 3699 C  C7  . NAG C 2 .   ? 5.809   41.255  21.110  1.00 40.57 ? 2   NAG C C7  1 
HETATM 3700 C  C8  . NAG C 2 .   ? 6.802   42.402  21.048  1.00 41.17 ? 2   NAG C C8  1 
HETATM 3701 N  N2  . NAG C 2 .   ? 4.598   41.542  21.589  1.00 36.18 ? 2   NAG C N2  1 
HETATM 3702 O  O3  . NAG C 2 .   ? 3.230   40.077  19.395  1.00 37.87 ? 2   NAG C O3  1 
HETATM 3703 O  O4  . NAG C 2 .   ? 0.356   40.007  19.801  1.00 38.82 ? 2   NAG C O4  1 
HETATM 3704 O  O5  . NAG C 2 .   ? 1.664   39.965  23.210  1.00 33.09 ? 2   NAG C O5  1 
HETATM 3705 O  O6  . NAG C 2 .   ? -1.236  39.791  23.605  1.00 43.64 ? 2   NAG C O6  1 
HETATM 3706 O  O7  . NAG C 2 .   ? 6.141   40.140  20.702  1.00 41.65 ? 2   NAG C O7  1 
HETATM 3707 C  C1  . MAN D 2 .   ? -1.806  -13.141 -16.043 1.00 27.36 ? 1   MAN D C1  1 
HETATM 3708 C  C2  . MAN D 2 .   ? -0.599  -12.305 -15.575 1.00 22.42 ? 1   MAN D C2  1 
HETATM 3709 C  C3  . MAN D 2 .   ? 0.160   -13.020 -14.445 1.00 24.70 ? 1   MAN D C3  1 
HETATM 3710 C  C4  . MAN D 2 .   ? -0.807  -13.400 -13.321 1.00 20.44 ? 1   MAN D C4  1 
HETATM 3711 C  C5  . MAN D 2 .   ? -1.945  -14.251 -13.902 1.00 21.62 ? 1   MAN D C5  1 
HETATM 3712 C  C6  . MAN D 2 .   ? -2.973  -14.681 -12.852 1.00 22.40 ? 1   MAN D C6  1 
HETATM 3713 O  O1  . MAN D 2 .   ? -1.346  -14.314 -16.633 1.00 29.05 ? 1   MAN D O1  1 
HETATM 3714 O  O2  . MAN D 2 .   ? -1.062  -11.023 -15.134 1.00 25.67 ? 1   MAN D O2  1 
HETATM 3715 O  O3  . MAN D 2 .   ? 1.196   -12.188 -13.930 1.00 23.12 ? 1   MAN D O3  1 
HETATM 3716 O  O4  . MAN D 2 .   ? -0.106  -14.141 -12.344 1.00 18.78 ? 1   MAN D O4  1 
HETATM 3717 O  O5  . MAN D 2 .   ? -2.644  -13.490 -14.917 1.00 24.62 ? 1   MAN D O5  1 
HETATM 3718 O  O6  . MAN D 2 .   ? -3.730  -13.571 -12.387 1.00 20.02 ? 1   MAN D O6  1 
HETATM 3719 C  C1  . NAG D 2 .   ? -0.420  -9.947  -15.739 1.00 27.09 ? 2   NAG D C1  1 
HETATM 3720 C  C2  . NAG D 2 .   ? -1.310  -8.707  -15.697 1.00 27.65 ? 2   NAG D C2  1 
HETATM 3721 C  C3  . NAG D 2 .   ? -0.538  -7.475  -16.206 1.00 29.76 ? 2   NAG D C3  1 
HETATM 3722 C  C4  . NAG D 2 .   ? 0.810   -7.347  -15.504 1.00 33.35 ? 2   NAG D C4  1 
HETATM 3723 C  C5  . NAG D 2 .   ? 1.577   -8.648  -15.636 1.00 31.77 ? 2   NAG D C5  1 
HETATM 3724 C  C6  . NAG D 2 .   ? 2.924   -8.606  -14.937 1.00 32.00 ? 2   NAG D C6  1 
HETATM 3725 C  C7  . NAG D 2 .   ? -3.660  -8.512  -16.234 1.00 31.83 ? 2   NAG D C7  1 
HETATM 3726 C  C8  . NAG D 2 .   ? -4.772  -8.823  -17.227 1.00 33.93 ? 2   NAG D C8  1 
HETATM 3727 N  N2  . NAG D 2 .   ? -2.449  -8.948  -16.560 1.00 29.43 ? 2   NAG D N2  1 
HETATM 3728 O  O3  . NAG D 2 .   ? -1.297  -6.306  -15.962 1.00 33.28 ? 2   NAG D O3  1 
HETATM 3729 O  O4  . NAG D 2 .   ? 1.565   -6.284  -16.080 1.00 37.73 ? 2   NAG D O4  1 
HETATM 3730 O  O5  . NAG D 2 .   ? 0.813   -9.723  -15.052 1.00 32.34 ? 2   NAG D O5  1 
HETATM 3731 O  O6  . NAG D 2 .   ? 3.637   -9.821  -15.120 1.00 38.27 ? 2   NAG D O6  1 
HETATM 3732 O  O7  . NAG D 2 .   ? -3.904  -7.888  -15.202 1.00 37.15 ? 2   NAG D O7  1 
HETATM 3733 MN MN  . MN  E 3 .   ? -1.173  31.689  32.588  1.00 17.92 ? 261 MN  A MN  1 
HETATM 3734 CA CA  . CA  F 4 .   ? 1.420   34.627  31.152  1.00 19.30 ? 263 CA  A CA  1 
HETATM 3735 MN MN  . MN  G 3 .   ? 6.061   -16.272 -5.327  1.00 15.50 ? 262 MN  B MN  1 
HETATM 3736 CA CA  . CA  H 4 .   ? 2.917   -16.002 -8.056  1.00 17.43 ? 264 CA  B CA  1 
HETATM 3737 O  O   . HOH I 5 .   ? -0.172  33.859  29.498  1.00 18.02 ? 264 HOH A O   1 
HETATM 3738 O  O   . HOH I 5 .   ? 3.227   34.472  29.570  1.00 19.23 ? 265 HOH A O   1 
HETATM 3739 O  O   . HOH I 5 .   ? -3.001  31.113  33.372  1.00 21.38 ? 266 HOH A O   1 
HETATM 3740 O  O   . HOH I 5 .   ? -2.077  31.866  30.496  1.00 19.38 ? 267 HOH A O   1 
HETATM 3741 O  O   . HOH I 5 .   ? -5.041  6.777   17.639  1.00 27.64 ? 268 HOH A O   1 
HETATM 3742 O  O   . HOH I 5 .   ? -8.574  3.317   13.148  1.00 28.45 ? 269 HOH A O   1 
HETATM 3743 O  O   . HOH I 5 .   ? -9.811  3.867   15.577  1.00 34.39 ? 270 HOH A O   1 
HETATM 3744 O  O   . HOH I 5 .   ? -4.898  -1.538  19.536  1.00 26.58 ? 271 HOH A O   1 
HETATM 3745 O  O   . HOH I 5 .   ? -3.863  -3.738  18.415  1.00 31.22 ? 272 HOH A O   1 
HETATM 3746 O  O   . HOH I 5 .   ? 14.109  10.243  18.658  1.00 26.29 ? 273 HOH A O   1 
HETATM 3747 O  O   . HOH I 5 .   ? 11.031  9.997   25.672  1.00 39.11 ? 274 HOH A O   1 
HETATM 3748 O  O   . HOH I 5 .   ? 9.899   16.307  10.370  1.00 30.76 ? 275 HOH A O   1 
HETATM 3749 O  O   . HOH I 5 .   ? 5.370   11.634  8.232   1.00 38.55 ? 276 HOH A O   1 
HETATM 3750 O  O   . HOH I 5 .   ? 1.346   28.100  11.418  1.00 34.77 ? 277 HOH A O   1 
HETATM 3751 O  O   . HOH I 5 .   ? 14.392  28.079  17.083  1.00 41.83 ? 278 HOH A O   1 
HETATM 3752 O  O   . HOH I 5 .   ? 17.356  16.360  23.813  1.00 34.89 ? 279 HOH A O   1 
HETATM 3753 O  O   . HOH I 5 .   ? 14.295  31.538  22.422  1.00 27.24 ? 280 HOH A O   1 
HETATM 3754 O  O   . HOH I 5 .   ? 13.045  33.962  23.129  1.00 25.84 ? 281 HOH A O   1 
HETATM 3755 O  O   . HOH I 5 .   ? 14.272  28.048  22.264  1.00 27.17 ? 282 HOH A O   1 
HETATM 3756 O  O   . HOH I 5 .   ? -4.169  27.265  18.301  1.00 35.26 ? 283 HOH A O   1 
HETATM 3757 O  O   . HOH I 5 .   ? -0.388  14.452  16.382  1.00 17.64 ? 284 HOH A O   1 
HETATM 3758 O  O   . HOH I 5 .   ? 4.138   8.339   27.410  1.00 37.82 ? 285 HOH A O   1 
HETATM 3759 O  O   . HOH I 5 .   ? 10.334  12.406  28.633  1.00 40.11 ? 286 HOH A O   1 
HETATM 3760 O  O   . HOH I 5 .   ? 14.059  25.459  33.291  1.00 21.79 ? 287 HOH A O   1 
HETATM 3761 O  O   . HOH I 5 .   ? -8.338  32.566  20.138  1.00 40.45 ? 288 HOH A O   1 
HETATM 3762 O  O   . HOH I 5 .   ? -17.955 37.210  22.196  1.00 52.25 ? 289 HOH A O   1 
HETATM 3763 O  O   . HOH I 5 .   ? 5.982   38.682  35.183  1.00 33.39 ? 290 HOH A O   1 
HETATM 3764 O  O   . HOH I 5 .   ? 8.759   36.590  34.750  1.00 40.09 ? 291 HOH A O   1 
HETATM 3765 O  O   . HOH I 5 .   ? -2.919  35.870  44.873  1.00 26.50 ? 292 HOH A O   1 
HETATM 3766 O  O   . HOH I 5 .   ? -9.018  27.806  30.119  1.00 22.98 ? 293 HOH A O   1 
HETATM 3767 O  O   . HOH I 5 .   ? -12.142 32.557  29.671  1.00 36.50 ? 294 HOH A O   1 
HETATM 3768 O  O   . HOH I 5 .   ? -6.930  31.162  36.186  1.00 30.04 ? 295 HOH A O   1 
HETATM 3769 O  O   . HOH I 5 .   ? -5.294  32.332  34.416  1.00 25.54 ? 296 HOH A O   1 
HETATM 3770 O  O   . HOH I 5 .   ? -1.502  27.307  43.875  1.00 27.75 ? 297 HOH A O   1 
HETATM 3771 O  O   . HOH I 5 .   ? 9.938   31.356  39.993  1.00 32.94 ? 298 HOH A O   1 
HETATM 3772 O  O   . HOH I 5 .   ? 16.493  30.389  38.346  1.00 42.91 ? 299 HOH A O   1 
HETATM 3773 O  O   . HOH I 5 .   ? 18.857  21.123  31.429  1.00 50.82 ? 300 HOH A O   1 
HETATM 3774 O  O   . HOH I 5 .   ? -0.016  12.643  35.459  1.00 25.53 ? 301 HOH A O   1 
HETATM 3775 O  O   . HOH I 5 .   ? -5.544  11.098  34.757  1.00 27.51 ? 302 HOH A O   1 
HETATM 3776 O  O   . HOH I 5 .   ? -14.838 10.019  29.187  1.00 43.63 ? 303 HOH A O   1 
HETATM 3777 O  O   . HOH I 5 .   ? -1.132  12.959  44.271  1.00 52.93 ? 304 HOH A O   1 
HETATM 3778 O  O   . HOH I 5 .   ? 0.458   14.170  45.860  1.00 41.84 ? 305 HOH A O   1 
HETATM 3779 O  O   . HOH I 5 .   ? -14.581 23.286  21.853  1.00 41.75 ? 306 HOH A O   1 
HETATM 3780 O  O   . HOH I 5 .   ? -15.224 14.739  15.077  1.00 38.59 ? 307 HOH A O   1 
HETATM 3781 O  O   . HOH I 5 .   ? -10.683 16.147  13.266  1.00 24.91 ? 308 HOH A O   1 
HETATM 3782 O  O   . HOH I 5 .   ? 17.068  26.140  27.440  1.00 49.44 ? 309 HOH A O   1 
HETATM 3783 O  O   . HOH I 5 .   ? 3.845   44.206  22.468  1.00 45.11 ? 310 HOH A O   1 
HETATM 3784 O  O   . HOH I 5 .   ? 6.686   43.820  29.001  1.00 41.67 ? 311 HOH A O   1 
HETATM 3785 O  O   . HOH I 5 .   ? 3.680   43.414  30.324  1.00 39.79 ? 312 HOH A O   1 
HETATM 3786 O  O   . HOH I 5 .   ? 2.390   37.983  17.610  1.00 36.87 ? 313 HOH A O   1 
HETATM 3787 O  O   . HOH I 5 .   ? 5.589   36.986  20.311  1.00 40.33 ? 314 HOH A O   1 
HETATM 3788 O  O   . HOH I 5 .   ? -6.059  6.491   20.413  1.00 19.85 ? 315 HOH A O   1 
HETATM 3789 O  O   . HOH I 5 .   ? -6.984  -1.752  21.285  1.00 47.70 ? 316 HOH A O   1 
HETATM 3790 O  O   . HOH I 5 .   ? 5.619   5.879   23.891  1.00 37.17 ? 317 HOH A O   1 
HETATM 3791 O  O   . HOH I 5 .   ? 15.438  10.973  27.316  1.00 43.79 ? 318 HOH A O   1 
HETATM 3792 O  O   . HOH I 5 .   ? 17.446  9.364   20.450  1.00 42.30 ? 319 HOH A O   1 
HETATM 3793 O  O   . HOH I 5 .   ? 7.312   20.988  8.952   1.00 37.98 ? 320 HOH A O   1 
HETATM 3794 O  O   . HOH I 5 .   ? 1.608   23.641  9.312   1.00 40.86 ? 321 HOH A O   1 
HETATM 3795 O  O   . HOH I 5 .   ? 10.265  35.593  14.718  1.00 50.41 ? 322 HOH A O   1 
HETATM 3796 O  O   . HOH I 5 .   ? 15.037  21.856  12.316  1.00 38.94 ? 323 HOH A O   1 
HETATM 3797 O  O   . HOH I 5 .   ? 12.844  43.076  23.940  1.00 45.05 ? 324 HOH A O   1 
HETATM 3798 O  O   . HOH I 5 .   ? 15.835  40.539  21.160  1.00 45.92 ? 325 HOH A O   1 
HETATM 3799 O  O   . HOH I 5 .   ? 7.473   33.368  14.026  1.00 53.71 ? 326 HOH A O   1 
HETATM 3800 O  O   . HOH I 5 .   ? -7.610  15.814  8.544   1.00 49.05 ? 327 HOH A O   1 
HETATM 3801 O  O   . HOH I 5 .   ? -1.726  21.507  11.370  1.00 33.62 ? 328 HOH A O   1 
HETATM 3802 O  O   . HOH I 5 .   ? -5.360  27.732  15.742  1.00 52.43 ? 329 HOH A O   1 
HETATM 3803 O  O   . HOH I 5 .   ? 2.202   26.700  9.424   1.00 50.96 ? 330 HOH A O   1 
HETATM 3804 O  O   . HOH I 5 .   ? -6.995  29.167  19.389  1.00 38.79 ? 331 HOH A O   1 
HETATM 3805 O  O   . HOH I 5 .   ? -11.684 36.921  24.359  1.00 42.25 ? 332 HOH A O   1 
HETATM 3806 O  O   . HOH I 5 .   ? -8.728  27.093  18.285  1.00 43.18 ? 333 HOH A O   1 
HETATM 3807 O  O   . HOH I 5 .   ? 2.732   46.032  34.928  1.00 38.52 ? 334 HOH A O   1 
HETATM 3808 O  O   . HOH I 5 .   ? 1.675   42.776  37.672  1.00 28.18 ? 335 HOH A O   1 
HETATM 3809 O  O   . HOH I 5 .   ? -5.672  41.029  36.390  1.00 44.81 ? 336 HOH A O   1 
HETATM 3810 O  O   . HOH I 5 .   ? 0.483   44.736  39.167  1.00 34.30 ? 337 HOH A O   1 
HETATM 3811 O  O   . HOH I 5 .   ? -2.737  28.963  41.842  1.00 33.41 ? 338 HOH A O   1 
HETATM 3812 O  O   . HOH I 5 .   ? -11.379 30.116  32.298  1.00 42.75 ? 339 HOH A O   1 
HETATM 3813 O  O   . HOH I 5 .   ? -6.843  27.392  40.006  1.00 39.60 ? 340 HOH A O   1 
HETATM 3814 O  O   . HOH I 5 .   ? -6.204  30.238  38.746  1.00 40.38 ? 341 HOH A O   1 
HETATM 3815 O  O   . HOH I 5 .   ? 2.637   25.123  44.420  1.00 41.22 ? 342 HOH A O   1 
HETATM 3816 O  O   . HOH I 5 .   ? 11.894  26.445  34.902  1.00 30.75 ? 343 HOH A O   1 
HETATM 3817 O  O   . HOH I 5 .   ? 17.497  32.877  37.148  1.00 52.41 ? 344 HOH A O   1 
HETATM 3818 O  O   . HOH I 5 .   ? 21.292  31.290  31.866  1.00 49.50 ? 345 HOH A O   1 
HETATM 3819 O  O   . HOH I 5 .   ? 15.751  19.380  37.330  1.00 26.50 ? 346 HOH A O   1 
HETATM 3820 O  O   . HOH I 5 .   ? -9.252  3.783   33.048  1.00 50.95 ? 347 HOH A O   1 
HETATM 3821 O  O   . HOH I 5 .   ? -8.460  9.508   37.619  1.00 40.50 ? 348 HOH A O   1 
HETATM 3822 O  O   . HOH I 5 .   ? -15.198 11.988  37.729  1.00 43.02 ? 349 HOH A O   1 
HETATM 3823 O  O   . HOH I 5 .   ? -14.217 12.348  28.104  1.00 38.31 ? 350 HOH A O   1 
HETATM 3824 O  O   . HOH I 5 .   ? -2.077  15.726  39.571  1.00 37.56 ? 351 HOH A O   1 
HETATM 3825 O  O   . HOH I 5 .   ? 6.887   14.135  36.862  1.00 30.69 ? 352 HOH A O   1 
HETATM 3826 O  O   . HOH I 5 .   ? 12.433  14.877  37.636  1.00 39.81 ? 353 HOH A O   1 
HETATM 3827 O  O   . HOH I 5 .   ? 16.753  20.328  40.713  1.00 42.34 ? 354 HOH A O   1 
HETATM 3828 O  O   . HOH I 5 .   ? 14.148  16.746  35.800  1.00 36.21 ? 355 HOH A O   1 
HETATM 3829 O  O   . HOH I 5 .   ? 16.504  16.371  47.095  1.00 36.02 ? 356 HOH A O   1 
HETATM 3830 O  O   . HOH I 5 .   ? 1.469   20.730  43.987  1.00 29.66 ? 357 HOH A O   1 
HETATM 3831 O  O   . HOH I 5 .   ? 3.367   13.317  46.721  1.00 52.28 ? 358 HOH A O   1 
HETATM 3832 O  O   . HOH I 5 .   ? -5.491  20.410  41.266  1.00 38.24 ? 359 HOH A O   1 
HETATM 3833 O  O   . HOH I 5 .   ? -12.291 19.532  38.080  1.00 42.56 ? 360 HOH A O   1 
HETATM 3834 O  O   . HOH I 5 .   ? -16.674 17.886  19.912  1.00 44.97 ? 361 HOH A O   1 
HETATM 3835 O  O   . HOH I 5 .   ? -12.637 14.188  13.321  1.00 37.45 ? 362 HOH A O   1 
HETATM 3836 O  O   . HOH I 5 .   ? 11.052  7.027   24.453  1.00 43.96 ? 363 HOH A O   1 
HETATM 3837 O  O   . HOH I 5 .   ? 18.713  8.756   10.235  1.00 44.27 ? 364 HOH A O   1 
HETATM 3838 O  O   . HOH I 5 .   ? -0.158  21.968  9.131   1.00 55.14 ? 365 HOH A O   1 
HETATM 3839 O  O   . HOH I 5 .   ? -9.163  14.910  10.654  1.00 42.26 ? 366 HOH A O   1 
HETATM 3840 O  O   . HOH I 5 .   ? -15.374 -1.764  19.169  1.00 54.34 ? 367 HOH A O   1 
HETATM 3841 O  O   . HOH I 5 .   ? -10.967 19.190  12.352  1.00 47.97 ? 368 HOH A O   1 
HETATM 3842 O  O   . HOH I 5 .   ? -6.150  38.458  11.062  1.00 50.33 ? 369 HOH A O   1 
HETATM 3843 O  O   . HOH I 5 .   ? -6.566  39.248  24.767  1.00 48.77 ? 370 HOH A O   1 
HETATM 3844 O  O   . HOH I 5 .   ? -19.183 35.072  19.538  1.00 56.64 ? 371 HOH A O   1 
HETATM 3845 O  O   . HOH I 5 .   ? -15.050 25.572  27.237  1.00 49.83 ? 372 HOH A O   1 
HETATM 3846 O  O   . HOH I 5 .   ? 11.473  25.560  44.782  1.00 47.33 ? 373 HOH A O   1 
HETATM 3847 O  O   . HOH I 5 .   ? 8.046   24.498  45.743  1.00 50.15 ? 374 HOH A O   1 
HETATM 3848 O  O   . HOH I 5 .   ? 6.112   22.491  45.119  1.00 34.99 ? 375 HOH A O   1 
HETATM 3849 O  O   . HOH I 5 .   ? 18.409  19.755  34.813  1.00 45.37 ? 376 HOH A O   1 
HETATM 3850 O  O   . HOH I 5 .   ? 18.451  17.008  35.418  1.00 53.86 ? 377 HOH A O   1 
HETATM 3851 O  O   . HOH I 5 .   ? -14.691 19.952  35.911  1.00 50.27 ? 378 HOH A O   1 
HETATM 3852 O  O   . HOH J 5 .   ? 4.353   -14.089 -8.010  1.00 18.83 ? 265 HOH B O   1 
HETATM 3853 O  O   . HOH J 5 .   ? 0.962   -14.678 -8.059  1.00 16.49 ? 266 HOH B O   1 
HETATM 3854 O  O   . HOH J 5 .   ? 6.592   -14.431 -6.072  1.00 19.37 ? 267 HOH B O   1 
HETATM 3855 O  O   . HOH J 5 .   ? 8.242   -16.621 -4.943  1.00 18.25 ? 268 HOH B O   1 
HETATM 3856 O  O   . HOH J 5 .   ? -6.168  6.142   10.519  1.00 23.06 ? 269 HOH B O   1 
HETATM 3857 O  O   . HOH J 5 .   ? -8.441  0.741   14.332  1.00 19.30 ? 270 HOH B O   1 
HETATM 3858 O  O   . HOH J 5 .   ? 6.675   4.228   21.621  1.00 39.27 ? 271 HOH B O   1 
HETATM 3859 O  O   . HOH J 5 .   ? 10.425  12.278  12.946  1.00 23.48 ? 272 HOH B O   1 
HETATM 3860 O  O   . HOH J 5 .   ? 13.559  10.784  15.738  1.00 35.30 ? 273 HOH B O   1 
HETATM 3861 O  O   . HOH J 5 .   ? -1.940  11.632  9.057   1.00 37.07 ? 274 HOH B O   1 
HETATM 3862 O  O   . HOH J 5 .   ? 11.909  5.363   22.514  1.00 41.05 ? 275 HOH B O   1 
HETATM 3863 O  O   . HOH J 5 .   ? -8.338  -8.070  16.018  1.00 39.70 ? 276 HOH B O   1 
HETATM 3864 O  O   . HOH J 5 .   ? -6.408  7.657   5.909   1.00 29.09 ? 277 HOH B O   1 
HETATM 3865 O  O   . HOH J 5 .   ? 0.445   7.748   -2.706  1.00 40.53 ? 278 HOH B O   1 
HETATM 3866 O  O   . HOH J 5 .   ? -4.744  7.957   0.668   1.00 35.61 ? 279 HOH B O   1 
HETATM 3867 O  O   . HOH J 5 .   ? 0.631   4.419   -6.574  1.00 33.89 ? 280 HOH B O   1 
HETATM 3868 O  O   . HOH J 5 .   ? -11.668 -6.286  10.344  1.00 24.01 ? 281 HOH B O   1 
HETATM 3869 O  O   . HOH J 5 .   ? -10.246 -7.366  -1.763  1.00 20.96 ? 282 HOH B O   1 
HETATM 3870 O  O   . HOH J 5 .   ? -10.714 -8.422  -5.070  1.00 18.95 ? 283 HOH B O   1 
HETATM 3871 O  O   . HOH J 5 .   ? -9.619  -9.470  -7.563  1.00 21.30 ? 284 HOH B O   1 
HETATM 3872 O  O   . HOH J 5 .   ? -13.299 -9.959  -13.778 1.00 38.74 ? 285 HOH B O   1 
HETATM 3873 O  O   . HOH J 5 .   ? 4.774   3.657   7.508   1.00 17.56 ? 286 HOH B O   1 
HETATM 3874 O  O   . HOH J 5 .   ? 10.507  4.990   14.275  1.00 27.03 ? 287 HOH B O   1 
HETATM 3875 O  O   . HOH J 5 .   ? 11.956  2.604   15.139  1.00 20.57 ? 288 HOH B O   1 
HETATM 3876 O  O   . HOH J 5 .   ? 3.842   -8.330  18.224  1.00 46.62 ? 289 HOH B O   1 
HETATM 3877 O  O   . HOH J 5 .   ? -7.993  -17.268 3.322   1.00 18.36 ? 290 HOH B O   1 
HETATM 3878 O  O   . HOH J 5 .   ? -16.330 -20.602 -10.505 1.00 33.82 ? 291 HOH B O   1 
HETATM 3879 O  O   . HOH J 5 .   ? -12.234 -21.912 -11.750 1.00 27.17 ? 292 HOH B O   1 
HETATM 3880 O  O   . HOH J 5 .   ? -8.952  -24.834 -5.731  1.00 20.67 ? 293 HOH B O   1 
HETATM 3881 O  O   . HOH J 5 .   ? -8.880  -20.202 -5.438  1.00 28.49 ? 294 HOH B O   1 
HETATM 3882 O  O   . HOH J 5 .   ? 7.029   -0.943  -5.046  1.00 32.59 ? 295 HOH B O   1 
HETATM 3883 O  O   . HOH J 5 .   ? 10.035  -2.064  -6.796  1.00 38.01 ? 296 HOH B O   1 
HETATM 3884 O  O   . HOH J 5 .   ? 14.309  -8.109  -14.287 1.00 39.22 ? 297 HOH B O   1 
HETATM 3885 O  O   . HOH J 5 .   ? -1.296  -21.544 -10.077 1.00 27.43 ? 298 HOH B O   1 
HETATM 3886 O  O   . HOH J 5 .   ? 9.191   -21.809 -14.666 1.00 56.48 ? 299 HOH B O   1 
HETATM 3887 O  O   . HOH J 5 .   ? 10.277  -17.643 -6.191  1.00 26.55 ? 300 HOH B O   1 
HETATM 3888 O  O   . HOH J 5 .   ? 13.733  -12.035 -3.400  1.00 25.34 ? 301 HOH B O   1 
HETATM 3889 O  O   . HOH J 5 .   ? 18.387  -2.136  -2.084  1.00 39.34 ? 302 HOH B O   1 
HETATM 3890 O  O   . HOH J 5 .   ? 16.491  -12.430 -8.464  1.00 37.31 ? 303 HOH B O   1 
HETATM 3891 O  O   . HOH J 5 .   ? 12.512  -18.750 -5.049  1.00 27.75 ? 304 HOH B O   1 
HETATM 3892 O  O   . HOH J 5 .   ? 12.735  -23.280 2.381   1.00 31.15 ? 305 HOH B O   1 
HETATM 3893 O  O   . HOH J 5 .   ? 8.314   -25.958 2.240   1.00 34.69 ? 306 HOH B O   1 
HETATM 3894 O  O   . HOH J 5 .   ? -10.068 -23.830 0.389   1.00 19.33 ? 307 HOH B O   1 
HETATM 3895 O  O   . HOH J 5 .   ? -15.195 -20.025 1.145   1.00 23.78 ? 308 HOH B O   1 
HETATM 3896 O  O   . HOH J 5 .   ? -12.254 -23.084 3.848   1.00 30.98 ? 309 HOH B O   1 
HETATM 3897 O  O   . HOH J 5 .   ? -6.254  -17.687 12.151  1.00 25.45 ? 310 HOH B O   1 
HETATM 3898 O  O   . HOH J 5 .   ? -8.329  -19.907 10.104  1.00 21.28 ? 311 HOH B O   1 
HETATM 3899 O  O   . HOH J 5 .   ? -0.002  -14.297 15.302  1.00 35.60 ? 312 HOH B O   1 
HETATM 3900 O  O   . HOH J 5 .   ? 1.082   -16.435 13.814  1.00 24.06 ? 313 HOH B O   1 
HETATM 3901 O  O   . HOH J 5 .   ? 7.828   -14.043 13.828  1.00 25.44 ? 314 HOH B O   1 
HETATM 3902 O  O   . HOH J 5 .   ? 13.220  -12.272 14.422  1.00 25.02 ? 315 HOH B O   1 
HETATM 3903 O  O   . HOH J 5 .   ? 21.617  -5.552  12.464  1.00 35.20 ? 316 HOH B O   1 
HETATM 3904 O  O   . HOH J 5 .   ? 20.574  -5.126  9.882   1.00 30.95 ? 317 HOH B O   1 
HETATM 3905 O  O   . HOH J 5 .   ? 16.780  -13.871 16.309  1.00 43.68 ? 318 HOH B O   1 
HETATM 3906 O  O   . HOH J 5 .   ? 15.491  -17.350 13.449  1.00 39.32 ? 319 HOH B O   1 
HETATM 3907 O  O   . HOH J 5 .   ? -4.426  -18.470 14.069  1.00 24.59 ? 320 HOH B O   1 
HETATM 3908 O  O   . HOH J 5 .   ? -3.669  -21.546 15.823  1.00 25.00 ? 321 HOH B O   1 
HETATM 3909 O  O   . HOH J 5 .   ? 21.295  -11.446 3.250   1.00 41.71 ? 322 HOH B O   1 
HETATM 3910 O  O   . HOH J 5 .   ? 19.080  6.805   4.261   1.00 32.70 ? 323 HOH B O   1 
HETATM 3911 O  O   . HOH J 5 .   ? 14.045  7.557   3.353   1.00 32.41 ? 324 HOH B O   1 
HETATM 3912 O  O   . HOH J 5 .   ? -11.639 -11.955 1.432   1.00 34.97 ? 325 HOH B O   1 
HETATM 3913 O  O   . HOH J 5 .   ? -2.330  -7.295  15.723  1.00 38.27 ? 326 HOH B O   1 
HETATM 3914 O  O   . HOH J 5 .   ? 3.534   -5.884  19.464  1.00 40.58 ? 327 HOH B O   1 
HETATM 3915 O  O   . HOH J 5 .   ? -2.168  -10.511 -19.080 1.00 42.63 ? 328 HOH B O   1 
HETATM 3916 O  O   . HOH J 5 .   ? -3.221  -6.806  -12.266 1.00 45.64 ? 329 HOH B O   1 
HETATM 3917 O  O   . HOH J 5 .   ? -0.344  -3.945  -14.188 1.00 37.52 ? 330 HOH B O   1 
HETATM 3918 O  O   . HOH J 5 .   ? 3.526   -7.062  -18.603 1.00 52.09 ? 331 HOH B O   1 
HETATM 3919 O  O   . HOH J 5 .   ? 1.502   10.992  9.283   1.00 32.35 ? 332 HOH B O   1 
HETATM 3920 O  O   . HOH J 5 .   ? 0.081   -23.802 15.995  1.00 34.93 ? 333 HOH B O   1 
HETATM 3921 O  O   . HOH J 5 .   ? -14.040 12.564  11.455  1.00 50.83 ? 334 HOH B O   1 
HETATM 3922 O  O   . HOH J 5 .   ? 12.454  9.994   4.262   1.00 42.74 ? 335 HOH B O   1 
HETATM 3923 O  O   . HOH J 5 .   ? 10.158  12.810  3.718   1.00 53.74 ? 336 HOH B O   1 
HETATM 3924 O  O   . HOH J 5 .   ? -5.847  12.293  6.731   1.00 45.96 ? 337 HOH B O   1 
HETATM 3925 O  O   . HOH J 5 .   ? -9.648  11.166  5.318   1.00 56.32 ? 338 HOH B O   1 
HETATM 3926 O  O   . HOH J 5 .   ? -5.639  -7.745  16.586  1.00 50.46 ? 339 HOH B O   1 
HETATM 3927 O  O   . HOH J 5 .   ? -4.298  -5.568  16.104  1.00 38.85 ? 340 HOH B O   1 
HETATM 3928 O  O   . HOH J 5 .   ? -5.861  -6.139  19.092  1.00 42.32 ? 341 HOH B O   1 
HETATM 3929 O  O   . HOH J 5 .   ? -10.611 -8.077  13.225  1.00 41.67 ? 342 HOH B O   1 
HETATM 3930 O  O   . HOH J 5 .   ? -16.828 1.832   9.932   1.00 43.15 ? 343 HOH B O   1 
HETATM 3931 O  O   . HOH J 5 .   ? -19.203 3.203   6.068   1.00 54.06 ? 344 HOH B O   1 
HETATM 3932 O  O   . HOH J 5 .   ? -2.834  5.530   -6.462  1.00 42.74 ? 345 HOH B O   1 
HETATM 3933 O  O   . HOH J 5 .   ? -7.801  3.656   -3.271  1.00 47.95 ? 346 HOH B O   1 
HETATM 3934 O  O   . HOH J 5 .   ? -11.189 -2.380  -3.128  1.00 33.82 ? 347 HOH B O   1 
HETATM 3935 O  O   . HOH J 5 .   ? -11.825 3.588   1.852   1.00 39.92 ? 348 HOH B O   1 
HETATM 3936 O  O   . HOH J 5 .   ? -11.505 5.457   4.276   1.00 51.47 ? 349 HOH B O   1 
HETATM 3937 O  O   . HOH J 5 .   ? -15.301 3.208   3.327   1.00 53.35 ? 350 HOH B O   1 
HETATM 3938 O  O   . HOH J 5 .   ? -16.620 -0.160  6.939   1.00 45.91 ? 351 HOH B O   1 
HETATM 3939 O  O   . HOH J 5 .   ? -13.507 -2.497  -3.985  1.00 44.00 ? 352 HOH B O   1 
HETATM 3940 O  O   . HOH J 5 .   ? 9.762   -25.847 4.935   1.00 39.88 ? 353 HOH B O   1 
HETATM 3941 O  O   . HOH J 5 .   ? -15.459 -11.221 -11.970 1.00 50.73 ? 354 HOH B O   1 
HETATM 3942 O  O   . HOH J 5 .   ? -10.004 -12.584 -16.400 1.00 40.94 ? 355 HOH B O   1 
HETATM 3943 O  O   . HOH J 5 .   ? -6.207  -5.535  -18.373 1.00 52.08 ? 356 HOH B O   1 
HETATM 3944 O  O   . HOH J 5 .   ? -5.938  -25.796 0.120   1.00 40.45 ? 357 HOH B O   1 
HETATM 3945 O  O   . HOH J 5 .   ? -6.474  -24.226 -2.684  1.00 40.38 ? 358 HOH B O   1 
HETATM 3946 O  O   . HOH J 5 .   ? -11.198 -17.793 9.793   1.00 40.30 ? 359 HOH B O   1 
HETATM 3947 O  O   . HOH J 5 .   ? 22.993  -14.021 12.681  1.00 33.27 ? 360 HOH B O   1 
HETATM 3948 O  O   . HOH J 5 .   ? 21.498  -16.406 11.198  1.00 51.26 ? 361 HOH B O   1 
HETATM 3949 O  O   . HOH J 5 .   ? 10.147  -18.461 11.753  1.00 37.06 ? 362 HOH B O   1 
HETATM 3950 O  O   . HOH J 5 .   ? 1.248   -27.534 11.612  1.00 39.30 ? 363 HOH B O   1 
HETATM 3951 O  O   . HOH J 5 .   ? 5.377   -25.492 4.951   1.00 35.58 ? 364 HOH B O   1 
HETATM 3952 O  O   . HOH J 5 .   ? 21.039  -14.924 4.458   1.00 32.67 ? 365 HOH B O   1 
HETATM 3953 O  O   . HOH J 5 .   ? 21.952  -9.028  3.889   1.00 41.32 ? 366 HOH B O   1 
HETATM 3954 O  O   . HOH J 5 .   ? 24.260  0.844   4.186   1.00 46.75 ? 367 HOH B O   1 
HETATM 3955 O  O   . HOH J 5 .   ? -16.932 -18.236 -11.628 1.00 43.74 ? 368 HOH B O   1 
HETATM 3956 O  O   . HOH J 5 .   ? -3.700  -16.891 -16.518 1.00 44.66 ? 369 HOH B O   1 
HETATM 3957 O  O   . HOH J 5 .   ? 1.571   -11.217 -18.803 1.00 55.64 ? 370 HOH B O   1 
HETATM 3958 O  O   . HOH J 5 .   ? 4.429   6.767   -0.699  1.00 36.76 ? 371 HOH B O   1 
HETATM 3959 O  O   . HOH J 5 .   ? -5.570  -18.582 2.551   1.00 26.61 ? 372 HOH B O   1 
HETATM 3960 O  O   . HOH J 5 .   ? -10.036 -22.758 -4.269  1.00 26.19 ? 373 HOH B O   1 
HETATM 3961 O  O   . HOH J 5 .   ? -8.541  -22.653 -1.836  1.00 22.52 ? 374 HOH B O   1 
HETATM 3962 O  O   . HOH J 5 .   ? -5.149  -20.469 -5.929  1.00 28.17 ? 375 HOH B O   1 
HETATM 3963 O  O   . HOH J 5 .   ? 12.036  -25.416 3.299   1.00 33.15 ? 376 HOH B O   1 
HETATM 3964 O  O   . HOH J 5 .   ? -8.394  -25.876 0.827   1.00 40.11 ? 377 HOH B O   1 
HETATM 3965 O  O   . HOH J 5 .   ? 16.579  7.899   4.912   1.00 47.07 ? 378 HOH B O   1 
HETATM 3966 O  O   . HOH J 5 .   ? 14.564  7.436   0.616   1.00 41.09 ? 379 HOH B O   1 
HETATM 3967 O  O   . HOH J 5 .   ? 20.530  0.978   2.302   1.00 41.36 ? 380 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   1   1   GLN GLN A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ASP 37  37  37  ASP ASN A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  TRP 59  59  59  TRP TRP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 ?   ?   ?   A . n 
A 1 242 GLN 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 LYS 244 244 ?   ?   ?   A . n 
A 1 245 GLY 245 245 ?   ?   ?   A . n 
A 1 246 GLU 246 246 ?   ?   ?   A . n 
A 1 247 ASN 247 247 ?   ?   ?   A . n 
A 1 248 LEU 248 248 ?   ?   ?   A . n 
A 1 249 ALA 249 249 ?   ?   ?   A . n 
A 1 250 LEU 250 250 ?   ?   ?   A . n 
A 1 251 GLU 251 251 ?   ?   ?   A . n 
A 1 252 MET 252 252 ?   ?   ?   A . n 
B 1 1   GLN 1   1   1   GLN GLN B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  PHE 20  20  20  PHE PHE B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  GLN 25  25  25  GLN GLN B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  ASN 28  28  28  ASN ASN B . n 
B 1 29  ASN 29  29  29  ASN ASN B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  ASN 41  41  41  ASN ASN B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PHE 52  52  52  PHE PHE B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  HIS 57  57  57  HIS HIS B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  TRP 59  59  59  TRP TRP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  PHE 73  73  73  PHE PHE B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 THR 115 115 115 THR THR B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 GLN 117 117 117 GLN GLN B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 THR 119 119 119 THR THR B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 ASN 138 138 138 ASN ASN B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 ASN 143 143 143 ASN ASN B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 HIS 146 146 146 HIS HIS B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 SER 153 153 153 SER SER B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 THR 159 159 159 THR THR B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 TRP 162 162 162 TRP TRP B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 ARG 164 164 164 ARG ARG B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 GLN 168 168 168 GLN GLN B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ASN 171 171 171 ASN ASN B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 PHE 176 176 176 PHE PHE B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 ASN 182 182 182 ASN ASN B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 THR 188 188 188 THR THR B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 ASP 191 191 191 ASP ASP B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 TYR 199 199 199 TYR TYR B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 ASP 202 202 202 ASP ASP B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 PRO 208 208 208 PRO PRO B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 TRP 210 210 210 TRP TRP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 PHE 215 215 215 PHE PHE B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 ALA 218 218 218 ALA ALA B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 GLN 222 222 222 GLN GLN B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 THR 225 225 225 THR THR B . n 
B 1 226 HIS 226 226 226 HIS HIS B . n 
B 1 227 THR 227 227 227 THR THR B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 GLU 229 229 229 GLU GLU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 TRP 231 231 231 TRP TRP B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 PHE 233 233 233 PHE PHE B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 LEU 238 238 238 LEU LEU B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 ALA 241 241 ?   ?   ?   B . n 
B 1 242 GLN 242 242 ?   ?   ?   B . n 
B 1 243 LYS 243 243 ?   ?   ?   B . n 
B 1 244 LYS 244 244 ?   ?   ?   B . n 
B 1 245 GLY 245 245 ?   ?   ?   B . n 
B 1 246 GLU 246 246 ?   ?   ?   B . n 
B 1 247 ASN 247 247 ?   ?   ?   B . n 
B 1 248 LEU 248 248 ?   ?   ?   B . n 
B 1 249 ALA 249 249 ?   ?   ?   B . n 
B 1 250 LEU 250 250 ?   ?   ?   B . n 
B 1 251 GLU 251 251 ?   ?   ?   B . n 
B 1 252 MET 252 252 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MN  1   261 261 MN  MN  A . 
F 4 CA  1   263 262 CA  CA  A . 
G 3 MN  1   262 261 MN  MN  B . 
H 4 CA  1   264 262 CA  CA  B . 
I 5 HOH 1   264 1   HOH WAT A . 
I 5 HOH 2   265 2   HOH WAT A . 
I 5 HOH 3   266 3   HOH WAT A . 
I 5 HOH 4   267 4   HOH WAT A . 
I 5 HOH 5   268 9   HOH WAT A . 
I 5 HOH 6   269 11  HOH WAT A . 
I 5 HOH 7   270 13  HOH WAT A . 
I 5 HOH 8   271 14  HOH WAT A . 
I 5 HOH 9   272 15  HOH WAT A . 
I 5 HOH 10  273 17  HOH WAT A . 
I 5 HOH 11  274 18  HOH WAT A . 
I 5 HOH 12  275 19  HOH WAT A . 
I 5 HOH 13  276 22  HOH WAT A . 
I 5 HOH 14  277 23  HOH WAT A . 
I 5 HOH 15  278 24  HOH WAT A . 
I 5 HOH 16  279 25  HOH WAT A . 
I 5 HOH 17  280 26  HOH WAT A . 
I 5 HOH 18  281 27  HOH WAT A . 
I 5 HOH 19  282 28  HOH WAT A . 
I 5 HOH 20  283 29  HOH WAT A . 
I 5 HOH 21  284 30  HOH WAT A . 
I 5 HOH 22  285 32  HOH WAT A . 
I 5 HOH 23  286 33  HOH WAT A . 
I 5 HOH 24  287 34  HOH WAT A . 
I 5 HOH 25  288 35  HOH WAT A . 
I 5 HOH 26  289 36  HOH WAT A . 
I 5 HOH 27  290 37  HOH WAT A . 
I 5 HOH 28  291 38  HOH WAT A . 
I 5 HOH 29  292 39  HOH WAT A . 
I 5 HOH 30  293 40  HOH WAT A . 
I 5 HOH 31  294 41  HOH WAT A . 
I 5 HOH 32  295 42  HOH WAT A . 
I 5 HOH 33  296 43  HOH WAT A . 
I 5 HOH 34  297 44  HOH WAT A . 
I 5 HOH 35  298 45  HOH WAT A . 
I 5 HOH 36  299 46  HOH WAT A . 
I 5 HOH 37  300 47  HOH WAT A . 
I 5 HOH 38  301 48  HOH WAT A . 
I 5 HOH 39  302 49  HOH WAT A . 
I 5 HOH 40  303 50  HOH WAT A . 
I 5 HOH 41  304 51  HOH WAT A . 
I 5 HOH 42  305 52  HOH WAT A . 
I 5 HOH 43  306 53  HOH WAT A . 
I 5 HOH 44  307 54  HOH WAT A . 
I 5 HOH 45  308 55  HOH WAT A . 
I 5 HOH 46  309 56  HOH WAT A . 
I 5 HOH 47  310 110 HOH WAT A . 
I 5 HOH 48  311 111 HOH WAT A . 
I 5 HOH 49  312 112 HOH WAT A . 
I 5 HOH 50  313 113 HOH WAT A . 
I 5 HOH 51  314 114 HOH WAT A . 
I 5 HOH 52  315 119 HOH WAT A . 
I 5 HOH 53  316 120 HOH WAT A . 
I 5 HOH 54  317 121 HOH WAT A . 
I 5 HOH 55  318 122 HOH WAT A . 
I 5 HOH 56  319 123 HOH WAT A . 
I 5 HOH 57  320 125 HOH WAT A . 
I 5 HOH 58  321 126 HOH WAT A . 
I 5 HOH 59  322 127 HOH WAT A . 
I 5 HOH 60  323 128 HOH WAT A . 
I 5 HOH 61  324 129 HOH WAT A . 
I 5 HOH 62  325 130 HOH WAT A . 
I 5 HOH 63  326 131 HOH WAT A . 
I 5 HOH 64  327 132 HOH WAT A . 
I 5 HOH 65  328 133 HOH WAT A . 
I 5 HOH 66  329 134 HOH WAT A . 
I 5 HOH 67  330 135 HOH WAT A . 
I 5 HOH 68  331 136 HOH WAT A . 
I 5 HOH 69  332 137 HOH WAT A . 
I 5 HOH 70  333 138 HOH WAT A . 
I 5 HOH 71  334 139 HOH WAT A . 
I 5 HOH 72  335 140 HOH WAT A . 
I 5 HOH 73  336 141 HOH WAT A . 
I 5 HOH 74  337 142 HOH WAT A . 
I 5 HOH 75  338 143 HOH WAT A . 
I 5 HOH 76  339 144 HOH WAT A . 
I 5 HOH 77  340 145 HOH WAT A . 
I 5 HOH 78  341 146 HOH WAT A . 
I 5 HOH 79  342 147 HOH WAT A . 
I 5 HOH 80  343 148 HOH WAT A . 
I 5 HOH 81  344 149 HOH WAT A . 
I 5 HOH 82  345 150 HOH WAT A . 
I 5 HOH 83  346 151 HOH WAT A . 
I 5 HOH 84  347 152 HOH WAT A . 
I 5 HOH 85  348 153 HOH WAT A . 
I 5 HOH 86  349 154 HOH WAT A . 
I 5 HOH 87  350 155 HOH WAT A . 
I 5 HOH 88  351 156 HOH WAT A . 
I 5 HOH 89  352 157 HOH WAT A . 
I 5 HOH 90  353 158 HOH WAT A . 
I 5 HOH 91  354 159 HOH WAT A . 
I 5 HOH 92  355 160 HOH WAT A . 
I 5 HOH 93  356 161 HOH WAT A . 
I 5 HOH 94  357 163 HOH WAT A . 
I 5 HOH 95  358 164 HOH WAT A . 
I 5 HOH 96  359 165 HOH WAT A . 
I 5 HOH 97  360 166 HOH WAT A . 
I 5 HOH 98  361 167 HOH WAT A . 
I 5 HOH 99  362 168 HOH WAT A . 
I 5 HOH 100 363 170 HOH WAT A . 
I 5 HOH 101 364 171 HOH WAT A . 
I 5 HOH 102 365 174 HOH WAT A . 
I 5 HOH 103 366 175 HOH WAT A . 
I 5 HOH 104 367 176 HOH WAT A . 
I 5 HOH 105 368 179 HOH WAT A . 
I 5 HOH 106 369 180 HOH WAT A . 
I 5 HOH 107 370 181 HOH WAT A . 
I 5 HOH 108 371 182 HOH WAT A . 
I 5 HOH 109 372 183 HOH WAT A . 
I 5 HOH 110 373 184 HOH WAT A . 
I 5 HOH 111 374 185 HOH WAT A . 
I 5 HOH 112 375 186 HOH WAT A . 
I 5 HOH 113 376 187 HOH WAT A . 
I 5 HOH 114 377 188 HOH WAT A . 
I 5 HOH 115 378 189 HOH WAT A . 
J 5 HOH 1   265 5   HOH WAT B . 
J 5 HOH 2   266 6   HOH WAT B . 
J 5 HOH 3   267 7   HOH WAT B . 
J 5 HOH 4   268 8   HOH WAT B . 
J 5 HOH 5   269 10  HOH WAT B . 
J 5 HOH 6   270 12  HOH WAT B . 
J 5 HOH 7   271 16  HOH WAT B . 
J 5 HOH 8   272 20  HOH WAT B . 
J 5 HOH 9   273 21  HOH WAT B . 
J 5 HOH 10  274 31  HOH WAT B . 
J 5 HOH 11  275 57  HOH WAT B . 
J 5 HOH 12  276 58  HOH WAT B . 
J 5 HOH 13  277 59  HOH WAT B . 
J 5 HOH 14  278 60  HOH WAT B . 
J 5 HOH 15  279 61  HOH WAT B . 
J 5 HOH 16  280 62  HOH WAT B . 
J 5 HOH 17  281 63  HOH WAT B . 
J 5 HOH 18  282 64  HOH WAT B . 
J 5 HOH 19  283 65  HOH WAT B . 
J 5 HOH 20  284 66  HOH WAT B . 
J 5 HOH 21  285 67  HOH WAT B . 
J 5 HOH 22  286 68  HOH WAT B . 
J 5 HOH 23  287 69  HOH WAT B . 
J 5 HOH 24  288 70  HOH WAT B . 
J 5 HOH 25  289 71  HOH WAT B . 
J 5 HOH 26  290 72  HOH WAT B . 
J 5 HOH 27  291 73  HOH WAT B . 
J 5 HOH 28  292 74  HOH WAT B . 
J 5 HOH 29  293 75  HOH WAT B . 
J 5 HOH 30  294 76  HOH WAT B . 
J 5 HOH 31  295 77  HOH WAT B . 
J 5 HOH 32  296 78  HOH WAT B . 
J 5 HOH 33  297 79  HOH WAT B . 
J 5 HOH 34  298 80  HOH WAT B . 
J 5 HOH 35  299 81  HOH WAT B . 
J 5 HOH 36  300 82  HOH WAT B . 
J 5 HOH 37  301 83  HOH WAT B . 
J 5 HOH 38  302 84  HOH WAT B . 
J 5 HOH 39  303 85  HOH WAT B . 
J 5 HOH 40  304 86  HOH WAT B . 
J 5 HOH 41  305 87  HOH WAT B . 
J 5 HOH 42  306 88  HOH WAT B . 
J 5 HOH 43  307 89  HOH WAT B . 
J 5 HOH 44  308 90  HOH WAT B . 
J 5 HOH 45  309 91  HOH WAT B . 
J 5 HOH 46  310 92  HOH WAT B . 
J 5 HOH 47  311 93  HOH WAT B . 
J 5 HOH 48  312 94  HOH WAT B . 
J 5 HOH 49  313 95  HOH WAT B . 
J 5 HOH 50  314 96  HOH WAT B . 
J 5 HOH 51  315 97  HOH WAT B . 
J 5 HOH 52  316 98  HOH WAT B . 
J 5 HOH 53  317 99  HOH WAT B . 
J 5 HOH 54  318 100 HOH WAT B . 
J 5 HOH 55  319 101 HOH WAT B . 
J 5 HOH 56  320 102 HOH WAT B . 
J 5 HOH 57  321 103 HOH WAT B . 
J 5 HOH 58  322 104 HOH WAT B . 
J 5 HOH 59  323 105 HOH WAT B . 
J 5 HOH 60  324 106 HOH WAT B . 
J 5 HOH 61  325 107 HOH WAT B . 
J 5 HOH 62  326 108 HOH WAT B . 
J 5 HOH 63  327 109 HOH WAT B . 
J 5 HOH 64  328 115 HOH WAT B . 
J 5 HOH 65  329 116 HOH WAT B . 
J 5 HOH 66  330 117 HOH WAT B . 
J 5 HOH 67  331 118 HOH WAT B . 
J 5 HOH 68  332 124 HOH WAT B . 
J 5 HOH 69  333 162 HOH WAT B . 
J 5 HOH 70  334 169 HOH WAT B . 
J 5 HOH 71  335 172 HOH WAT B . 
J 5 HOH 72  336 173 HOH WAT B . 
J 5 HOH 73  337 177 HOH WAT B . 
J 5 HOH 74  338 178 HOH WAT B . 
J 5 HOH 75  339 190 HOH WAT B . 
J 5 HOH 76  340 191 HOH WAT B . 
J 5 HOH 77  341 192 HOH WAT B . 
J 5 HOH 78  342 193 HOH WAT B . 
J 5 HOH 79  343 194 HOH WAT B . 
J 5 HOH 80  344 195 HOH WAT B . 
J 5 HOH 81  345 196 HOH WAT B . 
J 5 HOH 82  346 197 HOH WAT B . 
J 5 HOH 83  347 198 HOH WAT B . 
J 5 HOH 84  348 199 HOH WAT B . 
J 5 HOH 85  349 200 HOH WAT B . 
J 5 HOH 86  350 201 HOH WAT B . 
J 5 HOH 87  351 202 HOH WAT B . 
J 5 HOH 88  352 203 HOH WAT B . 
J 5 HOH 89  353 204 HOH WAT B . 
J 5 HOH 90  354 205 HOH WAT B . 
J 5 HOH 91  355 206 HOH WAT B . 
J 5 HOH 92  356 207 HOH WAT B . 
J 5 HOH 93  357 208 HOH WAT B . 
J 5 HOH 94  358 209 HOH WAT B . 
J 5 HOH 95  359 210 HOH WAT B . 
J 5 HOH 96  360 211 HOH WAT B . 
J 5 HOH 97  361 212 HOH WAT B . 
J 5 HOH 98  362 213 HOH WAT B . 
J 5 HOH 99  363 214 HOH WAT B . 
J 5 HOH 100 364 215 HOH WAT B . 
J 5 HOH 101 365 216 HOH WAT B . 
J 5 HOH 102 366 217 HOH WAT B . 
J 5 HOH 103 367 218 HOH WAT B . 
J 5 HOH 104 368 219 HOH WAT B . 
J 5 HOH 105 369 220 HOH WAT B . 
J 5 HOH 106 370 221 HOH WAT B . 
J 5 HOH 107 371 222 HOH WAT B . 
J 5 HOH 108 372 223 HOH WAT B . 
J 5 HOH 109 373 224 HOH WAT B . 
J 5 HOH 110 374 225 HOH WAT B . 
J 5 HOH 111 375 226 HOH WAT B . 
J 5 HOH 112 376 227 HOH WAT B . 
J 5 HOH 113 377 228 HOH WAT B . 
J 5 HOH 114 378 229 HOH WAT B . 
J 5 HOH 115 379 230 HOH WAT B . 
J 5 HOH 116 380 231 HOH WAT B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 96.8  ? 
2  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 169.3 ? 
3  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 92.2  ? 
4  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 91.6  ? 
5  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 91.5  ? 
6  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 93.9  ? 
7  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 266 ? 1_555 85.0  ? 
8  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 266 ? 1_555 178.0 ? 
9  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 266 ? 1_555 86.0  ? 
10 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 266 ? 1_555 87.6  ? 
11 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 267 ? 1_555 84.1  ? 
12 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 267 ? 1_555 89.9  ? 
13 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 267 ? 1_555 90.2  ? 
14 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 267 ? 1_555 175.6 ? 
15 O   ? I HOH .   ? A HOH 266 ? 1_555 MN ? E MN . ? A MN 261 ? 1_555 O   ? I HOH .   ? A HOH 267 ? 1_555 91.1  ? 
16 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 53.7  ? 
17 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 76.4  ? 
18 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 116.3 ? 
19 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 152.0 ? 
20 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 152.6 ? 
21 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 87.7  ? 
22 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 112.5 ? 
23 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 78.8  ? 
24 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 88.4  ? 
25 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 89.5  ? 
26 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 264 ? 1_555 110.7 ? 
27 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 264 ? 1_555 72.8  ? 
28 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 264 ? 1_555 170.9 ? 
29 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 264 ? 1_555 83.5  ? 
30 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 264 ? 1_555 93.8  ? 
31 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 72.2  ? 
32 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 109.8 ? 
33 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 85.3  ? 
34 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 83.8  ? 
35 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 171.0 ? 
36 O   ? I HOH .   ? A HOH 264 ? 1_555 CA ? F CA . ? A CA 263 ? 1_555 O   ? I HOH .   ? A HOH 265 ? 1_555 91.4  ? 
37 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 94.4  ? 
38 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 171.8 ? 
39 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 93.7  ? 
40 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 92.6  ? 
41 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 89.0  ? 
42 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 88.8  ? 
43 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 267 ? 1_555 83.7  ? 
44 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 267 ? 1_555 92.2  ? 
45 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 267 ? 1_555 94.8  ? 
46 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 267 ? 1_555 176.2 ? 
47 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 268 ? 1_555 88.8  ? 
48 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 268 ? 1_555 176.7 ? 
49 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 268 ? 1_555 83.1  ? 
50 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 268 ? 1_555 91.8  ? 
51 O   ? J HOH .   ? B HOH 267 ? 1_555 MN ? G MN . ? B MN 262 ? 1_555 O   ? J HOH .   ? B HOH 268 ? 1_555 87.1  ? 
52 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 53.0  ? 
53 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 117.4 ? 
54 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 80.0  ? 
55 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 154.1 ? 
56 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 151.9 ? 
57 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 83.9  ? 
58 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 78.9  ? 
59 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 114.4 ? 
60 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 88.1  ? 
61 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 87.7  ? 
62 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 265 ? 1_555 72.9  ? 
63 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 265 ? 1_555 109.7 ? 
64 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 265 ? 1_555 169.4 ? 
65 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 265 ? 1_555 85.5  ? 
66 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 265 ? 1_555 91.7  ? 
67 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 111.2 ? 
68 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 72.6  ? 
69 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 85.9  ? 
70 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 83.5  ? 
71 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 169.7 ? 
72 O   ? J HOH .   ? B HOH 265 ? 1_555 CA ? H CA . ? B CA 264 ? 1_555 O   ? J HOH .   ? B HOH 266 ? 1_555 92.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-01 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-02-22 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 5 'Structure model' 'Atomic model'              
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' atom_site                     
2  5 'Structure model' chem_comp                     
3  5 'Structure model' diffrn_source                 
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_entity_branch            
8  5 'Structure model' pdbx_entity_branch_descriptor 
9  5 'Structure model' pdbx_entity_branch_link       
10 5 'Structure model' pdbx_entity_branch_list       
11 5 'Structure model' pdbx_entity_nonpoly           
12 5 'Structure model' pdbx_nonpoly_scheme           
13 5 'Structure model' pdbx_struct_assembly_gen      
14 5 'Structure model' pdbx_struct_conn_angle        
15 5 'Structure model' struct_asym                   
16 5 'Structure model' struct_conn                   
17 5 'Structure model' struct_site                   
18 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  5 'Structure model' '_atom_site.Cartn_x'                          
3  5 'Structure model' '_atom_site.Cartn_y'                          
4  5 'Structure model' '_atom_site.Cartn_z'                          
5  5 'Structure model' '_atom_site.auth_asym_id'                     
6  5 'Structure model' '_atom_site.auth_atom_id'                     
7  5 'Structure model' '_atom_site.auth_comp_id'                     
8  5 'Structure model' '_atom_site.auth_seq_id'                      
9  5 'Structure model' '_atom_site.label_asym_id'                    
10 5 'Structure model' '_atom_site.label_atom_id'                    
11 5 'Structure model' '_atom_site.label_comp_id'                    
12 5 'Structure model' '_atom_site.label_entity_id'                  
13 5 'Structure model' '_atom_site.type_symbol'                      
14 5 'Structure model' '_chem_comp.name'                             
15 5 'Structure model' '_chem_comp.type'                             
16 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
28 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
29 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
30 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
31 5 'Structure model' '_pdbx_struct_conn_angle.value'               
32 5 'Structure model' '_struct_conn.pdbx_dist_value'                
33 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
34 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
35 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
36 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
37 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
38 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
39 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
40 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
41 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
42 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
43 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
44 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
45 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
46 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
47 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
PHASER    phasing          .   ? 3 
CNS       refinement       0.9 ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.483 
_pdbx_validate_rmsd_bond.bond_target_value         1.324 
_pdbx_validate_rmsd_bond.bond_deviation            0.159 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.025 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 45  ? ? 50.85   73.06   
2 1 LEU A 108 ? ? 58.05   16.31   
3 1 ASN A 138 ? ? -109.18 65.04   
4 1 ASN A 143 ? ? -91.65  59.22   
5 1 ASP B 37  ? ? -75.88  -169.69 
6 1 ASN B 143 ? ? -91.40  55.96   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 1   ? N   ? A GLN 1   N   
2  1 Y 1 A LYS 27  ? CE  ? A LYS 27  CE  
3  1 Y 1 A LYS 27  ? NZ  ? A LYS 27  NZ  
4  1 Y 1 A ASN 28  ? CG  ? A ASN 28  CG  
5  1 Y 1 A ASN 28  ? OD1 ? A ASN 28  OD1 
6  1 Y 1 A ASN 28  ? ND2 ? A ASN 28  ND2 
7  1 Y 1 A LYS 35  ? CE  ? A LYS 35  CE  
8  1 Y 1 A LYS 35  ? NZ  ? A LYS 35  NZ  
9  1 Y 1 A SER 38  ? OG  ? A SER 38  OG  
10 1 Y 1 A ASN 39  ? CG  ? A ASN 39  CG  
11 1 Y 1 A ASN 39  ? OD1 ? A ASN 39  OD1 
12 1 Y 1 A ASN 39  ? ND2 ? A ASN 39  ND2 
13 1 Y 1 A ASN 41  ? CG  ? A ASN 41  CG  
14 1 Y 1 A ASN 41  ? OD1 ? A ASN 41  OD1 
15 1 Y 1 A ASN 41  ? ND2 ? A ASN 41  ND2 
16 1 Y 1 A LYS 61  ? CE  ? A LYS 61  CE  
17 1 Y 1 A LYS 61  ? NZ  ? A LYS 61  NZ  
18 1 Y 1 A LYS 78  ? CG  ? A LYS 78  CG  
19 1 Y 1 A LYS 78  ? CD  ? A LYS 78  CD  
20 1 Y 1 A LYS 78  ? CE  ? A LYS 78  CE  
21 1 Y 1 A LYS 78  ? NZ  ? A LYS 78  NZ  
22 1 Y 1 A ARG 155 ? CZ  ? A ARG 155 CZ  
23 1 Y 1 A ARG 155 ? NH1 ? A ARG 155 NH1 
24 1 Y 1 A ARG 155 ? NH2 ? A ARG 155 NH2 
25 1 Y 1 A ARG 181 ? NE  ? A ARG 181 NE  
26 1 Y 1 A ARG 181 ? CZ  ? A ARG 181 CZ  
27 1 Y 1 A ARG 181 ? NH1 ? A ARG 181 NH1 
28 1 Y 1 A ARG 181 ? NH2 ? A ARG 181 NH2 
29 1 Y 1 A GLU 229 ? CG  ? A GLU 229 CG  
30 1 Y 1 A GLU 229 ? CD  ? A GLU 229 CD  
31 1 Y 1 A GLU 229 ? OE1 ? A GLU 229 OE1 
32 1 Y 1 A GLU 229 ? OE2 ? A GLU 229 OE2 
33 1 Y 1 A TYR 239 ? CG  ? A TYR 239 CG  
34 1 Y 1 A TYR 239 ? CD1 ? A TYR 239 CD1 
35 1 Y 1 A TYR 239 ? CD2 ? A TYR 239 CD2 
36 1 Y 1 A TYR 239 ? CE1 ? A TYR 239 CE1 
37 1 Y 1 A TYR 239 ? CE2 ? A TYR 239 CE2 
38 1 Y 1 A TYR 239 ? CZ  ? A TYR 239 CZ  
39 1 Y 1 A TYR 239 ? OH  ? A TYR 239 OH  
40 1 Y 1 B GLN 1   ? N   ? B GLN 1   N   
41 1 Y 1 B GLN 25  ? CD  ? B GLN 25  CD  
42 1 Y 1 B GLN 25  ? OE1 ? B GLN 25  OE1 
43 1 Y 1 B GLN 25  ? NE2 ? B GLN 25  NE2 
44 1 Y 1 B LYS 27  ? CE  ? B LYS 27  CE  
45 1 Y 1 B LYS 27  ? NZ  ? B LYS 27  NZ  
46 1 Y 1 B ASN 28  ? CG  ? B ASN 28  CG  
47 1 Y 1 B ASN 28  ? OD1 ? B ASN 28  OD1 
48 1 Y 1 B ASN 28  ? ND2 ? B ASN 28  ND2 
49 1 Y 1 B LYS 35  ? CE  ? B LYS 35  CE  
50 1 Y 1 B LYS 35  ? NZ  ? B LYS 35  NZ  
51 1 Y 1 B LYS 61  ? CE  ? B LYS 61  CE  
52 1 Y 1 B LYS 61  ? NZ  ? B LYS 61  NZ  
53 1 Y 1 B LYS 161 ? CE  ? B LYS 161 CE  
54 1 Y 1 B LYS 161 ? NZ  ? B LYS 161 NZ  
55 1 Y 1 B ARG 181 ? CZ  ? B ARG 181 CZ  
56 1 Y 1 B ARG 181 ? NH1 ? B ARG 181 NH1 
57 1 Y 1 B ARG 181 ? NH2 ? B ARG 181 NH2 
58 1 Y 1 B GLU 196 ? CD  ? B GLU 196 CD  
59 1 Y 1 B GLU 196 ? OE1 ? B GLU 196 OE1 
60 1 Y 1 B GLU 196 ? OE2 ? B GLU 196 OE2 
61 1 Y 1 B ARG 204 ? CZ  ? B ARG 204 CZ  
62 1 Y 1 B ARG 204 ? NH1 ? B ARG 204 NH1 
63 1 Y 1 B ARG 204 ? NH2 ? B ARG 204 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 241 ? A ALA 241 
2  1 Y 1 A GLN 242 ? A GLN 242 
3  1 Y 1 A LYS 243 ? A LYS 243 
4  1 Y 1 A LYS 244 ? A LYS 244 
5  1 Y 1 A GLY 245 ? A GLY 245 
6  1 Y 1 A GLU 246 ? A GLU 246 
7  1 Y 1 A ASN 247 ? A ASN 247 
8  1 Y 1 A LEU 248 ? A LEU 248 
9  1 Y 1 A ALA 249 ? A ALA 249 
10 1 Y 1 A LEU 250 ? A LEU 250 
11 1 Y 1 A GLU 251 ? A GLU 251 
12 1 Y 1 A MET 252 ? A MET 252 
13 1 Y 1 B ALA 241 ? B ALA 241 
14 1 Y 1 B GLN 242 ? B GLN 242 
15 1 Y 1 B LYS 243 ? B LYS 243 
16 1 Y 1 B LYS 244 ? B LYS 244 
17 1 Y 1 B GLY 245 ? B GLY 245 
18 1 Y 1 B GLU 246 ? B GLU 246 
19 1 Y 1 B ASN 247 ? B ASN 247 
20 1 Y 1 B LEU 248 ? B LEU 248 
21 1 Y 1 B ALA 249 ? B ALA 249 
22 1 Y 1 B LEU 250 ? B LEU 250 
23 1 Y 1 B GLU 251 ? B GLU 251 
24 1 Y 1 B MET 252 ? B MET 252 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 MAN 1 C MAN 1 C MAN 251 n 
C 2 NAG 2 C NAG 2 C NAG 250 n 
D 2 MAN 1 D MAN 1 D MAN 251 n 
D 2 NAG 2 D NAG 2 D NAG 250 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-2DManpa1-ROH                                              'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a1122h-1a_1-5][a2122h-1b_1-5_2*NCC/3=O]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][a-D-Manp]{[(2+1)][b-D-GlcpNAc]{}}'                               LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  MAN 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 MAN 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MANGANESE (II) ION' MN  
4 'CALCIUM ION'        CA  
5 water                HOH 
#