data_2ARE
# 
_entry.id   2ARE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ARE         
RCSB  RCSB034224   
WWPDB D_1000034224 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Q8O 'Related complex'     unspecified 
PDB 1S1A 'Ligand-free protein' unspecified 
PDB 2AR6 .                     unspecified 
PDB 2ARB .                     unspecified 
PDB 2ARX .                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ARE 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Buts, L.'        1  
'Garcia-Pino, A.' 2  
'Imberty, A.'     3  
'Amiot, N.'       4  
'Boons, G.-J.'    5  
'Versees, W.'     6  
'Lah, J.'         7  
'Beeckmans, S.'   8  
'Wyns, L.'        9  
'Loris, R.'       10 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.' 
_citation.journal_abbrev            'Febs J.' 
_citation.journal_volume            273 
_citation.page_first                2407 
_citation.page_last                 2420 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16704415 
_citation.pdbx_database_id_DOI      10.1111/j.1742-4658.2006.05248.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Buts, L.'        1 ? 
primary 'Garcia-Pino, A.' 2 ? 
primary 'Imberty, A.'     3 ? 
primary 'Amiot, N.'       4 ? 
primary 'Boons, G.J.'     5 ? 
primary 'Beeckmans, S.'   6 ? 
primary 'Versees, W.'     7 ? 
primary 'Wyns, L.'        8 ? 
primary 'Loris, R.'       9 ? 
# 
_cell.entry_id           2ARE 
_cell.length_a           56.731 
_cell.length_b           83.361 
_cell.length_c           122.938 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ARE 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat lectin                27575.326 2   ? ? ? ? 
2 non-polymer man alpha-D-mannopyranose 180.156   2   ? ? ? ? 
3 non-polymer syn 'MANGANESE (II) ION'  54.938    2   ? ? ? ? 
4 non-polymer syn 'CALCIUM ION'         40.078    2   ? ? ? ? 
5 water       nat water                 18.015    279 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PAL 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ASP n 
1 3   SER n 
1 4   LEU n 
1 5   SER n 
1 6   PHE n 
1 7   GLY n 
1 8   PHE n 
1 9   PRO n 
1 10  THR n 
1 11  PHE n 
1 12  PRO n 
1 13  SER n 
1 14  ASP n 
1 15  GLN n 
1 16  LYS n 
1 17  ASN n 
1 18  LEU n 
1 19  ILE n 
1 20  PHE n 
1 21  GLN n 
1 22  GLY n 
1 23  ASP n 
1 24  ALA n 
1 25  GLN n 
1 26  ILE n 
1 27  LYS n 
1 28  ASN n 
1 29  ASN n 
1 30  ALA n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  THR n 
1 37  ASP n 
1 38  SER n 
1 39  ASN n 
1 40  GLY n 
1 41  ASN n 
1 42  PRO n 
1 43  VAL n 
1 44  ALA n 
1 45  SER n 
1 46  THR n 
1 47  VAL n 
1 48  GLY n 
1 49  ARG n 
1 50  ILE n 
1 51  LEU n 
1 52  PHE n 
1 53  SER n 
1 54  ALA n 
1 55  GLN n 
1 56  VAL n 
1 57  HIS n 
1 58  LEU n 
1 59  TRP n 
1 60  GLU n 
1 61  LYS n 
1 62  SER n 
1 63  SER n 
1 64  SER n 
1 65  ARG n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  PHE n 
1 70  GLN n 
1 71  SER n 
1 72  GLN n 
1 73  PHE n 
1 74  SER n 
1 75  PHE n 
1 76  SER n 
1 77  LEU n 
1 78  LYS n 
1 79  SER n 
1 80  PRO n 
1 81  LEU n 
1 82  SER n 
1 83  ASN n 
1 84  GLY n 
1 85  ALA n 
1 86  ASP n 
1 87  GLY n 
1 88  ILE n 
1 89  ALA n 
1 90  PHE n 
1 91  PHE n 
1 92  ILE n 
1 93  ALA n 
1 94  PRO n 
1 95  PRO n 
1 96  ASP n 
1 97  THR n 
1 98  THR n 
1 99  ILE n 
1 100 PRO n 
1 101 SER n 
1 102 GLY n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 LEU n 
1 108 LEU n 
1 109 GLY n 
1 110 LEU n 
1 111 PHE n 
1 112 ALA n 
1 113 PRO n 
1 114 GLY n 
1 115 THR n 
1 116 ALA n 
1 117 GLN n 
1 118 ASN n 
1 119 THR n 
1 120 SER n 
1 121 ALA n 
1 122 ASN n 
1 123 GLN n 
1 124 VAL n 
1 125 ILE n 
1 126 ALA n 
1 127 VAL n 
1 128 GLU n 
1 129 PHE n 
1 130 ASP n 
1 131 THR n 
1 132 PHE n 
1 133 TYR n 
1 134 ALA n 
1 135 GLN n 
1 136 ASP n 
1 137 SER n 
1 138 ASN n 
1 139 THR n 
1 140 TRP n 
1 141 ASP n 
1 142 PRO n 
1 143 ASN n 
1 144 TYR n 
1 145 PRO n 
1 146 HIS n 
1 147 ILE n 
1 148 GLY n 
1 149 ILE n 
1 150 ASP n 
1 151 VAL n 
1 152 ASN n 
1 153 SER n 
1 154 ILE n 
1 155 ARG n 
1 156 SER n 
1 157 VAL n 
1 158 LYS n 
1 159 THR n 
1 160 VAL n 
1 161 LYS n 
1 162 TRP n 
1 163 ASP n 
1 164 ARG n 
1 165 ARG n 
1 166 ASP n 
1 167 GLY n 
1 168 GLN n 
1 169 SER n 
1 170 LEU n 
1 171 ASN n 
1 172 VAL n 
1 173 LEU n 
1 174 VAL n 
1 175 THR n 
1 176 PHE n 
1 177 ASN n 
1 178 PRO n 
1 179 SER n 
1 180 THR n 
1 181 ARG n 
1 182 ASN n 
1 183 LEU n 
1 184 ASP n 
1 185 VAL n 
1 186 VAL n 
1 187 ALA n 
1 188 THR n 
1 189 TYR n 
1 190 SER n 
1 191 ASP n 
1 192 GLY n 
1 193 THR n 
1 194 ARG n 
1 195 TYR n 
1 196 GLU n 
1 197 VAL n 
1 198 SER n 
1 199 TYR n 
1 200 GLU n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 ARG n 
1 205 SER n 
1 206 VAL n 
1 207 LEU n 
1 208 PRO n 
1 209 GLU n 
1 210 TRP n 
1 211 VAL n 
1 212 ARG n 
1 213 VAL n 
1 214 GLY n 
1 215 PHE n 
1 216 SER n 
1 217 ALA n 
1 218 ALA n 
1 219 SER n 
1 220 GLY n 
1 221 GLU n 
1 222 GLN n 
1 223 TYR n 
1 224 GLN n 
1 225 THR n 
1 226 HIS n 
1 227 THR n 
1 228 LEU n 
1 229 GLU n 
1 230 SER n 
1 231 TRP n 
1 232 SER n 
1 233 PHE n 
1 234 THR n 
1 235 SER n 
1 236 THR n 
1 237 LEU n 
1 238 LEU n 
1 239 TYR n 
1 240 THR n 
1 241 ALA n 
1 242 GLN n 
1 243 LYS n 
1 244 LYS n 
1 245 GLY n 
1 246 GLU n 
1 247 ASN n 
1 248 LEU n 
1 249 ALA n 
1 250 LEU n 
1 251 GLU n 
1 252 MET n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Pterocarpus angolensis' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      182271 
_entity_src_nat.genus                      Pterocarpus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     seed 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GSD2_9FABA 
_struct_ref.pdbx_db_accession          Q8GSD2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ARE A 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
2 1 2ARE B 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CA  non-polymer                   . 'CALCIUM ION'         ? 'Ca 2'           40.078  
GLN 'L-peptide linking'           y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'  ? 'Mn 2'           54.938  
PHE 'L-peptide linking'           y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ARE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   52.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'20% PEG8000, 200 mM calcium acetate, 100 mM sodium cacodylate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2ARE 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.8 
_reflns.d_resolution_low             20 
_reflns.number_all                   53278 
_reflns.number_obs                   52210 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.02 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   97.6 
_reflns_shell.Rmerge_I_obs           0.296 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ARE 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     54834 
_refine.ls_number_reflns_obs                     52166 
_refine.ls_number_reflns_R_free                  2591 
_refine.ls_percent_reflns_obs                    95.1 
_refine.ls_R_factor_all                          0.172 
_refine.ls_R_factor_obs                          0.172 
_refine.ls_R_factor_R_work                       0.1703 
_refine.ls_R_factor_R_free                       0.2043 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1Q3O' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3681 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             279 
_refine_hist.number_atoms_total               3988 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.64  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2ARE 
_struct.title                     'Pterocarpus angolensis Lectin (PAL) In Complex With D-Mannose (anomeric mixture)' 
_struct.pdbx_descriptor           lectin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ARE 
_struct_keywords.pdbx_keywords   'SUGAR BINDING PROTEIN' 
_struct_keywords.text            'LECTIN, CARBOHYDRATE RECOGNITION, SUGAR BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 104 ? LEU A 108 ? GLY A 104 LEU A 108 5 ? 5 
HELX_P HELX_P2 2 ALA A 112 ? ALA A 116 ? ALA A 112 ALA A 116 5 ? 5 
HELX_P HELX_P3 3 ASN A 118 ? ASN A 122 ? ASN A 118 ASN A 122 5 ? 5 
HELX_P HELX_P4 4 ASP A 202 ? VAL A 206 ? ASP A 202 VAL A 206 5 ? 5 
HELX_P HELX_P5 5 GLY B 104 ? LEU B 108 ? GLY B 104 LEU B 108 5 ? 5 
HELX_P HELX_P6 6 ALA B 112 ? ALA B 116 ? ALA B 112 ALA B 116 5 ? 5 
HELX_P HELX_P7 7 ASN B 118 ? ASN B 122 ? ASN B 118 ASN B 122 5 ? 5 
HELX_P HELX_P8 8 ASP B 202 ? VAL B 206 ? ASP B 202 VAL B 206 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A GLU 128 OE1 ? ? ? 1_555 D MN  . MN ? ? A GLU 128 A MN  281 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc2  metalc ? ? A ASP 130 OD2 ? ? ? 1_555 D MN  . MN ? ? A ASP 130 A MN  281 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc3  metalc ? ? A ASP 130 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 130 A CA  283 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc4  metalc ? ? A ASP 130 OD2 ? ? ? 1_555 E CA  . CA ? ? A ASP 130 A CA  283 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc5  metalc ? ? A PHE 132 O   ? ? ? 1_555 E CA  . CA ? ? A PHE 132 A CA  283 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc6  metalc ? ? A ASN 138 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASN 138 A CA  283 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc7  metalc ? ? A ASP 141 OD1 ? ? ? 1_555 D MN  . MN ? ? A ASP 141 A MN  281 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc8  metalc ? ? A ASP 141 OD2 ? ? ? 1_555 E CA  . CA ? ? A ASP 141 A CA  283 1_555 ? ? ? ? ? ? ? 2.229 ? ? 
metalc9  metalc ? ? A HIS 146 NE2 ? ? ? 1_555 D MN  . MN ? ? A HIS 146 A MN  281 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc10 metalc ? ? D MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  281 A HOH 286 1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc11 metalc ? ? D MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  281 A HOH 287 1_555 ? ? ? ? ? ? ? 1.943 ? ? 
metalc12 metalc ? ? E CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  283 A HOH 284 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc13 metalc ? ? E CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  283 A HOH 285 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc14 metalc ? ? B GLU 128 OE1 ? ? ? 1_555 G MN  . MN ? ? B GLU 128 B MN  282 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc15 metalc ? ? B ASP 130 OD2 ? ? ? 1_555 G MN  . MN ? ? B ASP 130 B MN  282 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc16 metalc ? ? B ASP 130 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  284 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc17 metalc ? ? B ASP 130 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  284 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc18 metalc ? ? B PHE 132 O   ? ? ? 1_555 H CA  . CA ? ? B PHE 132 B CA  284 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc19 metalc ? ? B ASN 138 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASN 138 B CA  284 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc20 metalc ? ? B ASP 141 OD1 ? ? ? 1_555 G MN  . MN ? ? B ASP 141 B MN  282 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc21 metalc ? ? B ASP 141 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 141 B CA  284 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc22 metalc ? ? B HIS 146 NE2 ? ? ? 1_555 G MN  . MN ? ? B HIS 146 B MN  282 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc23 metalc ? ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  282 B HOH 285 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc24 metalc ? ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  282 B HOH 286 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc25 metalc ? ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  284 B HOH 287 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc26 metalc ? ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  284 B HOH 288 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 85 A . ? ALA 85 A ASP 86 A ? ASP 86 A 1 0.20 
2 ALA 85 B . ? ALA 85 B ASP 86 B ? ASP 86 B 1 0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5  ? 
B ? 10 ? 
C ? 12 ? 
D ? 4  ? 
E ? 7  ? 
F ? 4  ? 
G ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? anti-parallel 
C 6  7  ? anti-parallel 
C 7  8  ? anti-parallel 
C 8  9  ? anti-parallel 
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
C 11 12 ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN B 25  ? LYS B 27  ? GLN B 25  LYS B 27  
A 2  ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
A 3  THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
A 4  ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
A 5  TRP B 59  ? GLU B 60  ? TRP B 59  GLU B 60  
B 1  GLN A 25  ? LYS A 27  ? GLN A 25  LYS A 27  
B 2  ALA A 30  ? GLN A 32  ? ALA A 30  GLN A 32  
B 3  THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
B 4  SER A 3   ? PHE A 8   ? SER A 3   PHE A 8   
B 5  SER B 3   ? PHE B 8   ? SER B 3   PHE B 8   
B 6  THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
B 7  ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
B 8  LEU B 170 ? ASN B 177 ? LEU B 170 ASN B 177 
B 9  ASN B 182 ? THR B 188 ? ASN B 182 THR B 188 
B 10 ARG B 194 ? GLU B 200 ? ARG B 194 GLU B 200 
C 1  ARG A 194 ? GLU A 200 ? ARG A 194 GLU A 200 
C 2  ASN A 182 ? TYR A 189 ? ASN A 182 TYR A 189 
C 3  LEU A 170 ? ASN A 177 ? LEU A 170 ASN A 177 
C 4  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
C 5  TRP A 59  ? GLU A 60  ? TRP A 59  GLU A 60  
C 6  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
C 7  THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
C 8  SER A 3   ? PHE A 8   ? SER A 3   PHE A 8   
C 9  SER B 3   ? PHE B 8   ? SER B 3   PHE B 8   
C 10 THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
C 11 ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
C 12 GLN B 25  ? LYS B 27  ? GLN B 25  LYS B 27  
D 1  LEU A 18  ? GLY A 22  ? LEU A 18  GLY A 22  
D 2  THR A 46  ? PHE A 52  ? THR A 46  PHE A 52  
D 3  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
D 4  VAL A 56  ? HIS A 57  ? VAL A 56  HIS A 57  
E 1  LEU A 18  ? GLY A 22  ? LEU A 18  GLY A 22  
E 2  THR A 46  ? PHE A 52  ? THR A 46  PHE A 52  
E 3  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
E 4  GLY A 87  ? ALA A 93  ? GLY A 87  ALA A 93  
E 5  ILE A 125 ? ASP A 130 ? ILE A 125 ASP A 130 
E 6  HIS A 146 ? VAL A 151 ? HIS A 146 VAL A 151 
E 7  LYS A 158 ? LYS A 161 ? LYS A 158 LYS A 161 
F 1  LEU B 18  ? GLY B 22  ? LEU B 18  GLY B 22  
F 2  THR B 46  ? PHE B 52  ? THR B 46  PHE B 52  
F 3  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
F 4  VAL B 56  ? HIS B 57  ? VAL B 56  HIS B 57  
G 1  LEU B 18  ? GLY B 22  ? LEU B 18  GLY B 22  
G 2  THR B 46  ? PHE B 52  ? THR B 46  PHE B 52  
G 3  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
G 4  GLY B 87  ? ALA B 93  ? GLY B 87  ALA B 93  
G 5  ILE B 125 ? ASP B 130 ? ILE B 125 ASP B 130 
G 6  HIS B 146 ? VAL B 151 ? HIS B 146 VAL B 151 
G 7  LYS B 158 ? LYS B 161 ? LYS B 158 LYS B 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLN B 25  ? N GLN B 25  O GLN B 32  ? O GLN B 32  
A 2  3  N VAL B 31  ? N VAL B 31  O LEU B 228 ? O LEU B 228 
A 3  4  O THR B 236 ? O THR B 236 N ASN B 68  ? N ASN B 68  
A 4  5  O ARG B 65  ? O ARG B 65  N GLU B 60  ? N GLU B 60  
B 1  2  N GLN A 25  ? N GLN A 25  O GLN A 32  ? O GLN A 32  
B 2  3  N VAL A 31  ? N VAL A 31  O LEU A 228 ? O LEU A 228 
B 3  4  O TRP A 231 ? O TRP A 231 N PHE A 8   ? N PHE A 8   
B 4  5  N SER A 5   ? N SER A 5   O SER B 5   ? O SER B 5   
B 5  6  N PHE B 8   ? N PHE B 8   O TRP B 231 ? O TRP B 231 
B 6  7  O THR B 236 ? O THR B 236 N ASN B 68  ? N ASN B 68  
B 7  8  N PHE B 73  ? N PHE B 73  O VAL B 172 ? O VAL B 172 
B 8  9  N ASN B 171 ? N ASN B 171 O THR B 188 ? O THR B 188 
B 9  10 N LEU B 183 ? N LEU B 183 O TYR B 199 ? O TYR B 199 
C 1  2  O TYR A 199 ? O TYR A 199 N LEU A 183 ? N LEU A 183 
C 2  3  O ASP A 184 ? O ASP A 184 N THR A 175 ? N THR A 175 
C 3  4  O VAL A 172 ? O VAL A 172 N PHE A 73  ? N PHE A 73  
C 4  5  O ARG A 65  ? O ARG A 65  N GLU A 60  ? N GLU A 60  
C 5  6  N GLU A 60  ? N GLU A 60  O ARG A 65  ? O ARG A 65  
C 6  7  N GLN A 72  ? N GLN A 72  O SER A 232 ? O SER A 232 
C 7  8  O TRP A 231 ? O TRP A 231 N PHE A 8   ? N PHE A 8   
C 8  9  N SER A 5   ? N SER A 5   O SER B 5   ? O SER B 5   
C 9  10 N PHE B 8   ? N PHE B 8   O TRP B 231 ? O TRP B 231 
C 10 11 O LEU B 228 ? O LEU B 228 N VAL B 31  ? N VAL B 31  
C 11 12 O GLN B 32  ? O GLN B 32  N GLN B 25  ? N GLN B 25  
D 1  2  N ILE A 19  ? N ILE A 19  O LEU A 51  ? O LEU A 51  
D 2  3  N PHE A 52  ? N PHE A 52  O VAL A 213 ? O VAL A 213 
D 3  4  O VAL A 211 ? O VAL A 211 N VAL A 56  ? N VAL A 56  
E 1  2  N ILE A 19  ? N ILE A 19  O LEU A 51  ? O LEU A 51  
E 2  3  N PHE A 52  ? N PHE A 52  O VAL A 213 ? O VAL A 213 
E 3  4  O ARG A 212 ? O ARG A 212 N ALA A 93  ? N ALA A 93  
E 4  5  N PHE A 90  ? N PHE A 90  O VAL A 127 ? O VAL A 127 
E 5  6  N ALA A 126 ? N ALA A 126 O ASP A 150 ? O ASP A 150 
E 6  7  N ILE A 149 ? N ILE A 149 O LYS A 158 ? O LYS A 158 
F 1  2  N ILE B 19  ? N ILE B 19  O LEU B 51  ? O LEU B 51  
F 2  3  N PHE B 52  ? N PHE B 52  O VAL B 213 ? O VAL B 213 
F 3  4  O VAL B 211 ? O VAL B 211 N VAL B 56  ? N VAL B 56  
G 1  2  N ILE B 19  ? N ILE B 19  O LEU B 51  ? O LEU B 51  
G 2  3  N PHE B 52  ? N PHE B 52  O VAL B 213 ? O VAL B 213 
G 3  4  O SER B 216 ? O SER B 216 N ALA B 89  ? N ALA B 89  
G 4  5  N PHE B 90  ? N PHE B 90  O VAL B 127 ? O VAL B 127 
G 5  6  N ALA B 126 ? N ALA B 126 O ASP B 150 ? O ASP B 150 
G 6  7  N ILE B 149 ? N ILE B 149 O LYS B 158 ? O LYS B 158 
# 
_database_PDB_matrix.entry_id          2ARE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ARE 
_atom_sites.fract_transf_matrix[1][1]   0.017627 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011996 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008134 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 1   ? -5.975  4.041   13.685  1.00 18.07 ? 1   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 1   ? -5.599  3.034   14.723  1.00 15.68 ? 1   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 1   ? -6.268  3.331   16.055  1.00 16.04 ? 1   GLN A C   1 
ATOM   4    O  O   . GLN A 1 1   ? -6.426  4.504   16.448  1.00 19.58 ? 1   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 1   ? -4.078  3.090   14.899  1.00 15.44 ? 1   GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 1   ? -3.636  4.406   14.325  1.00 21.04 ? 1   GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 1   ? -4.821  4.972   13.542  1.00 16.75 ? 1   GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 1   ? -4.678  5.881   12.746  1.00 22.05 ? 1   GLN A OE1 1 
ATOM   9    N  N   . ASP A 1 2   ? -6.637  2.270   16.759  1.00 13.56 ? 2   ASP A N   1 
ATOM   10   C  CA  . ASP A 1 2   ? -7.236  2.408   18.074  1.00 16.85 ? 2   ASP A CA  1 
ATOM   11   C  C   . ASP A 1 2   ? -6.149  2.828   19.068  1.00 18.12 ? 2   ASP A C   1 
ATOM   12   O  O   . ASP A 1 2   ? -6.442  3.464   20.086  1.00 17.00 ? 2   ASP A O   1 
ATOM   13   C  CB  . ASP A 1 2   ? -7.828  1.076   18.544  1.00 19.88 ? 2   ASP A CB  1 
ATOM   14   C  CG  . ASP A 1 2   ? -9.166  0.767   17.898  1.00 22.67 ? 2   ASP A CG  1 
ATOM   15   O  OD1 . ASP A 1 2   ? -9.546  1.453   16.934  1.00 25.20 ? 2   ASP A OD1 1 
ATOM   16   O  OD2 . ASP A 1 2   ? -9.823  -0.170  18.371  1.00 23.10 ? 2   ASP A OD2 1 
ATOM   17   N  N   . SER A 1 3   ? -4.907  2.424   18.800  1.00 15.73 ? 3   SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? -3.802  2.756   19.701  1.00 15.61 ? 3   SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? -2.627  3.310   18.923  1.00 17.73 ? 3   SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? -2.375  2.921   17.788  1.00 15.36 ? 3   SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? -3.368  1.517   20.499  1.00 20.20 ? 3   SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? -2.947  0.496   19.605  1.00 21.35 ? 3   SER A OG  1 
ATOM   23   N  N   . LEU A 1 4   ? -1.896  4.223   19.549  1.00 13.90 ? 4   LEU A N   1 
ATOM   24   C  CA  . LEU A 1 4   ? -0.751  4.850   18.890  1.00 15.16 ? 4   LEU A CA  1 
ATOM   25   C  C   . LEU A 1 4   ? 0.249   5.240   19.970  1.00 15.41 ? 4   LEU A C   1 
ATOM   26   O  O   . LEU A 1 4   ? -0.142  5.756   21.015  1.00 15.80 ? 4   LEU A O   1 
ATOM   27   C  CB  . LEU A 1 4   ? -1.205  6.133   18.166  1.00 15.84 ? 4   LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 4   ? -0.060  6.944   17.531  1.00 21.19 ? 4   LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 4   ? 0.465   6.136   16.356  1.00 24.46 ? 4   LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 4   ? -0.504  8.321   17.048  1.00 26.11 ? 4   LEU A CD2 1 
ATOM   31   N  N   . SER A 1 5   ? 1.531   4.990   19.740  1.00 14.05 ? 5   SER A N   1 
ATOM   32   C  CA  A SER A 1 5   ? 2.569   5.343   20.711  0.33 14.74 ? 5   SER A CA  1 
ATOM   33   C  CA  B SER A 1 5   ? 2.543   5.393   20.710  0.33 14.90 ? 5   SER A CA  1 
ATOM   34   C  CA  C SER A 1 5   ? 2.551   5.368   20.709  0.33 15.07 ? 5   SER A CA  1 
ATOM   35   C  C   . SER A 1 5   ? 3.817   5.763   19.963  1.00 16.90 ? 5   SER A C   1 
ATOM   36   O  O   . SER A 1 5   ? 4.115   5.209   18.906  1.00 17.77 ? 5   SER A O   1 
ATOM   37   C  CB  A SER A 1 5   ? 2.948   4.144   21.590  0.33 18.57 ? 5   SER A CB  1 
ATOM   38   C  CB  B SER A 1 5   ? 2.832   4.270   21.712  0.33 18.94 ? 5   SER A CB  1 
ATOM   39   C  CB  C SER A 1 5   ? 2.848   4.200   21.654  0.33 19.15 ? 5   SER A CB  1 
ATOM   40   O  OG  A SER A 1 5   ? 1.873   3.682   22.378  0.33 17.54 ? 5   SER A OG  1 
ATOM   41   O  OG  B SER A 1 5   ? 3.699   3.303   21.158  0.33 20.38 ? 5   SER A OG  1 
ATOM   42   O  OG  C SER A 1 5   ? 3.794   4.575   22.639  0.33 22.60 ? 5   SER A OG  1 
ATOM   43   N  N   . PHE A 1 6   ? 4.547   6.744   20.495  1.00 14.49 ? 6   PHE A N   1 
ATOM   44   C  CA  . PHE A 1 6   ? 5.797   7.130   19.851  1.00 15.18 ? 6   PHE A CA  1 
ATOM   45   C  C   . PHE A 1 6   ? 6.700   7.675   20.932  1.00 14.51 ? 6   PHE A C   1 
ATOM   46   O  O   . PHE A 1 6   ? 6.217   8.178   21.954  1.00 15.05 ? 6   PHE A O   1 
ATOM   47   C  CB  . PHE A 1 6   ? 5.599   8.128   18.692  1.00 16.07 ? 6   PHE A CB  1 
ATOM   48   C  CG  . PHE A 1 6   ? 4.860   9.383   19.058  1.00 18.95 ? 6   PHE A CG  1 
ATOM   49   C  CD1 . PHE A 1 6   ? 5.505   10.426  19.737  1.00 17.92 ? 6   PHE A CD1 1 
ATOM   50   C  CD2 . PHE A 1 6   ? 3.535   9.538   18.696  1.00 19.53 ? 6   PHE A CD2 1 
ATOM   51   C  CE1 . PHE A 1 6   ? 4.825   11.617  20.051  1.00 17.58 ? 6   PHE A CE1 1 
ATOM   52   C  CE2 . PHE A 1 6   ? 2.838   10.737  19.003  1.00 21.18 ? 6   PHE A CE2 1 
ATOM   53   C  CZ  . PHE A 1 6   ? 3.489   11.764  19.677  1.00 18.15 ? 6   PHE A CZ  1 
ATOM   54   N  N   . GLY A 1 7   ? 8.007   7.527   20.745  1.00 12.31 ? 7   GLY A N   1 
ATOM   55   C  CA  . GLY A 1 7   ? 8.930   8.031   21.749  1.00 14.47 ? 7   GLY A CA  1 
ATOM   56   C  C   . GLY A 1 7   ? 10.154  8.686   21.144  1.00 16.78 ? 7   GLY A C   1 
ATOM   57   O  O   . GLY A 1 7   ? 10.783  8.128   20.225  1.00 15.60 ? 7   GLY A O   1 
ATOM   58   N  N   . PHE A 1 8   ? 10.466  9.886   21.648  1.00 13.96 ? 8   PHE A N   1 
ATOM   59   C  CA  . PHE A 1 8   ? 11.625  10.682  21.228  1.00 15.74 ? 8   PHE A CA  1 
ATOM   60   C  C   . PHE A 1 8   ? 12.505  10.885  22.470  1.00 18.74 ? 8   PHE A C   1 
ATOM   61   O  O   . PHE A 1 8   ? 12.262  11.816  23.247  1.00 18.38 ? 8   PHE A O   1 
ATOM   62   C  CB  . PHE A 1 8   ? 11.212  12.088  20.764  1.00 18.73 ? 8   PHE A CB  1 
ATOM   63   C  CG  . PHE A 1 8   ? 10.421  12.132  19.484  1.00 17.97 ? 8   PHE A CG  1 
ATOM   64   C  CD1 . PHE A 1 8   ? 9.018   12.144  19.503  1.00 16.55 ? 8   PHE A CD1 1 
ATOM   65   C  CD2 . PHE A 1 8   ? 11.076  12.297  18.267  1.00 17.37 ? 8   PHE A CD2 1 
ATOM   66   C  CE1 . PHE A 1 8   ? 8.278   12.336  18.306  1.00 13.70 ? 8   PHE A CE1 1 
ATOM   67   C  CE2 . PHE A 1 8   ? 10.355  12.487  17.074  1.00 16.24 ? 8   PHE A CE2 1 
ATOM   68   C  CZ  . PHE A 1 8   ? 8.956   12.508  17.096  1.00 18.65 ? 8   PHE A CZ  1 
ATOM   69   N  N   . PRO A 1 9   ? 13.501  10.013  22.697  1.00 18.39 ? 9   PRO A N   1 
ATOM   70   C  CA  . PRO A 1 9   ? 14.389  10.164  23.872  1.00 19.24 ? 9   PRO A CA  1 
ATOM   71   C  C   . PRO A 1 9   ? 15.226  11.427  23.700  1.00 22.31 ? 9   PRO A C   1 
ATOM   72   O  O   . PRO A 1 9   ? 15.669  12.040  24.675  1.00 24.79 ? 9   PRO A O   1 
ATOM   73   C  CB  . PRO A 1 9   ? 15.246  8.904   23.832  1.00 21.13 ? 9   PRO A CB  1 
ATOM   74   C  CG  . PRO A 1 9   ? 14.347  7.893   23.123  1.00 28.07 ? 9   PRO A CG  1 
ATOM   75   C  CD  . PRO A 1 9   ? 13.736  8.723   22.018  1.00 24.69 ? 9   PRO A CD  1 
ATOM   76   N  N   . THR A 1 10  ? 15.468  11.759  22.435  1.00 21.34 ? 10  THR A N   1 
ATOM   77   C  CA  A THR A 1 10  ? 16.199  12.959  22.039  0.50 23.21 ? 10  THR A CA  1 
ATOM   78   C  CA  B THR A 1 10  ? 16.219  12.936  22.031  0.50 24.80 ? 10  THR A CA  1 
ATOM   79   C  C   . THR A 1 10  ? 15.636  13.339  20.674  1.00 24.50 ? 10  THR A C   1 
ATOM   80   O  O   . THR A 1 10  ? 14.777  12.623  20.130  1.00 23.14 ? 10  THR A O   1 
ATOM   81   C  CB  A THR A 1 10  ? 17.740  12.734  21.915  0.50 25.40 ? 10  THR A CB  1 
ATOM   82   C  CB  B THR A 1 10  ? 17.723  12.610  21.869  0.50 28.13 ? 10  THR A CB  1 
ATOM   83   O  OG1 A THR A 1 10  ? 18.016  11.766  20.897  0.50 16.46 ? 10  THR A OG1 1 
ATOM   84   O  OG1 B THR A 1 10  ? 18.236  12.080  23.096  0.50 33.92 ? 10  THR A OG1 1 
ATOM   85   C  CG2 A THR A 1 10  ? 18.320  12.273  23.238  0.50 30.29 ? 10  THR A CG2 1 
ATOM   86   C  CG2 B THR A 1 10  ? 18.497  13.853  21.522  0.50 32.19 ? 10  THR A CG2 1 
ATOM   87   N  N   . PHE A 1 11  ? 16.088  14.468  20.125  1.00 20.30 ? 11  PHE A N   1 
ATOM   88   C  CA  . PHE A 1 11  ? 15.609  14.923  18.829  1.00 23.99 ? 11  PHE A CA  1 
ATOM   89   C  C   . PHE A 1 11  ? 16.735  15.157  17.813  1.00 27.79 ? 11  PHE A C   1 
ATOM   90   O  O   . PHE A 1 11  ? 17.226  16.277  17.674  1.00 26.79 ? 11  PHE A O   1 
ATOM   91   C  CB  . PHE A 1 11  ? 14.803  16.214  18.984  1.00 24.40 ? 11  PHE A CB  1 
ATOM   92   C  CG  . PHE A 1 11  ? 13.472  16.028  19.667  1.00 20.68 ? 11  PHE A CG  1 
ATOM   93   C  CD1 . PHE A 1 11  ? 12.335  15.694  18.929  1.00 22.65 ? 11  PHE A CD1 1 
ATOM   94   C  CD2 . PHE A 1 11  ? 13.355  16.199  21.049  1.00 21.92 ? 11  PHE A CD2 1 
ATOM   95   C  CE1 . PHE A 1 11  ? 11.104  15.536  19.553  1.00 20.44 ? 11  PHE A CE1 1 
ATOM   96   C  CE2 . PHE A 1 11  ? 12.122  16.044  21.690  1.00 21.31 ? 11  PHE A CE2 1 
ATOM   97   C  CZ  . PHE A 1 11  ? 10.994  15.712  20.929  1.00 25.49 ? 11  PHE A CZ  1 
ATOM   98   N  N   . PRO A 1 12  ? 17.158  14.101  17.090  1.00 29.88 ? 12  PRO A N   1 
ATOM   99   C  CA  . PRO A 1 12  ? 18.230  14.267  16.095  1.00 30.19 ? 12  PRO A CA  1 
ATOM   100  C  C   . PRO A 1 12  ? 17.733  15.188  14.988  1.00 31.60 ? 12  PRO A C   1 
ATOM   101  O  O   . PRO A 1 12  ? 16.527  15.329  14.791  1.00 28.62 ? 12  PRO A O   1 
ATOM   102  C  CB  . PRO A 1 12  ? 18.468  12.850  15.607  1.00 32.43 ? 12  PRO A CB  1 
ATOM   103  C  CG  . PRO A 1 12  ? 18.106  12.020  16.814  1.00 35.42 ? 12  PRO A CG  1 
ATOM   104  C  CD  . PRO A 1 12  ? 16.840  12.678  17.275  1.00 29.38 ? 12  PRO A CD  1 
ATOM   105  N  N   . SER A 1 13  ? 18.653  15.793  14.243  1.00 32.72 ? 13  SER A N   1 
ATOM   106  C  CA  A SER A 1 13  ? 18.281  16.723  13.180  0.50 35.36 ? 13  SER A CA  1 
ATOM   107  C  CA  B SER A 1 13  ? 18.282  16.723  13.180  0.50 35.29 ? 13  SER A CA  1 
ATOM   108  C  C   . SER A 1 13  ? 17.478  16.118  12.033  1.00 35.98 ? 13  SER A C   1 
ATOM   109  O  O   . SER A 1 13  ? 16.720  16.820  11.367  1.00 36.84 ? 13  SER A O   1 
ATOM   110  C  CB  A SER A 1 13  ? 19.536  17.397  12.617  0.50 39.24 ? 13  SER A CB  1 
ATOM   111  C  CB  B SER A 1 13  ? 19.539  17.395  12.616  0.50 39.13 ? 13  SER A CB  1 
ATOM   112  O  OG  A SER A 1 13  ? 20.464  16.433  12.154  0.50 42.79 ? 13  SER A OG  1 
ATOM   113  O  OG  B SER A 1 13  ? 20.249  18.082  13.632  0.50 41.46 ? 13  SER A OG  1 
ATOM   114  N  N   . ASP A 1 14  ? 17.633  14.821  11.805  1.00 36.66 ? 14  ASP A N   1 
ATOM   115  C  CA  A ASP A 1 14  ? 16.922  14.154  10.716  0.50 40.22 ? 14  ASP A CA  1 
ATOM   116  C  CA  B ASP A 1 14  ? 16.934  14.147  10.717  0.50 40.19 ? 14  ASP A CA  1 
ATOM   117  C  C   . ASP A 1 14  ? 15.502  13.738  11.088  1.00 38.17 ? 14  ASP A C   1 
ATOM   118  O  O   . ASP A 1 14  ? 15.226  12.570  11.311  1.00 45.39 ? 14  ASP A O   1 
ATOM   119  C  CB  A ASP A 1 14  ? 17.713  12.926  10.250  0.50 43.38 ? 14  ASP A CB  1 
ATOM   120  C  CB  B ASP A 1 14  ? 17.756  12.922  10.296  0.50 43.17 ? 14  ASP A CB  1 
ATOM   121  C  CG  A ASP A 1 14  ? 18.101  12.010  11.394  0.50 48.22 ? 14  ASP A CG  1 
ATOM   122  C  CG  B ASP A 1 14  ? 17.212  12.244  9.060   0.50 47.91 ? 14  ASP A CG  1 
ATOM   123  O  OD1 A ASP A 1 14  ? 17.211  11.370  11.993  0.50 51.95 ? 14  ASP A OD1 1 
ATOM   124  O  OD1 B ASP A 1 14  ? 16.578  12.932  8.231   0.50 50.67 ? 14  ASP A OD1 1 
ATOM   125  O  OD2 A ASP A 1 14  ? 19.309  11.937  11.698  0.50 52.57 ? 14  ASP A OD2 1 
ATOM   126  O  OD2 B ASP A 1 14  ? 17.441  11.025  8.913   0.50 50.57 ? 14  ASP A OD2 1 
ATOM   127  N  N   . GLN A 1 15  ? 14.593  14.702  11.142  1.00 34.96 ? 15  GLN A N   1 
ATOM   128  C  CA  . GLN A 1 15  ? 13.203  14.409  11.495  1.00 31.28 ? 15  GLN A CA  1 
ATOM   129  C  C   . GLN A 1 15  ? 12.289  14.262  10.283  1.00 29.34 ? 15  GLN A C   1 
ATOM   130  O  O   . GLN A 1 15  ? 12.401  15.015  9.313   1.00 27.91 ? 15  GLN A O   1 
ATOM   131  C  CB  . GLN A 1 15  ? 12.659  15.507  12.400  1.00 31.69 ? 15  GLN A CB  1 
ATOM   132  C  CG  . GLN A 1 15  ? 13.310  15.537  13.767  1.00 30.54 ? 15  GLN A CG  1 
ATOM   133  C  CD  . GLN A 1 15  ? 13.083  14.258  14.534  1.00 33.23 ? 15  GLN A CD  1 
ATOM   134  O  OE1 . GLN A 1 15  ? 11.953  13.777  14.630  1.00 35.50 ? 15  GLN A OE1 1 
ATOM   135  N  NE2 . GLN A 1 15  ? 14.149  13.696  15.086  1.00 33.79 ? 15  GLN A NE2 1 
ATOM   136  N  N   . LYS A 1 16  ? 11.373  13.298  10.348  1.00 20.86 ? 16  LYS A N   1 
ATOM   137  C  CA  . LYS A 1 16  ? 10.448  13.062  9.246   1.00 22.89 ? 16  LYS A CA  1 
ATOM   138  C  C   . LYS A 1 16  ? 8.980   13.190  9.637   1.00 20.98 ? 16  LYS A C   1 
ATOM   139  O  O   . LYS A 1 16  ? 8.149   13.501  8.790   1.00 18.55 ? 16  LYS A O   1 
ATOM   140  C  CB  . LYS A 1 16  ? 10.644  11.649  8.672   1.00 21.35 ? 16  LYS A CB  1 
ATOM   141  C  CG  . LYS A 1 16  ? 12.045  11.328  8.166   1.00 28.26 ? 16  LYS A CG  1 
ATOM   142  C  CD  . LYS A 1 16  ? 12.418  12.182  6.984   1.00 27.38 ? 16  LYS A CD  1 
ATOM   143  C  CE  . LYS A 1 16  ? 13.808  11.797  6.493   1.00 38.38 ? 16  LYS A CE  1 
ATOM   144  N  NZ  . LYS A 1 16  ? 14.250  12.665  5.365   1.00 42.03 ? 16  LYS A NZ  1 
ATOM   145  N  N   . ASN A 1 17  ? 8.666   12.935  10.910  1.00 17.08 ? 17  ASN A N   1 
ATOM   146  C  CA  . ASN A 1 17  ? 7.277   12.954  11.370  1.00 17.82 ? 17  ASN A CA  1 
ATOM   147  C  C   . ASN A 1 17  ? 6.843   14.149  12.211  1.00 19.82 ? 17  ASN A C   1 
ATOM   148  O  O   . ASN A 1 17  ? 5.838   14.081  12.910  1.00 18.26 ? 17  ASN A O   1 
ATOM   149  C  CB  . ASN A 1 17  ? 6.988   11.683  12.158  1.00 17.63 ? 17  ASN A CB  1 
ATOM   150  C  CG  . ASN A 1 17  ? 7.109   10.431  11.306  1.00 18.17 ? 17  ASN A CG  1 
ATOM   151  O  OD1 . ASN A 1 17  ? 6.640   10.408  10.172  1.00 17.65 ? 17  ASN A OD1 1 
ATOM   152  N  ND2 . ASN A 1 17  ? 7.727   9.390   11.852  1.00 17.87 ? 17  ASN A ND2 1 
ATOM   153  N  N   . LEU A 1 18  ? 7.598   15.233  12.152  1.00 21.53 ? 18  LEU A N   1 
ATOM   154  C  CA  . LEU A 1 18  ? 7.231   16.419  12.915  1.00 21.58 ? 18  LEU A CA  1 
ATOM   155  C  C   . LEU A 1 18  ? 6.863   17.573  11.996  1.00 21.04 ? 18  LEU A C   1 
ATOM   156  O  O   . LEU A 1 18  ? 7.505   17.795  10.968  1.00 23.24 ? 18  LEU A O   1 
ATOM   157  C  CB  . LEU A 1 18  ? 8.385   16.849  13.816  1.00 21.21 ? 18  LEU A CB  1 
ATOM   158  C  CG  . LEU A 1 18  ? 8.660   15.984  15.048  1.00 22.80 ? 18  LEU A CG  1 
ATOM   159  C  CD1 . LEU A 1 18  ? 9.915   16.486  15.739  1.00 28.32 ? 18  LEU A CD1 1 
ATOM   160  C  CD2 . LEU A 1 18  ? 7.457   16.032  16.008  1.00 19.81 ? 18  LEU A CD2 1 
ATOM   161  N  N   . ILE A 1 19  ? 5.800   18.280  12.350  1.00 19.84 ? 19  ILE A N   1 
ATOM   162  C  CA  . ILE A 1 19  ? 5.373   19.456  11.591  1.00 21.28 ? 19  ILE A CA  1 
ATOM   163  C  C   . ILE A 1 19  ? 5.923   20.643  12.393  1.00 22.42 ? 19  ILE A C   1 
ATOM   164  O  O   . ILE A 1 19  ? 5.595   20.803  13.574  1.00 22.42 ? 19  ILE A O   1 
ATOM   165  C  CB  . ILE A 1 19  ? 3.853   19.535  11.536  1.00 21.69 ? 19  ILE A CB  1 
ATOM   166  C  CG1 . ILE A 1 19  ? 3.313   18.304  10.795  1.00 22.00 ? 19  ILE A CG1 1 
ATOM   167  C  CG2 . ILE A 1 19  ? 3.413   20.830  10.861  1.00 26.59 ? 19  ILE A CG2 1 
ATOM   168  C  CD1 . ILE A 1 19  ? 1.806   18.152  10.881  1.00 31.15 ? 19  ILE A CD1 1 
ATOM   169  N  N   . PHE A 1 20  ? 6.792   21.439  11.775  1.00 23.04 ? 20  PHE A N   1 
ATOM   170  C  CA  . PHE A 1 20  ? 7.369   22.603  12.451  1.00 22.54 ? 20  PHE A CA  1 
ATOM   171  C  C   . PHE A 1 20  ? 6.602   23.828  12.011  1.00 25.55 ? 20  PHE A C   1 
ATOM   172  O  O   . PHE A 1 20  ? 6.331   23.992  10.824  1.00 24.58 ? 20  PHE A O   1 
ATOM   173  C  CB  . PHE A 1 20  ? 8.836   22.781  12.070  1.00 23.95 ? 20  PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 20  ? 9.720   21.673  12.534  1.00 26.53 ? 20  PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 20  ? 10.348  21.738  13.772  1.00 25.89 ? 20  PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 20  ? 9.906   20.539  11.741  1.00 29.59 ? 20  PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 20  ? 11.152  20.683  14.221  1.00 29.85 ? 20  PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 20  ? 10.702  19.486  12.178  1.00 27.15 ? 20  PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 20  ? 11.326  19.553  13.417  1.00 28.33 ? 20  PHE A CZ  1 
ATOM   180  N  N   . GLN A 1 21  ? 6.236   24.684  12.962  1.00 20.98 ? 21  GLN A N   1 
ATOM   181  C  CA  . GLN A 1 21  ? 5.503   25.898  12.639  1.00 24.08 ? 21  GLN A CA  1 
ATOM   182  C  C   . GLN A 1 21  ? 6.211   27.073  13.283  1.00 24.26 ? 21  GLN A C   1 
ATOM   183  O  O   . GLN A 1 21  ? 6.862   26.926  14.319  1.00 21.39 ? 21  GLN A O   1 
ATOM   184  C  CB  . GLN A 1 21  ? 4.060   25.813  13.134  1.00 23.89 ? 21  GLN A CB  1 
ATOM   185  C  CG  . GLN A 1 21  ? 3.320   24.580  12.626  1.00 27.38 ? 21  GLN A CG  1 
ATOM   186  C  CD  . GLN A 1 21  ? 1.853   24.589  13.001  1.00 27.72 ? 21  GLN A CD  1 
ATOM   187  O  OE1 . GLN A 1 21  ? 1.490   24.979  14.111  1.00 25.45 ? 21  GLN A OE1 1 
ATOM   188  N  NE2 . GLN A 1 21  ? 1.002   24.135  12.090  1.00 26.08 ? 21  GLN A NE2 1 
ATOM   189  N  N   . GLY A 1 22  ? 6.117   28.239  12.658  1.00 24.38 ? 22  GLY A N   1 
ATOM   190  C  CA  . GLY A 1 22  ? 6.789   29.393  13.232  1.00 23.74 ? 22  GLY A CA  1 
ATOM   191  C  C   . GLY A 1 22  ? 8.290   29.223  13.255  1.00 23.56 ? 22  GLY A C   1 
ATOM   192  O  O   . GLY A 1 22  ? 8.882   28.718  12.296  1.00 24.08 ? 22  GLY A O   1 
ATOM   193  N  N   . ASP A 1 23  ? 8.918   29.603  14.366  1.00 22.85 ? 23  ASP A N   1 
ATOM   194  C  CA  . ASP A 1 23  ? 10.371  29.538  14.494  1.00 22.79 ? 23  ASP A CA  1 
ATOM   195  C  C   . ASP A 1 23  ? 10.984  28.247  15.005  1.00 24.12 ? 23  ASP A C   1 
ATOM   196  O  O   . ASP A 1 23  ? 12.200  28.156  15.141  1.00 24.42 ? 23  ASP A O   1 
ATOM   197  C  CB  . ASP A 1 23  ? 10.869  30.686  15.397  1.00 28.37 ? 23  ASP A CB  1 
ATOM   198  C  CG  . ASP A 1 23  ? 10.502  32.052  14.856  1.00 32.19 ? 23  ASP A CG  1 
ATOM   199  O  OD1 . ASP A 1 23  ? 10.501  32.201  13.621  1.00 31.39 ? 23  ASP A OD1 1 
ATOM   200  O  OD2 . ASP A 1 23  ? 10.228  32.975  15.658  1.00 29.48 ? 23  ASP A OD2 1 
ATOM   201  N  N   . ALA A 1 24  ? 10.166  27.244  15.285  1.00 22.87 ? 24  ALA A N   1 
ATOM   202  C  CA  . ALA A 1 24  ? 10.686  25.994  15.827  1.00 22.14 ? 24  ALA A CA  1 
ATOM   203  C  C   . ALA A 1 24  ? 11.727  25.271  14.981  1.00 22.63 ? 24  ALA A C   1 
ATOM   204  O  O   . ALA A 1 24  ? 11.566  25.117  13.777  1.00 23.84 ? 24  ALA A O   1 
ATOM   205  C  CB  . ALA A 1 24  ? 9.512   25.028  16.112  1.00 19.44 ? 24  ALA A CB  1 
ATOM   206  N  N   . GLN A 1 25  ? 12.782  24.789  15.617  1.00 23.32 ? 25  GLN A N   1 
ATOM   207  C  CA  . GLN A 1 25  ? 13.779  24.027  14.876  1.00 31.21 ? 25  GLN A CA  1 
ATOM   208  C  C   . GLN A 1 25  ? 14.617  23.146  15.782  1.00 32.37 ? 25  GLN A C   1 
ATOM   209  O  O   . GLN A 1 25  ? 14.727  23.392  16.989  1.00 32.06 ? 25  GLN A O   1 
ATOM   210  C  CB  . GLN A 1 25  ? 14.687  24.954  14.064  1.00 35.74 ? 25  GLN A CB  1 
ATOM   211  C  CG  . GLN A 1 25  ? 15.433  25.971  14.869  1.00 42.41 ? 25  GLN A CG  1 
ATOM   212  C  CD  . GLN A 1 25  ? 16.408  26.778  14.019  1.00 48.03 ? 25  GLN A CD  1 
ATOM   213  O  OE1 . GLN A 1 25  ? 17.379  26.238  13.477  1.00 50.43 ? 25  GLN A OE1 1 
ATOM   214  N  NE2 . GLN A 1 25  ? 16.151  28.077  13.900  1.00 50.92 ? 25  GLN A NE2 1 
ATOM   215  N  N   . ILE A 1 26  ? 15.197  22.104  15.199  1.00 29.60 ? 26  ILE A N   1 
ATOM   216  C  CA  . ILE A 1 26  ? 16.047  21.189  15.939  1.00 29.93 ? 26  ILE A CA  1 
ATOM   217  C  C   . ILE A 1 26  ? 17.431  21.800  16.033  1.00 33.90 ? 26  ILE A C   1 
ATOM   218  O  O   . ILE A 1 26  ? 17.950  22.354  15.059  1.00 34.59 ? 26  ILE A O   1 
ATOM   219  C  CB  . ILE A 1 26  ? 16.183  19.827  15.227  1.00 36.02 ? 26  ILE A CB  1 
ATOM   220  C  CG1 . ILE A 1 26  ? 14.809  19.169  15.079  1.00 36.97 ? 26  ILE A CG1 1 
ATOM   221  C  CG2 . ILE A 1 26  ? 17.141  18.928  16.006  1.00 32.57 ? 26  ILE A CG2 1 
ATOM   222  C  CD1 . ILE A 1 26  ? 14.179  18.809  16.368  1.00 40.64 ? 26  ILE A CD1 1 
ATOM   223  N  N   . LYS A 1 27  ? 18.040  21.679  17.201  1.00 33.44 ? 27  LYS A N   1 
ATOM   224  C  CA  . LYS A 1 27  ? 19.366  22.220  17.430  1.00 36.06 ? 27  LYS A CA  1 
ATOM   225  C  C   . LYS A 1 27  ? 19.966  21.471  18.608  1.00 36.75 ? 27  LYS A C   1 
ATOM   226  O  O   . LYS A 1 27  ? 19.362  21.383  19.675  1.00 36.35 ? 27  LYS A O   1 
ATOM   227  C  CB  . LYS A 1 27  ? 19.249  23.710  17.749  1.00 41.31 ? 27  LYS A CB  1 
ATOM   228  C  CG  . LYS A 1 27  ? 20.249  24.593  17.050  1.00 46.65 ? 27  LYS A CG  1 
ATOM   229  C  CD  . LYS A 1 27  ? 19.759  26.042  17.059  1.00 50.85 ? 27  LYS A CD  1 
ATOM   230  C  CE  . LYS A 1 27  ? 20.680  26.959  16.265  1.00 53.65 ? 27  LYS A CE  1 
ATOM   231  N  N   . ASN A 1 28  ? 21.143  20.901  18.403  1.00 35.92 ? 28  ASN A N   1 
ATOM   232  C  CA  . ASN A 1 28  ? 21.821  20.161  19.456  1.00 38.29 ? 28  ASN A CA  1 
ATOM   233  C  C   . ASN A 1 28  ? 20.963  19.055  20.077  1.00 35.49 ? 28  ASN A C   1 
ATOM   234  O  O   . ASN A 1 28  ? 20.866  18.948  21.298  1.00 33.30 ? 28  ASN A O   1 
ATOM   235  C  CB  . ASN A 1 28  ? 22.289  21.120  20.554  1.00 43.82 ? 28  ASN A CB  1 
ATOM   236  C  CG  . ASN A 1 28  ? 23.251  22.179  20.032  1.00 51.58 ? 28  ASN A CG  1 
ATOM   237  O  OD1 . ASN A 1 28  ? 24.256  21.855  19.390  1.00 53.67 ? 28  ASN A OD1 1 
ATOM   238  N  ND2 . ASN A 1 28  ? 22.947  23.448  20.304  1.00 50.06 ? 28  ASN A ND2 1 
ATOM   239  N  N   . ASN A 1 29  ? 20.329  18.247  19.234  1.00 32.72 ? 29  ASN A N   1 
ATOM   240  C  CA  . ASN A 1 29  ? 19.523  17.131  19.715  1.00 30.86 ? 29  ASN A CA  1 
ATOM   241  C  C   . ASN A 1 29  ? 18.278  17.483  20.536  1.00 25.57 ? 29  ASN A C   1 
ATOM   242  O  O   . ASN A 1 29  ? 17.717  16.623  21.220  1.00 24.46 ? 29  ASN A O   1 
ATOM   243  C  CB  . ASN A 1 29  ? 20.413  16.185  20.515  1.00 36.38 ? 29  ASN A CB  1 
ATOM   244  C  CG  . ASN A 1 29  ? 21.147  15.203  19.630  1.00 45.05 ? 29  ASN A CG  1 
ATOM   245  O  OD1 . ASN A 1 29  ? 21.494  15.517  18.490  1.00 43.87 ? 29  ASN A OD1 1 
ATOM   246  N  ND2 . ASN A 1 29  ? 21.392  14.004  20.152  1.00 51.38 ? 29  ASN A ND2 1 
ATOM   247  N  N   . ALA A 1 30  ? 17.850  18.737  20.474  1.00 22.64 ? 30  ALA A N   1 
ATOM   248  C  CA  . ALA A 1 30  ? 16.645  19.147  21.193  1.00 24.52 ? 30  ALA A CA  1 
ATOM   249  C  C   . ALA A 1 30  ? 15.822  20.048  20.292  1.00 22.46 ? 30  ALA A C   1 
ATOM   250  O  O   . ALA A 1 30  ? 16.325  20.559  19.295  1.00 25.82 ? 30  ALA A O   1 
ATOM   251  C  CB  . ALA A 1 30  ? 17.025  19.880  22.476  1.00 25.05 ? 30  ALA A CB  1 
ATOM   252  N  N   . VAL A 1 31  ? 14.543  20.223  20.604  1.00 19.15 ? 31  VAL A N   1 
ATOM   253  C  CA  . VAL A 1 31  ? 13.729  21.112  19.790  1.00 19.83 ? 31  VAL A CA  1 
ATOM   254  C  C   . VAL A 1 31  ? 13.789  22.498  20.439  1.00 24.20 ? 31  VAL A C   1 
ATOM   255  O  O   . VAL A 1 31  ? 13.467  22.642  21.624  1.00 22.45 ? 31  VAL A O   1 
ATOM   256  C  CB  . VAL A 1 31  ? 12.235  20.664  19.748  1.00 23.73 ? 31  VAL A CB  1 
ATOM   257  C  CG1 . VAL A 1 31  ? 11.413  21.667  18.958  1.00 21.78 ? 31  VAL A CG1 1 
ATOM   258  C  CG2 . VAL A 1 31  ? 12.109  19.263  19.120  1.00 23.28 ? 31  VAL A CG2 1 
ATOM   259  N  N   . GLN A 1 32  ? 14.233  23.501  19.688  1.00 19.03 ? 32  GLN A N   1 
ATOM   260  C  CA  . GLN A 1 32  ? 14.245  24.882  20.207  1.00 23.36 ? 32  GLN A CA  1 
ATOM   261  C  C   . GLN A 1 32  ? 12.955  25.469  19.647  1.00 22.44 ? 32  GLN A C   1 
ATOM   262  O  O   . GLN A 1 32  ? 12.854  25.744  18.445  1.00 22.82 ? 32  GLN A O   1 
ATOM   263  C  CB  . GLN A 1 32  ? 15.464  25.662  19.687  1.00 24.35 ? 32  GLN A CB  1 
ATOM   264  C  CG  . GLN A 1 32  ? 16.782  25.158  20.222  1.00 26.74 ? 32  GLN A CG  1 
ATOM   265  C  CD  . GLN A 1 32  ? 16.906  25.305  21.739  1.00 36.05 ? 32  GLN A CD  1 
ATOM   266  O  OE1 . GLN A 1 32  ? 16.157  26.054  22.382  1.00 29.86 ? 32  GLN A OE1 1 
ATOM   267  N  NE2 . GLN A 1 32  ? 17.868  24.592  22.315  1.00 42.11 ? 32  GLN A NE2 1 
ATOM   268  N  N   . LEU A 1 33  ? 11.943  25.644  20.495  1.00 19.65 ? 33  LEU A N   1 
ATOM   269  C  CA  A LEU A 1 33  ? 10.669  26.160  20.020  0.50 20.55 ? 33  LEU A CA  1 
ATOM   270  C  CA  B LEU A 1 33  ? 10.666  26.166  20.024  0.50 20.80 ? 33  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 33  ? 10.720  27.630  19.639  1.00 21.74 ? 33  LEU A C   1 
ATOM   272  O  O   . LEU A 1 33  ? 10.040  28.047  18.710  1.00 22.13 ? 33  LEU A O   1 
ATOM   273  C  CB  A LEU A 1 33  ? 9.578   25.916  21.065  0.50 20.91 ? 33  LEU A CB  1 
ATOM   274  C  CB  B LEU A 1 33  ? 9.569   25.950  21.072  0.50 21.92 ? 33  LEU A CB  1 
ATOM   275  C  CG  A LEU A 1 33  ? 9.207   24.440  21.274  0.50 20.09 ? 33  LEU A CG  1 
ATOM   276  C  CG  B LEU A 1 33  ? 8.988   24.535  21.186  0.50 22.50 ? 33  LEU A CG  1 
ATOM   277  C  CD1 A LEU A 1 33  ? 8.466   24.278  22.601  0.50 20.25 ? 33  LEU A CD1 1 
ATOM   278  C  CD1 B LEU A 1 33  ? 10.106  23.540  21.370  0.50 24.05 ? 33  LEU A CD1 1 
ATOM   279  C  CD2 A LEU A 1 33  ? 8.357   23.947  20.106  0.50 16.24 ? 33  LEU A CD2 1 
ATOM   280  C  CD2 B LEU A 1 33  ? 8.018   24.467  22.366  0.50 23.33 ? 33  LEU A CD2 1 
ATOM   281  N  N   . THR A 1 34  ? 11.527  28.404  20.363  1.00 21.84 ? 34  THR A N   1 
ATOM   282  C  CA  . THR A 1 34  ? 11.653  29.832  20.072  1.00 21.22 ? 34  THR A CA  1 
ATOM   283  C  C   . THR A 1 34  ? 13.034  30.136  19.524  1.00 21.31 ? 34  THR A C   1 
ATOM   284  O  O   . THR A 1 34  ? 14.023  29.469  19.853  1.00 23.37 ? 34  THR A O   1 
ATOM   285  C  CB  . THR A 1 34  ? 11.377  30.699  21.318  1.00 18.64 ? 34  THR A CB  1 
ATOM   286  O  OG1 . THR A 1 34  ? 12.052  30.141  22.452  1.00 18.19 ? 34  THR A OG1 1 
ATOM   287  C  CG2 . THR A 1 34  ? 9.867   30.773  21.582  1.00 18.86 ? 34  THR A CG2 1 
ATOM   288  N  N   . LYS A 1 35  ? 13.088  31.165  18.687  1.00 22.19 ? 35  LYS A N   1 
ATOM   289  C  CA  . LYS A 1 35  ? 14.323  31.562  18.022  1.00 29.24 ? 35  LYS A CA  1 
ATOM   290  C  C   . LYS A 1 35  ? 15.497  31.950  18.925  1.00 33.42 ? 35  LYS A C   1 
ATOM   291  O  O   . LYS A 1 35  ? 15.329  32.541  19.995  1.00 30.79 ? 35  LYS A O   1 
ATOM   292  C  CB  . LYS A 1 35  ? 14.015  32.710  17.048  1.00 30.67 ? 35  LYS A CB  1 
ATOM   293  C  CG  . LYS A 1 35  ? 15.189  33.101  16.147  1.00 37.28 ? 35  LYS A CG  1 
ATOM   294  C  CD  . LYS A 1 35  ? 14.804  34.230  15.185  1.00 38.22 ? 35  LYS A CD  1 
ATOM   295  C  CE  . LYS A 1 35  ? 13.728  33.793  14.192  1.00 40.12 ? 35  LYS A CE  1 
ATOM   296  N  N   . THR A 1 36  ? 16.695  31.589  18.490  1.00 34.12 ? 36  THR A N   1 
ATOM   297  C  CA  . THR A 1 36  ? 17.900  31.936  19.226  1.00 40.37 ? 36  THR A CA  1 
ATOM   298  C  C   . THR A 1 36  ? 18.858  32.568  18.222  1.00 44.54 ? 36  THR A C   1 
ATOM   299  O  O   . THR A 1 36  ? 18.714  32.362  17.012  1.00 43.79 ? 36  THR A O   1 
ATOM   300  C  CB  . THR A 1 36  ? 18.555  30.695  19.868  1.00 40.58 ? 36  THR A CB  1 
ATOM   301  O  OG1 . THR A 1 36  ? 18.795  29.696  18.864  1.00 43.97 ? 36  THR A OG1 1 
ATOM   302  C  CG2 . THR A 1 36  ? 17.649  30.120  20.952  1.00 38.38 ? 36  THR A CG2 1 
ATOM   303  N  N   . ASP A 1 37  ? 19.812  33.357  18.705  1.00 47.03 ? 37  ASP A N   1 
ATOM   304  C  CA  . ASP A 1 37  ? 20.767  33.984  17.800  1.00 50.32 ? 37  ASP A CA  1 
ATOM   305  C  C   . ASP A 1 37  ? 21.934  33.043  17.510  1.00 52.40 ? 37  ASP A C   1 
ATOM   306  O  O   . ASP A 1 37  ? 21.942  31.895  17.953  1.00 51.74 ? 37  ASP A O   1 
ATOM   307  C  CB  . ASP A 1 37  ? 21.288  35.305  18.377  1.00 48.81 ? 37  ASP A CB  1 
ATOM   308  C  CG  . ASP A 1 37  ? 22.078  35.120  19.655  1.00 48.48 ? 37  ASP A CG  1 
ATOM   309  O  OD1 . ASP A 1 37  ? 22.639  34.025  19.876  1.00 45.88 ? 37  ASP A OD1 1 
ATOM   310  O  OD2 . ASP A 1 37  ? 22.148  36.092  20.439  1.00 52.50 ? 37  ASP A OD2 1 
ATOM   311  N  N   . SER A 1 38  ? 22.917  33.547  16.768  1.00 55.28 ? 38  SER A N   1 
ATOM   312  C  CA  . SER A 1 38  ? 24.099  32.783  16.374  1.00 57.94 ? 38  SER A CA  1 
ATOM   313  C  C   . SER A 1 38  ? 24.833  32.098  17.518  1.00 59.16 ? 38  SER A C   1 
ATOM   314  O  O   . SER A 1 38  ? 25.454  31.051  17.326  1.00 59.86 ? 38  SER A O   1 
ATOM   315  C  CB  . SER A 1 38  ? 25.077  33.704  15.653  1.00 59.96 ? 38  SER A CB  1 
ATOM   316  O  OG  . SER A 1 38  ? 24.404  34.479  14.678  1.00 63.24 ? 38  SER A OG  1 
ATOM   317  N  N   . ASN A 1 39  ? 24.765  32.694  18.702  1.00 59.37 ? 39  ASN A N   1 
ATOM   318  C  CA  . ASN A 1 39  ? 25.449  32.157  19.874  1.00 60.36 ? 39  ASN A CA  1 
ATOM   319  C  C   . ASN A 1 39  ? 24.558  31.279  20.750  1.00 59.51 ? 39  ASN A C   1 
ATOM   320  O  O   . ASN A 1 39  ? 25.021  30.711  21.740  1.00 59.73 ? 39  ASN A O   1 
ATOM   321  C  CB  . ASN A 1 39  ? 26.024  33.300  20.720  1.00 62.48 ? 39  ASN A CB  1 
ATOM   322  C  CG  . ASN A 1 39  ? 25.651  34.676  20.185  1.00 65.47 ? 39  ASN A CG  1 
ATOM   323  O  OD1 . ASN A 1 39  ? 25.299  35.577  20.951  1.00 67.93 ? 39  ASN A OD1 1 
ATOM   324  N  ND2 . ASN A 1 39  ? 25.741  34.850  18.867  1.00 67.97 ? 39  ASN A ND2 1 
ATOM   325  N  N   . GLY A 1 40  ? 23.281  31.175  20.393  1.00 58.16 ? 40  GLY A N   1 
ATOM   326  C  CA  . GLY A 1 40  ? 22.372  30.346  21.165  1.00 55.00 ? 40  GLY A CA  1 
ATOM   327  C  C   . GLY A 1 40  ? 21.576  31.099  22.213  1.00 52.37 ? 40  GLY A C   1 
ATOM   328  O  O   . GLY A 1 40  ? 20.934  30.490  23.069  1.00 51.17 ? 40  GLY A O   1 
ATOM   329  N  N   . ASN A 1 41  ? 21.614  32.424  22.150  1.00 50.37 ? 41  ASN A N   1 
ATOM   330  C  CA  . ASN A 1 41  ? 20.880  33.247  23.103  1.00 48.73 ? 41  ASN A CA  1 
ATOM   331  C  C   . ASN A 1 41  ? 19.453  33.496  22.636  1.00 44.57 ? 41  ASN A C   1 
ATOM   332  O  O   . ASN A 1 41  ? 19.201  33.674  21.445  1.00 43.59 ? 41  ASN A O   1 
ATOM   333  C  CB  . ASN A 1 41  ? 21.587  34.584  23.296  1.00 51.14 ? 41  ASN A CB  1 
ATOM   334  C  CG  . ASN A 1 41  ? 22.911  34.439  24.005  1.00 55.36 ? 41  ASN A CG  1 
ATOM   335  O  OD1 . ASN A 1 41  ? 23.774  35.307  23.899  1.00 59.00 ? 41  ASN A OD1 1 
ATOM   336  N  ND2 . ASN A 1 41  ? 23.079  33.343  24.742  1.00 54.12 ? 41  ASN A ND2 1 
ATOM   337  N  N   . PRO A 1 42  ? 18.497  33.515  23.575  1.00 40.09 ? 42  PRO A N   1 
ATOM   338  C  CA  . PRO A 1 42  ? 17.102  33.750  23.202  1.00 37.01 ? 42  PRO A CA  1 
ATOM   339  C  C   . PRO A 1 42  ? 16.915  35.179  22.709  1.00 34.90 ? 42  PRO A C   1 
ATOM   340  O  O   . PRO A 1 42  ? 17.646  36.085  23.128  1.00 32.84 ? 42  PRO A O   1 
ATOM   341  C  CB  . PRO A 1 42  ? 16.349  33.484  24.507  1.00 35.55 ? 42  PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 42  ? 17.315  33.961  25.540  1.00 38.24 ? 42  PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 42  ? 18.647  33.422  25.041  1.00 39.56 ? 42  PRO A CD  1 
ATOM   344  N  N   . VAL A 1 43  ? 15.943  35.376  21.827  1.00 30.74 ? 43  VAL A N   1 
ATOM   345  C  CA  . VAL A 1 43  ? 15.641  36.698  21.288  1.00 31.71 ? 43  VAL A CA  1 
ATOM   346  C  C   . VAL A 1 43  ? 14.165  37.011  21.479  1.00 31.13 ? 43  VAL A C   1 
ATOM   347  O  O   . VAL A 1 43  ? 13.346  36.115  21.667  1.00 28.24 ? 43  VAL A O   1 
ATOM   348  C  CB  . VAL A 1 43  ? 15.973  36.783  19.780  1.00 32.10 ? 43  VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 43  ? 17.414  36.367  19.546  1.00 34.15 ? 43  VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 43  ? 15.029  35.894  18.983  1.00 35.27 ? 43  VAL A CG2 1 
ATOM   351  N  N   . ALA A 1 44  ? 13.830  38.290  21.434  1.00 27.58 ? 44  ALA A N   1 
ATOM   352  C  CA  . ALA A 1 44  ? 12.452  38.724  21.598  1.00 30.51 ? 44  ALA A CA  1 
ATOM   353  C  C   . ALA A 1 44  ? 11.629  38.446  20.346  1.00 31.46 ? 44  ALA A C   1 
ATOM   354  O  O   . ALA A 1 44  ? 12.180  38.165  19.278  1.00 31.65 ? 44  ALA A O   1 
ATOM   355  C  CB  . ALA A 1 44  ? 12.421  40.223  21.902  1.00 31.04 ? 44  ALA A CB  1 
ATOM   356  N  N   . SER A 1 45  ? 10.310  38.529  20.506  1.00 28.54 ? 45  SER A N   1 
ATOM   357  C  CA  . SER A 1 45  ? 9.342   38.375  19.430  1.00 29.44 ? 45  SER A CA  1 
ATOM   358  C  C   . SER A 1 45  ? 9.486   37.124  18.592  1.00 30.67 ? 45  SER A C   1 
ATOM   359  O  O   . SER A 1 45  ? 9.845   37.198  17.414  1.00 25.50 ? 45  SER A O   1 
ATOM   360  C  CB  . SER A 1 45  ? 9.409   39.587  18.499  1.00 33.43 ? 45  SER A CB  1 
ATOM   361  O  OG  . SER A 1 45  ? 9.425   40.783  19.249  1.00 41.86 ? 45  SER A OG  1 
ATOM   362  N  N   . THR A 1 46  ? 9.190   35.977  19.187  1.00 25.57 ? 46  THR A N   1 
ATOM   363  C  CA  . THR A 1 46  ? 9.302   34.734  18.458  1.00 25.68 ? 46  THR A CA  1 
ATOM   364  C  C   . THR A 1 46  ? 8.261   33.736  18.954  1.00 24.58 ? 46  THR A C   1 
ATOM   365  O  O   . THR A 1 46  ? 7.907   33.710  20.141  1.00 23.36 ? 46  THR A O   1 
ATOM   366  C  CB  . THR A 1 46  ? 10.756  34.152  18.591  1.00 25.83 ? 46  THR A CB  1 
ATOM   367  O  OG1 . THR A 1 46  ? 10.800  32.803  18.107  1.00 27.61 ? 46  THR A OG1 1 
ATOM   368  C  CG2 . THR A 1 46  ? 11.224  34.178  20.030  1.00 25.90 ? 46  THR A CG2 1 
ATOM   369  N  N   . VAL A 1 47  ? 7.722   32.967  18.018  1.00 24.58 ? 47  VAL A N   1 
ATOM   370  C  CA  A VAL A 1 47  ? 6.730   31.947  18.332  0.33 24.60 ? 47  VAL A CA  1 
ATOM   371  C  CA  B VAL A 1 47  ? 6.727   31.950  18.327  0.33 24.93 ? 47  VAL A CA  1 
ATOM   372  C  CA  C VAL A 1 47  ? 6.738   31.944  18.339  0.33 24.74 ? 47  VAL A CA  1 
ATOM   373  C  C   . VAL A 1 47  ? 7.108   30.692  17.548  1.00 25.18 ? 47  VAL A C   1 
ATOM   374  O  O   . VAL A 1 47  ? 7.618   30.781  16.429  1.00 22.36 ? 47  VAL A O   1 
ATOM   375  C  CB  A VAL A 1 47  ? 5.307   32.379  17.911  0.33 26.65 ? 47  VAL A CB  1 
ATOM   376  C  CB  B VAL A 1 47  ? 5.306   32.396  17.903  0.33 27.22 ? 47  VAL A CB  1 
ATOM   377  C  CB  C VAL A 1 47  ? 5.306   32.390  17.964  0.33 26.85 ? 47  VAL A CB  1 
ATOM   378  C  CG1 A VAL A 1 47  ? 4.298   31.330  18.352  0.33 25.70 ? 47  VAL A CG1 1 
ATOM   379  C  CG1 B VAL A 1 47  ? 4.900   33.650  18.662  0.33 27.98 ? 47  VAL A CG1 1 
ATOM   380  C  CG1 C VAL A 1 47  ? 5.222   32.696  16.474  0.33 28.29 ? 47  VAL A CG1 1 
ATOM   381  C  CG2 A VAL A 1 47  ? 4.969   33.738  18.505  0.33 27.45 ? 47  VAL A CG2 1 
ATOM   382  C  CG2 B VAL A 1 47  ? 5.264   32.658  16.404  0.33 28.94 ? 47  VAL A CG2 1 
ATOM   383  C  CG2 C VAL A 1 47  ? 4.308   31.306  18.347  0.33 26.28 ? 47  VAL A CG2 1 
ATOM   384  N  N   . GLY A 1 48  ? 6.873   29.524  18.133  1.00 21.15 ? 48  GLY A N   1 
ATOM   385  C  CA  . GLY A 1 48  ? 7.215   28.297  17.428  1.00 22.27 ? 48  GLY A CA  1 
ATOM   386  C  C   . GLY A 1 48  ? 6.430   27.150  18.002  1.00 22.84 ? 48  GLY A C   1 
ATOM   387  O  O   . GLY A 1 48  ? 6.120   27.157  19.204  1.00 19.89 ? 48  GLY A O   1 
ATOM   388  N  N   . ARG A 1 49  ? 6.082   26.177  17.157  1.00 18.90 ? 49  ARG A N   1 
ATOM   389  C  CA  . ARG A 1 49  ? 5.314   25.026  17.632  1.00 19.39 ? 49  ARG A CA  1 
ATOM   390  C  C   . ARG A 1 49  ? 5.726   23.803  16.828  1.00 18.79 ? 49  ARG A C   1 
ATOM   391  O  O   . ARG A 1 49  ? 6.312   23.931  15.753  1.00 18.04 ? 49  ARG A O   1 
ATOM   392  C  CB  . ARG A 1 49  ? 3.791   25.236  17.424  1.00 19.66 ? 49  ARG A CB  1 
ATOM   393  C  CG  . ARG A 1 49  ? 3.276   26.678  17.677  1.00 16.81 ? 49  ARG A CG  1 
ATOM   394  C  CD  . ARG A 1 49  ? 1.771   26.780  17.832  1.00 18.88 ? 49  ARG A CD  1 
ATOM   395  N  NE  . ARG A 1 49  ? 1.020   26.142  16.740  1.00 18.33 ? 49  ARG A NE  1 
ATOM   396  C  CZ  . ARG A 1 49  ? -0.310  26.133  16.664  1.00 23.11 ? 49  ARG A CZ  1 
ATOM   397  N  NH1 . ARG A 1 49  ? -1.036  26.736  17.594  1.00 25.07 ? 49  ARG A NH1 1 
ATOM   398  N  NH2 . ARG A 1 49  ? -0.928  25.473  15.688  1.00 21.29 ? 49  ARG A NH2 1 
ATOM   399  N  N   . ILE A 1 50  ? 5.466   22.619  17.377  1.00 18.72 ? 50  ILE A N   1 
ATOM   400  C  CA  . ILE A 1 50  ? 5.701   21.386  16.625  1.00 17.88 ? 50  ILE A CA  1 
ATOM   401  C  C   . ILE A 1 50  ? 4.498   20.507  16.899  1.00 20.19 ? 50  ILE A C   1 
ATOM   402  O  O   . ILE A 1 50  ? 3.851   20.623  17.945  1.00 16.79 ? 50  ILE A O   1 
ATOM   403  C  CB  . ILE A 1 50  ? 6.970   20.584  17.049  1.00 20.10 ? 50  ILE A CB  1 
ATOM   404  C  CG1 . ILE A 1 50  ? 6.926   20.230  18.537  1.00 23.44 ? 50  ILE A CG1 1 
ATOM   405  C  CG2 . ILE A 1 50  ? 8.231   21.351  16.659  1.00 20.15 ? 50  ILE A CG2 1 
ATOM   406  C  CD1 . ILE A 1 50  ? 7.937   19.128  18.918  1.00 27.61 ? 50  ILE A CD1 1 
ATOM   407  N  N   . LEU A 1 51  ? 4.168   19.657  15.939  1.00 17.65 ? 51  LEU A N   1 
ATOM   408  C  CA  . LEU A 1 51  ? 3.057   18.733  16.115  1.00 16.72 ? 51  LEU A CA  1 
ATOM   409  C  C   . LEU A 1 51  ? 3.527   17.399  15.553  1.00 17.89 ? 51  LEU A C   1 
ATOM   410  O  O   . LEU A 1 51  ? 4.324   17.358  14.616  1.00 19.32 ? 51  LEU A O   1 
ATOM   411  C  CB  . LEU A 1 51  ? 1.839   19.185  15.317  1.00 23.56 ? 51  LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 51  ? 1.187   20.527  15.655  1.00 28.83 ? 51  LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 51  ? 0.425   21.023  14.439  1.00 33.63 ? 51  LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 51  ? 0.259   20.358  16.840  1.00 31.67 ? 51  LEU A CD2 1 
ATOM   415  N  N   . PHE A 1 52  ? 3.063   16.300  16.132  1.00 16.11 ? 52  PHE A N   1 
ATOM   416  C  CA  . PHE A 1 52  ? 3.436   15.013  15.544  1.00 16.46 ? 52  PHE A CA  1 
ATOM   417  C  C   . PHE A 1 52  ? 2.544   14.890  14.297  1.00 16.07 ? 52  PHE A C   1 
ATOM   418  O  O   . PHE A 1 52  ? 1.381   15.299  14.314  1.00 18.14 ? 52  PHE A O   1 
ATOM   419  C  CB  . PHE A 1 52  ? 3.146   13.872  16.508  1.00 13.97 ? 52  PHE A CB  1 
ATOM   420  C  CG  . PHE A 1 52  ? 3.701   12.564  16.048  1.00 18.11 ? 52  PHE A CG  1 
ATOM   421  C  CD1 . PHE A 1 52  ? 5.073   12.387  15.948  1.00 16.59 ? 52  PHE A CD1 1 
ATOM   422  C  CD2 . PHE A 1 52  ? 2.855   11.513  15.724  1.00 19.80 ? 52  PHE A CD2 1 
ATOM   423  C  CE1 . PHE A 1 52  ? 5.615   11.173  15.531  1.00 21.92 ? 52  PHE A CE1 1 
ATOM   424  C  CE2 . PHE A 1 52  ? 3.380   10.275  15.301  1.00 19.27 ? 52  PHE A CE2 1 
ATOM   425  C  CZ  . PHE A 1 52  ? 4.764   10.109  15.206  1.00 20.08 ? 52  PHE A CZ  1 
ATOM   426  N  N   . SER A 1 53  ? 3.067   14.301  13.218  1.00 17.39 ? 53  SER A N   1 
ATOM   427  C  CA  . SER A 1 53  ? 2.280   14.237  11.986  1.00 17.31 ? 53  SER A CA  1 
ATOM   428  C  C   . SER A 1 53  ? 1.091   13.283  11.983  1.00 17.27 ? 53  SER A C   1 
ATOM   429  O  O   . SER A 1 53  ? 0.062   13.610  11.401  1.00 21.19 ? 53  SER A O   1 
ATOM   430  C  CB  . SER A 1 53  ? 3.184   13.935  10.786  1.00 22.14 ? 53  SER A CB  1 
ATOM   431  O  OG  . SER A 1 53  ? 3.754   12.653  10.921  1.00 25.16 ? 53  SER A OG  1 
ATOM   432  N  N   . ALA A 1 54  ? 1.191   12.126  12.632  1.00 17.04 ? 54  ALA A N   1 
ATOM   433  C  CA  . ALA A 1 54  ? 0.025   11.223  12.631  1.00 20.95 ? 54  ALA A CA  1 
ATOM   434  C  C   . ALA A 1 54  ? -1.065  11.768  13.550  1.00 21.79 ? 54  ALA A C   1 
ATOM   435  O  O   . ALA A 1 54  ? -0.787  12.288  14.649  1.00 20.22 ? 54  ALA A O   1 
ATOM   436  C  CB  . ALA A 1 54  ? 0.420   9.813   13.084  1.00 21.14 ? 54  ALA A CB  1 
ATOM   437  N  N   . GLN A 1 55  ? -2.304  11.657  13.098  1.00 18.24 ? 55  GLN A N   1 
ATOM   438  C  CA  . GLN A 1 55  ? -3.444  12.114  13.872  1.00 16.70 ? 55  GLN A CA  1 
ATOM   439  C  C   . GLN A 1 55  ? -3.798  11.082  14.927  1.00 19.79 ? 55  GLN A C   1 
ATOM   440  O  O   . GLN A 1 55  ? -3.683  9.874   14.702  1.00 17.45 ? 55  GLN A O   1 
ATOM   441  C  CB  . GLN A 1 55  ? -4.640  12.366  12.951  1.00 16.90 ? 55  GLN A CB  1 
ATOM   442  C  CG  . GLN A 1 55  ? -4.346  13.416  11.867  1.00 22.20 ? 55  GLN A CG  1 
ATOM   443  C  CD  . GLN A 1 55  ? -5.577  13.770  11.031  1.00 24.71 ? 55  GLN A CD  1 
ATOM   444  O  OE1 . GLN A 1 55  ? -6.693  13.842  11.539  1.00 25.66 ? 55  GLN A OE1 1 
ATOM   445  N  NE2 . GLN A 1 55  ? -5.364  14.003  9.746   1.00 29.55 ? 55  GLN A NE2 1 
ATOM   446  N  N   . VAL A 1 56  ? -4.242  11.569  16.081  1.00 16.48 ? 56  VAL A N   1 
ATOM   447  C  CA  . VAL A 1 56  ? -4.596  10.721  17.210  1.00 19.41 ? 56  VAL A CA  1 
ATOM   448  C  C   . VAL A 1 56  ? -6.101  10.567  17.277  1.00 17.89 ? 56  VAL A C   1 
ATOM   449  O  O   . VAL A 1 56  ? -6.824  11.566  17.211  1.00 16.80 ? 56  VAL A O   1 
ATOM   450  C  CB  . VAL A 1 56  ? -4.113  11.372  18.542  1.00 19.17 ? 56  VAL A CB  1 
ATOM   451  C  CG1 . VAL A 1 56  ? -4.548  10.531  19.738  1.00 20.07 ? 56  VAL A CG1 1 
ATOM   452  C  CG2 . VAL A 1 56  ? -2.564  11.528  18.522  1.00 21.32 ? 56  VAL A CG2 1 
ATOM   453  N  N   . HIS A 1 57  ? -6.579  9.331   17.429  1.00 16.71 ? 57  HIS A N   1 
ATOM   454  C  CA  . HIS A 1 57  ? -8.029  9.113   17.524  1.00 16.93 ? 57  HIS A CA  1 
ATOM   455  C  C   . HIS A 1 57  ? -8.377  9.254   19.003  1.00 17.89 ? 57  HIS A C   1 
ATOM   456  O  O   . HIS A 1 57  ? -8.220  8.323   19.784  1.00 18.48 ? 57  HIS A O   1 
ATOM   457  C  CB  . HIS A 1 57  ? -8.393  7.718   17.002  1.00 19.94 ? 57  HIS A CB  1 
ATOM   458  C  CG  . HIS A 1 57  ? -9.808  7.610   16.546  1.00 24.63 ? 57  HIS A CG  1 
ATOM   459  N  ND1 . HIS A 1 57  ? -10.345 6.436   16.055  1.00 27.83 ? 57  HIS A ND1 1 
ATOM   460  C  CD2 . HIS A 1 57  ? -10.810 8.522   16.526  1.00 28.03 ? 57  HIS A CD2 1 
ATOM   461  C  CE1 . HIS A 1 57  ? -11.619 6.632   15.757  1.00 27.40 ? 57  HIS A CE1 1 
ATOM   462  N  NE2 . HIS A 1 57  ? -11.927 7.887   16.034  1.00 29.96 ? 57  HIS A NE2 1 
ATOM   463  N  N   . LEU A 1 58  ? -8.828  10.451  19.372  1.00 20.44 ? 58  LEU A N   1 
ATOM   464  C  CA  . LEU A 1 58  ? -9.130  10.806  20.756  1.00 19.69 ? 58  LEU A CA  1 
ATOM   465  C  C   . LEU A 1 58  ? -10.439 10.214  21.280  1.00 17.54 ? 58  LEU A C   1 
ATOM   466  O  O   . LEU A 1 58  ? -10.546 9.848   22.450  1.00 20.39 ? 58  LEU A O   1 
ATOM   467  C  CB  . LEU A 1 58  ? -9.150  12.338  20.881  1.00 20.40 ? 58  LEU A CB  1 
ATOM   468  C  CG  . LEU A 1 58  ? -9.322  12.866  22.305  1.00 22.89 ? 58  LEU A CG  1 
ATOM   469  C  CD1 . LEU A 1 58  ? -8.152  12.432  23.156  1.00 24.91 ? 58  LEU A CD1 1 
ATOM   470  C  CD2 . LEU A 1 58  ? -9.409  14.379  22.264  1.00 28.73 ? 58  LEU A CD2 1 
ATOM   471  N  N   . TRP A 1 59  ? -11.445 10.143  20.423  1.00 19.95 ? 59  TRP A N   1 
ATOM   472  C  CA  . TRP A 1 59  ? -12.709 9.535   20.825  1.00 23.23 ? 59  TRP A CA  1 
ATOM   473  C  C   . TRP A 1 59  ? -13.435 9.068   19.572  1.00 25.30 ? 59  TRP A C   1 
ATOM   474  O  O   . TRP A 1 59  ? -13.162 9.539   18.472  1.00 24.47 ? 59  TRP A O   1 
ATOM   475  C  CB  . TRP A 1 59  ? -13.583 10.478  21.686  1.00 23.69 ? 59  TRP A CB  1 
ATOM   476  C  CG  . TRP A 1 59  ? -14.015 11.766  21.067  1.00 24.15 ? 59  TRP A CG  1 
ATOM   477  C  CD1 . TRP A 1 59  ? -13.282 12.908  20.947  1.00 28.20 ? 59  TRP A CD1 1 
ATOM   478  C  CD2 . TRP A 1 59  ? -15.313 12.066  20.536  1.00 30.31 ? 59  TRP A CD2 1 
ATOM   479  N  NE1 . TRP A 1 59  ? -14.045 13.910  20.377  1.00 22.91 ? 59  TRP A NE1 1 
ATOM   480  C  CE2 . TRP A 1 59  ? -15.293 13.416  20.114  1.00 27.62 ? 59  TRP A CE2 1 
ATOM   481  C  CE3 . TRP A 1 59  ? -16.492 11.324  20.374  1.00 33.85 ? 59  TRP A CE3 1 
ATOM   482  C  CZ2 . TRP A 1 59  ? -16.408 14.038  19.542  1.00 30.90 ? 59  TRP A CZ2 1 
ATOM   483  C  CZ3 . TRP A 1 59  ? -17.604 11.947  19.804  1.00 32.33 ? 59  TRP A CZ3 1 
ATOM   484  C  CH2 . TRP A 1 59  ? -17.551 13.288  19.397  1.00 32.50 ? 59  TRP A CH2 1 
ATOM   485  N  N   . GLU A 1 60  ? -14.333 8.106   19.744  1.00 30.04 ? 60  GLU A N   1 
ATOM   486  C  CA  . GLU A 1 60  ? -15.037 7.531   18.608  1.00 34.70 ? 60  GLU A CA  1 
ATOM   487  C  C   . GLU A 1 60  ? -16.516 7.433   18.921  1.00 37.35 ? 60  GLU A C   1 
ATOM   488  O  O   . GLU A 1 60  ? -16.937 6.615   19.741  1.00 35.97 ? 60  GLU A O   1 
ATOM   489  C  CB  . GLU A 1 60  ? -14.446 6.146   18.319  1.00 34.39 ? 60  GLU A CB  1 
ATOM   490  C  CG  . GLU A 1 60  ? -15.008 5.423   17.115  1.00 38.46 ? 60  GLU A CG  1 
ATOM   491  C  CD  . GLU A 1 60  ? -14.291 4.106   16.862  1.00 41.48 ? 60  GLU A CD  1 
ATOM   492  O  OE1 . GLU A 1 60  ? -14.346 3.223   17.742  1.00 43.02 ? 60  GLU A OE1 1 
ATOM   493  O  OE2 . GLU A 1 60  ? -13.667 3.956   15.787  1.00 45.34 ? 60  GLU A OE2 1 
ATOM   494  N  N   . LYS A 1 61  ? -17.291 8.285   18.265  1.00 39.69 ? 61  LYS A N   1 
ATOM   495  C  CA  . LYS A 1 61  ? -18.734 8.335   18.460  1.00 46.39 ? 61  LYS A CA  1 
ATOM   496  C  C   . LYS A 1 61  ? -19.439 6.986   18.269  1.00 47.34 ? 61  LYS A C   1 
ATOM   497  O  O   . LYS A 1 61  ? -20.179 6.534   19.145  1.00 50.33 ? 61  LYS A O   1 
ATOM   498  C  CB  . LYS A 1 61  ? -19.347 9.372   17.513  1.00 48.27 ? 61  LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 61  ? -20.833 9.598   17.743  1.00 52.75 ? 61  LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 61  ? -21.320 10.869  17.065  1.00 56.17 ? 61  LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 61  ? -22.743 11.217  17.518  1.00 58.85 ? 61  LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 61  ? -23.245 12.494  16.928  1.00 60.89 ? 61  LYS A NZ  1 
ATOM   503  N  N   . SER A 1 62  ? -19.192 6.333   17.143  1.00 47.63 ? 62  SER A N   1 
ATOM   504  C  CA  . SER A 1 62  ? -19.845 5.058   16.867  1.00 48.68 ? 62  SER A CA  1 
ATOM   505  C  C   . SER A 1 62  ? -19.720 3.998   17.969  1.00 50.44 ? 62  SER A C   1 
ATOM   506  O  O   . SER A 1 62  ? -20.680 3.275   18.241  1.00 50.55 ? 62  SER A O   1 
ATOM   507  C  CB  . SER A 1 62  ? -19.320 4.478   15.559  1.00 47.68 ? 62  SER A CB  1 
ATOM   508  O  OG  . SER A 1 62  ? -18.005 3.987   15.724  1.00 48.83 ? 62  SER A OG  1 
ATOM   509  N  N   . SER A 1 63  ? -18.553 3.908   18.601  1.00 47.72 ? 63  SER A N   1 
ATOM   510  C  CA  . SER A 1 63  ? -18.339 2.906   19.632  1.00 46.07 ? 63  SER A CA  1 
ATOM   511  C  C   . SER A 1 63  ? -18.456 3.429   21.044  1.00 46.58 ? 63  SER A C   1 
ATOM   512  O  O   . SER A 1 63  ? -18.367 2.653   21.997  1.00 47.03 ? 63  SER A O   1 
ATOM   513  C  CB  . SER A 1 63  ? -16.963 2.242   19.475  1.00 50.21 ? 63  SER A CB  1 
ATOM   514  O  OG  . SER A 1 63  ? -15.903 3.154   19.745  1.00 45.98 ? 63  SER A OG  1 
ATOM   515  N  N   . SER A 1 64  ? -18.657 4.736   21.180  1.00 44.36 ? 64  SER A N   1 
ATOM   516  C  CA  . SER A 1 64  ? -18.765 5.364   22.488  1.00 42.68 ? 64  SER A CA  1 
ATOM   517  C  C   . SER A 1 64  ? -17.452 5.239   23.300  1.00 40.33 ? 64  SER A C   1 
ATOM   518  O  O   . SER A 1 64  ? -17.459 5.202   24.521  1.00 40.94 ? 64  SER A O   1 
ATOM   519  C  CB  . SER A 1 64  ? -19.917 4.724   23.263  1.00 46.25 ? 64  SER A CB  1 
ATOM   520  O  OG  . SER A 1 64  ? -20.148 5.395   24.491  1.00 50.24 ? 64  SER A OG  1 
ATOM   521  N  N   . ARG A 1 65  ? -16.323 5.163   22.616  1.00 35.18 ? 65  ARG A N   1 
ATOM   522  C  CA  . ARG A 1 65  ? -15.066 5.035   23.317  1.00 28.00 ? 65  ARG A CA  1 
ATOM   523  C  C   . ARG A 1 65  ? -14.344 6.368   23.397  1.00 25.78 ? 65  ARG A C   1 
ATOM   524  O  O   . ARG A 1 65  ? -14.565 7.247   22.588  1.00 20.49 ? 65  ARG A O   1 
ATOM   525  C  CB  . ARG A 1 65  ? -14.166 4.026   22.609  1.00 30.15 ? 65  ARG A CB  1 
ATOM   526  C  CG  . ARG A 1 65  ? -14.693 2.633   22.638  1.00 26.52 ? 65  ARG A CG  1 
ATOM   527  C  CD  . ARG A 1 65  ? -13.666 1.708   22.023  1.00 30.67 ? 65  ARG A CD  1 
ATOM   528  N  NE  . ARG A 1 65  ? -13.534 1.842   20.581  1.00 26.64 ? 65  ARG A NE  1 
ATOM   529  C  CZ  . ARG A 1 65  ? -12.599 1.198   19.890  1.00 32.29 ? 65  ARG A CZ  1 
ATOM   530  N  NH1 . ARG A 1 65  ? -11.752 0.395   20.527  1.00 27.73 ? 65  ARG A NH1 1 
ATOM   531  N  NH2 . ARG A 1 65  ? -12.484 1.374   18.589  1.00 29.72 ? 65  ARG A NH2 1 
ATOM   532  N  N   . VAL A 1 66  ? -13.474 6.501   24.387  1.00 20.40 ? 66  VAL A N   1 
ATOM   533  C  CA  . VAL A 1 66  ? -12.684 7.708   24.550  1.00 21.09 ? 66  VAL A CA  1 
ATOM   534  C  C   . VAL A 1 66  ? -11.292 7.234   24.919  1.00 17.98 ? 66  VAL A C   1 
ATOM   535  O  O   . VAL A 1 66  ? -11.123 6.274   25.688  1.00 21.56 ? 66  VAL A O   1 
ATOM   536  C  CB  . VAL A 1 66  ? -13.256 8.622   25.654  1.00 23.32 ? 66  VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 66  ? -12.405 9.862   25.796  1.00 19.63 ? 66  VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 66  ? -14.692 9.002   25.304  1.00 25.15 ? 66  VAL A CG2 1 
ATOM   539  N  N   . ALA A 1 67  ? -10.281 7.897   24.375  1.00 18.91 ? 67  ALA A N   1 
ATOM   540  C  CA  . ALA A 1 67  ? -8.917  7.463   24.655  1.00 18.28 ? 67  ALA A CA  1 
ATOM   541  C  C   . ALA A 1 67  ? -8.359  7.810   26.019  1.00 21.65 ? 67  ALA A C   1 
ATOM   542  O  O   . ALA A 1 67  ? -8.672  8.852   26.602  1.00 20.48 ? 67  ALA A O   1 
ATOM   543  C  CB  . ALA A 1 67  ? -7.949  8.018   23.574  1.00 18.68 ? 67  ALA A CB  1 
ATOM   544  N  N   . ASN A 1 68  ? -7.543  6.893   26.526  1.00 18.26 ? 68  ASN A N   1 
ATOM   545  C  CA  . ASN A 1 68  ? -6.782  7.104   27.753  1.00 18.22 ? 68  ASN A CA  1 
ATOM   546  C  C   . ASN A 1 68  ? -5.434  7.495   27.136  1.00 24.11 ? 68  ASN A C   1 
ATOM   547  O  O   . ASN A 1 68  ? -4.930  6.765   26.254  1.00 24.58 ? 68  ASN A O   1 
ATOM   548  C  CB  . ASN A 1 68  ? -6.637  5.789   28.528  1.00 24.38 ? 68  ASN A CB  1 
ATOM   549  C  CG  . ASN A 1 68  ? -5.615  5.880   29.651  1.00 39.26 ? 68  ASN A CG  1 
ATOM   550  O  OD1 . ASN A 1 68  ? -4.412  5.972   29.399  1.00 40.57 ? 68  ASN A OD1 1 
ATOM   551  N  ND2 . ASN A 1 68  ? -6.091  5.861   30.899  1.00 42.43 ? 68  ASN A ND2 1 
ATOM   552  N  N   . PHE A 1 69  ? -4.846  8.625   27.533  1.00 14.45 ? 69  PHE A N   1 
ATOM   553  C  CA  . PHE A 1 69  ? -3.554  8.967   26.935  1.00 16.62 ? 69  PHE A CA  1 
ATOM   554  C  C   . PHE A 1 69  ? -2.585  9.459   27.991  1.00 18.24 ? 69  PHE A C   1 
ATOM   555  O  O   . PHE A 1 69  ? -2.996  9.852   29.086  1.00 16.97 ? 69  PHE A O   1 
ATOM   556  C  CB  . PHE A 1 69  ? -3.707  9.982   25.775  1.00 19.67 ? 69  PHE A CB  1 
ATOM   557  C  CG  . PHE A 1 69  ? -4.166  11.372  26.194  1.00 24.22 ? 69  PHE A CG  1 
ATOM   558  C  CD1 . PHE A 1 69  ? -3.266  12.292  26.719  1.00 26.84 ? 69  PHE A CD1 1 
ATOM   559  C  CD2 . PHE A 1 69  ? -5.489  11.765  26.018  1.00 26.76 ? 69  PHE A CD2 1 
ATOM   560  C  CE1 . PHE A 1 69  ? -3.682  13.586  27.058  1.00 26.33 ? 69  PHE A CE1 1 
ATOM   561  C  CE2 . PHE A 1 69  ? -5.909  13.061  26.357  1.00 25.26 ? 69  PHE A CE2 1 
ATOM   562  C  CZ  . PHE A 1 69  ? -5.002  13.962  26.873  1.00 20.89 ? 69  PHE A CZ  1 
ATOM   563  N  N   . GLN A 1 70  ? -1.293  9.380   27.666  1.00 14.16 ? 70  GLN A N   1 
ATOM   564  C  CA  . GLN A 1 70  ? -0.242  9.789   28.572  1.00 16.09 ? 70  GLN A CA  1 
ATOM   565  C  C   . GLN A 1 70  ? 0.825   10.459  27.727  1.00 17.78 ? 70  GLN A C   1 
ATOM   566  O  O   . GLN A 1 70  ? 1.191   9.959   26.669  1.00 17.71 ? 70  GLN A O   1 
ATOM   567  C  CB  . GLN A 1 70  ? 0.345   8.548   29.269  1.00 19.69 ? 70  GLN A CB  1 
ATOM   568  C  CG  . GLN A 1 70  ? 1.629   8.840   30.042  1.00 23.94 ? 70  GLN A CG  1 
ATOM   569  C  CD  . GLN A 1 70  ? 2.194   7.602   30.745  1.00 30.08 ? 70  GLN A CD  1 
ATOM   570  O  OE1 . GLN A 1 70  ? 1.655   7.152   31.751  1.00 32.32 ? 70  GLN A OE1 1 
ATOM   571  N  NE2 . GLN A 1 70  ? 3.274   7.049   30.200  1.00 32.27 ? 70  GLN A NE2 1 
ATOM   572  N  N   . SER A 1 71  ? 1.302   11.608  28.177  1.00 15.02 ? 71  SER A N   1 
ATOM   573  C  CA  . SER A 1 71  ? 2.349   12.326  27.468  1.00 17.00 ? 71  SER A CA  1 
ATOM   574  C  C   . SER A 1 71  ? 3.419   12.636  28.519  1.00 18.49 ? 71  SER A C   1 
ATOM   575  O  O   . SER A 1 71  ? 3.133   13.219  29.547  1.00 19.26 ? 71  SER A O   1 
ATOM   576  C  CB  . SER A 1 71  ? 1.799   13.636  26.880  1.00 19.66 ? 71  SER A CB  1 
ATOM   577  O  OG  . SER A 1 71  ? 2.798   14.339  26.153  1.00 22.56 ? 71  SER A OG  1 
ATOM   578  N  N   . GLN A 1 72  ? 4.644   12.215  28.257  1.00 15.97 ? 72  GLN A N   1 
ATOM   579  C  CA  . GLN A 1 72  ? 5.743   12.466  29.178  1.00 15.84 ? 72  GLN A CA  1 
ATOM   580  C  C   . GLN A 1 72  ? 6.760   13.285  28.420  1.00 16.50 ? 72  GLN A C   1 
ATOM   581  O  O   . GLN A 1 72  ? 7.100   12.956  27.296  1.00 15.89 ? 72  GLN A O   1 
ATOM   582  C  CB  . GLN A 1 72  ? 6.333   11.129  29.612  1.00 23.01 ? 72  GLN A CB  1 
ATOM   583  C  CG  . GLN A 1 72  ? 7.425   11.230  30.621  1.00 33.29 ? 72  GLN A CG  1 
ATOM   584  C  CD  . GLN A 1 72  ? 7.736   9.878   31.236  1.00 42.89 ? 72  GLN A CD  1 
ATOM   585  O  OE1 . GLN A 1 72  ? 7.141   8.861   30.862  1.00 47.18 ? 72  GLN A OE1 1 
ATOM   586  N  NE2 . GLN A 1 72  ? 8.671   9.857   32.184  1.00 47.22 ? 72  GLN A NE2 1 
ATOM   587  N  N   . PHE A 1 73  ? 7.264   14.355  29.022  1.00 12.96 ? 73  PHE A N   1 
ATOM   588  C  CA  . PHE A 1 73  ? 8.240   15.153  28.330  1.00 12.04 ? 73  PHE A CA  1 
ATOM   589  C  C   . PHE A 1 73  ? 9.072   15.929  29.331  1.00 13.74 ? 73  PHE A C   1 
ATOM   590  O  O   . PHE A 1 73  ? 8.711   16.059  30.493  1.00 16.31 ? 73  PHE A O   1 
ATOM   591  C  CB  . PHE A 1 73  ? 7.567   16.133  27.368  1.00 12.83 ? 73  PHE A CB  1 
ATOM   592  C  CG  . PHE A 1 73  ? 6.493   16.996  28.001  1.00 14.75 ? 73  PHE A CG  1 
ATOM   593  C  CD1 . PHE A 1 73  ? 6.798   18.245  28.521  1.00 17.23 ? 73  PHE A CD1 1 
ATOM   594  C  CD2 . PHE A 1 73  ? 5.173   16.568  28.034  1.00 15.78 ? 73  PHE A CD2 1 
ATOM   595  C  CE1 . PHE A 1 73  ? 5.787   19.077  29.074  1.00 17.82 ? 73  PHE A CE1 1 
ATOM   596  C  CE2 . PHE A 1 73  ? 4.147   17.394  28.581  1.00 18.42 ? 73  PHE A CE2 1 
ATOM   597  C  CZ  . PHE A 1 73  ? 4.472   18.645  29.096  1.00 16.44 ? 73  PHE A CZ  1 
ATOM   598  N  N   . SER A 1 74  ? 10.192  16.438  28.856  1.00 14.20 ? 74  SER A N   1 
ATOM   599  C  CA  A SER A 1 74  ? 11.074  17.236  29.701  0.33 14.48 ? 74  SER A CA  1 
ATOM   600  C  CA  B SER A 1 74  ? 11.101  17.225  29.691  0.33 15.34 ? 74  SER A CA  1 
ATOM   601  C  CA  C SER A 1 74  ? 11.107  17.219  29.688  0.33 15.78 ? 74  SER A CA  1 
ATOM   602  C  C   . SER A 1 74  ? 11.502  18.474  28.922  1.00 15.88 ? 74  SER A C   1 
ATOM   603  O  O   . SER A 1 74  ? 11.669  18.434  27.698  1.00 17.12 ? 74  SER A O   1 
ATOM   604  C  CB  A SER A 1 74  ? 12.300  16.419  30.132  0.33 16.75 ? 74  SER A CB  1 
ATOM   605  C  CB  B SER A 1 74  ? 12.354  16.409  30.034  0.33 18.01 ? 74  SER A CB  1 
ATOM   606  C  CB  C SER A 1 74  ? 12.362  16.392  30.006  0.33 18.70 ? 74  SER A CB  1 
ATOM   607  O  OG  A SER A 1 74  ? 13.127  16.094  29.031  0.33 10.20 ? 74  SER A OG  1 
ATOM   608  O  OG  B SER A 1 74  ? 12.040  15.309  30.865  0.33 19.02 ? 74  SER A OG  1 
ATOM   609  O  OG  C SER A 1 74  ? 13.371  17.191  30.612  0.33 22.06 ? 74  SER A OG  1 
ATOM   610  N  N   . PHE A 1 75  ? 11.653  19.596  29.622  1.00 13.63 ? 75  PHE A N   1 
ATOM   611  C  CA  . PHE A 1 75  ? 12.057  20.808  28.908  1.00 14.94 ? 75  PHE A CA  1 
ATOM   612  C  C   . PHE A 1 75  ? 12.858  21.670  29.871  1.00 16.58 ? 75  PHE A C   1 
ATOM   613  O  O   . PHE A 1 75  ? 12.835  21.443  31.085  1.00 16.33 ? 75  PHE A O   1 
ATOM   614  C  CB  . PHE A 1 75  ? 10.848  21.610  28.400  1.00 15.19 ? 75  PHE A CB  1 
ATOM   615  C  CG  . PHE A 1 75  ? 9.993   22.218  29.499  1.00 16.42 ? 75  PHE A CG  1 
ATOM   616  C  CD1 . PHE A 1 75  ? 8.876   21.538  29.989  1.00 18.70 ? 75  PHE A CD1 1 
ATOM   617  C  CD2 . PHE A 1 75  ? 10.314  23.473  30.049  1.00 17.41 ? 75  PHE A CD2 1 
ATOM   618  C  CE1 . PHE A 1 75  ? 8.076   22.089  31.012  1.00 18.38 ? 75  PHE A CE1 1 
ATOM   619  C  CE2 . PHE A 1 75  ? 9.528   24.036  31.072  1.00 20.31 ? 75  PHE A CE2 1 
ATOM   620  C  CZ  . PHE A 1 75  ? 8.396   23.338  31.559  1.00 17.13 ? 75  PHE A CZ  1 
ATOM   621  N  N   . SER A 1 76  ? 13.590  22.628  29.326  1.00 16.32 ? 76  SER A N   1 
ATOM   622  C  CA  . SER A 1 76  ? 14.339  23.549  30.185  1.00 17.07 ? 76  SER A CA  1 
ATOM   623  C  C   . SER A 1 76  ? 14.201  24.941  29.580  1.00 18.33 ? 76  SER A C   1 
ATOM   624  O  O   . SER A 1 76  ? 13.998  25.102  28.369  1.00 20.16 ? 76  SER A O   1 
ATOM   625  C  CB  . SER A 1 76  ? 15.812  23.127  30.293  1.00 21.66 ? 76  SER A CB  1 
ATOM   626  O  OG  . SER A 1 76  ? 16.402  23.112  29.013  1.00 25.62 ? 76  SER A OG  1 
ATOM   627  N  N   . LEU A 1 77  ? 14.290  25.951  30.439  1.00 17.49 ? 77  LEU A N   1 
ATOM   628  C  CA  . LEU A 1 77  ? 14.169  27.341  30.036  1.00 19.67 ? 77  LEU A CA  1 
ATOM   629  C  C   . LEU A 1 77  ? 15.439  28.058  30.493  1.00 21.64 ? 77  LEU A C   1 
ATOM   630  O  O   . LEU A 1 77  ? 15.876  27.866  31.630  1.00 22.74 ? 77  LEU A O   1 
ATOM   631  C  CB  . LEU A 1 77  ? 12.969  27.969  30.751  1.00 20.13 ? 77  LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 77  ? 11.617  27.269  30.618  1.00 23.42 ? 77  LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 77  ? 10.583  28.018  31.473  1.00 24.86 ? 77  LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 77  ? 11.193  27.238  29.152  1.00 18.50 ? 77  LEU A CD2 1 
ATOM   635  N  N   . LYS A 1 78  ? 16.026  28.873  29.622  1.00 20.01 ? 78  LYS A N   1 
ATOM   636  C  CA  . LYS A 1 78  ? 17.238  29.616  29.986  1.00 25.70 ? 78  LYS A CA  1 
ATOM   637  C  C   . LYS A 1 78  ? 17.116  31.064  29.545  1.00 25.09 ? 78  LYS A C   1 
ATOM   638  O  O   . LYS A 1 78  ? 16.583  31.370  28.483  1.00 24.19 ? 78  LYS A O   1 
ATOM   639  C  CB  . LYS A 1 78  ? 18.478  29.025  29.316  1.00 28.57 ? 78  LYS A CB  1 
ATOM   640  C  CG  . LYS A 1 78  ? 18.905  27.673  29.828  1.00 36.72 ? 78  LYS A CG  1 
ATOM   641  N  N   . SER A 1 79  ? 17.632  31.974  30.356  1.00 28.15 ? 79  SER A N   1 
ATOM   642  C  CA  . SER A 1 79  ? 17.551  33.375  29.976  1.00 32.85 ? 79  SER A CA  1 
ATOM   643  C  C   . SER A 1 79  ? 18.532  34.231  30.748  1.00 33.12 ? 79  SER A C   1 
ATOM   644  O  O   . SER A 1 79  ? 18.817  33.959  31.909  1.00 31.22 ? 79  SER A O   1 
ATOM   645  C  CB  . SER A 1 79  ? 16.142  33.916  30.223  1.00 33.26 ? 79  SER A CB  1 
ATOM   646  O  OG  . SER A 1 79  ? 16.081  35.302  29.928  1.00 36.29 ? 79  SER A OG  1 
ATOM   647  N  N   . PRO A 1 80  ? 19.079  35.263  30.095  1.00 38.74 ? 80  PRO A N   1 
ATOM   648  C  CA  . PRO A 1 80  ? 20.033  36.183  30.726  1.00 42.06 ? 80  PRO A CA  1 
ATOM   649  C  C   . PRO A 1 80  ? 19.257  37.032  31.728  1.00 44.56 ? 80  PRO A C   1 
ATOM   650  O  O   . PRO A 1 80  ? 19.800  37.494  32.727  1.00 45.36 ? 80  PRO A O   1 
ATOM   651  C  CB  . PRO A 1 80  ? 20.526  37.022  29.554  1.00 42.89 ? 80  PRO A CB  1 
ATOM   652  C  CG  . PRO A 1 80  ? 20.424  36.080  28.399  1.00 45.51 ? 80  PRO A CG  1 
ATOM   653  C  CD  . PRO A 1 80  ? 19.081  35.432  28.633  1.00 40.01 ? 80  PRO A CD  1 
ATOM   654  N  N   . LEU A 1 81  ? 17.976  37.231  31.434  1.00 46.91 ? 81  LEU A N   1 
ATOM   655  C  CA  . LEU A 1 81  ? 17.078  38.017  32.277  1.00 50.16 ? 81  LEU A CA  1 
ATOM   656  C  C   . LEU A 1 81  ? 16.624  37.179  33.466  1.00 52.56 ? 81  LEU A C   1 
ATOM   657  O  O   . LEU A 1 81  ? 16.596  35.951  33.404  1.00 52.89 ? 81  LEU A O   1 
ATOM   658  C  CB  . LEU A 1 81  ? 15.836  38.436  31.485  1.00 50.68 ? 81  LEU A CB  1 
ATOM   659  C  CG  . LEU A 1 81  ? 16.033  39.037  30.093  1.00 51.69 ? 81  LEU A CG  1 
ATOM   660  C  CD1 . LEU A 1 81  ? 14.682  39.137  29.377  1.00 49.84 ? 81  LEU A CD1 1 
ATOM   661  C  CD2 . LEU A 1 81  ? 16.701  40.398  30.219  1.00 50.54 ? 81  LEU A CD2 1 
ATOM   662  N  N   . SER A 1 82  ? 16.240  37.848  34.544  1.00 53.29 ? 82  SER A N   1 
ATOM   663  C  CA  . SER A 1 82  ? 15.779  37.151  35.730  1.00 54.42 ? 82  SER A CA  1 
ATOM   664  C  C   . SER A 1 82  ? 14.287  36.855  35.588  1.00 54.41 ? 82  SER A C   1 
ATOM   665  O  O   . SER A 1 82  ? 13.727  36.085  36.367  1.00 56.14 ? 82  SER A O   1 
ATOM   666  C  CB  . SER A 1 82  ? 16.001  38.018  36.956  1.00 55.87 ? 82  SER A CB  1 
ATOM   667  O  OG  . SER A 1 82  ? 15.105  39.099  36.890  1.00 57.17 ? 82  SER A OG  1 
ATOM   668  N  N   . ASN A 1 83  ? 13.642  37.492  34.614  1.00 51.15 ? 83  ASN A N   1 
ATOM   669  C  CA  . ASN A 1 83  ? 12.222  37.265  34.364  1.00 48.38 ? 83  ASN A CA  1 
ATOM   670  C  C   . ASN A 1 83  ? 11.969  36.866  32.905  1.00 44.66 ? 83  ASN A C   1 
ATOM   671  O  O   . ASN A 1 83  ? 11.410  37.644  32.121  1.00 41.72 ? 83  ASN A O   1 
ATOM   672  C  CB  . ASN A 1 83  ? 11.384  38.506  34.740  1.00 52.19 ? 83  ASN A CB  1 
ATOM   673  C  CG  . ASN A 1 83  ? 11.983  39.813  34.233  1.00 54.23 ? 83  ASN A CG  1 
ATOM   674  O  OD1 . ASN A 1 83  ? 12.260  39.969  33.042  1.00 54.80 ? 83  ASN A OD1 1 
ATOM   675  N  ND2 . ASN A 1 83  ? 12.172  40.766  35.142  1.00 52.53 ? 83  ASN A ND2 1 
ATOM   676  N  N   . GLY A 1 84  ? 12.387  35.650  32.551  1.00 35.54 ? 84  GLY A N   1 
ATOM   677  C  CA  . GLY A 1 84  ? 12.193  35.166  31.193  1.00 32.03 ? 84  GLY A CA  1 
ATOM   678  C  C   . GLY A 1 84  ? 10.721  34.988  30.855  1.00 26.04 ? 84  GLY A C   1 
ATOM   679  O  O   . GLY A 1 84  ? 9.888   34.823  31.752  1.00 21.75 ? 84  GLY A O   1 
ATOM   680  N  N   . ALA A 1 85  ? 10.392  35.038  29.566  1.00 20.84 ? 85  ALA A N   1 
ATOM   681  C  CA  . ALA A 1 85  ? 9.003   34.885  29.119  1.00 23.70 ? 85  ALA A CA  1 
ATOM   682  C  C   . ALA A 1 85  ? 9.003   34.188  27.763  1.00 22.19 ? 85  ALA A C   1 
ATOM   683  O  O   . ALA A 1 85  ? 10.045  34.123  27.107  1.00 21.97 ? 85  ALA A O   1 
ATOM   684  C  CB  . ALA A 1 85  ? 8.334   36.244  29.006  1.00 19.08 ? 85  ALA A CB  1 
ATOM   685  N  N   . ASP A 1 86  ? 7.856   33.671  27.326  1.00 18.61 ? 86  ASP A N   1 
ATOM   686  C  CA  . ASP A 1 86  ? 6.588   33.716  28.033  1.00 14.26 ? 86  ASP A CA  1 
ATOM   687  C  C   . ASP A 1 86  ? 6.118   32.379  28.586  1.00 18.36 ? 86  ASP A C   1 
ATOM   688  O  O   . ASP A 1 86  ? 5.278   32.346  29.477  1.00 16.86 ? 86  ASP A O   1 
ATOM   689  C  CB  . ASP A 1 86  ? 5.515   34.230  27.093  1.00 17.54 ? 86  ASP A CB  1 
ATOM   690  C  CG  . ASP A 1 86  ? 5.425   35.733  27.115  1.00 22.27 ? 86  ASP A CG  1 
ATOM   691  O  OD1 . ASP A 1 86  ? 4.734   36.248  28.017  1.00 21.63 ? 86  ASP A OD1 1 
ATOM   692  O  OD2 . ASP A 1 86  ? 6.064   36.376  26.249  1.00 23.77 ? 86  ASP A OD2 1 
ATOM   693  N  N   . GLY A 1 87  ? 6.640   31.283  28.038  1.00 16.49 ? 87  GLY A N   1 
ATOM   694  C  CA  . GLY A 1 87  ? 6.218   29.981  28.530  1.00 17.13 ? 87  GLY A CA  1 
ATOM   695  C  C   . GLY A 1 87  ? 6.080   28.967  27.424  1.00 17.99 ? 87  GLY A C   1 
ATOM   696  O  O   . GLY A 1 87  ? 6.111   29.315  26.238  1.00 16.44 ? 87  GLY A O   1 
ATOM   697  N  N   . ILE A 1 88  ? 5.906   27.711  27.826  1.00 17.02 ? 88  ILE A N   1 
ATOM   698  C  CA  . ILE A 1 88  ? 5.769   26.605  26.889  1.00 14.62 ? 88  ILE A CA  1 
ATOM   699  C  C   . ILE A 1 88  ? 4.497   25.840  27.228  1.00 15.04 ? 88  ILE A C   1 
ATOM   700  O  O   . ILE A 1 88  ? 4.069   25.803  28.391  1.00 16.95 ? 88  ILE A O   1 
ATOM   701  C  CB  . ILE A 1 88  ? 7.025   25.664  26.987  1.00 15.16 ? 88  ILE A CB  1 
ATOM   702  C  CG1 . ILE A 1 88  ? 6.873   24.477  26.042  1.00 18.32 ? 88  ILE A CG1 1 
ATOM   703  C  CG2 . ILE A 1 88  ? 7.223   25.137  28.438  1.00 18.22 ? 88  ILE A CG2 1 
ATOM   704  C  CD1 . ILE A 1 88  ? 8.106   23.575  26.035  1.00 24.13 ? 88  ILE A CD1 1 
ATOM   705  N  N   . ALA A 1 89  ? 3.870   25.230  26.228  1.00 14.77 ? 89  ALA A N   1 
ATOM   706  C  CA  . ALA A 1 89  ? 2.651   24.485  26.511  1.00 12.37 ? 89  ALA A CA  1 
ATOM   707  C  C   . ALA A 1 89  ? 2.558   23.228  25.682  1.00 15.14 ? 89  ALA A C   1 
ATOM   708  O  O   . ALA A 1 89  ? 2.984   23.208  24.526  1.00 16.11 ? 89  ALA A O   1 
ATOM   709  C  CB  . ALA A 1 89  ? 1.394   25.372  26.224  1.00 16.39 ? 89  ALA A CB  1 
ATOM   710  N  N   . PHE A 1 90  ? 2.019   22.184  26.297  1.00 13.99 ? 90  PHE A N   1 
ATOM   711  C  CA  . PHE A 1 90  ? 1.740   20.946  25.579  1.00 13.94 ? 90  PHE A CA  1 
ATOM   712  C  C   . PHE A 1 90  ? 0.273   21.181  25.155  1.00 15.99 ? 90  PHE A C   1 
ATOM   713  O  O   . PHE A 1 90  ? -0.538  21.652  25.964  1.00 17.17 ? 90  PHE A O   1 
ATOM   714  C  CB  . PHE A 1 90  ? 1.787   19.757  26.530  1.00 15.56 ? 90  PHE A CB  1 
ATOM   715  C  CG  . PHE A 1 90  ? 1.160   18.513  25.956  1.00 16.63 ? 90  PHE A CG  1 
ATOM   716  C  CD1 . PHE A 1 90  ? 1.739   17.877  24.867  1.00 17.27 ? 90  PHE A CD1 1 
ATOM   717  C  CD2 . PHE A 1 90  ? -0.016  18.003  26.493  1.00 21.50 ? 90  PHE A CD2 1 
ATOM   718  C  CE1 . PHE A 1 90  ? 1.144   16.729  24.307  1.00 19.64 ? 90  PHE A CE1 1 
ATOM   719  C  CE2 . PHE A 1 90  ? -0.616  16.858  25.945  1.00 23.01 ? 90  PHE A CE2 1 
ATOM   720  C  CZ  . PHE A 1 90  ? -0.033  16.228  24.854  1.00 19.72 ? 90  PHE A CZ  1 
ATOM   721  N  N   . PHE A 1 91  ? -0.081  20.908  23.906  1.00 14.59 ? 91  PHE A N   1 
ATOM   722  C  CA  . PHE A 1 91  ? -1.469  21.136  23.522  1.00 14.38 ? 91  PHE A CA  1 
ATOM   723  C  C   . PHE A 1 91  ? -2.037  20.056  22.594  1.00 16.48 ? 91  PHE A C   1 
ATOM   724  O  O   . PHE A 1 91  ? -1.292  19.285  21.976  1.00 15.49 ? 91  PHE A O   1 
ATOM   725  C  CB  . PHE A 1 91  ? -1.655  22.540  22.895  1.00 14.91 ? 91  PHE A CB  1 
ATOM   726  C  CG  . PHE A 1 91  ? -1.096  22.694  21.501  1.00 16.60 ? 91  PHE A CG  1 
ATOM   727  C  CD1 . PHE A 1 91  ? 0.286   22.762  21.278  1.00 18.60 ? 91  PHE A CD1 1 
ATOM   728  C  CD2 . PHE A 1 91  ? -1.958  22.831  20.411  1.00 23.26 ? 91  PHE A CD2 1 
ATOM   729  C  CE1 . PHE A 1 91  ? 0.797   22.970  19.989  1.00 18.98 ? 91  PHE A CE1 1 
ATOM   730  C  CE2 . PHE A 1 91  ? -1.449  23.041  19.108  1.00 22.18 ? 91  PHE A CE2 1 
ATOM   731  C  CZ  . PHE A 1 91  ? -0.083  23.111  18.903  1.00 25.42 ? 91  PHE A CZ  1 
ATOM   732  N  N   . ILE A 1 92  ? -3.364  20.005  22.550  1.00 14.16 ? 92  ILE A N   1 
ATOM   733  C  CA  . ILE A 1 92  ? -4.104  19.045  21.731  1.00 13.93 ? 92  ILE A CA  1 
ATOM   734  C  C   . ILE A 1 92  ? -5.107  19.911  20.964  1.00 15.99 ? 92  ILE A C   1 
ATOM   735  O  O   . ILE A 1 92  ? -5.836  20.713  21.571  1.00 18.04 ? 92  ILE A O   1 
ATOM   736  C  CB  . ILE A 1 92  ? -4.873  18.062  22.603  1.00 16.97 ? 92  ILE A CB  1 
ATOM   737  C  CG1 . ILE A 1 92  ? -3.918  17.446  23.636  1.00 15.50 ? 92  ILE A CG1 1 
ATOM   738  C  CG2 . ILE A 1 92  ? -5.517  16.969  21.720  1.00 18.07 ? 92  ILE A CG2 1 
ATOM   739  C  CD1 . ILE A 1 92  ? -4.642  16.599  24.652  1.00 25.07 ? 92  ILE A CD1 1 
ATOM   740  N  N   . ALA A 1 93  ? -5.136  19.772  19.644  1.00 16.99 ? 93  ALA A N   1 
ATOM   741  C  CA  . ALA A 1 93  ? -6.020  20.621  18.845  1.00 19.54 ? 93  ALA A CA  1 
ATOM   742  C  C   . ALA A 1 93  ? -6.439  19.913  17.564  1.00 21.78 ? 93  ALA A C   1 
ATOM   743  O  O   . ALA A 1 93  ? -5.936  18.830  17.257  1.00 20.60 ? 93  ALA A O   1 
ATOM   744  C  CB  . ALA A 1 93  ? -5.266  21.927  18.478  1.00 22.47 ? 93  ALA A CB  1 
ATOM   745  N  N   . PRO A 1 94  ? -7.380  20.516  16.806  1.00 22.78 ? 94  PRO A N   1 
ATOM   746  C  CA  . PRO A 1 94  ? -7.826  19.907  15.545  1.00 21.63 ? 94  PRO A CA  1 
ATOM   747  C  C   . PRO A 1 94  ? -6.576  19.744  14.695  1.00 20.23 ? 94  PRO A C   1 
ATOM   748  O  O   . PRO A 1 94  ? -5.636  20.527  14.797  1.00 19.65 ? 94  PRO A O   1 
ATOM   749  C  CB  . PRO A 1 94  ? -8.789  20.948  14.981  1.00 23.05 ? 94  PRO A CB  1 
ATOM   750  C  CG  . PRO A 1 94  ? -9.430  21.488  16.235  1.00 23.93 ? 94  PRO A CG  1 
ATOM   751  C  CD  . PRO A 1 94  ? -8.224  21.680  17.156  1.00 23.07 ? 94  PRO A CD  1 
ATOM   752  N  N   . PRO A 1 95  ? -6.558  18.744  13.812  1.00 18.98 ? 95  PRO A N   1 
ATOM   753  C  CA  . PRO A 1 95  ? -5.386  18.489  12.966  1.00 19.06 ? 95  PRO A CA  1 
ATOM   754  C  C   . PRO A 1 95  ? -4.857  19.610  12.090  1.00 21.48 ? 95  PRO A C   1 
ATOM   755  O  O   . PRO A 1 95  ? -3.665  19.665  11.812  1.00 22.38 ? 95  PRO A O   1 
ATOM   756  C  CB  . PRO A 1 95  ? -5.818  17.284  12.114  1.00 23.84 ? 95  PRO A CB  1 
ATOM   757  C  CG  . PRO A 1 95  ? -6.972  16.689  12.868  1.00 25.88 ? 95  PRO A CG  1 
ATOM   758  C  CD  . PRO A 1 95  ? -7.693  17.898  13.415  1.00 21.26 ? 95  PRO A CD  1 
ATOM   759  N  N   . ASP A 1 96  ? -5.736  20.495  11.629  1.00 21.12 ? 96  ASP A N   1 
ATOM   760  C  CA  . ASP A 1 96  ? -5.274  21.561  10.746  1.00 24.52 ? 96  ASP A CA  1 
ATOM   761  C  C   . ASP A 1 96  ? -4.838  22.838  11.480  1.00 26.31 ? 96  ASP A C   1 
ATOM   762  O  O   . ASP A 1 96  ? -4.682  23.886  10.863  1.00 23.17 ? 96  ASP A O   1 
ATOM   763  C  CB  . ASP A 1 96  ? -6.385  21.906  9.748   1.00 29.72 ? 96  ASP A CB  1 
ATOM   764  C  CG  . ASP A 1 96  ? -7.674  22.318  10.432  1.00 37.88 ? 96  ASP A CG  1 
ATOM   765  O  OD1 . ASP A 1 96  ? -8.628  22.703  9.719   1.00 43.92 ? 96  ASP A OD1 1 
ATOM   766  O  OD2 . ASP A 1 96  ? -7.749  22.257  11.679  1.00 43.40 ? 96  ASP A OD2 1 
ATOM   767  N  N   . THR A 1 97  ? -4.630  22.754  12.785  1.00 23.77 ? 97  THR A N   1 
ATOM   768  C  CA  . THR A 1 97  ? -4.259  23.948  13.543  1.00 23.09 ? 97  THR A CA  1 
ATOM   769  C  C   . THR A 1 97  ? -2.974  24.615  13.050  1.00 23.71 ? 97  THR A C   1 
ATOM   770  O  O   . THR A 1 97  ? -2.028  23.948  12.630  1.00 24.81 ? 97  THR A O   1 
ATOM   771  C  CB  . THR A 1 97  ? -4.129  23.605  15.046  1.00 23.89 ? 97  THR A CB  1 
ATOM   772  O  OG1 . THR A 1 97  ? -3.778  24.780  15.788  1.00 25.45 ? 97  THR A OG1 1 
ATOM   773  C  CG2 . THR A 1 97  ? -3.066  22.533  15.253  1.00 22.47 ? 97  THR A CG2 1 
ATOM   774  N  N   . THR A 1 98  ? -2.968  25.949  13.070  1.00 24.40 ? 98  THR A N   1 
ATOM   775  C  CA  . THR A 1 98  ? -1.804  26.734  12.677  1.00 26.09 ? 98  THR A CA  1 
ATOM   776  C  C   . THR A 1 98  ? -1.689  27.886  13.681  1.00 24.53 ? 98  THR A C   1 
ATOM   777  O  O   . THR A 1 98  ? -2.617  28.147  14.450  1.00 23.80 ? 98  THR A O   1 
ATOM   778  C  CB  . THR A 1 98  ? -1.945  27.334  11.250  1.00 30.90 ? 98  THR A CB  1 
ATOM   779  O  OG1 . THR A 1 98  ? -3.185  28.042  11.158  1.00 30.69 ? 98  THR A OG1 1 
ATOM   780  C  CG2 . THR A 1 98  ? -1.884  26.227  10.190  1.00 32.37 ? 98  THR A CG2 1 
ATOM   781  N  N   . ILE A 1 99  ? -0.544  28.546  13.686  1.00 26.73 ? 99  ILE A N   1 
ATOM   782  C  CA  . ILE A 1 99  ? -0.320  29.654  14.608  1.00 29.09 ? 99  ILE A CA  1 
ATOM   783  C  C   . ILE A 1 99  ? -1.282  30.784  14.270  1.00 32.01 ? 99  ILE A C   1 
ATOM   784  O  O   . ILE A 1 99  ? -1.293  31.273  13.143  1.00 29.77 ? 99  ILE A O   1 
ATOM   785  C  CB  . ILE A 1 99  ? 1.120   30.187  14.499  1.00 29.64 ? 99  ILE A CB  1 
ATOM   786  C  CG1 . ILE A 1 99  ? 2.113   29.105  14.934  1.00 28.66 ? 99  ILE A CG1 1 
ATOM   787  C  CG2 . ILE A 1 99  ? 1.270   31.455  15.354  1.00 30.48 ? 99  ILE A CG2 1 
ATOM   788  C  CD1 . ILE A 1 99  ? 3.575   29.438  14.661  1.00 26.50 ? 99  ILE A CD1 1 
ATOM   789  N  N   . PRO A 1 100 ? -2.107  31.210  15.238  1.00 30.90 ? 100 PRO A N   1 
ATOM   790  C  CA  . PRO A 1 100 ? -3.061  32.297  14.990  1.00 30.84 ? 100 PRO A CA  1 
ATOM   791  C  C   . PRO A 1 100 ? -2.353  33.645  14.841  1.00 31.46 ? 100 PRO A C   1 
ATOM   792  O  O   . PRO A 1 100 ? -1.320  33.893  15.471  1.00 26.37 ? 100 PRO A O   1 
ATOM   793  C  CB  . PRO A 1 100 ? -3.965  32.266  16.225  1.00 28.54 ? 100 PRO A CB  1 
ATOM   794  C  CG  . PRO A 1 100 ? -3.813  30.864  16.755  1.00 33.27 ? 100 PRO A CG  1 
ATOM   795  C  CD  . PRO A 1 100 ? -2.344  30.599  16.555  1.00 32.67 ? 100 PRO A CD  1 
ATOM   796  N  N   . SER A 1 101 ? -2.906  34.520  14.004  1.00 33.75 ? 101 SER A N   1 
ATOM   797  C  CA  . SER A 1 101 ? -2.308  35.845  13.806  1.00 35.68 ? 101 SER A CA  1 
ATOM   798  C  C   . SER A 1 101 ? -2.299  36.596  15.139  1.00 30.65 ? 101 SER A C   1 
ATOM   799  O  O   . SER A 1 101 ? -3.303  36.629  15.838  1.00 32.48 ? 101 SER A O   1 
ATOM   800  C  CB  . SER A 1 101 ? -3.115  36.663  12.784  1.00 39.77 ? 101 SER A CB  1 
ATOM   801  O  OG  . SER A 1 101 ? -3.427  35.890  11.640  1.00 44.97 ? 101 SER A OG  1 
ATOM   802  N  N   . GLY A 1 102 ? -1.156  37.183  15.481  1.00 33.93 ? 102 GLY A N   1 
ATOM   803  C  CA  . GLY A 1 102 ? -1.034  37.939  16.718  1.00 32.37 ? 102 GLY A CA  1 
ATOM   804  C  C   . GLY A 1 102 ? -1.040  37.121  18.001  1.00 35.26 ? 102 GLY A C   1 
ATOM   805  O  O   . GLY A 1 102 ? -1.283  37.666  19.075  1.00 34.40 ? 102 GLY A O   1 
ATOM   806  N  N   . SER A 1 103 ? -0.743  35.827  17.906  1.00 31.20 ? 103 SER A N   1 
ATOM   807  C  CA  . SER A 1 103 ? -0.762  34.959  19.078  1.00 31.36 ? 103 SER A CA  1 
ATOM   808  C  C   . SER A 1 103 ? 0.554   34.911  19.855  1.00 32.71 ? 103 SER A C   1 
ATOM   809  O  O   . SER A 1 103 ? 0.770   33.991  20.653  1.00 30.15 ? 103 SER A O   1 
ATOM   810  C  CB  . SER A 1 103 ? -1.135  33.543  18.655  1.00 31.81 ? 103 SER A CB  1 
ATOM   811  O  OG  . SER A 1 103 ? -0.106  33.002  17.850  1.00 31.68 ? 103 SER A OG  1 
ATOM   812  N  N   . GLY A 1 104 ? 1.430   35.887  19.633  1.00 27.75 ? 104 GLY A N   1 
ATOM   813  C  CA  . GLY A 1 104 ? 2.707   35.892  20.330  1.00 26.75 ? 104 GLY A CA  1 
ATOM   814  C  C   . GLY A 1 104 ? 2.621   36.254  21.811  1.00 24.94 ? 104 GLY A C   1 
ATOM   815  O  O   . GLY A 1 104 ? 1.535   36.365  22.391  1.00 20.92 ? 104 GLY A O   1 
ATOM   816  N  N   . GLY A 1 105 ? 3.786   36.430  22.423  1.00 25.88 ? 105 GLY A N   1 
ATOM   817  C  CA  . GLY A 1 105 ? 3.840   36.801  23.825  1.00 25.84 ? 105 GLY A CA  1 
ATOM   818  C  C   . GLY A 1 105 ? 3.038   35.914  24.750  1.00 26.24 ? 105 GLY A C   1 
ATOM   819  O  O   . GLY A 1 105 ? 3.091   34.683  24.661  1.00 21.41 ? 105 GLY A O   1 
ATOM   820  N  N   . GLY A 1 106 ? 2.273   36.553  25.624  1.00 22.03 ? 106 GLY A N   1 
ATOM   821  C  CA  . GLY A 1 106 ? 1.472   35.833  26.599  1.00 21.20 ? 106 GLY A CA  1 
ATOM   822  C  C   . GLY A 1 106 ? 0.401   34.920  26.054  1.00 21.89 ? 106 GLY A C   1 
ATOM   823  O  O   . GLY A 1 106 ? -0.194  34.152  26.823  1.00 20.80 ? 106 GLY A O   1 
ATOM   824  N  N   . LEU A 1 107 ? 0.127   35.006  24.748  1.00 18.59 ? 107 LEU A N   1 
ATOM   825  C  CA  . LEU A 1 107 ? -0.881  34.134  24.162  1.00 19.91 ? 107 LEU A CA  1 
ATOM   826  C  C   . LEU A 1 107 ? -0.263  32.786  23.781  1.00 21.71 ? 107 LEU A C   1 
ATOM   827  O  O   . LEU A 1 107 ? -0.956  31.890  23.292  1.00 19.13 ? 107 LEU A O   1 
ATOM   828  C  CB  . LEU A 1 107 ? -1.557  34.795  22.957  1.00 22.34 ? 107 LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 107 ? -2.389  36.012  23.393  1.00 25.12 ? 107 LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 107 ? -3.107  36.593  22.174  1.00 23.76 ? 107 LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 107 ? -3.399  35.602  24.472  1.00 24.25 ? 107 LEU A CD2 1 
ATOM   832  N  N   . LEU A 1 108 ? 1.047   32.675  23.993  1.00 20.77 ? 108 LEU A N   1 
ATOM   833  C  CA  . LEU A 1 108 ? 1.786   31.430  23.802  1.00 20.74 ? 108 LEU A CA  1 
ATOM   834  C  C   . LEU A 1 108 ? 1.702   30.733  22.444  1.00 22.99 ? 108 LEU A C   1 
ATOM   835  O  O   . LEU A 1 108 ? 2.018   29.539  22.347  1.00 20.81 ? 108 LEU A O   1 
ATOM   836  C  CB  . LEU A 1 108 ? 1.347   30.438  24.891  1.00 20.17 ? 108 LEU A CB  1 
ATOM   837  C  CG  . LEU A 1 108 ? 1.427   30.907  26.341  1.00 22.53 ? 108 LEU A CG  1 
ATOM   838  C  CD1 . LEU A 1 108 ? 0.907   29.799  27.263  1.00 23.83 ? 108 LEU A CD1 1 
ATOM   839  C  CD2 . LEU A 1 108 ? 2.879   31.268  26.683  1.00 23.60 ? 108 LEU A CD2 1 
ATOM   840  N  N   . GLY A 1 109 ? 1.301   31.463  21.408  1.00 18.41 ? 109 GLY A N   1 
ATOM   841  C  CA  . GLY A 1 109 ? 1.189   30.867  20.082  1.00 21.55 ? 109 GLY A CA  1 
ATOM   842  C  C   . GLY A 1 109 ? -0.038  29.973  19.950  1.00 21.69 ? 109 GLY A C   1 
ATOM   843  O  O   . GLY A 1 109 ? -0.176  29.238  18.972  1.00 23.71 ? 109 GLY A O   1 
ATOM   844  N  N   . LEU A 1 110 ? -0.948  30.069  20.908  1.00 20.23 ? 110 LEU A N   1 
ATOM   845  C  CA  . LEU A 1 110 ? -2.155  29.237  20.926  1.00 22.21 ? 110 LEU A CA  1 
ATOM   846  C  C   . LEU A 1 110 ? -3.484  29.935  20.673  1.00 24.39 ? 110 LEU A C   1 
ATOM   847  O  O   . LEU A 1 110 ? -4.438  29.312  20.190  1.00 21.74 ? 110 LEU A O   1 
ATOM   848  C  CB  . LEU A 1 110 ? -2.262  28.513  22.279  1.00 23.79 ? 110 LEU A CB  1 
ATOM   849  C  CG  . LEU A 1 110 ? -1.216  27.425  22.533  1.00 24.74 ? 110 LEU A CG  1 
ATOM   850  C  CD1 . LEU A 1 110 ? -1.335  26.911  23.963  1.00 24.56 ? 110 LEU A CD1 1 
ATOM   851  C  CD2 . LEU A 1 110 ? -1.424  26.285  21.543  1.00 27.33 ? 110 LEU A CD2 1 
ATOM   852  N  N   . PHE A 1 111 ? -3.573  31.213  21.021  1.00 23.66 ? 111 PHE A N   1 
ATOM   853  C  CA  . PHE A 1 111 ? -4.836  31.916  20.850  1.00 23.85 ? 111 PHE A CA  1 
ATOM   854  C  C   . PHE A 1 111 ? -4.676  33.227  20.113  1.00 26.60 ? 111 PHE A C   1 
ATOM   855  O  O   . PHE A 1 111 ? -3.609  33.842  20.141  1.00 25.19 ? 111 PHE A O   1 
ATOM   856  C  CB  . PHE A 1 111 ? -5.488  32.222  22.205  1.00 26.56 ? 111 PHE A CB  1 
ATOM   857  C  CG  . PHE A 1 111 ? -5.710  31.013  23.076  1.00 27.49 ? 111 PHE A CG  1 
ATOM   858  C  CD1 . PHE A 1 111 ? -4.707  30.551  23.926  1.00 24.86 ? 111 PHE A CD1 1 
ATOM   859  C  CD2 . PHE A 1 111 ? -6.938  30.366  23.078  1.00 27.48 ? 111 PHE A CD2 1 
ATOM   860  C  CE1 . PHE A 1 111 ? -4.939  29.461  24.768  1.00 21.61 ? 111 PHE A CE1 1 
ATOM   861  C  CE2 . PHE A 1 111 ? -7.184  29.275  23.914  1.00 28.69 ? 111 PHE A CE2 1 
ATOM   862  C  CZ  . PHE A 1 111 ? -6.186  28.822  24.761  1.00 25.35 ? 111 PHE A CZ  1 
ATOM   863  N  N   . ALA A 1 112 ? -5.755  33.635  19.450  1.00 29.66 ? 112 ALA A N   1 
ATOM   864  C  CA  . ALA A 1 112 ? -5.795  34.902  18.727  1.00 32.83 ? 112 ALA A CA  1 
ATOM   865  C  C   . ALA A 1 112 ? -6.257  35.938  19.755  1.00 31.89 ? 112 ALA A C   1 
ATOM   866  O  O   . ALA A 1 112 ? -7.163  35.670  20.552  1.00 31.38 ? 112 ALA A O   1 
ATOM   867  C  CB  . ALA A 1 112 ? -6.793  34.821  17.573  1.00 33.86 ? 112 ALA A CB  1 
ATOM   868  N  N   . PRO A 1 113 ? -5.650  37.135  19.740  1.00 33.73 ? 113 PRO A N   1 
ATOM   869  C  CA  . PRO A 1 113 ? -5.982  38.219  20.670  1.00 35.93 ? 113 PRO A CA  1 
ATOM   870  C  C   . PRO A 1 113 ? -7.467  38.480  20.877  1.00 35.90 ? 113 PRO A C   1 
ATOM   871  O  O   . PRO A 1 113 ? -7.946  38.562  22.012  1.00 37.86 ? 113 PRO A O   1 
ATOM   872  C  CB  . PRO A 1 113 ? -5.279  39.423  20.054  1.00 35.90 ? 113 PRO A CB  1 
ATOM   873  C  CG  . PRO A 1 113 ? -4.088  38.824  19.420  1.00 37.96 ? 113 PRO A CG  1 
ATOM   874  C  CD  . PRO A 1 113 ? -4.630  37.574  18.772  1.00 33.83 ? 113 PRO A CD  1 
ATOM   875  N  N   . GLY A 1 114 ? -8.201  38.604  19.780  1.00 37.98 ? 114 GLY A N   1 
ATOM   876  C  CA  . GLY A 1 114 ? -9.617  38.909  19.886  1.00 38.01 ? 114 GLY A CA  1 
ATOM   877  C  C   . GLY A 1 114 ? -10.522 37.865  20.497  1.00 39.03 ? 114 GLY A C   1 
ATOM   878  O  O   . GLY A 1 114 ? -11.604 38.190  21.000  1.00 39.49 ? 114 GLY A O   1 
ATOM   879  N  N   . THR A 1 115 ? -10.086 36.613  20.479  1.00 36.50 ? 115 THR A N   1 
ATOM   880  C  CA  . THR A 1 115 ? -10.917 35.542  20.994  1.00 35.29 ? 115 THR A CA  1 
ATOM   881  C  C   . THR A 1 115 ? -10.222 34.687  22.050  1.00 32.14 ? 115 THR A C   1 
ATOM   882  O  O   . THR A 1 115 ? -10.725 33.618  22.407  1.00 30.78 ? 115 THR A O   1 
ATOM   883  C  CB  . THR A 1 115 ? -11.350 34.620  19.837  1.00 36.99 ? 115 THR A CB  1 
ATOM   884  O  OG1 . THR A 1 115 ? -10.181 34.159  19.149  1.00 34.55 ? 115 THR A OG1 1 
ATOM   885  C  CG2 . THR A 1 115 ? -12.241 35.370  18.852  1.00 38.35 ? 115 THR A CG2 1 
ATOM   886  N  N   . ALA A 1 116 ? -9.097  35.171  22.563  1.00 31.50 ? 116 ALA A N   1 
ATOM   887  C  CA  . ALA A 1 116 ? -8.306  34.428  23.549  1.00 30.20 ? 116 ALA A CA  1 
ATOM   888  C  C   . ALA A 1 116 ? -9.056  33.981  24.797  1.00 29.42 ? 116 ALA A C   1 
ATOM   889  O  O   . ALA A 1 116 ? -8.686  32.971  25.407  1.00 25.12 ? 116 ALA A O   1 
ATOM   890  C  CB  . ALA A 1 116 ? -7.082  35.238  23.944  1.00 28.25 ? 116 ALA A CB  1 
ATOM   891  N  N   . GLN A 1 117 ? -10.093 34.718  25.191  1.00 28.47 ? 117 GLN A N   1 
ATOM   892  C  CA  . GLN A 1 117 ? -10.859 34.338  26.377  1.00 31.20 ? 117 GLN A CA  1 
ATOM   893  C  C   . GLN A 1 117 ? -12.296 33.932  26.076  1.00 33.63 ? 117 GLN A C   1 
ATOM   894  O  O   . GLN A 1 117 ? -13.109 33.797  26.981  1.00 35.22 ? 117 GLN A O   1 
ATOM   895  C  CB  . GLN A 1 117 ? -10.838 35.465  27.408  1.00 35.82 ? 117 GLN A CB  1 
ATOM   896  C  CG  . GLN A 1 117 ? -9.429  35.815  27.871  1.00 37.06 ? 117 GLN A CG  1 
ATOM   897  C  CD  . GLN A 1 117 ? -9.419  36.758  29.058  1.00 38.74 ? 117 GLN A CD  1 
ATOM   898  O  OE1 . GLN A 1 117 ? -9.908  36.417  30.137  1.00 39.22 ? 117 GLN A OE1 1 
ATOM   899  N  NE2 . GLN A 1 117 ? -8.867  37.950  28.864  1.00 35.08 ? 117 GLN A NE2 1 
ATOM   900  N  N   . ASN A 1 118 ? -12.597 33.721  24.797  1.00 33.85 ? 118 ASN A N   1 
ATOM   901  C  CA  . ASN A 1 118 ? -13.937 33.315  24.368  1.00 35.63 ? 118 ASN A CA  1 
ATOM   902  C  C   . ASN A 1 118 ? -13.933 31.794  24.178  1.00 32.09 ? 118 ASN A C   1 
ATOM   903  O  O   . ASN A 1 118 ? -13.458 31.292  23.158  1.00 31.56 ? 118 ASN A O   1 
ATOM   904  C  CB  . ASN A 1 118 ? -14.280 33.996  23.042  1.00 37.28 ? 118 ASN A CB  1 
ATOM   905  C  CG  . ASN A 1 118 ? -15.713 33.753  22.618  1.00 39.89 ? 118 ASN A CG  1 
ATOM   906  O  OD1 . ASN A 1 118 ? -16.347 32.787  23.057  1.00 40.27 ? 118 ASN A OD1 1 
ATOM   907  N  ND2 . ASN A 1 118 ? -16.217 34.627  21.750  1.00 42.61 ? 118 ASN A ND2 1 
ATOM   908  N  N   . THR A 1 119 ? -14.470 31.067  25.147  1.00 31.43 ? 119 THR A N   1 
ATOM   909  C  CA  . THR A 1 119 ? -14.456 29.612  25.071  1.00 35.20 ? 119 THR A CA  1 
ATOM   910  C  C   . THR A 1 119 ? -15.220 29.018  23.901  1.00 38.61 ? 119 THR A C   1 
ATOM   911  O  O   . THR A 1 119 ? -14.871 27.942  23.423  1.00 36.65 ? 119 THR A O   1 
ATOM   912  C  CB  . THR A 1 119 ? -14.981 28.968  26.364  1.00 36.15 ? 119 THR A CB  1 
ATOM   913  O  OG1 . THR A 1 119 ? -16.325 29.396  26.607  1.00 37.22 ? 119 THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 119 ? -14.113 29.358  27.537  1.00 37.80 ? 119 THR A CG2 1 
ATOM   915  N  N   . SER A 1 120 ? -16.254 29.701  23.423  1.00 38.37 ? 120 SER A N   1 
ATOM   916  C  CA  A SER A 1 120 ? -17.022 29.167  22.304  0.50 39.44 ? 120 SER A CA  1 
ATOM   917  C  CA  B SER A 1 120 ? -17.033 29.186  22.302  0.50 39.63 ? 120 SER A CA  1 
ATOM   918  C  C   . SER A 1 120 ? -16.307 29.376  20.968  1.00 38.71 ? 120 SER A C   1 
ATOM   919  O  O   . SER A 1 120 ? -16.710 28.818  19.950  1.00 40.81 ? 120 SER A O   1 
ATOM   920  C  CB  A SER A 1 120 ? -18.424 29.796  22.264  0.50 39.95 ? 120 SER A CB  1 
ATOM   921  C  CB  B SER A 1 120 ? -18.402 29.878  22.250  0.50 40.25 ? 120 SER A CB  1 
ATOM   922  O  OG  A SER A 1 120 ? -18.360 31.205  22.145  0.50 39.36 ? 120 SER A OG  1 
ATOM   923  O  OG  B SER A 1 120 ? -19.108 29.706  23.466  0.50 39.74 ? 120 SER A OG  1 
ATOM   924  N  N   . ALA A 1 121 ? -15.229 30.158  20.973  1.00 34.64 ? 121 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 121 ? -14.485 30.414  19.743  1.00 36.15 ? 121 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 121 ? -13.242 29.555  19.535  1.00 34.79 ? 121 ALA A C   1 
ATOM   927  O  O   . ALA A 1 121 ? -12.619 29.623  18.478  1.00 35.67 ? 121 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 121 ? -14.094 31.884  19.665  1.00 35.22 ? 121 ALA A CB  1 
ATOM   929  N  N   . ASN A 1 122 ? -12.877 28.749  20.525  1.00 32.52 ? 122 ASN A N   1 
ATOM   930  C  CA  . ASN A 1 122 ? -11.674 27.928  20.403  1.00 31.52 ? 122 ASN A CA  1 
ATOM   931  C  C   . ASN A 1 122 ? -11.898 26.435  20.576  1.00 29.62 ? 122 ASN A C   1 
ATOM   932  O  O   . ASN A 1 122 ? -12.929 26.008  21.090  1.00 29.48 ? 122 ASN A O   1 
ATOM   933  C  CB  . ASN A 1 122 ? -10.632 28.373  21.440  1.00 29.35 ? 122 ASN A CB  1 
ATOM   934  C  CG  . ASN A 1 122 ? -10.214 29.816  21.270  1.00 32.07 ? 122 ASN A CG  1 
ATOM   935  O  OD1 . ASN A 1 122 ? -9.485  30.158  20.339  1.00 35.04 ? 122 ASN A OD1 1 
ATOM   936  N  ND2 . ASN A 1 122 ? -10.678 30.675  22.169  1.00 33.68 ? 122 ASN A ND2 1 
ATOM   937  N  N   . GLN A 1 123 ? -10.909 25.652  20.141  1.00 28.36 ? 123 GLN A N   1 
ATOM   938  C  CA  . GLN A 1 123 ? -10.927 24.194  20.284  1.00 27.89 ? 123 GLN A CA  1 
ATOM   939  C  C   . GLN A 1 123 ? -9.504  23.780  20.637  1.00 26.38 ? 123 GLN A C   1 
ATOM   940  O  O   . GLN A 1 123 ? -8.701  23.441  19.767  1.00 21.18 ? 123 GLN A O   1 
ATOM   941  C  CB  . GLN A 1 123 ? -11.324 23.496  18.984  1.00 31.65 ? 123 GLN A CB  1 
ATOM   942  C  CG  . GLN A 1 123 ? -12.805 23.426  18.744  1.00 36.46 ? 123 GLN A CG  1 
ATOM   943  C  CD  . GLN A 1 123 ? -13.107 22.563  17.543  1.00 39.13 ? 123 GLN A CD  1 
ATOM   944  O  OE1 . GLN A 1 123 ? -12.666 22.861  16.435  1.00 39.50 ? 123 GLN A OE1 1 
ATOM   945  N  NE2 . GLN A 1 123 ? -13.844 21.479  17.757  1.00 41.59 ? 123 GLN A NE2 1 
ATOM   946  N  N   . VAL A 1 124 ? -9.179  23.826  21.918  1.00 23.18 ? 124 VAL A N   1 
ATOM   947  C  CA  . VAL A 1 124 ? -7.843  23.460  22.314  1.00 20.22 ? 124 VAL A CA  1 
ATOM   948  C  C   . VAL A 1 124 ? -7.807  23.152  23.787  1.00 21.40 ? 124 VAL A C   1 
ATOM   949  O  O   . VAL A 1 124 ? -8.530  23.749  24.585  1.00 21.09 ? 124 VAL A O   1 
ATOM   950  C  CB  . VAL A 1 124 ? -6.858  24.617  22.012  1.00 24.72 ? 124 VAL A CB  1 
ATOM   951  C  CG1 . VAL A 1 124 ? -7.338  25.881  22.706  1.00 25.32 ? 124 VAL A CG1 1 
ATOM   952  C  CG2 . VAL A 1 124 ? -5.448  24.269  22.486  1.00 24.60 ? 124 VAL A CG2 1 
ATOM   953  N  N   . ILE A 1 125 ? -6.984  22.176  24.134  1.00 19.03 ? 125 ILE A N   1 
ATOM   954  C  CA  . ILE A 1 125 ? -6.762  21.825  25.527  1.00 20.04 ? 125 ILE A CA  1 
ATOM   955  C  C   . ILE A 1 125 ? -5.251  21.946  25.630  1.00 22.17 ? 125 ILE A C   1 
ATOM   956  O  O   . ILE A 1 125 ? -4.528  21.391  24.804  1.00 18.91 ? 125 ILE A O   1 
ATOM   957  C  CB  . ILE A 1 125 ? -7.182  20.379  25.857  1.00 22.28 ? 125 ILE A CB  1 
ATOM   958  C  CG1 . ILE A 1 125 ? -8.717  20.274  25.855  1.00 22.95 ? 125 ILE A CG1 1 
ATOM   959  C  CG2 . ILE A 1 125 ? -6.625  19.970  27.229  1.00 26.26 ? 125 ILE A CG2 1 
ATOM   960  C  CD1 . ILE A 1 125 ? -9.240  18.866  26.200  1.00 26.69 ? 125 ILE A CD1 1 
ATOM   961  N  N   . ALA A 1 126 ? -4.765  22.680  26.622  1.00 18.47 ? 126 ALA A N   1 
ATOM   962  C  CA  . ALA A 1 126 ? -3.331  22.855  26.756  1.00 17.28 ? 126 ALA A CA  1 
ATOM   963  C  C   . ALA A 1 126 ? -2.901  22.837  28.212  1.00 13.37 ? 126 ALA A C   1 
ATOM   964  O  O   . ALA A 1 126 ? -3.687  23.144  29.106  1.00 18.38 ? 126 ALA A O   1 
ATOM   965  C  CB  . ALA A 1 126 ? -2.909  24.180  26.123  1.00 17.53 ? 126 ALA A CB  1 
ATOM   966  N  N   . VAL A 1 127 ? -1.651  22.458  28.446  1.00 14.71 ? 127 VAL A N   1 
ATOM   967  C  CA  . VAL A 1 127 ? -1.098  22.479  29.797  1.00 13.69 ? 127 VAL A CA  1 
ATOM   968  C  C   . VAL A 1 127 ? 0.042   23.466  29.637  1.00 16.08 ? 127 VAL A C   1 
ATOM   969  O  O   . VAL A 1 127 ? 1.016   23.183  28.931  1.00 14.49 ? 127 VAL A O   1 
ATOM   970  C  CB  . VAL A 1 127 ? -0.535  21.120  30.220  1.00 16.86 ? 127 VAL A CB  1 
ATOM   971  C  CG1 . VAL A 1 127 ? 0.148   21.266  31.594  1.00 14.14 ? 127 VAL A CG1 1 
ATOM   972  C  CG2 . VAL A 1 127 ? -1.673  20.087  30.313  1.00 17.08 ? 127 VAL A CG2 1 
ATOM   973  N  N   . GLU A 1 128 ? -0.080  24.626  30.282  1.00 14.34 ? 128 GLU A N   1 
ATOM   974  C  CA  . GLU A 1 128 ? 0.915   25.683  30.143  1.00 15.95 ? 128 GLU A CA  1 
ATOM   975  C  C   . GLU A 1 128 ? 1.852   25.798  31.342  1.00 15.67 ? 128 GLU A C   1 
ATOM   976  O  O   . GLU A 1 128 ? 1.454   25.527  32.462  1.00 15.11 ? 128 GLU A O   1 
ATOM   977  C  CB  . GLU A 1 128 ? 0.207   27.027  29.947  1.00 16.10 ? 128 GLU A CB  1 
ATOM   978  C  CG  . GLU A 1 128 ? -0.668  27.441  31.150  1.00 13.20 ? 128 GLU A CG  1 
ATOM   979  C  CD  . GLU A 1 128 ? -1.143  28.896  31.077  1.00 19.59 ? 128 GLU A CD  1 
ATOM   980  O  OE1 . GLU A 1 128 ? -0.901  29.647  32.040  1.00 16.48 ? 128 GLU A OE1 1 
ATOM   981  O  OE2 . GLU A 1 128 ? -1.754  29.290  30.067  1.00 18.16 ? 128 GLU A OE2 1 
ATOM   982  N  N   . PHE A 1 129 ? 3.094   26.212  31.073  1.00 15.67 ? 129 PHE A N   1 
ATOM   983  C  CA  . PHE A 1 129 ? 4.125   26.427  32.089  1.00 15.66 ? 129 PHE A CA  1 
ATOM   984  C  C   . PHE A 1 129 ? 4.421   27.876  31.778  1.00 16.90 ? 129 PHE A C   1 
ATOM   985  O  O   . PHE A 1 129 ? 5.195   28.187  30.876  1.00 16.10 ? 129 PHE A O   1 
ATOM   986  C  CB  . PHE A 1 129 ? 5.302   25.480  31.823  1.00 14.22 ? 129 PHE A CB  1 
ATOM   987  C  CG  . PHE A 1 129 ? 4.916   24.035  31.973  1.00 16.02 ? 129 PHE A CG  1 
ATOM   988  C  CD1 . PHE A 1 129 ? 4.288   23.363  30.932  1.00 20.09 ? 129 PHE A CD1 1 
ATOM   989  C  CD2 . PHE A 1 129 ? 5.086   23.387  33.190  1.00 20.54 ? 129 PHE A CD2 1 
ATOM   990  C  CE1 . PHE A 1 129 ? 3.820   22.053  31.102  1.00 20.88 ? 129 PHE A CE1 1 
ATOM   991  C  CE2 . PHE A 1 129 ? 4.625   22.086  33.373  1.00 20.44 ? 129 PHE A CE2 1 
ATOM   992  C  CZ  . PHE A 1 129 ? 3.990   21.420  32.322  1.00 22.14 ? 129 PHE A CZ  1 
ATOM   993  N  N   . ASP A 1 130 ? 3.764   28.743  32.553  1.00 17.38 ? 130 ASP A N   1 
ATOM   994  C  CA  . ASP A 1 130 ? 3.722   30.192  32.326  1.00 15.61 ? 130 ASP A CA  1 
ATOM   995  C  C   . ASP A 1 130 ? 4.627   30.944  33.276  1.00 16.29 ? 130 ASP A C   1 
ATOM   996  O  O   . ASP A 1 130 ? 4.368   30.974  34.470  1.00 16.43 ? 130 ASP A O   1 
ATOM   997  C  CB  . ASP A 1 130 ? 2.258   30.609  32.532  1.00 12.86 ? 130 ASP A CB  1 
ATOM   998  C  CG  . ASP A 1 130 ? 1.928   32.012  31.991  1.00 13.65 ? 130 ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1 130 ? 2.873   32.789  31.787  1.00 17.50 ? 130 ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1 130 ? 0.695   32.297  31.820  1.00 18.04 ? 130 ASP A OD2 1 
ATOM   1001 N  N   . THR A 1 131 ? 5.676   31.556  32.737  1.00 18.04 ? 131 THR A N   1 
ATOM   1002 C  CA  . THR A 1 131 ? 6.650   32.261  33.575  1.00 20.46 ? 131 THR A CA  1 
ATOM   1003 C  C   . THR A 1 131 ? 6.493   33.763  33.652  1.00 21.24 ? 131 THR A C   1 
ATOM   1004 O  O   . THR A 1 131 ? 7.244   34.424  34.380  1.00 20.19 ? 131 THR A O   1 
ATOM   1005 C  CB  . THR A 1 131 ? 8.084   32.037  33.076  1.00 20.17 ? 131 THR A CB  1 
ATOM   1006 O  OG1 . THR A 1 131 ? 8.199   32.557  31.737  1.00 19.13 ? 131 THR A OG1 1 
ATOM   1007 C  CG2 . THR A 1 131 ? 8.439   30.554  33.102  1.00 20.11 ? 131 THR A CG2 1 
ATOM   1008 N  N   . PHE A 1 132 ? 5.541   34.319  32.925  1.00 20.00 ? 132 PHE A N   1 
ATOM   1009 C  CA  . PHE A 1 132 ? 5.409   35.771  32.910  1.00 21.44 ? 132 PHE A CA  1 
ATOM   1010 C  C   . PHE A 1 132 ? 3.964   36.132  33.177  1.00 19.20 ? 132 PHE A C   1 
ATOM   1011 O  O   . PHE A 1 132 ? 3.056   35.652  32.489  1.00 17.20 ? 132 PHE A O   1 
ATOM   1012 C  CB  . PHE A 1 132 ? 5.869   36.298  31.555  1.00 21.45 ? 132 PHE A CB  1 
ATOM   1013 C  CG  . PHE A 1 132 ? 5.986   37.784  31.505  1.00 22.39 ? 132 PHE A CG  1 
ATOM   1014 C  CD1 . PHE A 1 132 ? 7.178   38.408  31.866  1.00 21.51 ? 132 PHE A CD1 1 
ATOM   1015 C  CD2 . PHE A 1 132 ? 4.899   38.558  31.135  1.00 23.99 ? 132 PHE A CD2 1 
ATOM   1016 C  CE1 . PHE A 1 132 ? 7.280   39.811  31.858  1.00 24.13 ? 132 PHE A CE1 1 
ATOM   1017 C  CE2 . PHE A 1 132 ? 4.984   39.969  31.125  1.00 26.73 ? 132 PHE A CE2 1 
ATOM   1018 C  CZ  . PHE A 1 132 ? 6.180   40.585  31.489  1.00 22.40 ? 132 PHE A CZ  1 
ATOM   1019 N  N   . TYR A 1 133 ? 3.747   37.015  34.153  1.00 16.82 ? 133 TYR A N   1 
ATOM   1020 C  CA  . TYR A 1 133 ? 2.386   37.331  34.564  1.00 15.37 ? 133 TYR A CA  1 
ATOM   1021 C  C   . TYR A 1 133 ? 2.073   38.797  34.844  1.00 20.29 ? 133 TYR A C   1 
ATOM   1022 O  O   . TYR A 1 133 ? 1.107   39.085  35.548  1.00 24.32 ? 133 TYR A O   1 
ATOM   1023 C  CB  . TYR A 1 133 ? 2.068   36.528  35.818  1.00 20.21 ? 133 TYR A CB  1 
ATOM   1024 C  CG  . TYR A 1 133 ? 3.198   36.594  36.813  1.00 28.25 ? 133 TYR A CG  1 
ATOM   1025 C  CD1 . TYR A 1 133 ? 4.280   35.714  36.730  1.00 30.16 ? 133 TYR A CD1 1 
ATOM   1026 C  CD2 . TYR A 1 133 ? 3.228   37.584  37.789  1.00 30.52 ? 133 TYR A CD2 1 
ATOM   1027 C  CE1 . TYR A 1 133 ? 5.362   35.821  37.591  1.00 31.19 ? 133 TYR A CE1 1 
ATOM   1028 C  CE2 . TYR A 1 133 ? 4.314   37.701  38.660  1.00 37.04 ? 133 TYR A CE2 1 
ATOM   1029 C  CZ  . TYR A 1 133 ? 5.371   36.815  38.551  1.00 37.02 ? 133 TYR A CZ  1 
ATOM   1030 O  OH  . TYR A 1 133 ? 6.438   36.921  39.408  1.00 44.02 ? 133 TYR A OH  1 
ATOM   1031 N  N   . ALA A 1 134 ? 2.859   39.714  34.297  1.00 21.18 ? 134 ALA A N   1 
ATOM   1032 C  CA  . ALA A 1 134 ? 2.597   41.146  34.519  1.00 26.19 ? 134 ALA A CA  1 
ATOM   1033 C  C   . ALA A 1 134 ? 1.128   41.433  34.194  1.00 27.98 ? 134 ALA A C   1 
ATOM   1034 O  O   . ALA A 1 134 ? 0.621   41.084  33.120  1.00 26.75 ? 134 ALA A O   1 
ATOM   1035 C  CB  . ALA A 1 134 ? 3.508   41.986  33.660  1.00 24.51 ? 134 ALA A CB  1 
ATOM   1036 N  N   . GLN A 1 135 ? 0.441   42.080  35.127  1.00 27.53 ? 135 GLN A N   1 
ATOM   1037 C  CA  . GLN A 1 135 ? -0.982  42.338  34.963  1.00 28.66 ? 135 GLN A CA  1 
ATOM   1038 C  C   . GLN A 1 135 ? -1.395  43.366  33.908  1.00 29.39 ? 135 GLN A C   1 
ATOM   1039 O  O   . GLN A 1 135 ? -2.571  43.466  33.588  1.00 33.93 ? 135 GLN A O   1 
ATOM   1040 C  CB  . GLN A 1 135 ? -1.581  42.693  36.325  1.00 27.95 ? 135 GLN A CB  1 
ATOM   1041 C  CG  . GLN A 1 135 ? -1.261  41.655  37.422  1.00 34.91 ? 135 GLN A CG  1 
ATOM   1042 C  CD  . GLN A 1 135 ? -2.050  40.356  37.268  1.00 37.80 ? 135 GLN A CD  1 
ATOM   1043 O  OE1 . GLN A 1 135 ? -3.256  40.327  37.514  1.00 39.63 ? 135 GLN A OE1 1 
ATOM   1044 N  NE2 . GLN A 1 135 ? -1.371  39.277  36.859  1.00 32.15 ? 135 GLN A NE2 1 
ATOM   1045 N  N   . ASP A 1 136 ? -0.457  44.129  33.356  1.00 31.02 ? 136 ASP A N   1 
ATOM   1046 C  CA  . ASP A 1 136 ? -0.850  45.093  32.333  1.00 32.96 ? 136 ASP A CA  1 
ATOM   1047 C  C   . ASP A 1 136 ? -1.100  44.372  31.001  1.00 34.18 ? 136 ASP A C   1 
ATOM   1048 O  O   . ASP A 1 136 ? -2.037  44.710  30.270  1.00 37.31 ? 136 ASP A O   1 
ATOM   1049 C  CB  . ASP A 1 136 ? 0.229   46.175  32.156  1.00 33.60 ? 136 ASP A CB  1 
ATOM   1050 C  CG  . ASP A 1 136 ? 1.581   45.595  31.799  1.00 37.39 ? 136 ASP A CG  1 
ATOM   1051 O  OD1 . ASP A 1 136 ? 2.020   44.657  32.493  1.00 34.95 ? 136 ASP A OD1 1 
ATOM   1052 O  OD2 . ASP A 1 136 ? 2.206   46.073  30.829  1.00 38.44 ? 136 ASP A OD2 1 
ATOM   1053 N  N   . SER A 1 137 ? -0.273  43.373  30.704  1.00 25.88 ? 137 SER A N   1 
ATOM   1054 C  CA  . SER A 1 137 ? -0.379  42.616  29.447  1.00 25.26 ? 137 SER A CA  1 
ATOM   1055 C  C   . SER A 1 137 ? -0.961  41.199  29.565  1.00 26.61 ? 137 SER A C   1 
ATOM   1056 O  O   . SER A 1 137 ? -1.556  40.697  28.614  1.00 24.84 ? 137 SER A O   1 
ATOM   1057 C  CB  . SER A 1 137 ? 0.994   42.520  28.794  1.00 26.71 ? 137 SER A CB  1 
ATOM   1058 O  OG  . SER A 1 137 ? 1.888   41.833  29.661  1.00 25.60 ? 137 SER A OG  1 
ATOM   1059 N  N   . ASN A 1 138 ? -0.760  40.545  30.706  1.00 22.03 ? 138 ASN A N   1 
ATOM   1060 C  CA  . ASN A 1 138 ? -1.289  39.188  30.933  1.00 23.28 ? 138 ASN A CA  1 
ATOM   1061 C  C   . ASN A 1 138 ? -2.359  39.316  32.002  1.00 23.04 ? 138 ASN A C   1 
ATOM   1062 O  O   . ASN A 1 138 ? -2.265  38.722  33.079  1.00 22.37 ? 138 ASN A O   1 
ATOM   1063 C  CB  . ASN A 1 138 ? -0.176  38.245  31.426  1.00 20.56 ? 138 ASN A CB  1 
ATOM   1064 C  CG  . ASN A 1 138 ? 0.848   37.906  30.336  1.00 25.71 ? 138 ASN A CG  1 
ATOM   1065 O  OD1 . ASN A 1 138 ? 1.092   36.733  30.051  1.00 20.50 ? 138 ASN A OD1 1 
ATOM   1066 N  ND2 . ASN A 1 138 ? 1.458   38.929  29.737  1.00 21.16 ? 138 ASN A ND2 1 
ATOM   1067 N  N   . THR A 1 139 ? -3.407  40.066  31.682  1.00 24.89 ? 139 THR A N   1 
ATOM   1068 C  CA  . THR A 1 139 ? -4.467  40.336  32.639  1.00 25.69 ? 139 THR A CA  1 
ATOM   1069 C  C   . THR A 1 139 ? -5.218  39.133  33.156  1.00 27.49 ? 139 THR A C   1 
ATOM   1070 O  O   . THR A 1 139 ? -5.820  39.198  34.214  1.00 25.31 ? 139 THR A O   1 
ATOM   1071 C  CB  . THR A 1 139 ? -5.478  41.350  32.050  1.00 30.97 ? 139 THR A CB  1 
ATOM   1072 O  OG1 . THR A 1 139 ? -6.118  40.784  30.897  1.00 34.52 ? 139 THR A OG1 1 
ATOM   1073 C  CG2 . THR A 1 139 ? -4.761  42.606  31.623  1.00 31.70 ? 139 THR A CG2 1 
ATOM   1074 N  N   . TRP A 1 140 ? -5.165  38.032  32.416  1.00 21.10 ? 140 TRP A N   1 
ATOM   1075 C  CA  . TRP A 1 140 ? -5.866  36.817  32.787  1.00 23.49 ? 140 TRP A CA  1 
ATOM   1076 C  C   . TRP A 1 140 ? -5.101  35.927  33.775  1.00 19.34 ? 140 TRP A C   1 
ATOM   1077 O  O   . TRP A 1 140 ? -5.680  34.998  34.329  1.00 22.92 ? 140 TRP A O   1 
ATOM   1078 C  CB  . TRP A 1 140 ? -6.138  36.001  31.510  1.00 19.90 ? 140 TRP A CB  1 
ATOM   1079 C  CG  . TRP A 1 140 ? -4.880  35.839  30.742  1.00 20.72 ? 140 TRP A CG  1 
ATOM   1080 C  CD1 . TRP A 1 140 ? -3.854  34.982  31.026  1.00 20.72 ? 140 TRP A CD1 1 
ATOM   1081 C  CD2 . TRP A 1 140 ? -4.442  36.643  29.643  1.00 23.13 ? 140 TRP A CD2 1 
ATOM   1082 N  NE1 . TRP A 1 140 ? -2.802  35.210  30.176  1.00 20.47 ? 140 TRP A NE1 1 
ATOM   1083 C  CE2 . TRP A 1 140 ? -3.136  36.218  29.315  1.00 21.03 ? 140 TRP A CE2 1 
ATOM   1084 C  CE3 . TRP A 1 140 ? -5.028  37.681  28.901  1.00 21.73 ? 140 TRP A CE3 1 
ATOM   1085 C  CZ2 . TRP A 1 140 ? -2.401  36.804  28.278  1.00 26.23 ? 140 TRP A CZ2 1 
ATOM   1086 C  CZ3 . TRP A 1 140 ? -4.294  38.257  27.873  1.00 26.74 ? 140 TRP A CZ3 1 
ATOM   1087 C  CH2 . TRP A 1 140 ? -2.995  37.814  27.570  1.00 26.12 ? 140 TRP A CH2 1 
ATOM   1088 N  N   . ASP A 1 141 ? -3.817  36.204  33.982  1.00 21.36 ? 141 ASP A N   1 
ATOM   1089 C  CA  . ASP A 1 141 ? -2.962  35.390  34.860  1.00 22.06 ? 141 ASP A CA  1 
ATOM   1090 C  C   . ASP A 1 141 ? -2.984  35.697  36.361  1.00 24.04 ? 141 ASP A C   1 
ATOM   1091 O  O   . ASP A 1 141 ? -3.232  36.830  36.771  1.00 24.65 ? 141 ASP A O   1 
ATOM   1092 C  CB  . ASP A 1 141 ? -1.482  35.543  34.474  1.00 19.91 ? 141 ASP A CB  1 
ATOM   1093 C  CG  . ASP A 1 141 ? -1.073  34.722  33.273  1.00 17.32 ? 141 ASP A CG  1 
ATOM   1094 O  OD1 . ASP A 1 141 ? -1.738  33.701  33.004  1.00 15.42 ? 141 ASP A OD1 1 
ATOM   1095 O  OD2 . ASP A 1 141 ? -0.062  35.100  32.635  1.00 17.90 ? 141 ASP A OD2 1 
ATOM   1096 N  N   . PRO A 1 142 ? -2.713  34.676  37.194  1.00 25.19 ? 142 PRO A N   1 
ATOM   1097 C  CA  . PRO A 1 142 ? -2.660  34.873  38.650  1.00 24.74 ? 142 PRO A CA  1 
ATOM   1098 C  C   . PRO A 1 142 ? -1.341  35.658  38.771  1.00 24.86 ? 142 PRO A C   1 
ATOM   1099 O  O   . PRO A 1 142 ? -0.547  35.667  37.834  1.00 22.77 ? 142 PRO A O   1 
ATOM   1100 C  CB  . PRO A 1 142 ? -2.559  33.448  39.194  1.00 25.65 ? 142 PRO A CB  1 
ATOM   1101 C  CG  . PRO A 1 142 ? -1.890  32.693  38.079  1.00 26.27 ? 142 PRO A CG  1 
ATOM   1102 C  CD  . PRO A 1 142 ? -2.593  33.247  36.853  1.00 24.37 ? 142 PRO A CD  1 
ATOM   1103 N  N   . ASN A 1 143 ? -1.069  36.315  39.889  1.00 21.54 ? 143 ASN A N   1 
ATOM   1104 C  CA  A ASN A 1 143 ? 0.153   37.104  40.006  0.50 26.37 ? 143 ASN A CA  1 
ATOM   1105 C  CA  B ASN A 1 143 ? 0.162   37.095  39.989  0.50 26.34 ? 143 ASN A CA  1 
ATOM   1106 C  C   . ASN A 1 143 ? 1.391   36.337  40.493  1.00 26.14 ? 143 ASN A C   1 
ATOM   1107 O  O   . ASN A 1 143 ? 2.023   36.726  41.474  1.00 27.10 ? 143 ASN A O   1 
ATOM   1108 C  CB  A ASN A 1 143 ? -0.133  38.318  40.915  0.50 30.25 ? 143 ASN A CB  1 
ATOM   1109 C  CB  B ASN A 1 143 ? -0.080  38.337  40.861  0.50 30.89 ? 143 ASN A CB  1 
ATOM   1110 C  CG  A ASN A 1 143 ? 0.950   39.377  40.845  0.50 37.18 ? 143 ASN A CG  1 
ATOM   1111 C  CG  B ASN A 1 143 ? -0.622  37.985  42.219  0.50 38.08 ? 143 ASN A CG  1 
ATOM   1112 O  OD1 A ASN A 1 143 ? 1.507   39.647  39.784  0.50 42.64 ? 143 ASN A OD1 1 
ATOM   1113 O  OD1 B ASN A 1 143 ? -0.099  37.102  42.889  0.50 46.22 ? 143 ASN A OD1 1 
ATOM   1114 N  ND2 A ASN A 1 143 ? 1.235   40.000  41.978  0.50 39.39 ? 143 ASN A ND2 1 
ATOM   1115 N  ND2 B ASN A 1 143 ? -1.673  38.675  42.639  0.50 43.12 ? 143 ASN A ND2 1 
ATOM   1116 N  N   . TYR A 1 144 ? 1.739   35.249  39.805  1.00 24.20 ? 144 TYR A N   1 
ATOM   1117 C  CA  . TYR A 1 144 ? 2.910   34.429  40.136  1.00 23.54 ? 144 TYR A CA  1 
ATOM   1118 C  C   . TYR A 1 144 ? 3.113   33.394  39.024  1.00 24.37 ? 144 TYR A C   1 
ATOM   1119 O  O   . TYR A 1 144 ? 2.176   33.116  38.265  1.00 22.49 ? 144 TYR A O   1 
ATOM   1120 C  CB  . TYR A 1 144 ? 2.750   33.724  41.503  1.00 22.29 ? 144 TYR A CB  1 
ATOM   1121 C  CG  . TYR A 1 144 ? 1.412   33.087  41.772  1.00 24.27 ? 144 TYR A CG  1 
ATOM   1122 C  CD1 . TYR A 1 144 ? 1.073   31.851  41.220  1.00 22.14 ? 144 TYR A CD1 1 
ATOM   1123 C  CD2 . TYR A 1 144 ? 0.461   33.738  42.571  1.00 24.30 ? 144 TYR A CD2 1 
ATOM   1124 C  CE1 . TYR A 1 144 ? -0.181  31.280  41.450  1.00 25.43 ? 144 TYR A CE1 1 
ATOM   1125 C  CE2 . TYR A 1 144 ? -0.785  33.177  42.804  1.00 26.82 ? 144 TYR A CE2 1 
ATOM   1126 C  CZ  . TYR A 1 144 ? -1.106  31.955  42.241  1.00 25.27 ? 144 TYR A CZ  1 
ATOM   1127 O  OH  . TYR A 1 144 ? -2.364  31.451  42.427  1.00 25.77 ? 144 TYR A OH  1 
ATOM   1128 N  N   . PRO A 1 145 ? 4.336   32.845  38.886  1.00 23.81 ? 145 PRO A N   1 
ATOM   1129 C  CA  . PRO A 1 145 ? 4.585   31.839  37.836  1.00 22.38 ? 145 PRO A CA  1 
ATOM   1130 C  C   . PRO A 1 145 ? 3.666   30.672  38.155  1.00 20.14 ? 145 PRO A C   1 
ATOM   1131 O  O   . PRO A 1 145 ? 3.419   30.400  39.322  1.00 19.73 ? 145 PRO A O   1 
ATOM   1132 C  CB  . PRO A 1 145 ? 6.052   31.478  38.029  1.00 22.38 ? 145 PRO A CB  1 
ATOM   1133 C  CG  . PRO A 1 145 ? 6.627   32.700  38.648  1.00 28.85 ? 145 PRO A CG  1 
ATOM   1134 C  CD  . PRO A 1 145 ? 5.570   33.113  39.640  1.00 23.23 ? 145 PRO A CD  1 
ATOM   1135 N  N   . HIS A 1 146 ? 3.201   29.945  37.140  1.00 15.60 ? 146 HIS A N   1 
ATOM   1136 C  CA  . HIS A 1 146 ? 2.250   28.890  37.416  1.00 16.33 ? 146 HIS A CA  1 
ATOM   1137 C  C   . HIS A 1 146 ? 2.158   27.860  36.312  1.00 17.44 ? 146 HIS A C   1 
ATOM   1138 O  O   . HIS A 1 146 ? 2.572   28.115  35.188  1.00 16.07 ? 146 HIS A O   1 
ATOM   1139 C  CB  . HIS A 1 146 ? 0.851   29.514  37.543  1.00 16.08 ? 146 HIS A CB  1 
ATOM   1140 C  CG  . HIS A 1 146 ? 0.504   30.431  36.398  1.00 19.06 ? 146 HIS A CG  1 
ATOM   1141 N  ND1 . HIS A 1 146 ? 0.943   31.737  36.327  1.00 19.67 ? 146 HIS A ND1 1 
ATOM   1142 C  CD2 . HIS A 1 146 ? -0.207  30.217  35.260  1.00 17.36 ? 146 HIS A CD2 1 
ATOM   1143 C  CE1 . HIS A 1 146 ? 0.521   32.288  35.200  1.00 21.58 ? 146 HIS A CE1 1 
ATOM   1144 N  NE2 . HIS A 1 146 ? -0.178  31.387  34.533  1.00 18.58 ? 146 HIS A NE2 1 
ATOM   1145 N  N   . ILE A 1 147 ? 1.617   26.696  36.659  1.00 15.71 ? 147 ILE A N   1 
ATOM   1146 C  CA  . ILE A 1 147 ? 1.340   25.659  35.659  1.00 14.86 ? 147 ILE A CA  1 
ATOM   1147 C  C   . ILE A 1 147 ? -0.175  25.759  35.551  1.00 17.18 ? 147 ILE A C   1 
ATOM   1148 O  O   . ILE A 1 147 ? -0.857  25.885  36.565  1.00 18.58 ? 147 ILE A O   1 
ATOM   1149 C  CB  . ILE A 1 147 ? 1.738   24.267  36.161  1.00 16.07 ? 147 ILE A CB  1 
ATOM   1150 C  CG1 . ILE A 1 147 ? 3.258   24.214  36.290  1.00 21.23 ? 147 ILE A CG1 1 
ATOM   1151 C  CG2 . ILE A 1 147 ? 1.214   23.178  35.204  1.00 18.12 ? 147 ILE A CG2 1 
ATOM   1152 C  CD1 . ILE A 1 147 ? 3.788   22.986  36.991  1.00 22.50 ? 147 ILE A CD1 1 
ATOM   1153 N  N   . GLY A 1 148 ? -0.728  25.737  34.339  1.00 14.25 ? 148 GLY A N   1 
ATOM   1154 C  CA  . GLY A 1 148 ? -2.169  25.832  34.262  1.00 13.88 ? 148 GLY A CA  1 
ATOM   1155 C  C   . GLY A 1 148 ? -2.758  24.901  33.224  1.00 16.61 ? 148 GLY A C   1 
ATOM   1156 O  O   . GLY A 1 148 ? -2.064  24.464  32.307  1.00 16.24 ? 148 GLY A O   1 
ATOM   1157 N  N   . ILE A 1 149 ? -4.025  24.553  33.412  1.00 15.38 ? 149 ILE A N   1 
ATOM   1158 C  CA  . ILE A 1 149 ? -4.725  23.727  32.443  1.00 15.76 ? 149 ILE A CA  1 
ATOM   1159 C  C   . ILE A 1 149 ? -5.640  24.719  31.706  1.00 18.45 ? 149 ILE A C   1 
ATOM   1160 O  O   . ILE A 1 149 ? -6.425  25.419  32.334  1.00 18.28 ? 149 ILE A O   1 
ATOM   1161 C  CB  . ILE A 1 149 ? -5.521  22.611  33.155  1.00 17.41 ? 149 ILE A CB  1 
ATOM   1162 C  CG1 . ILE A 1 149 ? -4.516  21.583  33.731  1.00 15.98 ? 149 ILE A CG1 1 
ATOM   1163 C  CG2 . ILE A 1 149 ? -6.507  21.968  32.170  1.00 18.19 ? 149 ILE A CG2 1 
ATOM   1164 C  CD1 . ILE A 1 149 ? -5.110  20.545  34.702  1.00 19.85 ? 149 ILE A CD1 1 
ATOM   1165 N  N   . ASP A 1 150 ? -5.486  24.803  30.381  1.00 19.03 ? 150 ASP A N   1 
ATOM   1166 C  CA  . ASP A 1 150 ? -6.260  25.726  29.542  1.00 16.71 ? 150 ASP A CA  1 
ATOM   1167 C  C   . ASP A 1 150 ? -7.257  24.940  28.707  1.00 20.18 ? 150 ASP A C   1 
ATOM   1168 O  O   . ASP A 1 150 ? -6.878  24.024  27.987  1.00 20.34 ? 150 ASP A O   1 
ATOM   1169 C  CB  . ASP A 1 150 ? -5.334  26.490  28.591  1.00 15.76 ? 150 ASP A CB  1 
ATOM   1170 C  CG  . ASP A 1 150 ? -4.313  27.337  29.333  1.00 20.28 ? 150 ASP A CG  1 
ATOM   1171 O  OD1 . ASP A 1 150 ? -3.357  27.838  28.701  1.00 18.01 ? 150 ASP A OD1 1 
ATOM   1172 O  OD2 . ASP A 1 150 ? -4.496  27.495  30.550  1.00 20.11 ? 150 ASP A OD2 1 
ATOM   1173 N  N   . VAL A 1 151 ? -8.535  25.290  28.821  1.00 17.63 ? 151 VAL A N   1 
ATOM   1174 C  CA  . VAL A 1 151 ? -9.554  24.615  28.030  1.00 18.97 ? 151 VAL A CA  1 
ATOM   1175 C  C   . VAL A 1 151 ? -10.293 25.717  27.275  1.00 22.78 ? 151 VAL A C   1 
ATOM   1176 O  O   . VAL A 1 151 ? -11.123 26.416  27.853  1.00 21.92 ? 151 VAL A O   1 
ATOM   1177 C  CB  . VAL A 1 151 ? -10.548 23.825  28.912  1.00 20.70 ? 151 VAL A CB  1 
ATOM   1178 C  CG1 . VAL A 1 151 ? -11.626 23.220  28.047  1.00 21.88 ? 151 VAL A CG1 1 
ATOM   1179 C  CG2 . VAL A 1 151 ? -9.821  22.713  29.683  1.00 17.03 ? 151 VAL A CG2 1 
ATOM   1180 N  N   . ASN A 1 152 ? -9.928  25.886  26.007  1.00 19.99 ? 152 ASN A N   1 
ATOM   1181 C  CA  . ASN A 1 152 ? -10.522 26.883  25.111  1.00 24.68 ? 152 ASN A CA  1 
ATOM   1182 C  C   . ASN A 1 152 ? -10.319 28.346  25.492  1.00 25.52 ? 152 ASN A C   1 
ATOM   1183 O  O   . ASN A 1 152 ? -10.998 29.228  24.964  1.00 21.94 ? 152 ASN A O   1 
ATOM   1184 C  CB  . ASN A 1 152 ? -12.017 26.598  24.936  1.00 23.25 ? 152 ASN A CB  1 
ATOM   1185 C  CG  . ASN A 1 152 ? -12.265 25.305  24.191  1.00 30.52 ? 152 ASN A CG  1 
ATOM   1186 O  OD1 . ASN A 1 152 ? -11.441 24.891  23.379  1.00 24.62 ? 152 ASN A OD1 1 
ATOM   1187 N  ND2 . ASN A 1 152 ? -13.403 24.670  24.448  1.00 28.75 ? 152 ASN A ND2 1 
ATOM   1188 N  N   . SER A 1 153 ? -9.384  28.616  26.396  1.00 22.49 ? 153 SER A N   1 
ATOM   1189 C  CA  . SER A 1 153 ? -9.137  30.003  26.808  1.00 22.12 ? 153 SER A CA  1 
ATOM   1190 C  C   . SER A 1 153 ? -7.751  30.131  27.427  1.00 22.38 ? 153 SER A C   1 
ATOM   1191 O  O   . SER A 1 153 ? -7.267  29.184  28.041  1.00 22.51 ? 153 SER A O   1 
ATOM   1192 C  CB  . SER A 1 153 ? -10.183 30.437  27.836  1.00 24.28 ? 153 SER A CB  1 
ATOM   1193 O  OG  . SER A 1 153 ? -9.845  31.700  28.390  1.00 23.61 ? 153 SER A OG  1 
ATOM   1194 N  N   . ILE A 1 154 ? -7.124  31.296  27.263  1.00 20.59 ? 154 ILE A N   1 
ATOM   1195 C  CA  . ILE A 1 154 ? -5.802  31.541  27.838  1.00 21.03 ? 154 ILE A CA  1 
ATOM   1196 C  C   . ILE A 1 154 ? -5.951  31.742  29.354  1.00 19.94 ? 154 ILE A C   1 
ATOM   1197 O  O   . ILE A 1 154 ? -4.966  31.712  30.091  1.00 18.57 ? 154 ILE A O   1 
ATOM   1198 C  CB  . ILE A 1 154 ? -5.115  32.762  27.154  1.00 21.51 ? 154 ILE A CB  1 
ATOM   1199 C  CG1 . ILE A 1 154 ? -3.630  32.820  27.519  1.00 21.56 ? 154 ILE A CG1 1 
ATOM   1200 C  CG2 . ILE A 1 154 ? -5.823  34.062  27.549  1.00 23.49 ? 154 ILE A CG2 1 
ATOM   1201 C  CD1 . ILE A 1 154 ? -2.809  31.609  27.090  1.00 20.12 ? 154 ILE A CD1 1 
ATOM   1202 N  N   . ARG A 1 155 ? -7.184  31.928  29.820  1.00 20.17 ? 155 ARG A N   1 
ATOM   1203 C  CA  . ARG A 1 155 ? -7.426  32.080  31.256  1.00 20.08 ? 155 ARG A CA  1 
ATOM   1204 C  C   . ARG A 1 155 ? -7.674  30.662  31.747  1.00 18.67 ? 155 ARG A C   1 
ATOM   1205 O  O   . ARG A 1 155 ? -8.766  30.094  31.551  1.00 19.63 ? 155 ARG A O   1 
ATOM   1206 C  CB  . ARG A 1 155 ? -8.653  32.962  31.538  1.00 23.65 ? 155 ARG A CB  1 
ATOM   1207 C  CG  . ARG A 1 155 ? -8.959  33.111  33.044  1.00 28.24 ? 155 ARG A CG  1 
ATOM   1208 C  CD  . ARG A 1 155 ? -10.117 34.085  33.296  1.00 38.94 ? 155 ARG A CD  1 
ATOM   1209 N  N   . SER A 1 156 ? -6.648  30.095  32.372  1.00 17.40 ? 156 SER A N   1 
ATOM   1210 C  CA  . SER A 1 156 ? -6.671  28.718  32.858  1.00 17.79 ? 156 SER A CA  1 
ATOM   1211 C  C   . SER A 1 156 ? -7.856  28.412  33.755  1.00 22.48 ? 156 SER A C   1 
ATOM   1212 O  O   . SER A 1 156 ? -8.224  29.224  34.607  1.00 20.74 ? 156 SER A O   1 
ATOM   1213 C  CB  . SER A 1 156 ? -5.377  28.424  33.645  1.00 16.13 ? 156 SER A CB  1 
ATOM   1214 O  OG  . SER A 1 156 ? -4.203  28.627  32.864  1.00 15.16 ? 156 SER A OG  1 
ATOM   1215 N  N   . VAL A 1 157 ? -8.454  27.238  33.574  1.00 16.39 ? 157 VAL A N   1 
ATOM   1216 C  CA  . VAL A 1 157 ? -9.548  26.836  34.437  1.00 21.47 ? 157 VAL A CA  1 
ATOM   1217 C  C   . VAL A 1 157 ? -8.991  26.411  35.798  1.00 23.42 ? 157 VAL A C   1 
ATOM   1218 O  O   . VAL A 1 157 ? -9.705  26.422  36.804  1.00 21.71 ? 157 VAL A O   1 
ATOM   1219 C  CB  . VAL A 1 157 ? -10.356 25.675  33.833  1.00 23.87 ? 157 VAL A CB  1 
ATOM   1220 C  CG1 . VAL A 1 157 ? -10.953 26.130  32.519  1.00 25.65 ? 157 VAL A CG1 1 
ATOM   1221 C  CG2 . VAL A 1 157 ? -9.470  24.421  33.666  1.00 24.82 ? 157 VAL A CG2 1 
ATOM   1222 N  N   . LYS A 1 158 ? -7.709  26.052  35.839  1.00 20.73 ? 158 LYS A N   1 
ATOM   1223 C  CA  . LYS A 1 158 ? -7.090  25.640  37.102  1.00 21.11 ? 158 LYS A CA  1 
ATOM   1224 C  C   . LYS A 1 158 ? -5.587  25.901  37.036  1.00 23.37 ? 158 LYS A C   1 
ATOM   1225 O  O   . LYS A 1 158 ? -4.970  25.661  35.999  1.00 21.80 ? 158 LYS A O   1 
ATOM   1226 C  CB  . LYS A 1 158 ? -7.333  24.149  37.328  1.00 26.31 ? 158 LYS A CB  1 
ATOM   1227 C  CG  . LYS A 1 158 ? -7.041  23.627  38.736  1.00 36.69 ? 158 LYS A CG  1 
ATOM   1228 C  CD  . LYS A 1 158 ? -8.255  23.775  39.657  1.00 39.37 ? 158 LYS A CD  1 
ATOM   1229 N  N   . THR A 1 159 ? -4.996  26.396  38.123  1.00 19.17 ? 159 THR A N   1 
ATOM   1230 C  CA  . THR A 1 159 ? -3.551  26.648  38.127  1.00 18.70 ? 159 THR A CA  1 
ATOM   1231 C  C   . THR A 1 159 ? -2.923  26.235  39.454  1.00 22.29 ? 159 THR A C   1 
ATOM   1232 O  O   . THR A 1 159 ? -3.618  26.057  40.453  1.00 21.29 ? 159 THR A O   1 
ATOM   1233 C  CB  . THR A 1 159 ? -3.186  28.146  37.963  1.00 21.45 ? 159 THR A CB  1 
ATOM   1234 O  OG1 . THR A 1 159 ? -3.720  28.895  39.067  1.00 21.42 ? 159 THR A OG1 1 
ATOM   1235 C  CG2 . THR A 1 159 ? -3.712  28.712  36.654  1.00 22.68 ? 159 THR A CG2 1 
ATOM   1236 N  N   . VAL A 1 160 ? -1.604  26.066  39.451  1.00 17.40 ? 160 VAL A N   1 
ATOM   1237 C  CA  . VAL A 1 160 ? -0.891  25.791  40.697  1.00 19.83 ? 160 VAL A CA  1 
ATOM   1238 C  C   . VAL A 1 160 ? 0.362   26.667  40.641  1.00 21.77 ? 160 VAL A C   1 
ATOM   1239 O  O   . VAL A 1 160 ? 0.945   26.879  39.569  1.00 19.34 ? 160 VAL A O   1 
ATOM   1240 C  CB  . VAL A 1 160 ? -0.541  24.266  40.873  1.00 20.49 ? 160 VAL A CB  1 
ATOM   1241 C  CG1 . VAL A 1 160 ? 0.357   23.758  39.731  1.00 19.66 ? 160 VAL A CG1 1 
ATOM   1242 C  CG2 . VAL A 1 160 ? 0.153   24.049  42.207  1.00 27.72 ? 160 VAL A CG2 1 
ATOM   1243 N  N   . LYS A 1 161 ? 0.754   27.236  41.774  1.00 18.73 ? 161 LYS A N   1 
ATOM   1244 C  CA  . LYS A 1 161 ? 1.948   28.062  41.771  1.00 20.66 ? 161 LYS A CA  1 
ATOM   1245 C  C   . LYS A 1 161 ? 3.140   27.179  41.423  1.00 19.96 ? 161 LYS A C   1 
ATOM   1246 O  O   . LYS A 1 161 ? 3.250   26.044  41.888  1.00 20.92 ? 161 LYS A O   1 
ATOM   1247 C  CB  . LYS A 1 161 ? 2.180   28.696  43.141  1.00 23.84 ? 161 LYS A CB  1 
ATOM   1248 C  CG  . LYS A 1 161 ? 3.371   29.642  43.134  1.00 29.34 ? 161 LYS A CG  1 
ATOM   1249 C  CD  . LYS A 1 161 ? 3.820   29.998  44.525  1.00 38.81 ? 161 LYS A CD  1 
ATOM   1250 C  CE  . LYS A 1 161 ? 5.088   30.835  44.479  1.00 40.24 ? 161 LYS A CE  1 
ATOM   1251 N  NZ  . LYS A 1 161 ? 6.187   30.084  43.831  1.00 43.00 ? 161 LYS A NZ  1 
ATOM   1252 N  N   . TRP A 1 162 ? 4.045   27.721  40.625  1.00 18.39 ? 162 TRP A N   1 
ATOM   1253 C  CA  . TRP A 1 162 ? 5.213   26.990  40.177  1.00 18.67 ? 162 TRP A CA  1 
ATOM   1254 C  C   . TRP A 1 162 ? 6.470   27.867  40.258  1.00 23.47 ? 162 TRP A C   1 
ATOM   1255 O  O   . TRP A 1 162 ? 6.386   29.096  40.261  1.00 26.48 ? 162 TRP A O   1 
ATOM   1256 C  CB  . TRP A 1 162 ? 4.923   26.514  38.731  1.00 22.11 ? 162 TRP A CB  1 
ATOM   1257 C  CG  . TRP A 1 162 ? 6.062   25.916  37.978  1.00 21.29 ? 162 TRP A CG  1 
ATOM   1258 C  CD1 . TRP A 1 162 ? 6.786   24.796  38.309  1.00 22.52 ? 162 TRP A CD1 1 
ATOM   1259 C  CD2 . TRP A 1 162 ? 6.598   26.392  36.744  1.00 20.56 ? 162 TRP A CD2 1 
ATOM   1260 N  NE1 . TRP A 1 162 ? 7.744   24.554  37.348  1.00 18.36 ? 162 TRP A NE1 1 
ATOM   1261 C  CE2 . TRP A 1 162 ? 7.651   25.523  36.379  1.00 19.15 ? 162 TRP A CE2 1 
ATOM   1262 C  CE3 . TRP A 1 162 ? 6.285   27.475  35.900  1.00 21.38 ? 162 TRP A CE3 1 
ATOM   1263 C  CZ2 . TRP A 1 162 ? 8.405   25.700  35.204  1.00 22.28 ? 162 TRP A CZ2 1 
ATOM   1264 C  CZ3 . TRP A 1 162 ? 7.037   27.648  34.725  1.00 20.81 ? 162 TRP A CZ3 1 
ATOM   1265 C  CH2 . TRP A 1 162 ? 8.082   26.763  34.395  1.00 19.04 ? 162 TRP A CH2 1 
ATOM   1266 N  N   . ASP A 1 163 ? 7.634   27.229  40.353  1.00 21.68 ? 163 ASP A N   1 
ATOM   1267 C  CA  . ASP A 1 163 ? 8.899   27.946  40.419  1.00 24.15 ? 163 ASP A CA  1 
ATOM   1268 C  C   . ASP A 1 163 ? 9.698   27.719  39.150  1.00 22.93 ? 163 ASP A C   1 
ATOM   1269 O  O   . ASP A 1 163 ? 9.943   26.582  38.755  1.00 24.06 ? 163 ASP A O   1 
ATOM   1270 C  CB  . ASP A 1 163 ? 9.720   27.439  41.602  1.00 21.91 ? 163 ASP A CB  1 
ATOM   1271 C  CG  . ASP A 1 163 ? 8.920   27.419  42.881  1.00 31.15 ? 163 ASP A CG  1 
ATOM   1272 O  OD1 . ASP A 1 163 ? 8.518   28.514  43.333  1.00 33.07 ? 163 ASP A OD1 1 
ATOM   1273 O  OD2 . ASP A 1 163 ? 8.683   26.313  43.419  1.00 31.21 ? 163 ASP A OD2 1 
ATOM   1274 N  N   . ARG A 1 164 ? 10.103  28.798  38.514  1.00 19.69 ? 164 ARG A N   1 
ATOM   1275 C  CA  . ARG A 1 164 ? 10.912  28.686  37.311  1.00 21.16 ? 164 ARG A CA  1 
ATOM   1276 C  C   . ARG A 1 164 ? 12.359  28.537  37.791  1.00 24.09 ? 164 ARG A C   1 
ATOM   1277 O  O   . ARG A 1 164 ? 12.789  29.257  38.695  1.00 24.21 ? 164 ARG A O   1 
ATOM   1278 C  CB  . ARG A 1 164 ? 10.766  29.962  36.473  1.00 23.51 ? 164 ARG A CB  1 
ATOM   1279 C  CG  . ARG A 1 164 ? 11.657  30.033  35.247  1.00 22.88 ? 164 ARG A CG  1 
ATOM   1280 C  CD  . ARG A 1 164 ? 11.582  31.415  34.598  1.00 27.17 ? 164 ARG A CD  1 
ATOM   1281 N  NE  . ARG A 1 164 ? 12.346  31.495  33.351  1.00 27.41 ? 164 ARG A NE  1 
ATOM   1282 C  CZ  . ARG A 1 164 ? 13.673  31.468  33.264  1.00 27.92 ? 164 ARG A CZ  1 
ATOM   1283 N  NH1 . ARG A 1 164 ? 14.260  31.543  32.078  1.00 29.23 ? 164 ARG A NH1 1 
ATOM   1284 N  NH2 . ARG A 1 164 ? 14.425  31.394  34.355  1.00 33.08 ? 164 ARG A NH2 1 
ATOM   1285 N  N   . ARG A 1 165 ? 13.097  27.584  37.234  1.00 19.74 ? 165 ARG A N   1 
ATOM   1286 C  CA  . ARG A 1 165 ? 14.498  27.410  37.616  1.00 23.70 ? 165 ARG A CA  1 
ATOM   1287 C  C   . ARG A 1 165 ? 15.308  27.477  36.330  1.00 26.73 ? 165 ARG A C   1 
ATOM   1288 O  O   . ARG A 1 165 ? 15.244  26.576  35.502  1.00 23.94 ? 165 ARG A O   1 
ATOM   1289 C  CB  . ARG A 1 165 ? 14.710  26.060  38.302  1.00 24.11 ? 165 ARG A CB  1 
ATOM   1290 C  CG  . ARG A 1 165 ? 13.975  25.917  39.624  1.00 28.30 ? 165 ARG A CG  1 
ATOM   1291 C  CD  . ARG A 1 165 ? 14.459  24.686  40.377  1.00 27.71 ? 165 ARG A CD  1 
ATOM   1292 N  NE  . ARG A 1 165 ? 13.761  24.518  41.645  1.00 30.35 ? 165 ARG A NE  1 
ATOM   1293 C  CZ  . ARG A 1 165 ? 13.901  23.455  42.431  1.00 35.50 ? 165 ARG A CZ  1 
ATOM   1294 N  NH1 . ARG A 1 165 ? 13.227  23.379  43.577  1.00 34.37 ? 165 ARG A NH1 1 
ATOM   1295 N  NH2 . ARG A 1 165 ? 14.705  22.464  42.065  1.00 29.57 ? 165 ARG A NH2 1 
ATOM   1296 N  N   . ASP A 1 166 ? 16.066  28.554  36.157  1.00 26.52 ? 166 ASP A N   1 
ATOM   1297 C  CA  . ASP A 1 166 ? 16.859  28.725  34.946  1.00 27.75 ? 166 ASP A CA  1 
ATOM   1298 C  C   . ASP A 1 166 ? 17.802  27.551  34.654  1.00 27.21 ? 166 ASP A C   1 
ATOM   1299 O  O   . ASP A 1 166 ? 18.577  27.122  35.511  1.00 25.85 ? 166 ASP A O   1 
ATOM   1300 C  CB  . ASP A 1 166 ? 17.672  30.016  35.041  1.00 27.33 ? 166 ASP A CB  1 
ATOM   1301 C  CG  . ASP A 1 166 ? 18.123  30.511  33.694  1.00 32.49 ? 166 ASP A CG  1 
ATOM   1302 O  OD1 . ASP A 1 166 ? 17.306  31.137  32.994  1.00 31.92 ? 166 ASP A OD1 1 
ATOM   1303 O  OD2 . ASP A 1 166 ? 19.288  30.256  33.325  1.00 36.78 ? 166 ASP A OD2 1 
ATOM   1304 N  N   . GLY A 1 167 ? 17.720  27.020  33.439  1.00 27.40 ? 167 GLY A N   1 
ATOM   1305 C  CA  . GLY A 1 167 ? 18.599  25.927  33.061  1.00 27.24 ? 167 GLY A CA  1 
ATOM   1306 C  C   . GLY A 1 167 ? 18.352  24.544  33.627  1.00 30.92 ? 167 GLY A C   1 
ATOM   1307 O  O   . GLY A 1 167 ? 19.101  23.627  33.301  1.00 34.37 ? 167 GLY A O   1 
ATOM   1308 N  N   . GLN A 1 168 ? 17.337  24.360  34.467  1.00 27.99 ? 168 GLN A N   1 
ATOM   1309 C  CA  A GLN A 1 168 ? 17.062  23.041  35.022  0.50 27.96 ? 168 GLN A CA  1 
ATOM   1310 C  CA  B GLN A 1 168 ? 17.053  23.046  35.036  0.50 27.99 ? 168 GLN A CA  1 
ATOM   1311 C  C   . GLN A 1 168 ? 15.908  22.363  34.295  1.00 26.51 ? 168 GLN A C   1 
ATOM   1312 O  O   . GLN A 1 168 ? 14.872  22.975  34.041  1.00 23.69 ? 168 GLN A O   1 
ATOM   1313 C  CB  A GLN A 1 168 ? 16.744  23.142  36.511  0.50 31.51 ? 168 GLN A CB  1 
ATOM   1314 C  CB  B GLN A 1 168 ? 16.698  23.175  36.516  0.50 31.60 ? 168 GLN A CB  1 
ATOM   1315 C  CG  A GLN A 1 168 ? 17.944  23.512  37.361  0.50 36.96 ? 168 GLN A CG  1 
ATOM   1316 C  CG  B GLN A 1 168 ? 17.842  23.675  37.380  0.50 37.35 ? 168 GLN A CG  1 
ATOM   1317 C  CD  A GLN A 1 168 ? 17.629  23.482  38.838  0.50 39.54 ? 168 GLN A CD  1 
ATOM   1318 C  CD  B GLN A 1 168 ? 19.036  22.743  37.348  0.50 40.59 ? 168 GLN A CD  1 
ATOM   1319 O  OE1 A GLN A 1 168 ? 17.077  22.502  39.345  0.50 41.53 ? 168 GLN A OE1 1 
ATOM   1320 O  OE1 B GLN A 1 168 ? 18.912  21.552  37.631  0.50 44.44 ? 168 GLN A OE1 1 
ATOM   1321 N  NE2 A GLN A 1 168 ? 17.978  24.555  39.541  0.50 41.98 ? 168 GLN A NE2 1 
ATOM   1322 N  NE2 B GLN A 1 168 ? 20.201  23.282  37.007  0.50 42.33 ? 168 GLN A NE2 1 
ATOM   1323 N  N   . SER A 1 169 ? 16.092  21.092  33.962  1.00 21.06 ? 169 SER A N   1 
ATOM   1324 C  CA  A SER A 1 169 ? 15.055  20.339  33.249  0.50 19.40 ? 169 SER A CA  1 
ATOM   1325 C  CA  B SER A 1 169 ? 15.062  20.343  33.242  0.50 20.14 ? 169 SER A CA  1 
ATOM   1326 C  C   . SER A 1 169 ? 13.875  19.974  34.144  1.00 18.68 ? 169 SER A C   1 
ATOM   1327 O  O   . SER A 1 169 ? 14.056  19.512  35.273  1.00 19.93 ? 169 SER A O   1 
ATOM   1328 C  CB  A SER A 1 169 ? 15.649  19.054  32.673  0.50 19.72 ? 169 SER A CB  1 
ATOM   1329 C  CB  B SER A 1 169 ? 15.681  19.071  32.650  0.50 20.80 ? 169 SER A CB  1 
ATOM   1330 O  OG  A SER A 1 169 ? 16.692  19.344  31.771  0.50 16.01 ? 169 SER A OG  1 
ATOM   1331 O  OG  B SER A 1 169 ? 14.709  18.283  31.985  0.50 25.69 ? 169 SER A OG  1 
ATOM   1332 N  N   . LEU A 1 170 ? 12.656  20.167  33.640  1.00 16.13 ? 170 LEU A N   1 
ATOM   1333 C  CA  . LEU A 1 170 ? 11.463  19.824  34.415  1.00 14.73 ? 170 LEU A CA  1 
ATOM   1334 C  C   . LEU A 1 170 ? 10.877  18.610  33.714  1.00 17.63 ? 170 LEU A C   1 
ATOM   1335 O  O   . LEU A 1 170 ? 10.701  18.629  32.495  1.00 16.87 ? 170 LEU A O   1 
ATOM   1336 C  CB  . LEU A 1 170 ? 10.439  20.962  34.378  1.00 15.39 ? 170 LEU A CB  1 
ATOM   1337 C  CG  . LEU A 1 170 ? 9.156   20.704  35.161  1.00 18.62 ? 170 LEU A CG  1 
ATOM   1338 C  CD1 . LEU A 1 170 ? 9.429   20.804  36.655  1.00 19.82 ? 170 LEU A CD1 1 
ATOM   1339 C  CD2 . LEU A 1 170 ? 8.114   21.745  34.746  1.00 18.74 ? 170 LEU A CD2 1 
ATOM   1340 N  N   . ASN A 1 171 ? 10.614  17.554  34.471  1.00 17.19 ? 171 ASN A N   1 
ATOM   1341 C  CA  A ASN A 1 171 ? 10.042  16.337  33.907  0.50 19.37 ? 171 ASN A CA  1 
ATOM   1342 C  CA  B ASN A 1 171 ? 10.043  16.336  33.902  0.50 19.42 ? 171 ASN A CA  1 
ATOM   1343 C  C   . ASN A 1 171 ? 8.542   16.401  34.149  1.00 18.70 ? 171 ASN A C   1 
ATOM   1344 O  O   . ASN A 1 171 ? 8.107   16.627  35.267  1.00 19.89 ? 171 ASN A O   1 
ATOM   1345 C  CB  A ASN A 1 171 ? 10.642  15.108  34.590  0.50 22.85 ? 171 ASN A CB  1 
ATOM   1346 C  CB  B ASN A 1 171 ? 10.642  15.098  34.576  0.50 23.23 ? 171 ASN A CB  1 
ATOM   1347 C  CG  A ASN A 1 171 ? 12.137  14.991  34.367  0.50 33.35 ? 171 ASN A CG  1 
ATOM   1348 C  CG  B ASN A 1 171 ? 10.199  13.800  33.909  0.50 34.23 ? 171 ASN A CG  1 
ATOM   1349 O  OD1 A ASN A 1 171 ? 12.630  15.179  33.258  0.50 35.89 ? 171 ASN A OD1 1 
ATOM   1350 O  OD1 B ASN A 1 171 ? 10.186  13.692  32.681  0.50 40.12 ? 171 ASN A OD1 1 
ATOM   1351 N  ND2 A ASN A 1 171 ? 12.864  14.666  35.425  0.50 38.67 ? 171 ASN A ND2 1 
ATOM   1352 N  ND2 B ASN A 1 171 ? 9.849   12.805  34.717  0.50 39.61 ? 171 ASN A ND2 1 
ATOM   1353 N  N   . VAL A 1 172 ? 7.762   16.196  33.095  1.00 13.85 ? 172 VAL A N   1 
ATOM   1354 C  CA  . VAL A 1 172 ? 6.314   16.279  33.196  1.00 15.66 ? 172 VAL A CA  1 
ATOM   1355 C  C   . VAL A 1 172 ? 5.574   15.053  32.717  1.00 16.62 ? 172 VAL A C   1 
ATOM   1356 O  O   . VAL A 1 172 ? 5.946   14.467  31.696  1.00 15.34 ? 172 VAL A O   1 
ATOM   1357 C  CB  . VAL A 1 172 ? 5.792   17.459  32.341  1.00 14.46 ? 172 VAL A CB  1 
ATOM   1358 C  CG1 . VAL A 1 172 ? 4.292   17.687  32.628  1.00 17.86 ? 172 VAL A CG1 1 
ATOM   1359 C  CG2 . VAL A 1 172 ? 6.619   18.724  32.632  1.00 13.71 ? 172 VAL A CG2 1 
ATOM   1360 N  N   . LEU A 1 173 ? 4.532   14.672  33.457  1.00 13.63 ? 173 LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 173 ? 3.682   13.564  33.054  1.00 15.00 ? 173 LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 173 ? 2.263   14.140  32.987  1.00 17.91 ? 173 LEU A C   1 
ATOM   1363 O  O   . LEU A 1 173 ? 1.783   14.706  33.977  1.00 17.33 ? 173 LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 173 ? 3.708   12.450  34.097  1.00 17.43 ? 173 LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 173 ? 2.820   11.247  33.781  1.00 24.16 ? 173 LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 173 ? 3.390   10.558  32.538  1.00 28.70 ? 173 LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 173 ? 2.800   10.272  34.960  1.00 25.29 ? 173 LEU A CD2 1 
ATOM   1368 N  N   . VAL A 1 174 ? 1.617   14.024  31.828  1.00 14.18 ? 174 VAL A N   1 
ATOM   1369 C  CA  . VAL A 1 174 ? 0.232   14.497  31.665  1.00 14.62 ? 174 VAL A CA  1 
ATOM   1370 C  C   . VAL A 1 174 ? -0.568  13.249  31.318  1.00 16.68 ? 174 VAL A C   1 
ATOM   1371 O  O   . VAL A 1 174 ? -0.223  12.516  30.378  1.00 15.44 ? 174 VAL A O   1 
ATOM   1372 C  CB  . VAL A 1 174 ? 0.093   15.500  30.502  1.00 16.03 ? 174 VAL A CB  1 
ATOM   1373 C  CG1 . VAL A 1 174 ? -1.398  15.834  30.265  1.00 15.14 ? 174 VAL A CG1 1 
ATOM   1374 C  CG2 . VAL A 1 174 ? 0.890   16.746  30.797  1.00 17.32 ? 174 VAL A CG2 1 
ATOM   1375 N  N   . THR A 1 175 ? -1.630  12.985  32.064  1.00 14.25 ? 175 THR A N   1 
ATOM   1376 C  CA  A THR A 1 175 ? -2.435  11.796  31.821  0.50 16.76 ? 175 THR A CA  1 
ATOM   1377 C  CA  B THR A 1 175 ? -2.436  11.801  31.797  0.50 15.43 ? 175 THR A CA  1 
ATOM   1378 C  C   . THR A 1 175 ? -3.912  12.151  31.760  1.00 17.51 ? 175 THR A C   1 
ATOM   1379 O  O   . THR A 1 175 ? -4.358  13.051  32.453  1.00 19.04 ? 175 THR A O   1 
ATOM   1380 C  CB  A THR A 1 175 ? -2.282  10.769  32.962  0.50 20.97 ? 175 THR A CB  1 
ATOM   1381 C  CB  B THR A 1 175 ? -2.250  10.719  32.882  0.50 19.17 ? 175 THR A CB  1 
ATOM   1382 O  OG1 A THR A 1 175 ? -0.893  10.469  33.172  0.50 26.85 ? 175 THR A OG1 1 
ATOM   1383 O  OG1 B THR A 1 175 ? -2.521  11.279  34.172  0.50 14.69 ? 175 THR A OG1 1 
ATOM   1384 C  CG2 A THR A 1 175 ? -3.024  9.490   32.620  0.50 24.06 ? 175 THR A CG2 1 
ATOM   1385 C  CG2 B THR A 1 175 ? -0.821  10.175  32.865  0.50 23.72 ? 175 THR A CG2 1 
ATOM   1386 N  N   . PHE A 1 176 ? -4.657  11.440  30.929  1.00 17.75 ? 176 PHE A N   1 
ATOM   1387 C  CA  . PHE A 1 176 ? -6.090  11.673  30.864  1.00 18.15 ? 176 PHE A CA  1 
ATOM   1388 C  C   . PHE A 1 176 ? -6.724  10.306  31.034  1.00 18.83 ? 176 PHE A C   1 
ATOM   1389 O  O   . PHE A 1 176 ? -6.409  9.382   30.293  1.00 19.73 ? 176 PHE A O   1 
ATOM   1390 C  CB  . PHE A 1 176 ? -6.553  12.254  29.534  1.00 16.18 ? 176 PHE A CB  1 
ATOM   1391 C  CG  . PHE A 1 176 ? -8.046  12.400  29.467  1.00 17.53 ? 176 PHE A CG  1 
ATOM   1392 C  CD1 . PHE A 1 176 ? -8.692  13.379  30.220  1.00 19.01 ? 176 PHE A CD1 1 
ATOM   1393 C  CD2 . PHE A 1 176 ? -8.812  11.535  28.693  1.00 17.09 ? 176 PHE A CD2 1 
ATOM   1394 C  CE1 . PHE A 1 176 ? -10.098 13.502  30.203  1.00 22.40 ? 176 PHE A CE1 1 
ATOM   1395 C  CE2 . PHE A 1 176 ? -10.217 11.646  28.669  1.00 23.08 ? 176 PHE A CE2 1 
ATOM   1396 C  CZ  . PHE A 1 176 ? -10.855 12.627  29.420  1.00 19.89 ? 176 PHE A CZ  1 
ATOM   1397 N  N   . ASN A 1 177 ? -7.618  10.184  32.011  1.00 18.39 ? 177 ASN A N   1 
ATOM   1398 C  CA  . ASN A 1 177 ? -8.293  8.919   32.291  1.00 22.90 ? 177 ASN A CA  1 
ATOM   1399 C  C   . ASN A 1 177 ? -9.769  9.097   31.894  1.00 23.73 ? 177 ASN A C   1 
ATOM   1400 O  O   . ASN A 1 177 ? -10.487 9.885   32.509  1.00 20.34 ? 177 ASN A O   1 
ATOM   1401 C  CB  . ASN A 1 177 ? -8.156  8.630   33.780  1.00 22.63 ? 177 ASN A CB  1 
ATOM   1402 C  CG  . ASN A 1 177 ? -8.792  7.302   34.185  1.00 29.96 ? 177 ASN A CG  1 
ATOM   1403 O  OD1 . ASN A 1 177 ? -9.797  6.891   33.622  1.00 31.31 ? 177 ASN A OD1 1 
ATOM   1404 N  ND2 . ASN A 1 177 ? -8.204  6.641   35.176  1.00 30.27 ? 177 ASN A ND2 1 
ATOM   1405 N  N   . PRO A 1 178 ? -10.231 8.390   30.851  1.00 21.14 ? 178 PRO A N   1 
ATOM   1406 C  CA  . PRO A 1 178 ? -11.625 8.518   30.402  1.00 25.59 ? 178 PRO A CA  1 
ATOM   1407 C  C   . PRO A 1 178 ? -12.668 8.019   31.395  1.00 25.45 ? 178 PRO A C   1 
ATOM   1408 O  O   . PRO A 1 178 ? -13.828 8.445   31.368  1.00 27.77 ? 178 PRO A O   1 
ATOM   1409 C  CB  . PRO A 1 178 ? -11.639 7.726   29.090  1.00 23.95 ? 178 PRO A CB  1 
ATOM   1410 C  CG  . PRO A 1 178 ? -10.651 6.656   29.337  1.00 26.35 ? 178 PRO A CG  1 
ATOM   1411 C  CD  . PRO A 1 178 ? -9.510  7.379   30.050  1.00 23.62 ? 178 PRO A CD  1 
ATOM   1412 N  N   . SER A 1 179 ? -12.246 7.116   32.262  1.00 27.75 ? 179 SER A N   1 
ATOM   1413 C  CA  . SER A 1 179 ? -13.119 6.547   33.271  1.00 32.95 ? 179 SER A CA  1 
ATOM   1414 C  C   . SER A 1 179 ? -13.587 7.646   34.241  1.00 34.15 ? 179 SER A C   1 
ATOM   1415 O  O   . SER A 1 179 ? -14.777 7.755   34.548  1.00 33.10 ? 179 SER A O   1 
ATOM   1416 C  CB  . SER A 1 179 ? -12.351 5.450   34.020  1.00 34.98 ? 179 SER A CB  1 
ATOM   1417 O  OG  . SER A 1 179 ? -13.228 4.598   34.724  1.00 47.35 ? 179 SER A OG  1 
ATOM   1418 N  N   . THR A 1 180 ? -12.645 8.477   34.682  1.00 31.11 ? 180 THR A N   1 
ATOM   1419 C  CA  . THR A 1 180 ? -12.920 9.571   35.624  1.00 28.92 ? 180 THR A CA  1 
ATOM   1420 C  C   . THR A 1 180 ? -12.960 10.963  34.981  1.00 27.77 ? 180 THR A C   1 
ATOM   1421 O  O   . THR A 1 180 ? -13.375 11.934  35.616  1.00 26.29 ? 180 THR A O   1 
ATOM   1422 C  CB  . THR A 1 180 ? -11.842 9.595   36.701  1.00 31.31 ? 180 THR A CB  1 
ATOM   1423 O  OG1 . THR A 1 180 ? -10.558 9.756   36.074  1.00 25.40 ? 180 THR A OG1 1 
ATOM   1424 C  CG2 . THR A 1 180 ? -11.850 8.288   37.493  1.00 32.43 ? 180 THR A CG2 1 
ATOM   1425 N  N   . ARG A 1 181 ? -12.523 11.052  33.727  1.00 23.18 ? 181 ARG A N   1 
ATOM   1426 C  CA  . ARG A 1 181 ? -12.457 12.306  32.977  1.00 24.47 ? 181 ARG A CA  1 
ATOM   1427 C  C   . ARG A 1 181 ? -11.461 13.285  33.594  1.00 25.07 ? 181 ARG A C   1 
ATOM   1428 O  O   . ARG A 1 181 ? -11.533 14.495  33.360  1.00 24.27 ? 181 ARG A O   1 
ATOM   1429 C  CB  . ARG A 1 181 ? -13.835 12.970  32.885  1.00 31.14 ? 181 ARG A CB  1 
ATOM   1430 C  CG  . ARG A 1 181 ? -14.788 12.239  31.946  1.00 35.51 ? 181 ARG A CG  1 
ATOM   1431 C  CD  . ARG A 1 181 ? -16.143 12.918  31.883  1.00 44.00 ? 181 ARG A CD  1 
ATOM   1432 N  NE  . ARG A 1 181 ? -17.078 12.185  31.035  1.00 50.46 ? 181 ARG A NE  1 
ATOM   1433 N  N   . ASN A 1 182 ? -10.528 12.758  34.370  1.00 22.79 ? 182 ASN A N   1 
ATOM   1434 C  CA  A ASN A 1 182 ? -9.519  13.585  35.015  0.50 23.02 ? 182 ASN A CA  1 
ATOM   1435 C  CA  B ASN A 1 182 ? -9.531  13.587  35.013  0.50 23.07 ? 182 ASN A CA  1 
ATOM   1436 C  C   . ASN A 1 182 ? -8.265  13.746  34.175  1.00 22.23 ? 182 ASN A C   1 
ATOM   1437 O  O   . ASN A 1 182 ? -7.680  12.757  33.743  1.00 19.65 ? 182 ASN A O   1 
ATOM   1438 C  CB  A ASN A 1 182 ? -9.107  12.997  36.368  0.50 28.74 ? 182 ASN A CB  1 
ATOM   1439 C  CB  B ASN A 1 182 ? -9.177  12.992  36.374  0.50 29.24 ? 182 ASN A CB  1 
ATOM   1440 C  CG  A ASN A 1 182 ? -10.115 13.281  37.459  0.50 36.06 ? 182 ASN A CG  1 
ATOM   1441 C  CG  B ASN A 1 182 ? -8.235  13.868  37.159  0.50 36.23 ? 182 ASN A CG  1 
ATOM   1442 O  OD1 A ASN A 1 182 ? -10.807 14.295  37.427  0.50 38.33 ? 182 ASN A OD1 1 
ATOM   1443 O  OD1 B ASN A 1 182 ? -8.401  15.086  37.205  0.50 42.07 ? 182 ASN A OD1 1 
ATOM   1444 N  ND2 A ASN A 1 182 ? -10.188 12.393  38.443  0.50 36.91 ? 182 ASN A ND2 1 
ATOM   1445 N  ND2 B ASN A 1 182 ? -7.246  13.255  37.792  0.50 39.65 ? 182 ASN A ND2 1 
ATOM   1446 N  N   . LEU A 1 183 ? -7.881  14.998  33.928  1.00 15.09 ? 183 LEU A N   1 
ATOM   1447 C  CA  . LEU A 1 183 ? -6.660  15.304  33.183  1.00 18.61 ? 183 LEU A CA  1 
ATOM   1448 C  C   . LEU A 1 183 ? -5.737  15.667  34.342  1.00 17.93 ? 183 LEU A C   1 
ATOM   1449 O  O   . LEU A 1 183 ? -5.985  16.656  35.051  1.00 19.19 ? 183 LEU A O   1 
ATOM   1450 C  CB  . LEU A 1 183 ? -6.851  16.512  32.274  1.00 18.83 ? 183 LEU A CB  1 
ATOM   1451 C  CG  . LEU A 1 183 ? -5.613  17.046  31.538  1.00 22.52 ? 183 LEU A CG  1 
ATOM   1452 C  CD1 . LEU A 1 183 ? -5.125  16.026  30.549  1.00 27.25 ? 183 LEU A CD1 1 
ATOM   1453 C  CD2 . LEU A 1 183 ? -5.982  18.329  30.811  1.00 28.89 ? 183 LEU A CD2 1 
ATOM   1454 N  N   . ASP A 1 184 ? -4.696  14.869  34.555  1.00 15.80 ? 184 ASP A N   1 
ATOM   1455 C  CA  A ASP A 1 184 ? -3.749  15.085  35.653  0.50 16.58 ? 184 ASP A CA  1 
ATOM   1456 C  CA  B ASP A 1 184 ? -3.765  15.109  35.650  0.50 16.61 ? 184 ASP A CA  1 
ATOM   1457 C  C   . ASP A 1 184 ? -2.379  15.506  35.156  1.00 18.28 ? 184 ASP A C   1 
ATOM   1458 O  O   . ASP A 1 184 ? -1.895  14.991  34.143  1.00 17.06 ? 184 ASP A O   1 
ATOM   1459 C  CB  A ASP A 1 184 ? -3.574  13.804  36.477  0.50 24.00 ? 184 ASP A CB  1 
ATOM   1460 C  CB  B ASP A 1 184 ? -3.680  13.853  36.520  0.50 24.74 ? 184 ASP A CB  1 
ATOM   1461 C  CG  A ASP A 1 184 ? -4.847  13.370  37.167  0.50 31.50 ? 184 ASP A CG  1 
ATOM   1462 C  CG  B ASP A 1 184 ? -2.792  14.040  37.726  0.50 33.01 ? 184 ASP A CG  1 
ATOM   1463 O  OD1 A ASP A 1 184 ? -5.527  14.233  37.750  0.50 32.12 ? 184 ASP A OD1 1 
ATOM   1464 O  OD1 B ASP A 1 184 ? -2.867  15.112  38.368  0.50 37.48 ? 184 ASP A OD1 1 
ATOM   1465 O  OD2 A ASP A 1 184 ? -5.159  12.164  37.138  0.50 36.46 ? 184 ASP A OD2 1 
ATOM   1466 O  OD2 B ASP A 1 184 ? -2.026  13.107  38.041  0.50 39.08 ? 184 ASP A OD2 1 
ATOM   1467 N  N   . VAL A 1 185 ? -1.754  16.428  35.881  1.00 15.04 ? 185 VAL A N   1 
ATOM   1468 C  CA  . VAL A 1 185 ? -0.429  16.916  35.537  1.00 16.14 ? 185 VAL A CA  1 
ATOM   1469 C  C   . VAL A 1 185 ? 0.488   16.804  36.757  1.00 17.71 ? 185 VAL A C   1 
ATOM   1470 O  O   . VAL A 1 185 ? 0.149   17.284  37.842  1.00 18.85 ? 185 VAL A O   1 
ATOM   1471 C  CB  . VAL A 1 185 ? -0.453  18.399  35.130  1.00 16.40 ? 185 VAL A CB  1 
ATOM   1472 C  CG1 . VAL A 1 185 ? 0.949   18.845  34.763  1.00 17.67 ? 185 VAL A CG1 1 
ATOM   1473 C  CG2 . VAL A 1 185 ? -1.385  18.618  33.949  1.00 18.77 ? 185 VAL A CG2 1 
ATOM   1474 N  N   . VAL A 1 186 ? 1.635   16.159  36.577  1.00 17.07 ? 186 VAL A N   1 
ATOM   1475 C  CA  . VAL A 1 186 ? 2.629   16.015  37.646  1.00 14.83 ? 186 VAL A CA  1 
ATOM   1476 C  C   . VAL A 1 186 ? 3.954   16.485  37.037  1.00 17.88 ? 186 VAL A C   1 
ATOM   1477 O  O   . VAL A 1 186 ? 4.382   15.960  36.005  1.00 16.46 ? 186 VAL A O   1 
ATOM   1478 C  CB  . VAL A 1 186 ? 2.767   14.537  38.089  1.00 19.44 ? 186 VAL A CB  1 
ATOM   1479 C  CG1 . VAL A 1 186 ? 3.950   14.389  39.074  1.00 24.09 ? 186 VAL A CG1 1 
ATOM   1480 C  CG2 . VAL A 1 186 ? 1.464   14.067  38.738  1.00 25.20 ? 186 VAL A CG2 1 
ATOM   1481 N  N   . ALA A 1 187 ? 4.587   17.481  37.651  1.00 15.56 ? 187 ALA A N   1 
ATOM   1482 C  CA  . ALA A 1 187 ? 5.841   18.013  37.130  1.00 18.22 ? 187 ALA A CA  1 
ATOM   1483 C  C   . ALA A 1 187 ? 6.858   17.943  38.261  1.00 19.92 ? 187 ALA A C   1 
ATOM   1484 O  O   . ALA A 1 187 ? 6.550   18.295  39.404  1.00 16.31 ? 187 ALA A O   1 
ATOM   1485 C  CB  . ALA A 1 187 ? 5.659   19.449  36.687  1.00 16.70 ? 187 ALA A CB  1 
ATOM   1486 N  N   . THR A 1 188 ? 8.077   17.525  37.943  1.00 17.25 ? 188 THR A N   1 
ATOM   1487 C  CA  A THR A 1 188 ? 9.097   17.415  38.973  0.50 18.32 ? 188 THR A CA  1 
ATOM   1488 C  CA  B THR A 1 188 ? 9.107   17.368  38.959  0.50 18.49 ? 188 THR A CA  1 
ATOM   1489 C  C   . THR A 1 188 ? 10.485  17.841  38.518  1.00 20.83 ? 188 THR A C   1 
ATOM   1490 O  O   . THR A 1 188 ? 10.874  17.633  37.364  1.00 18.81 ? 188 THR A O   1 
ATOM   1491 C  CB  A THR A 1 188 ? 9.209   15.969  39.487  0.50 22.77 ? 188 THR A CB  1 
ATOM   1492 C  CB  B THR A 1 188 ? 9.274   15.878  39.329  0.50 22.48 ? 188 THR A CB  1 
ATOM   1493 O  OG1 A THR A 1 188 ? 9.637   15.122  38.418  0.50 19.02 ? 188 THR A OG1 1 
ATOM   1494 O  OG1 B THR A 1 188 ? 7.994   15.292  39.605  0.50 24.14 ? 188 THR A OG1 1 
ATOM   1495 C  CG2 A THR A 1 188 ? 7.863   15.470  40.012  0.50 23.30 ? 188 THR A CG2 1 
ATOM   1496 C  CG2 B THR A 1 188 ? 10.177  15.731  40.545  0.50 19.46 ? 188 THR A CG2 1 
ATOM   1497 N  N   . TYR A 1 189 ? 11.228  18.457  39.438  1.00 18.34 ? 189 TYR A N   1 
ATOM   1498 C  CA  . TYR A 1 189 ? 12.598  18.848  39.126  1.00 17.20 ? 189 TYR A CA  1 
ATOM   1499 C  C   . TYR A 1 189 ? 13.424  17.662  39.645  1.00 21.37 ? 189 TYR A C   1 
ATOM   1500 O  O   . TYR A 1 189 ? 12.925  16.847  40.436  1.00 20.08 ? 189 TYR A O   1 
ATOM   1501 C  CB  . TYR A 1 189 ? 13.010  20.125  39.853  1.00 20.61 ? 189 TYR A CB  1 
ATOM   1502 C  CG  . TYR A 1 189 ? 12.507  21.357  39.168  1.00 18.54 ? 189 TYR A CG  1 
ATOM   1503 C  CD1 . TYR A 1 189 ? 11.551  22.173  39.780  1.00 18.10 ? 189 TYR A CD1 1 
ATOM   1504 C  CD2 . TYR A 1 189 ? 12.988  21.721  37.907  1.00 21.44 ? 189 TYR A CD2 1 
ATOM   1505 C  CE1 . TYR A 1 189 ? 11.095  23.309  39.166  1.00 15.89 ? 189 TYR A CE1 1 
ATOM   1506 C  CE2 . TYR A 1 189 ? 12.539  22.870  37.274  1.00 18.65 ? 189 TYR A CE2 1 
ATOM   1507 C  CZ  . TYR A 1 189 ? 11.593  23.660  37.911  1.00 18.81 ? 189 TYR A CZ  1 
ATOM   1508 O  OH  . TYR A 1 189 ? 11.140  24.793  37.310  1.00 21.67 ? 189 TYR A OH  1 
ATOM   1509 N  N   . SER A 1 190 ? 14.688  17.579  39.236  1.00 23.77 ? 190 SER A N   1 
ATOM   1510 C  CA  . SER A 1 190 ? 15.524  16.445  39.631  1.00 30.22 ? 190 SER A CA  1 
ATOM   1511 C  C   . SER A 1 190 ? 15.733  16.264  41.127  1.00 29.51 ? 190 SER A C   1 
ATOM   1512 O  O   . SER A 1 190 ? 16.059  15.163  41.565  1.00 29.17 ? 190 SER A O   1 
ATOM   1513 C  CB  . SER A 1 190 ? 16.890  16.508  38.943  1.00 30.49 ? 190 SER A CB  1 
ATOM   1514 O  OG  . SER A 1 190 ? 17.653  17.592  39.434  1.00 35.92 ? 190 SER A OG  1 
ATOM   1515 N  N   . ASP A 1 191 ? 15.540  17.324  41.905  1.00 25.55 ? 191 ASP A N   1 
ATOM   1516 C  CA  . ASP A 1 191 ? 15.730  17.219  43.346  1.00 24.33 ? 191 ASP A CA  1 
ATOM   1517 C  C   . ASP A 1 191 ? 14.504  16.677  44.064  1.00 26.14 ? 191 ASP A C   1 
ATOM   1518 O  O   . ASP A 1 191 ? 14.510  16.511  45.281  1.00 28.99 ? 191 ASP A O   1 
ATOM   1519 C  CB  . ASP A 1 191 ? 16.154  18.572  43.934  1.00 23.66 ? 191 ASP A CB  1 
ATOM   1520 C  CG  . ASP A 1 191 ? 15.086  19.644  43.815  1.00 30.13 ? 191 ASP A CG  1 
ATOM   1521 O  OD1 . ASP A 1 191 ? 13.974  19.348  43.337  1.00 23.46 ? 191 ASP A OD1 1 
ATOM   1522 O  OD2 . ASP A 1 191 ? 15.373  20.794  44.201  1.00 31.66 ? 191 ASP A OD2 1 
ATOM   1523 N  N   . GLY A 1 192 ? 13.461  16.367  43.301  1.00 21.78 ? 192 GLY A N   1 
ATOM   1524 C  CA  . GLY A 1 192 ? 12.244  15.837  43.880  1.00 20.95 ? 192 GLY A CA  1 
ATOM   1525 C  C   . GLY A 1 192 ? 11.129  16.856  44.099  1.00 21.44 ? 192 GLY A C   1 
ATOM   1526 O  O   . GLY A 1 192 ? 10.026  16.478  44.511  1.00 20.70 ? 192 GLY A O   1 
ATOM   1527 N  N   . THR A 1 193 ? 11.387  18.134  43.835  1.00 20.47 ? 193 THR A N   1 
ATOM   1528 C  CA  . THR A 1 193 ? 10.351  19.149  44.031  1.00 19.86 ? 193 THR A CA  1 
ATOM   1529 C  C   . THR A 1 193 ? 9.259   18.837  43.032  1.00 22.45 ? 193 THR A C   1 
ATOM   1530 O  O   . THR A 1 193 ? 9.517   18.744  41.827  1.00 19.91 ? 193 THR A O   1 
ATOM   1531 C  CB  . THR A 1 193 ? 10.907  20.542  43.804  1.00 24.61 ? 193 THR A CB  1 
ATOM   1532 O  OG1 . THR A 1 193 ? 12.009  20.745  44.705  1.00 25.16 ? 193 THR A OG1 1 
ATOM   1533 C  CG2 . THR A 1 193 ? 9.825   21.600  44.091  1.00 21.34 ? 193 THR A CG2 1 
ATOM   1534 N  N   . ARG A 1 194 ? 8.037   18.715  43.531  1.00 18.03 ? 194 ARG A N   1 
ATOM   1535 C  CA  . ARG A 1 194 ? 6.921   18.287  42.709  1.00 19.68 ? 194 ARG A CA  1 
ATOM   1536 C  C   . ARG A 1 194 ? 5.738   19.252  42.692  1.00 22.28 ? 194 ARG A C   1 
ATOM   1537 O  O   . ARG A 1 194 ? 5.461   19.942  43.674  1.00 20.03 ? 194 ARG A O   1 
ATOM   1538 C  CB  . ARG A 1 194 ? 6.504   16.921  43.252  1.00 21.66 ? 194 ARG A CB  1 
ATOM   1539 C  CG  . ARG A 1 194 ? 5.323   16.212  42.632  1.00 27.18 ? 194 ARG A CG  1 
ATOM   1540 C  CD  . ARG A 1 194 ? 5.041   14.988  43.523  1.00 34.27 ? 194 ARG A CD  1 
ATOM   1541 N  NE  . ARG A 1 194 ? 4.059   14.052  42.989  1.00 39.65 ? 194 ARG A NE  1 
ATOM   1542 C  CZ  . ARG A 1 194 ? 4.376   12.949  42.318  1.00 42.27 ? 194 ARG A CZ  1 
ATOM   1543 N  NH1 . ARG A 1 194 ? 5.653   12.644  42.098  1.00 45.14 ? 194 ARG A NH1 1 
ATOM   1544 N  NH2 . ARG A 1 194 ? 3.418   12.148  41.878  1.00 44.94 ? 194 ARG A NH2 1 
ATOM   1545 N  N   . TYR A 1 195 ? 5.064   19.319  41.551  1.00 17.92 ? 195 TYR A N   1 
ATOM   1546 C  CA  . TYR A 1 195 ? 3.891   20.179  41.408  1.00 20.10 ? 195 TYR A CA  1 
ATOM   1547 C  C   . TYR A 1 195 ? 2.799   19.338  40.766  1.00 19.15 ? 195 TYR A C   1 
ATOM   1548 O  O   . TYR A 1 195 ? 3.071   18.546  39.851  1.00 20.38 ? 195 TYR A O   1 
ATOM   1549 C  CB  . TYR A 1 195 ? 4.185   21.376  40.504  1.00 16.15 ? 195 TYR A CB  1 
ATOM   1550 C  CG  . TYR A 1 195 ? 5.424   22.121  40.882  1.00 20.90 ? 195 TYR A CG  1 
ATOM   1551 C  CD1 . TYR A 1 195 ? 6.677   21.689  40.442  1.00 18.58 ? 195 TYR A CD1 1 
ATOM   1552 C  CD2 . TYR A 1 195 ? 5.359   23.250  41.698  1.00 21.75 ? 195 TYR A CD2 1 
ATOM   1553 C  CE1 . TYR A 1 195 ? 7.828   22.367  40.801  1.00 22.23 ? 195 TYR A CE1 1 
ATOM   1554 C  CE2 . TYR A 1 195 ? 6.518   23.936  42.063  1.00 20.27 ? 195 TYR A CE2 1 
ATOM   1555 C  CZ  . TYR A 1 195 ? 7.744   23.487  41.605  1.00 21.97 ? 195 TYR A CZ  1 
ATOM   1556 O  OH  . TYR A 1 195 ? 8.896   24.177  41.924  1.00 21.79 ? 195 TYR A OH  1 
ATOM   1557 N  N   . GLU A 1 196 ? 1.561   19.510  41.218  1.00 17.52 ? 196 GLU A N   1 
ATOM   1558 C  CA  . GLU A 1 196 ? 0.488   18.719  40.644  1.00 18.57 ? 196 GLU A CA  1 
ATOM   1559 C  C   . GLU A 1 196 ? -0.728  19.576  40.437  1.00 21.15 ? 196 GLU A C   1 
ATOM   1560 O  O   . GLU A 1 196 ? -1.014  20.439  41.258  1.00 17.87 ? 196 GLU A O   1 
ATOM   1561 C  CB  . GLU A 1 196 ? 0.100   17.592  41.583  1.00 22.10 ? 196 GLU A CB  1 
ATOM   1562 C  CG  . GLU A 1 196 ? 1.255   16.737  42.040  1.00 31.16 ? 196 GLU A CG  1 
ATOM   1563 C  CD  . GLU A 1 196 ? 0.791   15.576  42.897  1.00 40.20 ? 196 GLU A CD  1 
ATOM   1564 O  OE1 . GLU A 1 196 ? 1.641   14.923  43.533  1.00 43.98 ? 196 GLU A OE1 1 
ATOM   1565 O  OE2 . GLU A 1 196 ? -0.432  15.312  42.922  1.00 44.79 ? 196 GLU A OE2 1 
ATOM   1566 N  N   . VAL A 1 197 ? -1.436  19.346  39.335  1.00 16.66 ? 197 VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 197 ? -2.673  20.083  39.083  1.00 19.61 ? 197 VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 197 ? -3.555  19.159  38.250  1.00 20.87 ? 197 VAL A C   1 
ATOM   1569 O  O   . VAL A 1 197 ? -3.073  18.401  37.398  1.00 18.39 ? 197 VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 197 ? -2.432  21.454  38.364  1.00 22.44 ? 197 VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 197 ? -1.818  21.268  36.982  1.00 22.35 ? 197 VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 197 ? -3.766  22.210  38.237  1.00 24.03 ? 197 VAL A CG2 1 
ATOM   1573 N  N   . SER A 1 198 ? -4.847  19.160  38.535  1.00 18.93 ? 198 SER A N   1 
ATOM   1574 C  CA  . SER A 1 198 ? -5.735  18.302  37.770  1.00 18.75 ? 198 SER A CA  1 
ATOM   1575 C  C   . SER A 1 198 ? -7.069  18.984  37.551  1.00 23.69 ? 198 SER A C   1 
ATOM   1576 O  O   . SER A 1 198 ? -7.437  19.925  38.261  1.00 20.05 ? 198 SER A O   1 
ATOM   1577 C  CB  . SER A 1 198 ? -5.939  16.964  38.475  1.00 22.38 ? 198 SER A CB  1 
ATOM   1578 O  OG  . SER A 1 198 ? -6.586  17.151  39.702  1.00 34.91 ? 198 SER A OG  1 
ATOM   1579 N  N   . TYR A 1 199 ? -7.796  18.499  36.562  1.00 17.18 ? 199 TYR A N   1 
ATOM   1580 C  CA  . TYR A 1 199 ? -9.093  19.082  36.246  1.00 19.93 ? 199 TYR A CA  1 
ATOM   1581 C  C   . TYR A 1 199 ? -9.948  18.029  35.564  1.00 22.93 ? 199 TYR A C   1 
ATOM   1582 O  O   . TYR A 1 199 ? -9.432  17.190  34.828  1.00 20.40 ? 199 TYR A O   1 
ATOM   1583 C  CB  . TYR A 1 199 ? -8.880  20.271  35.320  1.00 23.38 ? 199 TYR A CB  1 
ATOM   1584 C  CG  . TYR A 1 199 ? -10.152 20.999  34.941  1.00 28.63 ? 199 TYR A CG  1 
ATOM   1585 C  CD1 . TYR A 1 199 ? -10.694 20.862  33.668  1.00 32.51 ? 199 TYR A CD1 1 
ATOM   1586 C  CD2 . TYR A 1 199 ? -10.782 21.852  35.839  1.00 34.21 ? 199 TYR A CD2 1 
ATOM   1587 C  CE1 . TYR A 1 199 ? -11.822 21.563  33.289  1.00 38.16 ? 199 TYR A CE1 1 
ATOM   1588 C  CE2 . TYR A 1 199 ? -11.927 22.564  35.471  1.00 36.23 ? 199 TYR A CE2 1 
ATOM   1589 C  CZ  . TYR A 1 199 ? -12.433 22.417  34.193  1.00 37.21 ? 199 TYR A CZ  1 
ATOM   1590 O  OH  . TYR A 1 199 ? -13.520 23.149  33.778  1.00 46.10 ? 199 TYR A OH  1 
ATOM   1591 N  N   . GLU A 1 200 ? -11.253 18.072  35.810  1.00 21.95 ? 200 GLU A N   1 
ATOM   1592 C  CA  . GLU A 1 200 ? -12.154 17.117  35.192  1.00 24.19 ? 200 GLU A CA  1 
ATOM   1593 C  C   . GLU A 1 200 ? -12.673 17.741  33.901  1.00 26.17 ? 200 GLU A C   1 
ATOM   1594 O  O   . GLU A 1 200 ? -13.213 18.845  33.916  1.00 27.37 ? 200 GLU A O   1 
ATOM   1595 C  CB  . GLU A 1 200 ? -13.318 16.813  36.133  1.00 27.78 ? 200 GLU A CB  1 
ATOM   1596 C  CG  . GLU A 1 200 ? -14.230 15.725  35.610  1.00 37.37 ? 200 GLU A CG  1 
ATOM   1597 C  CD  . GLU A 1 200 ? -15.416 15.465  36.523  1.00 41.40 ? 200 GLU A CD  1 
ATOM   1598 O  OE1 . GLU A 1 200 ? -15.211 15.278  37.740  1.00 42.58 ? 200 GLU A OE1 1 
ATOM   1599 O  OE2 . GLU A 1 200 ? -16.553 15.437  36.009  1.00 49.50 ? 200 GLU A OE2 1 
ATOM   1600 N  N   . VAL A 1 201 ? -12.515 17.041  32.784  1.00 26.94 ? 201 VAL A N   1 
ATOM   1601 C  CA  . VAL A 1 201 ? -12.963 17.573  31.512  1.00 28.05 ? 201 VAL A CA  1 
ATOM   1602 C  C   . VAL A 1 201 ? -13.416 16.471  30.562  1.00 30.57 ? 201 VAL A C   1 
ATOM   1603 O  O   . VAL A 1 201 ? -12.754 15.439  30.421  1.00 26.01 ? 201 VAL A O   1 
ATOM   1604 C  CB  . VAL A 1 201 ? -11.845 18.369  30.829  1.00 30.68 ? 201 VAL A CB  1 
ATOM   1605 C  CG1 . VAL A 1 201 ? -10.639 17.475  30.616  1.00 32.11 ? 201 VAL A CG1 1 
ATOM   1606 C  CG2 . VAL A 1 201 ? -12.330 18.919  29.496  1.00 32.72 ? 201 VAL A CG2 1 
ATOM   1607 N  N   . ASP A 1 202 ? -14.549 16.699  29.910  1.00 29.19 ? 202 ASP A N   1 
ATOM   1608 C  CA  . ASP A 1 202 ? -15.078 15.734  28.951  1.00 28.91 ? 202 ASP A CA  1 
ATOM   1609 C  C   . ASP A 1 202 ? -14.493 16.149  27.611  1.00 25.88 ? 202 ASP A C   1 
ATOM   1610 O  O   . ASP A 1 202 ? -14.976 17.091  26.965  1.00 22.84 ? 202 ASP A O   1 
ATOM   1611 C  CB  . ASP A 1 202 ? -16.595 15.817  28.898  1.00 32.86 ? 202 ASP A CB  1 
ATOM   1612 C  CG  . ASP A 1 202 ? -17.201 14.701  28.079  1.00 39.76 ? 202 ASP A CG  1 
ATOM   1613 O  OD1 . ASP A 1 202 ? -16.491 14.140  27.212  1.00 33.95 ? 202 ASP A OD1 1 
ATOM   1614 O  OD2 . ASP A 1 202 ? -18.388 14.391  28.300  1.00 44.33 ? 202 ASP A OD2 1 
ATOM   1615 N  N   . VAL A 1 203 ? -13.437 15.464  27.186  1.00 24.11 ? 203 VAL A N   1 
ATOM   1616 C  CA  . VAL A 1 203 ? -12.800 15.855  25.937  1.00 24.03 ? 203 VAL A CA  1 
ATOM   1617 C  C   . VAL A 1 203 ? -13.738 15.789  24.744  1.00 22.49 ? 203 VAL A C   1 
ATOM   1618 O  O   . VAL A 1 203 ? -13.555 16.515  23.766  1.00 26.22 ? 203 VAL A O   1 
ATOM   1619 C  CB  . VAL A 1 203 ? -11.533 15.009  25.667  1.00 24.58 ? 203 VAL A CB  1 
ATOM   1620 C  CG1 . VAL A 1 203 ? -10.574 15.132  26.855  1.00 27.04 ? 203 VAL A CG1 1 
ATOM   1621 C  CG2 . VAL A 1 203 ? -11.912 13.564  25.428  1.00 25.74 ? 203 VAL A CG2 1 
ATOM   1622 N  N   . ARG A 1 204 ? -14.747 14.932  24.810  1.00 24.09 ? 204 ARG A N   1 
ATOM   1623 C  CA  . ARG A 1 204 ? -15.692 14.821  23.693  1.00 30.47 ? 204 ARG A CA  1 
ATOM   1624 C  C   . ARG A 1 204 ? -16.447 16.102  23.380  1.00 30.31 ? 204 ARG A C   1 
ATOM   1625 O  O   . ARG A 1 204 ? -16.867 16.311  22.241  1.00 31.26 ? 204 ARG A O   1 
ATOM   1626 C  CB  . ARG A 1 204 ? -16.715 13.723  23.954  1.00 30.82 ? 204 ARG A CB  1 
ATOM   1627 C  CG  . ARG A 1 204 ? -16.114 12.348  24.023  1.00 37.40 ? 204 ARG A CG  1 
ATOM   1628 C  CD  . ARG A 1 204 ? -17.169 11.367  24.443  1.00 42.32 ? 204 ARG A CD  1 
ATOM   1629 N  NE  . ARG A 1 204 ? -17.836 11.821  25.658  1.00 46.11 ? 204 ARG A NE  1 
ATOM   1630 C  CZ  . ARG A 1 204 ? -18.817 11.156  26.252  1.00 50.33 ? 204 ARG A CZ  1 
ATOM   1631 N  NH1 . ARG A 1 204 ? -19.233 10.006  25.736  1.00 50.60 ? 204 ARG A NH1 1 
ATOM   1632 N  NH2 . ARG A 1 204 ? -19.389 11.643  27.347  1.00 50.71 ? 204 ARG A NH2 1 
ATOM   1633 N  N   . SER A 1 205 ? -16.634 16.955  24.380  1.00 28.57 ? 205 SER A N   1 
ATOM   1634 C  CA  . SER A 1 205 ? -17.365 18.192  24.149  1.00 33.65 ? 205 SER A CA  1 
ATOM   1635 C  C   . SER A 1 205 ? -16.476 19.375  23.812  1.00 33.55 ? 205 SER A C   1 
ATOM   1636 O  O   . SER A 1 205 ? -16.970 20.476  23.595  1.00 36.62 ? 205 SER A O   1 
ATOM   1637 C  CB  . SER A 1 205 ? -18.223 18.527  25.367  1.00 36.14 ? 205 SER A CB  1 
ATOM   1638 O  OG  . SER A 1 205 ? -17.406 18.731  26.505  1.00 44.50 ? 205 SER A OG  1 
ATOM   1639 N  N   . VAL A 1 206 ? -15.167 19.151  23.753  1.00 28.72 ? 206 VAL A N   1 
ATOM   1640 C  CA  . VAL A 1 206 ? -14.227 20.223  23.458  1.00 26.21 ? 206 VAL A CA  1 
ATOM   1641 C  C   . VAL A 1 206 ? -13.477 20.039  22.156  1.00 25.73 ? 206 VAL A C   1 
ATOM   1642 O  O   . VAL A 1 206 ? -13.206 21.003  21.448  1.00 28.09 ? 206 VAL A O   1 
ATOM   1643 C  CB  . VAL A 1 206 ? -13.173 20.349  24.600  1.00 27.78 ? 206 VAL A CB  1 
ATOM   1644 C  CG1 . VAL A 1 206 ? -12.077 21.345  24.209  1.00 31.84 ? 206 VAL A CG1 1 
ATOM   1645 C  CG2 . VAL A 1 206 ? -13.861 20.782  25.875  1.00 30.72 ? 206 VAL A CG2 1 
ATOM   1646 N  N   . LEU A 1 207 ? -13.123 18.795  21.848  1.00 22.67 ? 207 LEU A N   1 
ATOM   1647 C  CA  . LEU A 1 207 ? -12.347 18.509  20.647  1.00 22.93 ? 207 LEU A CA  1 
ATOM   1648 C  C   . LEU A 1 207 ? -13.013 17.511  19.708  1.00 21.41 ? 207 LEU A C   1 
ATOM   1649 O  O   . LEU A 1 207 ? -13.890 16.754  20.112  1.00 22.49 ? 207 LEU A O   1 
ATOM   1650 C  CB  . LEU A 1 207 ? -10.977 17.939  21.049  1.00 20.98 ? 207 LEU A CB  1 
ATOM   1651 C  CG  . LEU A 1 207 ? -10.066 18.840  21.899  1.00 24.89 ? 207 LEU A CG  1 
ATOM   1652 C  CD1 . LEU A 1 207 ? -8.990  17.997  22.579  1.00 23.23 ? 207 LEU A CD1 1 
ATOM   1653 C  CD2 . LEU A 1 207 ? -9.451  19.906  21.016  1.00 22.31 ? 207 LEU A CD2 1 
ATOM   1654 N  N   . PRO A 1 208 ? -12.597 17.511  18.440  1.00 21.25 ? 208 PRO A N   1 
ATOM   1655 C  CA  . PRO A 1 208 ? -13.141 16.588  17.440  1.00 24.06 ? 208 PRO A CA  1 
ATOM   1656 C  C   . PRO A 1 208 ? -12.577 15.182  17.719  1.00 25.01 ? 208 PRO A C   1 
ATOM   1657 O  O   . PRO A 1 208 ? -11.678 15.019  18.552  1.00 19.71 ? 208 PRO A O   1 
ATOM   1658 C  CB  . PRO A 1 208 ? -12.639 17.171  16.117  1.00 23.55 ? 208 PRO A CB  1 
ATOM   1659 C  CG  . PRO A 1 208 ? -11.340 17.843  16.507  1.00 26.30 ? 208 PRO A CG  1 
ATOM   1660 C  CD  . PRO A 1 208 ? -11.675 18.488  17.828  1.00 24.78 ? 208 PRO A CD  1 
ATOM   1661 N  N   . GLU A 1 209 ? -13.084 14.174  17.013  1.00 21.95 ? 209 GLU A N   1 
ATOM   1662 C  CA  . GLU A 1 209 ? -12.637 12.800  17.216  1.00 22.19 ? 209 GLU A CA  1 
ATOM   1663 C  C   . GLU A 1 209 ? -11.163 12.578  16.898  1.00 20.88 ? 209 GLU A C   1 
ATOM   1664 O  O   . GLU A 1 209 ? -10.508 11.770  17.554  1.00 19.67 ? 209 GLU A O   1 
ATOM   1665 C  CB  . GLU A 1 209 ? -13.485 11.842  16.374  1.00 25.56 ? 209 GLU A CB  1 
ATOM   1666 C  CG  . GLU A 1 209 ? -14.947 11.844  16.764  1.00 31.99 ? 209 GLU A CG  1 
ATOM   1667 C  CD  . GLU A 1 209 ? -15.790 10.971  15.853  1.00 39.02 ? 209 GLU A CD  1 
ATOM   1668 O  OE1 . GLU A 1 209 ? -16.076 9.805   16.218  1.00 38.04 ? 209 GLU A OE1 1 
ATOM   1669 O  OE2 . GLU A 1 209 ? -16.152 11.464  14.766  1.00 42.03 ? 209 GLU A OE2 1 
ATOM   1670 N  N   . TRP A 1 210 ? -10.665 13.261  15.879  1.00 17.13 ? 210 TRP A N   1 
ATOM   1671 C  CA  . TRP A 1 210 ? -9.263  13.140  15.484  1.00 17.96 ? 210 TRP A CA  1 
ATOM   1672 C  C   . TRP A 1 210 ? -8.566  14.454  15.766  1.00 20.84 ? 210 TRP A C   1 
ATOM   1673 O  O   . TRP A 1 210 ? -9.067  15.523  15.412  1.00 20.47 ? 210 TRP A O   1 
ATOM   1674 C  CB  . TRP A 1 210 ? -9.130  12.802  14.000  1.00 18.66 ? 210 TRP A CB  1 
ATOM   1675 C  CG  . TRP A 1 210 ? -9.621  11.414  13.661  1.00 24.25 ? 210 TRP A CG  1 
ATOM   1676 C  CD1 . TRP A 1 210 ? -10.898 11.055  13.292  1.00 24.40 ? 210 TRP A CD1 1 
ATOM   1677 C  CD2 . TRP A 1 210 ? -8.840  10.213  13.624  1.00 21.63 ? 210 TRP A CD2 1 
ATOM   1678 N  NE1 . TRP A 1 210 ? -10.948 9.706   13.022  1.00 22.17 ? 210 TRP A NE1 1 
ATOM   1679 C  CE2 . TRP A 1 210 ? -9.702  9.165   13.213  1.00 23.38 ? 210 TRP A CE2 1 
ATOM   1680 C  CE3 . TRP A 1 210 ? -7.492  9.919   13.891  1.00 20.73 ? 210 TRP A CE3 1 
ATOM   1681 C  CZ2 . TRP A 1 210 ? -9.258  7.844   13.062  1.00 25.84 ? 210 TRP A CZ2 1 
ATOM   1682 C  CZ3 . TRP A 1 210 ? -7.051  8.593   13.735  1.00 25.52 ? 210 TRP A CZ3 1 
ATOM   1683 C  CH2 . TRP A 1 210 ? -7.938  7.580   13.325  1.00 23.86 ? 210 TRP A CH2 1 
ATOM   1684 N  N   . VAL A 1 211 ? -7.391  14.372  16.375  1.00 17.82 ? 211 VAL A N   1 
ATOM   1685 C  CA  . VAL A 1 211 ? -6.657  15.581  16.748  1.00 17.19 ? 211 VAL A CA  1 
ATOM   1686 C  C   . VAL A 1 211 ? -5.173  15.417  16.496  1.00 19.18 ? 211 VAL A C   1 
ATOM   1687 O  O   . VAL A 1 211 ? -4.707  14.339  16.126  1.00 18.21 ? 211 VAL A O   1 
ATOM   1688 C  CB  . VAL A 1 211 ? -6.816  15.880  18.294  1.00 18.35 ? 211 VAL A CB  1 
ATOM   1689 C  CG1 . VAL A 1 211 ? -8.278  16.125  18.651  1.00 20.83 ? 211 VAL A CG1 1 
ATOM   1690 C  CG2 . VAL A 1 211 ? -6.263  14.686  19.129  1.00 16.92 ? 211 VAL A CG2 1 
ATOM   1691 N  N   . ARG A 1 212 ? -4.424  16.499  16.665  1.00 15.72 ? 212 ARG A N   1 
ATOM   1692 C  CA  . ARG A 1 212 ? -2.971  16.385  16.606  1.00 17.99 ? 212 ARG A CA  1 
ATOM   1693 C  C   . ARG A 1 212 ? -2.460  16.897  17.954  1.00 19.14 ? 212 ARG A C   1 
ATOM   1694 O  O   . ARG A 1 212 ? -3.137  17.689  18.619  1.00 15.94 ? 212 ARG A O   1 
ATOM   1695 C  CB  . ARG A 1 212 ? -2.356  17.182  15.467  1.00 20.19 ? 212 ARG A CB  1 
ATOM   1696 C  CG  . ARG A 1 212 ? -2.429  16.444  14.141  1.00 22.25 ? 212 ARG A CG  1 
ATOM   1697 C  CD  . ARG A 1 212 ? -1.547  17.094  13.099  1.00 18.97 ? 212 ARG A CD  1 
ATOM   1698 N  NE  . ARG A 1 212 ? -1.297  16.185  11.975  1.00 23.02 ? 212 ARG A NE  1 
ATOM   1699 C  CZ  . ARG A 1 212 ? -1.732  16.384  10.740  1.00 28.24 ? 212 ARG A CZ  1 
ATOM   1700 N  NH1 . ARG A 1 212 ? -2.442  17.469  10.462  1.00 26.05 ? 212 ARG A NH1 1 
ATOM   1701 N  NH2 . ARG A 1 212 ? -1.465  15.490  9.788   1.00 23.76 ? 212 ARG A NH2 1 
ATOM   1702 N  N   . VAL A 1 213 ? -1.299  16.403  18.380  1.00 13.82 ? 213 VAL A N   1 
ATOM   1703 C  CA  . VAL A 1 213 ? -0.727  16.817  19.663  1.00 13.21 ? 213 VAL A CA  1 
ATOM   1704 C  C   . VAL A 1 213 ? 0.633   17.442  19.448  1.00 15.78 ? 213 VAL A C   1 
ATOM   1705 O  O   . VAL A 1 213 ? 1.342   17.100  18.492  1.00 16.29 ? 213 VAL A O   1 
ATOM   1706 C  CB  . VAL A 1 213 ? -0.590  15.617  20.630  1.00 15.22 ? 213 VAL A CB  1 
ATOM   1707 C  CG1 . VAL A 1 213 ? -1.985  15.063  20.947  1.00 21.02 ? 213 VAL A CG1 1 
ATOM   1708 C  CG2 . VAL A 1 213 ? 0.294   14.536  20.002  1.00 17.10 ? 213 VAL A CG2 1 
ATOM   1709 N  N   . GLY A 1 214 ? 1.011   18.367  20.323  1.00 11.92 ? 214 GLY A N   1 
ATOM   1710 C  CA  . GLY A 1 214 ? 2.296   19.019  20.133  1.00 16.32 ? 214 GLY A CA  1 
ATOM   1711 C  C   . GLY A 1 214 ? 2.652   20.000  21.237  1.00 16.24 ? 214 GLY A C   1 
ATOM   1712 O  O   . GLY A 1 214 ? 2.122   19.926  22.349  1.00 13.61 ? 214 GLY A O   1 
ATOM   1713 N  N   . PHE A 1 215 ? 3.555   20.922  20.916  1.00 13.06 ? 215 PHE A N   1 
ATOM   1714 C  CA  . PHE A 1 215 ? 4.020   21.916  21.881  1.00 14.25 ? 215 PHE A CA  1 
ATOM   1715 C  C   . PHE A 1 215 ? 4.088   23.277  21.219  1.00 16.18 ? 215 PHE A C   1 
ATOM   1716 O  O   . PHE A 1 215 ? 4.342   23.380  20.026  1.00 16.60 ? 215 PHE A O   1 
ATOM   1717 C  CB  . PHE A 1 215 ? 5.416   21.568  22.372  1.00 14.53 ? 215 PHE A CB  1 
ATOM   1718 C  CG  . PHE A 1 215 ? 5.467   20.311  23.175  1.00 18.47 ? 215 PHE A CG  1 
ATOM   1719 C  CD1 . PHE A 1 215 ? 5.576   19.068  22.551  1.00 19.83 ? 215 PHE A CD1 1 
ATOM   1720 C  CD2 . PHE A 1 215 ? 5.375   20.372  24.568  1.00 18.12 ? 215 PHE A CD2 1 
ATOM   1721 C  CE1 . PHE A 1 215 ? 5.597   17.897  23.303  1.00 21.69 ? 215 PHE A CE1 1 
ATOM   1722 C  CE2 . PHE A 1 215 ? 5.397   19.189  25.336  1.00 21.80 ? 215 PHE A CE2 1 
ATOM   1723 C  CZ  . PHE A 1 215 ? 5.510   17.963  24.701  1.00 19.62 ? 215 PHE A CZ  1 
ATOM   1724 N  N   . SER A 1 216 ? 3.899   24.310  22.023  1.00 16.55 ? 216 SER A N   1 
ATOM   1725 C  CA  . SER A 1 216 ? 3.945   25.675  21.528  1.00 16.52 ? 216 SER A CA  1 
ATOM   1726 C  C   . SER A 1 216 ? 4.682   26.518  22.555  1.00 20.39 ? 216 SER A C   1 
ATOM   1727 O  O   . SER A 1 216 ? 4.652   26.223  23.758  1.00 17.76 ? 216 SER A O   1 
ATOM   1728 C  CB  . SER A 1 216 ? 2.523   26.214  21.355  1.00 20.06 ? 216 SER A CB  1 
ATOM   1729 O  OG  . SER A 1 216 ? 2.540   27.497  20.754  1.00 23.17 ? 216 SER A OG  1 
ATOM   1730 N  N   . ALA A 1 217 ? 5.377   27.543  22.081  1.00 16.76 ? 217 ALA A N   1 
ATOM   1731 C  CA  . ALA A 1 217 ? 6.061   28.455  23.000  1.00 18.43 ? 217 ALA A CA  1 
ATOM   1732 C  C   . ALA A 1 217 ? 6.224   29.784  22.306  1.00 19.81 ? 217 ALA A C   1 
ATOM   1733 O  O   . ALA A 1 217 ? 6.221   29.869  21.066  1.00 17.98 ? 217 ALA A O   1 
ATOM   1734 C  CB  . ALA A 1 217 ? 7.405   27.926  23.405  1.00 16.61 ? 217 ALA A CB  1 
ATOM   1735 N  N   . ALA A 1 218 ? 6.362   30.833  23.109  1.00 17.54 ? 218 ALA A N   1 
ATOM   1736 C  CA  . ALA A 1 218 ? 6.528   32.165  22.544  1.00 18.66 ? 218 ALA A CA  1 
ATOM   1737 C  C   . ALA A 1 218 ? 7.276   33.056  23.519  1.00 20.61 ? 218 ALA A C   1 
ATOM   1738 O  O   . ALA A 1 218 ? 7.363   32.753  24.710  1.00 18.16 ? 218 ALA A O   1 
ATOM   1739 C  CB  . ALA A 1 218 ? 5.176   32.768  22.272  1.00 16.94 ? 218 ALA A CB  1 
ATOM   1740 N  N   . SER A 1 219 ? 7.827   34.137  22.986  1.00 20.85 ? 219 SER A N   1 
ATOM   1741 C  CA  . SER A 1 219 ? 8.512   35.166  23.775  1.00 22.82 ? 219 SER A CA  1 
ATOM   1742 C  C   . SER A 1 219 ? 8.086   36.497  23.151  1.00 23.15 ? 219 SER A C   1 
ATOM   1743 O  O   . SER A 1 219 ? 8.182   36.663  21.936  1.00 24.81 ? 219 SER A O   1 
ATOM   1744 C  CB  . SER A 1 219 ? 10.031  35.046  23.675  1.00 21.97 ? 219 SER A CB  1 
ATOM   1745 O  OG  . SER A 1 219 ? 10.545  33.970  24.436  1.00 20.37 ? 219 SER A OG  1 
ATOM   1746 N  N   . GLY A 1 220 ? 7.583   37.423  23.968  1.00 20.44 ? 220 GLY A N   1 
ATOM   1747 C  CA  . GLY A 1 220 ? 7.192   38.734  23.464  1.00 23.72 ? 220 GLY A CA  1 
ATOM   1748 C  C   . GLY A 1 220 ? 8.365   39.675  23.695  1.00 24.60 ? 220 GLY A C   1 
ATOM   1749 O  O   . GLY A 1 220 ? 9.436   39.450  23.147  1.00 25.05 ? 220 GLY A O   1 
ATOM   1750 N  N   . GLU A 1 221 ? 8.190   40.707  24.519  1.00 27.38 ? 221 GLU A N   1 
ATOM   1751 C  CA  . GLU A 1 221 ? 9.301   41.627  24.793  1.00 29.72 ? 221 GLU A CA  1 
ATOM   1752 C  C   . GLU A 1 221 ? 10.345  41.002  25.709  1.00 29.48 ? 221 GLU A C   1 
ATOM   1753 O  O   . GLU A 1 221 ? 11.534  41.331  25.624  1.00 30.68 ? 221 GLU A O   1 
ATOM   1754 C  CB  . GLU A 1 221 ? 8.782   42.927  25.389  1.00 34.50 ? 221 GLU A CB  1 
ATOM   1755 C  CG  . GLU A 1 221 ? 8.147   43.809  24.345  1.00 43.80 ? 221 GLU A CG  1 
ATOM   1756 C  CD  . GLU A 1 221 ? 7.780   45.162  24.890  1.00 50.51 ? 221 GLU A CD  1 
ATOM   1757 O  OE1 . GLU A 1 221 ? 8.672   45.803  25.490  1.00 50.63 ? 221 GLU A OE1 1 
ATOM   1758 O  OE2 . GLU A 1 221 ? 6.611   45.575  24.711  1.00 52.41 ? 221 GLU A OE2 1 
ATOM   1759 N  N   . GLN A 1 222 ? 9.896   40.133  26.611  1.00 24.33 ? 222 GLN A N   1 
ATOM   1760 C  CA  A GLN A 1 222 ? 10.792  39.426  27.518  0.50 26.73 ? 222 GLN A CA  1 
ATOM   1761 C  CA  B GLN A 1 222 ? 10.808  39.432  27.509  0.50 26.63 ? 222 GLN A CA  1 
ATOM   1762 C  C   . GLN A 1 222 ? 11.032  38.072  26.856  1.00 26.67 ? 222 GLN A C   1 
ATOM   1763 O  O   . GLN A 1 222 ? 10.172  37.588  26.120  1.00 24.27 ? 222 GLN A O   1 
ATOM   1764 C  CB  A GLN A 1 222 ? 10.140  39.252  28.887  0.50 30.31 ? 222 GLN A CB  1 
ATOM   1765 C  CB  B GLN A 1 222 ? 10.210  39.274  28.908  0.50 30.12 ? 222 GLN A CB  1 
ATOM   1766 C  CG  A GLN A 1 222 ? 9.784   40.571  29.547  0.50 40.45 ? 222 GLN A CG  1 
ATOM   1767 C  CG  B GLN A 1 222 ? 10.281  40.544  29.753  0.50 39.26 ? 222 GLN A CG  1 
ATOM   1768 C  CD  A GLN A 1 222 ? 10.966  41.507  29.627  0.50 41.12 ? 222 GLN A CD  1 
ATOM   1769 C  CD  B GLN A 1 222 ? 9.364   41.640  29.247  0.50 40.49 ? 222 GLN A CD  1 
ATOM   1770 O  OE1 A GLN A 1 222 ? 12.024  41.141  30.135  0.50 46.46 ? 222 GLN A OE1 1 
ATOM   1771 O  OE1 B GLN A 1 222 ? 8.149   41.469  29.187  0.50 46.32 ? 222 GLN A OE1 1 
ATOM   1772 N  NE2 A GLN A 1 222 ? 10.794  42.725  29.125  0.50 43.50 ? 222 GLN A NE2 1 
ATOM   1773 N  NE2 B GLN A 1 222 ? 9.945   42.776  28.885  0.50 45.92 ? 222 GLN A NE2 1 
ATOM   1774 N  N   . TYR A 1 223 ? 12.175  37.455  27.123  1.00 23.89 ? 223 TYR A N   1 
ATOM   1775 C  CA  . TYR A 1 223 ? 12.473  36.202  26.452  1.00 25.66 ? 223 TYR A CA  1 
ATOM   1776 C  C   . TYR A 1 223 ? 13.307  35.209  27.219  1.00 25.51 ? 223 TYR A C   1 
ATOM   1777 O  O   . TYR A 1 223 ? 13.905  35.541  28.239  1.00 22.76 ? 223 TYR A O   1 
ATOM   1778 C  CB  . TYR A 1 223 ? 13.185  36.542  25.139  1.00 26.61 ? 223 TYR A CB  1 
ATOM   1779 C  CG  . TYR A 1 223 ? 14.260  37.593  25.356  1.00 32.91 ? 223 TYR A CG  1 
ATOM   1780 C  CD1 . TYR A 1 223 ? 13.984  38.956  25.190  1.00 34.72 ? 223 TYR A CD1 1 
ATOM   1781 C  CD2 . TYR A 1 223 ? 15.524  37.235  25.827  1.00 35.57 ? 223 TYR A CD2 1 
ATOM   1782 C  CE1 . TYR A 1 223 ? 14.947  39.936  25.498  1.00 37.21 ? 223 TYR A CE1 1 
ATOM   1783 C  CE2 . TYR A 1 223 ? 16.488  38.204  26.138  1.00 39.40 ? 223 TYR A CE2 1 
ATOM   1784 C  CZ  . TYR A 1 223 ? 16.194  39.551  25.974  1.00 39.95 ? 223 TYR A CZ  1 
ATOM   1785 O  OH  . TYR A 1 223 ? 17.148  40.503  26.314  1.00 40.52 ? 223 TYR A OH  1 
ATOM   1786 N  N   . GLN A 1 224 ? 13.343  33.984  26.687  1.00 21.52 ? 224 GLN A N   1 
ATOM   1787 C  CA  . GLN A 1 224 ? 14.068  32.855  27.260  1.00 21.01 ? 224 GLN A CA  1 
ATOM   1788 C  C   . GLN A 1 224 ? 13.960  31.746  26.211  1.00 20.31 ? 224 GLN A C   1 
ATOM   1789 O  O   . GLN A 1 224 ? 13.048  31.759  25.379  1.00 18.88 ? 224 GLN A O   1 
ATOM   1790 C  CB  . GLN A 1 224 ? 13.371  32.365  28.548  1.00 19.91 ? 224 GLN A CB  1 
ATOM   1791 C  CG  . GLN A 1 224 ? 11.924  31.889  28.301  1.00 20.26 ? 224 GLN A CG  1 
ATOM   1792 C  CD  . GLN A 1 224 ? 11.082  31.689  29.579  1.00 22.62 ? 224 GLN A CD  1 
ATOM   1793 O  OE1 . GLN A 1 224 ? 9.864   31.478  29.502  1.00 24.66 ? 224 GLN A OE1 1 
ATOM   1794 N  NE2 . GLN A 1 224 ? 11.722  31.750  30.746  1.00 15.07 ? 224 GLN A NE2 1 
ATOM   1795 N  N   . THR A 1 225 ? 14.887  30.802  26.244  1.00 22.50 ? 225 THR A N   1 
ATOM   1796 C  CA  . THR A 1 225 ? 14.801  29.679  25.315  1.00 23.78 ? 225 THR A CA  1 
ATOM   1797 C  C   . THR A 1 225 ? 13.731  28.732  25.878  1.00 23.97 ? 225 THR A C   1 
ATOM   1798 O  O   . THR A 1 225 ? 13.488  28.717  27.097  1.00 22.95 ? 225 THR A O   1 
ATOM   1799 C  CB  . THR A 1 225 ? 16.120  28.899  25.262  1.00 24.61 ? 225 THR A CB  1 
ATOM   1800 O  OG1 . THR A 1 225 ? 16.451  28.438  26.581  1.00 31.28 ? 225 THR A OG1 1 
ATOM   1801 C  CG2 . THR A 1 225 ? 17.245  29.777  24.724  1.00 29.05 ? 225 THR A CG2 1 
ATOM   1802 N  N   . HIS A 1 226 ? 13.088  27.962  25.000  1.00 20.42 ? 226 HIS A N   1 
ATOM   1803 C  CA  . HIS A 1 226 ? 12.082  26.973  25.419  1.00 19.15 ? 226 HIS A CA  1 
ATOM   1804 C  C   . HIS A 1 226 ? 12.550  25.708  24.738  1.00 20.43 ? 226 HIS A C   1 
ATOM   1805 O  O   . HIS A 1 226 ? 12.210  25.448  23.584  1.00 20.49 ? 226 HIS A O   1 
ATOM   1806 C  CB  . HIS A 1 226 ? 10.707  27.367  24.924  1.00 16.76 ? 226 HIS A CB  1 
ATOM   1807 C  CG  . HIS A 1 226 ? 10.217  28.658  25.499  1.00 21.42 ? 226 HIS A CG  1 
ATOM   1808 N  ND1 . HIS A 1 226 ? 10.507  29.882  24.931  1.00 20.18 ? 226 HIS A ND1 1 
ATOM   1809 C  CD2 . HIS A 1 226 ? 9.441   28.917  26.581  1.00 18.16 ? 226 HIS A CD2 1 
ATOM   1810 C  CE1 . HIS A 1 226 ? 9.923   30.840  25.635  1.00 22.05 ? 226 HIS A CE1 1 
ATOM   1811 N  NE2 . HIS A 1 226 ? 9.271   30.281  26.641  1.00 18.04 ? 226 HIS A NE2 1 
ATOM   1812 N  N   . THR A 1 227 ? 13.342  24.938  25.464  1.00 18.93 ? 227 THR A N   1 
ATOM   1813 C  CA  . THR A 1 227 ? 13.970  23.747  24.914  1.00 19.01 ? 227 THR A CA  1 
ATOM   1814 C  C   . THR A 1 227 ? 13.270  22.458  25.275  1.00 19.55 ? 227 THR A C   1 
ATOM   1815 O  O   . THR A 1 227 ? 13.251  22.080  26.444  1.00 19.36 ? 227 THR A O   1 
ATOM   1816 C  CB  . THR A 1 227 ? 15.417  23.701  25.401  1.00 23.69 ? 227 THR A CB  1 
ATOM   1817 O  OG1 . THR A 1 227 ? 16.037  24.959  25.096  1.00 22.82 ? 227 THR A OG1 1 
ATOM   1818 C  CG2 . THR A 1 227 ? 16.188  22.572  24.731  1.00 18.61 ? 227 THR A CG2 1 
ATOM   1819 N  N   . LEU A 1 228 ? 12.706  21.778  24.273  1.00 17.37 ? 228 LEU A N   1 
ATOM   1820 C  CA  . LEU A 1 228 ? 12.020  20.504  24.526  1.00 17.25 ? 228 LEU A CA  1 
ATOM   1821 C  C   . LEU A 1 228 ? 13.093  19.418  24.354  1.00 16.64 ? 228 LEU A C   1 
ATOM   1822 O  O   . LEU A 1 228 ? 13.640  19.255  23.270  1.00 18.44 ? 228 LEU A O   1 
ATOM   1823 C  CB  . LEU A 1 228 ? 10.891  20.305  23.510  1.00 18.20 ? 228 LEU A CB  1 
ATOM   1824 C  CG  . LEU A 1 228 ? 10.058  19.041  23.716  1.00 23.47 ? 228 LEU A CG  1 
ATOM   1825 C  CD1 . LEU A 1 228 ? 9.284   19.159  25.024  1.00 24.08 ? 228 LEU A CD1 1 
ATOM   1826 C  CD2 . LEU A 1 228 ? 9.068   18.880  22.547  1.00 23.30 ? 228 LEU A CD2 1 
ATOM   1827 N  N   . GLU A 1 229 ? 13.372  18.671  25.412  1.00 15.46 ? 229 GLU A N   1 
ATOM   1828 C  CA  . GLU A 1 229 ? 14.459  17.687  25.388  1.00 17.00 ? 229 GLU A CA  1 
ATOM   1829 C  C   . GLU A 1 229 ? 14.083  16.255  25.071  1.00 18.75 ? 229 GLU A C   1 
ATOM   1830 O  O   . GLU A 1 229 ? 14.886  15.512  24.511  1.00 18.16 ? 229 GLU A O   1 
ATOM   1831 C  CB  . GLU A 1 229 ? 15.185  17.742  26.735  1.00 19.07 ? 229 GLU A CB  1 
ATOM   1832 C  CG  . GLU A 1 229 ? 15.702  19.136  27.012  1.00 22.25 ? 229 GLU A CG  1 
ATOM   1833 C  CD  . GLU A 1 229 ? 16.023  19.383  28.476  1.00 31.77 ? 229 GLU A CD  1 
ATOM   1834 O  OE1 . GLU A 1 229 ? 16.876  20.249  28.743  1.00 34.21 ? 229 GLU A OE1 1 
ATOM   1835 O  OE2 . GLU A 1 229 ? 15.426  18.726  29.347  1.00 32.02 ? 229 GLU A OE2 1 
ATOM   1836 N  N   . SER A 1 230 ? 12.871  15.861  25.443  1.00 15.55 ? 230 SER A N   1 
ATOM   1837 C  CA  . SER A 1 230 ? 12.428  14.487  25.186  1.00 14.32 ? 230 SER A CA  1 
ATOM   1838 C  C   . SER A 1 230 ? 10.910  14.475  25.232  1.00 19.89 ? 230 SER A C   1 
ATOM   1839 O  O   . SER A 1 230 ? 10.287  15.350  25.842  1.00 17.42 ? 230 SER A O   1 
ATOM   1840 C  CB  . SER A 1 230 ? 13.009  13.538  26.243  1.00 16.24 ? 230 SER A CB  1 
ATOM   1841 O  OG  . SER A 1 230 ? 12.474  13.826  27.522  1.00 23.61 ? 230 SER A OG  1 
ATOM   1842 N  N   . TRP A 1 231 ? 10.306  13.485  24.584  1.00 14.69 ? 231 TRP A N   1 
ATOM   1843 C  CA  . TRP A 1 231 ? 8.856   13.421  24.545  1.00 14.19 ? 231 TRP A CA  1 
ATOM   1844 C  C   . TRP A 1 231 ? 8.361   12.027  24.175  1.00 17.77 ? 231 TRP A C   1 
ATOM   1845 O  O   . TRP A 1 231 ? 8.828   11.445  23.190  1.00 16.20 ? 231 TRP A O   1 
ATOM   1846 C  CB  . TRP A 1 231 ? 8.325   14.403  23.481  1.00 12.37 ? 231 TRP A CB  1 
ATOM   1847 C  CG  . TRP A 1 231 ? 6.802   14.371  23.279  1.00 14.80 ? 231 TRP A CG  1 
ATOM   1848 C  CD1 . TRP A 1 231 ? 5.845   14.119  24.234  1.00 14.91 ? 231 TRP A CD1 1 
ATOM   1849 C  CD2 . TRP A 1 231 ? 6.082   14.736  22.085  1.00 16.17 ? 231 TRP A CD2 1 
ATOM   1850 N  NE1 . TRP A 1 231 ? 4.582   14.315  23.711  1.00 15.89 ? 231 TRP A NE1 1 
ATOM   1851 C  CE2 . TRP A 1 231 ? 4.701   14.701  22.398  1.00 13.47 ? 231 TRP A CE2 1 
ATOM   1852 C  CE3 . TRP A 1 231 ? 6.472   15.102  20.786  1.00 14.63 ? 231 TRP A CE3 1 
ATOM   1853 C  CZ2 . TRP A 1 231 ? 3.707   15.023  21.459  1.00 17.42 ? 231 TRP A CZ2 1 
ATOM   1854 C  CZ3 . TRP A 1 231 ? 5.488   15.421  19.849  1.00 18.73 ? 231 TRP A CZ3 1 
ATOM   1855 C  CH2 . TRP A 1 231 ? 4.117   15.381  20.193  1.00 18.54 ? 231 TRP A CH2 1 
ATOM   1856 N  N   . SER A 1 232 ? 7.449   11.488  24.981  1.00 15.09 ? 232 SER A N   1 
ATOM   1857 C  CA  A SER A 1 232 ? 6.864   10.182  24.692  0.33 17.61 ? 232 SER A CA  1 
ATOM   1858 C  CA  B SER A 1 232 ? 6.861   10.181  24.707  0.33 18.15 ? 232 SER A CA  1 
ATOM   1859 C  CA  C SER A 1 232 ? 6.869   10.177  24.721  0.33 18.31 ? 232 SER A CA  1 
ATOM   1860 C  C   . SER A 1 232 ? 5.348   10.334  24.799  1.00 18.26 ? 232 SER A C   1 
ATOM   1861 O  O   . SER A 1 232 ? 4.839   11.108  25.621  1.00 15.78 ? 232 SER A O   1 
ATOM   1862 C  CB  A SER A 1 232 ? 7.370   9.105   25.660  0.33 19.65 ? 232 SER A CB  1 
ATOM   1863 C  CB  B SER A 1 232 ? 7.352   9.134   25.709  0.33 20.56 ? 232 SER A CB  1 
ATOM   1864 C  CB  C SER A 1 232 ? 7.348   9.171   25.766  0.33 20.73 ? 232 SER A CB  1 
ATOM   1865 O  OG  A SER A 1 232 ? 6.896   9.298   26.978  0.33 15.84 ? 232 SER A OG  1 
ATOM   1866 O  OG  B SER A 1 232 ? 8.684   8.750   25.414  0.33 21.12 ? 232 SER A OG  1 
ATOM   1867 O  OG  C SER A 1 232 ? 7.111   7.850   25.329  0.33 25.91 ? 232 SER A OG  1 
ATOM   1868 N  N   . PHE A 1 233 ? 4.618   9.611   23.948  1.00 17.11 ? 233 PHE A N   1 
ATOM   1869 C  CA  . PHE A 1 233 ? 3.161   9.726   23.965  1.00 15.22 ? 233 PHE A CA  1 
ATOM   1870 C  C   . PHE A 1 233 ? 2.499   8.404   23.662  1.00 16.94 ? 233 PHE A C   1 
ATOM   1871 O  O   . PHE A 1 233 ? 2.985   7.656   22.830  1.00 15.33 ? 233 PHE A O   1 
ATOM   1872 C  CB  . PHE A 1 233 ? 2.724   10.740  22.896  1.00 14.57 ? 233 PHE A CB  1 
ATOM   1873 C  CG  . PHE A 1 233 ? 1.239   10.961  22.827  1.00 15.77 ? 233 PHE A CG  1 
ATOM   1874 C  CD1 . PHE A 1 233 ? 0.442   10.193  21.975  1.00 16.40 ? 233 PHE A CD1 1 
ATOM   1875 C  CD2 . PHE A 1 233 ? 0.626   11.925  23.634  1.00 18.54 ? 233 PHE A CD2 1 
ATOM   1876 C  CE1 . PHE A 1 233 ? -0.949  10.380  21.929  1.00 19.33 ? 233 PHE A CE1 1 
ATOM   1877 C  CE2 . PHE A 1 233 ? -0.762  12.122  23.597  1.00 18.42 ? 233 PHE A CE2 1 
ATOM   1878 C  CZ  . PHE A 1 233 ? -1.554  11.339  22.736  1.00 19.57 ? 233 PHE A CZ  1 
ATOM   1879 N  N   . THR A 1 234 ? 1.401   8.108   24.339  1.00 13.72 ? 234 THR A N   1 
ATOM   1880 C  CA  A THR A 1 234 ? 0.686   6.874   24.047  0.50 13.56 ? 234 THR A CA  1 
ATOM   1881 C  CA  B THR A 1 234 ? 0.685   6.862   24.086  0.50 14.13 ? 234 THR A CA  1 
ATOM   1882 C  C   . THR A 1 234 ? -0.798  7.124   24.256  1.00 15.91 ? 234 THR A C   1 
ATOM   1883 O  O   . THR A 1 234 ? -1.196  7.843   25.183  1.00 14.42 ? 234 THR A O   1 
ATOM   1884 C  CB  A THR A 1 234 ? 1.199   5.679   24.928  0.50 17.36 ? 234 THR A CB  1 
ATOM   1885 C  CB  B THR A 1 234 ? 1.112   5.752   25.074  0.50 17.90 ? 234 THR A CB  1 
ATOM   1886 O  OG1 A THR A 1 234 ? 0.417   4.502   24.658  0.50 15.97 ? 234 THR A OG1 1 
ATOM   1887 O  OG1 B THR A 1 234 ? 0.719   6.109   26.402  0.50 29.36 ? 234 THR A OG1 1 
ATOM   1888 C  CG2 A THR A 1 234 ? 1.121   6.012   26.393  0.50 24.71 ? 234 THR A CG2 1 
ATOM   1889 C  CG2 B THR A 1 234 ? 2.594   5.559   25.041  0.50 16.87 ? 234 THR A CG2 1 
ATOM   1890 N  N   . SER A 1 235 ? -1.619  6.589   23.354  1.00 12.93 ? 235 SER A N   1 
ATOM   1891 C  CA  A SER A 1 235 ? -3.064  6.744   23.493  0.50 15.85 ? 235 SER A CA  1 
ATOM   1892 C  CA  B SER A 1 235 ? -3.062  6.758   23.457  0.50 15.34 ? 235 SER A CA  1 
ATOM   1893 C  C   . SER A 1 235 ? -3.733  5.440   23.099  1.00 17.42 ? 235 SER A C   1 
ATOM   1894 O  O   . SER A 1 235 ? -3.280  4.751   22.188  1.00 17.59 ? 235 SER A O   1 
ATOM   1895 C  CB  A SER A 1 235 ? -3.593  7.903   22.633  0.50 17.84 ? 235 SER A CB  1 
ATOM   1896 C  CB  B SER A 1 235 ? -3.537  7.854   22.506  0.50 16.86 ? 235 SER A CB  1 
ATOM   1897 O  OG  A SER A 1 235 ? -3.490  7.639   21.246  0.50 18.59 ? 235 SER A OG  1 
ATOM   1898 O  OG  B SER A 1 235 ? -4.939  8.001   22.572  0.50 14.03 ? 235 SER A OG  1 
ATOM   1899 N  N   . THR A 1 236 ? -4.808  5.091   23.811  1.00 14.30 ? 236 THR A N   1 
ATOM   1900 C  CA  . THR A 1 236 ? -5.522  3.838   23.529  1.00 13.69 ? 236 THR A CA  1 
ATOM   1901 C  C   . THR A 1 236 ? -7.015  4.081   23.714  1.00 16.39 ? 236 THR A C   1 
ATOM   1902 O  O   . THR A 1 236 ? -7.418  4.533   24.778  1.00 16.00 ? 236 THR A O   1 
ATOM   1903 C  CB  . THR A 1 236 ? -5.119  2.730   24.538  1.00 18.08 ? 236 THR A CB  1 
ATOM   1904 O  OG1 . THR A 1 236 ? -3.691  2.588   24.558  1.00 24.66 ? 236 THR A OG1 1 
ATOM   1905 C  CG2 . THR A 1 236 ? -5.757  1.405   24.147  1.00 23.25 ? 236 THR A CG2 1 
ATOM   1906 N  N   . LEU A 1 237 ? -7.834  3.800   22.703  1.00 15.53 ? 237 LEU A N   1 
ATOM   1907 C  CA  . LEU A 1 237 ? -9.282  3.992   22.871  1.00 16.06 ? 237 LEU A CA  1 
ATOM   1908 C  C   . LEU A 1 237 ? -9.847  2.947   23.836  1.00 21.27 ? 237 LEU A C   1 
ATOM   1909 O  O   . LEU A 1 237 ? -9.572  1.763   23.703  1.00 23.02 ? 237 LEU A O   1 
ATOM   1910 C  CB  . LEU A 1 237 ? -10.002 3.868   21.529  1.00 17.86 ? 237 LEU A CB  1 
ATOM   1911 C  CG  . LEU A 1 237 ? -10.004 5.092   20.631  1.00 21.40 ? 237 LEU A CG  1 
ATOM   1912 C  CD1 . LEU A 1 237 ? -10.676 4.743   19.294  1.00 22.17 ? 237 LEU A CD1 1 
ATOM   1913 C  CD2 . LEU A 1 237 ? -10.769 6.245   21.342  1.00 18.60 ? 237 LEU A CD2 1 
ATOM   1914 N  N   . LEU A 1 238 ? -10.647 3.383   24.804  1.00 21.98 ? 238 LEU A N   1 
ATOM   1915 C  CA  . LEU A 1 238 ? -11.236 2.449   25.766  1.00 27.11 ? 238 LEU A CA  1 
ATOM   1916 C  C   . LEU A 1 238 ? -12.732 2.663   25.945  1.00 30.91 ? 238 LEU A C   1 
ATOM   1917 O  O   . LEU A 1 238 ? -13.215 3.793   25.844  1.00 26.76 ? 238 LEU A O   1 
ATOM   1918 C  CB  . LEU A 1 238 ? -10.580 2.608   27.139  1.00 27.35 ? 238 LEU A CB  1 
ATOM   1919 C  CG  . LEU A 1 238 ? -9.094  2.269   27.277  1.00 30.27 ? 238 LEU A CG  1 
ATOM   1920 C  CD1 . LEU A 1 238 ? -8.658  2.539   28.718  1.00 34.61 ? 238 LEU A CD1 1 
ATOM   1921 C  CD2 . LEU A 1 238 ? -8.855  0.804   26.886  1.00 31.61 ? 238 LEU A CD2 1 
ATOM   1922 N  N   . TYR A 1 239 ? -13.458 1.574   26.203  1.00 37.46 ? 239 TYR A N   1 
ATOM   1923 C  CA  . TYR A 1 239 ? -14.889 1.657   26.488  1.00 49.02 ? 239 TYR A CA  1 
ATOM   1924 C  C   . TYR A 1 239 ? -14.838 1.763   28.007  1.00 53.60 ? 239 TYR A C   1 
ATOM   1925 O  O   . TYR A 1 239 ? -14.227 0.916   28.662  1.00 55.64 ? 239 TYR A O   1 
ATOM   1926 C  CB  . TYR A 1 239 ? -15.637 0.366   26.130  1.00 52.42 ? 239 TYR A CB  1 
ATOM   1927 N  N   . THR A 1 240 ? -15.464 2.780   28.579  1.00 58.10 ? 240 THR A N   1 
ATOM   1928 C  CA  . THR A 1 240 ? -15.418 2.926   30.030  1.00 63.45 ? 240 THR A CA  1 
ATOM   1929 C  C   . THR A 1 240 ? -16.789 3.028   30.697  1.00 64.33 ? 240 THR A C   1 
ATOM   1930 O  O   . THR A 1 240 ? -17.817 3.040   30.026  1.00 65.09 ? 240 THR A O   1 
ATOM   1931 C  CB  . THR A 1 240 ? -14.549 4.148   30.407  1.00 64.52 ? 240 THR A CB  1 
ATOM   1932 O  OG1 . THR A 1 240 ? -13.413 3.704   31.160  1.00 67.22 ? 240 THR A OG1 1 
ATOM   1933 C  CG2 . THR A 1 240 ? -15.347 5.162   31.212  1.00 65.99 ? 240 THR A CG2 1 
ATOM   1934 N  N   . GLN B 1 1   ? 11.047  9.648   15.710  1.00 17.14 ? 1   GLN B N   1 
ATOM   1935 C  CA  . GLN B 1 1   ? 10.991  8.924   17.011  1.00 19.80 ? 1   GLN B CA  1 
ATOM   1936 C  C   . GLN B 1 1   ? 11.789  7.637   16.925  1.00 19.32 ? 1   GLN B C   1 
ATOM   1937 O  O   . GLN B 1 1   ? 11.828  6.991   15.876  1.00 21.28 ? 1   GLN B O   1 
ATOM   1938 C  CB  . GLN B 1 1   ? 9.536   8.609   17.313  1.00 21.63 ? 1   GLN B CB  1 
ATOM   1939 C  CG  . GLN B 1 1   ? 8.806   8.753   16.007  1.00 22.00 ? 1   GLN B CG  1 
ATOM   1940 C  CD  . GLN B 1 1   ? 9.711   9.548   15.079  1.00 17.82 ? 1   GLN B CD  1 
ATOM   1941 O  OE1 . GLN B 1 1   ? 9.317   9.996   14.009  1.00 21.97 ? 1   GLN B OE1 1 
ATOM   1942 N  N   . ASP B 1 2   ? 12.419  7.259   18.030  1.00 16.52 ? 2   ASP B N   1 
ATOM   1943 C  CA  . ASP B 1 2   ? 13.191  6.029   18.082  1.00 19.18 ? 2   ASP B CA  1 
ATOM   1944 C  C   . ASP B 1 2   ? 12.217  4.859   18.154  1.00 18.96 ? 2   ASP B C   1 
ATOM   1945 O  O   . ASP B 1 2   ? 12.543  3.745   17.748  1.00 19.22 ? 2   ASP B O   1 
ATOM   1946 C  CB  . ASP B 1 2   ? 14.045  5.967   19.339  1.00 18.96 ? 2   ASP B CB  1 
ATOM   1947 C  CG  . ASP B 1 2   ? 15.284  6.855   19.270  1.00 22.10 ? 2   ASP B CG  1 
ATOM   1948 O  OD1 . ASP B 1 2   ? 15.453  7.610   18.303  1.00 24.58 ? 2   ASP B OD1 1 
ATOM   1949 O  OD2 . ASP B 1 2   ? 16.081  6.773   20.215  1.00 28.69 ? 2   ASP B OD2 1 
ATOM   1950 N  N   . SER B 1 3   ? 11.041  5.104   18.721  1.00 18.45 ? 3   SER B N   1 
ATOM   1951 C  CA  A SER B 1 3   ? 10.046  4.044   18.849  0.50 16.76 ? 3   SER B CA  1 
ATOM   1952 C  CA  B SER B 1 3   ? 10.036  4.054   18.874  0.50 18.72 ? 3   SER B CA  1 
ATOM   1953 C  C   . SER B 1 3   ? 8.688   4.471   18.312  1.00 17.18 ? 3   SER B C   1 
ATOM   1954 O  O   . SER B 1 3   ? 8.289   5.619   18.431  1.00 14.90 ? 3   SER B O   1 
ATOM   1955 C  CB  A SER B 1 3   ? 9.926   3.608   20.312  0.50 18.93 ? 3   SER B CB  1 
ATOM   1956 C  CB  B SER B 1 3   ? 9.878   3.696   20.353  0.50 22.27 ? 3   SER B CB  1 
ATOM   1957 O  OG  A SER B 1 3   ? 9.608   4.701   21.149  0.50 11.94 ? 3   SER B OG  1 
ATOM   1958 O  OG  B SER B 1 3   ? 11.088  3.191   20.880  0.50 28.32 ? 3   SER B OG  1 
ATOM   1959 N  N   . LEU B 1 4   ? 7.973   3.528   17.706  1.00 17.41 ? 4   LEU B N   1 
ATOM   1960 C  CA  . LEU B 1 4   ? 6.663   3.846   17.134  1.00 17.95 ? 4   LEU B CA  1 
ATOM   1961 C  C   . LEU B 1 4   ? 5.814   2.589   17.182  1.00 17.67 ? 4   LEU B C   1 
ATOM   1962 O  O   . LEU B 1 4   ? 6.305   1.492   16.911  1.00 16.91 ? 4   LEU B O   1 
ATOM   1963 C  CB  . LEU B 1 4   ? 6.821   4.292   15.673  1.00 17.90 ? 4   LEU B CB  1 
ATOM   1964 C  CG  . LEU B 1 4   ? 5.528   4.530   14.887  1.00 22.81 ? 4   LEU B CG  1 
ATOM   1965 C  CD1 . LEU B 1 4   ? 4.834   5.801   15.370  1.00 22.61 ? 4   LEU B CD1 1 
ATOM   1966 C  CD2 . LEU B 1 4   ? 5.861   4.654   13.421  1.00 30.68 ? 4   LEU B CD2 1 
ATOM   1967 N  N   . SER B 1 5   ? 4.547   2.726   17.556  1.00 13.95 ? 5   SER B N   1 
ATOM   1968 C  CA  . SER B 1 5   ? 3.681   1.542   17.582  1.00 14.31 ? 5   SER B CA  1 
ATOM   1969 C  C   . SER B 1 5   ? 2.272   1.976   17.241  1.00 16.82 ? 5   SER B C   1 
ATOM   1970 O  O   . SER B 1 5   ? 1.881   3.105   17.514  1.00 15.97 ? 5   SER B O   1 
ATOM   1971 C  CB  A SER B 1 5   ? 3.716   0.856   18.952  0.33 16.38 ? 5   SER B CB  1 
ATOM   1972 C  CB  B SER B 1 5   ? 3.664   0.915   18.977  0.33 17.84 ? 5   SER B CB  1 
ATOM   1973 C  CB  C SER B 1 5   ? 3.701   0.912   18.976  0.33 17.47 ? 5   SER B CB  1 
ATOM   1974 O  OG  A SER B 1 5   ? 2.919   1.524   19.908  0.33 15.12 ? 5   SER B OG  1 
ATOM   1975 O  OG  B SER B 1 5   ? 4.963   0.564   19.411  0.33 23.47 ? 5   SER B OG  1 
ATOM   1976 O  OG  C SER B 1 5   ? 2.850   -0.218  19.047  0.33 23.30 ? 5   SER B OG  1 
ATOM   1977 N  N   . PHE B 1 6   ? 1.513   1.098   16.607  1.00 13.60 ? 6   PHE B N   1 
ATOM   1978 C  CA  . PHE B 1 6   ? 0.123   1.424   16.337  1.00 12.58 ? 6   PHE B CA  1 
ATOM   1979 C  C   . PHE B 1 6   ? -0.644  0.127   16.201  1.00 13.67 ? 6   PHE B C   1 
ATOM   1980 O  O   . PHE B 1 6   ? -0.066  -0.912  15.861  1.00 12.58 ? 6   PHE B O   1 
ATOM   1981 C  CB  . PHE B 1 6   ? -0.027  2.304   15.081  1.00 14.85 ? 6   PHE B CB  1 
ATOM   1982 C  CG  . PHE B 1 6   ? 0.633   1.750   13.842  1.00 16.42 ? 6   PHE B CG  1 
ATOM   1983 C  CD1 . PHE B 1 6   ? -0.020  0.810   13.046  1.00 16.87 ? 6   PHE B CD1 1 
ATOM   1984 C  CD2 . PHE B 1 6   ? 1.875   2.207   13.445  1.00 18.84 ? 6   PHE B CD2 1 
ATOM   1985 C  CE1 . PHE B 1 6   ? 0.570   0.341   11.858  1.00 18.51 ? 6   PHE B CE1 1 
ATOM   1986 C  CE2 . PHE B 1 6   ? 2.471   1.746   12.259  1.00 19.94 ? 6   PHE B CE2 1 
ATOM   1987 C  CZ  . PHE B 1 6   ? 1.813   0.815   11.472  1.00 17.68 ? 6   PHE B CZ  1 
ATOM   1988 N  N   . GLY B 1 7   ? -1.941  0.181   16.502  1.00 13.68 ? 7   GLY B N   1 
ATOM   1989 C  CA  . GLY B 1 7   ? -2.746  -1.025  16.402  1.00 14.82 ? 7   GLY B CA  1 
ATOM   1990 C  C   . GLY B 1 7   ? -4.108  -0.781  15.786  1.00 15.75 ? 7   GLY B C   1 
ATOM   1991 O  O   . GLY B 1 7   ? -4.815  0.155   16.182  1.00 14.38 ? 7   GLY B O   1 
ATOM   1992 N  N   . PHE B 1 8   ? -4.457  -1.625  14.810  1.00 13.89 ? 8   PHE B N   1 
ATOM   1993 C  CA  . PHE B 1 8   ? -5.759  -1.564  14.140  1.00 14.62 ? 8   PHE B CA  1 
ATOM   1994 C  C   . PHE B 1 8   ? -6.454  -2.906  14.399  1.00 14.18 ? 8   PHE B C   1 
ATOM   1995 O  O   . PHE B 1 8   ? -6.272  -3.859  13.636  1.00 15.90 ? 8   PHE B O   1 
ATOM   1996 C  CB  . PHE B 1 8   ? -5.626  -1.419  12.614  1.00 14.50 ? 8   PHE B CB  1 
ATOM   1997 C  CG  . PHE B 1 8   ? -5.054  -0.105  12.131  1.00 17.07 ? 8   PHE B CG  1 
ATOM   1998 C  CD1 . PHE B 1 8   ? -3.678  0.050   11.954  1.00 13.93 ? 8   PHE B CD1 1 
ATOM   1999 C  CD2 . PHE B 1 8   ? -5.901  0.953   11.761  1.00 16.24 ? 8   PHE B CD2 1 
ATOM   2000 C  CE1 . PHE B 1 8   ? -3.141  1.234   11.408  1.00 15.41 ? 8   PHE B CE1 1 
ATOM   2001 C  CE2 . PHE B 1 8   ? -5.375  2.136   11.218  1.00 18.15 ? 8   PHE B CE2 1 
ATOM   2002 C  CZ  . PHE B 1 8   ? -3.991  2.271   11.042  1.00 20.78 ? 8   PHE B CZ  1 
ATOM   2003 N  N   . PRO B 1 9   ? -7.236  -3.021  15.483  1.00 14.81 ? 9   PRO B N   1 
ATOM   2004 C  CA  . PRO B 1 9   ? -7.918  -4.307  15.717  1.00 17.09 ? 9   PRO B CA  1 
ATOM   2005 C  C   . PRO B 1 9   ? -8.936  -4.569  14.602  1.00 18.52 ? 9   PRO B C   1 
ATOM   2006 O  O   . PRO B 1 9   ? -9.275  -5.725  14.334  1.00 18.24 ? 9   PRO B O   1 
ATOM   2007 C  CB  . PRO B 1 9   ? -8.618  -4.114  17.066  1.00 17.16 ? 9   PRO B CB  1 
ATOM   2008 C  CG  . PRO B 1 9   ? -7.810  -3.008  17.740  1.00 19.14 ? 9   PRO B CG  1 
ATOM   2009 C  CD  . PRO B 1 9   ? -7.411  -2.093  16.622  1.00 14.92 ? 9   PRO B CD  1 
ATOM   2010 N  N   . THR B 1 10  ? -9.449  -3.486  14.015  1.00 17.90 ? 10  THR B N   1 
ATOM   2011 C  CA  . THR B 1 10  ? -10.393 -3.500  12.876  1.00 19.10 ? 10  THR B CA  1 
ATOM   2012 C  C   . THR B 1 10  ? -10.084 -2.224  12.102  1.00 19.27 ? 10  THR B C   1 
ATOM   2013 O  O   . THR B 1 10  ? -9.281  -1.400  12.563  1.00 18.13 ? 10  THR B O   1 
ATOM   2014 C  CB  . THR B 1 10  ? -11.882 -3.429  13.304  1.00 23.60 ? 10  THR B CB  1 
ATOM   2015 O  OG1 . THR B 1 10  ? -12.129 -2.161  13.924  1.00 26.58 ? 10  THR B OG1 1 
ATOM   2016 C  CG2 . THR B 1 10  ? -12.224 -4.539  14.264  1.00 27.64 ? 10  THR B CG2 1 
ATOM   2017 N  N   . PHE B 1 11  ? -10.705 -2.048  10.932  1.00 19.62 ? 11  PHE B N   1 
ATOM   2018 C  CA  . PHE B 1 11  ? -10.484 -0.858  10.129  1.00 18.28 ? 11  PHE B CA  1 
ATOM   2019 C  C   . PHE B 1 11  ? -11.781 -0.106  9.816   1.00 23.52 ? 11  PHE B C   1 
ATOM   2020 O  O   . PHE B 1 11  ? -12.388 -0.340  8.774   1.00 21.68 ? 11  PHE B O   1 
ATOM   2021 C  CB  . PHE B 1 11  ? -9.817  -1.225  8.805   1.00 17.26 ? 11  PHE B CB  1 
ATOM   2022 C  CG  . PHE B 1 11  ? -8.394  -1.696  8.952   1.00 17.18 ? 11  PHE B CG  1 
ATOM   2023 C  CD1 . PHE B 1 11  ? -7.351  -0.783  8.970   1.00 17.93 ? 11  PHE B CD1 1 
ATOM   2024 C  CD2 . PHE B 1 11  ? -8.106  -3.056  9.027   1.00 17.35 ? 11  PHE B CD2 1 
ATOM   2025 C  CE1 . PHE B 1 11  ? -6.019  -1.212  9.051   1.00 19.18 ? 11  PHE B CE1 1 
ATOM   2026 C  CE2 . PHE B 1 11  ? -6.783  -3.505  9.111   1.00 18.44 ? 11  PHE B CE2 1 
ATOM   2027 C  CZ  . PHE B 1 11  ? -5.741  -2.583  9.119   1.00 16.60 ? 11  PHE B CZ  1 
ATOM   2028 N  N   . PRO B 1 12  ? -12.216 0.798   10.716  1.00 23.78 ? 12  PRO B N   1 
ATOM   2029 C  CA  . PRO B 1 12  ? -13.445 1.589   10.518  1.00 26.97 ? 12  PRO B CA  1 
ATOM   2030 C  C   . PRO B 1 12  ? -13.270 2.479   9.291   1.00 25.99 ? 12  PRO B C   1 
ATOM   2031 O  O   . PRO B 1 12  ? -12.147 2.842   8.946   1.00 25.33 ? 12  PRO B O   1 
ATOM   2032 C  CB  . PRO B 1 12  ? -13.551 2.397   11.807  1.00 26.52 ? 12  PRO B CB  1 
ATOM   2033 C  CG  . PRO B 1 12  ? -12.900 1.494   12.819  1.00 32.44 ? 12  PRO B CG  1 
ATOM   2034 C  CD  . PRO B 1 12  ? -11.675 1.000   12.069  1.00 25.11 ? 12  PRO B CD  1 
ATOM   2035 N  N   . SER B 1 13  ? -14.366 2.865   8.642   1.00 27.22 ? 13  SER B N   1 
ATOM   2036 C  CA  A SER B 1 13  ? -14.289 3.694   7.442   0.50 29.79 ? 13  SER B CA  1 
ATOM   2037 C  CA  B SER B 1 13  ? -14.280 3.692   7.442   0.50 30.11 ? 13  SER B CA  1 
ATOM   2038 C  C   . SER B 1 13  ? -13.603 5.046   7.629   1.00 31.51 ? 13  SER B C   1 
ATOM   2039 O  O   . SER B 1 13  ? -13.056 5.607   6.680   1.00 31.06 ? 13  SER B O   1 
ATOM   2040 C  CB  A SER B 1 13  ? -15.694 3.930   6.879   0.50 33.50 ? 13  SER B CB  1 
ATOM   2041 C  CB  B SER B 1 13  ? -15.677 3.908   6.849   0.50 34.14 ? 13  SER B CB  1 
ATOM   2042 O  OG  A SER B 1 13  ? -16.527 4.538   7.850   0.50 35.91 ? 13  SER B OG  1 
ATOM   2043 O  OG  B SER B 1 13  ? -16.236 2.678   6.421   0.50 38.76 ? 13  SER B OG  1 
ATOM   2044 N  N   . ASP B 1 14  ? -13.622 5.575   8.842   1.00 29.57 ? 14  ASP B N   1 
ATOM   2045 C  CA  A ASP B 1 14  ? -13.022 6.875   9.099   0.50 33.77 ? 14  ASP B CA  1 
ATOM   2046 C  CA  B ASP B 1 14  ? -13.010 6.879   9.070   0.50 34.13 ? 14  ASP B CA  1 
ATOM   2047 C  C   . ASP B 1 14  ? -11.527 6.759   9.397   1.00 32.70 ? 14  ASP B C   1 
ATOM   2048 O  O   . ASP B 1 14  ? -11.138 6.680   10.553  1.00 38.20 ? 14  ASP B O   1 
ATOM   2049 C  CB  A ASP B 1 14  ? -13.765 7.527   10.266  0.50 36.26 ? 14  ASP B CB  1 
ATOM   2050 C  CB  B ASP B 1 14  ? -13.753 7.632   10.182  0.50 37.81 ? 14  ASP B CB  1 
ATOM   2051 C  CG  A ASP B 1 14  ? -13.367 8.962   10.485  0.50 37.89 ? 14  ASP B CG  1 
ATOM   2052 C  CG  B ASP B 1 14  ? -13.639 6.956   11.533  0.50 41.27 ? 14  ASP B CG  1 
ATOM   2053 O  OD1 A ASP B 1 14  ? -13.219 9.698   9.486   0.50 37.59 ? 14  ASP B OD1 1 
ATOM   2054 O  OD1 B ASP B 1 14  ? -13.206 5.787   11.588  0.50 44.60 ? 14  ASP B OD1 1 
ATOM   2055 O  OD2 A ASP B 1 14  ? -13.220 9.352   11.662  0.50 40.10 ? 14  ASP B OD2 1 
ATOM   2056 O  OD2 B ASP B 1 14  ? -13.990 7.602   12.545  0.50 46.80 ? 14  ASP B OD2 1 
ATOM   2057 N  N   . GLN B 1 15  ? -10.704 6.740   8.349   1.00 28.25 ? 15  GLN B N   1 
ATOM   2058 C  CA  . GLN B 1 15  ? -9.250  6.616   8.491   1.00 28.09 ? 15  GLN B CA  1 
ATOM   2059 C  C   . GLN B 1 15  ? -8.543  7.917   8.166   1.00 25.15 ? 15  GLN B C   1 
ATOM   2060 O  O   . GLN B 1 15  ? -8.905  8.601   7.210   1.00 27.12 ? 15  GLN B O   1 
ATOM   2061 C  CB  . GLN B 1 15  ? -8.713  5.531   7.548   1.00 29.37 ? 15  GLN B CB  1 
ATOM   2062 C  CG  . GLN B 1 15  ? -9.136  4.129   7.899   1.00 30.19 ? 15  GLN B CG  1 
ATOM   2063 C  CD  . GLN B 1 15  ? -8.755  3.759   9.305   1.00 28.70 ? 15  GLN B CD  1 
ATOM   2064 O  OE1 . GLN B 1 15  ? -7.684  4.132   9.787   1.00 31.19 ? 15  GLN B OE1 1 
ATOM   2065 N  NE2 . GLN B 1 15  ? -9.623  3.019   9.978   1.00 28.38 ? 15  GLN B NE2 1 
ATOM   2066 N  N   . LYS B 1 16  ? -7.516  8.249   8.944   1.00 20.76 ? 16  LYS B N   1 
ATOM   2067 C  CA  . LYS B 1 16  ? -6.758  9.470   8.721   1.00 21.74 ? 16  LYS B CA  1 
ATOM   2068 C  C   . LYS B 1 16  ? -5.282  9.208   8.486   1.00 20.43 ? 16  LYS B C   1 
ATOM   2069 O  O   . LYS B 1 16  ? -4.622  10.019  7.852   1.00 21.33 ? 16  LYS B O   1 
ATOM   2070 C  CB  . LYS B 1 16  ? -6.856  10.416  9.927   1.00 21.92 ? 16  LYS B CB  1 
ATOM   2071 C  CG  . LYS B 1 16  ? -8.260  10.781  10.365  1.00 26.87 ? 16  LYS B CG  1 
ATOM   2072 C  CD  . LYS B 1 16  ? -8.968  11.672  9.363   1.00 28.62 ? 16  LYS B CD  1 
ATOM   2073 C  CE  . LYS B 1 16  ? -10.404 11.918  9.830   1.00 36.60 ? 16  LYS B CE  1 
ATOM   2074 N  NZ  . LYS B 1 16  ? -11.213 12.671  8.831   1.00 41.38 ? 16  LYS B NZ  1 
ATOM   2075 N  N   . ASN B 1 17  ? -4.759  8.102   9.023   1.00 16.76 ? 17  ASN B N   1 
ATOM   2076 C  CA  . ASN B 1 17  ? -3.337  7.805   8.899   1.00 17.28 ? 17  ASN B CA  1 
ATOM   2077 C  C   . ASN B 1 17  ? -2.922  6.736   7.900   1.00 19.50 ? 17  ASN B C   1 
ATOM   2078 O  O   . ASN B 1 17  ? -1.804  6.223   7.986   1.00 19.11 ? 17  ASN B O   1 
ATOM   2079 C  CB  . ASN B 1 17  ? -2.765  7.440   10.267  1.00 16.75 ? 17  ASN B CB  1 
ATOM   2080 C  CG  . ASN B 1 17  ? -2.889  8.581   11.261  1.00 19.21 ? 17  ASN B CG  1 
ATOM   2081 O  OD1 . ASN B 1 17  ? -2.591  9.731   10.935  1.00 19.98 ? 17  ASN B OD1 1 
ATOM   2082 N  ND2 . ASN B 1 17  ? -3.322  8.265   12.477  1.00 18.45 ? 17  ASN B ND2 1 
ATOM   2083 N  N   . LEU B 1 18  ? -3.812  6.394   6.971   1.00 18.99 ? 18  LEU B N   1 
ATOM   2084 C  CA  . LEU B 1 18  ? -3.456  5.408   5.964   1.00 18.08 ? 18  LEU B CA  1 
ATOM   2085 C  C   . LEU B 1 18  ? -3.356  6.077   4.605   1.00 18.73 ? 18  LEU B C   1 
ATOM   2086 O  O   . LEU B 1 18  ? -4.164  6.946   4.279   1.00 21.18 ? 18  LEU B O   1 
ATOM   2087 C  CB  . LEU B 1 18  ? -4.500  4.300   5.880   1.00 14.25 ? 18  LEU B CB  1 
ATOM   2088 C  CG  . LEU B 1 18  ? -4.604  3.376   7.102   1.00 19.68 ? 18  LEU B CG  1 
ATOM   2089 C  CD1 . LEU B 1 18  ? -5.745  2.389   6.895   1.00 24.41 ? 18  LEU B CD1 1 
ATOM   2090 C  CD2 . LEU B 1 18  ? -3.266  2.665   7.304   1.00 22.56 ? 18  LEU B CD2 1 
ATOM   2091 N  N   . ILE B 1 19  ? -2.351  5.681   3.835   1.00 17.85 ? 19  ILE B N   1 
ATOM   2092 C  CA  . ILE B 1 19  ? -2.181  6.196   2.477   1.00 17.24 ? 19  ILE B CA  1 
ATOM   2093 C  C   . ILE B 1 19  ? -2.762  5.084   1.606   1.00 22.12 ? 19  ILE B C   1 
ATOM   2094 O  O   . ILE B 1 19  ? -2.301  3.942   1.666   1.00 21.07 ? 19  ILE B O   1 
ATOM   2095 C  CB  . ILE B 1 19  ? -0.694  6.414   2.130   1.00 21.64 ? 19  ILE B CB  1 
ATOM   2096 C  CG1 . ILE B 1 19  ? -0.126  7.556   2.985   1.00 23.91 ? 19  ILE B CG1 1 
ATOM   2097 C  CG2 . ILE B 1 19  ? -0.557  6.767   0.661   1.00 23.08 ? 19  ILE B CG2 1 
ATOM   2098 C  CD1 . ILE B 1 19  ? 1.370   7.694   2.916   1.00 25.61 ? 19  ILE B CD1 1 
ATOM   2099 N  N   . PHE B 1 20  ? -3.793  5.407   0.830   1.00 20.70 ? 20  PHE B N   1 
ATOM   2100 C  CA  . PHE B 1 20  ? -4.406  4.410   -0.045  1.00 20.79 ? 20  PHE B CA  1 
ATOM   2101 C  C   . PHE B 1 20  ? -3.879  4.558   -1.457  1.00 23.62 ? 20  PHE B C   1 
ATOM   2102 O  O   . PHE B 1 20  ? -3.842  5.666   -1.991  1.00 21.19 ? 20  PHE B O   1 
ATOM   2103 C  CB  . PHE B 1 20  ? -5.914  4.579   -0.056  1.00 21.76 ? 20  PHE B CB  1 
ATOM   2104 C  CG  . PHE B 1 20  ? -6.571  4.221   1.231   1.00 22.78 ? 20  PHE B CG  1 
ATOM   2105 C  CD1 . PHE B 1 20  ? -7.022  2.920   1.461   1.00 22.88 ? 20  PHE B CD1 1 
ATOM   2106 C  CD2 . PHE B 1 20  ? -6.771  5.187   2.212   1.00 24.10 ? 20  PHE B CD2 1 
ATOM   2107 C  CE1 . PHE B 1 20  ? -7.664  2.590   2.649   1.00 26.54 ? 20  PHE B CE1 1 
ATOM   2108 C  CE2 . PHE B 1 20  ? -7.413  4.866   3.405   1.00 26.33 ? 20  PHE B CE2 1 
ATOM   2109 C  CZ  . PHE B 1 20  ? -7.861  3.565   3.626   1.00 24.25 ? 20  PHE B CZ  1 
ATOM   2110 N  N   . GLN B 1 21  ? -3.447  3.452   -2.059  1.00 20.10 ? 21  GLN B N   1 
ATOM   2111 C  CA  . GLN B 1 21  ? -2.942  3.510   -3.417  1.00 18.73 ? 21  GLN B CA  1 
ATOM   2112 C  C   . GLN B 1 21  ? -3.691  2.523   -4.283  1.00 21.28 ? 21  GLN B C   1 
ATOM   2113 O  O   . GLN B 1 21  ? -4.104  1.458   -3.815  1.00 20.90 ? 21  GLN B O   1 
ATOM   2114 C  CB  . GLN B 1 21  ? -1.437  3.224   -3.455  1.00 20.94 ? 21  GLN B CB  1 
ATOM   2115 C  CG  . GLN B 1 21  ? -0.627  4.225   -2.615  1.00 21.59 ? 21  GLN B CG  1 
ATOM   2116 C  CD  . GLN B 1 21  ? 0.872   3.987   -2.666  1.00 23.95 ? 21  GLN B CD  1 
ATOM   2117 O  OE1 . GLN B 1 21  ? 1.341   2.848   -2.761  1.00 23.72 ? 21  GLN B OE1 1 
ATOM   2118 N  NE2 . GLN B 1 21  ? 1.640   5.070   -2.583  1.00 20.55 ? 21  GLN B NE2 1 
ATOM   2119 N  N   . GLY B 1 22  ? -3.897  2.878   -5.548  1.00 20.35 ? 22  GLY B N   1 
ATOM   2120 C  CA  . GLY B 1 22  ? -4.606  1.954   -6.417  1.00 20.97 ? 22  GLY B CA  1 
ATOM   2121 C  C   . GLY B 1 22  ? -6.056  1.773   -6.026  1.00 21.44 ? 22  GLY B C   1 
ATOM   2122 O  O   . GLY B 1 22  ? -6.747  2.740   -5.682  1.00 22.24 ? 22  GLY B O   1 
ATOM   2123 N  N   . ASP B 1 23  ? -6.526  0.528   -6.046  1.00 18.91 ? 23  ASP B N   1 
ATOM   2124 C  CA  . ASP B 1 23  ? -7.921  0.229   -5.738  1.00 18.61 ? 23  ASP B CA  1 
ATOM   2125 C  C   . ASP B 1 23  ? -8.254  -0.016  -4.271  1.00 21.76 ? 23  ASP B C   1 
ATOM   2126 O  O   . ASP B 1 23  ? -9.411  -0.253  -3.929  1.00 21.35 ? 23  ASP B O   1 
ATOM   2127 C  CB  . ASP B 1 23  ? -8.397  -0.992  -6.546  1.00 22.08 ? 23  ASP B CB  1 
ATOM   2128 C  CG  . ASP B 1 23  ? -8.289  -0.776  -8.061  1.00 27.43 ? 23  ASP B CG  1 
ATOM   2129 O  OD1 . ASP B 1 23  ? -8.529  0.360   -8.511  1.00 28.24 ? 23  ASP B OD1 1 
ATOM   2130 O  OD2 . ASP B 1 23  ? -7.978  -1.738  -8.800  1.00 23.58 ? 23  ASP B OD2 1 
ATOM   2131 N  N   . ALA B 1 24  ? -7.259  0.055   -3.396  1.00 19.81 ? 24  ALA B N   1 
ATOM   2132 C  CA  . ALA B 1 24  ? -7.511  -0.222  -1.988  1.00 23.09 ? 24  ALA B CA  1 
ATOM   2133 C  C   . ALA B 1 24  ? -8.546  0.706   -1.354  1.00 21.37 ? 24  ALA B C   1 
ATOM   2134 O  O   . ALA B 1 24  ? -8.563  1.904   -1.617  1.00 22.04 ? 24  ALA B O   1 
ATOM   2135 C  CB  . ALA B 1 24  ? -6.192  -0.140  -1.197  1.00 19.97 ? 24  ALA B CB  1 
ATOM   2136 N  N   . GLN B 1 25  ? -9.417  0.137   -0.537  1.00 21.46 ? 25  GLN B N   1 
ATOM   2137 C  CA  . GLN B 1 25  ? -10.402 0.925   0.186   1.00 24.72 ? 25  GLN B CA  1 
ATOM   2138 C  C   . GLN B 1 25  ? -10.969 0.139   1.353   1.00 27.00 ? 25  GLN B C   1 
ATOM   2139 O  O   . GLN B 1 25  ? -10.858 -1.087  1.412   1.00 22.56 ? 25  GLN B O   1 
ATOM   2140 C  CB  . GLN B 1 25  ? -11.526 1.388   -0.735  1.00 32.19 ? 25  GLN B CB  1 
ATOM   2141 C  CG  . GLN B 1 25  ? -12.291 0.298   -1.403  1.00 39.49 ? 25  GLN B CG  1 
ATOM   2142 C  CD  . GLN B 1 25  ? -13.180 0.851   -2.508  1.00 48.11 ? 25  GLN B CD  1 
ATOM   2143 O  OE1 . GLN B 1 25  ? -12.696 1.261   -3.569  1.00 49.99 ? 25  GLN B OE1 1 
ATOM   2144 N  NE2 . GLN B 1 25  ? -14.482 0.884   -2.255  1.00 47.22 ? 25  GLN B NE2 1 
ATOM   2145 N  N   . ILE B 1 26  ? -11.552 0.856   2.303   1.00 22.41 ? 26  ILE B N   1 
ATOM   2146 C  CA  . ILE B 1 26  ? -12.149 0.215   3.460   1.00 22.24 ? 26  ILE B CA  1 
ATOM   2147 C  C   . ILE B 1 26  ? -13.589 -0.169  3.139   1.00 26.21 ? 26  ILE B C   1 
ATOM   2148 O  O   . ILE B 1 26  ? -14.332 0.635   2.590   1.00 29.11 ? 26  ILE B O   1 
ATOM   2149 C  CB  . ILE B 1 26  ? -12.212 1.183   4.667   1.00 30.61 ? 26  ILE B CB  1 
ATOM   2150 C  CG1 . ILE B 1 26  ? -10.808 1.591   5.108   1.00 32.25 ? 26  ILE B CG1 1 
ATOM   2151 C  CG2 . ILE B 1 26  ? -12.994 0.541   5.801   1.00 32.12 ? 26  ILE B CG2 1 
ATOM   2152 C  CD1 . ILE B 1 26  ? -10.003 0.470   5.592   1.00 35.47 ? 26  ILE B CD1 1 
ATOM   2153 N  N   . LYS B 1 27  ? -13.970 -1.395  3.484   1.00 23.45 ? 27  LYS B N   1 
ATOM   2154 C  CA  . LYS B 1 27  ? -15.335 -1.888  3.316   1.00 29.94 ? 27  LYS B CA  1 
ATOM   2155 C  C   . LYS B 1 27  ? -15.600 -2.875  4.447   1.00 30.75 ? 27  LYS B C   1 
ATOM   2156 O  O   . LYS B 1 27  ? -14.781 -3.761  4.711   1.00 25.49 ? 27  LYS B O   1 
ATOM   2157 C  CB  . LYS B 1 27  ? -15.529 -2.600  1.972   1.00 34.19 ? 27  LYS B CB  1 
ATOM   2158 C  CG  . LYS B 1 27  ? -15.719 -1.667  0.784   1.00 43.69 ? 27  LYS B CG  1 
ATOM   2159 N  N   . ASN B 1 28  ? -16.733 -2.704  5.123   1.00 28.79 ? 28  ASN B N   1 
ATOM   2160 C  CA  . ASN B 1 28  ? -17.123 -3.583  6.218   1.00 30.41 ? 28  ASN B CA  1 
ATOM   2161 C  C   . ASN B 1 28  ? -16.046 -3.767  7.295   1.00 28.62 ? 28  ASN B C   1 
ATOM   2162 O  O   . ASN B 1 28  ? -15.781 -4.885  7.730   1.00 26.62 ? 28  ASN B O   1 
ATOM   2163 C  CB  . ASN B 1 28  ? -17.526 -4.954  5.674   1.00 37.04 ? 28  ASN B CB  1 
ATOM   2164 C  CG  . ASN B 1 28  ? -18.622 -4.866  4.627   1.00 45.94 ? 28  ASN B CG  1 
ATOM   2165 O  OD1 . ASN B 1 28  ? -19.608 -4.141  4.804   1.00 51.04 ? 28  ASN B OD1 1 
ATOM   2166 N  ND2 . ASN B 1 28  ? -18.462 -5.609  3.532   1.00 47.09 ? 28  ASN B ND2 1 
ATOM   2167 N  N   . ASN B 1 29  ? -15.445 -2.663  7.715   1.00 25.64 ? 29  ASN B N   1 
ATOM   2168 C  CA  . ASN B 1 29  ? -14.424 -2.668  8.765   1.00 26.57 ? 29  ASN B CA  1 
ATOM   2169 C  C   . ASN B 1 29  ? -13.142 -3.425  8.447   1.00 21.95 ? 29  ASN B C   1 
ATOM   2170 O  O   . ASN B 1 29  ? -12.426 -3.835  9.359   1.00 22.46 ? 29  ASN B O   1 
ATOM   2171 C  CB  . ASN B 1 29  ? -15.002 -3.213  10.068  1.00 29.83 ? 29  ASN B CB  1 
ATOM   2172 C  CG  . ASN B 1 29  ? -16.132 -2.357  10.599  1.00 38.11 ? 29  ASN B CG  1 
ATOM   2173 O  OD1 . ASN B 1 29  ? -15.967 -1.152  10.820  1.00 41.53 ? 29  ASN B OD1 1 
ATOM   2174 N  ND2 . ASN B 1 29  ? -17.290 -2.973  10.805  1.00 42.70 ? 29  ASN B ND2 1 
ATOM   2175 N  N   . ALA B 1 30  ? -12.879 -3.642  7.168   1.00 20.22 ? 30  ALA B N   1 
ATOM   2176 C  CA  . ALA B 1 30  ? -11.648 -4.304  6.754   1.00 16.49 ? 30  ALA B CA  1 
ATOM   2177 C  C   . ALA B 1 30  ? -11.117 -3.559  5.551   1.00 21.61 ? 30  ALA B C   1 
ATOM   2178 O  O   . ALA B 1 30  ? -11.847 -2.803  4.899   1.00 24.72 ? 30  ALA B O   1 
ATOM   2179 C  CB  . ALA B 1 30  ? -11.908 -5.760  6.379   1.00 20.30 ? 30  ALA B CB  1 
ATOM   2180 N  N   . VAL B 1 31  ? -9.842  -3.759  5.243   1.00 17.86 ? 31  VAL B N   1 
ATOM   2181 C  CA  . VAL B 1 31  ? -9.289  -3.126  4.066   1.00 18.94 ? 31  VAL B CA  1 
ATOM   2182 C  C   . VAL B 1 31  ? -9.405  -4.117  2.903   1.00 19.91 ? 31  VAL B C   1 
ATOM   2183 O  O   . VAL B 1 31  ? -8.912  -5.247  2.992   1.00 17.44 ? 31  VAL B O   1 
ATOM   2184 C  CB  . VAL B 1 31  ? -7.800  -2.793  4.230   1.00 20.64 ? 31  VAL B CB  1 
ATOM   2185 C  CG1 . VAL B 1 31  ? -7.285  -2.183  2.926   1.00 20.66 ? 31  VAL B CG1 1 
ATOM   2186 C  CG2 . VAL B 1 31  ? -7.591  -1.831  5.415   1.00 19.45 ? 31  VAL B CG2 1 
ATOM   2187 N  N   . GLN B 1 32  ? -10.093 -3.716  1.842   1.00 16.42 ? 32  GLN B N   1 
ATOM   2188 C  CA  . GLN B 1 32  ? -10.203 -4.558  0.644   1.00 18.73 ? 32  GLN B CA  1 
ATOM   2189 C  C   . GLN B 1 32  ? -9.084  -4.025  -0.233  1.00 17.58 ? 32  GLN B C   1 
ATOM   2190 O  O   . GLN B 1 32  ? -9.200  -2.929  -0.792  1.00 19.47 ? 32  GLN B O   1 
ATOM   2191 C  CB  . GLN B 1 32  ? -11.546 -4.342  -0.067  1.00 20.03 ? 32  GLN B CB  1 
ATOM   2192 C  CG  . GLN B 1 32  ? -12.743 -4.824  0.716   1.00 24.48 ? 32  GLN B CG  1 
ATOM   2193 C  CD  . GLN B 1 32  ? -12.626 -6.277  1.158   1.00 30.24 ? 32  GLN B CD  1 
ATOM   2194 O  OE1 . GLN B 1 32  ? -11.969 -7.102  0.503   1.00 26.69 ? 32  GLN B OE1 1 
ATOM   2195 N  NE2 . GLN B 1 32  ? -13.283 -6.605  2.274   1.00 33.68 ? 32  GLN B NE2 1 
ATOM   2196 N  N   . LEU B 1 33  ? -7.975  -4.761  -0.337  1.00 14.40 ? 33  LEU B N   1 
ATOM   2197 C  CA  . LEU B 1 33  ? -6.854  -4.271  -1.132  1.00 16.34 ? 33  LEU B CA  1 
ATOM   2198 C  C   . LEU B 1 33  ? -7.159  -4.256  -2.623  1.00 18.81 ? 33  LEU B C   1 
ATOM   2199 O  O   . LEU B 1 33  ? -6.751  -3.333  -3.324  1.00 18.94 ? 33  LEU B O   1 
ATOM   2200 C  CB  . LEU B 1 33  ? -5.598  -5.108  -0.860  1.00 17.25 ? 33  LEU B CB  1 
ATOM   2201 C  CG  . LEU B 1 33  ? -5.023  -4.868  0.556   1.00 18.24 ? 33  LEU B CG  1 
ATOM   2202 C  CD1 . LEU B 1 33  ? -3.962  -5.918  0.878   1.00 22.58 ? 33  LEU B CD1 1 
ATOM   2203 C  CD2 . LEU B 1 33  ? -4.413  -3.456  0.637   1.00 21.87 ? 33  LEU B CD2 1 
ATOM   2204 N  N   . THR B 1 34  ? -7.878  -5.279  -3.090  1.00 18.30 ? 34  THR B N   1 
ATOM   2205 C  CA  . THR B 1 34  ? -8.228  -5.368  -4.500  1.00 17.89 ? 34  THR B CA  1 
ATOM   2206 C  C   . THR B 1 34  ? -9.692  -5.059  -4.679  1.00 21.11 ? 34  THR B C   1 
ATOM   2207 O  O   . THR B 1 34  ? -10.504 -5.239  -3.769  1.00 19.26 ? 34  THR B O   1 
ATOM   2208 C  CB  . THR B 1 34  ? -7.879  -6.741  -5.086  1.00 15.61 ? 34  THR B CB  1 
ATOM   2209 O  OG1 . THR B 1 34  ? -8.272  -7.781  -4.174  1.00 16.27 ? 34  THR B OG1 1 
ATOM   2210 C  CG2 . THR B 1 34  ? -6.354  -6.821  -5.324  1.00 18.89 ? 34  THR B CG2 1 
ATOM   2211 N  N   . LYS B 1 35  ? -10.020 -4.562  -5.861  1.00 22.74 ? 35  LYS B N   1 
ATOM   2212 C  CA  . LYS B 1 35  ? -11.379 -4.142  -6.161  1.00 25.33 ? 35  LYS B CA  1 
ATOM   2213 C  C   . LYS B 1 35  ? -12.437 -5.228  -6.143  1.00 26.13 ? 35  LYS B C   1 
ATOM   2214 O  O   . LYS B 1 35  ? -12.194 -6.345  -6.580  1.00 23.07 ? 35  LYS B O   1 
ATOM   2215 C  CB  . LYS B 1 35  ? -11.388 -3.473  -7.529  1.00 25.67 ? 35  LYS B CB  1 
ATOM   2216 C  CG  . LYS B 1 35  ? -12.750 -2.944  -7.948  1.00 31.19 ? 35  LYS B CG  1 
ATOM   2217 C  CD  . LYS B 1 35  ? -12.571 -1.835  -8.969  1.00 35.16 ? 35  LYS B CD  1 
ATOM   2218 C  CE  . LYS B 1 35  ? -11.501 -2.199  -10.005 1.00 38.38 ? 35  LYS B CE  1 
ATOM   2219 N  N   . THR B 1 36  ? -13.624 -4.882  -5.659  1.00 29.55 ? 36  THR B N   1 
ATOM   2220 C  CA  . THR B 1 36  ? -14.745 -5.818  -5.632  1.00 33.74 ? 36  THR B CA  1 
ATOM   2221 C  C   . THR B 1 36  ? -15.914 -5.080  -6.264  1.00 39.03 ? 36  THR B C   1 
ATOM   2222 O  O   . THR B 1 36  ? -15.985 -3.851  -6.173  1.00 37.99 ? 36  THR B O   1 
ATOM   2223 C  CB  . THR B 1 36  ? -15.145 -6.193  -4.203  1.00 37.80 ? 36  THR B CB  1 
ATOM   2224 O  OG1 . THR B 1 36  ? -15.436 -4.997  -3.461  1.00 37.97 ? 36  THR B OG1 1 
ATOM   2225 C  CG2 . THR B 1 36  ? -14.020 -6.959  -3.515  1.00 32.86 ? 36  THR B CG2 1 
ATOM   2226 N  N   . ASP B 1 37  ? -16.817 -5.807  -6.918  1.00 41.17 ? 37  ASP B N   1 
ATOM   2227 C  CA  . ASP B 1 37  ? -17.978 -5.159  -7.525  1.00 44.50 ? 37  ASP B CA  1 
ATOM   2228 C  C   . ASP B 1 37  ? -18.999 -4.841  -6.427  1.00 46.82 ? 37  ASP B C   1 
ATOM   2229 O  O   . ASP B 1 37  ? -18.710 -4.998  -5.237  1.00 44.37 ? 37  ASP B O   1 
ATOM   2230 C  CB  . ASP B 1 37  ? -18.617 -6.058  -8.592  1.00 45.24 ? 37  ASP B CB  1 
ATOM   2231 C  CG  . ASP B 1 37  ? -19.091 -7.390  -8.035  1.00 45.02 ? 37  ASP B CG  1 
ATOM   2232 O  OD1 . ASP B 1 37  ? -19.463 -7.454  -6.848  1.00 46.48 ? 37  ASP B OD1 1 
ATOM   2233 O  OD2 . ASP B 1 37  ? -19.109 -8.378  -8.794  1.00 49.00 ? 37  ASP B OD2 1 
ATOM   2234 N  N   . SER B 1 38  ? -20.192 -4.408  -6.826  1.00 49.65 ? 38  SER B N   1 
ATOM   2235 C  CA  . SER B 1 38  ? -21.246 -4.051  -5.873  1.00 51.70 ? 38  SER B CA  1 
ATOM   2236 C  C   . SER B 1 38  ? -21.600 -5.163  -4.904  1.00 51.65 ? 38  SER B C   1 
ATOM   2237 O  O   . SER B 1 38  ? -21.838 -4.904  -3.724  1.00 52.12 ? 38  SER B O   1 
ATOM   2238 C  CB  . SER B 1 38  ? -22.505 -3.623  -6.619  1.00 53.39 ? 38  SER B CB  1 
ATOM   2239 O  OG  . SER B 1 38  ? -22.217 -2.553  -7.501  1.00 57.17 ? 38  SER B OG  1 
ATOM   2240 N  N   . ASN B 1 39  ? -21.631 -6.396  -5.404  1.00 50.91 ? 39  ASN B N   1 
ATOM   2241 C  CA  . ASN B 1 39  ? -21.961 -7.557  -4.579  1.00 52.74 ? 39  ASN B CA  1 
ATOM   2242 C  C   . ASN B 1 39  ? -20.782 -8.063  -3.732  1.00 52.04 ? 39  ASN B C   1 
ATOM   2243 O  O   . ASN B 1 39  ? -20.882 -9.103  -3.075  1.00 53.36 ? 39  ASN B O   1 
ATOM   2244 C  CB  . ASN B 1 39  ? -22.482 -8.693  -5.468  1.00 55.15 ? 39  ASN B CB  1 
ATOM   2245 N  N   . GLY B 1 40  ? -19.669 -7.335  -3.747  1.00 49.34 ? 40  GLY B N   1 
ATOM   2246 C  CA  . GLY B 1 40  ? -18.511 -7.744  -2.970  1.00 46.34 ? 40  GLY B CA  1 
ATOM   2247 C  C   . GLY B 1 40  ? -17.696 -8.868  -3.592  1.00 42.94 ? 40  GLY B C   1 
ATOM   2248 O  O   . GLY B 1 40  ? -16.858 -9.482  -2.926  1.00 42.75 ? 40  GLY B O   1 
ATOM   2249 N  N   . ASN B 1 41  ? -17.947 -9.146  -4.864  1.00 38.66 ? 41  ASN B N   1 
ATOM   2250 C  CA  . ASN B 1 41  ? -17.222 -10.197 -5.572  1.00 37.91 ? 41  ASN B CA  1 
ATOM   2251 C  C   . ASN B 1 41  ? -15.941 -9.638  -6.164  1.00 33.80 ? 41  ASN B C   1 
ATOM   2252 O  O   . ASN B 1 41  ? -15.898 -8.485  -6.585  1.00 30.75 ? 41  ASN B O   1 
ATOM   2253 C  CB  . ASN B 1 41  ? -18.080 -10.763 -6.694  1.00 41.25 ? 41  ASN B CB  1 
ATOM   2254 C  CG  . ASN B 1 41  ? -19.247 -11.567 -6.178  1.00 43.70 ? 41  ASN B CG  1 
ATOM   2255 O  OD1 . ASN B 1 41  ? -20.251 -11.716 -6.863  1.00 48.35 ? 41  ASN B OD1 1 
ATOM   2256 N  ND2 . ASN B 1 41  ? -19.114 -12.107 -4.969  1.00 45.71 ? 41  ASN B ND2 1 
ATOM   2257 N  N   . PRO B 1 42  ? -14.877 -10.452 -6.202  1.00 27.46 ? 42  PRO B N   1 
ATOM   2258 C  CA  . PRO B 1 42  ? -13.604 -9.982  -6.759  1.00 25.67 ? 42  PRO B CA  1 
ATOM   2259 C  C   . PRO B 1 42  ? -13.657 -9.881  -8.279  1.00 27.64 ? 42  PRO B C   1 
ATOM   2260 O  O   . PRO B 1 42  ? -14.398 -10.626 -8.932  1.00 26.00 ? 42  PRO B O   1 
ATOM   2261 C  CB  . PRO B 1 42  ? -12.608 -11.040 -6.287  1.00 22.24 ? 42  PRO B CB  1 
ATOM   2262 C  CG  . PRO B 1 42  ? -13.453 -12.304 -6.303  1.00 31.03 ? 42  PRO B CG  1 
ATOM   2263 C  CD  . PRO B 1 42  ? -14.769 -11.828 -5.688  1.00 26.51 ? 42  PRO B CD  1 
ATOM   2264 N  N   . VAL B 1 43  ? -12.867 -8.966  -8.830  1.00 25.87 ? 43  VAL B N   1 
ATOM   2265 C  CA  . VAL B 1 43  ? -12.802 -8.762  -10.272 1.00 28.75 ? 43  VAL B CA  1 
ATOM   2266 C  C   . VAL B 1 43  ? -11.350 -8.817  -10.715 1.00 28.01 ? 43  VAL B C   1 
ATOM   2267 O  O   . VAL B 1 43  ? -10.426 -8.673  -9.908  1.00 21.94 ? 43  VAL B O   1 
ATOM   2268 C  CB  . VAL B 1 43  ? -13.412 -7.389  -10.692 1.00 28.98 ? 43  VAL B CB  1 
ATOM   2269 C  CG1 . VAL B 1 43  ? -14.842 -7.291  -10.209 1.00 29.42 ? 43  VAL B CG1 1 
ATOM   2270 C  CG2 . VAL B 1 43  ? -12.596 -6.242  -10.123 1.00 28.51 ? 43  VAL B CG2 1 
ATOM   2271 N  N   . ALA B 1 44  ? -11.145 -9.019  -12.005 1.00 23.59 ? 44  ALA B N   1 
ATOM   2272 C  CA  . ALA B 1 44  ? -9.796  -9.085  -12.540 1.00 24.64 ? 44  ALA B CA  1 
ATOM   2273 C  C   . ALA B 1 44  ? -9.135  -7.721  -12.765 1.00 24.03 ? 44  ALA B C   1 
ATOM   2274 O  O   . ALA B 1 44  ? -9.786  -6.676  -12.696 1.00 23.50 ? 44  ALA B O   1 
ATOM   2275 C  CB  . ALA B 1 44  ? -9.823  -9.848  -13.858 1.00 29.59 ? 44  ALA B CB  1 
ATOM   2276 N  N   . SER B 1 45  ? -7.823  -7.776  -12.992 1.00 23.33 ? 45  SER B N   1 
ATOM   2277 C  CA  A SER B 1 45  ? -7.017  -6.595  -13.276 0.33 24.20 ? 45  SER B CA  1 
ATOM   2278 C  CA  B SER B 1 45  ? -7.009  -6.600  -13.274 0.33 24.82 ? 45  SER B CA  1 
ATOM   2279 C  CA  C SER B 1 45  ? -7.015  -6.598  -13.277 0.33 24.67 ? 45  SER B CA  1 
ATOM   2280 C  C   . SER B 1 45  ? -7.135  -5.475  -12.254 1.00 25.97 ? 45  SER B C   1 
ATOM   2281 O  O   . SER B 1 45  ? -7.594  -4.371  -12.578 1.00 24.08 ? 45  SER B O   1 
ATOM   2282 C  CB  A SER B 1 45  ? -7.386  -6.058  -14.659 0.33 26.73 ? 45  SER B CB  1 
ATOM   2283 C  CB  B SER B 1 45  ? -7.353  -6.065  -14.667 0.33 27.79 ? 45  SER B CB  1 
ATOM   2284 C  CB  C SER B 1 45  ? -7.370  -6.063  -14.669 0.33 27.58 ? 45  SER B CB  1 
ATOM   2285 O  OG  A SER B 1 45  ? -7.362  -7.101  -15.609 0.33 23.62 ? 45  SER B OG  1 
ATOM   2286 O  OG  B SER B 1 45  ? -8.701  -5.636  -14.718 0.33 29.97 ? 45  SER B OG  1 
ATOM   2287 O  OG  C SER B 1 45  ? -6.656  -4.875  -14.954 0.33 27.69 ? 45  SER B OG  1 
ATOM   2288 N  N   . THR B 1 46  ? -6.710  -5.745  -11.023 1.00 21.37 ? 46  THR B N   1 
ATOM   2289 C  CA  . THR B 1 46  ? -6.789  -4.725  -9.989  1.00 17.76 ? 46  THR B CA  1 
ATOM   2290 C  C   . THR B 1 46  ? -5.551  -4.829  -9.107  1.00 19.30 ? 46  THR B C   1 
ATOM   2291 O  O   . THR B 1 46  ? -4.982  -5.902  -8.962  1.00 18.12 ? 46  THR B O   1 
ATOM   2292 C  CB  . THR B 1 46  ? -8.074  -4.913  -9.142  1.00 19.03 ? 46  THR B CB  1 
ATOM   2293 O  OG1 . THR B 1 46  ? -7.971  -4.131  -7.946  1.00 20.84 ? 46  THR B OG1 1 
ATOM   2294 C  CG2 . THR B 1 46  ? -8.283  -6.400  -8.792  1.00 19.20 ? 46  THR B CG2 1 
ATOM   2295 N  N   . VAL B 1 47  ? -5.122  -3.699  -8.563  1.00 18.61 ? 47  VAL B N   1 
ATOM   2296 C  CA  . VAL B 1 47  ? -3.956  -3.649  -7.688  1.00 20.07 ? 47  VAL B CA  1 
ATOM   2297 C  C   . VAL B 1 47  ? -4.289  -2.598  -6.646  1.00 20.88 ? 47  VAL B C   1 
ATOM   2298 O  O   . VAL B 1 47  ? -4.953  -1.597  -6.949  1.00 20.13 ? 47  VAL B O   1 
ATOM   2299 C  CB  . VAL B 1 47  ? -2.690  -3.178  -8.436  1.00 22.20 ? 47  VAL B CB  1 
ATOM   2300 C  CG1 . VAL B 1 47  ? -1.472  -3.208  -7.494  1.00 19.54 ? 47  VAL B CG1 1 
ATOM   2301 C  CG2 . VAL B 1 47  ? -2.409  -4.079  -9.616  1.00 27.69 ? 47  VAL B CG2 1 
ATOM   2302 N  N   . GLY B 1 48  ? -3.844  -2.822  -5.420  1.00 17.44 ? 48  GLY B N   1 
ATOM   2303 C  CA  . GLY B 1 48  ? -4.110  -1.848  -4.374  1.00 17.51 ? 48  GLY B CA  1 
ATOM   2304 C  C   . GLY B 1 48  ? -3.095  -2.029  -3.265  1.00 17.64 ? 48  GLY B C   1 
ATOM   2305 O  O   . GLY B 1 48  ? -2.629  -3.145  -3.043  1.00 17.52 ? 48  GLY B O   1 
ATOM   2306 N  N   . ARG B 1 49  ? -2.742  -0.940  -2.575  1.00 14.89 ? 49  ARG B N   1 
ATOM   2307 C  CA  . ARG B 1 49  ? -1.771  -1.010  -1.484  1.00 12.23 ? 49  ARG B CA  1 
ATOM   2308 C  C   . ARG B 1 49  ? -2.186  0.008   -0.431  1.00 13.70 ? 49  ARG B C   1 
ATOM   2309 O  O   . ARG B 1 49  ? -2.958  0.929   -0.716  1.00 16.79 ? 49  ARG B O   1 
ATOM   2310 C  CB  . ARG B 1 49  ? -0.360  -0.623  -1.977  1.00 13.36 ? 49  ARG B CB  1 
ATOM   2311 C  CG  . ARG B 1 49  ? 0.033   -1.218  -3.357  1.00 15.05 ? 49  ARG B CG  1 
ATOM   2312 C  CD  . ARG B 1 49  ? 1.532   -1.232  -3.619  1.00 17.47 ? 49  ARG B CD  1 
ATOM   2313 N  NE  . ARG B 1 49  ? 2.168   0.077   -3.447  1.00 19.04 ? 49  ARG B NE  1 
ATOM   2314 C  CZ  . ARG B 1 49  ? 3.448   0.312   -3.700  1.00 21.21 ? 49  ARG B CZ  1 
ATOM   2315 N  NH1 . ARG B 1 49  ? 4.217   -0.671  -4.159  1.00 21.06 ? 49  ARG B NH1 1 
ATOM   2316 N  NH2 . ARG B 1 49  ? 3.974   1.517   -3.439  1.00 20.26 ? 49  ARG B NH2 1 
ATOM   2317 N  N   . ILE B 1 50  ? -1.742  -0.209  0.804   1.00 15.21 ? 50  ILE B N   1 
ATOM   2318 C  CA  . ILE B 1 50  ? -1.965  0.800   1.833   1.00 16.96 ? 50  ILE B CA  1 
ATOM   2319 C  C   . ILE B 1 50  ? -0.636  0.922   2.557   1.00 17.40 ? 50  ILE B C   1 
ATOM   2320 O  O   . ILE B 1 50  ? 0.138   -0.030  2.631   1.00 18.31 ? 50  ILE B O   1 
ATOM   2321 C  CB  . ILE B 1 50  ? -3.045  0.437   2.888   1.00 17.32 ? 50  ILE B CB  1 
ATOM   2322 C  CG1 . ILE B 1 50  ? -2.697  -0.874  3.592   1.00 18.60 ? 50  ILE B CG1 1 
ATOM   2323 C  CG2 . ILE B 1 50  ? -4.412  0.429   2.237   1.00 21.73 ? 50  ILE B CG2 1 
ATOM   2324 C  CD1 . ILE B 1 50  ? -3.354  -0.994  4.978   1.00 21.45 ? 50  ILE B CD1 1 
ATOM   2325 N  N   . LEU B 1 51  ? -0.363  2.116   3.064   1.00 16.26 ? 51  LEU B N   1 
ATOM   2326 C  CA  A LEU B 1 51  ? 0.857   2.370   3.812   0.50 17.22 ? 51  LEU B CA  1 
ATOM   2327 C  CA  B LEU B 1 51  ? 0.857   2.369   3.813   0.50 17.23 ? 51  LEU B CA  1 
ATOM   2328 C  C   . LEU B 1 51  ? 0.487   3.170   5.050   1.00 16.93 ? 51  LEU B C   1 
ATOM   2329 O  O   . LEU B 1 51  ? -0.450  3.962   5.012   1.00 16.41 ? 51  LEU B O   1 
ATOM   2330 C  CB  A LEU B 1 51  ? 1.828   3.192   2.973   0.50 20.19 ? 51  LEU B CB  1 
ATOM   2331 C  CB  B LEU B 1 51  ? 1.835   3.190   2.979   0.50 20.16 ? 51  LEU B CB  1 
ATOM   2332 C  CG  A LEU B 1 51  ? 2.338   2.542   1.686   0.50 23.57 ? 51  LEU B CG  1 
ATOM   2333 C  CG  B LEU B 1 51  ? 2.410   2.542   1.719   0.50 23.76 ? 51  LEU B CG  1 
ATOM   2334 C  CD1 A LEU B 1 51  ? 2.981   3.594   0.812   0.50 30.57 ? 51  LEU B CD1 1 
ATOM   2335 C  CD1 B LEU B 1 51  ? 3.084   3.604   0.879   0.50 30.36 ? 51  LEU B CD1 1 
ATOM   2336 C  CD2 A LEU B 1 51  ? 3.337   1.453   2.035   0.50 25.93 ? 51  LEU B CD2 1 
ATOM   2337 C  CD2 B LEU B 1 51  ? 3.409   1.466   2.111   0.50 25.74 ? 51  LEU B CD2 1 
ATOM   2338 N  N   . PHE B 1 52  ? 1.212   2.965   6.150   1.00 15.32 ? 52  PHE B N   1 
ATOM   2339 C  CA  . PHE B 1 52  ? 0.900   3.779   7.322   1.00 14.14 ? 52  PHE B CA  1 
ATOM   2340 C  C   . PHE B 1 52  ? 1.581   5.118   7.009   1.00 17.46 ? 52  PHE B C   1 
ATOM   2341 O  O   . PHE B 1 52  ? 2.698   5.147   6.485   1.00 18.12 ? 52  PHE B O   1 
ATOM   2342 C  CB  . PHE B 1 52  ? 1.469   3.184   8.595   1.00 13.83 ? 52  PHE B CB  1 
ATOM   2343 C  CG  . PHE B 1 52  ? 1.026   3.921   9.830   1.00 18.48 ? 52  PHE B CG  1 
ATOM   2344 C  CD1 . PHE B 1 52  ? -0.303  3.855   10.245  1.00 18.39 ? 52  PHE B CD1 1 
ATOM   2345 C  CD2 . PHE B 1 52  ? 1.928   4.665   10.574  1.00 21.50 ? 52  PHE B CD2 1 
ATOM   2346 C  CE1 . PHE B 1 52  ? -0.732  4.514   11.387  1.00 19.05 ? 52  PHE B CE1 1 
ATOM   2347 C  CE2 . PHE B 1 52  ? 1.509   5.337   11.726  1.00 20.56 ? 52  PHE B CE2 1 
ATOM   2348 C  CZ  . PHE B 1 52  ? 0.184   5.259   12.129  1.00 17.73 ? 52  PHE B CZ  1 
ATOM   2349 N  N   . SER B 1 53  ? 0.929   6.224   7.355   1.00 17.79 ? 53  SER B N   1 
ATOM   2350 C  CA  A SER B 1 53  ? 1.470   7.538   7.029   0.50 17.97 ? 53  SER B CA  1 
ATOM   2351 C  CA  B SER B 1 53  ? 1.450   7.555   7.063   0.50 19.77 ? 53  SER B CA  1 
ATOM   2352 C  C   . SER B 1 53  ? 2.769   7.931   7.728   1.00 20.71 ? 53  SER B C   1 
ATOM   2353 O  O   . SER B 1 53  ? 3.655   8.503   7.092   1.00 21.66 ? 53  SER B O   1 
ATOM   2354 C  CB  A SER B 1 53  ? 0.401   8.616   7.254   0.50 19.03 ? 53  SER B CB  1 
ATOM   2355 C  CB  B SER B 1 53  ? 0.399   8.615   7.415   0.50 21.77 ? 53  SER B CB  1 
ATOM   2356 O  OG  A SER B 1 53  ? 0.097   8.750   8.623   0.50 14.23 ? 53  SER B OG  1 
ATOM   2357 O  OG  B SER B 1 53  ? 0.921   9.914   7.193   0.50 28.71 ? 53  SER B OG  1 
ATOM   2358 N  N   . ALA B 1 54  ? 2.907   7.633   9.017   1.00 19.43 ? 54  ALA B N   1 
ATOM   2359 C  CA  . ALA B 1 54  ? 4.159   8.003   9.692   1.00 20.93 ? 54  ALA B CA  1 
ATOM   2360 C  C   . ALA B 1 54  ? 5.336   7.148   9.228   1.00 19.47 ? 54  ALA B C   1 
ATOM   2361 O  O   . ALA B 1 54  ? 5.219   5.930   9.056   1.00 19.80 ? 54  ALA B O   1 
ATOM   2362 C  CB  . ALA B 1 54  ? 4.001   7.903   11.220  1.00 18.75 ? 54  ALA B CB  1 
ATOM   2363 N  N   . GLN B 1 55  ? 6.475   7.789   9.003   1.00 17.33 ? 55  GLN B N   1 
ATOM   2364 C  CA  . GLN B 1 55  ? 7.658   7.052   8.574   1.00 19.02 ? 55  GLN B CA  1 
ATOM   2365 C  C   . GLN B 1 55  ? 8.294   6.331   9.748   1.00 19.12 ? 55  GLN B C   1 
ATOM   2366 O  O   . GLN B 1 55  ? 8.276   6.828   10.878  1.00 16.85 ? 55  GLN B O   1 
ATOM   2367 C  CB  . GLN B 1 55  ? 8.651   8.013   7.901   1.00 18.83 ? 55  GLN B CB  1 
ATOM   2368 C  CG  . GLN B 1 55  ? 8.065   8.639   6.630   1.00 22.06 ? 55  GLN B CG  1 
ATOM   2369 C  CD  . GLN B 1 55  ? 9.027   9.571   5.927   1.00 24.36 ? 55  GLN B CD  1 
ATOM   2370 O  OE1 . GLN B 1 55  ? 10.229  9.309   5.860   1.00 23.05 ? 55  GLN B OE1 1 
ATOM   2371 N  NE2 . GLN B 1 55  ? 8.502   10.665  5.395   1.00 27.00 ? 55  GLN B NE2 1 
ATOM   2372 N  N   . VAL B 1 56  ? 8.843   5.144   9.485   1.00 16.87 ? 56  VAL B N   1 
ATOM   2373 C  CA  . VAL B 1 56  ? 9.472   4.338   10.530  1.00 16.74 ? 56  VAL B CA  1 
ATOM   2374 C  C   . VAL B 1 56  ? 10.970  4.515   10.458  1.00 19.79 ? 56  VAL B C   1 
ATOM   2375 O  O   . VAL B 1 56  ? 11.529  4.481   9.370   1.00 18.05 ? 56  VAL B O   1 
ATOM   2376 C  CB  . VAL B 1 56  ? 9.163   2.848   10.348  1.00 19.15 ? 56  VAL B CB  1 
ATOM   2377 C  CG1 . VAL B 1 56  ? 9.843   2.024   11.450  1.00 18.83 ? 56  VAL B CG1 1 
ATOM   2378 C  CG2 . VAL B 1 56  ? 7.638   2.642   10.373  1.00 22.30 ? 56  VAL B CG2 1 
ATOM   2379 N  N   . HIS B 1 57  ? 11.615  4.718   11.603  1.00 18.68 ? 57  HIS B N   1 
ATOM   2380 C  CA  . HIS B 1 57  ? 13.070  4.880   11.596  1.00 19.94 ? 57  HIS B CA  1 
ATOM   2381 C  C   . HIS B 1 57  ? 13.625  3.480   11.770  1.00 19.51 ? 57  HIS B C   1 
ATOM   2382 O  O   . HIS B 1 57  ? 13.679  2.955   12.880  1.00 20.25 ? 57  HIS B O   1 
ATOM   2383 C  CB  . HIS B 1 57  ? 13.528  5.821   12.733  1.00 19.66 ? 57  HIS B CB  1 
ATOM   2384 C  CG  . HIS B 1 57  ? 14.856  6.461   12.475  1.00 26.53 ? 57  HIS B CG  1 
ATOM   2385 N  ND1 . HIS B 1 57  ? 15.427  7.378   13.335  1.00 23.33 ? 57  HIS B ND1 1 
ATOM   2386 C  CD2 . HIS B 1 57  ? 15.723  6.326   11.441  1.00 28.65 ? 57  HIS B CD2 1 
ATOM   2387 C  CE1 . HIS B 1 57  ? 16.586  7.780   12.841  1.00 27.86 ? 57  HIS B CE1 1 
ATOM   2388 N  NE2 . HIS B 1 57  ? 16.791  7.157   11.693  1.00 31.27 ? 57  HIS B NE2 1 
ATOM   2389 N  N   . LEU B 1 58  ? 14.016  2.873   10.645  1.00 19.96 ? 58  LEU B N   1 
ATOM   2390 C  CA  . LEU B 1 58  ? 14.520  1.502   10.586  1.00 21.50 ? 58  LEU B CA  1 
ATOM   2391 C  C   . LEU B 1 58  ? 15.956  1.350   11.080  1.00 21.14 ? 58  LEU B C   1 
ATOM   2392 O  O   . LEU B 1 58  ? 16.286  0.371   11.752  1.00 19.16 ? 58  LEU B O   1 
ATOM   2393 C  CB  . LEU B 1 58  ? 14.393  0.989   9.144   1.00 20.99 ? 58  LEU B CB  1 
ATOM   2394 C  CG  . LEU B 1 58  ? 14.664  -0.489  8.870   1.00 25.51 ? 58  LEU B CG  1 
ATOM   2395 C  CD1 . LEU B 1 58  ? 13.676  -1.349  9.614   1.00 23.54 ? 58  LEU B CD1 1 
ATOM   2396 C  CD2 . LEU B 1 58  ? 14.561  -0.734  7.361   1.00 25.40 ? 58  LEU B CD2 1 
ATOM   2397 N  N   . TRP B 1 59  ? 16.823  2.293   10.722  1.00 19.34 ? 59  TRP B N   1 
ATOM   2398 C  CA  . TRP B 1 59  ? 18.189  2.236   11.224  1.00 22.97 ? 59  TRP B CA  1 
ATOM   2399 C  C   . TRP B 1 59  ? 18.770  3.637   11.235  1.00 24.85 ? 59  TRP B C   1 
ATOM   2400 O  O   . TRP B 1 59  ? 18.247  4.543   10.576  1.00 22.88 ? 59  TRP B O   1 
ATOM   2401 C  CB  . TRP B 1 59  ? 19.074  1.265   10.426  1.00 22.88 ? 59  TRP B CB  1 
ATOM   2402 C  CG  . TRP B 1 59  ? 19.228  1.544   8.971   1.00 26.66 ? 59  TRP B CG  1 
ATOM   2403 C  CD1 . TRP B 1 59  ? 18.326  1.285   7.980   1.00 26.79 ? 59  TRP B CD1 1 
ATOM   2404 C  CD2 . TRP B 1 59  ? 20.386  2.090   8.328   1.00 31.63 ? 59  TRP B CD2 1 
ATOM   2405 N  NE1 . TRP B 1 59  ? 18.853  1.632   6.753   1.00 29.63 ? 59  TRP B NE1 1 
ATOM   2406 C  CE2 . TRP B 1 59  ? 20.116  2.131   6.939   1.00 32.01 ? 59  TRP B CE2 1 
ATOM   2407 C  CE3 . TRP B 1 59  ? 21.628  2.553   8.790   1.00 35.16 ? 59  TRP B CE3 1 
ATOM   2408 C  CZ2 . TRP B 1 59  ? 21.045  2.611   6.006   1.00 36.33 ? 59  TRP B CZ2 1 
ATOM   2409 C  CZ3 . TRP B 1 59  ? 22.553  3.031   7.861   1.00 33.91 ? 59  TRP B CZ3 1 
ATOM   2410 C  CH2 . TRP B 1 59  ? 22.253  3.057   6.487   1.00 34.54 ? 59  TRP B CH2 1 
ATOM   2411 N  N   . GLU B 1 60  ? 19.845  3.814   11.991  1.00 29.24 ? 60  GLU B N   1 
ATOM   2412 C  CA  . GLU B 1 60  ? 20.448  5.134   12.132  1.00 35.34 ? 60  GLU B CA  1 
ATOM   2413 C  C   . GLU B 1 60  ? 21.955  5.045   11.973  1.00 37.81 ? 60  GLU B C   1 
ATOM   2414 O  O   . GLU B 1 60  ? 22.651  4.535   12.843  1.00 38.51 ? 60  GLU B O   1 
ATOM   2415 C  CB  . GLU B 1 60  ? 20.078  5.705   13.506  1.00 36.16 ? 60  GLU B CB  1 
ATOM   2416 C  CG  . GLU B 1 60  ? 20.425  7.164   13.701  1.00 39.61 ? 60  GLU B CG  1 
ATOM   2417 C  CD  . GLU B 1 60  ? 19.890  7.719   15.017  1.00 43.35 ? 60  GLU B CD  1 
ATOM   2418 O  OE1 . GLU B 1 60  ? 20.324  7.246   16.090  1.00 41.79 ? 60  GLU B OE1 1 
ATOM   2419 O  OE2 . GLU B 1 60  ? 19.027  8.622   14.978  1.00 42.00 ? 60  GLU B OE2 1 
ATOM   2420 N  N   . LYS B 1 61  ? 22.447  5.544   10.847  1.00 40.68 ? 61  LYS B N   1 
ATOM   2421 C  CA  . LYS B 1 61  ? 23.869  5.503   10.552  1.00 45.70 ? 61  LYS B CA  1 
ATOM   2422 C  C   . LYS B 1 61  ? 24.690  6.104   11.694  1.00 46.61 ? 61  LYS B C   1 
ATOM   2423 O  O   . LYS B 1 61  ? 25.524  5.431   12.299  1.00 46.24 ? 61  LYS B O   1 
ATOM   2424 C  CB  . LYS B 1 61  ? 24.134  6.257   9.248   1.00 48.39 ? 61  LYS B CB  1 
ATOM   2425 C  CG  . LYS B 1 61  ? 25.485  5.962   8.623   1.00 53.14 ? 61  LYS B CG  1 
ATOM   2426 C  CD  . LYS B 1 61  ? 25.637  6.675   7.289   1.00 55.62 ? 61  LYS B CD  1 
ATOM   2427 N  N   . SER B 1 62  ? 24.414  7.359   12.014  1.00 47.87 ? 62  SER B N   1 
ATOM   2428 C  CA  . SER B 1 62  ? 25.147  8.057   13.064  1.00 49.63 ? 62  SER B CA  1 
ATOM   2429 C  C   . SER B 1 62  ? 25.302  7.330   14.402  1.00 49.57 ? 62  SER B C   1 
ATOM   2430 O  O   . SER B 1 62  ? 26.340  7.455   15.052  1.00 50.53 ? 62  SER B O   1 
ATOM   2431 C  CB  . SER B 1 62  ? 24.520  9.432   13.311  1.00 47.96 ? 62  SER B CB  1 
ATOM   2432 O  OG  . SER B 1 62  ? 23.292  9.321   14.006  1.00 51.96 ? 62  SER B OG  1 
ATOM   2433 N  N   . SER B 1 63  ? 24.298  6.567   14.823  1.00 47.64 ? 63  SER B N   1 
ATOM   2434 C  CA  . SER B 1 63  ? 24.398  5.888   16.111  1.00 43.66 ? 63  SER B CA  1 
ATOM   2435 C  C   . SER B 1 63  ? 24.610  4.375   16.061  1.00 42.69 ? 63  SER B C   1 
ATOM   2436 O  O   . SER B 1 63  ? 24.639  3.721   17.106  1.00 42.33 ? 63  SER B O   1 
ATOM   2437 C  CB  . SER B 1 63  ? 23.159  6.195   16.959  1.00 46.72 ? 63  SER B CB  1 
ATOM   2438 O  OG  . SER B 1 63  ? 21.989  5.649   16.374  1.00 44.75 ? 63  SER B OG  1 
ATOM   2439 N  N   . SER B 1 64  ? 24.754  3.812   14.866  1.00 40.58 ? 64  SER B N   1 
ATOM   2440 C  CA  . SER B 1 64  ? 24.958  2.373   14.751  1.00 40.14 ? 64  SER B CA  1 
ATOM   2441 C  C   . SER B 1 64  ? 23.774  1.556   15.327  1.00 37.85 ? 64  SER B C   1 
ATOM   2442 O  O   . SER B 1 64  ? 23.951  0.450   15.839  1.00 39.98 ? 64  SER B O   1 
ATOM   2443 C  CB  . SER B 1 64  ? 26.264  1.992   15.463  1.00 44.40 ? 64  SER B CB  1 
ATOM   2444 O  OG  . SER B 1 64  ? 26.464  0.588   15.483  1.00 51.80 ? 64  SER B OG  1 
ATOM   2445 N  N   . ARG B 1 65  ? 22.566  2.102   15.257  1.00 30.51 ? 65  ARG B N   1 
ATOM   2446 C  CA  . ARG B 1 65  ? 21.413  1.371   15.770  1.00 26.23 ? 65  ARG B CA  1 
ATOM   2447 C  C   . ARG B 1 65  ? 20.540  0.862   14.629  1.00 23.35 ? 65  ARG B C   1 
ATOM   2448 O  O   . ARG B 1 65  ? 20.515  1.444   13.541  1.00 22.45 ? 65  ARG B O   1 
ATOM   2449 C  CB  . ARG B 1 65  ? 20.583  2.252   16.709  1.00 28.24 ? 65  ARG B CB  1 
ATOM   2450 C  CG  . ARG B 1 65  ? 21.291  2.583   18.022  1.00 29.37 ? 65  ARG B CG  1 
ATOM   2451 C  CD  . ARG B 1 65  ? 20.353  3.315   18.969  1.00 30.97 ? 65  ARG B CD  1 
ATOM   2452 N  NE  . ARG B 1 65  ? 19.951  4.594   18.401  1.00 31.66 ? 65  ARG B NE  1 
ATOM   2453 C  CZ  . ARG B 1 65  ? 18.970  5.350   18.884  1.00 34.11 ? 65  ARG B CZ  1 
ATOM   2454 N  NH1 . ARG B 1 65  ? 18.287  4.958   19.952  1.00 30.77 ? 65  ARG B NH1 1 
ATOM   2455 N  NH2 . ARG B 1 65  ? 18.660  6.483   18.279  1.00 29.95 ? 65  ARG B NH2 1 
ATOM   2456 N  N   . VAL B 1 66  ? 19.840  -0.237  14.899  1.00 22.94 ? 66  VAL B N   1 
ATOM   2457 C  CA  . VAL B 1 66  ? 18.926  -0.850  13.939  1.00 21.54 ? 66  VAL B CA  1 
ATOM   2458 C  C   . VAL B 1 66  ? 17.681  -1.256  14.724  1.00 19.88 ? 66  VAL B C   1 
ATOM   2459 O  O   . VAL B 1 66  ? 17.768  -1.756  15.846  1.00 21.73 ? 66  VAL B O   1 
ATOM   2460 C  CB  . VAL B 1 66  ? 19.531  -2.105  13.289  1.00 22.42 ? 66  VAL B CB  1 
ATOM   2461 C  CG1 . VAL B 1 66  ? 18.542  -2.690  12.266  1.00 18.35 ? 66  VAL B CG1 1 
ATOM   2462 C  CG2 . VAL B 1 66  ? 20.850  -1.742  12.605  1.00 22.41 ? 66  VAL B CG2 1 
ATOM   2463 N  N   . ALA B 1 67  ? 16.527  -1.061  14.113  1.00 20.00 ? 67  ALA B N   1 
ATOM   2464 C  CA  . ALA B 1 67  ? 15.283  -1.367  14.790  1.00 17.09 ? 67  ALA B CA  1 
ATOM   2465 C  C   . ALA B 1 67  ? 14.906  -2.826  14.942  1.00 21.71 ? 67  ALA B C   1 
ATOM   2466 O  O   . ALA B 1 67  ? 15.186  -3.669  14.093  1.00 22.40 ? 67  ALA B O   1 
ATOM   2467 C  CB  . ALA B 1 67  ? 14.150  -0.640  14.106  1.00 21.76 ? 67  ALA B CB  1 
ATOM   2468 N  N   . ASN B 1 68  ? 14.273  -3.106  16.067  1.00 15.57 ? 68  ASN B N   1 
ATOM   2469 C  CA  . ASN B 1 68  ? 13.717  -4.412  16.326  1.00 17.53 ? 68  ASN B CA  1 
ATOM   2470 C  C   . ASN B 1 68  ? 12.237  -4.108  15.975  1.00 20.34 ? 68  ASN B C   1 
ATOM   2471 O  O   . ASN B 1 68  ? 11.677  -3.139  16.501  1.00 19.75 ? 68  ASN B O   1 
ATOM   2472 C  CB  . ASN B 1 68  ? 13.854  -4.718  17.818  1.00 22.50 ? 68  ASN B CB  1 
ATOM   2473 C  CG  . ASN B 1 68  ? 13.396  -6.108  18.173  1.00 35.11 ? 68  ASN B CG  1 
ATOM   2474 O  OD1 . ASN B 1 68  ? 14.209  -6.973  18.520  1.00 44.23 ? 68  ASN B OD1 1 
ATOM   2475 N  ND2 . ASN B 1 68  ? 12.090  -6.341  18.088  1.00 33.72 ? 68  ASN B ND2 1 
ATOM   2476 N  N   . PHE B 1 69  ? 11.607  -4.852  15.062  1.00 16.82 ? 69  PHE B N   1 
ATOM   2477 C  CA  . PHE B 1 69  ? 10.197  -4.559  14.780  1.00 16.36 ? 69  PHE B CA  1 
ATOM   2478 C  C   . PHE B 1 69  ? 9.382   -5.831  14.729  1.00 16.83 ? 69  PHE B C   1 
ATOM   2479 O  O   . PHE B 1 69  ? 9.931   -6.931  14.526  1.00 13.18 ? 69  PHE B O   1 
ATOM   2480 C  CB  . PHE B 1 69  ? 10.001  -3.743  13.474  1.00 15.87 ? 69  PHE B CB  1 
ATOM   2481 C  CG  . PHE B 1 69  ? 10.406  -4.463  12.195  1.00 23.28 ? 69  PHE B CG  1 
ATOM   2482 C  CD1 . PHE B 1 69  ? 9.556   -5.388  11.595  1.00 25.00 ? 69  PHE B CD1 1 
ATOM   2483 C  CD2 . PHE B 1 69  ? 11.615  -4.163  11.566  1.00 24.88 ? 69  PHE B CD2 1 
ATOM   2484 C  CE1 . PHE B 1 69  ? 9.905   -6.004  10.376  1.00 27.25 ? 69  PHE B CE1 1 
ATOM   2485 C  CE2 . PHE B 1 69  ? 11.970  -4.772  10.351  1.00 26.08 ? 69  PHE B CE2 1 
ATOM   2486 C  CZ  . PHE B 1 69  ? 11.107  -5.694  9.761   1.00 20.88 ? 69  PHE B CZ  1 
ATOM   2487 N  N   . GLN B 1 70  ? 8.080   -5.681  14.988  1.00 16.13 ? 70  GLN B N   1 
ATOM   2488 C  CA  A GLN B 1 70  ? 7.146   -6.809  14.966  0.50 16.32 ? 70  GLN B CA  1 
ATOM   2489 C  CA  B GLN B 1 70  ? 7.154   -6.815  14.946  0.50 16.14 ? 70  GLN B CA  1 
ATOM   2490 C  C   . GLN B 1 70  ? 5.886   -6.339  14.247  1.00 16.68 ? 70  GLN B C   1 
ATOM   2491 O  O   . GLN B 1 70  ? 5.394   -5.240  14.516  1.00 14.34 ? 70  GLN B O   1 
ATOM   2492 C  CB  A GLN B 1 70  ? 6.792   -7.238  16.396  0.50 22.26 ? 70  GLN B CB  1 
ATOM   2493 C  CB  B GLN B 1 70  ? 6.821   -7.301  16.360  0.50 21.77 ? 70  GLN B CB  1 
ATOM   2494 C  CG  A GLN B 1 70  ? 5.723   -8.317  16.488  0.50 32.75 ? 70  GLN B CG  1 
ATOM   2495 C  CG  B GLN B 1 70  ? 8.046   -7.645  17.197  0.50 31.21 ? 70  GLN B CG  1 
ATOM   2496 C  CD  A GLN B 1 70  ? 5.238   -8.565  17.914  0.50 39.42 ? 70  GLN B CD  1 
ATOM   2497 C  CD  B GLN B 1 70  ? 7.695   -8.155  18.581  0.50 38.66 ? 70  GLN B CD  1 
ATOM   2498 O  OE1 A GLN B 1 70  ? 6.014   -8.960  18.785  0.50 41.37 ? 70  GLN B OE1 1 
ATOM   2499 O  OE1 B GLN B 1 70  ? 6.541   -8.105  19.006  0.50 43.31 ? 70  GLN B OE1 1 
ATOM   2500 N  NE2 A GLN B 1 70  ? 3.946   -8.331  18.155  0.50 37.49 ? 70  GLN B NE2 1 
ATOM   2501 N  NE2 B GLN B 1 70  ? 8.698   -8.644  19.299  0.50 42.54 ? 70  GLN B NE2 1 
ATOM   2502 N  N   . SER B 1 71  ? 5.378   -7.147  13.319  1.00 12.75 ? 71  SER B N   1 
ATOM   2503 C  CA  . SER B 1 71  ? 4.169   -6.776  12.602  1.00 14.39 ? 71  SER B CA  1 
ATOM   2504 C  C   . SER B 1 71  ? 3.237   -7.986  12.714  1.00 15.23 ? 71  SER B C   1 
ATOM   2505 O  O   . SER B 1 71  ? 3.584   -9.076  12.268  1.00 16.94 ? 71  SER B O   1 
ATOM   2506 C  CB  . SER B 1 71  ? 4.486   -6.481  11.130  1.00 19.08 ? 71  SER B CB  1 
ATOM   2507 O  OG  . SER B 1 71  ? 3.338   -6.030  10.425  1.00 19.09 ? 71  SER B OG  1 
ATOM   2508 N  N   . GLN B 1 72  ? 2.064   -7.798  13.318  1.00 11.57 ? 72  GLN B N   1 
ATOM   2509 C  CA  . GLN B 1 72  ? 1.104   -8.896  13.469  1.00 12.21 ? 72  GLN B CA  1 
ATOM   2510 C  C   . GLN B 1 72  ? -0.124  -8.519  12.651  1.00 13.76 ? 72  GLN B C   1 
ATOM   2511 O  O   . GLN B 1 72  ? -0.600  -7.390  12.734  1.00 12.69 ? 72  GLN B O   1 
ATOM   2512 C  CB  . GLN B 1 72  ? 0.710   -9.041  14.938  1.00 13.54 ? 72  GLN B CB  1 
ATOM   2513 C  CG  . GLN B 1 72  ? 0.055   -10.377 15.323  1.00 19.10 ? 72  GLN B CG  1 
ATOM   2514 C  CD  . GLN B 1 72  ? -1.342  -10.587 14.754  1.00 26.46 ? 72  GLN B CD  1 
ATOM   2515 O  OE1 . GLN B 1 72  ? -2.166  -9.678  14.763  1.00 23.82 ? 72  GLN B OE1 1 
ATOM   2516 N  NE2 . GLN B 1 72  ? -1.620  -11.812 14.273  1.00 22.67 ? 72  GLN B NE2 1 
ATOM   2517 N  N   . PHE B 1 73  ? -0.631  -9.439  11.835  1.00 8.58  ? 73  PHE B N   1 
ATOM   2518 C  CA  . PHE B 1 73  ? -1.792  -9.091  11.051  1.00 11.53 ? 73  PHE B CA  1 
ATOM   2519 C  C   . PHE B 1 73  ? -2.572  -10.324 10.663  1.00 11.60 ? 73  PHE B C   1 
ATOM   2520 O  O   . PHE B 1 73  ? -2.084  -11.438 10.782  1.00 12.73 ? 73  PHE B O   1 
ATOM   2521 C  CB  . PHE B 1 73  ? -1.373  -8.314  9.778   1.00 11.84 ? 73  PHE B CB  1 
ATOM   2522 C  CG  . PHE B 1 73  ? -0.332  -9.034  8.915   1.00 14.86 ? 73  PHE B CG  1 
ATOM   2523 C  CD1 . PHE B 1 73  ? -0.719  -9.820  7.826   1.00 14.77 ? 73  PHE B CD1 1 
ATOM   2524 C  CD2 . PHE B 1 73  ? 1.030   -8.865  9.168   1.00 15.41 ? 73  PHE B CD2 1 
ATOM   2525 C  CE1 . PHE B 1 73  ? 0.267   -10.430 6.976   1.00 13.20 ? 73  PHE B CE1 1 
ATOM   2526 C  CE2 . PHE B 1 73  ? 2.011   -9.460  8.334   1.00 19.41 ? 73  PHE B CE2 1 
ATOM   2527 C  CZ  . PHE B 1 73  ? 1.622   -10.234 7.246   1.00 11.77 ? 73  PHE B CZ  1 
ATOM   2528 N  N   . SER B 1 74  ? -3.801  -10.110 10.229  1.00 11.40 ? 74  SER B N   1 
ATOM   2529 C  CA  A SER B 1 74  ? -4.621  -11.229 9.786   0.50 11.82 ? 74  SER B CA  1 
ATOM   2530 C  CA  B SER B 1 74  ? -4.661  -11.210 9.810   0.50 12.67 ? 74  SER B CA  1 
ATOM   2531 C  C   . SER B 1 74  ? -5.320  -10.834 8.487   1.00 11.11 ? 74  SER B C   1 
ATOM   2532 O  O   . SER B 1 74  ? -5.669  -9.670  8.275   1.00 12.87 ? 74  SER B O   1 
ATOM   2533 C  CB  A SER B 1 74  ? -5.636  -11.608 10.871  0.50 13.62 ? 74  SER B CB  1 
ATOM   2534 C  CB  B SER B 1 74  ? -5.731  -11.457 10.886  0.50 14.22 ? 74  SER B CB  1 
ATOM   2535 O  OG  A SER B 1 74  ? -6.549  -10.560 11.099  0.50 12.26 ? 74  SER B OG  1 
ATOM   2536 O  OG  B SER B 1 74  ? -6.617  -12.505 10.525  0.50 23.12 ? 74  SER B OG  1 
ATOM   2537 N  N   . PHE B 1 75  ? -5.494  -11.809 7.602   1.00 10.81 ? 75  PHE B N   1 
ATOM   2538 C  CA  . PHE B 1 75  ? -6.147  -11.547 6.315   1.00 11.19 ? 75  PHE B CA  1 
ATOM   2539 C  C   . PHE B 1 75  ? -6.870  -12.819 5.851   1.00 10.46 ? 75  PHE B C   1 
ATOM   2540 O  O   . PHE B 1 75  ? -6.655  -13.893 6.388   1.00 13.59 ? 75  PHE B O   1 
ATOM   2541 C  CB  . PHE B 1 75  ? -5.122  -11.129 5.240   1.00 12.98 ? 75  PHE B CB  1 
ATOM   2542 C  CG  . PHE B 1 75  ? -4.183  -12.252 4.796   1.00 10.71 ? 75  PHE B CG  1 
ATOM   2543 C  CD1 . PHE B 1 75  ? -2.909  -12.391 5.373   1.00 16.56 ? 75  PHE B CD1 1 
ATOM   2544 C  CD2 . PHE B 1 75  ? -4.573  -13.158 3.809   1.00 12.84 ? 75  PHE B CD2 1 
ATOM   2545 C  CE1 . PHE B 1 75  ? -2.041  -13.413 4.967   1.00 13.66 ? 75  PHE B CE1 1 
ATOM   2546 C  CE2 . PHE B 1 75  ? -3.718  -14.194 3.386   1.00 17.88 ? 75  PHE B CE2 1 
ATOM   2547 C  CZ  . PHE B 1 75  ? -2.446  -14.328 3.961   1.00 14.66 ? 75  PHE B CZ  1 
ATOM   2548 N  N   . SER B 1 76  ? -7.771  -12.659 4.889   1.00 12.56 ? 76  SER B N   1 
ATOM   2549 C  CA  A SER B 1 76  ? -8.474  -13.804 4.328   0.50 12.19 ? 76  SER B CA  1 
ATOM   2550 C  CA  B SER B 1 76  ? -8.520  -13.781 4.327   0.50 13.79 ? 76  SER B CA  1 
ATOM   2551 C  C   . SER B 1 76  ? -8.616  -13.558 2.837   1.00 13.08 ? 76  SER B C   1 
ATOM   2552 O  O   . SER B 1 76  ? -8.679  -12.408 2.382   1.00 14.30 ? 76  SER B O   1 
ATOM   2553 C  CB  A SER B 1 76  ? -9.859  -13.988 4.967   0.50 15.79 ? 76  SER B CB  1 
ATOM   2554 C  CB  B SER B 1 76  ? -9.952  -13.850 4.891   0.50 16.95 ? 76  SER B CB  1 
ATOM   2555 O  OG  A SER B 1 76  ? -10.635 -12.823 4.819   0.50 9.06  ? 76  SER B OG  1 
ATOM   2556 O  OG  B SER B 1 76  ? -9.959  -14.266 6.239   0.50 26.11 ? 76  SER B OG  1 
ATOM   2557 N  N   . LEU B 1 77  ? -8.662  -14.644 2.082   1.00 12.18 ? 77  LEU B N   1 
ATOM   2558 C  CA  . LEU B 1 77  ? -8.772  -14.547 0.626   1.00 12.14 ? 77  LEU B CA  1 
ATOM   2559 C  C   . LEU B 1 77  ? -10.018 -15.355 0.233   1.00 14.11 ? 77  LEU B C   1 
ATOM   2560 O  O   . LEU B 1 77  ? -10.244 -16.425 0.781   1.00 15.03 ? 77  LEU B O   1 
ATOM   2561 C  CB  . LEU B 1 77  ? -7.572  -15.218 -0.025  1.00 15.14 ? 77  LEU B CB  1 
ATOM   2562 C  CG  . LEU B 1 77  ? -6.180  -14.824 0.494   1.00 16.58 ? 77  LEU B CG  1 
ATOM   2563 C  CD1 . LEU B 1 77  ? -5.133  -15.717 -0.179  1.00 17.88 ? 77  LEU B CD1 1 
ATOM   2564 C  CD2 . LEU B 1 77  ? -5.904  -13.351 0.202   1.00 15.14 ? 77  LEU B CD2 1 
ATOM   2565 N  N   . LYS B 1 78  ? -10.778 -14.869 -0.738  1.00 15.25 ? 78  LYS B N   1 
ATOM   2566 C  CA  . LYS B 1 78  ? -11.981 -15.596 -1.147  1.00 16.91 ? 78  LYS B CA  1 
ATOM   2567 C  C   . LYS B 1 78  ? -12.110 -15.503 -2.668  1.00 15.20 ? 78  LYS B C   1 
ATOM   2568 O  O   . LYS B 1 78  ? -11.901 -14.430 -3.256  1.00 14.31 ? 78  LYS B O   1 
ATOM   2569 C  CB  . LYS B 1 78  ? -13.204 -14.951 -0.477  1.00 20.57 ? 78  LYS B CB  1 
ATOM   2570 C  CG  . LYS B 1 78  ? -14.408 -15.847 -0.338  1.00 33.43 ? 78  LYS B CG  1 
ATOM   2571 C  CD  . LYS B 1 78  ? -15.403 -15.260 0.670   1.00 37.56 ? 78  LYS B CD  1 
ATOM   2572 N  N   . SER B 1 79  ? -12.460 -16.617 -3.313  1.00 14.63 ? 79  SER B N   1 
ATOM   2573 C  CA  . SER B 1 79  ? -12.647 -16.602 -4.765  1.00 16.14 ? 79  SER B CA  1 
ATOM   2574 C  C   . SER B 1 79  ? -13.511 -17.776 -5.210  1.00 18.00 ? 79  SER B C   1 
ATOM   2575 O  O   . SER B 1 79  ? -13.364 -18.877 -4.689  1.00 14.14 ? 79  SER B O   1 
ATOM   2576 C  CB  . SER B 1 79  ? -11.328 -16.739 -5.519  1.00 20.64 ? 79  SER B CB  1 
ATOM   2577 O  OG  . SER B 1 79  ? -11.610 -16.662 -6.919  1.00 17.83 ? 79  SER B OG  1 
ATOM   2578 N  N   . PRO B 1 80  ? -14.429 -17.545 -6.163  1.00 19.12 ? 80  PRO B N   1 
ATOM   2579 C  CA  . PRO B 1 80  ? -15.269 -18.656 -6.634  1.00 20.38 ? 80  PRO B CA  1 
ATOM   2580 C  C   . PRO B 1 80  ? -14.470 -19.523 -7.609  1.00 21.79 ? 80  PRO B C   1 
ATOM   2581 O  O   . PRO B 1 80  ? -14.862 -20.655 -7.920  1.00 22.49 ? 80  PRO B O   1 
ATOM   2582 C  CB  . PRO B 1 80  ? -16.425 -17.949 -7.339  1.00 22.71 ? 80  PRO B CB  1 
ATOM   2583 C  CG  . PRO B 1 80  ? -15.785 -16.697 -7.861  1.00 25.15 ? 80  PRO B CG  1 
ATOM   2584 C  CD  . PRO B 1 80  ? -14.937 -16.255 -6.667  1.00 19.86 ? 80  PRO B CD  1 
ATOM   2585 N  N   . LEU B 1 81  ? -13.360 -18.983 -8.102  1.00 18.50 ? 81  LEU B N   1 
ATOM   2586 C  CA  . LEU B 1 81  ? -12.492 -19.721 -9.040  1.00 21.44 ? 81  LEU B CA  1 
ATOM   2587 C  C   . LEU B 1 81  ? -11.663 -20.782 -8.337  1.00 21.91 ? 81  LEU B C   1 
ATOM   2588 O  O   . LEU B 1 81  ? -11.399 -20.692 -7.138  1.00 18.88 ? 81  LEU B O   1 
ATOM   2589 C  CB  . LEU B 1 81  ? -11.498 -18.778 -9.722  1.00 20.35 ? 81  LEU B CB  1 
ATOM   2590 C  CG  . LEU B 1 81  ? -12.066 -17.523 -10.361 1.00 25.01 ? 81  LEU B CG  1 
ATOM   2591 C  CD1 . LEU B 1 81  ? -10.921 -16.656 -10.879 1.00 25.00 ? 81  LEU B CD1 1 
ATOM   2592 C  CD2 . LEU B 1 81  ? -13.029 -17.926 -11.473 1.00 26.66 ? 81  LEU B CD2 1 
ATOM   2593 N  N   . SER B 1 82  ? -11.215 -21.780 -9.093  1.00 17.48 ? 82  SER B N   1 
ATOM   2594 C  CA  . SER B 1 82  ? -10.370 -22.816 -8.515  1.00 20.04 ? 82  SER B CA  1 
ATOM   2595 C  C   . SER B 1 82  ? -8.910  -22.296 -8.367  1.00 22.07 ? 82  SER B C   1 
ATOM   2596 O  O   . SER B 1 82  ? -8.111  -22.867 -7.625  1.00 20.67 ? 82  SER B O   1 
ATOM   2597 C  CB  . SER B 1 82  ? -10.377 -24.059 -9.414  1.00 23.65 ? 82  SER B CB  1 
ATOM   2598 O  OG  . SER B 1 82  ? -9.830  -23.726 -10.680 1.00 22.67 ? 82  SER B OG  1 
ATOM   2599 N  N   . ASN B 1 83  ? -8.549  -21.233 -9.077  1.00 22.21 ? 83  ASN B N   1 
ATOM   2600 C  CA  A ASN B 1 83  ? -7.183  -20.723 -8.961  0.50 25.00 ? 83  ASN B CA  1 
ATOM   2601 C  CA  B ASN B 1 83  ? -7.187  -20.718 -8.988  0.50 25.01 ? 83  ASN B CA  1 
ATOM   2602 C  C   . ASN B 1 83  ? -7.130  -19.226 -8.699  1.00 22.71 ? 83  ASN B C   1 
ATOM   2603 O  O   . ASN B 1 83  ? -6.626  -18.454 -9.522  1.00 23.54 ? 83  ASN B O   1 
ATOM   2604 C  CB  A ASN B 1 83  ? -6.368  -21.047 -10.220 0.50 31.87 ? 83  ASN B CB  1 
ATOM   2605 C  CB  B ASN B 1 83  ? -6.428  -21.031 -10.287 0.50 31.64 ? 83  ASN B CB  1 
ATOM   2606 C  CG  A ASN B 1 83  ? -6.336  -22.529 -10.532 0.50 38.36 ? 83  ASN B CG  1 
ATOM   2607 C  CG  B ASN B 1 83  ? -7.183  -20.582 -11.537 0.50 37.45 ? 83  ASN B CG  1 
ATOM   2608 O  OD1 A ASN B 1 83  ? -6.053  -23.356 -9.660  0.50 44.31 ? 83  ASN B OD1 1 
ATOM   2609 O  OD1 B ASN B 1 83  ? -8.338  -20.156 -11.469 0.50 39.34 ? 83  ASN B OD1 1 
ATOM   2610 N  ND2 A ASN B 1 83  ? -6.621  -22.875 -11.782 0.50 43.73 ? 83  ASN B ND2 1 
ATOM   2611 N  ND2 B ASN B 1 83  ? -6.528  -20.688 -12.691 0.50 41.91 ? 83  ASN B ND2 1 
ATOM   2612 N  N   . GLY B 1 84  ? -7.624  -18.830 -7.527  1.00 18.92 ? 84  GLY B N   1 
ATOM   2613 C  CA  . GLY B 1 84  ? -7.629  -17.425 -7.146  1.00 19.75 ? 84  GLY B CA  1 
ATOM   2614 C  C   . GLY B 1 84  ? -6.219  -16.861 -7.169  1.00 15.93 ? 84  GLY B C   1 
ATOM   2615 O  O   . GLY B 1 84  ? -5.273  -17.547 -6.771  1.00 16.14 ? 84  GLY B O   1 
ATOM   2616 N  N   . ALA B 1 85  ? -6.100  -15.604 -7.589  1.00 15.56 ? 85  ALA B N   1 
ATOM   2617 C  CA  . ALA B 1 85  ? -4.811  -14.933 -7.731  1.00 17.24 ? 85  ALA B CA  1 
ATOM   2618 C  C   . ALA B 1 85  ? -4.943  -13.458 -7.371  1.00 15.99 ? 85  ALA B C   1 
ATOM   2619 O  O   . ALA B 1 85  ? -6.051  -12.929 -7.352  1.00 16.90 ? 85  ALA B O   1 
ATOM   2620 C  CB  . ALA B 1 85  ? -4.329  -15.072 -9.184  1.00 17.40 ? 85  ALA B CB  1 
ATOM   2621 N  N   . ASP B 1 86  ? -3.828  -12.765 -7.128  1.00 15.33 ? 86  ASP B N   1 
ATOM   2622 C  CA  . ASP B 1 86  ? -2.471  -13.315 -7.182  1.00 13.52 ? 86  ASP B CA  1 
ATOM   2623 C  C   . ASP B 1 86  ? -1.791  -13.439 -5.826  1.00 15.63 ? 86  ASP B C   1 
ATOM   2624 O  O   . ASP B 1 86  ? -0.849  -14.216 -5.674  1.00 14.68 ? 86  ASP B O   1 
ATOM   2625 C  CB  . ASP B 1 86  ? -1.617  -12.432 -8.078  1.00 15.07 ? 86  ASP B CB  1 
ATOM   2626 C  CG  . ASP B 1 86  ? -1.759  -12.807 -9.545  1.00 15.50 ? 86  ASP B CG  1 
ATOM   2627 O  OD1 . ASP B 1 86  ? -1.022  -13.713 -9.986  1.00 17.10 ? 86  ASP B OD1 1 
ATOM   2628 O  OD2 . ASP B 1 86  ? -2.617  -12.218 -10.234 1.00 16.11 ? 86  ASP B OD2 1 
ATOM   2629 N  N   . GLY B 1 87  ? -2.262  -12.685 -4.840  1.00 15.47 ? 87  GLY B N   1 
ATOM   2630 C  CA  . GLY B 1 87  ? -1.641  -12.787 -3.536  1.00 14.61 ? 87  GLY B CA  1 
ATOM   2631 C  C   . GLY B 1 87  ? -1.542  -11.451 -2.831  1.00 10.85 ? 87  GLY B C   1 
ATOM   2632 O  O   . GLY B 1 87  ? -1.823  -10.387 -3.410  1.00 13.76 ? 87  GLY B O   1 
ATOM   2633 N  N   . ILE B 1 88  ? -1.138  -11.520 -1.571  1.00 14.85 ? 88  ILE B N   1 
ATOM   2634 C  CA  . ILE B 1 88  ? -1.006  -10.336 -0.747  1.00 11.57 ? 88  ILE B CA  1 
ATOM   2635 C  C   . ILE B 1 88  ? 0.381   -10.320 -0.128  1.00 12.07 ? 88  ILE B C   1 
ATOM   2636 O  O   . ILE B 1 88  ? 0.981   -11.369 0.135   1.00 12.00 ? 88  ILE B O   1 
ATOM   2637 C  CB  . ILE B 1 88  ? -2.117  -10.343 0.362   1.00 12.57 ? 88  ILE B CB  1 
ATOM   2638 C  CG1 . ILE B 1 88  ? -1.963  -9.144  1.287   1.00 14.58 ? 88  ILE B CG1 1 
ATOM   2639 C  CG2 . ILE B 1 88  ? -2.024  -11.644 1.208   1.00 15.54 ? 88  ILE B CG2 1 
ATOM   2640 C  CD1 . ILE B 1 88  ? -3.052  -9.092  2.372   1.00 19.17 ? 88  ILE B CD1 1 
ATOM   2641 N  N   . ALA B 1 89  ? 0.923   -9.126  0.081   1.00 13.19 ? 89  ALA B N   1 
ATOM   2642 C  CA  . ALA B 1 89  ? 2.241   -9.053  0.703   1.00 11.69 ? 89  ALA B CA  1 
ATOM   2643 C  C   . ALA B 1 89  ? 2.337   -7.936  1.726   1.00 13.20 ? 89  ALA B C   1 
ATOM   2644 O  O   . ALA B 1 89  ? 1.744   -6.886  1.532   1.00 14.27 ? 89  ALA B O   1 
ATOM   2645 C  CB  . ALA B 1 89  ? 3.336   -8.817  -0.373  1.00 13.16 ? 89  ALA B CB  1 
ATOM   2646 N  N   . PHE B 1 90  ? 3.089   -8.192  2.808   1.00 11.21 ? 90  PHE B N   1 
ATOM   2647 C  CA  . PHE B 1 90  ? 3.395   -7.157  3.797   1.00 12.47 ? 90  PHE B CA  1 
ATOM   2648 C  C   . PHE B 1 90  ? 4.730   -6.640  3.255   1.00 14.17 ? 90  PHE B C   1 
ATOM   2649 O  O   . PHE B 1 90  ? 5.583   -7.450  2.859   1.00 14.83 ? 90  PHE B O   1 
ATOM   2650 C  CB  . PHE B 1 90  ? 3.613   -7.771  5.172   1.00 13.08 ? 90  PHE B CB  1 
ATOM   2651 C  CG  . PHE B 1 90  ? 4.316   -6.854  6.133   1.00 13.13 ? 90  PHE B CG  1 
ATOM   2652 C  CD1 . PHE B 1 90  ? 3.727   -5.654  6.520   1.00 15.13 ? 90  PHE B CD1 1 
ATOM   2653 C  CD2 . PHE B 1 90  ? 5.579   -7.188  6.618   1.00 15.92 ? 90  PHE B CD2 1 
ATOM   2654 C  CE1 . PHE B 1 90  ? 4.394   -4.773  7.391   1.00 18.41 ? 90  PHE B CE1 1 
ATOM   2655 C  CE2 . PHE B 1 90  ? 6.271   -6.321  7.493   1.00 20.08 ? 90  PHE B CE2 1 
ATOM   2656 C  CZ  . PHE B 1 90  ? 5.674   -5.116  7.875   1.00 19.33 ? 90  PHE B CZ  1 
ATOM   2657 N  N   . PHE B 1 91  ? 4.940   -5.329  3.217   1.00 11.71 ? 91  PHE B N   1 
ATOM   2658 C  CA  . PHE B 1 91  ? 6.215   -4.854  2.656   1.00 12.06 ? 91  PHE B CA  1 
ATOM   2659 C  C   . PHE B 1 91  ? 6.761   -3.625  3.345   1.00 14.57 ? 91  PHE B C   1 
ATOM   2660 O  O   . PHE B 1 91  ? 6.047   -2.922  4.062   1.00 13.91 ? 91  PHE B O   1 
ATOM   2661 C  CB  . PHE B 1 91  ? 6.100   -4.596  1.132   1.00 13.99 ? 91  PHE B CB  1 
ATOM   2662 C  CG  . PHE B 1 91  ? 5.349   -3.347  0.738   1.00 13.74 ? 91  PHE B CG  1 
ATOM   2663 C  CD1 . PHE B 1 91  ? 3.949   -3.278  0.803   1.00 15.27 ? 91  PHE B CD1 1 
ATOM   2664 C  CD2 . PHE B 1 91  ? 6.035   -2.265  0.197   1.00 20.23 ? 91  PHE B CD2 1 
ATOM   2665 C  CE1 . PHE B 1 91  ? 3.256   -2.152  0.322   1.00 18.21 ? 91  PHE B CE1 1 
ATOM   2666 C  CE2 . PHE B 1 91  ? 5.345   -1.131  -0.289  1.00 25.11 ? 91  PHE B CE2 1 
ATOM   2667 C  CZ  . PHE B 1 91  ? 3.959   -1.081  -0.228  1.00 20.99 ? 91  PHE B CZ  1 
ATOM   2668 N  N   . ILE B 1 92  ? 8.045   -3.390  3.115   1.00 14.64 ? 92  ILE B N   1 
ATOM   2669 C  CA  . ILE B 1 92  ? 8.755   -2.255  3.693   1.00 17.29 ? 92  ILE B CA  1 
ATOM   2670 C  C   . ILE B 1 92  ? 9.501   -1.637  2.530   1.00 18.30 ? 92  ILE B C   1 
ATOM   2671 O  O   . ILE B 1 92  ? 10.214  -2.342  1.826   1.00 20.40 ? 92  ILE B O   1 
ATOM   2672 C  CB  . ILE B 1 92  ? 9.770   -2.716  4.734   1.00 17.66 ? 92  ILE B CB  1 
ATOM   2673 C  CG1 . ILE B 1 92  ? 9.091   -3.631  5.761   1.00 18.03 ? 92  ILE B CG1 1 
ATOM   2674 C  CG2 . ILE B 1 92  ? 10.385  -1.471  5.414   1.00 18.45 ? 92  ILE B CG2 1 
ATOM   2675 C  CD1 . ILE B 1 92  ? 10.089  -4.352  6.662   1.00 22.51 ? 92  ILE B CD1 1 
ATOM   2676 N  N   . ALA B 1 93  ? 9.341   -0.332  2.329   1.00 18.31 ? 93  ALA B N   1 
ATOM   2677 C  CA  . ALA B 1 93  ? 9.969   0.333   1.192   1.00 18.73 ? 93  ALA B CA  1 
ATOM   2678 C  C   . ALA B 1 93  ? 10.293  1.782   1.530   1.00 21.69 ? 93  ALA B C   1 
ATOM   2679 O  O   . ALA B 1 93  ? 9.961   2.265   2.628   1.00 16.99 ? 93  ALA B O   1 
ATOM   2680 C  CB  . ALA B 1 93  ? 9.011   0.304   0.002   1.00 16.53 ? 93  ALA B CB  1 
ATOM   2681 N  N   . PRO B 1 94  ? 10.964  2.490   0.596   1.00 21.28 ? 94  PRO B N   1 
ATOM   2682 C  CA  . PRO B 1 94  ? 11.308  3.902   0.820   1.00 21.38 ? 94  PRO B CA  1 
ATOM   2683 C  C   . PRO B 1 94  ? 9.979   4.633   0.950   1.00 19.60 ? 94  PRO B C   1 
ATOM   2684 O  O   . PRO B 1 94  ? 8.984   4.242   0.340   1.00 19.00 ? 94  PRO B O   1 
ATOM   2685 C  CB  . PRO B 1 94  ? 12.077  4.286   -0.447  1.00 19.76 ? 94  PRO B CB  1 
ATOM   2686 C  CG  . PRO B 1 94  ? 12.729  2.969   -0.858  1.00 25.62 ? 94  PRO B CG  1 
ATOM   2687 C  CD  . PRO B 1 94  ? 11.593  1.977   -0.637  1.00 21.28 ? 94  PRO B CD  1 
ATOM   2688 N  N   . PRO B 1 95  ? 9.943   5.728   1.718   1.00 20.37 ? 95  PRO B N   1 
ATOM   2689 C  CA  . PRO B 1 95  ? 8.715   6.496   1.940   1.00 21.52 ? 95  PRO B CA  1 
ATOM   2690 C  C   . PRO B 1 95  ? 7.909   6.983   0.751   1.00 21.66 ? 95  PRO B C   1 
ATOM   2691 O  O   . PRO B 1 95  ? 6.688   7.097   0.836   1.00 23.42 ? 95  PRO B O   1 
ATOM   2692 C  CB  . PRO B 1 95  ? 9.191   7.665   2.817   1.00 25.22 ? 95  PRO B CB  1 
ATOM   2693 C  CG  . PRO B 1 95  ? 10.369  7.090   3.538   1.00 23.84 ? 95  PRO B CG  1 
ATOM   2694 C  CD  . PRO B 1 95  ? 11.077  6.336   2.438   1.00 22.18 ? 95  PRO B CD  1 
ATOM   2695 N  N   . ASP B 1 96  ? 8.582   7.262   -0.355  1.00 21.28 ? 96  ASP B N   1 
ATOM   2696 C  CA  . ASP B 1 96  ? 7.899   7.777   -1.532  1.00 24.67 ? 96  ASP B CA  1 
ATOM   2697 C  C   . ASP B 1 96  ? 7.423   6.679   -2.478  1.00 24.73 ? 96  ASP B C   1 
ATOM   2698 O  O   . ASP B 1 96  ? 7.012   6.953   -3.597  1.00 24.12 ? 96  ASP B O   1 
ATOM   2699 C  CB  . ASP B 1 96  ? 8.819   8.750   -2.281  1.00 32.24 ? 96  ASP B CB  1 
ATOM   2700 C  CG  . ASP B 1 96  ? 10.172  8.144   -2.612  1.00 40.43 ? 96  ASP B CG  1 
ATOM   2701 O  OD1 . ASP B 1 96  ? 10.994  8.842   -3.248  1.00 47.75 ? 96  ASP B OD1 1 
ATOM   2702 O  OD2 . ASP B 1 96  ? 10.431  6.978   -2.245  1.00 42.75 ? 96  ASP B OD2 1 
ATOM   2703 N  N   . THR B 1 97  ? 7.458   5.436   -2.021  1.00 23.13 ? 97  THR B N   1 
ATOM   2704 C  CA  . THR B 1 97  ? 7.030   4.327   -2.872  1.00 21.94 ? 97  THR B CA  1 
ATOM   2705 C  C   . THR B 1 97  ? 5.608   4.461   -3.434  1.00 23.10 ? 97  THR B C   1 
ATOM   2706 O  O   . THR B 1 97  ? 4.673   4.858   -2.732  1.00 20.75 ? 97  THR B O   1 
ATOM   2707 C  CB  . THR B 1 97  ? 7.133   2.994   -2.113  1.00 25.72 ? 97  THR B CB  1 
ATOM   2708 O  OG1 . THR B 1 97  ? 6.805   1.917   -3.002  1.00 23.91 ? 97  THR B OG1 1 
ATOM   2709 C  CG2 . THR B 1 97  ? 6.165   2.982   -0.914  1.00 18.58 ? 97  THR B CG2 1 
ATOM   2710 N  N   . THR B 1 98  ? 5.451   4.131   -4.716  1.00 23.20 ? 98  THR B N   1 
ATOM   2711 C  CA  . THR B 1 98  ? 4.140   4.175   -5.374  1.00 24.82 ? 98  THR B CA  1 
ATOM   2712 C  C   . THR B 1 98  ? 4.016   2.905   -6.223  1.00 22.36 ? 98  THR B C   1 
ATOM   2713 O  O   . THR B 1 98  ? 4.993   2.191   -6.427  1.00 23.63 ? 98  THR B O   1 
ATOM   2714 C  CB  . THR B 1 98  ? 3.965   5.406   -6.324  1.00 27.51 ? 98  THR B CB  1 
ATOM   2715 O  OG1 . THR B 1 98  ? 5.065   5.465   -7.236  1.00 30.08 ? 98  THR B OG1 1 
ATOM   2716 C  CG2 . THR B 1 98  ? 3.881   6.692   -5.533  1.00 29.57 ? 98  THR B CG2 1 
ATOM   2717 N  N   . ILE B 1 99  ? 2.815   2.620   -6.704  1.00 23.57 ? 99  ILE B N   1 
ATOM   2718 C  CA  . ILE B 1 99  ? 2.629   1.421   -7.510  1.00 24.09 ? 99  ILE B CA  1 
ATOM   2719 C  C   . ILE B 1 99  ? 3.380   1.556   -8.828  1.00 25.13 ? 99  ILE B C   1 
ATOM   2720 O  O   . ILE B 1 99  ? 3.121   2.475   -9.600  1.00 24.08 ? 99  ILE B O   1 
ATOM   2721 C  CB  . ILE B 1 99  ? 1.148   1.171   -7.796  1.00 23.98 ? 99  ILE B CB  1 
ATOM   2722 C  CG1 . ILE B 1 99  ? 0.402   0.959   -6.460  1.00 23.92 ? 99  ILE B CG1 1 
ATOM   2723 C  CG2 . ILE B 1 99  ? 1.000   -0.041  -8.731  1.00 23.79 ? 99  ILE B CG2 1 
ATOM   2724 C  CD1 . ILE B 1 99  ? -1.117  0.775   -6.594  1.00 25.43 ? 99  ILE B CD1 1 
ATOM   2725 N  N   . PRO B 1 100 ? 4.315   0.637   -9.099  1.00 26.56 ? 100 PRO B N   1 
ATOM   2726 C  CA  . PRO B 1 100 ? 5.089   0.695   -10.346 1.00 28.14 ? 100 PRO B CA  1 
ATOM   2727 C  C   . PRO B 1 100 ? 4.203   0.429   -11.563 1.00 31.98 ? 100 PRO B C   1 
ATOM   2728 O  O   . PRO B 1 100 ? 3.265   -0.366  -11.494 1.00 26.01 ? 100 PRO B O   1 
ATOM   2729 C  CB  . PRO B 1 100 ? 6.136   -0.405  -10.162 1.00 30.62 ? 100 PRO B CB  1 
ATOM   2730 C  CG  . PRO B 1 100 ? 6.220   -0.601  -8.670  1.00 29.76 ? 100 PRO B CG  1 
ATOM   2731 C  CD  . PRO B 1 100 ? 4.776   -0.474  -8.248  1.00 29.74 ? 100 PRO B CD  1 
ATOM   2732 N  N   . SER B 1 101 ? 4.481   1.094   -12.680 1.00 32.85 ? 101 SER B N   1 
ATOM   2733 C  CA  A SER B 1 101 ? 3.698   0.879   -13.891 0.50 33.91 ? 101 SER B CA  1 
ATOM   2734 C  CA  B SER B 1 101 ? 3.684   0.872   -13.882 0.50 34.09 ? 101 SER B CA  1 
ATOM   2735 C  C   . SER B 1 101 ? 3.829   -0.583  -14.306 1.00 31.94 ? 101 SER B C   1 
ATOM   2736 O  O   . SER B 1 101 ? 4.935   -1.115  -14.351 1.00 31.77 ? 101 SER B O   1 
ATOM   2737 C  CB  A SER B 1 101 ? 4.214   1.773   -15.019 0.50 35.94 ? 101 SER B CB  1 
ATOM   2738 C  CB  B SER B 1 101 ? 4.146   1.796   -15.012 0.50 36.52 ? 101 SER B CB  1 
ATOM   2739 O  OG  A SER B 1 101 ? 3.380   1.674   -16.155 0.50 36.41 ? 101 SER B OG  1 
ATOM   2740 O  OG  B SER B 1 101 ? 3.866   3.150   -14.695 0.50 38.03 ? 101 SER B OG  1 
ATOM   2741 N  N   . GLY B 1 102 ? 2.699   -1.224  -14.594 1.00 32.78 ? 102 GLY B N   1 
ATOM   2742 C  CA  . GLY B 1 102 ? 2.696   -2.617  -15.015 1.00 33.16 ? 102 GLY B CA  1 
ATOM   2743 C  C   . GLY B 1 102 ? 3.020   -3.654  -13.954 1.00 32.92 ? 102 GLY B C   1 
ATOM   2744 O  O   . GLY B 1 102 ? 3.393   -4.780  -14.276 1.00 27.45 ? 102 GLY B O   1 
ATOM   2745 N  N   . SER B 1 103 ? 2.864   -3.288  -12.686 1.00 29.93 ? 103 SER B N   1 
ATOM   2746 C  CA  . SER B 1 103 ? 3.182   -4.204  -11.594 1.00 29.21 ? 103 SER B CA  1 
ATOM   2747 C  C   . SER B 1 103 ? 2.022   -5.100  -11.178 1.00 27.65 ? 103 SER B C   1 
ATOM   2748 O  O   . SER B 1 103 ? 2.041   -5.685  -10.095 1.00 26.50 ? 103 SER B O   1 
ATOM   2749 C  CB  . SER B 1 103 ? 3.642   -3.401  -10.380 1.00 25.32 ? 103 SER B CB  1 
ATOM   2750 O  OG  . SER B 1 103 ? 2.612   -2.499  -10.017 1.00 25.23 ? 103 SER B OG  1 
ATOM   2751 N  N   . GLY B 1 104 ? 1.016   -5.212  -12.033 1.00 28.36 ? 104 GLY B N   1 
ATOM   2752 C  CA  . GLY B 1 104 ? -0.127  -6.034  -11.694 1.00 25.71 ? 104 GLY B CA  1 
ATOM   2753 C  C   . GLY B 1 104 ? 0.139   -7.532  -11.687 1.00 20.17 ? 104 GLY B C   1 
ATOM   2754 O  O   . GLY B 1 104 ? 1.270   -8.007  -11.859 1.00 20.91 ? 104 GLY B O   1 
ATOM   2755 N  N   . GLY B 1 105 ? -0.926  -8.292  -11.463 1.00 20.02 ? 105 GLY B N   1 
ATOM   2756 C  CA  . GLY B 1 105 ? -0.799  -9.742  -11.464 1.00 18.88 ? 105 GLY B CA  1 
ATOM   2757 C  C   . GLY B 1 105 ? 0.243   -10.341 -10.554 1.00 18.75 ? 105 GLY B C   1 
ATOM   2758 O  O   . GLY B 1 105 ? 0.314   -10.024 -9.364  1.00 18.42 ? 105 GLY B O   1 
ATOM   2759 N  N   . GLY B 1 106 ? 1.063   -11.220 -11.122 1.00 16.67 ? 106 GLY B N   1 
ATOM   2760 C  CA  . GLY B 1 106 ? 2.092   -11.890 -10.354 1.00 15.78 ? 106 GLY B CA  1 
ATOM   2761 C  C   . GLY B 1 106 ? 3.177   -10.986 -9.797  1.00 15.75 ? 106 GLY B C   1 
ATOM   2762 O  O   . GLY B 1 106 ? 3.992   -11.461 -9.020  1.00 20.15 ? 106 GLY B O   1 
ATOM   2763 N  N   . LEU B 1 107 ? 3.205   -9.711  -10.191 1.00 15.93 ? 107 LEU B N   1 
ATOM   2764 C  CA  . LEU B 1 107 ? 4.216   -8.811  -9.642  1.00 16.71 ? 107 LEU B CA  1 
ATOM   2765 C  C   . LEU B 1 107 ? 3.720   -8.199  -8.326  1.00 19.02 ? 107 LEU B C   1 
ATOM   2766 O  O   . LEU B 1 107 ? 4.459   -7.464  -7.660  1.00 17.34 ? 107 LEU B O   1 
ATOM   2767 C  CB  . LEU B 1 107 ? 4.600   -7.729  -10.658 1.00 19.30 ? 107 LEU B CB  1 
ATOM   2768 C  CG  . LEU B 1 107 ? 5.259   -8.385  -11.891 1.00 24.34 ? 107 LEU B CG  1 
ATOM   2769 C  CD1 . LEU B 1 107 ? 5.788   -7.309  -12.816 1.00 26.33 ? 107 LEU B CD1 1 
ATOM   2770 C  CD2 . LEU B 1 107 ? 6.387   -9.336  -11.458 1.00 21.99 ? 107 LEU B CD2 1 
ATOM   2771 N  N   . LEU B 1 108 ? 2.462   -8.499  -7.984  1.00 16.74 ? 108 LEU B N   1 
ATOM   2772 C  CA  . LEU B 1 108 ? 1.860   -8.110  -6.716  1.00 18.67 ? 108 LEU B CA  1 
ATOM   2773 C  C   . LEU B 1 108 ? 1.816   -6.638  -6.362  1.00 22.31 ? 108 LEU B C   1 
ATOM   2774 O  O   . LEU B 1 108 ? 1.667   -6.293  -5.175  1.00 21.62 ? 108 LEU B O   1 
ATOM   2775 C  CB  . LEU B 1 108 ? 2.578   -8.857  -5.582  1.00 17.31 ? 108 LEU B CB  1 
ATOM   2776 C  CG  . LEU B 1 108 ? 2.570   -10.380 -5.661  1.00 20.01 ? 108 LEU B CG  1 
ATOM   2777 C  CD1 . LEU B 1 108 ? 3.391   -10.955 -4.509  1.00 19.34 ? 108 LEU B CD1 1 
ATOM   2778 C  CD2 . LEU B 1 108 ? 1.121   -10.888 -5.607  1.00 20.89 ? 108 LEU B CD2 1 
ATOM   2779 N  N   . GLY B 1 109 ? 1.939   -5.776  -7.369  1.00 16.17 ? 109 GLY B N   1 
ATOM   2780 C  CA  . GLY B 1 109 ? 1.918   -4.344  -7.130  1.00 18.30 ? 109 GLY B CA  1 
ATOM   2781 C  C   . GLY B 1 109 ? 3.215   -3.843  -6.509  1.00 19.83 ? 109 GLY B C   1 
ATOM   2782 O  O   . GLY B 1 109 ? 3.289   -2.703  -6.056  1.00 18.73 ? 109 GLY B O   1 
ATOM   2783 N  N   . LEU B 1 110 ? 4.247   -4.679  -6.515  1.00 17.45 ? 110 LEU B N   1 
ATOM   2784 C  CA  . LEU B 1 110 ? 5.527   -4.322  -5.908  1.00 17.74 ? 110 LEU B CA  1 
ATOM   2785 C  C   . LEU B 1 110 ? 6.684   -4.080  -6.867  1.00 24.68 ? 110 LEU B C   1 
ATOM   2786 O  O   . LEU B 1 110 ? 7.621   -3.333  -6.540  1.00 21.58 ? 110 LEU B O   1 
ATOM   2787 C  CB  . LEU B 1 110 ? 5.973   -5.417  -4.944  1.00 18.13 ? 110 LEU B CB  1 
ATOM   2788 C  CG  . LEU B 1 110 ? 5.097   -5.623  -3.699  1.00 20.40 ? 110 LEU B CG  1 
ATOM   2789 C  CD1 . LEU B 1 110 ? 5.603   -6.823  -2.915  1.00 23.90 ? 110 LEU B CD1 1 
ATOM   2790 C  CD2 . LEU B 1 110 ? 5.149   -4.370  -2.845  1.00 27.30 ? 110 LEU B CD2 1 
ATOM   2791 N  N   . PHE B 1 111 ? 6.646   -4.732  -8.027  1.00 22.43 ? 111 PHE B N   1 
ATOM   2792 C  CA  . PHE B 1 111 ? 7.741   -4.608  -8.983  1.00 25.91 ? 111 PHE B CA  1 
ATOM   2793 C  C   . PHE B 1 111 ? 7.305   -4.276  -10.400 1.00 26.90 ? 111 PHE B C   1 
ATOM   2794 O  O   . PHE B 1 111 ? 6.202   -4.612  -10.816 1.00 28.55 ? 111 PHE B O   1 
ATOM   2795 C  CB  . PHE B 1 111 ? 8.543   -5.907  -9.055  1.00 23.88 ? 111 PHE B CB  1 
ATOM   2796 C  CG  . PHE B 1 111 ? 9.057   -6.387  -7.735  1.00 28.47 ? 111 PHE B CG  1 
ATOM   2797 C  CD1 . PHE B 1 111 ? 8.310   -7.273  -6.965  1.00 22.29 ? 111 PHE B CD1 1 
ATOM   2798 C  CD2 . PHE B 1 111 ? 10.303  -5.982  -7.269  1.00 27.89 ? 111 PHE B CD2 1 
ATOM   2799 C  CE1 . PHE B 1 111 ? 8.798   -7.753  -5.754  1.00 25.27 ? 111 PHE B CE1 1 
ATOM   2800 C  CE2 . PHE B 1 111 ? 10.801  -6.456  -6.055  1.00 28.06 ? 111 PHE B CE2 1 
ATOM   2801 C  CZ  . PHE B 1 111 ? 10.050  -7.344  -5.296  1.00 28.72 ? 111 PHE B CZ  1 
ATOM   2802 N  N   . ALA B 1 112 ? 8.201   -3.615  -11.130 1.00 30.62 ? 112 ALA B N   1 
ATOM   2803 C  CA  . ALA B 1 112 ? 7.968   -3.265  -12.531 1.00 29.89 ? 112 ALA B CA  1 
ATOM   2804 C  C   . ALA B 1 112 ? 8.490   -4.467  -13.321 1.00 29.93 ? 112 ALA B C   1 
ATOM   2805 O  O   . ALA B 1 112 ? 9.504   -5.062  -12.953 1.00 28.35 ? 112 ALA B O   1 
ATOM   2806 C  CB  . ALA B 1 112 ? 8.759   -2.009  -12.895 1.00 32.06 ? 112 ALA B CB  1 
ATOM   2807 N  N   . PRO B 1 113 ? 7.810   -4.841  -14.419 1.00 30.17 ? 113 PRO B N   1 
ATOM   2808 C  CA  . PRO B 1 113 ? 8.222   -5.986  -15.242 1.00 33.41 ? 113 PRO B CA  1 
ATOM   2809 C  C   . PRO B 1 113 ? 9.695   -6.000  -15.647 1.00 32.75 ? 113 PRO B C   1 
ATOM   2810 O  O   . PRO B 1 113 ? 10.384  -7.010  -15.505 1.00 34.11 ? 113 PRO B O   1 
ATOM   2811 C  CB  . PRO B 1 113 ? 7.311   -5.883  -16.458 1.00 34.02 ? 113 PRO B CB  1 
ATOM   2812 C  CG  . PRO B 1 113 ? 6.085   -5.235  -15.915 1.00 37.09 ? 113 PRO B CG  1 
ATOM   2813 C  CD  . PRO B 1 113 ? 6.637   -4.168  -15.003 1.00 30.85 ? 113 PRO B CD  1 
ATOM   2814 N  N   . GLY B 1 114 ? 10.178  -4.865  -16.129 1.00 35.51 ? 114 GLY B N   1 
ATOM   2815 C  CA  . GLY B 1 114 ? 11.553  -4.786  -16.584 1.00 38.75 ? 114 GLY B CA  1 
ATOM   2816 C  C   . GLY B 1 114 ? 12.657  -5.026  -15.574 1.00 39.57 ? 114 GLY B C   1 
ATOM   2817 O  O   . GLY B 1 114 ? 13.766  -5.403  -15.954 1.00 40.92 ? 114 GLY B O   1 
ATOM   2818 N  N   . THR B 1 115 ? 12.372  -4.827  -14.293 1.00 36.51 ? 115 THR B N   1 
ATOM   2819 C  CA  . THR B 1 115 ? 13.399  -4.998  -13.279 1.00 36.32 ? 115 THR B CA  1 
ATOM   2820 C  C   . THR B 1 115 ? 12.987  -5.879  -12.110 1.00 35.34 ? 115 THR B C   1 
ATOM   2821 O  O   . THR B 1 115 ? 13.641  -5.864  -11.070 1.00 31.14 ? 115 THR B O   1 
ATOM   2822 C  CB  . THR B 1 115 ? 13.814  -3.625  -12.726 1.00 39.05 ? 115 THR B CB  1 
ATOM   2823 O  OG1 . THR B 1 115 ? 12.636  -2.856  -12.446 1.00 37.35 ? 115 THR B OG1 1 
ATOM   2824 C  CG2 . THR B 1 115 ? 14.677  -2.876  -13.741 1.00 39.72 ? 115 THR B CG2 1 
ATOM   2825 N  N   . ALA B 1 116 ? 11.923  -6.657  -12.294 1.00 32.85 ? 116 ALA B N   1 
ATOM   2826 C  CA  . ALA B 1 116 ? 11.389  -7.510  -11.233 1.00 28.60 ? 116 ALA B CA  1 
ATOM   2827 C  C   . ALA B 1 116 ? 12.349  -8.512  -10.636 1.00 30.81 ? 116 ALA B C   1 
ATOM   2828 O  O   . ALA B 1 116 ? 12.172  -8.925  -9.491  1.00 25.59 ? 116 ALA B O   1 
ATOM   2829 C  CB  . ALA B 1 116 ? 10.144  -8.230  -11.731 1.00 27.15 ? 116 ALA B CB  1 
ATOM   2830 N  N   . GLN B 1 117 ? 13.362  -8.923  -11.393 1.00 28.80 ? 117 GLN B N   1 
ATOM   2831 C  CA  . GLN B 1 117 ? 14.309  -9.889  -10.861 1.00 30.28 ? 117 GLN B CA  1 
ATOM   2832 C  C   . GLN B 1 117 ? 15.711  -9.308  -10.810 1.00 32.93 ? 117 GLN B C   1 
ATOM   2833 O  O   . GLN B 1 117 ? 16.702  -10.035 -10.725 1.00 34.29 ? 117 GLN B O   1 
ATOM   2834 C  CB  . GLN B 1 117 ? 14.290  -11.171 -11.697 1.00 33.96 ? 117 GLN B CB  1 
ATOM   2835 C  CG  . GLN B 1 117 ? 12.961  -11.903 -11.638 1.00 35.01 ? 117 GLN B CG  1 
ATOM   2836 C  CD  . GLN B 1 117 ? 13.005  -13.286 -12.273 1.00 34.17 ? 117 GLN B CD  1 
ATOM   2837 O  OE1 . GLN B 1 117 ? 13.681  -14.197 -11.782 1.00 35.91 ? 117 GLN B OE1 1 
ATOM   2838 N  NE2 . GLN B 1 117 ? 12.274  -13.450 -13.360 1.00 34.61 ? 117 GLN B NE2 1 
ATOM   2839 N  N   . ASN B 1 118 ? 15.783  -7.988  -10.863 1.00 31.24 ? 118 ASN B N   1 
ATOM   2840 C  CA  . ASN B 1 118 ? 17.058  -7.296  -10.806 1.00 35.08 ? 118 ASN B CA  1 
ATOM   2841 C  C   . ASN B 1 118 ? 17.209  -6.732  -9.395  1.00 30.45 ? 118 ASN B C   1 
ATOM   2842 O  O   . ASN B 1 118 ? 16.665  -5.676  -9.079  1.00 31.33 ? 118 ASN B O   1 
ATOM   2843 C  CB  . ASN B 1 118 ? 17.073  -6.161  -11.826 1.00 37.76 ? 118 ASN B CB  1 
ATOM   2844 C  CG  . ASN B 1 118 ? 18.433  -5.501  -11.941 1.00 43.59 ? 118 ASN B CG  1 
ATOM   2845 O  OD1 . ASN B 1 118 ? 19.265  -5.596  -11.031 1.00 39.82 ? 118 ASN B OD1 1 
ATOM   2846 N  ND2 . ASN B 1 118 ? 18.644  -4.816  -13.063 1.00 46.69 ? 118 ASN B ND2 1 
ATOM   2847 N  N   . THR B 1 119 ? 17.956  -7.430  -8.553  1.00 32.48 ? 119 THR B N   1 
ATOM   2848 C  CA  . THR B 1 119 ? 18.112  -6.991  -7.174  1.00 36.39 ? 119 THR B CA  1 
ATOM   2849 C  C   . THR B 1 119 ? 18.757  -5.626  -6.977  1.00 40.23 ? 119 THR B C   1 
ATOM   2850 O  O   . THR B 1 119 ? 18.444  -4.927  -6.010  1.00 41.48 ? 119 THR B O   1 
ATOM   2851 C  CB  . THR B 1 119 ? 18.880  -8.027  -6.339  1.00 37.78 ? 119 THR B CB  1 
ATOM   2852 O  OG1 . THR B 1 119 ? 20.177  -8.250  -6.909  1.00 38.02 ? 119 THR B OG1 1 
ATOM   2853 C  CG2 . THR B 1 119 ? 18.109  -9.332  -6.294  1.00 36.98 ? 119 THR B CG2 1 
ATOM   2854 N  N   . SER B 1 120 ? 19.642  -5.218  -7.880  1.00 40.73 ? 120 SER B N   1 
ATOM   2855 C  CA  . SER B 1 120 ? 20.269  -3.915  -7.704  1.00 41.04 ? 120 SER B CA  1 
ATOM   2856 C  C   . SER B 1 120 ? 19.352  -2.789  -8.186  1.00 40.12 ? 120 SER B C   1 
ATOM   2857 O  O   . SER B 1 120 ? 19.673  -1.614  -8.054  1.00 42.82 ? 120 SER B O   1 
ATOM   2858 C  CB  . SER B 1 120 ? 21.620  -3.868  -8.432  1.00 43.14 ? 120 SER B CB  1 
ATOM   2859 O  OG  . SER B 1 120 ? 21.445  -4.006  -9.825  1.00 47.63 ? 120 SER B OG  1 
ATOM   2860 N  N   . ALA B 1 121 ? 18.187  -3.142  -8.715  1.00 38.81 ? 121 ALA B N   1 
ATOM   2861 C  CA  . ALA B 1 121 ? 17.264  -2.122  -9.203  1.00 37.01 ? 121 ALA B CA  1 
ATOM   2862 C  C   . ALA B 1 121 ? 16.077  -1.843  -8.277  1.00 36.88 ? 121 ALA B C   1 
ATOM   2863 O  O   . ALA B 1 121 ? 15.216  -1.015  -8.595  1.00 38.01 ? 121 ALA B O   1 
ATOM   2864 C  CB  . ALA B 1 121 ? 16.749  -2.515  -10.583 1.00 39.66 ? 121 ALA B CB  1 
ATOM   2865 N  N   . ASN B 1 122 ? 16.024  -2.527  -7.141  1.00 33.11 ? 122 ASN B N   1 
ATOM   2866 C  CA  . ASN B 1 122 ? 14.906  -2.336  -6.215  1.00 32.27 ? 122 ASN B CA  1 
ATOM   2867 C  C   . ASN B 1 122 ? 15.336  -2.126  -4.769  1.00 31.43 ? 122 ASN B C   1 
ATOM   2868 O  O   . ASN B 1 122 ? 16.470  -2.419  -4.381  1.00 29.16 ? 122 ASN B O   1 
ATOM   2869 C  CB  . ASN B 1 122 ? 13.974  -3.563  -6.245  1.00 32.77 ? 122 ASN B CB  1 
ATOM   2870 C  CG  . ASN B 1 122 ? 13.393  -3.834  -7.623  1.00 29.65 ? 122 ASN B CG  1 
ATOM   2871 O  OD1 . ASN B 1 122 ? 12.561  -3.081  -8.112  1.00 35.71 ? 122 ASN B OD1 1 
ATOM   2872 N  ND2 . ASN B 1 122 ? 13.834  -4.917  -8.251  1.00 31.21 ? 122 ASN B ND2 1 
ATOM   2873 N  N   . GLN B 1 123 ? 14.402  -1.618  -3.970  1.00 25.60 ? 123 GLN B N   1 
ATOM   2874 C  CA  . GLN B 1 123 ? 14.631  -1.429  -2.542  1.00 28.07 ? 123 GLN B CA  1 
ATOM   2875 C  C   . GLN B 1 123 ? 13.329  -1.831  -1.866  1.00 24.72 ? 123 GLN B C   1 
ATOM   2876 O  O   . GLN B 1 123 ? 12.451  -0.999  -1.647  1.00 25.70 ? 123 GLN B O   1 
ATOM   2877 C  CB  . GLN B 1 123 ? 14.936  0.031   -2.214  1.00 30.90 ? 123 GLN B CB  1 
ATOM   2878 C  CG  . GLN B 1 123 ? 16.324  0.486   -2.580  1.00 35.26 ? 123 GLN B CG  1 
ATOM   2879 C  CD  . GLN B 1 123 ? 16.563  1.905   -2.109  1.00 39.33 ? 123 GLN B CD  1 
ATOM   2880 O  OE1 . GLN B 1 123 ? 16.020  2.857   -2.673  1.00 43.07 ? 123 GLN B OE1 1 
ATOM   2881 N  NE2 . GLN B 1 123 ? 17.351  2.053   -1.051  1.00 39.25 ? 123 GLN B NE2 1 
ATOM   2882 N  N   . VAL B 1 124 ? 13.191  -3.108  -1.554  1.00 25.04 ? 124 VAL B N   1 
ATOM   2883 C  CA  . VAL B 1 124 ? 11.959  -3.564  -0.916  1.00 21.68 ? 124 VAL B CA  1 
ATOM   2884 C  C   . VAL B 1 124 ? 12.184  -4.892  -0.247  1.00 20.94 ? 124 VAL B C   1 
ATOM   2885 O  O   . VAL B 1 124 ? 12.923  -5.741  -0.762  1.00 19.79 ? 124 VAL B O   1 
ATOM   2886 C  CB  . VAL B 1 124 ? 10.830  -3.732  -1.951  1.00 25.68 ? 124 VAL B CB  1 
ATOM   2887 C  CG1 . VAL B 1 124 ? 11.282  -4.717  -3.035  1.00 25.95 ? 124 VAL B CG1 1 
ATOM   2888 C  CG2 . VAL B 1 124 ? 9.543   -4.258  -1.269  1.00 22.29 ? 124 VAL B CG2 1 
ATOM   2889 N  N   . ILE B 1 125 ? 11.609  -5.048  0.947   1.00 15.78 ? 125 ILE B N   1 
ATOM   2890 C  CA  . ILE B 1 125 ? 11.649  -6.327  1.628   1.00 15.25 ? 125 ILE B CA  1 
ATOM   2891 C  C   . ILE B 1 125 ? 10.158  -6.635  1.772   1.00 18.31 ? 125 ILE B C   1 
ATOM   2892 O  O   . ILE B 1 125 ? 9.383   -5.788  2.225   1.00 17.96 ? 125 ILE B O   1 
ATOM   2893 C  CB  . ILE B 1 125 ? 12.317  -6.260  3.020   1.00 20.37 ? 125 ILE B CB  1 
ATOM   2894 C  CG1 . ILE B 1 125 ? 13.834  -6.071  2.856   1.00 20.24 ? 125 ILE B CG1 1 
ATOM   2895 C  CG2 . ILE B 1 125 ? 12.045  -7.547  3.788   1.00 20.86 ? 125 ILE B CG2 1 
ATOM   2896 C  CD1 . ILE B 1 125 ? 14.577  -5.999  4.196   1.00 24.84 ? 125 ILE B CD1 1 
ATOM   2897 N  N   . ALA B 1 126 ? 9.744   -7.825  1.349   1.00 15.54 ? 126 ALA B N   1 
ATOM   2898 C  CA  . ALA B 1 126 ? 8.326   -8.157  1.463   1.00 15.19 ? 126 ALA B CA  1 
ATOM   2899 C  C   . ALA B 1 126 ? 8.140   -9.606  1.852   1.00 15.51 ? 126 ALA B C   1 
ATOM   2900 O  O   . ALA B 1 126 ? 9.014   -10.456 1.609   1.00 18.77 ? 126 ALA B O   1 
ATOM   2901 C  CB  . ALA B 1 126 ? 7.615   -7.876  0.128   1.00 16.93 ? 126 ALA B CB  1 
ATOM   2902 N  N   . VAL B 1 127 ? 7.008   -9.885  2.491   1.00 13.20 ? 127 VAL B N   1 
ATOM   2903 C  CA  . VAL B 1 127 ? 6.665   -11.248 2.868   1.00 13.43 ? 127 VAL B CA  1 
ATOM   2904 C  C   . VAL B 1 127 ? 5.395   -11.480 2.040   1.00 14.15 ? 127 VAL B C   1 
ATOM   2905 O  O   . VAL B 1 127 ? 4.382   -10.816 2.256   1.00 13.98 ? 127 VAL B O   1 
ATOM   2906 C  CB  . VAL B 1 127 ? 6.353   -11.403 4.385   1.00 13.73 ? 127 VAL B CB  1 
ATOM   2907 C  CG1 . VAL B 1 127 ? 5.878   -12.824 4.662   1.00 15.02 ? 127 VAL B CG1 1 
ATOM   2908 C  CG2 . VAL B 1 127 ? 7.637   -11.113 5.243   1.00 13.67 ? 127 VAL B CG2 1 
ATOM   2909 N  N   . GLU B 1 128 ? 5.464   -12.406 1.084   1.00 13.37 ? 128 GLU B N   1 
ATOM   2910 C  CA  . GLU B 1 128 ? 4.325   -12.664 0.204   1.00 13.71 ? 128 GLU B CA  1 
ATOM   2911 C  C   . GLU B 1 128 ? 3.593   -13.965 0.517   1.00 10.79 ? 128 GLU B C   1 
ATOM   2912 O  O   . GLU B 1 128 ? 4.198   -14.917 0.981   1.00 13.64 ? 128 GLU B O   1 
ATOM   2913 C  CB  . GLU B 1 128 ? 4.798   -12.716 -1.254  1.00 16.23 ? 128 GLU B CB  1 
ATOM   2914 C  CG  . GLU B 1 128 ? 5.818   -13.839 -1.529  1.00 13.19 ? 128 GLU B CG  1 
ATOM   2915 C  CD  . GLU B 1 128 ? 6.069   -14.060 -3.030  1.00 14.14 ? 128 GLU B CD  1 
ATOM   2916 O  OE1 . GLU B 1 128 ? 5.862   -15.195 -3.494  1.00 14.16 ? 128 GLU B OE1 1 
ATOM   2917 O  OE2 . GLU B 1 128 ? 6.468   -13.115 -3.747  1.00 14.43 ? 128 GLU B OE2 1 
ATOM   2918 N  N   . PHE B 1 129 ? 2.277   -13.959 0.281   1.00 12.97 ? 129 PHE B N   1 
ATOM   2919 C  CA  . PHE B 1 129 ? 1.407   -15.124 0.437   1.00 13.81 ? 129 PHE B CA  1 
ATOM   2920 C  C   . PHE B 1 129 ? 0.896   -15.170 -1.002  1.00 14.64 ? 129 PHE B C   1 
ATOM   2921 O  O   . PHE B 1 129 ? -0.005  -14.428 -1.407  1.00 13.77 ? 129 PHE B O   1 
ATOM   2922 C  CB  . PHE B 1 129 ? 0.322   -14.824 1.468   1.00 13.34 ? 129 PHE B CB  1 
ATOM   2923 C  CG  . PHE B 1 129 ? 0.893   -14.564 2.826   1.00 12.26 ? 129 PHE B CG  1 
ATOM   2924 C  CD1 . PHE B 1 129 ? 1.401   -13.312 3.143   1.00 13.00 ? 129 PHE B CD1 1 
ATOM   2925 C  CD2 . PHE B 1 129 ? 1.045   -15.603 3.737   1.00 15.74 ? 129 PHE B CD2 1 
ATOM   2926 C  CE1 . PHE B 1 129 ? 2.071   -13.094 4.365   1.00 17.57 ? 129 PHE B CE1 1 
ATOM   2927 C  CE2 . PHE B 1 129 ? 1.714   -15.388 4.955   1.00 20.07 ? 129 PHE B CE2 1 
ATOM   2928 C  CZ  . PHE B 1 129 ? 2.221   -14.144 5.257   1.00 15.70 ? 129 PHE B CZ  1 
ATOM   2929 N  N   . ASP B 1 130 ? 1.504   -16.084 -1.750  1.00 14.55 ? 130 ASP B N   1 
ATOM   2930 C  CA  . ASP B 1 130 ? 1.350   -16.186 -3.201  1.00 13.20 ? 130 ASP B CA  1 
ATOM   2931 C  C   . ASP B 1 130 ? 0.531   -17.408 -3.563  1.00 14.27 ? 130 ASP B C   1 
ATOM   2932 O  O   . ASP B 1 130 ? 0.964   -18.519 -3.321  1.00 14.55 ? 130 ASP B O   1 
ATOM   2933 C  CB  . ASP B 1 130 ? 2.774   -16.303 -3.783  1.00 17.21 ? 130 ASP B CB  1 
ATOM   2934 C  CG  . ASP B 1 130 ? 2.825   -16.117 -5.286  1.00 16.11 ? 130 ASP B CG  1 
ATOM   2935 O  OD1 . ASP B 1 130 ? 1.765   -16.227 -5.938  1.00 13.72 ? 130 ASP B OD1 1 
ATOM   2936 O  OD2 . ASP B 1 130 ? 3.942   -15.881 -5.812  1.00 15.67 ? 130 ASP B OD2 1 
ATOM   2937 N  N   . THR B 1 131 ? -0.628  -17.180 -4.183  1.00 13.85 ? 131 THR B N   1 
ATOM   2938 C  CA  . THR B 1 131 ? -1.528  -18.286 -4.498  1.00 13.84 ? 131 THR B CA  1 
ATOM   2939 C  C   . THR B 1 131 ? -1.551  -18.712 -5.945  1.00 16.28 ? 131 THR B C   1 
ATOM   2940 O  O   . THR B 1 131 ? -2.258  -19.668 -6.296  1.00 17.13 ? 131 THR B O   1 
ATOM   2941 C  CB  . THR B 1 131 ? -2.975  -17.913 -4.142  1.00 12.89 ? 131 THR B CB  1 
ATOM   2942 O  OG1 . THR B 1 131 ? -3.349  -16.760 -4.900  1.00 13.51 ? 131 THR B OG1 1 
ATOM   2943 C  CG2 . THR B 1 131 ? -3.077  -17.558 -2.635  1.00 16.56 ? 131 THR B CG2 1 
ATOM   2944 N  N   . PHE B 1 132 ? -0.802  -18.021 -6.793  1.00 18.18 ? 132 PHE B N   1 
ATOM   2945 C  CA  . PHE B 1 132 ? -0.845  -18.342 -8.212  1.00 17.06 ? 132 PHE B CA  1 
ATOM   2946 C  C   . PHE B 1 132 ? 0.569   -18.582 -8.687  1.00 22.35 ? 132 PHE B C   1 
ATOM   2947 O  O   . PHE B 1 132 ? 1.434   -17.711 -8.584  1.00 15.66 ? 132 PHE B O   1 
ATOM   2948 C  CB  . PHE B 1 132 ? -1.499  -17.200 -8.970  1.00 18.91 ? 132 PHE B CB  1 
ATOM   2949 C  CG  . PHE B 1 132 ? -1.760  -17.523 -10.419 1.00 20.41 ? 132 PHE B CG  1 
ATOM   2950 C  CD1 . PHE B 1 132 ? -2.927  -18.177 -10.800 1.00 25.17 ? 132 PHE B CD1 1 
ATOM   2951 C  CD2 . PHE B 1 132 ? -0.812  -17.208 -11.389 1.00 25.84 ? 132 PHE B CD2 1 
ATOM   2952 C  CE1 . PHE B 1 132 ? -3.152  -18.518 -12.146 1.00 26.60 ? 132 PHE B CE1 1 
ATOM   2953 C  CE2 . PHE B 1 132 ? -1.030  -17.546 -12.737 1.00 25.71 ? 132 PHE B CE2 1 
ATOM   2954 C  CZ  . PHE B 1 132 ? -2.202  -18.199 -13.104 1.00 22.20 ? 132 PHE B CZ  1 
ATOM   2955 N  N   . TYR B 1 133 ? 0.794   -19.766 -9.243  1.00 20.30 ? 133 TYR B N   1 
ATOM   2956 C  CA  . TYR B 1 133 ? 2.143   -20.154 -9.622  1.00 22.68 ? 133 TYR B CA  1 
ATOM   2957 C  C   . TYR B 1 133 ? 2.285   -20.828 -10.997 1.00 23.84 ? 133 TYR B C   1 
ATOM   2958 O  O   . TYR B 1 133 ? 3.265   -21.532 -11.235 1.00 27.60 ? 133 TYR B O   1 
ATOM   2959 C  CB  . TYR B 1 133 ? 2.662   -21.081 -8.528  1.00 19.77 ? 133 TYR B CB  1 
ATOM   2960 C  CG  . TYR B 1 133 ? 1.633   -22.125 -8.161  1.00 26.60 ? 133 TYR B CG  1 
ATOM   2961 C  CD1 . TYR B 1 133 ? 0.585   -21.831 -7.277  1.00 25.52 ? 133 TYR B CD1 1 
ATOM   2962 C  CD2 . TYR B 1 133 ? 1.641   -23.376 -8.778  1.00 26.56 ? 133 TYR B CD2 1 
ATOM   2963 C  CE1 . TYR B 1 133 ? -0.433  -22.760 -7.027  1.00 30.18 ? 133 TYR B CE1 1 
ATOM   2964 C  CE2 . TYR B 1 133 ? 0.630   -24.307 -8.535  1.00 31.12 ? 133 TYR B CE2 1 
ATOM   2965 C  CZ  . TYR B 1 133 ? -0.401  -23.993 -7.664  1.00 32.27 ? 133 TYR B CZ  1 
ATOM   2966 O  OH  . TYR B 1 133 ? -1.406  -24.907 -7.451  1.00 39.15 ? 133 TYR B OH  1 
ATOM   2967 N  N   . ALA B 1 134 ? 1.326   -20.602 -11.888 1.00 26.66 ? 134 ALA B N   1 
ATOM   2968 C  CA  . ALA B 1 134 ? 1.389   -21.188 -13.234 1.00 26.93 ? 134 ALA B CA  1 
ATOM   2969 C  C   . ALA B 1 134 ? 2.787   -20.936 -13.789 1.00 29.58 ? 134 ALA B C   1 
ATOM   2970 O  O   . ALA B 1 134 ? 3.215   -19.790 -13.963 1.00 28.25 ? 134 ALA B O   1 
ATOM   2971 C  CB  . ALA B 1 134 ? 0.348   -20.544 -14.125 1.00 29.96 ? 134 ALA B CB  1 
ATOM   2972 N  N   . GLN B 1 135 ? 3.490   -22.020 -14.075 1.00 33.66 ? 135 GLN B N   1 
ATOM   2973 C  CA  . GLN B 1 135 ? 4.855   -21.947 -14.574 1.00 35.92 ? 135 GLN B CA  1 
ATOM   2974 C  C   . GLN B 1 135 ? 5.041   -21.225 -15.907 1.00 36.93 ? 135 GLN B C   1 
ATOM   2975 O  O   . GLN B 1 135 ? 6.154   -20.850 -16.259 1.00 37.77 ? 135 GLN B O   1 
ATOM   2976 C  CB  . GLN B 1 135 ? 5.412   -23.362 -14.642 1.00 34.87 ? 135 GLN B CB  1 
ATOM   2977 C  CG  . GLN B 1 135 ? 5.388   -24.044 -13.287 1.00 37.09 ? 135 GLN B CG  1 
ATOM   2978 C  CD  . GLN B 1 135 ? 6.393   -23.435 -12.330 1.00 40.01 ? 135 GLN B CD  1 
ATOM   2979 O  OE1 . GLN B 1 135 ? 7.601   -23.527 -12.555 1.00 40.14 ? 135 GLN B OE1 1 
ATOM   2980 N  NE2 . GLN B 1 135 ? 5.904   -22.799 -11.259 1.00 34.48 ? 135 GLN B NE2 1 
ATOM   2981 N  N   . ASP B 1 136 ? 3.959   -21.008 -16.641 1.00 38.89 ? 136 ASP B N   1 
ATOM   2982 C  CA  . ASP B 1 136 ? 4.062   -20.326 -17.927 1.00 42.13 ? 136 ASP B CA  1 
ATOM   2983 C  C   . ASP B 1 136 ? 4.127   -18.811 -17.787 1.00 40.15 ? 136 ASP B C   1 
ATOM   2984 O  O   . ASP B 1 136 ? 4.715   -18.140 -18.632 1.00 40.87 ? 136 ASP B O   1 
ATOM   2985 C  CB  . ASP B 1 136 ? 2.884   -20.702 -18.834 1.00 47.33 ? 136 ASP B CB  1 
ATOM   2986 C  CG  . ASP B 1 136 ? 1.555   -20.236 -18.278 1.00 50.86 ? 136 ASP B CG  1 
ATOM   2987 O  OD1 . ASP B 1 136 ? 1.208   -20.657 -17.154 1.00 54.87 ? 136 ASP B OD1 1 
ATOM   2988 O  OD2 . ASP B 1 136 ? 0.861   -19.447 -18.960 1.00 54.25 ? 136 ASP B OD2 1 
ATOM   2989 N  N   . SER B 1 137 ? 3.524   -18.261 -16.733 1.00 36.44 ? 137 SER B N   1 
ATOM   2990 C  CA  . SER B 1 137 ? 3.549   -16.812 -16.542 1.00 32.56 ? 137 SER B CA  1 
ATOM   2991 C  C   . SER B 1 137 ? 4.339   -16.414 -15.306 1.00 32.07 ? 137 SER B C   1 
ATOM   2992 O  O   . SER B 1 137 ? 5.089   -15.442 -15.328 1.00 36.85 ? 137 SER B O   1 
ATOM   2993 C  CB  . SER B 1 137 ? 2.129   -16.244 -16.439 1.00 36.34 ? 137 SER B CB  1 
ATOM   2994 O  OG  . SER B 1 137 ? 1.402   -16.861 -15.391 1.00 33.21 ? 137 SER B OG  1 
ATOM   2995 N  N   . ASN B 1 138 ? 4.170   -17.154 -14.219 1.00 25.13 ? 138 ASN B N   1 
ATOM   2996 C  CA  . ASN B 1 138 ? 4.904   -16.832 -12.994 1.00 24.33 ? 138 ASN B CA  1 
ATOM   2997 C  C   . ASN B 1 138 ? 6.124   -17.758 -12.990 1.00 20.97 ? 138 ASN B C   1 
ATOM   2998 O  O   . ASN B 1 138 ? 6.269   -18.640 -12.145 1.00 18.19 ? 138 ASN B O   1 
ATOM   2999 C  CB  . ASN B 1 138 ? 3.999   -17.083 -11.773 1.00 23.96 ? 138 ASN B CB  1 
ATOM   3000 C  CG  . ASN B 1 138 ? 2.938   -15.987 -11.586 1.00 21.26 ? 138 ASN B CG  1 
ATOM   3001 O  OD1 . ASN B 1 138 ? 2.740   -15.494 -10.469 1.00 20.02 ? 138 ASN B OD1 1 
ATOM   3002 N  ND2 . ASN B 1 138 ? 2.257   -15.597 -12.669 1.00 22.04 ? 138 ASN B ND2 1 
ATOM   3003 N  N   . THR B 1 139 ? 7.011   -17.550 -13.960 1.00 23.22 ? 139 THR B N   1 
ATOM   3004 C  CA  . THR B 1 139 ? 8.171   -18.419 -14.124 1.00 25.87 ? 139 THR B CA  1 
ATOM   3005 C  C   . THR B 1 139 ? 9.145   -18.498 -12.955 1.00 24.08 ? 139 THR B C   1 
ATOM   3006 O  O   . THR B 1 139 ? 9.885   -19.472 -12.831 1.00 28.66 ? 139 THR B O   1 
ATOM   3007 C  CB  . THR B 1 139 ? 8.962   -18.022 -15.406 1.00 24.91 ? 139 THR B CB  1 
ATOM   3008 O  OG1 . THR B 1 139 ? 9.426   -16.675 -15.280 1.00 28.70 ? 139 THR B OG1 1 
ATOM   3009 C  CG2 . THR B 1 139 ? 8.054   -18.083 -16.622 1.00 30.38 ? 139 THR B CG2 1 
ATOM   3010 N  N   . TRP B 1 140 ? 9.162   -17.465 -12.122 1.00 20.34 ? 140 TRP B N   1 
ATOM   3011 C  CA  . TRP B 1 140 ? 10.051  -17.397 -10.964 1.00 21.05 ? 140 TRP B CA  1 
ATOM   3012 C  C   . TRP B 1 140 ? 9.557   -18.191 -9.754  1.00 20.18 ? 140 TRP B C   1 
ATOM   3013 O  O   . TRP B 1 140 ? 10.314  -18.453 -8.813  1.00 21.78 ? 140 TRP B O   1 
ATOM   3014 C  CB  . TRP B 1 140 ? 10.205  -15.926 -10.569 1.00 23.68 ? 140 TRP B CB  1 
ATOM   3015 C  CG  . TRP B 1 140 ? 8.866   -15.270 -10.401 1.00 23.28 ? 140 TRP B CG  1 
ATOM   3016 C  CD1 . TRP B 1 140 ? 8.039   -15.353 -9.306  1.00 23.66 ? 140 TRP B CD1 1 
ATOM   3017 C  CD2 . TRP B 1 140 ? 8.140   -14.542 -11.390 1.00 24.79 ? 140 TRP B CD2 1 
ATOM   3018 N  NE1 . TRP B 1 140 ? 6.851   -14.725 -9.561  1.00 20.63 ? 140 TRP B NE1 1 
ATOM   3019 C  CE2 . TRP B 1 140 ? 6.879   -14.217 -10.829 1.00 24.76 ? 140 TRP B CE2 1 
ATOM   3020 C  CE3 . TRP B 1 140 ? 8.424   -14.134 -12.696 1.00 25.75 ? 140 TRP B CE3 1 
ATOM   3021 C  CZ2 . TRP B 1 140 ? 5.906   -13.503 -11.538 1.00 23.02 ? 140 TRP B CZ2 1 
ATOM   3022 C  CZ3 . TRP B 1 140 ? 7.454   -13.424 -13.398 1.00 27.00 ? 140 TRP B CZ3 1 
ATOM   3023 C  CH2 . TRP B 1 140 ? 6.210   -13.117 -12.816 1.00 29.99 ? 140 TRP B CH2 1 
ATOM   3024 N  N   . ASP B 1 141 ? 8.279   -18.567 -9.762  1.00 20.18 ? 141 ASP B N   1 
ATOM   3025 C  CA  . ASP B 1 141 ? 7.692   -19.282 -8.624  1.00 20.83 ? 141 ASP B CA  1 
ATOM   3026 C  C   . ASP B 1 141 ? 7.892   -20.772 -8.578  1.00 24.78 ? 141 ASP B C   1 
ATOM   3027 O  O   . ASP B 1 141 ? 8.063   -21.430 -9.613  1.00 23.37 ? 141 ASP B O   1 
ATOM   3028 C  CB  . ASP B 1 141 ? 6.160   -19.133 -8.599  1.00 19.10 ? 141 ASP B CB  1 
ATOM   3029 C  CG  . ASP B 1 141 ? 5.699   -17.814 -8.056  1.00 21.15 ? 141 ASP B CG  1 
ATOM   3030 O  OD1 . ASP B 1 141 ? 6.402   -17.243 -7.213  1.00 16.04 ? 141 ASP B OD1 1 
ATOM   3031 O  OD2 . ASP B 1 141 ? 4.615   -17.358 -8.443  1.00 19.40 ? 141 ASP B OD2 1 
ATOM   3032 N  N   . PRO B 1 142 ? 7.856   -21.331 -7.363  1.00 23.73 ? 142 PRO B N   1 
ATOM   3033 C  CA  . PRO B 1 142 ? 7.984   -22.774 -7.172  1.00 23.90 ? 142 PRO B CA  1 
ATOM   3034 C  C   . PRO B 1 142 ? 6.596   -23.220 -7.644  1.00 29.92 ? 142 PRO B C   1 
ATOM   3035 O  O   . PRO B 1 142 ? 5.681   -22.387 -7.759  1.00 26.39 ? 142 PRO B O   1 
ATOM   3036 C  CB  . PRO B 1 142 ? 8.146   -22.925 -5.662  1.00 29.00 ? 142 PRO B CB  1 
ATOM   3037 C  CG  . PRO B 1 142 ? 7.401   -21.708 -5.111  1.00 26.94 ? 142 PRO B CG  1 
ATOM   3038 C  CD  . PRO B 1 142 ? 7.856   -20.622 -6.067  1.00 24.88 ? 142 PRO B CD  1 
ATOM   3039 N  N   . ASN B 1 143 ? 6.410   -24.511 -7.898  1.00 25.86 ? 143 ASN B N   1 
ATOM   3040 C  CA  . ASN B 1 143 ? 5.131   -24.966 -8.417  1.00 30.37 ? 143 ASN B CA  1 
ATOM   3041 C  C   . ASN B 1 143 ? 4.076   -25.362 -7.392  1.00 29.33 ? 143 ASN B C   1 
ATOM   3042 O  O   . ASN B 1 143 ? 3.591   -26.493 -7.387  1.00 29.92 ? 143 ASN B O   1 
ATOM   3043 C  CB  . ASN B 1 143 ? 5.385   -26.116 -9.402  1.00 32.94 ? 143 ASN B CB  1 
ATOM   3044 C  CG  . ASN B 1 143 ? 4.185   -26.427 -10.246 1.00 36.96 ? 143 ASN B CG  1 
ATOM   3045 O  OD1 . ASN B 1 143 ? 3.467   -25.526 -10.671 1.00 38.12 ? 143 ASN B OD1 1 
ATOM   3046 N  ND2 . ASN B 1 143 ? 3.965   -27.716 -10.516 1.00 43.00 ? 143 ASN B ND2 1 
ATOM   3047 N  N   . TYR B 1 144 ? 3.724   -24.421 -6.519  1.00 25.05 ? 144 TYR B N   1 
ATOM   3048 C  CA  . TYR B 1 144 ? 2.705   -24.631 -5.493  1.00 23.52 ? 144 TYR B CA  1 
ATOM   3049 C  C   . TYR B 1 144 ? 2.517   -23.324 -4.738  1.00 21.74 ? 144 TYR B C   1 
ATOM   3050 O  O   . TYR B 1 144 ? 3.374   -22.437 -4.828  1.00 18.39 ? 144 TYR B O   1 
ATOM   3051 C  CB  . TYR B 1 144 ? 3.112   -25.732 -4.505  1.00 25.31 ? 144 TYR B CB  1 
ATOM   3052 C  CG  . TYR B 1 144 ? 4.533   -25.676 -4.021  1.00 28.04 ? 144 TYR B CG  1 
ATOM   3053 C  CD1 . TYR B 1 144 ? 4.950   -24.723 -3.084  1.00 26.55 ? 144 TYR B CD1 1 
ATOM   3054 C  CD2 . TYR B 1 144 ? 5.483   -26.549 -4.536  1.00 33.83 ? 144 TYR B CD2 1 
ATOM   3055 C  CE1 . TYR B 1 144 ? 6.277   -24.642 -2.689  1.00 32.09 ? 144 TYR B CE1 1 
ATOM   3056 C  CE2 . TYR B 1 144 ? 6.805   -26.476 -4.152  1.00 36.21 ? 144 TYR B CE2 1 
ATOM   3057 C  CZ  . TYR B 1 144 ? 7.199   -25.526 -3.238  1.00 35.89 ? 144 TYR B CZ  1 
ATOM   3058 O  OH  . TYR B 1 144 ? 8.520   -25.447 -2.909  1.00 39.74 ? 144 TYR B OH  1 
ATOM   3059 N  N   . PRO B 1 145 ? 1.384   -23.178 -4.025  1.00 21.94 ? 145 PRO B N   1 
ATOM   3060 C  CA  . PRO B 1 145 ? 1.117   -21.957 -3.254  1.00 18.40 ? 145 PRO B CA  1 
ATOM   3061 C  C   . PRO B 1 145 ? 2.197   -21.887 -2.173  1.00 16.83 ? 145 PRO B C   1 
ATOM   3062 O  O   . PRO B 1 145 ? 2.605   -22.906 -1.624  1.00 18.19 ? 145 PRO B O   1 
ATOM   3063 C  CB  . PRO B 1 145 ? -0.302  -22.183 -2.713  1.00 19.57 ? 145 PRO B CB  1 
ATOM   3064 C  CG  . PRO B 1 145 ? -0.426  -23.661 -2.674  1.00 26.86 ? 145 PRO B CG  1 
ATOM   3065 C  CD  . PRO B 1 145 ? 0.262   -24.126 -3.919  1.00 21.95 ? 145 PRO B CD  1 
ATOM   3066 N  N   . HIS B 1 146 ? 2.651   -20.679 -1.856  1.00 15.20 ? 146 HIS B N   1 
ATOM   3067 C  CA  . HIS B 1 146 ? 3.745   -20.562 -0.928  1.00 12.44 ? 146 HIS B CA  1 
ATOM   3068 C  C   . HIS B 1 146 ? 3.808   -19.241 -0.192  1.00 13.93 ? 146 HIS B C   1 
ATOM   3069 O  O   . HIS B 1 146 ? 3.183   -18.259 -0.598  1.00 12.80 ? 146 HIS B O   1 
ATOM   3070 C  CB  . HIS B 1 146 ? 5.059   -20.676 -1.721  1.00 11.68 ? 146 HIS B CB  1 
ATOM   3071 C  CG  . HIS B 1 146 ? 5.115   -19.774 -2.917  1.00 15.75 ? 146 HIS B CG  1 
ATOM   3072 N  ND1 . HIS B 1 146 ? 4.526   -20.093 -4.126  1.00 16.13 ? 146 HIS B ND1 1 
ATOM   3073 C  CD2 . HIS B 1 146 ? 5.674   -18.549 -3.089  1.00 13.34 ? 146 HIS B CD2 1 
ATOM   3074 C  CE1 . HIS B 1 146 ? 4.717   -19.105 -4.982  1.00 17.57 ? 146 HIS B CE1 1 
ATOM   3075 N  NE2 . HIS B 1 146 ? 5.414   -18.151 -4.380  1.00 19.13 ? 146 HIS B NE2 1 
ATOM   3076 N  N   . ILE B 1 147 ? 4.583   -19.253 0.885   1.00 12.13 ? 147 ILE B N   1 
ATOM   3077 C  CA  . ILE B 1 147 ? 4.884   -18.031 1.613   1.00 12.40 ? 147 ILE B CA  1 
ATOM   3078 C  C   . ILE B 1 147 ? 6.313   -17.776 1.167   1.00 14.34 ? 147 ILE B C   1 
ATOM   3079 O  O   . ILE B 1 147 ? 7.142   -18.700 1.132   1.00 17.57 ? 147 ILE B O   1 
ATOM   3080 C  CB  . ILE B 1 147 ? 4.879   -18.209 3.122   1.00 14.63 ? 147 ILE B CB  1 
ATOM   3081 C  CG1 . ILE B 1 147 ? 3.441   -18.431 3.593   1.00 16.36 ? 147 ILE B CG1 1 
ATOM   3082 C  CG2 . ILE B 1 147 ? 5.489   -16.952 3.787   1.00 14.70 ? 147 ILE B CG2 1 
ATOM   3083 C  CD1 . ILE B 1 147 ? 3.330   -18.836 5.058   1.00 20.00 ? 147 ILE B CD1 1 
ATOM   3084 N  N   . GLY B 1 148 ? 6.606   -16.539 0.809   1.00 13.35 ? 148 GLY B N   1 
ATOM   3085 C  CA  . GLY B 1 148 ? 7.963   -16.245 0.365   1.00 16.15 ? 148 GLY B CA  1 
ATOM   3086 C  C   . GLY B 1 148 ? 8.506   -14.988 0.999   1.00 18.21 ? 148 GLY B C   1 
ATOM   3087 O  O   . GLY B 1 148 ? 7.748   -14.129 1.452   1.00 17.49 ? 148 GLY B O   1 
ATOM   3088 N  N   . ILE B 1 149 ? 9.825   -14.917 1.093   1.00 15.45 ? 149 ILE B N   1 
ATOM   3089 C  CA  . ILE B 1 149 ? 10.464  -13.715 1.617   1.00 16.46 ? 149 ILE B CA  1 
ATOM   3090 C  C   . ILE B 1 149 ? 11.124  -13.130 0.384   1.00 17.91 ? 149 ILE B C   1 
ATOM   3091 O  O   . ILE B 1 149 ? 11.902  -13.809 -0.307  1.00 19.23 ? 149 ILE B O   1 
ATOM   3092 C  CB  . ILE B 1 149 ? 11.500  -14.043 2.700   1.00 17.02 ? 149 ILE B CB  1 
ATOM   3093 C  CG1 . ILE B 1 149 ? 10.777  -14.539 3.960   1.00 17.86 ? 149 ILE B CG1 1 
ATOM   3094 C  CG2 . ILE B 1 149 ? 12.321  -12.767 3.014   1.00 19.28 ? 149 ILE B CG2 1 
ATOM   3095 C  CD1 . ILE B 1 149 ? 11.684  -15.056 5.073   1.00 24.60 ? 149 ILE B CD1 1 
ATOM   3096 N  N   . ASP B 1 150 ? 10.773  -11.891 0.073   1.00 13.90 ? 150 ASP B N   1 
ATOM   3097 C  CA  . ASP B 1 150 ? 11.292  -11.222 -1.107  1.00 15.62 ? 150 ASP B CA  1 
ATOM   3098 C  C   . ASP B 1 150 ? 12.232  -10.090 -0.731  1.00 19.83 ? 150 ASP B C   1 
ATOM   3099 O  O   . ASP B 1 150 ? 11.850  -9.201  0.030   1.00 19.16 ? 150 ASP B O   1 
ATOM   3100 C  CB  . ASP B 1 150 ? 10.147  -10.626 -1.925  1.00 18.12 ? 150 ASP B CB  1 
ATOM   3101 C  CG  . ASP B 1 150 ? 9.148   -11.677 -2.405  1.00 20.31 ? 150 ASP B CG  1 
ATOM   3102 O  OD1 . ASP B 1 150 ? 8.055   -11.298 -2.876  1.00 19.99 ? 150 ASP B OD1 1 
ATOM   3103 O  OD2 . ASP B 1 150 ? 9.460   -12.870 -2.316  1.00 18.47 ? 150 ASP B OD2 1 
ATOM   3104 N  N   . VAL B 1 151 ? 13.451  -10.111 -1.277  1.00 16.98 ? 151 VAL B N   1 
ATOM   3105 C  CA  . VAL B 1 151 ? 14.405  -9.042  -0.990  1.00 17.46 ? 151 VAL B CA  1 
ATOM   3106 C  C   . VAL B 1 151 ? 14.873  -8.504  -2.329  1.00 18.12 ? 151 VAL B C   1 
ATOM   3107 O  O   . VAL B 1 151 ? 15.698  -9.142  -2.989  1.00 22.30 ? 151 VAL B O   1 
ATOM   3108 C  CB  . VAL B 1 151 ? 15.627  -9.544  -0.201  1.00 17.63 ? 151 VAL B CB  1 
ATOM   3109 C  CG1 . VAL B 1 151 ? 16.584  -8.380  0.034   1.00 26.47 ? 151 VAL B CG1 1 
ATOM   3110 C  CG2 . VAL B 1 151 ? 15.208  -10.153 1.149   1.00 21.02 ? 151 VAL B CG2 1 
ATOM   3111 N  N   . ASN B 1 152 ? 14.300  -7.375  -2.740  1.00 18.31 ? 152 ASN B N   1 
ATOM   3112 C  CA  . ASN B 1 152 ? 14.633  -6.698  -3.991  1.00 23.31 ? 152 ASN B CA  1 
ATOM   3113 C  C   . ASN B 1 152 ? 14.316  -7.482  -5.249  1.00 24.30 ? 152 ASN B C   1 
ATOM   3114 O  O   . ASN B 1 152 ? 14.799  -7.142  -6.329  1.00 21.18 ? 152 ASN B O   1 
ATOM   3115 C  CB  . ASN B 1 152 ? 16.114  -6.302  -3.991  1.00 20.83 ? 152 ASN B CB  1 
ATOM   3116 C  CG  . ASN B 1 152 ? 16.410  -5.229  -2.981  1.00 25.77 ? 152 ASN B CG  1 
ATOM   3117 O  OD1 . ASN B 1 152 ? 15.509  -4.492  -2.583  1.00 23.19 ? 152 ASN B OD1 1 
ATOM   3118 N  ND2 . ASN B 1 152 ? 17.673  -5.113  -2.572  1.00 26.01 ? 152 ASN B ND2 1 
ATOM   3119 N  N   . SER B 1 153 ? 13.502  -8.527  -5.117  1.00 20.28 ? 153 SER B N   1 
ATOM   3120 C  CA  . SER B 1 153 ? 13.143  -9.323  -6.290  1.00 22.79 ? 153 SER B CA  1 
ATOM   3121 C  C   . SER B 1 153 ? 11.866  -10.133 -6.084  1.00 21.89 ? 153 SER B C   1 
ATOM   3122 O  O   . SER B 1 153 ? 11.596  -10.608 -4.969  1.00 17.79 ? 153 SER B O   1 
ATOM   3123 C  CB  . SER B 1 153 ? 14.280  -10.291 -6.617  1.00 24.29 ? 153 SER B CB  1 
ATOM   3124 O  OG  . SER B 1 153 ? 13.894  -11.165 -7.661  1.00 23.44 ? 153 SER B OG  1 
ATOM   3125 N  N   . ILE B 1 154 ? 11.100  -10.310 -7.158  1.00 22.22 ? 154 ILE B N   1 
ATOM   3126 C  CA  . ILE B 1 154 ? 9.872   -11.112 -7.069  1.00 20.89 ? 154 ILE B CA  1 
ATOM   3127 C  C   . ILE B 1 154 ? 10.248  -12.605 -6.963  1.00 22.29 ? 154 ILE B C   1 
ATOM   3128 O  O   . ILE B 1 154 ? 9.422   -13.442 -6.563  1.00 18.97 ? 154 ILE B O   1 
ATOM   3129 C  CB  . ILE B 1 154 ? 8.937   -10.864 -8.288  1.00 22.98 ? 154 ILE B CB  1 
ATOM   3130 C  CG1 . ILE B 1 154 ? 7.535   -11.471 -8.024  1.00 21.48 ? 154 ILE B CG1 1 
ATOM   3131 C  CG2 . ILE B 1 154 ? 9.575   -11.462 -9.562  1.00 24.28 ? 154 ILE B CG2 1 
ATOM   3132 C  CD1 . ILE B 1 154 ? 6.814   -10.914 -6.753  1.00 18.86 ? 154 ILE B CD1 1 
ATOM   3133 N  N   . ARG B 1 155 ? 11.487  -12.960 -7.328  1.00 20.60 ? 155 ARG B N   1 
ATOM   3134 C  CA  . ARG B 1 155 ? 11.905  -14.350 -7.174  1.00 19.14 ? 155 ARG B CA  1 
ATOM   3135 C  C   . ARG B 1 155 ? 12.379  -14.403 -5.725  1.00 24.06 ? 155 ARG B C   1 
ATOM   3136 O  O   . ARG B 1 155 ? 13.461  -13.905 -5.402  1.00 22.30 ? 155 ARG B O   1 
ATOM   3137 C  CB  . ARG B 1 155 ? 13.067  -14.716 -8.125  1.00 24.29 ? 155 ARG B CB  1 
ATOM   3138 C  CG  . ARG B 1 155 ? 13.601  -16.153 -7.891  1.00 20.90 ? 155 ARG B CG  1 
ATOM   3139 C  CD  . ARG B 1 155 ? 14.829  -16.461 -8.758  1.00 31.29 ? 155 ARG B CD  1 
ATOM   3140 N  NE  . ARG B 1 155 ? 14.493  -16.413 -10.174 1.00 37.51 ? 155 ARG B NE  1 
ATOM   3141 C  CZ  . ARG B 1 155 ? 14.041  -17.452 -10.874 1.00 40.71 ? 155 ARG B CZ  1 
ATOM   3142 N  NH1 . ARG B 1 155 ? 13.754  -17.306 -12.162 1.00 39.46 ? 155 ARG B NH1 1 
ATOM   3143 N  NH2 . ARG B 1 155 ? 13.910  -18.642 -10.298 1.00 42.65 ? 155 ARG B NH2 1 
ATOM   3144 N  N   . SER B 1 156 ? 11.558  -14.997 -4.857  1.00 18.40 ? 156 SER B N   1 
ATOM   3145 C  CA  . SER B 1 156 ? 11.836  -15.082 -3.433  1.00 18.70 ? 156 SER B CA  1 
ATOM   3146 C  C   . SER B 1 156 ? 13.198  -15.666 -3.067  1.00 20.37 ? 156 SER B C   1 
ATOM   3147 O  O   . SER B 1 156 ? 13.656  -16.625 -3.693  1.00 20.86 ? 156 SER B O   1 
ATOM   3148 C  CB  . SER B 1 156 ? 10.747  -15.922 -2.759  1.00 18.24 ? 156 SER B CB  1 
ATOM   3149 O  OG  . SER B 1 156 ? 9.466   -15.346 -3.007  1.00 15.18 ? 156 SER B OG  1 
ATOM   3150 N  N   . VAL B 1 157 ? 13.831  -15.108 -2.037  1.00 18.08 ? 157 VAL B N   1 
ATOM   3151 C  CA  . VAL B 1 157 ? 15.118  -15.635 -1.607  1.00 20.33 ? 157 VAL B CA  1 
ATOM   3152 C  C   . VAL B 1 157 ? 14.834  -16.946 -0.927  1.00 22.38 ? 157 VAL B C   1 
ATOM   3153 O  O   . VAL B 1 157 ? 15.711  -17.805 -0.815  1.00 23.53 ? 157 VAL B O   1 
ATOM   3154 C  CB  . VAL B 1 157 ? 15.868  -14.685 -0.632  1.00 18.06 ? 157 VAL B CB  1 
ATOM   3155 C  CG1 . VAL B 1 157 ? 16.173  -13.387 -1.346  1.00 22.02 ? 157 VAL B CG1 1 
ATOM   3156 C  CG2 . VAL B 1 157 ? 15.044  -14.419 0.639   1.00 20.46 ? 157 VAL B CG2 1 
ATOM   3157 N  N   . LYS B 1 158 ? 13.590  -17.114 -0.489  1.00 20.80 ? 158 LYS B N   1 
ATOM   3158 C  CA  . LYS B 1 158 ? 13.181  -18.345 0.164   1.00 25.24 ? 158 LYS B CA  1 
ATOM   3159 C  C   . LYS B 1 158 ? 11.666  -18.525 0.156   1.00 24.29 ? 158 LYS B C   1 
ATOM   3160 O  O   . LYS B 1 158 ? 10.926  -17.560 0.299   1.00 21.70 ? 158 LYS B O   1 
ATOM   3161 C  CB  . LYS B 1 158 ? 13.653  -18.364 1.615   1.00 26.16 ? 158 LYS B CB  1 
ATOM   3162 C  CG  . LYS B 1 158 ? 13.172  -19.588 2.372   1.00 34.71 ? 158 LYS B CG  1 
ATOM   3163 C  CD  . LYS B 1 158 ? 13.776  -19.685 3.760   1.00 32.89 ? 158 LYS B CD  1 
ATOM   3164 C  CE  . LYS B 1 158 ? 15.267  -19.784 3.715   1.00 27.20 ? 158 LYS B CE  1 
ATOM   3165 N  NZ  . LYS B 1 158 ? 15.772  -20.112 5.072   1.00 24.75 ? 158 LYS B NZ  1 
ATOM   3166 N  N   . THR B 1 159 ? 11.210  -19.760 -0.017  1.00 23.91 ? 159 THR B N   1 
ATOM   3167 C  CA  . THR B 1 159 ? 9.778   -20.031 0.033   1.00 21.49 ? 159 THR B CA  1 
ATOM   3168 C  C   . THR B 1 159 ? 9.525   -21.300 0.846   1.00 23.60 ? 159 THR B C   1 
ATOM   3169 O  O   . THR B 1 159 ? 10.432  -22.104 1.074   1.00 22.74 ? 159 THR B O   1 
ATOM   3170 C  CB  . THR B 1 159 ? 9.159   -20.244 -1.377  1.00 21.83 ? 159 THR B CB  1 
ATOM   3171 O  OG1 . THR B 1 159 ? 9.737   -21.409 -1.982  1.00 21.75 ? 159 THR B OG1 1 
ATOM   3172 C  CG2 . THR B 1 159 ? 9.385   -19.017 -2.278  1.00 23.18 ? 159 THR B CG2 1 
ATOM   3173 N  N   . VAL B 1 160 ? 8.295   -21.463 1.324   1.00 20.46 ? 160 VAL B N   1 
ATOM   3174 C  CA  . VAL B 1 160 ? 7.909   -22.683 2.029   1.00 18.71 ? 160 VAL B CA  1 
ATOM   3175 C  C   . VAL B 1 160 ? 6.505   -22.978 1.529   1.00 17.56 ? 160 VAL B C   1 
ATOM   3176 O  O   . VAL B 1 160 ? 5.752   -22.054 1.190   1.00 16.95 ? 160 VAL B O   1 
ATOM   3177 C  CB  . VAL B 1 160 ? 7.879   -22.547 3.571   1.00 22.89 ? 160 VAL B CB  1 
ATOM   3178 C  CG1 . VAL B 1 160 ? 9.293   -22.373 4.099   1.00 24.22 ? 160 VAL B CG1 1 
ATOM   3179 C  CG2 . VAL B 1 160 ? 6.969   -21.387 3.987   1.00 24.02 ? 160 VAL B CG2 1 
ATOM   3180 N  N   . LYS B 1 161 ? 6.159   -24.258 1.467   1.00 16.30 ? 161 LYS B N   1 
ATOM   3181 C  CA  . LYS B 1 161 ? 4.846   -24.649 0.973   1.00 19.69 ? 161 LYS B CA  1 
ATOM   3182 C  C   . LYS B 1 161 ? 3.762   -24.124 1.903   1.00 21.00 ? 161 LYS B C   1 
ATOM   3183 O  O   . LYS B 1 161 ? 3.893   -24.176 3.125   1.00 21.07 ? 161 LYS B O   1 
ATOM   3184 C  CB  . LYS B 1 161 ? 4.752   -26.172 0.852   1.00 27.12 ? 161 LYS B CB  1 
ATOM   3185 C  CG  . LYS B 1 161 ? 3.581   -26.645 -0.019  1.00 36.15 ? 161 LYS B CG  1 
ATOM   3186 N  N   . TRP B 1 162 ? 2.674   -23.648 1.314   1.00 18.84 ? 162 TRP B N   1 
ATOM   3187 C  CA  . TRP B 1 162 ? 1.591   -23.072 2.092   1.00 17.20 ? 162 TRP B CA  1 
ATOM   3188 C  C   . TRP B 1 162 ? 0.248   -23.530 1.518   1.00 21.09 ? 162 TRP B C   1 
ATOM   3189 O  O   . TRP B 1 162 ? 0.151   -23.809 0.326   1.00 25.69 ? 162 TRP B O   1 
ATOM   3190 C  CB  . TRP B 1 162 ? 1.717   -21.558 2.014   1.00 16.07 ? 162 TRP B CB  1 
ATOM   3191 C  CG  . TRP B 1 162 ? 0.551   -20.796 2.620   1.00 17.80 ? 162 TRP B CG  1 
ATOM   3192 C  CD1 . TRP B 1 162 ? 0.064   -20.903 3.896   1.00 17.90 ? 162 TRP B CD1 1 
ATOM   3193 C  CD2 . TRP B 1 162 ? -0.236  -19.797 1.968   1.00 15.08 ? 162 TRP B CD2 1 
ATOM   3194 N  NE1 . TRP B 1 162 ? -0.996  -20.022 4.077   1.00 15.34 ? 162 TRP B NE1 1 
ATOM   3195 C  CE2 . TRP B 1 162 ? -1.195  -19.334 2.907   1.00 13.03 ? 162 TRP B CE2 1 
ATOM   3196 C  CE3 . TRP B 1 162 ? -0.225  -19.240 0.679   1.00 17.03 ? 162 TRP B CE3 1 
ATOM   3197 C  CZ2 . TRP B 1 162 ? -2.134  -18.342 2.588   1.00 19.02 ? 162 TRP B CZ2 1 
ATOM   3198 C  CZ3 . TRP B 1 162 ? -1.156  -18.257 0.365   1.00 21.62 ? 162 TRP B CZ3 1 
ATOM   3199 C  CH2 . TRP B 1 162 ? -2.098  -17.818 1.316   1.00 18.82 ? 162 TRP B CH2 1 
ATOM   3200 N  N   . ASP B 1 163 ? -0.774  -23.637 2.360   1.00 17.71 ? 163 ASP B N   1 
ATOM   3201 C  CA  . ASP B 1 163 ? -2.091  -24.041 1.864   1.00 18.60 ? 163 ASP B CA  1 
ATOM   3202 C  C   . ASP B 1 163 ? -3.027  -22.843 1.858   1.00 20.20 ? 163 ASP B C   1 
ATOM   3203 O  O   . ASP B 1 163 ? -3.162  -22.165 2.873   1.00 18.66 ? 163 ASP B O   1 
ATOM   3204 C  CB  . ASP B 1 163 ? -2.684  -25.112 2.771   1.00 22.32 ? 163 ASP B CB  1 
ATOM   3205 C  CG  . ASP B 1 163 ? -1.734  -26.246 2.993   1.00 34.97 ? 163 ASP B CG  1 
ATOM   3206 O  OD1 . ASP B 1 163 ? -1.461  -26.974 2.010   1.00 37.83 ? 163 ASP B OD1 1 
ATOM   3207 O  OD2 . ASP B 1 163 ? -1.244  -26.397 4.137   1.00 37.60 ? 163 ASP B OD2 1 
ATOM   3208 N  N   . ARG B 1 164 ? -3.650  -22.574 0.712   1.00 16.89 ? 164 ARG B N   1 
ATOM   3209 C  CA  . ARG B 1 164 ? -4.615  -21.488 0.591   1.00 18.29 ? 164 ARG B CA  1 
ATOM   3210 C  C   . ARG B 1 164 ? -5.934  -22.078 1.086   1.00 18.79 ? 164 ARG B C   1 
ATOM   3211 O  O   . ARG B 1 164 ? -6.308  -23.174 0.662   1.00 20.14 ? 164 ARG B O   1 
ATOM   3212 C  CB  . ARG B 1 164 ? -4.797  -21.086 -0.876  1.00 18.48 ? 164 ARG B CB  1 
ATOM   3213 C  CG  . ARG B 1 164 ? -5.873  -20.009 -1.108  1.00 18.72 ? 164 ARG B CG  1 
ATOM   3214 C  CD  . ARG B 1 164 ? -6.163  -19.830 -2.609  1.00 17.54 ? 164 ARG B CD  1 
ATOM   3215 N  NE  . ARG B 1 164 ? -7.017  -18.666 -2.872  1.00 18.93 ? 164 ARG B NE  1 
ATOM   3216 C  CZ  . ARG B 1 164 ? -8.324  -18.606 -2.600  1.00 20.28 ? 164 ARG B CZ  1 
ATOM   3217 N  NH1 . ARG B 1 164 ? -9.016  -17.496 -2.872  1.00 16.83 ? 164 ARG B NH1 1 
ATOM   3218 N  NH2 . ARG B 1 164 ? -8.936  -19.662 -2.077  1.00 20.31 ? 164 ARG B NH2 1 
ATOM   3219 N  N   . ARG B 1 165 ? -6.626  -21.392 1.992   1.00 15.36 ? 165 ARG B N   1 
ATOM   3220 C  CA  . ARG B 1 165 ? -7.917  -21.894 2.480   1.00 14.29 ? 165 ARG B CA  1 
ATOM   3221 C  C   . ARG B 1 165 ? -8.921  -20.774 2.270   1.00 17.15 ? 165 ARG B C   1 
ATOM   3222 O  O   . ARG B 1 165 ? -8.833  -19.698 2.888   1.00 17.47 ? 165 ARG B O   1 
ATOM   3223 C  CB  . ARG B 1 165 ? -7.846  -22.263 3.957   1.00 14.08 ? 165 ARG B CB  1 
ATOM   3224 C  CG  . ARG B 1 165 ? -6.942  -23.413 4.240   1.00 18.25 ? 165 ARG B CG  1 
ATOM   3225 C  CD  . ARG B 1 165 ? -7.044  -23.816 5.699   1.00 19.31 ? 165 ARG B CD  1 
ATOM   3226 N  NE  . ARG B 1 165 ? -6.162  -24.934 5.996   1.00 20.62 ? 165 ARG B NE  1 
ATOM   3227 C  CZ  . ARG B 1 165 ? -5.989  -25.429 7.220   1.00 25.44 ? 165 ARG B CZ  1 
ATOM   3228 N  NH1 . ARG B 1 165 ? -5.166  -26.446 7.412   1.00 24.10 ? 165 ARG B NH1 1 
ATOM   3229 N  NH2 . ARG B 1 165 ? -6.634  -24.894 8.249   1.00 24.41 ? 165 ARG B NH2 1 
ATOM   3230 N  N   . ASP B 1 166 ? -9.867  -21.018 1.375   1.00 15.59 ? 166 ASP B N   1 
ATOM   3231 C  CA  . ASP B 1 166 ? -10.850 -20.001 1.027   1.00 13.80 ? 166 ASP B CA  1 
ATOM   3232 C  C   . ASP B 1 166 ? -11.685 -19.528 2.195   1.00 17.73 ? 166 ASP B C   1 
ATOM   3233 O  O   . ASP B 1 166 ? -12.261 -20.340 2.937   1.00 17.54 ? 166 ASP B O   1 
ATOM   3234 C  CB  . ASP B 1 166 ? -11.783 -20.522 -0.073  1.00 14.27 ? 166 ASP B CB  1 
ATOM   3235 C  CG  . ASP B 1 166 ? -12.357 -19.397 -0.923  1.00 15.84 ? 166 ASP B CG  1 
ATOM   3236 O  OD1 . ASP B 1 166 ? -11.673 -18.909 -1.848  1.00 17.17 ? 166 ASP B OD1 1 
ATOM   3237 O  OD2 . ASP B 1 166 ? -13.488 -18.984 -0.658  1.00 20.00 ? 166 ASP B OD2 1 
ATOM   3238 N  N   . GLY B 1 167 ? -11.723 -18.209 2.362   1.00 18.87 ? 167 GLY B N   1 
ATOM   3239 C  CA  . GLY B 1 167 ? -12.513 -17.601 3.424   1.00 19.67 ? 167 GLY B CA  1 
ATOM   3240 C  C   . GLY B 1 167 ? -12.048 -17.806 4.856   1.00 23.97 ? 167 GLY B C   1 
ATOM   3241 O  O   . GLY B 1 167 ? -12.775 -17.464 5.787   1.00 27.00 ? 167 GLY B O   1 
ATOM   3242 N  N   . GLN B 1 168 ? -10.862 -18.359 5.057   1.00 15.49 ? 168 GLN B N   1 
ATOM   3243 C  CA  A GLN B 1 168 ? -10.364 -18.586 6.409   0.50 18.77 ? 168 GLN B CA  1 
ATOM   3244 C  CA  B GLN B 1 168 ? -10.364 -18.586 6.408   0.50 18.78 ? 168 GLN B CA  1 
ATOM   3245 C  C   . GLN B 1 168 ? -9.262  -17.590 6.733   1.00 18.22 ? 168 GLN B C   1 
ATOM   3246 O  O   . GLN B 1 168 ? -8.368  -17.361 5.922   1.00 18.72 ? 168 GLN B O   1 
ATOM   3247 C  CB  A GLN B 1 168 ? -9.803  -20.001 6.558   0.50 19.75 ? 168 GLN B CB  1 
ATOM   3248 C  CB  B GLN B 1 168 ? -9.810  -20.004 6.544   0.50 19.77 ? 168 GLN B CB  1 
ATOM   3249 C  CG  A GLN B 1 168 ? -10.846 -21.115 6.542   0.50 31.33 ? 168 GLN B CG  1 
ATOM   3250 C  CG  B GLN B 1 168 ? -10.843 -21.098 6.309   0.50 31.44 ? 168 GLN B CG  1 
ATOM   3251 C  CD  A GLN B 1 168 ? -10.246 -22.460 6.915   0.50 35.66 ? 168 GLN B CD  1 
ATOM   3252 C  CD  B GLN B 1 168 ? -11.977 -21.043 7.311   0.50 35.27 ? 168 GLN B CD  1 
ATOM   3253 O  OE1 A GLN B 1 168 ? -9.352  -22.536 7.763   0.50 37.53 ? 168 GLN B OE1 1 
ATOM   3254 O  OE1 B GLN B 1 168 ? -11.753 -21.044 8.520   0.50 42.17 ? 168 GLN B OE1 1 
ATOM   3255 N  NE2 A GLN B 1 168 ? -10.742 -23.529 6.297   0.50 35.68 ? 168 GLN B NE2 1 
ATOM   3256 N  NE2 B GLN B 1 168 ? -13.206 -21.003 6.811   0.50 40.36 ? 168 GLN B NE2 1 
ATOM   3257 N  N   . SER B 1 169 ? -9.327  -17.006 7.917   1.00 14.98 ? 169 SER B N   1 
ATOM   3258 C  CA  . SER B 1 169 ? -8.308  -16.034 8.312   1.00 14.41 ? 169 SER B CA  1 
ATOM   3259 C  C   . SER B 1 169 ? -6.957  -16.655 8.661   1.00 11.89 ? 169 SER B C   1 
ATOM   3260 O  O   . SER B 1 169 ? -6.879  -17.651 9.389   1.00 15.03 ? 169 SER B O   1 
ATOM   3261 C  CB  . SER B 1 169 ? -8.786  -15.225 9.530   1.00 17.01 ? 169 SER B CB  1 
ATOM   3262 O  OG  . SER B 1 169 ? -9.938  -14.483 9.174   1.00 22.04 ? 169 SER B OG  1 
ATOM   3263 N  N   . LEU B 1 170 ? -5.894  -16.025 8.167   1.00 12.31 ? 170 LEU B N   1 
ATOM   3264 C  CA  . LEU B 1 170 ? -4.546  -16.474 8.486   1.00 11.12 ? 170 LEU B CA  1 
ATOM   3265 C  C   . LEU B 1 170 ? -3.967  -15.395 9.415   1.00 11.76 ? 170 LEU B C   1 
ATOM   3266 O  O   . LEU B 1 170 ? -4.041  -14.205 9.094   1.00 12.59 ? 170 LEU B O   1 
ATOM   3267 C  CB  . LEU B 1 170 ? -3.702  -16.566 7.198   1.00 12.91 ? 170 LEU B CB  1 
ATOM   3268 C  CG  . LEU B 1 170 ? -2.297  -17.130 7.438   1.00 16.02 ? 170 LEU B CG  1 
ATOM   3269 C  CD1 . LEU B 1 170 ? -2.398  -18.636 7.728   1.00 13.05 ? 170 LEU B CD1 1 
ATOM   3270 C  CD2 . LEU B 1 170 ? -1.396  -16.860 6.238   1.00 13.87 ? 170 LEU B CD2 1 
ATOM   3271 N  N   . ASN B 1 171 ? -3.429  -15.795 10.560  1.00 12.25 ? 171 ASN B N   1 
ATOM   3272 C  CA  . ASN B 1 171 ? -2.796  -14.830 11.474  1.00 13.05 ? 171 ASN B CA  1 
ATOM   3273 C  C   . ASN B 1 171 ? -1.298  -14.943 11.252  1.00 13.77 ? 171 ASN B C   1 
ATOM   3274 O  O   . ASN B 1 171 ? -0.767  -16.031 11.193  1.00 12.20 ? 171 ASN B O   1 
ATOM   3275 C  CB  . ASN B 1 171 ? -3.186  -15.129 12.908  1.00 16.91 ? 171 ASN B CB  1 
ATOM   3276 C  CG  . ASN B 1 171 ? -4.458  -14.373 13.292  1.00 26.46 ? 171 ASN B CG  1 
ATOM   3277 O  OD1 . ASN B 1 171 ? -4.405  -13.208 13.691  1.00 25.61 ? 171 ASN B OD1 1 
ATOM   3278 N  ND2 . ASN B 1 171 ? -5.598  -15.007 13.102  1.00 28.13 ? 171 ASN B ND2 1 
ATOM   3279 N  N   . VAL B 1 172 ? -0.648  -13.806 11.090  1.00 12.25 ? 172 VAL B N   1 
ATOM   3280 C  CA  . VAL B 1 172 ? 0.771   -13.788 10.779  1.00 11.95 ? 172 VAL B CA  1 
ATOM   3281 C  C   . VAL B 1 172 ? 1.534   -12.911 11.727  1.00 11.26 ? 172 VAL B C   1 
ATOM   3282 O  O   . VAL B 1 172 ? 1.040   -11.840 12.109  1.00 12.60 ? 172 VAL B O   1 
ATOM   3283 C  CB  . VAL B 1 172 ? 0.965   -13.216 9.353   1.00 13.49 ? 172 VAL B CB  1 
ATOM   3284 C  CG1 . VAL B 1 172 ? 2.430   -13.313 8.952   1.00 14.76 ? 172 VAL B CG1 1 
ATOM   3285 C  CG2 . VAL B 1 172 ? 0.042   -13.996 8.333   1.00 11.81 ? 172 VAL B CG2 1 
ATOM   3286 N  N   . LEU B 1 173 ? 2.720   -13.365 12.127  1.00 12.49 ? 173 LEU B N   1 
ATOM   3287 C  CA  . LEU B 1 173 ? 3.589   -12.519 12.957  1.00 12.01 ? 173 LEU B CA  1 
ATOM   3288 C  C   . LEU B 1 173 ? 4.923   -12.438 12.201  1.00 14.69 ? 173 LEU B C   1 
ATOM   3289 O  O   . LEU B 1 173 ? 5.529   -13.472 11.918  1.00 13.74 ? 173 LEU B O   1 
ATOM   3290 C  CB  . LEU B 1 173 ? 3.837   -13.158 14.312  1.00 13.92 ? 173 LEU B CB  1 
ATOM   3291 C  CG  . LEU B 1 173 ? 4.785   -12.371 15.221  1.00 19.55 ? 173 LEU B CG  1 
ATOM   3292 C  CD1 . LEU B 1 173 ? 4.194   -11.002 15.507  1.00 22.08 ? 173 LEU B CD1 1 
ATOM   3293 C  CD2 . LEU B 1 173 ? 4.994   -13.115 16.518  1.00 22.18 ? 173 LEU B CD2 1 
ATOM   3294 N  N   . VAL B 1 174 ? 5.361   -11.230 11.860  1.00 12.33 ? 174 VAL B N   1 
ATOM   3295 C  CA  . VAL B 1 174 ? 6.653   -11.052 11.170  1.00 13.57 ? 174 VAL B CA  1 
ATOM   3296 C  C   . VAL B 1 174 ? 7.533   -10.297 12.168  1.00 14.89 ? 174 VAL B C   1 
ATOM   3297 O  O   . VAL B 1 174 ? 7.115   -9.259  12.679  1.00 15.37 ? 174 VAL B O   1 
ATOM   3298 C  CB  . VAL B 1 174 ? 6.498   -10.181 9.896   1.00 15.92 ? 174 VAL B CB  1 
ATOM   3299 C  CG1 . VAL B 1 174 ? 7.885   -9.936  9.252   1.00 16.14 ? 174 VAL B CG1 1 
ATOM   3300 C  CG2 . VAL B 1 174 ? 5.563   -10.863 8.892   1.00 16.32 ? 174 VAL B CG2 1 
ATOM   3301 N  N   . THR B 1 175 ? 8.735   -10.799 12.459  1.00 13.85 ? 175 THR B N   1 
ATOM   3302 C  CA  . THR B 1 175 ? 9.586   -10.079 13.403  1.00 15.58 ? 175 THR B CA  1 
ATOM   3303 C  C   . THR B 1 175 ? 10.990  -9.991  12.830  1.00 17.30 ? 175 THR B C   1 
ATOM   3304 O  O   . THR B 1 175 ? 11.398  -10.819 12.003  1.00 15.82 ? 175 THR B O   1 
ATOM   3305 C  CB  . THR B 1 175 ? 9.694   -10.803 14.771  1.00 19.35 ? 175 THR B CB  1 
ATOM   3306 O  OG1 . THR B 1 175 ? 10.327  -12.075 14.588  1.00 22.39 ? 175 THR B OG1 1 
ATOM   3307 C  CG2 . THR B 1 175 ? 8.302   -11.074 15.373  1.00 18.38 ? 175 THR B CG2 1 
ATOM   3308 N  N   . PHE B 1 176 ? 11.717  -8.968  13.264  1.00 17.37 ? 176 PHE B N   1 
ATOM   3309 C  CA  . PHE B 1 176 ? 13.097  -8.790  12.834  1.00 15.44 ? 176 PHE B CA  1 
ATOM   3310 C  C   . PHE B 1 176 ? 13.892  -8.482  14.088  1.00 19.81 ? 176 PHE B C   1 
ATOM   3311 O  O   . PHE B 1 176 ? 13.527  -7.590  14.858  1.00 16.74 ? 176 PHE B O   1 
ATOM   3312 C  CB  . PHE B 1 176 ? 13.237  -7.640  11.837  1.00 14.50 ? 176 PHE B CB  1 
ATOM   3313 C  CG  . PHE B 1 176 ? 14.662  -7.402  11.423  1.00 19.06 ? 176 PHE B CG  1 
ATOM   3314 C  CD1 . PHE B 1 176 ? 15.308  -8.312  10.587  1.00 19.35 ? 176 PHE B CD1 1 
ATOM   3315 C  CD2 . PHE B 1 176 ? 15.381  -6.310  11.922  1.00 19.27 ? 176 PHE B CD2 1 
ATOM   3316 C  CE1 . PHE B 1 176 ? 16.661  -8.143  10.247  1.00 24.89 ? 176 PHE B CE1 1 
ATOM   3317 C  CE2 . PHE B 1 176 ? 16.735  -6.135  11.583  1.00 22.49 ? 176 PHE B CE2 1 
ATOM   3318 C  CZ  . PHE B 1 176 ? 17.368  -7.056  10.748  1.00 21.44 ? 176 PHE B CZ  1 
ATOM   3319 N  N   . ASN B 1 177 ? 14.960  -9.251  14.301  1.00 16.47 ? 177 ASN B N   1 
ATOM   3320 C  CA  . ASN B 1 177 ? 15.814  -9.115  15.478  1.00 17.96 ? 177 ASN B CA  1 
ATOM   3321 C  C   . ASN B 1 177 ? 17.155  -8.610  14.936  1.00 22.25 ? 177 ASN B C   1 
ATOM   3322 O  O   . ASN B 1 177 ? 17.854  -9.341  14.236  1.00 21.93 ? 177 ASN B O   1 
ATOM   3323 C  CB  . ASN B 1 177 ? 15.976  -10.486 16.135  1.00 22.36 ? 177 ASN B CB  1 
ATOM   3324 C  CG  . ASN B 1 177 ? 16.858  -10.446 17.380  1.00 29.07 ? 177 ASN B CG  1 
ATOM   3325 O  OD1 . ASN B 1 177 ? 17.653  -9.527  17.565  1.00 30.69 ? 177 ASN B OD1 1 
ATOM   3326 N  ND2 . ASN B 1 177 ? 16.731  -11.458 18.223  1.00 31.47 ? 177 ASN B ND2 1 
ATOM   3327 N  N   . PRO B 1 178 ? 17.516  -7.353  15.237  1.00 21.62 ? 178 PRO B N   1 
ATOM   3328 C  CA  . PRO B 1 178 ? 18.777  -6.795  14.739  1.00 22.16 ? 178 PRO B CA  1 
ATOM   3329 C  C   . PRO B 1 178 ? 20.042  -7.471  15.253  1.00 22.75 ? 178 PRO B C   1 
ATOM   3330 O  O   . PRO B 1 178 ? 21.088  -7.375  14.609  1.00 25.45 ? 178 PRO B O   1 
ATOM   3331 C  CB  . PRO B 1 178 ? 18.685  -5.323  15.134  1.00 26.06 ? 178 PRO B CB  1 
ATOM   3332 C  CG  . PRO B 1 178 ? 17.889  -5.369  16.388  1.00 28.46 ? 178 PRO B CG  1 
ATOM   3333 C  CD  . PRO B 1 178 ? 16.798  -6.371  16.073  1.00 26.55 ? 178 PRO B CD  1 
ATOM   3334 N  N   . SER B 1 179 ? 19.944  -8.163  16.389  1.00 24.24 ? 179 SER B N   1 
ATOM   3335 C  CA  . SER B 1 179 ? 21.113  -8.841  16.952  1.00 30.25 ? 179 SER B CA  1 
ATOM   3336 C  C   . SER B 1 179 ? 21.557  -10.008 16.081  1.00 32.47 ? 179 SER B C   1 
ATOM   3337 O  O   . SER B 1 179 ? 22.746  -10.197 15.811  1.00 32.74 ? 179 SER B O   1 
ATOM   3338 C  CB  . SER B 1 179 ? 20.802  -9.364  18.352  1.00 34.52 ? 179 SER B CB  1 
ATOM   3339 O  OG  . SER B 1 179 ? 20.539  -8.287  19.230  1.00 44.34 ? 179 SER B OG  1 
ATOM   3340 N  N   . THR B 1 180 ? 20.584  -10.783 15.633  1.00 26.06 ? 180 THR B N   1 
ATOM   3341 C  CA  . THR B 1 180 ? 20.847  -11.957 14.804  1.00 26.68 ? 180 THR B CA  1 
ATOM   3342 C  C   . THR B 1 180 ? 20.603  -11.661 13.328  1.00 25.63 ? 180 THR B C   1 
ATOM   3343 O  O   . THR B 1 180 ? 21.000  -12.431 12.451  1.00 24.53 ? 180 THR B O   1 
ATOM   3344 C  CB  . THR B 1 180 ? 19.908  -13.086 15.216  1.00 28.36 ? 180 THR B CB  1 
ATOM   3345 O  OG1 . THR B 1 180 ? 18.551  -12.652 15.018  1.00 27.11 ? 180 THR B OG1 1 
ATOM   3346 C  CG2 . THR B 1 180 ? 20.107  -13.433 16.687  1.00 29.68 ? 180 THR B CG2 1 
ATOM   3347 N  N   . ARG B 1 181 ? 19.941  -10.541 13.067  1.00 20.08 ? 181 ARG B N   1 
ATOM   3348 C  CA  . ARG B 1 181 ? 19.567  -10.122 11.723  1.00 22.05 ? 181 ARG B CA  1 
ATOM   3349 C  C   . ARG B 1 181 ? 18.587  -11.127 11.125  1.00 20.56 ? 181 ARG B C   1 
ATOM   3350 O  O   . ARG B 1 181 ? 18.473  -11.239 9.918   1.00 22.31 ? 181 ARG B O   1 
ATOM   3351 C  CB  . ARG B 1 181 ? 20.797  -9.958  10.818  1.00 26.75 ? 181 ARG B CB  1 
ATOM   3352 C  CG  . ARG B 1 181 ? 21.624  -8.731  11.181  1.00 33.30 ? 181 ARG B CG  1 
ATOM   3353 C  CD  . ARG B 1 181 ? 22.912  -8.647  10.394  1.00 43.46 ? 181 ARG B CD  1 
ATOM   3354 N  NE  . ARG B 1 181 ? 23.684  -9.883  10.511  1.00 50.09 ? 181 ARG B NE  1 
ATOM   3355 C  CZ  . ARG B 1 181 ? 24.827  -10.110 9.869   1.00 56.62 ? 181 ARG B CZ  1 
ATOM   3356 N  NH1 . ARG B 1 181 ? 25.335  -9.179  9.067   1.00 57.20 ? 181 ARG B NH1 1 
ATOM   3357 N  NH2 . ARG B 1 181 ? 25.454  -11.276 10.013  1.00 59.54 ? 181 ARG B NH2 1 
ATOM   3358 N  N   . ASN B 1 182 ? 17.862  -11.848 11.974  1.00 18.71 ? 182 ASN B N   1 
ATOM   3359 C  CA  . ASN B 1 182 ? 16.883  -12.796 11.446  1.00 16.82 ? 182 ASN B CA  1 
ATOM   3360 C  C   . ASN B 1 182 ? 15.509  -12.170 11.239  1.00 20.48 ? 182 ASN B C   1 
ATOM   3361 O  O   . ASN B 1 182 ? 14.982  -11.499 12.139  1.00 17.34 ? 182 ASN B O   1 
ATOM   3362 C  CB  . ASN B 1 182 ? 16.720  -13.978 12.378  1.00 23.15 ? 182 ASN B CB  1 
ATOM   3363 C  CG  . ASN B 1 182 ? 17.820  -15.001 12.204  1.00 30.82 ? 182 ASN B CG  1 
ATOM   3364 O  OD1 . ASN B 1 182 ? 18.866  -14.708 11.629  1.00 38.40 ? 182 ASN B OD1 1 
ATOM   3365 N  ND2 . ASN B 1 182 ? 17.594  -16.198 12.702  1.00 30.95 ? 182 ASN B ND2 1 
ATOM   3366 N  N   . LEU B 1 183 ? 14.943  -12.389 10.058  1.00 15.95 ? 183 LEU B N   1 
ATOM   3367 C  CA  . LEU B 1 183 ? 13.570  -11.942 9.759   1.00 15.44 ? 183 LEU B CA  1 
ATOM   3368 C  C   . LEU B 1 183 ? 12.781  -13.261 9.876   1.00 19.29 ? 183 LEU B C   1 
ATOM   3369 O  O   . LEU B 1 183 ? 13.015  -14.202 9.103   1.00 17.74 ? 183 LEU B O   1 
ATOM   3370 C  CB  . LEU B 1 183 ? 13.471  -11.380 8.336   1.00 20.08 ? 183 LEU B CB  1 
ATOM   3371 C  CG  . LEU B 1 183 ? 12.064  -10.971 7.873   1.00 23.86 ? 183 LEU B CG  1 
ATOM   3372 C  CD1 . LEU B 1 183 ? 11.572  -9.775  8.689   1.00 25.06 ? 183 LEU B CD1 1 
ATOM   3373 C  CD2 . LEU B 1 183 ? 12.088  -10.625 6.407   1.00 28.22 ? 183 LEU B CD2 1 
ATOM   3374 N  N   . ASP B 1 184 ? 11.888  -13.350 10.865  1.00 16.23 ? 184 ASP B N   1 
ATOM   3375 C  CA  . ASP B 1 184 ? 11.113  -14.564 11.078  1.00 14.91 ? 184 ASP B CA  1 
ATOM   3376 C  C   . ASP B 1 184 ? 9.651   -14.352 10.720  1.00 17.61 ? 184 ASP B C   1 
ATOM   3377 O  O   . ASP B 1 184 ? 9.096   -13.291 10.989  1.00 17.15 ? 184 ASP B O   1 
ATOM   3378 C  CB  . ASP B 1 184 ? 11.156  -15.004 12.537  1.00 17.18 ? 184 ASP B CB  1 
ATOM   3379 C  CG  . ASP B 1 184 ? 12.535  -15.365 12.993  1.00 29.84 ? 184 ASP B CG  1 
ATOM   3380 O  OD1 . ASP B 1 184 ? 13.274  -15.969 12.199  1.00 29.42 ? 184 ASP B OD1 1 
ATOM   3381 O  OD2 . ASP B 1 184 ? 12.875  -15.066 14.150  1.00 32.68 ? 184 ASP B OD2 1 
ATOM   3382 N  N   . VAL B 1 185 ? 9.037   -15.376 10.132  1.00 13.09 ? 185 VAL B N   1 
ATOM   3383 C  CA  . VAL B 1 185 ? 7.618   -15.316 9.778   1.00 14.64 ? 185 VAL B CA  1 
ATOM   3384 C  C   . VAL B 1 185 ? 6.961   -16.550 10.369  1.00 16.07 ? 185 VAL B C   1 
ATOM   3385 O  O   . VAL B 1 185 ? 7.459   -17.680 10.194  1.00 14.65 ? 185 VAL B O   1 
ATOM   3386 C  CB  . VAL B 1 185 ? 7.417   -15.367 8.251   1.00 14.93 ? 185 VAL B CB  1 
ATOM   3387 C  CG1 . VAL B 1 185 ? 5.921   -15.330 7.911   1.00 17.83 ? 185 VAL B CG1 1 
ATOM   3388 C  CG2 . VAL B 1 185 ? 8.147   -14.197 7.595   1.00 17.27 ? 185 VAL B CG2 1 
ATOM   3389 N  N   . VAL B 1 186 ? 5.851   -16.350 11.084  1.00 13.33 ? 186 VAL B N   1 
ATOM   3390 C  CA  . VAL B 1 186 ? 5.116   -17.475 11.634  1.00 13.64 ? 186 VAL B CA  1 
ATOM   3391 C  C   . VAL B 1 186 ? 3.660   -17.201 11.252  1.00 13.63 ? 186 VAL B C   1 
ATOM   3392 O  O   . VAL B 1 186 ? 3.157   -16.126 11.549  1.00 14.18 ? 186 VAL B O   1 
ATOM   3393 C  CB  . VAL B 1 186 ? 5.230   -17.556 13.171  1.00 17.01 ? 186 VAL B CB  1 
ATOM   3394 C  CG1 . VAL B 1 186 ? 4.355   -18.686 13.692  1.00 20.69 ? 186 VAL B CG1 1 
ATOM   3395 C  CG2 . VAL B 1 186 ? 6.689   -17.814 13.578  1.00 20.09 ? 186 VAL B CG2 1 
ATOM   3396 N  N   . ALA B 1 187 ? 3.001   -18.146 10.589  1.00 11.79 ? 187 ALA B N   1 
ATOM   3397 C  CA  . ALA B 1 187 ? 1.605   -17.925 10.197  1.00 14.28 ? 187 ALA B CA  1 
ATOM   3398 C  C   . ALA B 1 187 ? 0.784   -19.109 10.670  1.00 14.35 ? 187 ALA B C   1 
ATOM   3399 O  O   . ALA B 1 187 ? 1.256   -20.252 10.622  1.00 14.70 ? 187 ALA B O   1 
ATOM   3400 C  CB  . ALA B 1 187 ? 1.498   -17.788 8.666   1.00 15.48 ? 187 ALA B CB  1 
ATOM   3401 N  N   . THR B 1 188 ? -0.446  -18.854 11.116  1.00 13.81 ? 188 THR B N   1 
ATOM   3402 C  CA  . THR B 1 188 ? -1.270  -19.957 11.586  1.00 13.63 ? 188 THR B CA  1 
ATOM   3403 C  C   . THR B 1 188 ? -2.724  -19.791 11.170  1.00 14.87 ? 188 THR B C   1 
ATOM   3404 O  O   . THR B 1 188 ? -3.212  -18.668 11.003  1.00 13.95 ? 188 THR B O   1 
ATOM   3405 C  CB  . THR B 1 188 ? -1.284  -20.023 13.128  1.00 18.25 ? 188 THR B CB  1 
ATOM   3406 O  OG1 . THR B 1 188 ? -1.626  -18.720 13.638  1.00 17.54 ? 188 THR B OG1 1 
ATOM   3407 C  CG2 . THR B 1 188 ? 0.083   -20.434 13.683  1.00 20.73 ? 188 THR B CG2 1 
ATOM   3408 N  N   . TYR B 1 189 ? -3.396  -20.922 10.974  1.00 14.65 ? 189 TYR B N   1 
ATOM   3409 C  CA  . TYR B 1 189 ? -4.825  -20.920 10.702  1.00 14.12 ? 189 TYR B CA  1 
ATOM   3410 C  C   . TYR B 1 189 ? -5.447  -21.222 12.073  1.00 16.88 ? 189 TYR B C   1 
ATOM   3411 O  O   . TYR B 1 189 ? -4.752  -21.663 12.986  1.00 18.95 ? 189 TYR B O   1 
ATOM   3412 C  CB  . TYR B 1 189 ? -5.215  -22.008 9.689   1.00 14.04 ? 189 TYR B CB  1 
ATOM   3413 C  CG  . TYR B 1 189 ? -4.986  -21.569 8.254   1.00 13.04 ? 189 TYR B CG  1 
ATOM   3414 C  CD1 . TYR B 1 189 ? -4.059  -22.227 7.432   1.00 15.04 ? 189 TYR B CD1 1 
ATOM   3415 C  CD2 . TYR B 1 189 ? -5.695  -20.504 7.724   1.00 13.40 ? 189 TYR B CD2 1 
ATOM   3416 C  CE1 . TYR B 1 189 ? -3.858  -21.814 6.095   1.00 13.43 ? 189 TYR B CE1 1 
ATOM   3417 C  CE2 . TYR B 1 189 ? -5.498  -20.085 6.385   1.00 14.88 ? 189 TYR B CE2 1 
ATOM   3418 C  CZ  . TYR B 1 189 ? -4.581  -20.750 5.591   1.00 15.48 ? 189 TYR B CZ  1 
ATOM   3419 O  OH  . TYR B 1 189 ? -4.383  -20.318 4.299   1.00 17.44 ? 189 TYR B OH  1 
ATOM   3420 N  N   . SER B 1 190 ? -6.758  -21.034 12.196  1.00 18.07 ? 190 SER B N   1 
ATOM   3421 C  CA  A SER B 1 190 ? -7.450  -21.249 13.467  0.50 22.27 ? 190 SER B CA  1 
ATOM   3422 C  CA  B SER B 1 190 ? -7.453  -21.242 13.470  0.50 21.88 ? 190 SER B CA  1 
ATOM   3423 C  C   . SER B 1 190 ? -7.461  -22.667 14.021  1.00 20.75 ? 190 SER B C   1 
ATOM   3424 O  O   . SER B 1 190 ? -7.788  -22.871 15.178  1.00 23.92 ? 190 SER B O   1 
ATOM   3425 C  CB  A SER B 1 190 ? -8.888  -20.747 13.354  0.50 24.55 ? 190 SER B CB  1 
ATOM   3426 C  CB  B SER B 1 190 ? -8.897  -20.762 13.348  0.50 23.93 ? 190 SER B CB  1 
ATOM   3427 O  OG  A SER B 1 190 ? -8.909  -19.341 13.227  0.50 32.06 ? 190 SER B OG  1 
ATOM   3428 O  OG  B SER B 1 190 ? -9.645  -21.662 12.559  0.50 24.37 ? 190 SER B OG  1 
ATOM   3429 N  N   . ASP B 1 191 ? -7.123  -23.652 13.200  1.00 19.69 ? 191 ASP B N   1 
ATOM   3430 C  CA  . ASP B 1 191 ? -7.109  -25.027 13.684  1.00 21.49 ? 191 ASP B CA  1 
ATOM   3431 C  C   . ASP B 1 191 ? -5.711  -25.403 14.159  1.00 21.81 ? 191 ASP B C   1 
ATOM   3432 O  O   . ASP B 1 191 ? -5.435  -26.571 14.432  1.00 21.98 ? 191 ASP B O   1 
ATOM   3433 C  CB  . ASP B 1 191 ? -7.549  -25.998 12.576  1.00 22.93 ? 191 ASP B CB  1 
ATOM   3434 C  CG  . ASP B 1 191 ? -6.584  -26.032 11.391  1.00 28.11 ? 191 ASP B CG  1 
ATOM   3435 O  OD1 . ASP B 1 191 ? -5.674  -25.167 11.291  1.00 22.65 ? 191 ASP B OD1 1 
ATOM   3436 O  OD2 . ASP B 1 191 ? -6.741  -26.930 10.532  1.00 28.03 ? 191 ASP B OD2 1 
ATOM   3437 N  N   . GLY B 1 192 ? -4.825  -24.412 14.225  1.00 23.93 ? 192 GLY B N   1 
ATOM   3438 C  CA  . GLY B 1 192 ? -3.465  -24.671 14.669  1.00 24.37 ? 192 GLY B CA  1 
ATOM   3439 C  C   . GLY B 1 192 ? -2.433  -25.008 13.597  1.00 25.16 ? 192 GLY B C   1 
ATOM   3440 O  O   . GLY B 1 192 ? -1.247  -25.182 13.919  1.00 26.91 ? 192 GLY B O   1 
ATOM   3441 N  N   . THR B 1 193 ? -2.856  -25.129 12.339  1.00 19.81 ? 193 THR B N   1 
ATOM   3442 C  CA  . THR B 1 193 ? -1.902  -25.430 11.259  1.00 18.61 ? 193 THR B CA  1 
ATOM   3443 C  C   . THR B 1 193 ? -0.925  -24.257 11.239  1.00 19.46 ? 193 THR B C   1 
ATOM   3444 O  O   . THR B 1 193 ? -1.326  -23.103 11.148  1.00 19.34 ? 193 THR B O   1 
ATOM   3445 C  CB  . THR B 1 193 ? -2.616  -25.563 9.935   1.00 20.68 ? 193 THR B CB  1 
ATOM   3446 O  OG1 . THR B 1 193 ? -3.559  -26.633 10.037  1.00 20.76 ? 193 THR B OG1 1 
ATOM   3447 C  CG2 . THR B 1 193 ? -1.608  -25.845 8.821   1.00 21.47 ? 193 THR B CG2 1 
ATOM   3448 N  N   . ARG B 1 194 ? 0.361   -24.577 11.272  1.00 19.07 ? 194 ARG B N   1 
ATOM   3449 C  CA  A ARG B 1 194 ? 1.414   -23.570 11.362  0.50 17.89 ? 194 ARG B CA  1 
ATOM   3450 C  CA  B ARG B 1 194 ? 1.408   -23.566 11.356  0.50 17.85 ? 194 ARG B CA  1 
ATOM   3451 C  C   . ARG B 1 194 ? 2.427   -23.632 10.219  1.00 20.12 ? 194 ARG B C   1 
ATOM   3452 O  O   . ARG B 1 194 ? 2.747   -24.717 9.724   1.00 18.03 ? 194 ARG B O   1 
ATOM   3453 C  CB  A ARG B 1 194 ? 2.128   -23.790 12.702  0.50 22.06 ? 194 ARG B CB  1 
ATOM   3454 C  CB  B ARG B 1 194 ? 2.104   -23.759 12.712  0.50 22.08 ? 194 ARG B CB  1 
ATOM   3455 C  CG  A ARG B 1 194 ? 3.095   -22.721 13.169  0.50 28.57 ? 194 ARG B CG  1 
ATOM   3456 C  CG  B ARG B 1 194 ? 3.223   -22.805 13.070  0.50 28.57 ? 194 ARG B CG  1 
ATOM   3457 C  CD  A ARG B 1 194 ? 3.856   -23.232 14.403  0.50 34.71 ? 194 ARG B CD  1 
ATOM   3458 C  CD  B ARG B 1 194 ? 3.767   -23.158 14.466  0.50 34.65 ? 194 ARG B CD  1 
ATOM   3459 N  NE  A ARG B 1 194 ? 4.424   -22.149 15.202  0.50 42.26 ? 194 ARG B NE  1 
ATOM   3460 N  NE  B ARG B 1 194 ? 4.782   -22.207 14.909  0.50 41.87 ? 194 ARG B NE  1 
ATOM   3461 C  CZ  A ARG B 1 194 ? 3.743   -21.452 16.108  0.50 44.08 ? 194 ARG B CZ  1 
ATOM   3462 C  CZ  B ARG B 1 194 ? 5.398   -22.245 16.087  0.50 45.19 ? 194 ARG B CZ  1 
ATOM   3463 N  NH1 A ARG B 1 194 ? 2.466   -21.726 16.341  0.50 46.14 ? 194 ARG B NH1 1 
ATOM   3464 N  NH1 B ARG B 1 194 ? 5.112   -23.198 16.970  0.50 48.07 ? 194 ARG B NH1 1 
ATOM   3465 N  NH2 A ARG B 1 194 ? 4.337   -20.472 16.774  0.50 47.06 ? 194 ARG B NH2 1 
ATOM   3466 N  NH2 B ARG B 1 194 ? 6.312   -21.329 16.377  0.50 46.17 ? 194 ARG B NH2 1 
ATOM   3467 N  N   . TYR B 1 195 ? 2.918   -22.460 9.804   1.00 12.75 ? 195 TYR B N   1 
ATOM   3468 C  CA  . TYR B 1 195 ? 3.928   -22.342 8.747   1.00 13.37 ? 195 TYR B CA  1 
ATOM   3469 C  C   . TYR B 1 195 ? 5.002   -21.413 9.312   1.00 17.41 ? 195 TYR B C   1 
ATOM   3470 O  O   . TYR B 1 195 ? 4.675   -20.403 9.948   1.00 16.06 ? 195 TYR B O   1 
ATOM   3471 C  CB  . TYR B 1 195 ? 3.352   -21.723 7.474   1.00 12.45 ? 195 TYR B CB  1 
ATOM   3472 C  CG  . TYR B 1 195 ? 2.110   -22.426 6.999   1.00 16.32 ? 195 TYR B CG  1 
ATOM   3473 C  CD1 . TYR B 1 195 ? 0.855   -22.030 7.452   1.00 16.14 ? 195 TYR B CD1 1 
ATOM   3474 C  CD2 . TYR B 1 195 ? 2.186   -23.513 6.122   1.00 17.86 ? 195 TYR B CD2 1 
ATOM   3475 C  CE1 . TYR B 1 195 ? -0.302  -22.701 7.043   1.00 19.09 ? 195 TYR B CE1 1 
ATOM   3476 C  CE2 . TYR B 1 195 ? 1.035   -24.189 5.703   1.00 19.91 ? 195 TYR B CE2 1 
ATOM   3477 C  CZ  . TYR B 1 195 ? -0.204  -23.770 6.169   1.00 19.63 ? 195 TYR B CZ  1 
ATOM   3478 O  OH  . TYR B 1 195 ? -1.349  -24.382 5.737   1.00 20.31 ? 195 TYR B OH  1 
ATOM   3479 N  N   . GLU B 1 196 ? 6.274   -21.737 9.088   1.00 14.77 ? 196 GLU B N   1 
ATOM   3480 C  CA  . GLU B 1 196 ? 7.352   -20.893 9.608   1.00 14.05 ? 196 GLU B CA  1 
ATOM   3481 C  C   . GLU B 1 196 ? 8.468   -20.785 8.578   1.00 19.77 ? 196 GLU B C   1 
ATOM   3482 O  O   . GLU B 1 196 ? 8.790   -21.766 7.911   1.00 19.59 ? 196 GLU B O   1 
ATOM   3483 C  CB  . GLU B 1 196 ? 7.978   -21.497 10.867  1.00 23.10 ? 196 GLU B CB  1 
ATOM   3484 C  CG  . GLU B 1 196 ? 7.064   -21.667 12.038  1.00 35.20 ? 196 GLU B CG  1 
ATOM   3485 C  CD  . GLU B 1 196 ? 7.737   -22.392 13.200  1.00 42.75 ? 196 GLU B CD  1 
ATOM   3486 O  OE1 . GLU B 1 196 ? 7.049   -22.677 14.200  1.00 43.63 ? 196 GLU B OE1 1 
ATOM   3487 O  OE2 . GLU B 1 196 ? 8.953   -22.676 13.114  1.00 47.98 ? 196 GLU B OE2 1 
ATOM   3488 N  N   . VAL B 1 197 ? 9.042   -19.599 8.431   1.00 15.79 ? 197 VAL B N   1 
ATOM   3489 C  CA  . VAL B 1 197 ? 10.170  -19.437 7.515   1.00 16.78 ? 197 VAL B CA  1 
ATOM   3490 C  C   . VAL B 1 197 ? 11.024  -18.292 8.060   1.00 19.90 ? 197 VAL B C   1 
ATOM   3491 O  O   . VAL B 1 197 ? 10.494  -17.321 8.589   1.00 18.93 ? 197 VAL B O   1 
ATOM   3492 C  CB  . VAL B 1 197 ? 9.693   -19.184 6.044   1.00 21.18 ? 197 VAL B CB  1 
ATOM   3493 C  CG1 . VAL B 1 197 ? 8.836   -17.943 5.944   1.00 19.86 ? 197 VAL B CG1 1 
ATOM   3494 C  CG2 . VAL B 1 197 ? 10.891  -19.080 5.119   1.00 21.41 ? 197 VAL B CG2 1 
ATOM   3495 N  N   . SER B 1 198 ? 12.346  -18.414 7.967   1.00 15.35 ? 198 SER B N   1 
ATOM   3496 C  CA  A SER B 1 198 ? 13.238  -17.369 8.482   0.50 16.01 ? 198 SER B CA  1 
ATOM   3497 C  CA  B SER B 1 198 ? 13.238  -17.370 8.478   0.50 15.96 ? 198 SER B CA  1 
ATOM   3498 C  C   . SER B 1 198 ? 14.366  -17.094 7.496   1.00 18.85 ? 198 SER B C   1 
ATOM   3499 O  O   . SER B 1 198 ? 14.753  -17.967 6.728   1.00 17.62 ? 198 SER B O   1 
ATOM   3500 C  CB  A SER B 1 198 ? 13.841  -17.801 9.823   0.50 19.03 ? 198 SER B CB  1 
ATOM   3501 C  CB  B SER B 1 198 ? 13.827  -17.803 9.822   0.50 18.94 ? 198 SER B CB  1 
ATOM   3502 O  OG  A SER B 1 198 ? 12.837  -18.116 10.773  0.50 23.60 ? 198 SER B OG  1 
ATOM   3503 O  OG  B SER B 1 198 ? 14.841  -16.912 10.248  0.50 22.48 ? 198 SER B OG  1 
ATOM   3504 N  N   . TYR B 1 199 ? 14.896  -15.880 7.530   1.00 15.04 ? 199 TYR B N   1 
ATOM   3505 C  CA  . TYR B 1 199 ? 15.979  -15.522 6.629   1.00 17.18 ? 199 TYR B CA  1 
ATOM   3506 C  C   . TYR B 1 199 ? 16.862  -14.489 7.295   1.00 19.38 ? 199 TYR B C   1 
ATOM   3507 O  O   . TYR B 1 199 ? 16.362  -13.604 7.971   1.00 20.12 ? 199 TYR B O   1 
ATOM   3508 C  CB  . TYR B 1 199 ? 15.411  -14.947 5.335   1.00 16.57 ? 199 TYR B CB  1 
ATOM   3509 C  CG  . TYR B 1 199 ? 16.457  -14.620 4.294   1.00 19.59 ? 199 TYR B CG  1 
ATOM   3510 C  CD1 . TYR B 1 199 ? 16.684  -13.297 3.907   1.00 17.52 ? 199 TYR B CD1 1 
ATOM   3511 C  CD2 . TYR B 1 199 ? 17.170  -15.636 3.639   1.00 20.89 ? 199 TYR B CD2 1 
ATOM   3512 C  CE1 . TYR B 1 199 ? 17.589  -12.979 2.881   1.00 22.10 ? 199 TYR B CE1 1 
ATOM   3513 C  CE2 . TYR B 1 199 ? 18.082  -15.324 2.609   1.00 21.16 ? 199 TYR B CE2 1 
ATOM   3514 C  CZ  . TYR B 1 199 ? 18.277  -13.995 2.240   1.00 23.02 ? 199 TYR B CZ  1 
ATOM   3515 O  OH  . TYR B 1 199 ? 19.143  -13.669 1.225   1.00 25.55 ? 199 TYR B OH  1 
ATOM   3516 N  N   . GLU B 1 200 ? 18.174  -14.591 7.100   1.00 16.16 ? 200 GLU B N   1 
ATOM   3517 C  CA  . GLU B 1 200 ? 19.064  -13.610 7.708   1.00 18.45 ? 200 GLU B CA  1 
ATOM   3518 C  C   . GLU B 1 200 ? 19.333  -12.515 6.694   1.00 19.60 ? 200 GLU B C   1 
ATOM   3519 O  O   . GLU B 1 200 ? 19.797  -12.787 5.588   1.00 21.71 ? 200 GLU B O   1 
ATOM   3520 C  CB  . GLU B 1 200 ? 20.389  -14.261 8.115   1.00 23.24 ? 200 GLU B CB  1 
ATOM   3521 C  CG  . GLU B 1 200 ? 21.290  -13.308 8.890   1.00 30.61 ? 200 GLU B CG  1 
ATOM   3522 C  CD  . GLU B 1 200 ? 22.705  -13.846 9.083   1.00 36.15 ? 200 GLU B CD  1 
ATOM   3523 O  OE1 . GLU B 1 200 ? 22.854  -15.047 9.373   1.00 35.98 ? 200 GLU B OE1 1 
ATOM   3524 O  OE2 . GLU B 1 200 ? 23.663  -13.053 8.953   1.00 41.34 ? 200 GLU B OE2 1 
ATOM   3525 N  N   . VAL B 1 201 ? 19.047  -11.272 7.060   1.00 19.05 ? 201 VAL B N   1 
ATOM   3526 C  CA  . VAL B 1 201 ? 19.265  -10.175 6.143   1.00 20.72 ? 201 VAL B CA  1 
ATOM   3527 C  C   . VAL B 1 201 ? 19.643  -8.909  6.898   1.00 24.71 ? 201 VAL B C   1 
ATOM   3528 O  O   . VAL B 1 201 ? 19.062  -8.609  7.941   1.00 21.88 ? 201 VAL B O   1 
ATOM   3529 C  CB  . VAL B 1 201 ? 18.002  -9.917  5.288   1.00 23.38 ? 201 VAL B CB  1 
ATOM   3530 C  CG1 . VAL B 1 201 ? 16.793  -9.636  6.200   1.00 27.58 ? 201 VAL B CG1 1 
ATOM   3531 C  CG2 . VAL B 1 201 ? 18.232  -8.756  4.356   1.00 27.12 ? 201 VAL B CG2 1 
ATOM   3532 N  N   . ASP B 1 202 ? 20.631  -8.182  6.376   1.00 21.54 ? 202 ASP B N   1 
ATOM   3533 C  CA  . ASP B 1 202 ? 21.067  -6.926  6.995   1.00 23.46 ? 202 ASP B CA  1 
ATOM   3534 C  C   . ASP B 1 202 ? 20.217  -5.862  6.318   1.00 22.29 ? 202 ASP B C   1 
ATOM   3535 O  O   . ASP B 1 202 ? 20.473  -5.494  5.164   1.00 21.49 ? 202 ASP B O   1 
ATOM   3536 C  CB  . ASP B 1 202 ? 22.547  -6.666  6.692   1.00 27.34 ? 202 ASP B CB  1 
ATOM   3537 C  CG  . ASP B 1 202 ? 23.090  -5.462  7.437   1.00 35.33 ? 202 ASP B CG  1 
ATOM   3538 O  OD1 . ASP B 1 202 ? 22.287  -4.585  7.831   1.00 28.96 ? 202 ASP B OD1 1 
ATOM   3539 O  OD2 . ASP B 1 202 ? 24.328  -5.388  7.622   1.00 39.04 ? 202 ASP B OD2 1 
ATOM   3540 N  N   . VAL B 1 203 ? 19.187  -5.385  7.011   1.00 20.72 ? 203 VAL B N   1 
ATOM   3541 C  CA  . VAL B 1 203 ? 18.304  -4.408  6.403   1.00 20.28 ? 203 VAL B CA  1 
ATOM   3542 C  C   . VAL B 1 203 ? 19.026  -3.120  6.002   1.00 21.10 ? 203 VAL B C   1 
ATOM   3543 O  O   . VAL B 1 203 ? 18.588  -2.426  5.093   1.00 20.84 ? 203 VAL B O   1 
ATOM   3544 C  CB  . VAL B 1 203 ? 17.114  -4.076  7.340   1.00 21.54 ? 203 VAL B CB  1 
ATOM   3545 C  CG1 . VAL B 1 203 ? 16.363  -5.364  7.687   1.00 21.44 ? 203 VAL B CG1 1 
ATOM   3546 C  CG2 . VAL B 1 203 ? 17.607  -3.387  8.621   1.00 25.96 ? 203 VAL B CG2 1 
ATOM   3547 N  N   . ARG B 1 204 ? 20.141  -2.821  6.663   1.00 23.03 ? 204 ARG B N   1 
ATOM   3548 C  CA  . ARG B 1 204 ? 20.872  -1.592  6.359   1.00 27.46 ? 204 ARG B CA  1 
ATOM   3549 C  C   . ARG B 1 204 ? 21.447  -1.582  4.955   1.00 30.63 ? 204 ARG B C   1 
ATOM   3550 O  O   . ARG B 1 204 ? 21.696  -0.519  4.396   1.00 31.34 ? 204 ARG B O   1 
ATOM   3551 C  CB  . ARG B 1 204 ? 22.021  -1.372  7.353   1.00 32.87 ? 204 ARG B CB  1 
ATOM   3552 C  CG  . ARG B 1 204 ? 21.606  -1.281  8.794   1.00 33.79 ? 204 ARG B CG  1 
ATOM   3553 C  CD  . ARG B 1 204 ? 22.836  -1.231  9.678   1.00 41.15 ? 204 ARG B CD  1 
ATOM   3554 N  NE  . ARG B 1 204 ? 23.688  -2.387  9.438   1.00 43.84 ? 204 ARG B NE  1 
ATOM   3555 C  CZ  . ARG B 1 204 ? 24.651  -2.788  10.260  1.00 52.89 ? 204 ARG B CZ  1 
ATOM   3556 N  NH1 . ARG B 1 204 ? 24.889  -2.118  11.387  1.00 55.87 ? 204 ARG B NH1 1 
ATOM   3557 N  NH2 . ARG B 1 204 ? 25.371  -3.865  9.962   1.00 52.61 ? 204 ARG B NH2 1 
ATOM   3558 N  N   . SER B 1 205 ? 21.665  -2.756  4.373   1.00 29.52 ? 205 SER B N   1 
ATOM   3559 C  CA  . SER B 1 205 ? 22.228  -2.785  3.032   1.00 31.41 ? 205 SER B CA  1 
ATOM   3560 C  C   . SER B 1 205 ? 21.156  -2.847  1.959   1.00 32.07 ? 205 SER B C   1 
ATOM   3561 O  O   . SER B 1 205 ? 21.456  -2.798  0.767   1.00 28.68 ? 205 SER B O   1 
ATOM   3562 C  CB  . SER B 1 205 ? 23.183  -3.967  2.888   1.00 33.83 ? 205 SER B CB  1 
ATOM   3563 O  OG  . SER B 1 205 ? 22.480  -5.188  2.938   1.00 40.90 ? 205 SER B OG  1 
ATOM   3564 N  N   . VAL B 1 206 ? 19.896  -2.923  2.386   1.00 25.07 ? 206 VAL B N   1 
ATOM   3565 C  CA  . VAL B 1 206 ? 18.783  -3.019  1.451   1.00 24.85 ? 206 VAL B CA  1 
ATOM   3566 C  C   . VAL B 1 206 ? 17.859  -1.803  1.412   1.00 22.81 ? 206 VAL B C   1 
ATOM   3567 O  O   . VAL B 1 206 ? 17.358  -1.412  0.350   1.00 25.88 ? 206 VAL B O   1 
ATOM   3568 C  CB  . VAL B 1 206 ? 17.884  -4.241  1.797   1.00 25.49 ? 206 VAL B CB  1 
ATOM   3569 C  CG1 . VAL B 1 206 ? 16.751  -4.330  0.799   1.00 32.00 ? 206 VAL B CG1 1 
ATOM   3570 C  CG2 . VAL B 1 206 ? 18.691  -5.506  1.819   1.00 32.22 ? 206 VAL B CG2 1 
ATOM   3571 N  N   . LEU B 1 207 ? 17.624  -1.211  2.578   1.00 22.17 ? 207 LEU B N   1 
ATOM   3572 C  CA  . LEU B 1 207 ? 16.695  -0.102  2.694   1.00 20.41 ? 207 LEU B CA  1 
ATOM   3573 C  C   . LEU B 1 207 ? 17.296  1.167   3.301   1.00 21.98 ? 207 LEU B C   1 
ATOM   3574 O  O   . LEU B 1 207 ? 18.312  1.114   3.998   1.00 20.97 ? 207 LEU B O   1 
ATOM   3575 C  CB  . LEU B 1 207 ? 15.520  -0.548  3.585   1.00 19.16 ? 207 LEU B CB  1 
ATOM   3576 C  CG  . LEU B 1 207 ? 14.608  -1.666  3.051   1.00 22.76 ? 207 LEU B CG  1 
ATOM   3577 C  CD1 . LEU B 1 207 ? 13.742  -2.225  4.175   1.00 24.18 ? 207 LEU B CD1 1 
ATOM   3578 C  CD2 . LEU B 1 207 ? 13.746  -1.106  1.946   1.00 24.65 ? 207 LEU B CD2 1 
ATOM   3579 N  N   . PRO B 1 208 ? 16.662  2.320   3.046   1.00 22.55 ? 208 PRO B N   1 
ATOM   3580 C  CA  . PRO B 1 208 ? 17.156  3.584   3.601   1.00 24.45 ? 208 PRO B CA  1 
ATOM   3581 C  C   . PRO B 1 208 ? 16.816  3.634   5.099   1.00 27.30 ? 208 PRO B C   1 
ATOM   3582 O  O   . PRO B 1 208 ? 16.026  2.818   5.598   1.00 22.27 ? 208 PRO B O   1 
ATOM   3583 C  CB  . PRO B 1 208 ? 16.401  4.640   2.789   1.00 21.96 ? 208 PRO B CB  1 
ATOM   3584 C  CG  . PRO B 1 208 ? 15.116  3.927   2.418   1.00 27.81 ? 208 PRO B CG  1 
ATOM   3585 C  CD  . PRO B 1 208 ? 15.598  2.557   2.053   1.00 24.28 ? 208 PRO B CD  1 
ATOM   3586 N  N   . GLU B 1 209 ? 17.401  4.592   5.812   1.00 22.55 ? 209 GLU B N   1 
ATOM   3587 C  CA  . GLU B 1 209 ? 17.172  4.726   7.253   1.00 21.52 ? 209 GLU B CA  1 
ATOM   3588 C  C   . GLU B 1 209 ? 15.706  4.896   7.629   1.00 19.35 ? 209 GLU B C   1 
ATOM   3589 O  O   . GLU B 1 209 ? 15.272  4.397   8.661   1.00 20.37 ? 209 GLU B O   1 
ATOM   3590 C  CB  . GLU B 1 209 ? 17.946  5.929   7.787   1.00 25.55 ? 209 GLU B CB  1 
ATOM   3591 C  CG  . GLU B 1 209 ? 19.436  5.753   7.674   1.00 30.81 ? 209 GLU B CG  1 
ATOM   3592 C  CD  . GLU B 1 209 ? 20.173  7.018   8.034   1.00 39.26 ? 209 GLU B CD  1 
ATOM   3593 O  OE1 . GLU B 1 209 ? 20.517  7.186   9.226   1.00 38.81 ? 209 GLU B OE1 1 
ATOM   3594 O  OE2 . GLU B 1 209 ? 20.384  7.842   7.116   1.00 39.33 ? 209 GLU B OE2 1 
ATOM   3595 N  N   . TRP B 1 210 ? 14.970  5.644   6.819   1.00 17.46 ? 210 TRP B N   1 
ATOM   3596 C  CA  . TRP B 1 210 ? 13.546  5.862   7.078   1.00 21.45 ? 210 TRP B CA  1 
ATOM   3597 C  C   . TRP B 1 210 ? 12.719  5.178   5.986   1.00 20.09 ? 210 TRP B C   1 
ATOM   3598 O  O   . TRP B 1 210 ? 12.995  5.338   4.797   1.00 19.77 ? 210 TRP B O   1 
ATOM   3599 C  CB  . TRP B 1 210 ? 13.213  7.350   7.085   1.00 22.31 ? 210 TRP B CB  1 
ATOM   3600 C  CG  . TRP B 1 210 ? 13.794  8.117   8.236   1.00 23.76 ? 210 TRP B CG  1 
ATOM   3601 C  CD1 . TRP B 1 210 ? 15.023  8.720   8.292   1.00 28.85 ? 210 TRP B CD1 1 
ATOM   3602 C  CD2 . TRP B 1 210 ? 13.145  8.412   9.480   1.00 25.75 ? 210 TRP B CD2 1 
ATOM   3603 N  NE1 . TRP B 1 210 ? 15.174  9.381   9.491   1.00 25.22 ? 210 TRP B NE1 1 
ATOM   3604 C  CE2 . TRP B 1 210 ? 14.036  9.211   10.237  1.00 26.36 ? 210 TRP B CE2 1 
ATOM   3605 C  CE3 . TRP B 1 210 ? 11.895  8.087   10.023  1.00 22.28 ? 210 TRP B CE3 1 
ATOM   3606 C  CZ2 . TRP B 1 210 ? 13.715  9.693   11.507  1.00 26.82 ? 210 TRP B CZ2 1 
ATOM   3607 C  CZ3 . TRP B 1 210 ? 11.573  8.570   11.292  1.00 26.35 ? 210 TRP B CZ3 1 
ATOM   3608 C  CH2 . TRP B 1 210 ? 12.486  9.367   12.017  1.00 26.19 ? 210 TRP B CH2 1 
ATOM   3609 N  N   . VAL B 1 211 ? 11.683  4.448   6.396   1.00 16.81 ? 211 VAL B N   1 
ATOM   3610 C  CA  . VAL B 1 211 ? 10.835  3.709   5.448   1.00 16.66 ? 211 VAL B CA  1 
ATOM   3611 C  C   . VAL B 1 211 ? 9.366   3.824   5.800   1.00 18.66 ? 211 VAL B C   1 
ATOM   3612 O  O   . VAL B 1 211 ? 9.012   4.409   6.825   1.00 16.57 ? 211 VAL B O   1 
ATOM   3613 C  CB  . VAL B 1 211 ? 11.154  2.207   5.511   1.00 17.85 ? 211 VAL B CB  1 
ATOM   3614 C  CG1 . VAL B 1 211 ? 12.615  1.963   5.156   1.00 20.61 ? 211 VAL B CG1 1 
ATOM   3615 C  CG2 . VAL B 1 211 ? 10.859  1.679   6.915   1.00 15.41 ? 211 VAL B CG2 1 
ATOM   3616 N  N   . ARG B 1 212 ? 8.513   3.282   4.928   1.00 13.31 ? 212 ARG B N   1 
ATOM   3617 C  CA  . ARG B 1 212 ? 7.090   3.198   5.223   1.00 16.08 ? 212 ARG B CA  1 
ATOM   3618 C  C   . ARG B 1 212 ? 6.762   1.697   5.127   1.00 16.71 ? 212 ARG B C   1 
ATOM   3619 O  O   . ARG B 1 212 ? 7.450   0.933   4.423   1.00 16.03 ? 212 ARG B O   1 
ATOM   3620 C  CB  . ARG B 1 212 ? 6.228   4.014   4.260   1.00 17.28 ? 212 ARG B CB  1 
ATOM   3621 C  CG  . ARG B 1 212 ? 6.082   5.490   4.701   1.00 17.69 ? 212 ARG B CG  1 
ATOM   3622 C  CD  . ARG B 1 212 ? 4.967   6.209   3.949   1.00 20.05 ? 212 ARG B CD  1 
ATOM   3623 N  NE  . ARG B 1 212 ? 4.621   7.496   4.577   1.00 23.31 ? 212 ARG B NE  1 
ATOM   3624 C  CZ  . ARG B 1 212 ? 4.928   8.686   4.066   1.00 28.20 ? 212 ARG B CZ  1 
ATOM   3625 N  NH1 . ARG B 1 212 ? 5.580   8.765   2.921   1.00 28.46 ? 212 ARG B NH1 1 
ATOM   3626 N  NH2 . ARG B 1 212 ? 4.603   9.803   4.714   1.00 27.99 ? 212 ARG B NH2 1 
ATOM   3627 N  N   . VAL B 1 213 ? 5.764   1.282   5.894   1.00 14.14 ? 213 VAL B N   1 
ATOM   3628 C  CA  . VAL B 1 213 ? 5.346   -0.114  5.916   1.00 11.92 ? 213 VAL B CA  1 
ATOM   3629 C  C   . VAL B 1 213 ? 3.896   -0.223  5.485   1.00 15.49 ? 213 VAL B C   1 
ATOM   3630 O  O   . VAL B 1 213 ? 3.098   0.683   5.705   1.00 14.81 ? 213 VAL B O   1 
ATOM   3631 C  CB  . VAL B 1 213 ? 5.511   -0.732  7.335   1.00 16.53 ? 213 VAL B CB  1 
ATOM   3632 C  CG1 . VAL B 1 213 ? 6.995   -0.812  7.694   1.00 20.75 ? 213 VAL B CG1 1 
ATOM   3633 C  CG2 . VAL B 1 213 ? 4.786   0.124   8.380   1.00 18.21 ? 213 VAL B CG2 1 
ATOM   3634 N  N   . GLY B 1 214 ? 3.550   -1.333  4.846   1.00 12.50 ? 214 GLY B N   1 
ATOM   3635 C  CA  . GLY B 1 214 ? 2.174   -1.477  4.424   1.00 14.47 ? 214 GLY B CA  1 
ATOM   3636 C  C   . GLY B 1 214 ? 1.928   -2.827  3.781   1.00 14.03 ? 214 GLY B C   1 
ATOM   3637 O  O   . GLY B 1 214 ? 2.680   -3.793  4.008   1.00 12.35 ? 214 GLY B O   1 
ATOM   3638 N  N   . PHE B 1 215 ? 0.867   -2.882  2.978   1.00 12.54 ? 215 PHE B N   1 
ATOM   3639 C  CA  . PHE B 1 215 ? 0.468   -4.128  2.313   1.00 11.34 ? 215 PHE B CA  1 
ATOM   3640 C  C   . PHE B 1 215 ? 0.139   -3.844  0.865   1.00 13.17 ? 215 PHE B C   1 
ATOM   3641 O  O   . PHE B 1 215 ? -0.273  -2.748  0.512   1.00 13.81 ? 215 PHE B O   1 
ATOM   3642 C  CB  . PHE B 1 215 ? -0.778  -4.719  2.984   1.00 11.14 ? 215 PHE B CB  1 
ATOM   3643 C  CG  . PHE B 1 215 ? -0.544  -5.160  4.409   1.00 12.81 ? 215 PHE B CG  1 
ATOM   3644 C  CD1 . PHE B 1 215 ? -0.610  -4.235  5.455   1.00 14.90 ? 215 PHE B CD1 1 
ATOM   3645 C  CD2 . PHE B 1 215 ? -0.220  -6.494  4.697   1.00 14.96 ? 215 PHE B CD2 1 
ATOM   3646 C  CE1 . PHE B 1 215 ? -0.357  -4.630  6.783   1.00 15.78 ? 215 PHE B CE1 1 
ATOM   3647 C  CE2 . PHE B 1 215 ? 0.037   -6.904  6.027   1.00 13.83 ? 215 PHE B CE2 1 
ATOM   3648 C  CZ  . PHE B 1 215 ? -0.035  -5.972  7.064   1.00 16.26 ? 215 PHE B CZ  1 
ATOM   3649 N  N   . SER B 1 216 ? 0.289   -4.865  0.041   1.00 13.37 ? 216 SER B N   1 
ATOM   3650 C  CA  . SER B 1 216 ? 0.004   -4.730  -1.371  1.00 13.22 ? 216 SER B CA  1 
ATOM   3651 C  C   . SER B 1 216 ? -0.633  -6.033  -1.838  1.00 16.03 ? 216 SER B C   1 
ATOM   3652 O  O   . SER B 1 216 ? -0.349  -7.085  -1.287  1.00 13.87 ? 216 SER B O   1 
ATOM   3653 C  CB  . SER B 1 216 ? 1.313   -4.502  -2.135  1.00 18.44 ? 216 SER B CB  1 
ATOM   3654 O  OG  . SER B 1 216 ? 1.068   -4.292  -3.516  1.00 18.56 ? 216 SER B OG  1 
ATOM   3655 N  N   . ALA B 1 217 ? -1.507  -5.957  -2.838  1.00 16.06 ? 217 ALA B N   1 
ATOM   3656 C  CA  . ALA B 1 217 ? -2.111  -7.177  -3.377  1.00 15.44 ? 217 ALA B CA  1 
ATOM   3657 C  C   . ALA B 1 217 ? -2.499  -6.864  -4.808  1.00 14.07 ? 217 ALA B C   1 
ATOM   3658 O  O   . ALA B 1 217 ? -2.632  -5.701  -5.187  1.00 15.74 ? 217 ALA B O   1 
ATOM   3659 C  CB  . ALA B 1 217 ? -3.347  -7.591  -2.580  1.00 16.47 ? 217 ALA B CB  1 
ATOM   3660 N  N   . ALA B 1 218 ? -2.691  -7.905  -5.609  1.00 15.48 ? 218 ALA B N   1 
ATOM   3661 C  CA  . ALA B 1 218 ? -3.086  -7.684  -6.987  1.00 16.53 ? 218 ALA B CA  1 
ATOM   3662 C  C   . ALA B 1 218 ? -3.771  -8.934  -7.522  1.00 16.72 ? 218 ALA B C   1 
ATOM   3663 O  O   . ALA B 1 218 ? -3.679  -10.014 -6.922  1.00 14.29 ? 218 ALA B O   1 
ATOM   3664 C  CB  . ALA B 1 218 ? -1.841  -7.352  -7.848  1.00 17.27 ? 218 ALA B CB  1 
ATOM   3665 N  N   . SER B 1 219 ? -4.499  -8.752  -8.619  1.00 17.21 ? 219 SER B N   1 
ATOM   3666 C  CA  . SER B 1 219 ? -5.158  -9.853  -9.320  1.00 17.10 ? 219 SER B CA  1 
ATOM   3667 C  C   . SER B 1 219 ? -4.976  -9.536  -10.813 1.00 20.63 ? 219 SER B C   1 
ATOM   3668 O  O   . SER B 1 219 ? -5.226  -8.409  -11.230 1.00 19.60 ? 219 SER B O   1 
ATOM   3669 C  CB  . SER B 1 219 ? -6.653  -9.917  -9.000  1.00 16.57 ? 219 SER B CB  1 
ATOM   3670 O  OG  . SER B 1 219 ? -6.884  -10.385 -7.673  1.00 16.85 ? 219 SER B OG  1 
ATOM   3671 N  N   . GLY B 1 220 ? -4.522  -10.525 -11.581 1.00 17.63 ? 220 GLY B N   1 
ATOM   3672 C  CA  . GLY B 1 220 ? -4.331  -10.344 -13.010 1.00 20.89 ? 220 GLY B CA  1 
ATOM   3673 C  C   . GLY B 1 220 ? -5.542  -10.934 -13.720 1.00 25.23 ? 220 GLY B C   1 
ATOM   3674 O  O   . GLY B 1 220 ? -6.653  -10.461 -13.512 1.00 22.06 ? 220 GLY B O   1 
ATOM   3675 N  N   . GLU B 1 221 ? -5.349  -11.965 -14.539 1.00 24.05 ? 221 GLU B N   1 
ATOM   3676 C  CA  A GLU B 1 221 ? -6.474  -12.570 -15.241 0.75 28.27 ? 221 GLU B CA  1 
ATOM   3677 C  CA  B GLU B 1 221 ? -6.467  -12.589 -15.244 0.25 28.29 ? 221 GLU B CA  1 
ATOM   3678 C  C   . GLU B 1 221 ? -7.334  -13.382 -14.272 1.00 26.21 ? 221 GLU B C   1 
ATOM   3679 O  O   . GLU B 1 221 ? -8.550  -13.501 -14.463 1.00 24.76 ? 221 GLU B O   1 
ATOM   3680 C  CB  A GLU B 1 221 ? -5.963  -13.450 -16.396 0.75 31.19 ? 221 GLU B CB  1 
ATOM   3681 C  CB  B GLU B 1 221 ? -5.967  -13.525 -16.349 0.25 32.57 ? 221 GLU B CB  1 
ATOM   3682 C  CG  A GLU B 1 221 ? -5.153  -12.659 -17.415 0.75 41.53 ? 221 GLU B CG  1 
ATOM   3683 C  CG  B GLU B 1 221 ? -7.086  -14.020 -17.260 0.25 40.15 ? 221 GLU B CG  1 
ATOM   3684 C  CD  A GLU B 1 221 ? -4.708  -13.483 -18.616 0.75 46.29 ? 221 GLU B CD  1 
ATOM   3685 C  CD  B GLU B 1 221 ? -6.605  -14.989 -18.321 0.25 43.55 ? 221 GLU B CD  1 
ATOM   3686 O  OE1 A GLU B 1 221 ? -4.247  -14.632 -18.426 0.75 49.34 ? 221 GLU B OE1 1 
ATOM   3687 O  OE1 B GLU B 1 221 ? -5.394  -14.996 -18.618 0.25 47.16 ? 221 GLU B OE1 1 
ATOM   3688 O  OE2 A GLU B 1 221 ? -4.806  -12.964 -19.749 0.75 51.43 ? 221 GLU B OE2 1 
ATOM   3689 O  OE2 B GLU B 1 221 ? -7.443  -15.735 -18.868 0.25 46.39 ? 221 GLU B OE2 1 
ATOM   3690 N  N   . GLN B 1 222 ? -6.705  -13.949 -13.243 1.00 21.77 ? 222 GLN B N   1 
ATOM   3691 C  CA  A GLN B 1 222 ? -7.427  -14.713 -12.227 0.50 23.90 ? 222 GLN B CA  1 
ATOM   3692 C  CA  B GLN B 1 222 ? -7.431  -14.707 -12.225 0.50 24.07 ? 222 GLN B CA  1 
ATOM   3693 C  C   . GLN B 1 222 ? -7.578  -13.769 -11.029 1.00 24.71 ? 222 GLN B C   1 
ATOM   3694 O  O   . GLN B 1 222 ? -6.807  -12.827 -10.880 1.00 21.81 ? 222 GLN B O   1 
ATOM   3695 C  CB  A GLN B 1 222 ? -6.654  -15.972 -11.834 0.50 28.30 ? 222 GLN B CB  1 
ATOM   3696 C  CB  B GLN B 1 222 ? -6.670  -15.970 -11.831 0.50 28.76 ? 222 GLN B CB  1 
ATOM   3697 C  CG  A GLN B 1 222 ? -6.765  -17.126 -12.833 0.50 34.98 ? 222 GLN B CG  1 
ATOM   3698 C  CG  B GLN B 1 222 ? -6.509  -16.975 -12.963 0.50 36.66 ? 222 GLN B CG  1 
ATOM   3699 C  CD  A GLN B 1 222 ? -6.150  -16.808 -14.184 0.50 35.59 ? 222 GLN B CD  1 
ATOM   3700 C  CD  B GLN B 1 222 ? -7.813  -17.265 -13.676 0.50 38.76 ? 222 GLN B CD  1 
ATOM   3701 O  OE1 A GLN B 1 222 ? -4.965  -16.497 -14.281 0.50 37.58 ? 222 GLN B OE1 1 
ATOM   3702 O  OE1 B GLN B 1 222 ? -8.795  -17.675 -13.057 0.50 43.33 ? 222 GLN B OE1 1 
ATOM   3703 N  NE2 A GLN B 1 222 ? -6.958  -16.890 -15.236 0.50 39.91 ? 222 GLN B NE2 1 
ATOM   3704 N  NE2 B GLN B 1 222 ? -7.829  -17.054 -14.987 0.50 39.54 ? 222 GLN B NE2 1 
ATOM   3705 N  N   . TYR B 1 223 ? -8.546  -14.026 -10.164 1.00 20.34 ? 223 TYR B N   1 
ATOM   3706 C  CA  . TYR B 1 223 ? -8.779  -13.096 -9.067  1.00 18.82 ? 223 TYR B CA  1 
ATOM   3707 C  C   . TYR B 1 223 ? -9.358  -13.682 -7.802  1.00 18.44 ? 223 TYR B C   1 
ATOM   3708 O  O   . TYR B 1 223 ? -9.849  -14.810 -7.799  1.00 15.90 ? 223 TYR B O   1 
ATOM   3709 C  CB  . TYR B 1 223 ? -9.735  -12.016 -9.578  1.00 18.99 ? 223 TYR B CB  1 
ATOM   3710 C  CG  . TYR B 1 223 ? -10.887 -12.599 -10.373 1.00 23.88 ? 223 TYR B CG  1 
ATOM   3711 C  CD1 . TYR B 1 223 ? -10.808 -12.733 -11.768 1.00 27.48 ? 223 TYR B CD1 1 
ATOM   3712 C  CD2 . TYR B 1 223 ? -12.029 -13.069 -9.732  1.00 25.05 ? 223 TYR B CD2 1 
ATOM   3713 C  CE1 . TYR B 1 223 ? -11.852 -13.326 -12.496 1.00 29.49 ? 223 TYR B CE1 1 
ATOM   3714 C  CE2 . TYR B 1 223 ? -13.070 -13.666 -10.448 1.00 30.18 ? 223 TYR B CE2 1 
ATOM   3715 C  CZ  . TYR B 1 223 ? -12.975 -13.790 -11.823 1.00 30.74 ? 223 TYR B CZ  1 
ATOM   3716 O  OH  . TYR B 1 223 ? -14.011 -14.399 -12.514 1.00 33.70 ? 223 TYR B OH  1 
ATOM   3717 N  N   . GLN B 1 224 ? -9.301  -12.881 -6.732  1.00 16.53 ? 224 GLN B N   1 
ATOM   3718 C  CA  . GLN B 1 224 ? -9.803  -13.252 -5.412  1.00 16.17 ? 224 GLN B CA  1 
ATOM   3719 C  C   . GLN B 1 224 ? -9.762  -11.964 -4.578  1.00 17.00 ? 224 GLN B C   1 
ATOM   3720 O  O   . GLN B 1 224 ? -9.026  -11.056 -4.921  1.00 13.32 ? 224 GLN B O   1 
ATOM   3721 C  CB  . GLN B 1 224 ? -8.871  -14.283 -4.737  1.00 15.90 ? 224 GLN B CB  1 
ATOM   3722 C  CG  . GLN B 1 224 ? -7.453  -13.719 -4.425  1.00 13.06 ? 224 GLN B CG  1 
ATOM   3723 C  CD  . GLN B 1 224 ? -6.393  -14.791 -4.162  1.00 14.18 ? 224 GLN B CD  1 
ATOM   3724 O  OE1 . GLN B 1 224 ? -5.180  -14.489 -4.162  1.00 20.20 ? 224 GLN B OE1 1 
ATOM   3725 N  NE2 . GLN B 1 224 ? -6.822  -16.039 -3.931  1.00 12.02 ? 224 GLN B NE2 1 
ATOM   3726 N  N   . THR B 1 225 ? -10.556 -11.883 -3.509  1.00 14.14 ? 225 THR B N   1 
ATOM   3727 C  CA  . THR B 1 225 ? -10.480 -10.711 -2.646  1.00 13.88 ? 225 THR B CA  1 
ATOM   3728 C  C   . THR B 1 225 ? -9.219  -10.903 -1.782  1.00 18.74 ? 225 THR B C   1 
ATOM   3729 O  O   . THR B 1 225 ? -8.776  -12.036 -1.544  1.00 16.53 ? 225 THR B O   1 
ATOM   3730 C  CB  . THR B 1 225 ? -11.667 -10.639 -1.688  1.00 18.73 ? 225 THR B CB  1 
ATOM   3731 O  OG1 . THR B 1 225 ? -11.776 -11.883 -0.975  1.00 21.34 ? 225 THR B OG1 1 
ATOM   3732 C  CG2 . THR B 1 225 ? -12.939 -10.397 -2.447  1.00 21.69 ? 225 THR B CG2 1 
ATOM   3733 N  N   . HIS B 1 226 ? -8.641  -9.795  -1.329  1.00 14.69 ? 226 HIS B N   1 
ATOM   3734 C  CA  . HIS B 1 226 ? -7.470  -9.850  -0.457  1.00 14.37 ? 226 HIS B CA  1 
ATOM   3735 C  C   . HIS B 1 226 ? -7.898  -8.904  0.653   1.00 14.02 ? 226 HIS B C   1 
ATOM   3736 O  O   . HIS B 1 226 ? -7.756  -7.688  0.539   1.00 15.60 ? 226 HIS B O   1 
ATOM   3737 C  CB  . HIS B 1 226 ? -6.238  -9.313  -1.162  1.00 16.31 ? 226 HIS B CB  1 
ATOM   3738 C  CG  . HIS B 1 226 ? -5.836  -10.104 -2.366  1.00 16.91 ? 226 HIS B CG  1 
ATOM   3739 N  ND1 . HIS B 1 226 ? -6.342  -9.847  -3.622  1.00 17.31 ? 226 HIS B ND1 1 
ATOM   3740 C  CD2 . HIS B 1 226 ? -4.940  -11.110 -2.520  1.00 17.29 ? 226 HIS B CD2 1 
ATOM   3741 C  CE1 . HIS B 1 226 ? -5.772  -10.656 -4.501  1.00 16.09 ? 226 HIS B CE1 1 
ATOM   3742 N  NE2 . HIS B 1 226 ? -4.915  -11.432 -3.859  1.00 16.03 ? 226 HIS B NE2 1 
ATOM   3743 N  N   . THR B 1 227 ? -8.418  -9.473  1.722   1.00 14.20 ? 227 THR B N   1 
ATOM   3744 C  CA  . THR B 1 227 ? -8.967  -8.674  2.798   1.00 14.08 ? 227 THR B CA  1 
ATOM   3745 C  C   . THR B 1 227 ? -8.078  -8.616  4.042   1.00 13.12 ? 227 THR B C   1 
ATOM   3746 O  O   . THR B 1 227 ? -7.875  -9.619  4.704   1.00 15.45 ? 227 THR B O   1 
ATOM   3747 C  CB  . THR B 1 227 ? -10.337 -9.250  3.185   1.00 19.24 ? 227 THR B CB  1 
ATOM   3748 O  OG1 . THR B 1 227 ? -11.144 -9.377  1.994   1.00 18.17 ? 227 THR B OG1 1 
ATOM   3749 C  CG2 . THR B 1 227 ? -11.028 -8.364  4.220   1.00 20.93 ? 227 THR B CG2 1 
ATOM   3750 N  N   . LEU B 1 228 ? -7.594  -7.424  4.365   1.00 13.29 ? 228 LEU B N   1 
ATOM   3751 C  CA  . LEU B 1 228 ? -6.744  -7.253  5.549   1.00 14.02 ? 228 LEU B CA  1 
ATOM   3752 C  C   . LEU B 1 228 ? -7.712  -6.935  6.683   1.00 14.63 ? 228 LEU B C   1 
ATOM   3753 O  O   . LEU B 1 228 ? -8.415  -5.919  6.630   1.00 16.85 ? 228 LEU B O   1 
ATOM   3754 C  CB  . LEU B 1 228 ? -5.799  -6.085  5.332   1.00 14.89 ? 228 LEU B CB  1 
ATOM   3755 C  CG  . LEU B 1 228 ? -4.826  -5.788  6.487   1.00 18.54 ? 228 LEU B CG  1 
ATOM   3756 C  CD1 . LEU B 1 228 ? -3.849  -6.953  6.666   1.00 19.07 ? 228 LEU B CD1 1 
ATOM   3757 C  CD2 . LEU B 1 228 ? -4.070  -4.514  6.133   1.00 19.77 ? 228 LEU B CD2 1 
ATOM   3758 N  N   . GLU B 1 229 ? -7.724  -7.797  7.699   1.00 13.80 ? 229 GLU B N   1 
ATOM   3759 C  CA  . GLU B 1 229 ? -8.664  -7.700  8.812   1.00 13.62 ? 229 GLU B CA  1 
ATOM   3760 C  C   . GLU B 1 229 ? -8.172  -6.983  10.061  1.00 16.73 ? 229 GLU B C   1 
ATOM   3761 O  O   . GLU B 1 229 ? -8.964  -6.389  10.766  1.00 15.41 ? 229 GLU B O   1 
ATOM   3762 C  CB  . GLU B 1 229 ? -9.123  -9.122  9.174   1.00 17.67 ? 229 GLU B CB  1 
ATOM   3763 C  CG  . GLU B 1 229 ? -9.766  -9.834  7.967   1.00 18.95 ? 229 GLU B CG  1 
ATOM   3764 C  CD  . GLU B 1 229 ? -9.943  -11.344 8.157   1.00 23.23 ? 229 GLU B CD  1 
ATOM   3765 O  OE1 . GLU B 1 229 ? -10.828 -11.915 7.494   1.00 26.88 ? 229 GLU B OE1 1 
ATOM   3766 O  OE2 . GLU B 1 229 ? -9.200  -11.960 8.940   1.00 27.42 ? 229 GLU B OE2 1 
ATOM   3767 N  N   . SER B 1 230 ? -6.879  -7.041  10.341  1.00 12.48 ? 230 SER B N   1 
ATOM   3768 C  CA  . SER B 1 230 ? -6.332  -6.385  11.544  1.00 11.78 ? 230 SER B CA  1 
ATOM   3769 C  C   . SER B 1 230 ? -4.826  -6.253  11.346  1.00 14.91 ? 230 SER B C   1 
ATOM   3770 O  O   . SER B 1 230 ? -4.226  -6.992  10.556  1.00 13.83 ? 230 SER B O   1 
ATOM   3771 C  CB  . SER B 1 230 ? -6.611  -7.221  12.801  1.00 13.64 ? 230 SER B CB  1 
ATOM   3772 O  OG  . SER B 1 230 ? -5.983  -8.489  12.734  1.00 21.48 ? 230 SER B OG  1 
ATOM   3773 N  N   . TRP B 1 231 ? -4.221  -5.321  12.074  1.00 12.02 ? 231 TRP B N   1 
ATOM   3774 C  CA  . TRP B 1 231 ? -2.786  -5.091  11.941  1.00 12.58 ? 231 TRP B CA  1 
ATOM   3775 C  C   . TRP B 1 231 ? -2.232  -4.322  13.138  1.00 13.47 ? 231 TRP B C   1 
ATOM   3776 O  O   . TRP B 1 231 ? -2.823  -3.325  13.569  1.00 16.38 ? 231 TRP B O   1 
ATOM   3777 C  CB  . TRP B 1 231 ? -2.541  -4.267  10.678  1.00 12.85 ? 231 TRP B CB  1 
ATOM   3778 C  CG  . TRP B 1 231 ? -1.092  -3.896  10.396  1.00 14.93 ? 231 TRP B CG  1 
ATOM   3779 C  CD1 . TRP B 1 231 ? 0.024   -4.611  10.733  1.00 13.63 ? 231 TRP B CD1 1 
ATOM   3780 C  CD2 . TRP B 1 231 ? -0.636  -2.768  9.636   1.00 13.65 ? 231 TRP B CD2 1 
ATOM   3781 N  NE1 . TRP B 1 231 ? 1.164   -3.987  10.216  1.00 13.27 ? 231 TRP B NE1 1 
ATOM   3782 C  CE2 . TRP B 1 231 ? 0.778   -2.860  9.540   1.00 12.43 ? 231 TRP B CE2 1 
ATOM   3783 C  CE3 . TRP B 1 231 ? -1.286  -1.683  9.022   1.00 11.72 ? 231 TRP B CE3 1 
ATOM   3784 C  CZ2 . TRP B 1 231 ? 1.555   -1.907  8.847   1.00 17.34 ? 231 TRP B CZ2 1 
ATOM   3785 C  CZ3 . TRP B 1 231 ? -0.512  -0.734  8.326   1.00 13.54 ? 231 TRP B CZ3 1 
ATOM   3786 C  CH2 . TRP B 1 231 ? 0.892   -0.856  8.246   1.00 13.61 ? 231 TRP B CH2 1 
ATOM   3787 N  N   . SER B 1 232 ? -1.123  -4.799  13.699  1.00 12.05 ? 232 SER B N   1 
ATOM   3788 C  CA  A SER B 1 232 ? -0.476  -4.062  14.789  0.50 9.80  ? 232 SER B CA  1 
ATOM   3789 C  CA  B SER B 1 232 ? -0.473  -4.101  14.804  0.50 11.50 ? 232 SER B CA  1 
ATOM   3790 C  C   . SER B 1 232 ? 0.997   -4.059  14.431  1.00 14.07 ? 232 SER B C   1 
ATOM   3791 O  O   . SER B 1 232 ? 1.513   -5.016  13.860  1.00 12.25 ? 232 SER B O   1 
ATOM   3792 C  CB  A SER B 1 232 ? -0.693  -4.708  16.170  0.50 13.70 ? 232 SER B CB  1 
ATOM   3793 C  CB  B SER B 1 232 ? -0.665  -4.865  16.113  0.50 15.36 ? 232 SER B CB  1 
ATOM   3794 O  OG  A SER B 1 232 ? -0.076  -5.968  16.289  0.50 13.23 ? 232 SER B OG  1 
ATOM   3795 O  OG  B SER B 1 232 ? -2.023  -4.801  16.519  0.50 22.22 ? 232 SER B OG  1 
ATOM   3796 N  N   . PHE B 1 233 ? 1.661   -2.960  14.745  1.00 13.62 ? 233 PHE B N   1 
ATOM   3797 C  CA  . PHE B 1 233 ? 3.070   -2.852  14.399  1.00 13.46 ? 233 PHE B CA  1 
ATOM   3798 C  C   . PHE B 1 233 ? 3.815   -2.123  15.485  1.00 18.15 ? 233 PHE B C   1 
ATOM   3799 O  O   . PHE B 1 233 ? 3.291   -1.197  16.098  1.00 15.87 ? 233 PHE B O   1 
ATOM   3800 C  CB  . PHE B 1 233 ? 3.193   -2.050  13.116  1.00 13.08 ? 233 PHE B CB  1 
ATOM   3801 C  CG  . PHE B 1 233 ? 4.602   -1.854  12.658  1.00 13.94 ? 233 PHE B CG  1 
ATOM   3802 C  CD1 . PHE B 1 233 ? 5.322   -0.725  13.035  1.00 15.70 ? 233 PHE B CD1 1 
ATOM   3803 C  CD2 . PHE B 1 233 ? 5.204   -2.789  11.825  1.00 16.36 ? 233 PHE B CD2 1 
ATOM   3804 C  CE1 . PHE B 1 233 ? 6.629   -0.526  12.579  1.00 22.56 ? 233 PHE B CE1 1 
ATOM   3805 C  CE2 . PHE B 1 233 ? 6.508   -2.599  11.364  1.00 19.63 ? 233 PHE B CE2 1 
ATOM   3806 C  CZ  . PHE B 1 233 ? 7.217   -1.459  11.746  1.00 18.72 ? 233 PHE B CZ  1 
ATOM   3807 N  N   . THR B 1 234 ? 5.038   -2.542  15.739  1.00 14.01 ? 234 THR B N   1 
ATOM   3808 C  CA  A THR B 1 234 ? 5.840   -1.848  16.733  0.50 14.16 ? 234 THR B CA  1 
ATOM   3809 C  CA  B THR B 1 234 ? 5.847   -1.878  16.754  0.50 15.00 ? 234 THR B CA  1 
ATOM   3810 C  C   . THR B 1 234 ? 7.289   -1.903  16.270  1.00 17.36 ? 234 THR B C   1 
ATOM   3811 O  O   . THR B 1 234 ? 7.732   -2.887  15.672  1.00 14.94 ? 234 THR B O   1 
ATOM   3812 C  CB  A THR B 1 234 ? 5.694   -2.475  18.138  0.50 18.04 ? 234 THR B CB  1 
ATOM   3813 C  CB  B THR B 1 234 ? 5.778   -2.614  18.107  0.50 19.39 ? 234 THR B CB  1 
ATOM   3814 O  OG1 A THR B 1 234 ? 6.445   -1.699  19.082  0.50 21.25 ? 234 THR B OG1 1 
ATOM   3815 O  OG1 B THR B 1 234 ? 4.422   -2.648  18.575  0.50 18.64 ? 234 THR B OG1 1 
ATOM   3816 C  CG2 A THR B 1 234 ? 6.181   -3.923  18.158  0.50 12.57 ? 234 THR B CG2 1 
ATOM   3817 C  CG2 B THR B 1 234 ? 6.648   -1.908  19.141  0.50 22.14 ? 234 THR B CG2 1 
ATOM   3818 N  N   . SER B 1 235 ? 8.012   -0.825  16.507  1.00 14.87 ? 235 SER B N   1 
ATOM   3819 C  CA  A SER B 1 235 ? 9.410   -0.770  16.117  0.50 13.46 ? 235 SER B CA  1 
ATOM   3820 C  CA  B SER B 1 235 ? 9.414   -0.777  16.116  0.50 14.14 ? 235 SER B CA  1 
ATOM   3821 C  C   . SER B 1 235 ? 10.160  0.066   17.146  1.00 16.71 ? 235 SER B C   1 
ATOM   3822 O  O   . SER B 1 235 ? 9.643   1.074   17.622  1.00 16.22 ? 235 SER B O   1 
ATOM   3823 C  CB  A SER B 1 235 ? 9.540   -0.127  14.733  0.50 16.74 ? 235 SER B CB  1 
ATOM   3824 C  CB  B SER B 1 235 ? 9.572   -0.167  14.724  0.50 17.72 ? 235 SER B CB  1 
ATOM   3825 O  OG  A SER B 1 235 ? 10.895  0.060   14.351  0.50 14.87 ? 235 SER B OG  1 
ATOM   3826 O  OG  B SER B 1 235 ? 9.196   1.196   14.711  0.50 24.69 ? 235 SER B OG  1 
ATOM   3827 N  N   . THR B 1 236 ? 11.371  -0.359  17.497  1.00 16.17 ? 236 THR B N   1 
ATOM   3828 C  CA  A THR B 1 236 ? 12.171  0.422   18.421  0.50 18.83 ? 236 THR B CA  1 
ATOM   3829 C  CA  B THR B 1 236 ? 12.179  0.373   18.460  0.50 18.94 ? 236 THR B CA  1 
ATOM   3830 C  C   . THR B 1 236 ? 13.643  0.268   18.057  1.00 21.61 ? 236 THR B C   1 
ATOM   3831 O  O   . THR B 1 236 ? 14.122  -0.833  17.798  1.00 19.15 ? 236 THR B O   1 
ATOM   3832 C  CB  A THR B 1 236 ? 11.935  0.015   19.890  0.50 23.28 ? 236 THR B CB  1 
ATOM   3833 C  CB  B THR B 1 236 ? 12.052  -0.224  19.869  0.50 23.39 ? 236 THR B CB  1 
ATOM   3834 O  OG1 A THR B 1 236 ? 12.573  0.977   20.740  0.50 27.97 ? 236 THR B OG1 1 
ATOM   3835 O  OG1 B THR B 1 236 ? 10.682  -0.211  20.282  0.50 24.82 ? 236 THR B OG1 1 
ATOM   3836 C  CG2 A THR B 1 236 ? 12.494  -1.370  20.184  0.50 23.99 ? 236 THR B CG2 1 
ATOM   3837 C  CG2 B THR B 1 236 ? 12.887  0.579   20.851  0.50 27.55 ? 236 THR B CG2 1 
ATOM   3838 N  N   . LEU B 1 237 ? 14.353  1.393   18.012  1.00 20.41 ? 237 LEU B N   1 
ATOM   3839 C  CA  . LEU B 1 237 ? 15.776  1.352   17.653  1.00 20.88 ? 237 LEU B CA  1 
ATOM   3840 C  C   . LEU B 1 237 ? 16.625  0.766   18.775  1.00 27.75 ? 237 LEU B C   1 
ATOM   3841 O  O   . LEU B 1 237 ? 16.474  1.151   19.937  1.00 25.75 ? 237 LEU B O   1 
ATOM   3842 C  CB  . LEU B 1 237 ? 16.273  2.768   17.321  1.00 23.39 ? 237 LEU B CB  1 
ATOM   3843 C  CG  . LEU B 1 237 ? 15.907  3.264   15.932  1.00 23.04 ? 237 LEU B CG  1 
ATOM   3844 C  CD1 . LEU B 1 237 ? 16.342  4.729   15.762  1.00 25.44 ? 237 LEU B CD1 1 
ATOM   3845 C  CD2 . LEU B 1 237 ? 16.607  2.373   14.881  1.00 25.97 ? 237 LEU B CD2 1 
ATOM   3846 N  N   . LEU B 1 238 ? 17.516  -0.164  18.425  1.00 29.61 ? 238 LEU B N   1 
ATOM   3847 C  CA  . LEU B 1 238 ? 18.400  -0.802  19.406  1.00 33.38 ? 238 LEU B CA  1 
ATOM   3848 C  C   . LEU B 1 238 ? 19.879  -0.756  19.005  1.00 38.42 ? 238 LEU B C   1 
ATOM   3849 O  O   . LEU B 1 238 ? 20.223  -0.742  17.819  1.00 35.46 ? 238 LEU B O   1 
ATOM   3850 C  CB  . LEU B 1 238 ? 18.009  -2.269  19.614  1.00 34.90 ? 238 LEU B CB  1 
ATOM   3851 C  CG  . LEU B 1 238 ? 16.612  -2.605  20.142  1.00 38.60 ? 238 LEU B CG  1 
ATOM   3852 C  CD1 . LEU B 1 238 ? 16.501  -4.121  20.341  1.00 39.91 ? 238 LEU B CD1 1 
ATOM   3853 C  CD2 . LEU B 1 238 ? 16.355  -1.867  21.458  1.00 40.85 ? 238 LEU B CD2 1 
ATOM   3854 N  N   . TYR B 1 239 ? 20.756  -0.736  20.003  1.00 47.85 ? 239 TYR B N   1 
ATOM   3855 C  CA  . TYR B 1 239 ? 22.192  -0.736  19.739  1.00 55.99 ? 239 TYR B CA  1 
ATOM   3856 C  C   . TYR B 1 239 ? 22.603  -2.144  19.333  1.00 58.32 ? 239 TYR B C   1 
ATOM   3857 O  O   . TYR B 1 239 ? 22.216  -3.116  19.978  1.00 59.31 ? 239 TYR B O   1 
ATOM   3858 C  CB  . TYR B 1 239 ? 22.971  -0.311  20.988  1.00 61.15 ? 239 TYR B CB  1 
ATOM   3859 C  CG  . TYR B 1 239 ? 22.987  1.185   21.216  1.00 67.25 ? 239 TYR B CG  1 
ATOM   3860 C  CD1 . TYR B 1 239 ? 23.753  2.028   20.404  1.00 69.03 ? 239 TYR B CD1 1 
ATOM   3861 C  CD2 . TYR B 1 239 ? 22.210  1.766   22.222  1.00 69.54 ? 239 TYR B CD2 1 
ATOM   3862 C  CE1 . TYR B 1 239 ? 23.742  3.415   20.589  1.00 71.02 ? 239 TYR B CE1 1 
ATOM   3863 C  CE2 . TYR B 1 239 ? 22.191  3.149   22.414  1.00 71.53 ? 239 TYR B CE2 1 
ATOM   3864 C  CZ  . TYR B 1 239 ? 22.955  3.965   21.596  1.00 72.52 ? 239 TYR B CZ  1 
ATOM   3865 O  OH  . TYR B 1 239 ? 22.913  5.329   21.777  1.00 74.45 ? 239 TYR B OH  1 
ATOM   3866 N  N   . THR B 1 240 ? 23.379  -2.252  18.257  1.00 61.76 ? 240 THR B N   1 
ATOM   3867 C  CA  . THR B 1 240 ? 23.843  -3.552  17.776  1.00 65.23 ? 240 THR B CA  1 
ATOM   3868 C  C   . THR B 1 240 ? 25.368  -3.598  17.687  1.00 66.26 ? 240 THR B C   1 
ATOM   3869 O  O   . THR B 1 240 ? 26.007  -2.635  17.258  1.00 67.55 ? 240 THR B O   1 
ATOM   3870 C  CB  . THR B 1 240 ? 23.267  -3.877  16.380  1.00 67.05 ? 240 THR B CB  1 
ATOM   3871 O  OG1 . THR B 1 240 ? 21.834  -3.814  16.423  1.00 68.59 ? 240 THR B OG1 1 
ATOM   3872 C  CG2 . THR B 1 240 ? 23.697  -5.277  15.940  1.00 67.37 ? 240 THR B CG2 1 
HETATM 3873 C  C1  . MAN C 2 .   ? 4.764   42.055  25.637  1.00 29.39 ? 253 MAN A C1  1 
HETATM 3874 C  C2  . MAN C 2 .   ? 3.672   41.193  25.006  1.00 30.41 ? 253 MAN A C2  1 
HETATM 3875 C  C3  . MAN C 2 .   ? 3.088   40.251  26.063  1.00 29.78 ? 253 MAN A C3  1 
HETATM 3876 C  C4  . MAN C 2 .   ? 4.205   39.417  26.696  1.00 25.74 ? 253 MAN A C4  1 
HETATM 3877 C  C5  . MAN C 2 .   ? 5.268   40.360  27.270  1.00 27.13 ? 253 MAN A C5  1 
HETATM 3878 C  C6  . MAN C 2 .   ? 6.452   39.620  27.857  1.00 24.85 ? 253 MAN A C6  1 
HETATM 3879 O  O1  . MAN C 2 .   ? 4.210   42.846  26.633  1.00 34.24 ? 253 MAN A O1  1 
HETATM 3880 O  O2  . MAN C 2 .   ? 4.223   40.434  23.941  1.00 31.16 ? 253 MAN A O2  1 
HETATM 3881 O  O3  . MAN C 2 .   ? 2.126   39.408  25.463  1.00 29.83 ? 253 MAN A O3  1 
HETATM 3882 O  O4  . MAN C 2 .   ? 3.676   38.603  27.736  1.00 24.95 ? 253 MAN A O4  1 
HETATM 3883 O  O5  . MAN C 2 .   ? 5.781   41.221  26.228  1.00 26.51 ? 253 MAN A O5  1 
HETATM 3884 O  O6  . MAN C 2 .   ? 7.165   38.934  26.838  1.00 22.66 ? 253 MAN A O6  1 
HETATM 3885 MN MN  . MN  D 3 .   ? -1.127  31.686  32.514  1.00 16.41 ? 281 MN  A MN  1 
HETATM 3886 CA CA  . CA  E 4 .   ? 1.445   34.604  31.069  1.00 18.32 ? 283 CA  A CA  1 
HETATM 3887 C  C1  . MAN F 2 .   ? -1.988  -13.076 -16.040 1.00 25.55 ? 253 MAN B C1  1 
HETATM 3888 C  C2  . MAN F 2 .   ? -0.899  -12.100 -15.574 1.00 23.35 ? 253 MAN B C2  1 
HETATM 3889 C  C3  . MAN F 2 .   ? -0.038  -12.752 -14.494 1.00 24.93 ? 253 MAN B C3  1 
HETATM 3890 C  C4  . MAN F 2 .   ? -0.930  -13.244 -13.349 1.00 20.39 ? 253 MAN B C4  1 
HETATM 3891 C  C5  . MAN F 2 .   ? -2.024  -14.177 -13.896 1.00 21.97 ? 253 MAN B C5  1 
HETATM 3892 C  C6  . MAN F 2 .   ? -3.010  -14.617 -12.823 1.00 21.97 ? 253 MAN B C6  1 
HETATM 3893 O  O1  A MAN F 2 .   ? -1.403  -14.203 -16.597 0.75 22.76 ? 253 MAN B O1  1 
HETATM 3894 O  O1  B MAN F 2 .   ? -2.822  -12.239 -16.879 0.25 25.95 ? 253 MAN B O1  1 
HETATM 3895 O  O2  . MAN F 2 .   ? -1.498  -10.924 -15.053 1.00 25.49 ? 253 MAN B O2  1 
HETATM 3896 O  O3  . MAN F 2 .   ? 0.909   -11.812 -13.998 1.00 25.58 ? 253 MAN B O3  1 
HETATM 3897 O  O4  . MAN F 2 .   ? -0.136  -13.939 -12.402 1.00 17.67 ? 253 MAN B O4  1 
HETATM 3898 O  O5  . MAN F 2 .   ? -2.791  -13.499 -14.922 1.00 23.30 ? 253 MAN B O5  1 
HETATM 3899 O  O6  . MAN F 2 .   ? -3.805  -13.526 -12.376 1.00 20.69 ? 253 MAN B O6  1 
HETATM 3900 MN MN  . MN  G 3 .   ? 5.976   -16.209 -5.356  1.00 14.02 ? 282 MN  B MN  1 
HETATM 3901 CA CA  . CA  H 4 .   ? 2.820   -15.919 -8.082  1.00 17.98 ? 284 CA  B CA  1 
HETATM 3902 O  O   . HOH I 5 .   ? -0.198  33.825  29.482  1.00 17.47 ? 284 HOH A O   1 
HETATM 3903 O  O   . HOH I 5 .   ? 3.275   34.450  29.484  1.00 18.00 ? 285 HOH A O   1 
HETATM 3904 O  O   . HOH I 5 .   ? -2.064  31.808  30.488  1.00 15.44 ? 286 HOH A O   1 
HETATM 3905 O  O   . HOH I 5 .   ? -2.845  31.111  33.215  1.00 17.50 ? 287 HOH A O   1 
HETATM 3906 O  O   . HOH I 5 .   ? -14.996 10.041  29.184  1.00 38.09 ? 288 HOH A O   1 
HETATM 3907 O  O   . HOH I 5 .   ? 2.500   25.177  44.419  1.00 40.84 ? 289 HOH A O   1 
HETATM 3908 O  O   . HOH I 5 .   ? -1.423  27.318  43.866  1.00 27.45 ? 290 HOH A O   1 
HETATM 3909 O  O   . HOH I 5 .   ? -11.500 30.051  32.027  1.00 46.90 ? 291 HOH A O   1 
HETATM 3910 O  O   . HOH I 5 .   ? 18.769  17.803  31.644  1.00 52.35 ? 292 HOH A O   1 
HETATM 3911 O  O   . HOH I 5 .   ? 6.922   14.047  36.837  1.00 30.36 ? 293 HOH A O   1 
HETATM 3912 O  O   . HOH I 5 .   ? 1.714   42.709  37.598  1.00 25.11 ? 294 HOH A O   1 
HETATM 3913 O  O   . HOH I 5 .   ? -8.570  3.381   13.084  1.00 26.85 ? 295 HOH A O   1 
HETATM 3914 O  O   . HOH I 5 .   ? -5.353  32.325  34.373  1.00 22.21 ? 296 HOH A O   1 
HETATM 3915 O  O   . HOH I 5 .   ? -10.667 16.160  13.273  1.00 25.00 ? 297 HOH A O   1 
HETATM 3916 O  O   . HOH I 5 .   ? -8.907  27.702  30.121  1.00 21.72 ? 298 HOH A O   1 
HETATM 3917 O  O   . HOH I 5 .   ? -0.376  14.491  16.375  1.00 17.99 ? 299 HOH A O   1 
HETATM 3918 O  O   . HOH I 5 .   ? 7.220   21.008  8.923   1.00 36.63 ? 300 HOH A O   1 
HETATM 3919 O  O   . HOH I 5 .   ? 14.459  31.454  22.406  1.00 26.40 ? 301 HOH A O   1 
HETATM 3920 O  O   . HOH I 5 .   ? 9.908   16.423  10.328  1.00 29.41 ? 302 HOH A O   1 
HETATM 3921 O  O   . HOH I 5 .   ? -5.078  6.819   17.581  1.00 27.96 ? 303 HOH A O   1 
HETATM 3922 O  O   . HOH I 5 .   ? 9.898   31.268  40.001  1.00 37.31 ? 304 HOH A O   1 
HETATM 3923 O  O   . HOH I 5 .   ? 14.079  25.387  33.333  1.00 21.94 ? 305 HOH A O   1 
HETATM 3924 O  O   . HOH I 5 .   ? -8.623  26.976  18.588  1.00 45.52 ? 306 HOH A O   1 
HETATM 3925 O  O   . HOH I 5 .   ? -4.891  -1.542  19.441  1.00 27.64 ? 307 HOH A O   1 
HETATM 3926 O  O   . HOH I 5 .   ? 14.065  10.303  18.613  1.00 26.73 ? 308 HOH A O   1 
HETATM 3927 O  O   . HOH I 5 .   ? -6.055  6.533   20.429  1.00 21.27 ? 309 HOH A O   1 
HETATM 3928 O  O   . HOH I 5 .   ? 14.980  21.714  12.402  1.00 35.10 ? 310 HOH A O   1 
HETATM 3929 O  O   . HOH I 5 .   ? 7.674   31.117  46.981  1.00 47.98 ? 311 HOH A O   1 
HETATM 3930 O  O   . HOH I 5 .   ? -1.713  21.566  11.305  1.00 35.04 ? 312 HOH A O   1 
HETATM 3931 O  O   . HOH I 5 .   ? 10.317  12.351  28.426  1.00 41.74 ? 313 HOH A O   1 
HETATM 3932 O  O   . HOH I 5 .   ? 12.364  14.827  37.765  1.00 38.13 ? 314 HOH A O   1 
HETATM 3933 O  O   . HOH I 5 .   ? 14.312  27.928  22.281  1.00 27.91 ? 315 HOH A O   1 
HETATM 3934 O  O   . HOH I 5 .   ? 6.095   38.585  35.117  1.00 29.96 ? 316 HOH A O   1 
HETATM 3935 O  O   . HOH I 5 .   ? 7.090   39.803  40.366  1.00 43.79 ? 317 HOH A O   1 
HETATM 3936 O  O   . HOH I 5 .   ? -9.130  14.900  10.653  1.00 42.80 ? 318 HOH A O   1 
HETATM 3937 O  O   . HOH I 5 .   ? 2.080   39.952  22.119  1.00 43.43 ? 319 HOH A O   1 
HETATM 3938 O  O   . HOH I 5 .   ? -15.146 14.737  14.857  1.00 38.62 ? 320 HOH A O   1 
HETATM 3939 O  O   . HOH I 5 .   ? 5.404   11.627  8.094   1.00 41.88 ? 321 HOH A O   1 
HETATM 3940 O  O   . HOH I 5 .   ? -12.163 19.474  38.148  1.00 40.71 ? 322 HOH A O   1 
HETATM 3941 O  O   . HOH I 5 .   ? -7.918  38.504  16.896  1.00 40.86 ? 323 HOH A O   1 
HETATM 3942 O  O   . HOH I 5 .   ? 12.019  26.246  34.952  1.00 26.77 ? 324 HOH A O   1 
HETATM 3943 O  O   . HOH I 5 .   ? 16.547  30.425  38.435  1.00 39.82 ? 325 HOH A O   1 
HETATM 3944 O  O   . HOH I 5 .   ? -4.126  18.470  8.037   1.00 51.10 ? 326 HOH A O   1 
HETATM 3945 O  O   . HOH I 5 .   ? 14.179  31.827  37.018  1.00 38.14 ? 327 HOH A O   1 
HETATM 3946 O  O   . HOH I 5 .   ? -4.018  27.277  18.179  1.00 34.90 ? 328 HOH A O   1 
HETATM 3947 O  O   . HOH I 5 .   ? -8.332  38.502  26.395  1.00 53.06 ? 329 HOH A O   1 
HETATM 3948 O  O   . HOH I 5 .   ? -16.835 5.501   27.533  1.00 47.41 ? 330 HOH A O   1 
HETATM 3949 O  O   . HOH I 5 .   ? -15.960 19.404  30.183  1.00 43.34 ? 331 HOH A O   1 
HETATM 3950 O  O   . HOH I 5 .   ? -0.053  12.637  35.422  1.00 29.83 ? 332 HOH A O   1 
HETATM 3951 O  O   . HOH I 5 .   ? 6.616   4.386   21.626  1.00 39.44 ? 333 HOH A O   1 
HETATM 3952 O  O   . HOH I 5 .   ? 3.681   43.390  30.376  1.00 36.60 ? 334 HOH A O   1 
HETATM 3953 O  O   . HOH I 5 .   ? 5.617   5.902   24.052  1.00 37.32 ? 335 HOH A O   1 
HETATM 3954 O  O   . HOH I 5 .   ? 19.011  21.001  31.381  1.00 44.64 ? 336 HOH A O   1 
HETATM 3955 O  O   . HOH I 5 .   ? -5.717  26.498  16.122  1.00 53.67 ? 337 HOH A O   1 
HETATM 3956 O  O   . HOH I 5 .   ? -15.203 11.867  37.768  1.00 46.44 ? 338 HOH A O   1 
HETATM 3957 O  O   . HOH I 5 .   ? 1.260   28.045  11.558  1.00 34.91 ? 339 HOH A O   1 
HETATM 3958 O  O   . HOH I 5 .   ? 17.632  21.896  44.909  1.00 52.68 ? 340 HOH A O   1 
HETATM 3959 O  O   . HOH I 5 .   ? 15.819  19.362  37.331  1.00 27.94 ? 341 HOH A O   1 
HETATM 3960 O  O   . HOH I 5 .   ? 15.853  16.258  30.128  1.00 43.09 ? 342 HOH A O   1 
HETATM 3961 O  O   . HOH I 5 .   ? -14.926 36.160  34.252  1.00 53.01 ? 343 HOH A O   1 
HETATM 3962 O  O   . HOH I 5 .   ? 18.098  23.849  42.007  1.00 52.25 ? 344 HOH A O   1 
HETATM 3963 O  O   . HOH I 5 .   ? 14.285  28.002  17.118  1.00 35.97 ? 345 HOH A O   1 
HETATM 3964 O  O   . HOH I 5 .   ? -11.812 36.808  24.217  1.00 37.92 ? 346 HOH A O   1 
HETATM 3965 O  O   . HOH I 5 .   ? -8.339  32.423  20.105  1.00 33.98 ? 347 HOH A O   1 
HETATM 3966 O  O   . HOH I 5 .   ? -6.034  30.393  38.826  1.00 38.52 ? 348 HOH A O   1 
HETATM 3967 O  O   . HOH I 5 .   ? 11.067  9.769   25.491  1.00 38.77 ? 349 HOH A O   1 
HETATM 3968 O  O   . HOH I 5 .   ? -11.588 -1.645  16.739  1.00 43.28 ? 350 HOH A O   1 
HETATM 3969 O  O   . HOH I 5 .   ? 2.857   46.007  34.629  1.00 38.56 ? 351 HOH A O   1 
HETATM 3970 O  O   . HOH I 5 .   ? 6.808   43.571  29.106  1.00 38.55 ? 352 HOH A O   1 
HETATM 3971 O  O   . HOH I 5 .   ? -5.501  41.293  36.182  1.00 46.32 ? 353 HOH A O   1 
HETATM 3972 O  O   . HOH I 5 .   ? 17.256  25.979  27.320  1.00 46.78 ? 354 HOH A O   1 
HETATM 3973 O  O   . HOH I 5 .   ? 11.361  23.446  46.711  1.00 46.43 ? 355 HOH A O   1 
HETATM 3974 O  O   . HOH I 5 .   ? 12.818  43.037  23.879  1.00 40.20 ? 356 HOH A O   1 
HETATM 3975 O  O   . HOH I 5 .   ? 17.173  10.638  5.759   1.00 51.85 ? 357 HOH A O   1 
HETATM 3976 O  O   . HOH I 5 .   ? -17.976 27.522  25.146  1.00 49.35 ? 358 HOH A O   1 
HETATM 3977 O  O   . HOH I 5 .   ? -21.279 27.560  25.520  1.00 55.29 ? 359 HOH A O   1 
HETATM 3978 O  O   . HOH I 5 .   ? 4.159   8.307   27.382  1.00 35.82 ? 360 HOH A O   1 
HETATM 3979 O  O   . HOH I 5 .   ? 16.785  20.117  40.760  1.00 39.14 ? 361 HOH A O   1 
HETATM 3980 O  O   . HOH I 5 .   ? -2.257  38.485  9.347   1.00 51.63 ? 362 HOH A O   1 
HETATM 3981 O  O   . HOH I 5 .   ? 21.144  31.742  31.664  1.00 40.05 ? 363 HOH A O   1 
HETATM 3982 O  O   . HOH I 5 .   ? 5.792   36.456  20.346  1.00 32.05 ? 364 HOH A O   1 
HETATM 3983 O  O   . HOH I 5 .   ? 18.602  8.909   10.296  1.00 42.38 ? 365 HOH A O   1 
HETATM 3984 O  O   . HOH I 5 .   ? 10.150  35.484  14.429  1.00 48.91 ? 366 HOH A O   1 
HETATM 3985 O  O   . HOH I 5 .   ? -14.236 8.610   15.188  1.00 45.95 ? 367 HOH A O   1 
HETATM 3986 O  O   . HOH I 5 .   ? -22.483 1.600   19.168  1.00 51.99 ? 368 HOH A O   1 
HETATM 3987 O  O   . HOH I 5 .   ? 15.549  10.911  27.096  1.00 44.17 ? 369 HOH A O   1 
HETATM 3988 O  O   . HOH I 5 .   ? 13.133  43.065  27.738  1.00 49.15 ? 370 HOH A O   1 
HETATM 3989 O  O   . HOH I 5 .   ? -13.204 14.042  38.480  1.00 46.64 ? 371 HOH A O   1 
HETATM 3990 O  O   . HOH I 5 .   ? -9.750  16.802  39.182  1.00 45.55 ? 372 HOH A O   1 
HETATM 3991 O  O   . HOH I 5 .   ? -16.551 17.973  20.232  1.00 43.48 ? 373 HOH A O   1 
HETATM 3992 O  O   . HOH I 5 .   ? -9.788  3.853   15.669  1.00 37.15 ? 374 HOH A O   1 
HETATM 3993 O  O   . HOH I 5 .   ? 11.130  7.188   24.491  1.00 47.06 ? 375 HOH A O   1 
HETATM 3994 O  O   . HOH I 5 .   ? 17.437  16.174  23.892  1.00 29.21 ? 376 HOH A O   1 
HETATM 3995 O  O   . HOH I 5 .   ? 17.490  9.153   20.632  1.00 49.59 ? 377 HOH A O   1 
HETATM 3996 O  O   . HOH I 5 .   ? 15.986  40.441  21.373  1.00 42.57 ? 378 HOH A O   1 
HETATM 3997 O  O   . HOH I 5 .   ? -6.882  28.841  19.432  1.00 42.33 ? 379 HOH A O   1 
HETATM 3998 O  O   . HOH I 5 .   ? -5.507  11.177  34.655  1.00 29.21 ? 380 HOH A O   1 
HETATM 3999 O  O   . HOH I 5 .   ? 20.122  11.727  19.261  1.00 42.15 ? 381 HOH A O   1 
HETATM 4000 O  O   . HOH I 5 .   ? 14.231  18.365  11.504  1.00 40.32 ? 382 HOH A O   1 
HETATM 4001 O  O   . HOH I 5 .   ? 19.372  10.409  13.420  1.00 46.49 ? 383 HOH A O   1 
HETATM 4002 O  O   . HOH I 5 .   ? 9.087   14.212  6.245   1.00 41.53 ? 384 HOH A O   1 
HETATM 4003 O  O   . HOH I 5 .   ? 13.128  33.765  23.147  1.00 25.60 ? 385 HOH A O   1 
HETATM 4004 O  O   . HOH I 5 .   ? 14.987  42.790  22.197  1.00 43.84 ? 386 HOH A O   1 
HETATM 4005 O  O   . HOH I 5 .   ? -5.405  33.950  12.842  1.00 40.12 ? 387 HOH A O   1 
HETATM 4006 O  O   . HOH I 5 .   ? -5.984  38.520  10.992  1.00 39.69 ? 388 HOH A O   1 
HETATM 4007 O  O   . HOH I 5 .   ? -12.161 32.462  29.687  1.00 32.65 ? 389 HOH A O   1 
HETATM 4008 O  O   . HOH I 5 .   ? -5.410  37.576  39.118  1.00 40.43 ? 390 HOH A O   1 
HETATM 4009 O  O   . HOH I 5 .   ? -6.844  31.216  36.032  1.00 32.65 ? 391 HOH A O   1 
HETATM 4010 O  O   . HOH I 5 .   ? -6.792  27.183  40.013  1.00 39.53 ? 392 HOH A O   1 
HETATM 4011 O  O   . HOH I 5 .   ? -2.663  28.776  41.829  1.00 32.86 ? 393 HOH A O   1 
HETATM 4012 O  O   . HOH I 5 .   ? 6.778   28.346  45.568  1.00 43.07 ? 394 HOH A O   1 
HETATM 4013 O  O   . HOH I 5 .   ? 18.421  19.710  34.860  1.00 38.09 ? 395 HOH A O   1 
HETATM 4014 O  O   . HOH I 5 .   ? -8.340  9.421   37.534  1.00 35.60 ? 396 HOH A O   1 
HETATM 4015 O  O   . HOH I 5 .   ? 16.476  16.367  47.107  1.00 36.14 ? 397 HOH A O   1 
HETATM 4016 O  O   . HOH I 5 .   ? -14.550 23.439  21.665  1.00 39.02 ? 398 HOH A O   1 
HETATM 4017 O  O   . HOH I 5 .   ? -14.326 12.440  27.973  1.00 32.45 ? 399 HOH A O   1 
HETATM 4018 O  O   . HOH I 5 .   ? -12.529 14.220  13.164  1.00 36.98 ? 400 HOH A O   1 
HETATM 4019 O  O   . HOH I 5 .   ? 4.752   31.618  47.051  1.00 43.29 ? 401 HOH A O   1 
HETATM 4020 O  O   . HOH I 5 .   ? 14.104  16.668  35.891  1.00 36.79 ? 402 HOH A O   1 
HETATM 4021 O  O   . HOH I 5 .   ? -7.688  15.834  8.603   1.00 42.39 ? 403 HOH A O   1 
HETATM 4022 O  O   . HOH I 5 .   ? 0.042   38.459  21.675  1.00 37.09 ? 404 HOH A O   1 
HETATM 4023 O  O   . HOH I 5 .   ? -7.206  25.097  17.797  1.00 41.84 ? 405 HOH A O   1 
HETATM 4024 O  O   . HOH I 5 .   ? -6.662  39.219  24.588  1.00 42.61 ? 406 HOH A O   1 
HETATM 4025 O  O   . HOH I 5 .   ? 11.401  25.551  44.782  1.00 41.92 ? 407 HOH A O   1 
HETATM 4026 O  O   . HOH I 5 .   ? 17.026  13.896  26.355  1.00 36.62 ? 408 HOH A O   1 
HETATM 4027 O  O   . HOH I 5 .   ? 9.008   45.570  28.608  1.00 46.06 ? 409 HOH A O   1 
HETATM 4028 O  O   . HOH I 5 .   ? 8.789   5.611   25.593  1.00 44.91 ? 410 HOH A O   1 
HETATM 4029 O  O   . HOH I 5 .   ? -0.507  2.877   22.181  1.00 35.68 ? 411 HOH A O   1 
HETATM 4030 O  O   . HOH I 5 .   ? 12.162  18.293  9.618   1.00 38.36 ? 412 HOH A O   1 
HETATM 4031 O  O   . HOH I 5 .   ? 1.676   23.696  9.335   1.00 33.80 ? 413 HOH A O   1 
HETATM 4032 O  O   . HOH I 5 .   ? -0.139  21.658  9.142   1.00 39.13 ? 414 HOH A O   1 
HETATM 4033 O  O   . HOH I 5 .   ? 9.851   26.463  11.712  1.00 38.90 ? 415 HOH A O   1 
HETATM 4034 O  O   . HOH I 5 .   ? 7.396   33.152  13.013  1.00 39.25 ? 416 HOH A O   1 
HETATM 4035 O  O   . HOH I 5 .   ? 4.470   4.529   31.069  1.00 39.50 ? 417 HOH A O   1 
HETATM 4036 O  O   . HOH I 5 .   ? 13.605  34.264  34.641  1.00 39.62 ? 418 HOH A O   1 
HETATM 4037 O  O   . HOH I 5 .   ? -1.657  39.990  23.465  1.00 38.78 ? 419 HOH A O   1 
HETATM 4038 O  O   . HOH I 5 .   ? -4.275  40.309  24.442  1.00 40.25 ? 420 HOH A O   1 
HETATM 4039 O  O   . HOH I 5 .   ? 18.881  21.786  47.120  1.00 39.78 ? 421 HOH A O   1 
HETATM 4040 O  O   . HOH I 5 .   ? 9.593   10.142  27.904  1.00 38.19 ? 422 HOH A O   1 
HETATM 4041 O  O   . HOH I 5 .   ? 0.076   27.377  46.357  1.00 32.13 ? 423 HOH A O   1 
HETATM 4042 O  O   . HOH J 5 .   ? 8.088   -16.606 -4.960  1.00 17.23 ? 285 HOH B O   1 
HETATM 4043 O  O   . HOH J 5 .   ? 6.536   -14.317 -6.067  1.00 18.41 ? 286 HOH B O   1 
HETATM 4044 O  O   . HOH J 5 .   ? 4.299   -14.012 -8.032  1.00 14.56 ? 287 HOH B O   1 
HETATM 4045 O  O   . HOH J 5 .   ? 0.905   -14.544 -8.017  1.00 16.22 ? 288 HOH B O   1 
HETATM 4046 O  O   . HOH J 5 .   ? -8.563  -22.573 -1.860  1.00 22.08 ? 289 HOH B O   1 
HETATM 4047 O  O   . HOH J 5 .   ? 21.099  -11.428 3.348   1.00 43.45 ? 290 HOH B O   1 
HETATM 4048 O  O   . HOH J 5 .   ? 16.283  -12.376 -8.662  1.00 40.20 ? 291 HOH B O   1 
HETATM 4049 O  O   . HOH J 5 .   ? 1.231   -27.402 11.646  1.00 36.95 ? 292 HOH B O   1 
HETATM 4050 O  O   . HOH J 5 .   ? -12.534 -14.654 7.653   1.00 42.48 ? 293 HOH B O   1 
HETATM 4051 O  O   . HOH J 5 .   ? -6.408  -22.327 -5.259  1.00 37.95 ? 294 HOH B O   1 
HETATM 4052 O  O   . HOH J 5 .   ? 9.684   -19.850 13.612  1.00 45.09 ? 295 HOH B O   1 
HETATM 4053 O  O   . HOH J 5 .   ? -3.793  -24.675 -1.370  1.00 26.37 ? 296 HOH B O   1 
HETATM 4054 O  O   . HOH J 5 .   ? -10.719 -8.352  -5.060  1.00 17.47 ? 297 HOH B O   1 
HETATM 4055 O  O   . HOH J 5 .   ? -10.253 -7.263  -1.733  1.00 22.16 ? 298 HOH B O   1 
HETATM 4056 O  O   . HOH J 5 .   ? -7.983  -17.161 3.318   1.00 17.21 ? 299 HOH B O   1 
HETATM 4057 O  O   . HOH J 5 .   ? 11.966  2.578   15.098  1.00 19.43 ? 300 HOH B O   1 
HETATM 4058 O  O   . HOH J 5 .   ? 14.030  7.505   3.429   1.00 33.03 ? 301 HOH B O   1 
HETATM 4059 O  O   . HOH J 5 .   ? -15.215 -19.929 1.099   1.00 24.50 ? 302 HOH B O   1 
HETATM 4060 O  O   . HOH J 5 .   ? -8.415  -19.828 10.119  1.00 20.60 ? 303 HOH B O   1 
HETATM 4061 O  O   . HOH J 5 .   ? 13.617  -12.058 -3.513  1.00 22.95 ? 304 HOH B O   1 
HETATM 4062 O  O   . HOH J 5 .   ? -8.473  0.754   14.328  1.00 20.35 ? 305 HOH B O   1 
HETATM 4063 O  O   . HOH J 5 .   ? -6.192  6.162   10.529  1.00 22.00 ? 306 HOH B O   1 
HETATM 4064 O  O   . HOH J 5 .   ? 20.499  -5.147  9.849   1.00 32.32 ? 307 HOH B O   1 
HETATM 4065 O  O   . HOH J 5 .   ? -10.144 -23.727 0.310   1.00 19.89 ? 308 HOH B O   1 
HETATM 4066 O  O   . HOH J 5 .   ? 12.363  -18.673 -5.070  1.00 29.67 ? 309 HOH B O   1 
HETATM 4067 O  O   . HOH J 5 .   ? 4.788   3.642   7.541   1.00 16.51 ? 310 HOH B O   1 
HETATM 4068 O  O   . HOH J 5 .   ? 20.630  1.023   2.365   1.00 41.38 ? 311 HOH B O   1 
HETATM 4069 O  O   . HOH J 5 .   ? -13.535 -9.706  -13.665 1.00 39.37 ? 312 HOH B O   1 
HETATM 4070 O  O   . HOH J 5 .   ? 10.192  -17.594 -6.251  1.00 22.63 ? 313 HOH B O   1 
HETATM 4071 O  O   . HOH J 5 .   ? 13.602  10.718  15.836  1.00 31.87 ? 314 HOH B O   1 
HETATM 4072 O  O   . HOH J 5 .   ? -10.006 -26.629 9.604   1.00 45.03 ? 315 HOH B O   1 
HETATM 4073 O  O   . HOH J 5 .   ? -1.392  -21.399 -10.166 1.00 28.21 ? 316 HOH B O   1 
HETATM 4074 O  O   . HOH J 5 .   ? 1.018   -16.496 13.796  1.00 26.27 ? 317 HOH B O   1 
HETATM 4075 O  O   . HOH J 5 .   ? -9.630  -9.375  -7.430  1.00 20.45 ? 318 HOH B O   1 
HETATM 4076 O  O   . HOH J 5 .   ? -11.671 3.708   1.878   1.00 37.50 ? 319 HOH B O   1 
HETATM 4077 O  O   . HOH J 5 .   ? -11.665 -6.318  10.439  1.00 24.93 ? 320 HOH B O   1 
HETATM 4078 O  O   . HOH J 5 .   ? 11.618  -16.070 16.504  1.00 51.74 ? 321 HOH B O   1 
HETATM 4079 O  O   . HOH J 5 .   ? 2.910   -5.860  16.676  1.00 26.91 ? 322 HOH B O   1 
HETATM 4080 O  O   . HOH J 5 .   ? 11.892  5.234   22.708  1.00 39.41 ? 323 HOH B O   1 
HETATM 4081 O  O   . HOH J 5 .   ? 10.409  12.227  13.062  1.00 24.80 ? 324 HOH B O   1 
HETATM 4082 O  O   . HOH J 5 .   ? 10.474  -11.419 -14.137 1.00 46.24 ? 325 HOH B O   1 
HETATM 4083 O  O   . HOH J 5 .   ? 7.030   -0.879  -5.000  1.00 33.12 ? 326 HOH B O   1 
HETATM 4084 O  O   . HOH J 5 .   ? 10.460  5.087   14.265  1.00 26.16 ? 327 HOH B O   1 
HETATM 4085 O  O   . HOH J 5 .   ? 8.508   1.350   -5.074  1.00 47.80 ? 328 HOH B O   1 
HETATM 4086 O  O   . HOH J 5 .   ? 11.324  -23.495 11.486  1.00 46.36 ? 329 HOH B O   1 
HETATM 4087 O  O   . HOH J 5 .   ? -4.492  -18.526 14.006  1.00 27.12 ? 330 HOH B O   1 
HETATM 4088 O  O   . HOH J 5 .   ? -11.745 -13.980 11.096  1.00 51.65 ? 331 HOH B O   1 
HETATM 4089 O  O   . HOH J 5 .   ? 27.298  -3.142  13.019  1.00 52.46 ? 332 HOH B O   1 
HETATM 4090 O  O   . HOH J 5 .   ? 12.787  -19.906 -7.916  1.00 40.75 ? 333 HOH B O   1 
HETATM 4091 O  O   . HOH J 5 .   ? 14.405  -8.172  -14.084 1.00 38.29 ? 334 HOH B O   1 
HETATM 4092 O  O   . HOH J 5 .   ? 16.496  5.197   -0.834  1.00 49.49 ? 335 HOH B O   1 
HETATM 4093 O  O   . HOH J 5 .   ? 19.806  -15.694 -0.916  1.00 39.39 ? 336 HOH B O   1 
HETATM 4094 O  O   . HOH J 5 .   ? 13.125  -12.365 14.419  1.00 26.44 ? 337 HOH B O   1 
HETATM 4095 O  O   . HOH J 5 .   ? -8.951  -20.194 -5.512  1.00 26.59 ? 338 HOH B O   1 
HETATM 4096 O  O   . HOH J 5 .   ? -5.626  -18.543 2.503   1.00 25.06 ? 339 HOH B O   1 
HETATM 4097 O  O   . HOH J 5 .   ? -4.663  8.124   0.671   1.00 39.09 ? 340 HOH B O   1 
HETATM 4098 O  O   . HOH J 5 .   ? 12.388  10.075  4.346   1.00 38.10 ? 341 HOH B O   1 
HETATM 4099 O  O   . HOH J 5 .   ? -2.786  5.314   -6.551  1.00 42.43 ? 342 HOH B O   1 
HETATM 4100 O  O   . HOH J 5 .   ? -12.207 -21.866 -11.802 1.00 25.72 ? 343 HOH B O   1 
HETATM 4101 O  O   . HOH J 5 .   ? 22.228  -8.489  21.945  1.00 52.28 ? 344 HOH B O   1 
HETATM 4102 O  O   . HOH J 5 .   ? 7.803   -14.070 13.817  1.00 27.77 ? 345 HOH B O   1 
HETATM 4103 O  O   . HOH J 5 .   ? -3.881  -3.940  18.420  1.00 32.72 ? 346 HOH B O   1 
HETATM 4104 O  O   . HOH J 5 .   ? -6.261  -17.631 12.097  1.00 23.83 ? 347 HOH B O   1 
HETATM 4105 O  O   . HOH J 5 .   ? -0.073  -23.885 16.000  1.00 35.68 ? 348 HOH B O   1 
HETATM 4106 O  O   . HOH J 5 .   ? 10.015  -2.003  -6.802  1.00 37.50 ? 349 HOH B O   1 
HETATM 4107 O  O   . HOH J 5 .   ? -11.807 -6.475  -14.562 1.00 45.43 ? 350 HOH B O   1 
HETATM 4108 O  O   . HOH J 5 .   ? 18.434  -10.632 -2.574  1.00 39.60 ? 351 HOH B O   1 
HETATM 4109 O  O   . HOH J 5 .   ? 15.512  4.615   22.204  1.00 44.24 ? 352 HOH B O   1 
HETATM 4110 O  O   . HOH J 5 .   ? -16.087 -5.922  -0.390  1.00 50.71 ? 353 HOH B O   1 
HETATM 4111 O  O   . HOH J 5 .   ? -8.370  -7.951  16.008  1.00 39.73 ? 354 HOH B O   1 
HETATM 4112 O  O   . HOH J 5 .   ? 19.047  6.804   4.322   1.00 32.43 ? 355 HOH B O   1 
HETATM 4113 O  O   . HOH J 5 .   ? -12.162 -23.038 3.846   1.00 30.37 ? 356 HOH B O   1 
HETATM 4114 O  O   . HOH J 5 .   ? -5.900  -25.775 0.560   1.00 45.53 ? 357 HOH B O   1 
HETATM 4115 O  O   . HOH J 5 .   ? 18.486  -2.287  -1.958  1.00 37.24 ? 358 HOH B O   1 
HETATM 4116 O  O   . HOH J 5 .   ? -3.264  -6.714  -11.854 1.00 36.13 ? 359 HOH B O   1 
HETATM 4117 O  O   . HOH J 5 .   ? 0.246   -0.881  -14.569 1.00 48.66 ? 360 HOH B O   1 
HETATM 4118 O  O   . HOH J 5 .   ? -25.844 -10.498 -8.581  1.00 50.03 ? 361 HOH B O   1 
HETATM 4119 O  O   . HOH J 5 .   ? 0.751   4.457   -6.426  1.00 31.00 ? 362 HOH B O   1 
HETATM 4120 O  O   . HOH J 5 .   ? 16.675  -13.933 16.305  1.00 42.77 ? 363 HOH B O   1 
HETATM 4121 O  O   . HOH J 5 .   ? -10.349 -12.544 -16.219 1.00 35.86 ? 364 HOH B O   1 
HETATM 4122 O  O   . HOH J 5 .   ? -3.473  -28.345 14.497  1.00 45.55 ? 365 HOH B O   1 
HETATM 4123 O  O   . HOH J 5 .   ? -16.944 1.931   9.590   1.00 41.16 ? 366 HOH B O   1 
HETATM 4124 O  O   . HOH J 5 .   ? 7.424   -11.356 19.040  1.00 51.95 ? 367 HOH B O   1 
HETATM 4125 O  O   . HOH J 5 .   ? 1.611   10.987  9.431   1.00 33.94 ? 368 HOH B O   1 
HETATM 4126 O  O   . HOH J 5 .   ? -11.173 -2.335  -3.051  1.00 32.33 ? 369 HOH B O   1 
HETATM 4127 O  O   . HOH J 5 .   ? 0.083   -27.779 5.522   1.00 49.16 ? 370 HOH B O   1 
HETATM 4128 O  O   . HOH J 5 .   ? -1.977  11.610  8.997   1.00 37.91 ? 371 HOH B O   1 
HETATM 4129 O  O   . HOH J 5 .   ? 8.589   -24.528 8.123   1.00 43.57 ? 372 HOH B O   1 
HETATM 4130 O  O   . HOH J 5 .   ? 10.727  1.813   23.776  1.00 46.07 ? 373 HOH B O   1 
HETATM 4131 O  O   . HOH J 5 .   ? -6.263  7.714   5.824   1.00 28.49 ? 374 HOH B O   1 
HETATM 4132 O  O   . HOH J 5 .   ? -12.232 5.470   4.252   1.00 52.83 ? 375 HOH B O   1 
HETATM 4133 O  O   . HOH J 5 .   ? 10.126  13.158  3.947   1.00 47.00 ? 376 HOH B O   1 
HETATM 4134 O  O   . HOH J 5 .   ? -8.616  -1.592  -11.559 1.00 43.38 ? 377 HOH B O   1 
HETATM 4135 O  O   . HOH J 5 .   ? -0.277  -3.618  -14.270 1.00 44.34 ? 378 HOH B O   1 
HETATM 4136 O  O   . HOH J 5 .   ? 25.359  1.108   10.863  1.00 50.85 ? 379 HOH B O   1 
HETATM 4137 O  O   . HOH J 5 .   ? -10.170 -25.106 3.494   1.00 43.16 ? 380 HOH B O   1 
HETATM 4138 O  O   . HOH J 5 .   ? 11.979  -0.973  -5.169  1.00 48.28 ? 381 HOH B O   1 
HETATM 4139 O  O   . HOH J 5 .   ? -11.831 -11.905 1.434   1.00 37.79 ? 382 HOH B O   1 
HETATM 4140 O  O   . HOH J 5 .   ? -0.622  -18.136 -16.454 1.00 46.17 ? 383 HOH B O   1 
HETATM 4141 O  O   . HOH J 5 .   ? -9.729  4.537   -0.083  1.00 44.08 ? 384 HOH B O   1 
HETATM 4142 O  O   . HOH J 5 .   ? 9.648   -3.476  18.829  1.00 44.80 ? 385 HOH B O   1 
HETATM 4143 O  O   . HOH J 5 .   ? -13.660 12.809  11.175  1.00 47.19 ? 386 HOH B O   1 
HETATM 4144 O  O   . HOH J 5 .   ? -5.290  -26.726 3.582   1.00 43.53 ? 387 HOH B O   1 
HETATM 4145 O  O   . HOH J 5 .   ? -10.575 -8.201  12.973  1.00 40.17 ? 388 HOH B O   1 
HETATM 4146 O  O   . HOH J 5 .   ? -0.013  -8.345  -15.188 1.00 43.79 ? 389 HOH B O   1 
HETATM 4147 O  O   . HOH J 5 .   ? 0.178   1.191   20.106  1.00 38.36 ? 390 HOH B O   1 
HETATM 4148 O  O   . HOH J 5 .   ? 14.987  8.163   15.800  1.00 38.58 ? 391 HOH B O   1 
HETATM 4149 O  O   . HOH J 5 .   ? -3.802  -17.026 -16.430 1.00 42.78 ? 392 HOH B O   1 
HETATM 4150 O  O   . HOH J 5 .   ? 21.556  -5.566  12.447  1.00 36.82 ? 393 HOH B O   1 
HETATM 4151 O  O   . HOH J 5 .   ? -15.702 -18.489 -2.474  1.00 28.38 ? 394 HOH B O   1 
HETATM 4152 O  O   . HOH J 5 .   ? -8.983  -24.777 -5.746  1.00 20.10 ? 395 HOH B O   1 
HETATM 4153 O  O   . HOH J 5 .   ? -10.117 -22.597 -4.306  1.00 25.80 ? 396 HOH B O   1 
HETATM 4154 O  O   . HOH J 5 .   ? -5.104  -20.314 -6.200  1.00 33.09 ? 397 HOH B O   1 
HETATM 4155 O  O   . HOH J 5 .   ? 4.569   6.762   -0.746  1.00 32.88 ? 398 HOH B O   1 
HETATM 4156 O  O   . HOH J 5 .   ? 10.981  -3.481  -10.120 1.00 38.19 ? 399 HOH B O   1 
HETATM 4157 O  O   . HOH J 5 .   ? 9.203   -24.288 -0.960  1.00 40.53 ? 400 HOH B O   1 
HETATM 4158 O  O   . HOH J 5 .   ? 8.184   -26.051 2.209   1.00 35.08 ? 401 HOH B O   1 
HETATM 4159 O  O   . HOH J 5 .   ? -11.309 -17.604 9.682   1.00 35.87 ? 402 HOH B O   1 
HETATM 4160 O  O   . HOH J 5 .   ? 21.284  -16.285 11.232  1.00 40.07 ? 403 HOH B O   1 
HETATM 4161 O  O   . HOH J 5 .   ? 15.437  -17.409 13.389  1.00 41.54 ? 404 HOH B O   1 
HETATM 4162 O  O   . HOH J 5 .   ? -3.675  -21.411 15.735  1.00 25.70 ? 405 HOH B O   1 
HETATM 4163 O  O   . HOH J 5 .   ? -1.434  -20.740 17.615  1.00 30.05 ? 406 HOH B O   1 
HETATM 4164 O  O   . HOH J 5 .   ? 22.004  -9.058  4.020   1.00 36.96 ? 407 HOH B O   1 
HETATM 4165 O  O   . HOH J 5 .   ? -9.009  -11.776 11.615  1.00 36.37 ? 408 HOH B O   1 
HETATM 4166 O  O   . HOH J 5 .   ? -6.618  -24.190 -2.667  1.00 40.61 ? 409 HOH B O   1 
HETATM 4167 O  O   . HOH J 5 .   ? -7.320  -26.688 -4.390  1.00 30.72 ? 410 HOH B O   1 
HETATM 4168 O  O   . HOH J 5 .   ? 10.075  -18.291 11.637  1.00 36.13 ? 411 HOH B O   1 
HETATM 4169 O  O   . HOH J 5 .   ? 14.535  7.250   0.667   1.00 37.69 ? 412 HOH B O   1 
HETATM 4170 O  O   . HOH J 5 .   ? -3.801  -21.409 -8.558  1.00 42.79 ? 413 HOH B O   1 
HETATM 4171 O  O   . HOH J 5 .   ? 1.871   -17.343 16.171  1.00 37.26 ? 414 HOH B O   1 
HETATM 4172 O  O   . HOH J 5 .   ? -13.246 -8.295  9.278   1.00 34.54 ? 415 HOH B O   1 
HETATM 4173 O  O   . HOH J 5 .   ? -6.251  -19.312 16.344  1.00 35.06 ? 416 HOH B O   1 
HETATM 4174 O  O   . HOH J 5 .   ? 8.039   -15.489 16.049  1.00 38.06 ? 417 HOH B O   1 
HETATM 4175 O  O   . HOH J 5 .   ? -9.459  -16.912 12.911  1.00 43.98 ? 418 HOH B O   1 
HETATM 4176 O  O   . HOH J 5 .   ? 19.147  -11.198 0.326   1.00 38.32 ? 419 HOH B O   1 
HETATM 4177 O  O   . HOH J 5 .   ? 10.268  0.156   -3.598  1.00 41.07 ? 420 HOH B O   1 
HETATM 4178 O  O   . HOH J 5 .   ? -2.227  -7.364  15.751  1.00 33.70 ? 421 HOH B O   1 
HETATM 4179 O  O   . HOH J 5 .   ? 2.586   -7.445  -14.263 1.00 36.60 ? 422 HOH B O   1 
HETATM 4180 O  O   . HOH J 5 .   ? 16.253  -14.348 -5.499  1.00 36.25 ? 423 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'MAN B 253 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   1   1   GLN GLN A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  TRP 59  59  59  TRP TRP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 ?   ?   ?   A . n 
A 1 242 GLN 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 LYS 244 244 ?   ?   ?   A . n 
A 1 245 GLY 245 245 ?   ?   ?   A . n 
A 1 246 GLU 246 246 ?   ?   ?   A . n 
A 1 247 ASN 247 247 ?   ?   ?   A . n 
A 1 248 LEU 248 248 ?   ?   ?   A . n 
A 1 249 ALA 249 249 ?   ?   ?   A . n 
A 1 250 LEU 250 250 ?   ?   ?   A . n 
A 1 251 GLU 251 251 ?   ?   ?   A . n 
A 1 252 MET 252 252 ?   ?   ?   A . n 
B 1 1   GLN 1   1   1   GLN GLN B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  PHE 20  20  20  PHE PHE B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  GLN 25  25  25  GLN GLN B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  ASN 28  28  28  ASN ASN B . n 
B 1 29  ASN 29  29  29  ASN ASN B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  ASN 41  41  41  ASN ASN B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PHE 52  52  52  PHE PHE B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  HIS 57  57  57  HIS HIS B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  TRP 59  59  59  TRP TRP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  PHE 73  73  73  PHE PHE B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 THR 115 115 115 THR THR B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 GLN 117 117 117 GLN GLN B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 THR 119 119 119 THR THR B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 ASN 138 138 138 ASN ASN B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 ASN 143 143 143 ASN ASN B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 HIS 146 146 146 HIS HIS B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 SER 153 153 153 SER SER B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 THR 159 159 159 THR THR B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 TRP 162 162 162 TRP TRP B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 ARG 164 164 164 ARG ARG B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 GLN 168 168 168 GLN GLN B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ASN 171 171 171 ASN ASN B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 PHE 176 176 176 PHE PHE B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 ASN 182 182 182 ASN ASN B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 THR 188 188 188 THR THR B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 ASP 191 191 191 ASP ASP B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 TYR 199 199 199 TYR TYR B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 ASP 202 202 202 ASP ASP B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 PRO 208 208 208 PRO PRO B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 TRP 210 210 210 TRP TRP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 PHE 215 215 215 PHE PHE B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 ALA 218 218 218 ALA ALA B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 GLN 222 222 222 GLN GLN B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 THR 225 225 225 THR THR B . n 
B 1 226 HIS 226 226 226 HIS HIS B . n 
B 1 227 THR 227 227 227 THR THR B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 GLU 229 229 229 GLU GLU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 TRP 231 231 231 TRP TRP B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 PHE 233 233 233 PHE PHE B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 LEU 238 238 238 LEU LEU B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 ALA 241 241 ?   ?   ?   B . n 
B 1 242 GLN 242 242 ?   ?   ?   B . n 
B 1 243 LYS 243 243 ?   ?   ?   B . n 
B 1 244 LYS 244 244 ?   ?   ?   B . n 
B 1 245 GLY 245 245 ?   ?   ?   B . n 
B 1 246 GLU 246 246 ?   ?   ?   B . n 
B 1 247 ASN 247 247 ?   ?   ?   B . n 
B 1 248 LEU 248 248 ?   ?   ?   B . n 
B 1 249 ALA 249 249 ?   ?   ?   B . n 
B 1 250 LEU 250 250 ?   ?   ?   B . n 
B 1 251 GLU 251 251 ?   ?   ?   B . n 
B 1 252 MET 252 252 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MAN 1   253 251 MAN MAN A . 
D 3 MN  1   281 261 MN  MN  A . 
E 4 CA  1   283 262 CA  CA  A . 
F 2 MAN 1   253 251 MAN MAN B . 
G 3 MN  1   282 261 MN  MN  B . 
H 4 CA  1   284 262 CA  CA  B . 
I 5 HOH 1   284 1   HOH HOH A . 
I 5 HOH 2   285 2   HOH HOH A . 
I 5 HOH 3   286 3   HOH HOH A . 
I 5 HOH 4   287 4   HOH HOH A . 
I 5 HOH 5   288 11  HOH HOH A . 
I 5 HOH 6   289 12  HOH HOH A . 
I 5 HOH 7   290 13  HOH HOH A . 
I 5 HOH 8   291 15  HOH HOH A . 
I 5 HOH 9   292 16  HOH HOH A . 
I 5 HOH 10  293 19  HOH HOH A . 
I 5 HOH 11  294 20  HOH HOH A . 
I 5 HOH 12  295 21  HOH HOH A . 
I 5 HOH 13  296 22  HOH HOH A . 
I 5 HOH 14  297 23  HOH HOH A . 
I 5 HOH 15  298 24  HOH HOH A . 
I 5 HOH 16  299 31  HOH HOH A . 
I 5 HOH 17  300 32  HOH HOH A . 
I 5 HOH 18  301 33  HOH HOH A . 
I 5 HOH 19  302 41  HOH HOH A . 
I 5 HOH 20  303 44  HOH HOH A . 
I 5 HOH 21  304 45  HOH HOH A . 
I 5 HOH 22  305 47  HOH HOH A . 
I 5 HOH 23  306 49  HOH HOH A . 
I 5 HOH 24  307 51  HOH HOH A . 
I 5 HOH 25  308 52  HOH HOH A . 
I 5 HOH 26  309 55  HOH HOH A . 
I 5 HOH 27  310 56  HOH HOH A . 
I 5 HOH 28  311 58  HOH HOH A . 
I 5 HOH 29  312 65  HOH HOH A . 
I 5 HOH 30  313 66  HOH HOH A . 
I 5 HOH 31  314 67  HOH HOH A . 
I 5 HOH 32  315 72  HOH HOH A . 
I 5 HOH 33  316 76  HOH HOH A . 
I 5 HOH 34  317 80  HOH HOH A . 
I 5 HOH 35  318 81  HOH HOH A . 
I 5 HOH 36  319 82  HOH HOH A . 
I 5 HOH 37  320 84  HOH HOH A . 
I 5 HOH 38  321 85  HOH HOH A . 
I 5 HOH 39  322 87  HOH HOH A . 
I 5 HOH 40  323 89  HOH HOH A . 
I 5 HOH 41  324 90  HOH HOH A . 
I 5 HOH 42  325 93  HOH HOH A . 
I 5 HOH 43  326 95  HOH HOH A . 
I 5 HOH 44  327 97  HOH HOH A . 
I 5 HOH 45  328 100 HOH HOH A . 
I 5 HOH 46  329 101 HOH HOH A . 
I 5 HOH 47  330 102 HOH HOH A . 
I 5 HOH 48  331 104 HOH HOH A . 
I 5 HOH 49  332 108 HOH HOH A . 
I 5 HOH 50  333 110 HOH HOH A . 
I 5 HOH 51  334 115 HOH HOH A . 
I 5 HOH 52  335 116 HOH HOH A . 
I 5 HOH 53  336 122 HOH HOH A . 
I 5 HOH 54  337 123 HOH HOH A . 
I 5 HOH 55  338 124 HOH HOH A . 
I 5 HOH 56  339 125 HOH HOH A . 
I 5 HOH 57  340 127 HOH HOH A . 
I 5 HOH 58  341 128 HOH HOH A . 
I 5 HOH 59  342 134 HOH HOH A . 
I 5 HOH 60  343 139 HOH HOH A . 
I 5 HOH 61  344 142 HOH HOH A . 
I 5 HOH 62  345 145 HOH HOH A . 
I 5 HOH 63  346 147 HOH HOH A . 
I 5 HOH 64  347 153 HOH HOH A . 
I 5 HOH 65  348 156 HOH HOH A . 
I 5 HOH 66  349 159 HOH HOH A . 
I 5 HOH 67  350 160 HOH HOH A . 
I 5 HOH 68  351 162 HOH HOH A . 
I 5 HOH 69  352 163 HOH HOH A . 
I 5 HOH 70  353 165 HOH HOH A . 
I 5 HOH 71  354 166 HOH HOH A . 
I 5 HOH 72  355 167 HOH HOH A . 
I 5 HOH 73  356 168 HOH HOH A . 
I 5 HOH 74  357 169 HOH HOH A . 
I 5 HOH 75  358 170 HOH HOH A . 
I 5 HOH 76  359 172 HOH HOH A . 
I 5 HOH 77  360 173 HOH HOH A . 
I 5 HOH 78  361 175 HOH HOH A . 
I 5 HOH 79  362 176 HOH HOH A . 
I 5 HOH 80  363 177 HOH HOH A . 
I 5 HOH 81  364 178 HOH HOH A . 
I 5 HOH 82  365 180 HOH HOH A . 
I 5 HOH 83  366 181 HOH HOH A . 
I 5 HOH 84  367 182 HOH HOH A . 
I 5 HOH 85  368 184 HOH HOH A . 
I 5 HOH 86  369 185 HOH HOH A . 
I 5 HOH 87  370 186 HOH HOH A . 
I 5 HOH 88  371 187 HOH HOH A . 
I 5 HOH 89  372 188 HOH HOH A . 
I 5 HOH 90  373 194 HOH HOH A . 
I 5 HOH 91  374 195 HOH HOH A . 
I 5 HOH 92  375 196 HOH HOH A . 
I 5 HOH 93  376 197 HOH HOH A . 
I 5 HOH 94  377 198 HOH HOH A . 
I 5 HOH 95  378 199 HOH HOH A . 
I 5 HOH 96  379 200 HOH HOH A . 
I 5 HOH 97  380 201 HOH HOH A . 
I 5 HOH 98  381 204 HOH HOH A . 
I 5 HOH 99  382 205 HOH HOH A . 
I 5 HOH 100 383 206 HOH HOH A . 
I 5 HOH 101 384 207 HOH HOH A . 
I 5 HOH 102 385 208 HOH HOH A . 
I 5 HOH 103 386 209 HOH HOH A . 
I 5 HOH 104 387 210 HOH HOH A . 
I 5 HOH 105 388 211 HOH HOH A . 
I 5 HOH 106 389 212 HOH HOH A . 
I 5 HOH 107 390 213 HOH HOH A . 
I 5 HOH 108 391 214 HOH HOH A . 
I 5 HOH 109 392 215 HOH HOH A . 
I 5 HOH 110 393 216 HOH HOH A . 
I 5 HOH 111 394 217 HOH HOH A . 
I 5 HOH 112 395 218 HOH HOH A . 
I 5 HOH 113 396 219 HOH HOH A . 
I 5 HOH 114 397 220 HOH HOH A . 
I 5 HOH 115 398 221 HOH HOH A . 
I 5 HOH 116 399 224 HOH HOH A . 
I 5 HOH 117 400 241 HOH HOH A . 
I 5 HOH 118 401 246 HOH HOH A . 
I 5 HOH 119 402 250 HOH HOH A . 
I 5 HOH 120 403 252 HOH HOH A . 
I 5 HOH 121 404 253 HOH HOH A . 
I 5 HOH 122 405 254 HOH HOH A . 
I 5 HOH 123 406 255 HOH HOH A . 
I 5 HOH 124 407 259 HOH HOH A . 
I 5 HOH 125 408 261 HOH HOH A . 
I 5 HOH 126 409 262 HOH HOH A . 
I 5 HOH 127 410 263 HOH HOH A . 
I 5 HOH 128 411 264 HOH HOH A . 
I 5 HOH 129 412 265 HOH HOH A . 
I 5 HOH 130 413 266 HOH HOH A . 
I 5 HOH 131 414 267 HOH HOH A . 
I 5 HOH 132 415 268 HOH HOH A . 
I 5 HOH 133 416 269 HOH HOH A . 
I 5 HOH 134 417 270 HOH HOH A . 
I 5 HOH 135 418 271 HOH HOH A . 
I 5 HOH 136 419 272 HOH HOH A . 
I 5 HOH 137 420 273 HOH HOH A . 
I 5 HOH 138 421 275 HOH HOH A . 
I 5 HOH 139 422 276 HOH HOH A . 
I 5 HOH 140 423 278 HOH HOH A . 
J 5 HOH 1   285 5   HOH HOH B . 
J 5 HOH 2   286 6   HOH HOH B . 
J 5 HOH 3   287 7   HOH HOH B . 
J 5 HOH 4   288 8   HOH HOH B . 
J 5 HOH 5   289 9   HOH HOH B . 
J 5 HOH 6   290 10  HOH HOH B . 
J 5 HOH 7   291 14  HOH HOH B . 
J 5 HOH 8   292 17  HOH HOH B . 
J 5 HOH 9   293 18  HOH HOH B . 
J 5 HOH 10  294 25  HOH HOH B . 
J 5 HOH 11  295 26  HOH HOH B . 
J 5 HOH 12  296 27  HOH HOH B . 
J 5 HOH 13  297 28  HOH HOH B . 
J 5 HOH 14  298 29  HOH HOH B . 
J 5 HOH 15  299 30  HOH HOH B . 
J 5 HOH 16  300 34  HOH HOH B . 
J 5 HOH 17  301 35  HOH HOH B . 
J 5 HOH 18  302 36  HOH HOH B . 
J 5 HOH 19  303 37  HOH HOH B . 
J 5 HOH 20  304 38  HOH HOH B . 
J 5 HOH 21  305 39  HOH HOH B . 
J 5 HOH 22  306 40  HOH HOH B . 
J 5 HOH 23  307 42  HOH HOH B . 
J 5 HOH 24  308 43  HOH HOH B . 
J 5 HOH 25  309 46  HOH HOH B . 
J 5 HOH 26  310 48  HOH HOH B . 
J 5 HOH 27  311 50  HOH HOH B . 
J 5 HOH 28  312 53  HOH HOH B . 
J 5 HOH 29  313 54  HOH HOH B . 
J 5 HOH 30  314 57  HOH HOH B . 
J 5 HOH 31  315 59  HOH HOH B . 
J 5 HOH 32  316 60  HOH HOH B . 
J 5 HOH 33  317 61  HOH HOH B . 
J 5 HOH 34  318 62  HOH HOH B . 
J 5 HOH 35  319 63  HOH HOH B . 
J 5 HOH 36  320 64  HOH HOH B . 
J 5 HOH 37  321 68  HOH HOH B . 
J 5 HOH 38  322 69  HOH HOH B . 
J 5 HOH 39  323 70  HOH HOH B . 
J 5 HOH 40  324 71  HOH HOH B . 
J 5 HOH 41  325 73  HOH HOH B . 
J 5 HOH 42  326 74  HOH HOH B . 
J 5 HOH 43  327 75  HOH HOH B . 
J 5 HOH 44  328 77  HOH HOH B . 
J 5 HOH 45  329 78  HOH HOH B . 
J 5 HOH 46  330 79  HOH HOH B . 
J 5 HOH 47  331 83  HOH HOH B . 
J 5 HOH 48  332 86  HOH HOH B . 
J 5 HOH 49  333 88  HOH HOH B . 
J 5 HOH 50  334 91  HOH HOH B . 
J 5 HOH 51  335 92  HOH HOH B . 
J 5 HOH 52  336 94  HOH HOH B . 
J 5 HOH 53  337 96  HOH HOH B . 
J 5 HOH 54  338 98  HOH HOH B . 
J 5 HOH 55  339 99  HOH HOH B . 
J 5 HOH 56  340 103 HOH HOH B . 
J 5 HOH 57  341 105 HOH HOH B . 
J 5 HOH 58  342 106 HOH HOH B . 
J 5 HOH 59  343 107 HOH HOH B . 
J 5 HOH 60  344 109 HOH HOH B . 
J 5 HOH 61  345 111 HOH HOH B . 
J 5 HOH 62  346 112 HOH HOH B . 
J 5 HOH 63  347 113 HOH HOH B . 
J 5 HOH 64  348 114 HOH HOH B . 
J 5 HOH 65  349 117 HOH HOH B . 
J 5 HOH 66  350 118 HOH HOH B . 
J 5 HOH 67  351 119 HOH HOH B . 
J 5 HOH 68  352 120 HOH HOH B . 
J 5 HOH 69  353 121 HOH HOH B . 
J 5 HOH 70  354 126 HOH HOH B . 
J 5 HOH 71  355 129 HOH HOH B . 
J 5 HOH 72  356 130 HOH HOH B . 
J 5 HOH 73  357 131 HOH HOH B . 
J 5 HOH 74  358 132 HOH HOH B . 
J 5 HOH 75  359 133 HOH HOH B . 
J 5 HOH 76  360 135 HOH HOH B . 
J 5 HOH 77  361 136 HOH HOH B . 
J 5 HOH 78  362 137 HOH HOH B . 
J 5 HOH 79  363 138 HOH HOH B . 
J 5 HOH 80  364 140 HOH HOH B . 
J 5 HOH 81  365 141 HOH HOH B . 
J 5 HOH 82  366 143 HOH HOH B . 
J 5 HOH 83  367 144 HOH HOH B . 
J 5 HOH 84  368 146 HOH HOH B . 
J 5 HOH 85  369 148 HOH HOH B . 
J 5 HOH 86  370 149 HOH HOH B . 
J 5 HOH 87  371 150 HOH HOH B . 
J 5 HOH 88  372 151 HOH HOH B . 
J 5 HOH 89  373 152 HOH HOH B . 
J 5 HOH 90  374 154 HOH HOH B . 
J 5 HOH 91  375 155 HOH HOH B . 
J 5 HOH 92  376 157 HOH HOH B . 
J 5 HOH 93  377 158 HOH HOH B . 
J 5 HOH 94  378 161 HOH HOH B . 
J 5 HOH 95  379 164 HOH HOH B . 
J 5 HOH 96  380 171 HOH HOH B . 
J 5 HOH 97  381 174 HOH HOH B . 
J 5 HOH 98  382 179 HOH HOH B . 
J 5 HOH 99  383 183 HOH HOH B . 
J 5 HOH 100 384 189 HOH HOH B . 
J 5 HOH 101 385 190 HOH HOH B . 
J 5 HOH 102 386 191 HOH HOH B . 
J 5 HOH 103 387 192 HOH HOH B . 
J 5 HOH 104 388 193 HOH HOH B . 
J 5 HOH 105 389 202 HOH HOH B . 
J 5 HOH 106 390 203 HOH HOH B . 
J 5 HOH 107 391 222 HOH HOH B . 
J 5 HOH 108 392 223 HOH HOH B . 
J 5 HOH 109 393 225 HOH HOH B . 
J 5 HOH 110 394 226 HOH HOH B . 
J 5 HOH 111 395 227 HOH HOH B . 
J 5 HOH 112 396 228 HOH HOH B . 
J 5 HOH 113 397 229 HOH HOH B . 
J 5 HOH 114 398 230 HOH HOH B . 
J 5 HOH 115 399 231 HOH HOH B . 
J 5 HOH 116 400 232 HOH HOH B . 
J 5 HOH 117 401 233 HOH HOH B . 
J 5 HOH 118 402 234 HOH HOH B . 
J 5 HOH 119 403 235 HOH HOH B . 
J 5 HOH 120 404 236 HOH HOH B . 
J 5 HOH 121 405 237 HOH HOH B . 
J 5 HOH 122 406 238 HOH HOH B . 
J 5 HOH 123 407 239 HOH HOH B . 
J 5 HOH 124 408 240 HOH HOH B . 
J 5 HOH 125 409 242 HOH HOH B . 
J 5 HOH 126 410 243 HOH HOH B . 
J 5 HOH 127 411 244 HOH HOH B . 
J 5 HOH 128 412 245 HOH HOH B . 
J 5 HOH 129 413 247 HOH HOH B . 
J 5 HOH 130 414 248 HOH HOH B . 
J 5 HOH 131 415 249 HOH HOH B . 
J 5 HOH 132 416 251 HOH HOH B . 
J 5 HOH 133 417 256 HOH HOH B . 
J 5 HOH 134 418 257 HOH HOH B . 
J 5 HOH 135 419 258 HOH HOH B . 
J 5 HOH 136 420 260 HOH HOH B . 
J 5 HOH 137 421 274 HOH HOH B . 
J 5 HOH 138 422 277 HOH HOH B . 
J 5 HOH 139 423 279 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 96.7  ? 
2  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 169.7 ? 
3  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 92.9  ? 
4  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 91.6  ? 
5  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 88.2  ? 
6  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 92.3  ? 
7  OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 286 ? 1_555 83.9  ? 
8  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 286 ? 1_555 92.8  ? 
9  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 286 ? 1_555 92.1  ? 
10 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 286 ? 1_555 175.5 ? 
11 OE1 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 287 ? 1_555 83.7  ? 
12 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 287 ? 1_555 178.7 ? 
13 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 287 ? 1_555 86.8  ? 
14 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 287 ? 1_555 90.6  ? 
15 O   ? I HOH .   ? A HOH 286 ? 1_555 MN ? D MN . ? A MN 281 ? 1_555 O   ? I HOH .   ? A HOH 287 ? 1_555 88.4  ? 
16 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 53.5  ? 
17 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 75.8  ? 
18 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 114.9 ? 
19 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 152.1 ? 
20 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 153.3 ? 
21 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 87.8  ? 
22 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 111.0 ? 
23 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 78.2  ? 
24 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 86.6  ? 
25 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 90.1  ? 
26 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 284 ? 1_555 110.8 ? 
27 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 284 ? 1_555 72.6  ? 
28 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 284 ? 1_555 172.4 ? 
29 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 284 ? 1_555 84.6  ? 
30 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 284 ? 1_555 94.2  ? 
31 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 72.6  ? 
32 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 111.0 ? 
33 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 84.7  ? 
34 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 83.7  ? 
35 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 169.4 ? 
36 O   ? I HOH .   ? A HOH 284 ? 1_555 CA ? E CA . ? A CA 283 ? 1_555 O   ? I HOH .   ? A HOH 285 ? 1_555 93.6  ? 
37 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 93.6  ? 
38 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 171.7 ? 
39 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 94.5  ? 
40 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 91.1  ? 
41 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 89.3  ? 
42 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 90.5  ? 
43 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 285 ? 1_555 88.8  ? 
44 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 285 ? 1_555 177.5 ? 
45 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 285 ? 1_555 83.0  ? 
46 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 285 ? 1_555 90.3  ? 
47 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 286 ? 1_555 83.2  ? 
48 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 286 ? 1_555 92.5  ? 
49 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 286 ? 1_555 95.0  ? 
50 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 286 ? 1_555 174.0 ? 
51 O   ? J HOH .   ? B HOH 285 ? 1_555 MN ? G MN . ? B MN 282 ? 1_555 O   ? J HOH .   ? B HOH 286 ? 1_555 88.1  ? 
52 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 53.0  ? 
53 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 80.3  ? 
54 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 118.0 ? 
55 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 152.1 ? 
56 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 153.4 ? 
57 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 84.4  ? 
58 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 113.4 ? 
59 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 78.9  ? 
60 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 87.1  ? 
61 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 88.9  ? 
62 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 287 ? 1_555 110.5 ? 
63 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 287 ? 1_555 72.4  ? 
64 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 287 ? 1_555 168.7 ? 
65 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 287 ? 1_555 84.4  ? 
66 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 287 ? 1_555 91.1  ? 
67 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 72.2  ? 
68 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 109.0 ? 
69 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 88.4  ? 
70 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 84.2  ? 
71 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 172.1 ? 
72 O   ? J HOH .   ? B HOH 287 ? 1_555 CA ? H CA . ? B CA 284 ? 1_555 O   ? J HOH .   ? B HOH 288 ? 1_555 92.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-01 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-02-22 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 5 'Structure model' Advisory                    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' chem_comp                 
2  5 'Structure model' database_PDB_caveat       
3  5 'Structure model' diffrn_source             
4  5 'Structure model' entity                    
5  5 'Structure model' pdbx_chem_comp_identifier 
6  5 'Structure model' pdbx_entity_nonpoly       
7  5 'Structure model' pdbx_struct_conn_angle    
8  5 'Structure model' struct_conn               
9  5 'Structure model' struct_site               
10 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_chem_comp.name'                             
2  5 'Structure model' '_chem_comp.type'                             
3  5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
4  5 'Structure model' '_entity.pdbx_description'                    
5  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
18 5 'Structure model' '_pdbx_struct_conn_angle.value'               
19 5 'Structure model' '_struct_conn.pdbx_dist_value'                
20 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
27 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
33 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO  'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
PHASER phasing          .         ? 3 
CNS    refinement       1.1       ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 108 ? ? 55.26   19.19 
2 1 ASN A 138 ? ? -112.08 62.63 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    MAN 
_pdbx_validate_chiral.auth_seq_id     253 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 1   ? NE2 ? A GLN 1   NE2 
2  1 Y 1 A LYS 27  ? NZ  ? A LYS 27  NZ  
3  1 Y 1 A LYS 35  ? NZ  ? A LYS 35  NZ  
4  1 Y 1 A LYS 78  ? CD  ? A LYS 78  CD  
5  1 Y 1 A LYS 78  ? CE  ? A LYS 78  CE  
6  1 Y 1 A LYS 78  ? NZ  ? A LYS 78  NZ  
7  1 Y 1 A ARG 155 ? NE  ? A ARG 155 NE  
8  1 Y 1 A ARG 155 ? CZ  ? A ARG 155 CZ  
9  1 Y 1 A ARG 155 ? NH1 ? A ARG 155 NH1 
10 1 Y 1 A ARG 155 ? NH2 ? A ARG 155 NH2 
11 1 Y 1 A LYS 158 ? CE  ? A LYS 158 CE  
12 1 Y 1 A LYS 158 ? NZ  ? A LYS 158 NZ  
13 1 Y 1 A ARG 181 ? CZ  ? A ARG 181 CZ  
14 1 Y 1 A ARG 181 ? NH1 ? A ARG 181 NH1 
15 1 Y 1 A ARG 181 ? NH2 ? A ARG 181 NH2 
16 1 Y 1 A TYR 239 ? CG  ? A TYR 239 CG  
17 1 Y 1 A TYR 239 ? CD1 ? A TYR 239 CD1 
18 1 Y 1 A TYR 239 ? CD2 ? A TYR 239 CD2 
19 1 Y 1 A TYR 239 ? CE1 ? A TYR 239 CE1 
20 1 Y 1 A TYR 239 ? CE2 ? A TYR 239 CE2 
21 1 Y 1 A TYR 239 ? CZ  ? A TYR 239 CZ  
22 1 Y 1 A TYR 239 ? OH  ? A TYR 239 OH  
23 1 Y 1 B GLN 1   ? NE2 ? B GLN 1   NE2 
24 1 Y 1 B LYS 27  ? CD  ? B LYS 27  CD  
25 1 Y 1 B LYS 27  ? CE  ? B LYS 27  CE  
26 1 Y 1 B LYS 27  ? NZ  ? B LYS 27  NZ  
27 1 Y 1 B LYS 35  ? NZ  ? B LYS 35  NZ  
28 1 Y 1 B ASN 39  ? CG  ? B ASN 39  CG  
29 1 Y 1 B ASN 39  ? OD1 ? B ASN 39  OD1 
30 1 Y 1 B ASN 39  ? ND2 ? B ASN 39  ND2 
31 1 Y 1 B LYS 61  ? CE  ? B LYS 61  CE  
32 1 Y 1 B LYS 61  ? NZ  ? B LYS 61  NZ  
33 1 Y 1 B LYS 78  ? CE  ? B LYS 78  CE  
34 1 Y 1 B LYS 78  ? NZ  ? B LYS 78  NZ  
35 1 Y 1 B LYS 161 ? CD  ? B LYS 161 CD  
36 1 Y 1 B LYS 161 ? CE  ? B LYS 161 CE  
37 1 Y 1 B LYS 161 ? NZ  ? B LYS 161 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 241 ? A ALA 241 
2  1 Y 1 A GLN 242 ? A GLN 242 
3  1 Y 1 A LYS 243 ? A LYS 243 
4  1 Y 1 A LYS 244 ? A LYS 244 
5  1 Y 1 A GLY 245 ? A GLY 245 
6  1 Y 1 A GLU 246 ? A GLU 246 
7  1 Y 1 A ASN 247 ? A ASN 247 
8  1 Y 1 A LEU 248 ? A LEU 248 
9  1 Y 1 A ALA 249 ? A ALA 249 
10 1 Y 1 A LEU 250 ? A LEU 250 
11 1 Y 1 A GLU 251 ? A GLU 251 
12 1 Y 1 A MET 252 ? A MET 252 
13 1 Y 1 B ALA 241 ? B ALA 241 
14 1 Y 1 B GLN 242 ? B GLN 242 
15 1 Y 1 B LYS 243 ? B LYS 243 
16 1 Y 1 B LYS 244 ? B LYS 244 
17 1 Y 1 B GLY 245 ? B GLY 245 
18 1 Y 1 B GLU 246 ? B GLU 246 
19 1 Y 1 B ASN 247 ? B ASN 247 
20 1 Y 1 B LEU 248 ? B LEU 248 
21 1 Y 1 B ALA 249 ? B ALA 249 
22 1 Y 1 B LEU 250 ? B LEU 250 
23 1 Y 1 B GLU 251 ? B GLU 251 
24 1 Y 1 B MET 252 ? B MET 252 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa            
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose 
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp          
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man               
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 alpha-D-mannopyranose MAN 
3 'MANGANESE (II) ION'  MN  
4 'CALCIUM ION'         CA  
5 water                 HOH 
#