data_2ASL
# 
_entry.id   2ASL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ASL         
NDB   PD0710       
RCSB  RCSB034264   
WWPDB D_1000034264 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ASD 'oxoG-modified insertion ternary complex'   unspecified 
PDB 2ASJ 'oxoG-modified preinsertion binary complex' unspecified 
PDB 2AU0 .                                           unspecified 
PDB 2ATL .                                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ASL 
_pdbx_database_status.recvd_initial_deposition_date   2005-08-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rechkoblit, O.'  1 
'Malinina, L.'    2 
'Cheng, Y.'       3 
'Kuryavyi, V.'    4 
'Broyde, S.'      5 
'Geacintov, N.E.' 6 
'Patel, D.J.'     7 
# 
_citation.id                        primary 
_citation.title                     'Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion' 
_citation.journal_abbrev            'Plos Biol.' 
_citation.journal_volume            4 
_citation.page_first                1 
_citation.page_last                 18 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1544-9173 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16379496 
_citation.pdbx_database_id_DOI      10.1371/journal.pbio.0040011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rechkoblit, O.'  1 
primary 'Malinina, L.'    2 
primary 'Cheng, Y.'       3 
primary 'Kuryavyi, V.'    4 
primary 'Broyde, S.'      5 
primary 'Geacintov, N.E.' 6 
primary 'Patel, D.J.'     7 
# 
_cell.entry_id           2ASL 
_cell.length_a           73.218 
_cell.length_b           101.024 
_cell.length_c           84.925 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.16 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ASL 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*TP*TP*GP*GP*AP*TP*GP*GP*TP*AP*GP*(DOC))-3'"               4375.851  2   ?       ? ? 
;Primer Strand (DIDEOXY-TERMINATED AT 3'-end)
;
2 polymer     syn "5'-D(*CP*T*AP*AP*CP*(8OG)P*CP*TP*AP*CP*CP*AP*TP*CP*CP*AP*AP*CP*C)-3'" 5694.703  2   ?       ? ? 
'oxoG-modified Template Strand'                
3 polymer     man 'DNA polymerase IV'                                                    40825.410 2   2.7.7.7 ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                          40.078    4   ?       ? ? ? 
5 water       nat water                                                                  18.015    181 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DG)(DT)(DT)(DG)(DG)(DA)(DT)(DG)(DG)(DT)(DA)(DG)(DOC)' GGTTGGATGGTAGC D,H ? 
2 polydeoxyribonucleotide no yes '(DC)(DT)(DA)(DA)(DC)(8OG)(DC)(DT)(DA)(DC)(DC)(DA)(DT)(DC)(DC)(DA)(DA)(DC)(DC)' 
CTAACGCTACCATCCAACC E,J ? 
3 'polypeptide(L)'        no no  
;GSHMGGGGGIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAV
YLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAK
IAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDE
YNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAY
SESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;GSHMGGGGGIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAV
YLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAK
IAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDE
YNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAY
SESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DT  n 
1 4   DT  n 
1 5   DG  n 
1 6   DG  n 
1 7   DA  n 
1 8   DT  n 
1 9   DG  n 
1 10  DG  n 
1 11  DT  n 
1 12  DA  n 
1 13  DG  n 
1 14  DOC n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DA  n 
2 5   DC  n 
2 6   8OG n 
2 7   DC  n 
2 8   DT  n 
2 9   DA  n 
2 10  DC  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DA  n 
2 17  DA  n 
2 18  DC  n 
2 19  DC  n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   GLY n 
3 6   GLY n 
3 7   GLY n 
3 8   GLY n 
3 9   GLY n 
3 10  ILE n 
3 11  VAL n 
3 12  LEU n 
3 13  PHE n 
3 14  VAL n 
3 15  ASP n 
3 16  PHE n 
3 17  ASP n 
3 18  TYR n 
3 19  PHE n 
3 20  TYR n 
3 21  ALA n 
3 22  GLN n 
3 23  VAL n 
3 24  GLU n 
3 25  GLU n 
3 26  VAL n 
3 27  LEU n 
3 28  ASN n 
3 29  PRO n 
3 30  SER n 
3 31  LEU n 
3 32  LYS n 
3 33  GLY n 
3 34  LYS n 
3 35  PRO n 
3 36  VAL n 
3 37  VAL n 
3 38  VAL n 
3 39  CYS n 
3 40  VAL n 
3 41  PHE n 
3 42  SER n 
3 43  GLY n 
3 44  ARG n 
3 45  PHE n 
3 46  GLU n 
3 47  ASP n 
3 48  SER n 
3 49  GLY n 
3 50  ALA n 
3 51  VAL n 
3 52  ALA n 
3 53  THR n 
3 54  ALA n 
3 55  ASN n 
3 56  TYR n 
3 57  GLU n 
3 58  ALA n 
3 59  ARG n 
3 60  LYS n 
3 61  PHE n 
3 62  GLY n 
3 63  VAL n 
3 64  LYS n 
3 65  ALA n 
3 66  GLY n 
3 67  ILE n 
3 68  PRO n 
3 69  ILE n 
3 70  VAL n 
3 71  GLU n 
3 72  ALA n 
3 73  LYS n 
3 74  LYS n 
3 75  ILE n 
3 76  LEU n 
3 77  PRO n 
3 78  ASN n 
3 79  ALA n 
3 80  VAL n 
3 81  TYR n 
3 82  LEU n 
3 83  PRO n 
3 84  MET n 
3 85  ARG n 
3 86  LYS n 
3 87  GLU n 
3 88  VAL n 
3 89  TYR n 
3 90  GLN n 
3 91  GLN n 
3 92  VAL n 
3 93  SER n 
3 94  SER n 
3 95  ARG n 
3 96  ILE n 
3 97  MET n 
3 98  ASN n 
3 99  LEU n 
3 100 LEU n 
3 101 ARG n 
3 102 GLU n 
3 103 TYR n 
3 104 SER n 
3 105 GLU n 
3 106 LYS n 
3 107 ILE n 
3 108 GLU n 
3 109 ILE n 
3 110 ALA n 
3 111 SER n 
3 112 ILE n 
3 113 ASP n 
3 114 GLU n 
3 115 ALA n 
3 116 TYR n 
3 117 LEU n 
3 118 ASP n 
3 119 ILE n 
3 120 SER n 
3 121 ASP n 
3 122 LYS n 
3 123 VAL n 
3 124 ARG n 
3 125 ASP n 
3 126 TYR n 
3 127 ARG n 
3 128 GLU n 
3 129 ALA n 
3 130 TYR n 
3 131 ASN n 
3 132 LEU n 
3 133 GLY n 
3 134 LEU n 
3 135 GLU n 
3 136 ILE n 
3 137 LYS n 
3 138 ASN n 
3 139 LYS n 
3 140 ILE n 
3 141 LEU n 
3 142 GLU n 
3 143 LYS n 
3 144 GLU n 
3 145 LYS n 
3 146 ILE n 
3 147 THR n 
3 148 VAL n 
3 149 THR n 
3 150 VAL n 
3 151 GLY n 
3 152 ILE n 
3 153 SER n 
3 154 LYS n 
3 155 ASN n 
3 156 LYS n 
3 157 VAL n 
3 158 PHE n 
3 159 ALA n 
3 160 LYS n 
3 161 ILE n 
3 162 ALA n 
3 163 ALA n 
3 164 ASP n 
3 165 MET n 
3 166 ALA n 
3 167 LYS n 
3 168 PRO n 
3 169 ASN n 
3 170 GLY n 
3 171 ILE n 
3 172 LYS n 
3 173 VAL n 
3 174 ILE n 
3 175 ASP n 
3 176 ASP n 
3 177 GLU n 
3 178 GLU n 
3 179 VAL n 
3 180 LYS n 
3 181 ARG n 
3 182 LEU n 
3 183 ILE n 
3 184 ARG n 
3 185 GLU n 
3 186 LEU n 
3 187 ASP n 
3 188 ILE n 
3 189 ALA n 
3 190 ASP n 
3 191 VAL n 
3 192 PRO n 
3 193 GLY n 
3 194 ILE n 
3 195 GLY n 
3 196 ASN n 
3 197 ILE n 
3 198 THR n 
3 199 ALA n 
3 200 GLU n 
3 201 LYS n 
3 202 LEU n 
3 203 LYS n 
3 204 LYS n 
3 205 LEU n 
3 206 GLY n 
3 207 ILE n 
3 208 ASN n 
3 209 LYS n 
3 210 LEU n 
3 211 VAL n 
3 212 ASP n 
3 213 THR n 
3 214 LEU n 
3 215 SER n 
3 216 ILE n 
3 217 GLU n 
3 218 PHE n 
3 219 ASP n 
3 220 LYS n 
3 221 LEU n 
3 222 LYS n 
3 223 GLY n 
3 224 MET n 
3 225 ILE n 
3 226 GLY n 
3 227 GLU n 
3 228 ALA n 
3 229 LYS n 
3 230 ALA n 
3 231 LYS n 
3 232 TYR n 
3 233 LEU n 
3 234 ILE n 
3 235 SER n 
3 236 LEU n 
3 237 ALA n 
3 238 ARG n 
3 239 ASP n 
3 240 GLU n 
3 241 TYR n 
3 242 ASN n 
3 243 GLU n 
3 244 PRO n 
3 245 ILE n 
3 246 ARG n 
3 247 THR n 
3 248 ARG n 
3 249 VAL n 
3 250 ARG n 
3 251 LYS n 
3 252 SER n 
3 253 ILE n 
3 254 GLY n 
3 255 ARG n 
3 256 ILE n 
3 257 VAL n 
3 258 THR n 
3 259 MET n 
3 260 LYS n 
3 261 ARG n 
3 262 ASN n 
3 263 SER n 
3 264 ARG n 
3 265 ASN n 
3 266 LEU n 
3 267 GLU n 
3 268 GLU n 
3 269 ILE n 
3 270 LYS n 
3 271 PRO n 
3 272 TYR n 
3 273 LEU n 
3 274 PHE n 
3 275 ARG n 
3 276 ALA n 
3 277 ILE n 
3 278 GLU n 
3 279 GLU n 
3 280 SER n 
3 281 TYR n 
3 282 TYR n 
3 283 LYS n 
3 284 LEU n 
3 285 ASP n 
3 286 LYS n 
3 287 ARG n 
3 288 ILE n 
3 289 PRO n 
3 290 LYS n 
3 291 ALA n 
3 292 ILE n 
3 293 HIS n 
3 294 VAL n 
3 295 VAL n 
3 296 ALA n 
3 297 VAL n 
3 298 THR n 
3 299 GLU n 
3 300 ASP n 
3 301 LEU n 
3 302 ASP n 
3 303 ILE n 
3 304 VAL n 
3 305 SER n 
3 306 ARG n 
3 307 GLY n 
3 308 ARG n 
3 309 THR n 
3 310 PHE n 
3 311 PRO n 
3 312 HIS n 
3 313 GLY n 
3 314 ILE n 
3 315 SER n 
3 316 LYS n 
3 317 GLU n 
3 318 THR n 
3 319 ALA n 
3 320 TYR n 
3 321 SER n 
3 322 GLU n 
3 323 SER n 
3 324 VAL n 
3 325 LYS n 
3 326 LEU n 
3 327 LEU n 
3 328 GLN n 
3 329 LYS n 
3 330 ILE n 
3 331 LEU n 
3 332 GLU n 
3 333 GLU n 
3 334 ASP n 
3 335 GLU n 
3 336 ARG n 
3 337 LYS n 
3 338 ILE n 
3 339 ARG n 
3 340 ARG n 
3 341 ILE n 
3 342 GLY n 
3 343 VAL n 
3 344 ARG n 
3 345 PHE n 
3 346 SER n 
3 347 LYS n 
3 348 PHE n 
3 349 ILE n 
3 350 GLU n 
3 351 ALA n 
3 352 ILE n 
3 353 GLY n 
3 354 LEU n 
3 355 ASP n 
3 356 LYS n 
3 357 PHE n 
3 358 PHE n 
3 359 ASP n 
3 360 THR n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Sulfolobus 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL (Stratagene)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 3 
;IVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVY
QQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPN
GIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRV
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQK
ILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
2 ? 
2 PDB 2ASL        2ASL   1 ? ? ? 
3 PDB 2ASL        2ASL   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ASL A 10 ? 360 ? Q97W02 2    ? 352  ? 2    352  
2 1 2ASL B 10 ? 360 ? Q97W02 2    ? 352  ? 1002 1352 
3 2 2ASL D 1  ? 14  ? 2ASL   801  ? 814  ? 801  814  
4 3 2ASL E 1  ? 19  ? 2ASL   901  ? 919  ? 901  919  
5 2 2ASL H 1  ? 14  ? 2ASL   1801 ? 1814 ? 1801 1814 
6 3 2ASL J 1  ? 19  ? 2ASL   1901 ? 1919 ? 1901 1919 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ASL GLY A 1 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -7   1  
1 2ASL SER A 2 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -6   2  
1 2ASL HIS A 3 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -5   3  
1 2ASL MET A 4 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -4   4  
1 2ASL GLY A 5 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -3   5  
1 2ASL GLY A 6 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -2   6  
1 2ASL GLY A 7 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -1   7  
1 2ASL GLY A 8 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' 0    8  
1 2ASL GLY A 9 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' 1    9  
2 2ASL GLY B 1 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -7   10 
2 2ASL SER B 2 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -6   11 
2 2ASL HIS B 3 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -5   12 
2 2ASL MET B 4 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -4   13 
2 2ASL GLY B 5 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -3   14 
2 2ASL GLY B 6 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -2   15 
2 2ASL GLY B 7 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' -1   16 
2 2ASL GLY B 8 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' 0    17 
2 2ASL GLY B 9 ? UNP Q97W02 ? ? 'CLONING ARTIFACT' 1001 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P' 363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P' 347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                                                       
'C9 H14 N3 O6 P'  291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2ASL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.2 
_exptl_crystal.density_percent_sol   61.1 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, HEPES-sodium, calcium acetate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'        ? ? ? 
1 2 1 HEPES-sodium      ? ? ? 
1 3 1 'calcium acetate' ? ? ? 
1 4 1 H2O               ? ? ? 
1 5 2 'PEG 4000'        ? ? ? 
1 6 2 HEPES-sodium      ? ? ? 
1 7 2 'calcium acetate' ? ? ? 
1 8 2 H2O               ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-11-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9810 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9810 
# 
_reflns.entry_id                     2ASL 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             20 
_reflns.number_all                   34610 
_reflns.number_obs                   34610 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.082 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.73 
_reflns_shell.percent_possible_all   80.0 
_reflns_shell.Rmerge_I_obs           0.504 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2345 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ASL 
_refine.ls_number_reflns_obs                     29331 
_refine.ls_number_reflns_all                     29331 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    91.76 
_refine.ls_R_factor_obs                          0.23792 
_refine.ls_R_factor_all                          0.23792 
_refine.ls_R_factor_R_work                       0.23233 
_refine.ls_R_factor_R_free                       0.28686 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  3290 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.912 
_refine.correlation_coeff_Fo_to_Fc_free          0.865 
_refine.B_iso_mean                               14.504 
_refine.aniso_B[1][1]                            0.93 
_refine.aniso_B[2][2]                            -0.25 
_refine.aniso_B[3][3]                            -0.99 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.26 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.352 
_refine.pdbx_overall_ESU_R_Free                  0.394 
_refine.overall_SU_ML                            0.277 
_refine.overall_SU_B                             13.636 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5478 
_refine_hist.pdbx_number_atoms_nucleic_acid   1258 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             181 
_refine_hist.number_atoms_total               6921 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010 0.022 ? 6970  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 5960  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.456 2.214 ? 9632  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.816 3.000 ? 13984 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.651 5.000 ? 680   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.098 0.200 ? 1040  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004 0.020 ? 6658  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001 0.020 ? 1116  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.203 0.200 ? 1328  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.213 0.200 ? 6874  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.079 0.200 ? 3900  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.252 0.200 ? 178   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.345 0.200 ? 7     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.114 0.200 ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.234 0.200 ? 56    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.310 0.200 ? 7     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.318 1.500 ? 3398  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.629 2.000 ? 5516  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.993 3.000 ? 3572  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.712 4.500 ? 4116  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.720 
_refine_ls_shell.number_reflns_R_work             1394 
_refine_ls_shell.R_factor_R_work                  0.351 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.429 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2ASL 
_struct.title                     'oxoG-modified Postinsertion Binary Complex' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ASL 
_struct_keywords.pdbx_keywords   transferase/DNA 
_struct_keywords.text            'DNA polymerase, 8-oxoguanine, Y-family, lesion bypass, transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR E 18  ? ASN E 28  ? TYR A 10   ASN A 20   1 ? 11 
HELX_P HELX_P2  2  PRO E 29  ? LYS E 32  ? PRO A 21   LYS A 24   5 ? 4  
HELX_P HELX_P3  3  ASN E 55  ? LYS E 60  ? ASN A 47   LYS A 52   1 ? 6  
HELX_P HELX_P4  4  PRO E 68  ? LEU E 76  ? PRO A 60   LEU A 68   1 ? 9  
HELX_P HELX_P5  5  ARG E 85  ? GLU E 102 ? ARG A 77   GLU A 94   1 ? 18 
HELX_P HELX_P6  6  ASP E 125 ? LYS E 145 ? ASP A 117  LYS A 137  1 ? 21 
HELX_P HELX_P7  7  ASN E 155 ? ALA E 166 ? ASN A 147  ALA A 158  1 ? 12 
HELX_P HELX_P8  8  ASP E 175 ? LEU E 186 ? ASP A 167  LEU A 178  1 ? 12 
HELX_P HELX_P9  9  ASP E 187 ? VAL E 191 ? ASP A 179  VAL A 183  5 ? 5  
HELX_P HELX_P10 10 GLY E 195 ? GLY E 206 ? GLY A 187  GLY A 198  1 ? 12 
HELX_P HELX_P11 11 LYS E 209 ? SER E 215 ? LYS A 201  SER A 207  5 ? 7  
HELX_P HELX_P12 12 GLU E 217 ? ARG E 238 ? GLU A 209  ARG A 230  1 ? 22 
HELX_P HELX_P13 13 ASN E 265 ? ASP E 285 ? ASN A 257  ASP A 277  1 ? 21 
HELX_P HELX_P14 14 SER E 315 ? ASP E 334 ? SER A 307  ASP A 326  1 ? 20 
HELX_P HELX_P15 15 TYR F 18  ? ASN F 28  ? TYR B 1010 ASN B 1020 1 ? 11 
HELX_P HELX_P16 16 PRO F 29  ? LYS F 32  ? PRO B 1021 LYS B 1024 5 ? 4  
HELX_P HELX_P17 17 ASN F 55  ? GLY F 62  ? ASN B 1047 GLY B 1054 1 ? 8  
HELX_P HELX_P18 18 PRO F 68  ? LEU F 76  ? PRO B 1060 LEU B 1068 1 ? 9  
HELX_P HELX_P19 19 ARG F 85  ? SER F 104 ? ARG B 1077 SER B 1096 1 ? 20 
HELX_P HELX_P20 20 ASP F 125 ? LYS F 145 ? ASP B 1117 LYS B 1137 1 ? 21 
HELX_P HELX_P21 21 ASN F 155 ? LYS F 167 ? ASN B 1147 LYS B 1159 1 ? 13 
HELX_P HELX_P22 22 ASP F 175 ? LEU F 186 ? ASP B 1167 LEU B 1178 1 ? 12 
HELX_P HELX_P23 23 ASP F 187 ? VAL F 191 ? ASP B 1179 VAL B 1183 5 ? 5  
HELX_P HELX_P24 24 GLY F 195 ? GLY F 206 ? GLY B 1187 GLY B 1198 1 ? 12 
HELX_P HELX_P25 25 LYS F 209 ? LEU F 214 ? LYS B 1201 LEU B 1206 5 ? 6  
HELX_P HELX_P26 26 GLU F 217 ? GLY F 226 ? GLU B 1209 GLY B 1218 1 ? 10 
HELX_P HELX_P27 27 GLY F 226 ? ARG F 238 ? GLY B 1218 ARG B 1230 1 ? 13 
HELX_P HELX_P28 28 ASN F 265 ? LEU F 284 ? ASN B 1257 LEU B 1276 1 ? 20 
HELX_P HELX_P29 29 SER F 315 ? ASP F 334 ? SER B 1307 ASP B 1326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I CA  .  CA    ? ? ? 1_555 O HOH .   O   ? ? A CA  415  A HOH 502  1_555 ? ? ? ? ? ? ?            1.704 ? 
metalc2  metalc ? ? I CA  .  CA    ? ? ? 1_555 O HOH .   O   ? ? A CA  415  A HOH 503  1_555 ? ? ? ? ? ? ?            1.888 ? 
metalc3  metalc ? ? I CA  .  CA    ? ? ? 1_555 A DOC 14  OP1 ? ? A CA  415  D DOC 814  1_555 ? ? ? ? ? ? ?            2.907 ? 
metalc4  metalc ? ? I CA  .  CA    ? ? ? 1_555 O HOH .   O   ? ? A CA  415  A HOH 501  1_555 ? ? ? ? ? ? ?            2.668 ? 
metalc5  metalc ? ? I CA  .  CA    ? ? ? 1_555 O HOH .   O   ? ? A CA  415  A HOH 537  1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc6  metalc ? ? I CA  .  CA    ? ? ? 1_555 E ASP 113 OD2 ? ? A CA  415  A ASP 105  1_555 ? ? ? ? ? ? ?            2.711 ? 
metalc7  metalc ? ? I CA  .  CA    ? ? ? 1_555 O HOH .   O   ? ? A CA  415  A HOH 547  1_555 ? ? ? ? ? ? ?            2.860 ? 
metalc8  metalc ? ? I CA  .  CA    ? ? ? 1_555 E ASP 15  OD2 ? ? A CA  415  A ASP 7    1_555 ? ? ? ? ? ? ?            2.582 ? 
metalc9  metalc ? ? I CA  .  CA    ? ? ? 1_555 E ASP 15  OD1 ? ? A CA  415  A ASP 7    1_555 ? ? ? ? ? ? ?            3.386 ? 
metalc10 metalc ? ? J CA  .  CA    ? ? ? 1_555 F ASP 15  OD2 ? ? B CA  1415 B ASP 1007 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc11 metalc ? ? J CA  .  CA    ? ? ? 1_555 F GLU 114 OE1 ? ? B CA  1415 B GLU 1106 1_555 ? ? ? ? ? ? ?            3.020 ? 
metalc12 metalc ? ? J CA  .  CA    ? ? ? 1_555 F ASP 113 OD2 ? ? B CA  1415 B ASP 1105 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc13 metalc ? ? J CA  .  CA    ? ? ? 1_555 P HOH .   O   ? ? B CA  1415 B HOH 1501 1_555 ? ? ? ? ? ? ?            2.623 ? 
metalc14 metalc ? ? J CA  .  CA    ? ? ? 1_555 F ASP 113 OD1 ? ? B CA  1415 B ASP 1105 1_555 ? ? ? ? ? ? ?            2.933 ? 
metalc15 metalc ? ? J CA  .  CA    ? ? ? 1_555 C DOC 14  OP1 ? ? B CA  1415 H DOC 1814 1_555 ? ? ? ? ? ? ?            2.574 ? 
metalc16 metalc ? ? J CA  .  CA    ? ? ? 1_555 P HOH .   O   ? ? B CA  1415 B HOH 1503 1_555 ? ? ? ? ? ? ?            2.933 ? 
metalc17 metalc ? ? G CA  .  CA    ? ? ? 1_555 L HOH .   O   ? ? D CA  416  E HOH 508  1_555 ? ? ? ? ? ? ?            2.740 ? 
metalc18 metalc ? ? G CA  .  CA    ? ? ? 1_555 L HOH .   O   ? ? D CA  416  E HOH 504  1_555 ? ? ? ? ? ? ?            2.558 ? 
metalc19 metalc ? ? G CA  .  CA    ? ? ? 1_555 L HOH .   O   ? ? D CA  416  E HOH 507  1_555 ? ? ? ? ? ? ?            2.702 ? 
metalc20 metalc ? ? G CA  .  CA    ? ? ? 1_555 K HOH .   O   ? ? D CA  416  D HOH 505  1_555 ? ? ? ? ? ? ?            2.880 ? 
metalc21 metalc ? ? G CA  .  CA    ? ? ? 1_555 K HOH .   O   ? ? D CA  416  D HOH 509  1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc22 metalc ? ? G CA  .  CA    ? ? ? 1_555 K HOH .   O   ? ? D CA  416  D HOH 506  1_555 ? ? ? ? ? ? ?            2.370 ? 
covale1  covale ? ? A DG  13 "O3'" ? ? ? 1_555 A DOC 14  P   ? ? D DG  813  D DOC 814  1_555 ? ? ? ? ? ? ?            1.601 ? 
covale2  covale ? ? B DC  5  "O3'" ? ? ? 1_555 B 8OG 6   P   ? ? E DC  905  E 8OG 906  1_555 ? ? ? ? ? ? ?            1.588 ? 
covale3  covale ? ? B 8OG 6  "O3'" ? ? ? 1_555 B DC  7   P   ? ? E 8OG 906  E DC  907  1_555 ? ? ? ? ? ? ?            1.612 ? 
covale4  covale ? ? C DG  13 "O3'" ? ? ? 1_555 C DOC 14  P   ? ? H DG  1813 H DOC 1814 1_555 ? ? ? ? ? ? ?            1.610 ? 
metalc23 metalc ? ? H CA  .  CA    ? ? ? 1_555 M HOH .   O   ? ? J CA  1416 H HOH 1509 1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc24 metalc ? ? H CA  .  CA    ? ? ? 1_555 M HOH .   O   ? ? J CA  1416 H HOH 1504 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc25 metalc ? ? H CA  .  CA    ? ? ? 1_555 M HOH .   O   ? ? J CA  1416 H HOH 1508 1_555 ? ? ? ? ? ? ?            2.548 ? 
metalc26 metalc ? ? H CA  .  CA    ? ? ? 1_555 M HOH .   O   ? ? J CA  1416 H HOH 1506 1_555 ? ? ? ? ? ? ?            3.224 ? 
metalc27 metalc ? ? H CA  .  CA    ? ? ? 1_555 N HOH .   O   ? ? J CA  1416 J HOH 1507 1_555 ? ? ? ? ? ? ?            3.012 ? 
covale5  covale ? ? D DC  5  "O3'" ? ? ? 1_555 D 8OG 6   P   ? ? J DC  1905 J 8OG 1906 1_555 ? ? ? ? ? ? ?            1.572 ? 
covale6  covale ? ? D 8OG 6  "O3'" ? ? ? 1_555 D DC  7   P   ? ? J 8OG 1906 J DC  1907 1_555 ? ? ? ? ? ? ?            1.605 ? 
hydrog1  hydrog ? ? A DG  1  N1    ? ? ? 1_555 B DC  19  N3  ? ? D DG  801  E DC  919  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1  N2    ? ? ? 1_555 B DC  19  O2  ? ? D DG  801  E DC  919  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1  O6    ? ? ? 1_555 B DC  19  N4  ? ? D DG  801  E DC  919  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  2  N1    ? ? ? 1_555 B DC  18  N3  ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  2  N2    ? ? ? 1_555 B DC  18  O2  ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  2  O6    ? ? ? 1_555 B DC  18  N4  ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  3  N3    ? ? ? 1_555 B DA  17  N1  ? ? D DT  803  E DA  917  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT  3  O4    ? ? ? 1_555 B DA  17  N6  ? ? D DT  803  E DA  917  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  16  N1  ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  16  N6  ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5  N1    ? ? ? 1_555 B DC  15  N3  ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  5  N2    ? ? ? 1_555 B DC  15  O2  ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  5  O6    ? ? ? 1_555 B DC  15  N4  ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  6  N1    ? ? ? 1_555 B DC  14  N3  ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  6  N2    ? ? ? 1_555 B DC  14  O2  ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  6  O6    ? ? ? 1_555 B DC  14  N4  ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA  7  N1    ? ? ? 1_555 B DT  13  N3  ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA  7  N6    ? ? ? 1_555 B DT  13  O4  ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT  8  N3    ? ? ? 1_555 B DA  12  N1  ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  8  O4    ? ? ? 1_555 B DA  12  N6  ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  9  N1    ? ? ? 1_555 B DC  11  N3  ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  9  N2    ? ? ? 1_555 B DC  11  O2  ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  9  O6    ? ? ? 1_555 B DC  11  N4  ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG  10 N1    ? ? ? 1_555 B DC  10  N3  ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG  10 N2    ? ? ? 1_555 B DC  10  O2  ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  10 O6    ? ? ? 1_555 B DC  10  N4  ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DT  11 N3    ? ? ? 1_555 B DA  9   N1  ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DT  11 O4    ? ? ? 1_555 B DA  9   N6  ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DA  12 N1    ? ? ? 1_555 B DT  8   N3  ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DA  12 N6    ? ? ? 1_555 B DT  8   O4  ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DG  13 N1    ? ? ? 1_555 B DC  7   N3  ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DG  13 N2    ? ? ? 1_555 B DC  7   O2  ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DG  13 O6    ? ? ? 1_555 B DC  7   N4  ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DOC 14 N3    ? ? ? 1_555 B 8OG 6   N1  ? ? D DOC 814  E 8OG 906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DOC 14 N4    ? ? ? 1_555 B 8OG 6   O6  ? ? D DOC 814  E 8OG 906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DOC 14 O2    ? ? ? 1_555 B 8OG 6   N2  ? ? D DOC 814  E 8OG 906  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  1  N1    ? ? ? 1_555 D DC  19  N3  ? ? H DG  1801 J DC  1919 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG  1  N2    ? ? ? 1_555 D DC  19  O2  ? ? H DG  1801 J DC  1919 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  1  O6    ? ? ? 1_555 D DC  19  N4  ? ? H DG  1801 J DC  1919 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG  2  N1    ? ? ? 1_555 D DC  18  N3  ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  2  N2    ? ? ? 1_555 D DC  18  O2  ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DG  2  O6    ? ? ? 1_555 D DC  18  N4  ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DT  3  N3    ? ? ? 1_555 D DA  17  N1  ? ? H DT  1803 J DA  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DT  3  O4    ? ? ? 1_555 D DA  17  N6  ? ? H DT  1803 J DA  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DT  4  N3    ? ? ? 1_555 D DA  16  N1  ? ? H DT  1804 J DA  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DT  4  O4    ? ? ? 1_555 D DA  16  N6  ? ? H DT  1804 J DA  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG  5  N1    ? ? ? 1_555 D DC  15  N3  ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DG  5  N2    ? ? ? 1_555 D DC  15  O2  ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DG  5  O6    ? ? ? 1_555 D DC  15  N4  ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DG  6  N1    ? ? ? 1_555 D DC  14  N3  ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DG  6  N2    ? ? ? 1_555 D DC  14  O2  ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DG  6  O6    ? ? ? 1_555 D DC  14  N4  ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DA  7  N1    ? ? ? 1_555 D DT  13  N3  ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DA  7  N6    ? ? ? 1_555 D DT  13  O4  ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DT  8  N3    ? ? ? 1_555 D DA  12  N1  ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DT  8  O4    ? ? ? 1_555 D DA  12  N6  ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DG  9  N1    ? ? ? 1_555 D DC  11  N3  ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DG  9  N2    ? ? ? 1_555 D DC  11  O2  ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? C DG  9  O6    ? ? ? 1_555 D DC  11  N4  ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? C DG  10 N1    ? ? ? 1_555 D DC  10  N3  ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? C DG  10 N2    ? ? ? 1_555 D DC  10  O2  ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? C DG  10 O6    ? ? ? 1_555 D DC  10  N4  ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? C DT  11 N3    ? ? ? 1_555 D DA  9   N1  ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? C DT  11 O4    ? ? ? 1_555 D DA  9   N6  ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? C DA  12 N1    ? ? ? 1_555 D DT  8   N3  ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? C DA  12 N6    ? ? ? 1_555 D DT  8   O4  ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? C DG  13 N1    ? ? ? 1_555 D DC  7   N3  ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? C DG  13 N2    ? ? ? 1_555 D DC  7   O2  ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? C DG  13 O6    ? ? ? 1_555 D DC  7   N4  ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? C DOC 14 N3    ? ? ? 1_555 D 8OG 6   N1  ? ? H DOC 1814 J 8OG 1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? C DOC 14 N4    ? ? ? 1_555 D 8OG 6   O6  ? ? H DOC 1814 J 8OG 1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? C DOC 14 O2    ? ? ? 1_555 D 8OG 6   N2  ? ? H DOC 1814 J 8OG 1906 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 107 ? ILE E 109 ? ILE A 99   ILE A 101  
A 2 GLU E 114 ? ASP E 118 ? GLU A 106  ASP A 110  
A 3 VAL E 11  ? PHE E 16  ? VAL A 3    PHE A 8    
A 4 VAL E 148 ? SER E 153 ? VAL A 140  SER A 145  
A 5 ILE E 171 ? VAL E 173 ? ILE A 163  VAL A 165  
B 1 GLY E 49  ? ALA E 54  ? GLY A 41   ALA A 46   
B 2 VAL E 36  ? PHE E 41  ? VAL A 28   PHE A 33   
B 3 VAL E 80  ? PRO E 83  ? VAL A 72   PRO A 75   
C 1 SER E 252 ? SER E 263 ? SER A 244  SER A 255  
C 2 ILE E 338 ? PHE E 348 ? ILE A 330  PHE A 340  
C 3 PRO E 289 ? THR E 298 ? PRO A 281  THR A 290  
C 4 ILE E 303 ? THR E 309 ? ILE A 295  THR A 301  
D 1 ILE F 107 ? SER F 111 ? ILE B 1099 SER B 1103 
D 2 GLU F 114 ? ASP F 118 ? GLU B 1106 ASP B 1110 
D 3 VAL F 11  ? PHE F 16  ? VAL B 1003 PHE B 1008 
D 4 VAL F 148 ? SER F 153 ? VAL B 1140 SER B 1145 
D 5 ILE F 171 ? VAL F 173 ? ILE B 1163 VAL B 1165 
E 1 GLY F 49  ? ALA F 54  ? GLY B 1041 ALA B 1046 
E 2 VAL F 36  ? PHE F 41  ? VAL B 1028 PHE B 1033 
E 3 VAL F 80  ? PRO F 83  ? VAL B 1072 PRO B 1075 
F 1 SER F 252 ? SER F 263 ? SER B 1244 SER B 1255 
F 2 ILE F 338 ? PHE F 348 ? ILE B 1330 PHE B 1340 
F 3 PRO F 289 ? THR F 298 ? PRO B 1281 THR B 1290 
F 4 ILE F 303 ? THR F 309 ? ILE B 1295 THR B 1301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU E 108 ? N GLU A 100  O TYR E 116 ? O TYR A 108  
A 2 3 O LEU E 117 ? O LEU A 109  N LEU E 12  ? N LEU A 4    
A 3 4 N ASP E 15  ? N ASP A 7    O THR E 149 ? O THR A 141  
A 4 5 N ILE E 152 ? N ILE A 144  O LYS E 172 ? O LYS A 164  
B 1 2 O ALA E 50  ? O ALA A 42   N VAL E 40  ? N VAL A 32   
B 2 3 N CYS E 39  ? N CYS A 31   O LEU E 82  ? O LEU A 74   
C 1 2 N ILE E 253 ? N ILE A 245  O PHE E 345 ? O PHE A 337  
C 2 3 O ARG E 339 ? O ARG A 331  N VAL E 297 ? N VAL A 289  
C 3 4 N VAL E 294 ? N VAL A 286  O ARG E 306 ? O ARG A 298  
D 1 2 N GLU F 108 ? N GLU B 1100 O TYR F 116 ? O TYR B 1108 
D 2 3 O ALA F 115 ? O ALA B 1107 N VAL F 14  ? N VAL B 1006 
D 3 4 N PHE F 13  ? N PHE B 1005 O GLY F 151 ? O GLY B 1143 
D 4 5 N ILE F 152 ? N ILE B 1144 O LYS F 172 ? O LYS B 1164 
E 1 2 O ALA F 50  ? O ALA B 1042 N VAL F 40  ? N VAL B 1032 
E 2 3 N CYS F 39  ? N CYS B 1031 O LEU F 82  ? O LEU B 1074 
F 1 2 N ILE F 253 ? N ILE B 1245 O PHE F 345 ? O PHE B 1337 
F 2 3 O ARG F 339 ? O ARG B 1331 N VAL F 297 ? N VAL B 1289 
F 3 4 N ALA F 296 ? N ALA B 1288 O VAL F 304 ? O VAL B 1296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CA A 415'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA D 416'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 1415' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA J 1416' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ASP E 15  ? ASP A 7    . ? 1_555 ? 
2  AC1 8 ASP E 113 ? ASP A 105  . ? 1_555 ? 
3  AC1 8 HOH O .   ? HOH A 501  . ? 1_555 ? 
4  AC1 8 HOH O .   ? HOH A 502  . ? 1_555 ? 
5  AC1 8 HOH O .   ? HOH A 503  . ? 1_555 ? 
6  AC1 8 HOH O .   ? HOH A 537  . ? 1_555 ? 
7  AC1 8 HOH O .   ? HOH A 547  . ? 1_555 ? 
8  AC1 8 DOC A 14  ? DOC D 814  . ? 1_555 ? 
9  AC2 6 HOH K .   ? HOH D 505  . ? 1_555 ? 
10 AC2 6 HOH K .   ? HOH D 506  . ? 1_555 ? 
11 AC2 6 HOH K .   ? HOH D 509  . ? 1_555 ? 
12 AC2 6 HOH L .   ? HOH E 504  . ? 1_555 ? 
13 AC2 6 HOH L .   ? HOH E 507  . ? 1_555 ? 
14 AC2 6 HOH L .   ? HOH E 508  . ? 1_555 ? 
15 AC3 6 ASP F 15  ? ASP B 1007 . ? 1_555 ? 
16 AC3 6 ASP F 113 ? ASP B 1105 . ? 1_555 ? 
17 AC3 6 GLU F 114 ? GLU B 1106 . ? 1_555 ? 
18 AC3 6 HOH P .   ? HOH B 1501 . ? 1_555 ? 
19 AC3 6 HOH P .   ? HOH B 1503 . ? 1_555 ? 
20 AC3 6 DOC C 14  ? DOC H 1814 . ? 1_555 ? 
21 AC4 4 HOH M .   ? HOH H 1504 . ? 1_555 ? 
22 AC4 4 HOH M .   ? HOH H 1508 . ? 1_555 ? 
23 AC4 4 HOH M .   ? HOH H 1509 . ? 1_555 ? 
24 AC4 4 HOH N .   ? HOH J 1507 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ASL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ASL 
_atom_sites.fract_transf_matrix[1][1]   0.013658 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001716 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009899 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011868 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? -0.886  -29.505 -7.727  1.00 13.27 ? 801  DG  D "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? -2.148  -29.257 -7.070  1.00 12.42 ? 801  DG  D "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? -2.760  -27.947 -7.555  1.00 11.62 ? 801  DG  D "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? -4.201  -28.027 -7.662  1.00 11.07 ? 801  DG  D "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? -2.501  -26.741 -6.668  1.00 10.74 ? 801  DG  D "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? -1.707  -25.869 -7.415  1.00 11.06 ? 801  DG  D "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? -3.880  -26.162 -6.363  1.00 10.50 ? 801  DG  D "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? -4.714  -26.732 -7.491  1.00 10.56 ? 801  DG  D "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? -6.143  -26.895 -7.279  1.00 10.62 ? 801  DG  D N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? -6.766  -27.786 -6.444  1.00 10.80 ? 801  DG  D C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? -8.067  -27.717 -6.483  1.00 11.05 ? 801  DG  D N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? -8.324  -26.728 -7.414  1.00 11.15 ? 801  DG  D C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? -9.555  -26.220 -7.883  1.00 11.06 ? 801  DG  D C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? -10.702 -26.558 -7.549  1.00 9.65  ? 801  DG  D O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? -9.363  -25.207 -8.828  1.00 11.54 ? 801  DG  D N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? -8.134  -24.766 -9.274  1.00 11.48 ? 801  DG  D C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? -8.138  -23.792 -10.194 1.00 11.50 ? 801  DG  D N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? -6.978  -25.240 -8.842  1.00 11.40 ? 801  DG  D N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? -7.148  -26.214 -7.917  1.00 11.15 ? 801  DG  D C4    1 
ATOM   20   P  P     . DG  A 1 2   ? -1.013  -24.595 -6.761  1.00 12.92 ? 802  DG  D P     1 
ATOM   21   O  OP1   . DG  A 1 2   ? 0.296   -24.511 -7.436  1.00 12.16 ? 802  DG  D OP1   1 
ATOM   22   O  OP2   . DG  A 1 2   ? -1.115  -24.663 -5.286  1.00 12.39 ? 802  DG  D OP2   1 
ATOM   23   O  "O5'" . DG  A 1 2   ? -1.939  -23.380 -7.232  1.00 13.04 ? 802  DG  D "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1 2   ? -2.127  -23.216 -8.631  1.00 14.77 ? 802  DG  D "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1 2   ? -3.005  -22.019 -8.918  1.00 15.66 ? 802  DG  D "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1 2   ? -4.408  -22.360 -8.719  1.00 15.98 ? 802  DG  D "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1 2   ? -2.707  -20.825 -8.024  1.00 15.81 ? 802  DG  D "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1 2   ? -2.694  -19.643 -8.821  1.00 16.09 ? 802  DG  D "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1 2   ? -3.830  -20.892 -6.986  1.00 16.07 ? 802  DG  D "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1 2   ? -4.997  -21.517 -7.752  1.00 15.25 ? 802  DG  D "C1'" 1 
ATOM   31   N  N9    . DG  A 1 2   ? -5.934  -22.301 -6.931  1.00 14.03 ? 802  DG  D N9    1 
ATOM   32   C  C8    . DG  A 1 2   ? -5.655  -23.215 -5.931  1.00 13.90 ? 802  DG  D C8    1 
ATOM   33   N  N7    . DG  A 1 2   ? -6.718  -23.756 -5.387  1.00 13.28 ? 802  DG  D N7    1 
ATOM   34   C  C5    . DG  A 1 2   ? -7.773  -23.154 -6.069  1.00 12.95 ? 802  DG  D C5    1 
ATOM   35   C  C6    . DG  A 1 2   ? -9.176  -23.317 -5.934  1.00 11.81 ? 802  DG  D C6    1 
ATOM   36   O  O6    . DG  A 1 2   ? -9.807  -24.044 -5.162  1.00 10.38 ? 802  DG  D O6    1 
ATOM   37   N  N1    . DG  A 1 2   ? -9.886  -22.513 -6.821  1.00 12.29 ? 802  DG  D N1    1 
ATOM   38   C  C2    . DG  A 1 2   ? -9.315  -21.657 -7.731  1.00 12.10 ? 802  DG  D C2    1 
ATOM   39   N  N2    . DG  A 1 2   ? -10.166 -20.976 -8.505  1.00 11.74 ? 802  DG  D N2    1 
ATOM   40   N  N3    . DG  A 1 2   ? -8.011  -21.492 -7.879  1.00 12.56 ? 802  DG  D N3    1 
ATOM   41   C  C4    . DG  A 1 2   ? -7.304  -22.261 -7.015  1.00 13.11 ? 802  DG  D C4    1 
ATOM   42   P  P     . DT  A 1 3   ? -2.497  -18.199 -8.165  1.00 16.51 ? 803  DT  D P     1 
ATOM   43   O  OP1   . DT  A 1 3   ? -1.829  -17.407 -9.214  1.00 18.17 ? 803  DT  D OP1   1 
ATOM   44   O  OP2   . DT  A 1 3   ? -1.925  -18.319 -6.799  1.00 15.32 ? 803  DT  D OP2   1 
ATOM   45   O  "O5'" . DT  A 1 3   ? -4.003  -17.694 -8.024  1.00 16.51 ? 803  DT  D "O5'" 1 
ATOM   46   C  "C5'" . DT  A 1 3   ? -4.851  -17.662 -9.177  1.00 16.30 ? 803  DT  D "C5'" 1 
ATOM   47   C  "C4'" . DT  A 1 3   ? -6.177  -17.000 -8.841  1.00 16.13 ? 803  DT  D "C4'" 1 
ATOM   48   O  "O4'" . DT  A 1 3   ? -7.063  -17.967 -8.195  1.00 15.82 ? 803  DT  D "O4'" 1 
ATOM   49   C  "C3'" . DT  A 1 3   ? -6.038  -15.819 -7.889  1.00 15.79 ? 803  DT  D "C3'" 1 
ATOM   50   O  "O3'" . DT  A 1 3   ? -6.782  -14.709 -8.359  1.00 17.00 ? 803  DT  D "O3'" 1 
ATOM   51   C  "C2'" . DT  A 1 3   ? -6.547  -16.387 -6.569  1.00 15.44 ? 803  DT  D "C2'" 1 
ATOM   52   C  "C1'" . DT  A 1 3   ? -7.598  -17.401 -7.021  1.00 15.20 ? 803  DT  D "C1'" 1 
ATOM   53   N  N1    . DT  A 1 3   ? -7.936  -18.473 -5.986  1.00 14.59 ? 803  DT  D N1    1 
ATOM   54   C  C2    . DT  A 1 3   ? -9.262  -18.761 -5.710  1.00 13.78 ? 803  DT  D C2    1 
ATOM   55   O  O2    . DT  A 1 3   ? -10.190 -18.193 -6.262  1.00 11.30 ? 803  DT  D O2    1 
ATOM   56   N  N3    . DT  A 1 3   ? -9.463  -19.735 -4.745  1.00 13.22 ? 803  DT  D N3    1 
ATOM   57   C  C4    . DT  A 1 3   ? -8.488  -20.439 -4.048  1.00 12.99 ? 803  DT  D C4    1 
ATOM   58   O  O4    . DT  A 1 3   ? -8.771  -21.290 -3.205  1.00 12.19 ? 803  DT  D O4    1 
ATOM   59   C  C5    . DT  A 1 3   ? -7.123  -20.094 -4.377  1.00 12.81 ? 803  DT  D C5    1 
ATOM   60   C  C7    . DT  A 1 3   ? -5.962  -20.768 -3.705  1.00 11.76 ? 803  DT  D C7    1 
ATOM   61   C  C6    . DT  A 1 3   ? -6.923  -19.147 -5.310  1.00 14.20 ? 803  DT  D C6    1 
ATOM   62   P  P     . DT  A 1 4   ? -6.644  -13.249 -7.686  1.00 18.13 ? 804  DT  D P     1 
ATOM   63   O  OP1   . DT  A 1 4   ? -5.781  -12.514 -8.627  1.00 17.72 ? 804  DT  D OP1   1 
ATOM   64   O  OP2   . DT  A 1 4   ? -6.314  -13.306 -6.231  1.00 15.88 ? 804  DT  D OP2   1 
ATOM   65   O  "O5'" . DT  A 1 4   ? -8.137  -12.672 -7.761  1.00 16.99 ? 804  DT  D "O5'" 1 
ATOM   66   C  "C5'" . DT  A 1 4   ? -9.215  -13.475 -8.217  1.00 16.76 ? 804  DT  D "C5'" 1 
ATOM   67   C  "C4'" . DT  A 1 4   ? -10.450 -13.323 -7.355  1.00 15.92 ? 804  DT  D "C4'" 1 
ATOM   68   O  "O4'" . DT  A 1 4   ? -10.571 -14.463 -6.468  1.00 16.08 ? 804  DT  D "O4'" 1 
ATOM   69   C  "C3'" . DT  A 1 4   ? -10.532 -12.107 -6.444  1.00 14.77 ? 804  DT  D "C3'" 1 
ATOM   70   O  "O3'" . DT  A 1 4   ? -11.883 -11.717 -6.498  1.00 14.23 ? 804  DT  D "O3'" 1 
ATOM   71   C  "C2'" . DT  A 1 4   ? -10.114 -12.675 -5.097  1.00 15.12 ? 804  DT  D "C2'" 1 
ATOM   72   C  "C1'" . DT  A 1 4   ? -10.806 -14.032 -5.149  1.00 15.28 ? 804  DT  D "C1'" 1 
ATOM   73   N  N1    . DT  A 1 4   ? -10.328 -15.143 -4.259  1.00 15.24 ? 804  DT  D N1    1 
ATOM   74   C  C2    . DT  A 1 4   ? -11.254 -16.014 -3.692  1.00 15.34 ? 804  DT  D C2    1 
ATOM   75   O  O2    . DT  A 1 4   ? -12.463 -15.934 -3.843  1.00 15.01 ? 804  DT  D O2    1 
ATOM   76   N  N3    . DT  A 1 4   ? -10.729 -17.011 -2.909  1.00 15.13 ? 804  DT  D N3    1 
ATOM   77   C  C4    . DT  A 1 4   ? -9.387  -17.216 -2.648  1.00 15.84 ? 804  DT  D C4    1 
ATOM   78   O  O4    . DT  A 1 4   ? -9.014  -18.139 -1.933  1.00 16.91 ? 804  DT  D O4    1 
ATOM   79   C  C5    . DT  A 1 4   ? -8.469  -16.291 -3.276  1.00 15.88 ? 804  DT  D C5    1 
ATOM   80   C  C7    . DT  A 1 4   ? -6.987  -16.417 -3.062  1.00 16.31 ? 804  DT  D C7    1 
ATOM   81   C  C6    . DT  A 1 4   ? -8.976  -15.313 -4.038  1.00 15.35 ? 804  DT  D C6    1 
ATOM   82   P  P     . DG  A 1 5   ? -12.454 -10.372 -5.885  1.00 14.65 ? 805  DG  D P     1 
ATOM   83   O  OP1   . DG  A 1 5   ? -13.641 -10.054 -6.691  1.00 13.45 ? 805  DG  D OP1   1 
ATOM   84   O  OP2   . DG  A 1 5   ? -11.337 -9.398  -5.726  1.00 13.61 ? 805  DG  D OP2   1 
ATOM   85   O  "O5'" . DG  A 1 5   ? -12.937 -10.830 -4.429  1.00 13.36 ? 805  DG  D "O5'" 1 
ATOM   86   C  "C5'" . DG  A 1 5   ? -14.146 -11.541 -4.273  1.00 12.60 ? 805  DG  D "C5'" 1 
ATOM   87   C  "C4'" . DG  A 1 5   ? -14.423 -11.879 -2.823  1.00 12.06 ? 805  DG  D "C4'" 1 
ATOM   88   O  "O4'" . DG  A 1 5   ? -13.555 -12.952 -2.415  1.00 12.40 ? 805  DG  D "O4'" 1 
ATOM   89   C  "C3'" . DG  A 1 5   ? -14.163 -10.762 -1.822  1.00 12.85 ? 805  DG  D "C3'" 1 
ATOM   90   O  "O3'" . DG  A 1 5   ? -15.433 -10.365 -1.334  1.00 13.33 ? 805  DG  D "O3'" 1 
ATOM   91   C  "C2'" . DG  A 1 5   ? -13.222 -11.378 -0.775  1.00 12.96 ? 805  DG  D "C2'" 1 
ATOM   92   C  "C1'" . DG  A 1 5   ? -13.355 -12.878 -1.026  1.00 12.01 ? 805  DG  D "C1'" 1 
ATOM   93   N  N9    . DG  A 1 5   ? -12.200 -13.713 -0.692  1.00 12.05 ? 805  DG  D N9    1 
ATOM   94   C  C8    . DG  A 1 5   ? -10.900 -13.565 -1.128  1.00 12.06 ? 805  DG  D C8    1 
ATOM   95   N  N7    . DG  A 1 5   ? -10.082 -14.473 -0.657  1.00 11.56 ? 805  DG  D N7    1 
ATOM   96   C  C5    . DG  A 1 5   ? -10.887 -15.285 0.130   1.00 10.69 ? 805  DG  D C5    1 
ATOM   97   C  C6    . DG  A 1 5   ? -10.574 -16.438 0.892   1.00 9.87  ? 805  DG  D C6    1 
ATOM   98   O  O6    . DG  A 1 5   ? -9.477  -16.994 1.033   1.00 9.07  ? 805  DG  D O6    1 
ATOM   99   N  N1    . DG  A 1 5   ? -11.677 -16.962 1.566   1.00 9.93  ? 805  DG  D N1    1 
ATOM   100  C  C2    . DG  A 1 5   ? -12.945 -16.446 1.485   1.00 10.62 ? 805  DG  D C2    1 
ATOM   101  N  N2    . DG  A 1 5   ? -13.891 -17.079 2.190   1.00 10.27 ? 805  DG  D N2    1 
ATOM   102  N  N3    . DG  A 1 5   ? -13.261 -15.371 0.771   1.00 12.69 ? 805  DG  D N3    1 
ATOM   103  C  C4    . DG  A 1 5   ? -12.190 -14.836 0.116   1.00 12.10 ? 805  DG  D C4    1 
ATOM   104  P  P     . DG  A 1 6   ? -15.607 -9.158  -0.312  1.00 14.13 ? 806  DG  D P     1 
ATOM   105  O  OP1   . DG  A 1 6   ? -16.984 -8.635  -0.477  1.00 13.81 ? 806  DG  D OP1   1 
ATOM   106  O  OP2   . DG  A 1 6   ? -14.423 -8.283  -0.376  1.00 12.80 ? 806  DG  D OP2   1 
ATOM   107  O  "O5'" . DG  A 1 6   ? -15.543 -9.977  1.047   1.00 13.15 ? 806  DG  D "O5'" 1 
ATOM   108  C  "C5'" . DG  A 1 6   ? -16.556 -10.909 1.324   1.00 11.54 ? 806  DG  D "C5'" 1 
ATOM   109  C  "C4'" . DG  A 1 6   ? -16.311 -11.462 2.699   1.00 11.31 ? 806  DG  D "C4'" 1 
ATOM   110  O  "O4'" . DG  A 1 6   ? -15.112 -12.260 2.642   1.00 11.35 ? 806  DG  D "O4'" 1 
ATOM   111  C  "C3'" . DG  A 1 6   ? -16.060 -10.414 3.773   1.00 11.34 ? 806  DG  D "C3'" 1 
ATOM   112  O  "O3'" . DG  A 1 6   ? -16.761 -10.803 4.927   1.00 11.57 ? 806  DG  D "O3'" 1 
ATOM   113  C  "C2'" . DG  A 1 6   ? -14.549 -10.458 3.974   1.00 11.56 ? 806  DG  D "C2'" 1 
ATOM   114  C  "C1'" . DG  A 1 6   ? -14.323 -11.945 3.760   1.00 11.87 ? 806  DG  D "C1'" 1 
ATOM   115  N  N9    . DG  A 1 6   ? -12.960 -12.369 3.456   1.00 12.20 ? 806  DG  D N9    1 
ATOM   116  C  C8    . DG  A 1 6   ? -12.023 -11.743 2.671   1.00 11.97 ? 806  DG  D C8    1 
ATOM   117  N  N7    . DG  A 1 6   ? -10.906 -12.403 2.594   1.00 11.96 ? 806  DG  D N7    1 
ATOM   118  C  C5    . DG  A 1 6   ? -11.113 -13.532 3.374   1.00 10.76 ? 806  DG  D C5    1 
ATOM   119  C  C6    . DG  A 1 6   ? -10.258 -14.611 3.674   1.00 9.58  ? 806  DG  D C6    1 
ATOM   120  O  O6    . DG  A 1 6   ? -9.099  -14.785 3.286   1.00 8.61  ? 806  DG  D O6    1 
ATOM   121  N  N1    . DG  A 1 6   ? -10.870 -15.552 4.502   1.00 10.46 ? 806  DG  D N1    1 
ATOM   122  C  C2    . DG  A 1 6   ? -12.161 -15.450 4.987   1.00 10.92 ? 806  DG  D C2    1 
ATOM   123  N  N2    . DG  A 1 6   ? -12.611 -16.433 5.780   1.00 10.27 ? 806  DG  D N2    1 
ATOM   124  N  N3    . DG  A 1 6   ? -12.971 -14.446 4.705   1.00 11.72 ? 806  DG  D N3    1 
ATOM   125  C  C4    . DG  A 1 6   ? -12.378 -13.527 3.903   1.00 11.77 ? 806  DG  D C4    1 
ATOM   126  P  P     . DA  A 1 7   ? -16.980 -9.781  6.124   1.00 10.53 ? 807  DA  D P     1 
ATOM   127  O  OP1   . DA  A 1 7   ? -18.434 -9.504  6.211   1.00 9.64  ? 807  DA  D OP1   1 
ATOM   128  O  OP2   . DA  A 1 7   ? -16.030 -8.654  5.965   1.00 10.22 ? 807  DA  D OP2   1 
ATOM   129  O  "O5'" . DA  A 1 7   ? -16.438 -10.618 7.376   1.00 10.04 ? 807  DA  D "O5'" 1 
ATOM   130  C  "C5'" . DA  A 1 7   ? -16.917 -11.916 7.747   1.00 10.79 ? 807  DA  D "C5'" 1 
ATOM   131  C  "C4'" . DA  A 1 7   ? -15.892 -12.631 8.629   1.00 10.79 ? 807  DA  D "C4'" 1 
ATOM   132  O  "O4'" . DA  A 1 7   ? -14.674 -12.830 7.858   1.00 10.18 ? 807  DA  D "O4'" 1 
ATOM   133  C  "C3'" . DA  A 1 7   ? -15.465 -11.887 9.896   1.00 10.39 ? 807  DA  D "C3'" 1 
ATOM   134  O  "O3'" . DA  A 1 7   ? -15.769 -12.646 11.047  1.00 9.56  ? 807  DA  D "O3'" 1 
ATOM   135  C  "C2'" . DA  A 1 7   ? -13.960 -11.665 9.707   1.00 10.41 ? 807  DA  D "C2'" 1 
ATOM   136  C  "C1'" . DA  A 1 7   ? -13.565 -12.743 8.707   1.00 9.94  ? 807  DA  D "C1'" 1 
ATOM   137  N  N9    . DA  A 1 7   ? -12.445 -12.450 7.825   1.00 10.04 ? 807  DA  D N9    1 
ATOM   138  C  C8    . DA  A 1 7   ? -12.364 -11.375 6.994   1.00 11.25 ? 807  DA  D C8    1 
ATOM   139  N  N7    . DA  A 1 7   ? -11.267 -11.326 6.286   1.00 11.58 ? 807  DA  D N7    1 
ATOM   140  C  C5    . DA  A 1 7   ? -10.575 -12.458 6.671   1.00 9.83  ? 807  DA  D C5    1 
ATOM   141  C  C6    . DA  A 1 7   ? -9.324  -12.965 6.265   1.00 9.27  ? 807  DA  D C6    1 
ATOM   142  N  N6    . DA  A 1 7   ? -8.546  -12.369 5.351   1.00 9.92  ? 807  DA  D N6    1 
ATOM   143  N  N1    . DA  A 1 7   ? -8.910  -14.109 6.827   1.00 9.04  ? 807  DA  D N1    1 
ATOM   144  C  C2    . DA  A 1 7   ? -9.705  -14.698 7.745   1.00 10.56 ? 807  DA  D C2    1 
ATOM   145  N  N3    . DA  A 1 7   ? -10.899 -14.313 8.213   1.00 10.22 ? 807  DA  D N3    1 
ATOM   146  C  C4    . DA  A 1 7   ? -11.286 -13.167 7.622   1.00 9.86  ? 807  DA  D C4    1 
ATOM   147  P  P     . DT  A 1 8   ? -15.509 -12.083 12.529  1.00 11.20 ? 808  DT  D P     1 
ATOM   148  O  OP1   . DT  A 1 8   ? -16.479 -12.793 13.399  1.00 12.33 ? 808  DT  D OP1   1 
ATOM   149  O  OP2   . DT  A 1 8   ? -15.467 -10.607 12.567  1.00 9.74  ? 808  DT  D OP2   1 
ATOM   150  O  "O5'" . DT  A 1 8   ? -14.033 -12.589 12.876  1.00 11.12 ? 808  DT  D "O5'" 1 
ATOM   151  C  "C5'" . DT  A 1 8   ? -13.795 -13.996 12.954  1.00 11.57 ? 808  DT  D "C5'" 1 
ATOM   152  C  "C4'" . DT  A 1 8   ? -12.330 -14.327 13.190  1.00 11.48 ? 808  DT  D "C4'" 1 
ATOM   153  O  "O4'" . DT  A 1 8   ? -11.592 -14.008 11.992  1.00 11.04 ? 808  DT  D "O4'" 1 
ATOM   154  C  "C3'" . DT  A 1 8   ? -11.665 -13.581 14.346  1.00 12.03 ? 808  DT  D "C3'" 1 
ATOM   155  O  "O3'" . DT  A 1 8   ? -11.192 -14.508 15.325  1.00 12.52 ? 808  DT  D "O3'" 1 
ATOM   156  C  "C2'" . DT  A 1 8   ? -10.530 -12.803 13.694  1.00 12.18 ? 808  DT  D "C2'" 1 
ATOM   157  C  "C1'" . DT  A 1 8   ? -10.339 -13.493 12.346  1.00 11.86 ? 808  DT  D "C1'" 1 
ATOM   158  N  N1    . DT  A 1 8   ? -9.859  -12.591 11.231  1.00 11.53 ? 808  DT  D N1    1 
ATOM   159  C  C2    . DT  A 1 8   ? -8.731  -12.958 10.534  1.00 11.75 ? 808  DT  D C2    1 
ATOM   160  O  O2    . DT  A 1 8   ? -8.128  -13.986 10.783  1.00 12.83 ? 808  DT  D O2    1 
ATOM   161  N  N3    . DT  A 1 8   ? -8.334  -12.096 9.523   1.00 11.49 ? 808  DT  D N3    1 
ATOM   162  C  C4    . DT  A 1 8   ? -8.951  -10.911 9.159   1.00 10.60 ? 808  DT  D C4    1 
ATOM   163  O  O4    . DT  A 1 8   ? -8.522  -10.221 8.244   1.00 8.97  ? 808  DT  D O4    1 
ATOM   164  C  C5    . DT  A 1 8   ? -10.134 -10.574 9.930   1.00 11.14 ? 808  DT  D C5    1 
ATOM   165  C  C7    . DT  A 1 8   ? -10.891 -9.314  9.643   1.00 10.55 ? 808  DT  D C7    1 
ATOM   166  C  C6    . DT  A 1 8   ? -10.527 -11.413 10.915  1.00 11.27 ? 808  DT  D C6    1 
ATOM   167  P  P     . DG  A 1 9   ? -10.658 -14.054 16.762  1.00 12.99 ? 809  DG  D P     1 
ATOM   168  O  OP1   . DG  A 1 9   ? -11.055 -15.149 17.668  1.00 14.67 ? 809  DG  D OP1   1 
ATOM   169  O  OP2   . DG  A 1 9   ? -11.068 -12.660 17.089  1.00 14.36 ? 809  DG  D OP2   1 
ATOM   170  O  "O5'" . DG  A 1 9   ? -9.060  -14.036 16.598  1.00 12.96 ? 809  DG  D "O5'" 1 
ATOM   171  C  "C5'" . DG  A 1 9   ? -8.352  -15.144 16.048  1.00 13.97 ? 809  DG  D "C5'" 1 
ATOM   172  C  "C4'" . DG  A 1 9   ? -6.946  -14.782 15.611  1.00 14.60 ? 809  DG  D "C4'" 1 
ATOM   173  O  "O4'" . DG  A 1 9   ? -7.011  -14.130 14.315  1.00 15.95 ? 809  DG  D "O4'" 1 
ATOM   174  C  "C3'" . DG  A 1 9   ? -6.198  -13.817 16.530  1.00 15.52 ? 809  DG  D "C3'" 1 
ATOM   175  O  "O3'" . DG  A 1 9   ? -5.107  -14.445 17.198  1.00 16.44 ? 809  DG  D "O3'" 1 
ATOM   176  C  "C2'" . DG  A 1 9   ? -5.712  -12.721 15.588  1.00 15.92 ? 809  DG  D "C2'" 1 
ATOM   177  C  "C1'" . DG  A 1 9   ? -5.874  -13.313 14.195  1.00 16.03 ? 809  DG  D "C1'" 1 
ATOM   178  N  N9    . DG  A 1 9   ? -6.010  -12.213 13.243  1.00 16.85 ? 809  DG  D N9    1 
ATOM   179  C  C8    . DG  A 1 9   ? -7.039  -11.293 13.187  1.00 17.61 ? 809  DG  D C8    1 
ATOM   180  N  N7    . DG  A 1 9   ? -6.883  -10.376 12.261  1.00 16.78 ? 809  DG  D N7    1 
ATOM   181  C  C5    . DG  A 1 9   ? -5.670  -10.699 11.682  1.00 15.15 ? 809  DG  D C5    1 
ATOM   182  C  C6    . DG  A 1 9   ? -5.003  -10.056 10.628  1.00 14.03 ? 809  DG  D C6    1 
ATOM   183  O  O6    . DG  A 1 9   ? -5.385  -9.052  10.012  1.00 13.61 ? 809  DG  D O6    1 
ATOM   184  N  N1    . DG  A 1 9   ? -3.786  -10.672 10.332  1.00 13.43 ? 809  DG  D N1    1 
ATOM   185  C  C2    . DG  A 1 9   ? -3.307  -11.795 10.977  1.00 13.58 ? 809  DG  D C2    1 
ATOM   186  N  N2    . DG  A 1 9   ? -2.131  -12.264 10.552  1.00 12.87 ? 809  DG  D N2    1 
ATOM   187  N  N3    . DG  A 1 9   ? -3.928  -12.423 11.967  1.00 14.30 ? 809  DG  D N3    1 
ATOM   188  C  C4    . DG  A 1 9   ? -5.106  -11.817 12.273  1.00 15.96 ? 809  DG  D C4    1 
ATOM   189  P  P     . DG  A 1 10  ? -4.155  -13.606 18.178  1.00 17.39 ? 810  DG  D P     1 
ATOM   190  O  OP1   . DG  A 1 10  ? -3.765  -14.519 19.278  1.00 17.87 ? 810  DG  D OP1   1 
ATOM   191  O  OP2   . DG  A 1 10  ? -4.768  -12.288 18.462  1.00 17.70 ? 810  DG  D OP2   1 
ATOM   192  O  "O5'" . DG  A 1 10  ? -2.858  -13.245 17.317  1.00 18.03 ? 810  DG  D "O5'" 1 
ATOM   193  C  "C5'" . DG  A 1 10  ? -2.461  -14.004 16.171  1.00 18.21 ? 810  DG  D "C5'" 1 
ATOM   194  C  "C4'" . DG  A 1 10  ? -1.511  -13.183 15.313  1.00 17.79 ? 810  DG  D "C4'" 1 
ATOM   195  O  "O4'" . DG  A 1 10  ? -2.303  -12.295 14.497  1.00 17.52 ? 810  DG  D "O4'" 1 
ATOM   196  C  "C3'" . DG  A 1 10  ? -0.559  -12.282 16.093  1.00 17.50 ? 810  DG  D "C3'" 1 
ATOM   197  O  "O3'" . DG  A 1 10  ? 0.801   -12.626 15.903  1.00 18.11 ? 810  DG  D "O3'" 1 
ATOM   198  C  "C2'" . DG  A 1 10  ? -0.848  -10.885 15.560  1.00 16.89 ? 810  DG  D "C2'" 1 
ATOM   199  C  "C1'" . DG  A 1 10  ? -1.509  -11.167 14.232  1.00 16.58 ? 810  DG  D "C1'" 1 
ATOM   200  N  N9    . DG  A 1 10  ? -2.311  -10.038 13.779  1.00 15.63 ? 810  DG  D N9    1 
ATOM   201  C  C8    . DG  A 1 10  ? -3.518  -9.587  14.267  1.00 15.56 ? 810  DG  D C8    1 
ATOM   202  N  N7    . DG  A 1 10  ? -3.970  -8.528  13.652  1.00 15.02 ? 810  DG  D N7    1 
ATOM   203  C  C5    . DG  A 1 10  ? -2.993  -8.264  12.695  1.00 14.47 ? 810  DG  D C5    1 
ATOM   204  C  C6    . DG  A 1 10  ? -2.904  -7.243  11.713  1.00 13.95 ? 810  DG  D C6    1 
ATOM   205  O  O6    . DG  A 1 10  ? -3.707  -6.331  11.480  1.00 13.54 ? 810  DG  D O6    1 
ATOM   206  N  N1    . DG  A 1 10  ? -1.730  -7.322  10.958  1.00 13.86 ? 810  DG  D N1    1 
ATOM   207  C  C2    . DG  A 1 10  ? -0.777  -8.306  11.118  1.00 14.06 ? 810  DG  D C2    1 
ATOM   208  N  N2    . DG  A 1 10  ? 0.289   -8.261  10.309  1.00 12.85 ? 810  DG  D N2    1 
ATOM   209  N  N3    . DG  A 1 10  ? -0.850  -9.268  12.030  1.00 14.78 ? 810  DG  D N3    1 
ATOM   210  C  C4    . DG  A 1 10  ? -1.975  -9.185  12.770  1.00 14.51 ? 810  DG  D C4    1 
ATOM   211  P  P     . DT  A 1 11  ? 1.875   -11.971 16.912  1.00 18.97 ? 811  DT  D P     1 
ATOM   212  O  OP1   . DT  A 1 11  ? 2.493   -13.116 17.622  1.00 19.03 ? 811  DT  D OP1   1 
ATOM   213  O  OP2   . DT  A 1 11  ? 1.264   -10.853 17.685  1.00 17.78 ? 811  DT  D OP2   1 
ATOM   214  O  "O5'" . DT  A 1 11  ? 2.945   -11.270 15.932  1.00 17.08 ? 811  DT  D "O5'" 1 
ATOM   215  C  "C5'" . DT  A 1 11  ? 2.908   -11.407 14.496  1.00 14.37 ? 811  DT  D "C5'" 1 
ATOM   216  C  "C4'" . DT  A 1 11  ? 3.791   -10.389 13.784  1.00 12.39 ? 811  DT  D "C4'" 1 
ATOM   217  O  "O4'" . DT  A 1 11  ? 2.920   -9.489  13.048  1.00 10.94 ? 811  DT  D "O4'" 1 
ATOM   218  C  "C3'" . DT  A 1 11  ? 4.691   -9.544  14.688  1.00 11.50 ? 811  DT  D "C3'" 1 
ATOM   219  O  "O3'" . DT  A 1 11  ? 6.045   -9.553  14.273  1.00 10.72 ? 811  DT  D "O3'" 1 
ATOM   220  C  "C2'" . DT  A 1 11  ? 4.081   -8.151  14.617  1.00 11.52 ? 811  DT  D "C2'" 1 
ATOM   221  C  "C1'" . DT  A 1 11  ? 3.213   -8.150  13.364  1.00 11.58 ? 811  DT  D "C1'" 1 
ATOM   222  N  N1    . DT  A 1 11  ? 1.947   -7.312  13.557  1.00 10.92 ? 811  DT  D N1    1 
ATOM   223  C  C2    . DT  A 1 11  ? 1.731   -6.263  12.694  1.00 10.89 ? 811  DT  D C2    1 
ATOM   224  O  O2    . DT  A 1 11  ? 2.480   -5.979  11.780  1.00 10.80 ? 811  DT  D O2    1 
ATOM   225  N  N3    . DT  A 1 11  ? 0.598   -5.531  12.928  1.00 10.58 ? 811  DT  D N3    1 
ATOM   226  C  C4    . DT  A 1 11  ? -0.332  -5.743  13.918  1.00 9.64  ? 811  DT  D C4    1 
ATOM   227  O  O4    . DT  A 1 11  ? -1.309  -5.007  14.008  1.00 10.17 ? 811  DT  D O4    1 
ATOM   228  C  C5    . DT  A 1 11  ? -0.053  -6.840  14.815  1.00 7.90  ? 811  DT  D C5    1 
ATOM   229  C  C7    . DT  A 1 11  ? -0.983  -7.159  15.943  1.00 6.70  ? 811  DT  D C7    1 
ATOM   230  C  C6    . DT  A 1 11  ? 1.056   -7.561  14.593  1.00 8.98  ? 811  DT  D C6    1 
ATOM   231  P  P     . DA  A 1 12  ? 7.132   -8.608  14.994  1.00 10.98 ? 812  DA  D P     1 
ATOM   232  O  OP1   . DA  A 1 12  ? 8.397   -9.360  14.973  1.00 11.26 ? 812  DA  D OP1   1 
ATOM   233  O  OP2   . DA  A 1 12  ? 6.667   -8.037  16.282  1.00 10.43 ? 812  DA  D OP2   1 
ATOM   234  O  "O5'" . DA  A 1 12  ? 7.221   -7.379  13.982  1.00 9.39  ? 812  DA  D "O5'" 1 
ATOM   235  C  "C5'" . DA  A 1 12  ? 7.599   -7.581  12.618  1.00 8.66  ? 812  DA  D "C5'" 1 
ATOM   236  C  "C4'" . DA  A 1 12  ? 7.957   -6.271  11.932  1.00 7.30  ? 812  DA  D "C4'" 1 
ATOM   237  O  "O4'" . DA  A 1 12  ? 6.775   -5.447  11.819  1.00 5.58  ? 812  DA  D "O4'" 1 
ATOM   238  C  "C3'" . DA  A 1 12  ? 8.981   -5.420  12.667  1.00 7.06  ? 812  DA  D "C3'" 1 
ATOM   239  O  "O3'" . DA  A 1 12  ? 9.780   -4.685  11.757  1.00 8.09  ? 812  DA  D "O3'" 1 
ATOM   240  C  "C2'" . DA  A 1 12  ? 8.099   -4.522  13.525  1.00 6.89  ? 812  DA  D "C2'" 1 
ATOM   241  C  "C1'" . DA  A 1 12  ? 6.936   -4.267  12.582  1.00 6.29  ? 812  DA  D "C1'" 1 
ATOM   242  N  N9    . DA  A 1 12  ? 5.649   -4.010  13.210  1.00 5.86  ? 812  DA  D N9    1 
ATOM   243  C  C8    . DA  A 1 12  ? 5.096   -4.628  14.293  1.00 5.37  ? 812  DA  D C8    1 
ATOM   244  N  N7    . DA  A 1 12  ? 3.902   -4.197  14.607  1.00 4.70  ? 812  DA  D N7    1 
ATOM   245  C  C5    . DA  A 1 12  ? 3.649   -3.225  13.664  1.00 4.78  ? 812  DA  D C5    1 
ATOM   246  C  C6    . DA  A 1 12  ? 2.543   -2.387  13.437  1.00 3.64  ? 812  DA  D C6    1 
ATOM   247  N  N6    . DA  A 1 12  ? 1.446   -2.386  14.184  1.00 2.62  ? 812  DA  D N6    1 
ATOM   248  N  N1    . DA  A 1 12  ? 2.619   -1.536  12.395  1.00 4.47  ? 812  DA  D N1    1 
ATOM   249  C  C2    . DA  A 1 12  ? 3.716   -1.525  11.622  1.00 4.75  ? 812  DA  D C2    1 
ATOM   250  N  N3    . DA  A 1 12  ? 4.820   -2.268  11.730  1.00 5.31  ? 812  DA  D N3    1 
ATOM   251  C  C4    . DA  A 1 12  ? 4.716   -3.100  12.786  1.00 5.84  ? 812  DA  D C4    1 
ATOM   252  P  P     . DG  A 1 13  ? 11.018  -3.845  12.320  1.00 11.29 ? 813  DG  D P     1 
ATOM   253  O  OP1   . DG  A 1 13  ? 12.102  -3.797  11.308  1.00 11.83 ? 813  DG  D OP1   1 
ATOM   254  O  OP2   . DG  A 1 13  ? 11.328  -4.321  13.683  1.00 12.47 ? 813  DG  D OP2   1 
ATOM   255  O  "O5'" . DG  A 1 13  ? 10.417  -2.383  12.486  1.00 11.19 ? 813  DG  D "O5'" 1 
ATOM   256  C  "C5'" . DG  A 1 13  ? 9.986   -1.696  11.334  1.00 13.61 ? 813  DG  D "C5'" 1 
ATOM   257  C  "C4'" . DG  A 1 13  ? 9.316   -0.414  11.743  1.00 15.48 ? 813  DG  D "C4'" 1 
ATOM   258  O  "O4'" . DG  A 1 13  ? 8.038   -0.725  12.347  1.00 14.81 ? 813  DG  D "O4'" 1 
ATOM   259  C  "C3'" . DG  A 1 13  ? 10.108  0.353   12.793  1.00 18.22 ? 813  DG  D "C3'" 1 
ATOM   260  O  "O3'" . DG  A 1 13  ? 10.162  1.690   12.403  1.00 24.94 ? 813  DG  D "O3'" 1 
ATOM   261  C  "C2'" . DG  A 1 13  ? 9.307   0.143   14.070  1.00 16.45 ? 813  DG  D "C2'" 1 
ATOM   262  C  "C1'" . DG  A 1 13  ? 7.910   0.114   13.474  1.00 15.00 ? 813  DG  D "C1'" 1 
ATOM   263  N  N9    . DG  A 1 13  ? 6.855   -0.348  14.385  1.00 12.55 ? 813  DG  D N9    1 
ATOM   264  C  C8    . DG  A 1 13  ? 6.902   -1.346  15.332  1.00 10.79 ? 813  DG  D C8    1 
ATOM   265  N  N7    . DG  A 1 13  ? 5.778   -1.483  15.984  1.00 9.49  ? 813  DG  D N7    1 
ATOM   266  C  C5    . DG  A 1 13  ? 4.939   -0.512  15.448  1.00 8.60  ? 813  DG  D C5    1 
ATOM   267  C  C6    . DG  A 1 13  ? 3.596   -0.163  15.749  1.00 7.35  ? 813  DG  D C6    1 
ATOM   268  O  O6    . DG  A 1 13  ? 2.826   -0.670  16.575  1.00 6.27  ? 813  DG  D O6    1 
ATOM   269  N  N1    . DG  A 1 13  ? 3.130   0.889   14.960  1.00 7.06  ? 813  DG  D N1    1 
ATOM   270  C  C2    . DG  A 1 13  ? 3.883   1.535   14.001  1.00 7.73  ? 813  DG  D C2    1 
ATOM   271  N  N2    . DG  A 1 13  ? 3.277   2.529   13.331  1.00 7.65  ? 813  DG  D N2    1 
ATOM   272  N  N3    . DG  A 1 13  ? 5.136   1.216   13.702  1.00 7.93  ? 813  DG  D N3    1 
ATOM   273  C  C4    . DG  A 1 13  ? 5.594   0.192   14.462  1.00 9.70  ? 813  DG  D C4    1 
HETATM 274  N  N1    . DOC A 1 14  ? 6.985   4.746   14.592  1.00 28.66 ? 814  DOC D N1    1 
HETATM 275  C  C2    . DOC A 1 14  ? 5.695   4.900   15.124  1.00 26.68 ? 814  DOC D C2    1 
HETATM 276  N  N3    . DOC A 1 14  ? 5.251   4.016   16.038  1.00 26.94 ? 814  DOC D N3    1 
HETATM 277  C  C4    . DOC A 1 14  ? 6.028   3.010   16.441  1.00 27.28 ? 814  DOC D C4    1 
HETATM 278  C  C5    . DOC A 1 14  ? 7.346   2.820   15.917  1.00 26.79 ? 814  DOC D C5    1 
HETATM 279  C  C6    . DOC A 1 14  ? 7.773   3.704   14.998  1.00 27.84 ? 814  DOC D C6    1 
HETATM 280  O  O2    . DOC A 1 14  ? 4.976   5.826   14.769  1.00 24.95 ? 814  DOC D O2    1 
HETATM 281  N  N4    . DOC A 1 14  ? 5.500   2.192   17.356  1.00 26.93 ? 814  DOC D N4    1 
HETATM 282  C  "C1'" . DOC A 1 14  ? 7.486   5.716   13.586  1.00 31.19 ? 814  DOC D "C1'" 1 
HETATM 283  C  "C2'" . DOC A 1 14  ? 8.776   6.411   13.999  1.00 32.70 ? 814  DOC D "C2'" 1 
HETATM 284  C  "C3'" . DOC A 1 14  ? 9.352   6.807   12.639  1.00 33.85 ? 814  DOC D "C3'" 1 
HETATM 285  C  "C4'" . DOC A 1 14  ? 8.956   5.601   11.777  1.00 33.78 ? 814  DOC D "C4'" 1 
HETATM 286  O  "O4'" . DOC A 1 14  ? 7.759   5.037   12.384  1.00 32.64 ? 814  DOC D "O4'" 1 
HETATM 287  C  "C5'" . DOC A 1 14  ? 10.018  4.519   11.647  1.00 32.12 ? 814  DOC D "C5'" 1 
HETATM 288  O  "O5'" . DOC A 1 14  ? 10.564  4.080   12.897  1.00 30.41 ? 814  DOC D "O5'" 1 
HETATM 289  P  P     . DOC A 1 14  ? 11.337  2.649   12.916  1.00 32.68 ? 814  DOC D P     1 
HETATM 290  O  OP1   . DOC A 1 14  ? 12.369  2.674   11.842  1.00 32.39 ? 814  DOC D OP1   1 
HETATM 291  O  OP2   . DOC A 1 14  ? 11.685  2.193   14.282  1.00 29.10 ? 814  DOC D OP2   1 
ATOM   292  O  "O5'" . DA  B 2 3   ? 0.135   -6.823  30.377  1.00 22.02 ? 903  DA  E "O5'" 1 
ATOM   293  C  "C5'" . DA  B 2 3   ? 0.053   -6.029  31.556  1.00 22.29 ? 903  DA  E "C5'" 1 
ATOM   294  C  "C4'" . DA  B 2 3   ? -1.132  -5.074  31.519  1.00 22.82 ? 903  DA  E "C4'" 1 
ATOM   295  O  "O4'" . DA  B 2 3   ? -1.071  -4.215  32.693  1.00 22.88 ? 903  DA  E "O4'" 1 
ATOM   296  C  "C3'" . DA  B 2 3   ? -1.192  -4.101  30.343  1.00 23.45 ? 903  DA  E "C3'" 1 
ATOM   297  O  "O3'" . DA  B 2 3   ? -2.562  -3.702  30.071  1.00 25.66 ? 903  DA  E "O3'" 1 
ATOM   298  C  "C2'" . DA  B 2 3   ? -0.311  -2.973  30.878  1.00 22.39 ? 903  DA  E "C2'" 1 
ATOM   299  C  "C1'" . DA  B 2 3   ? -0.897  -2.862  32.284  1.00 22.04 ? 903  DA  E "C1'" 1 
ATOM   300  N  N9    . DA  B 2 3   ? -0.095  -2.125  33.272  1.00 20.83 ? 903  DA  E N9    1 
ATOM   301  C  C8    . DA  B 2 3   ? 1.263   -2.185  33.469  1.00 20.15 ? 903  DA  E C8    1 
ATOM   302  N  N7    . DA  B 2 3   ? 1.698   -1.407  34.435  1.00 19.60 ? 903  DA  E N7    1 
ATOM   303  C  C5    . DA  B 2 3   ? 0.548   -0.791  34.909  1.00 19.40 ? 903  DA  E C5    1 
ATOM   304  C  C6    . DA  B 2 3   ? 0.325   0.155   35.937  1.00 18.74 ? 903  DA  E C6    1 
ATOM   305  N  N6    . DA  B 2 3   ? 1.311   0.656   36.691  1.00 18.09 ? 903  DA  E N6    1 
ATOM   306  N  N1    . DA  B 2 3   ? -0.951  0.566   36.152  1.00 18.61 ? 903  DA  E N1    1 
ATOM   307  C  C2    . DA  B 2 3   ? -1.938  0.065   35.392  1.00 18.52 ? 903  DA  E C2    1 
ATOM   308  N  N3    . DA  B 2 3   ? -1.851  -0.828  34.401  1.00 19.16 ? 903  DA  E N3    1 
ATOM   309  C  C4    . DA  B 2 3   ? -0.571  -1.221  34.205  1.00 19.89 ? 903  DA  E C4    1 
ATOM   310  P  P     . DA  B 2 4   ? -2.907  -2.650  28.896  1.00 29.32 ? 904  DA  E P     1 
ATOM   311  O  OP1   . DA  B 2 4   ? -4.324  -2.781  28.447  1.00 28.43 ? 904  DA  E OP1   1 
ATOM   312  O  OP2   . DA  B 2 4   ? -1.854  -2.800  27.851  1.00 28.93 ? 904  DA  E OP2   1 
ATOM   313  O  "O5'" . DA  B 2 4   ? -2.710  -1.221  29.640  1.00 27.73 ? 904  DA  E "O5'" 1 
ATOM   314  C  "C5'" . DA  B 2 4   ? -3.690  -0.698  30.576  1.00 26.28 ? 904  DA  E "C5'" 1 
ATOM   315  C  "C4'" . DA  B 2 4   ? -3.502  0.785   30.909  1.00 25.39 ? 904  DA  E "C4'" 1 
ATOM   316  O  "O4'" . DA  B 2 4   ? -2.318  0.959   31.738  1.00 24.75 ? 904  DA  E "O4'" 1 
ATOM   317  C  "C3'" . DA  B 2 4   ? -3.332  1.723   29.707  1.00 25.16 ? 904  DA  E "C3'" 1 
ATOM   318  O  "O3'" . DA  B 2 4   ? -4.199  2.898   29.808  1.00 25.43 ? 904  DA  E "O3'" 1 
ATOM   319  C  "C2'" . DA  B 2 4   ? -1.837  2.061   29.721  1.00 24.33 ? 904  DA  E "C2'" 1 
ATOM   320  C  "C1'" . DA  B 2 4   ? -1.457  1.952   31.195  1.00 24.09 ? 904  DA  E "C1'" 1 
ATOM   321  N  N9    . DA  B 2 4   ? -0.052  1.599   31.476  1.00 23.60 ? 904  DA  E N9    1 
ATOM   322  C  C8    . DA  B 2 4   ? 0.786   0.775   30.758  1.00 23.16 ? 904  DA  E C8    1 
ATOM   323  N  N7    . DA  B 2 4   ? 1.994   0.652   31.274  1.00 23.10 ? 904  DA  E N7    1 
ATOM   324  C  C5    . DA  B 2 4   ? 1.957   1.445   32.415  1.00 23.28 ? 904  DA  E C5    1 
ATOM   325  C  C6    . DA  B 2 4   ? 2.924   1.745   33.412  1.00 23.63 ? 904  DA  E C6    1 
ATOM   326  N  N6    . DA  B 2 4   ? 4.174   1.255   33.422  1.00 23.17 ? 904  DA  E N6    1 
ATOM   327  N  N1    . DA  B 2 4   ? 2.548   2.576   34.417  1.00 23.97 ? 904  DA  E N1    1 
ATOM   328  C  C2    . DA  B 2 4   ? 1.293   3.068   34.418  1.00 23.51 ? 904  DA  E C2    1 
ATOM   329  N  N3    . DA  B 2 4   ? 0.306   2.859   33.540  1.00 22.33 ? 904  DA  E N3    1 
ATOM   330  C  C4    . DA  B 2 4   ? 0.702   2.033   32.553  1.00 23.15 ? 904  DA  E C4    1 
ATOM   331  P  P     . DC  B 2 5   ? -5.395  3.202   28.750  1.00 26.36 ? 905  DC  E P     1 
ATOM   332  O  OP1   . DC  B 2 5   ? -6.423  3.938   29.533  1.00 24.88 ? 905  DC  E OP1   1 
ATOM   333  O  OP2   . DC  B 2 5   ? -5.735  1.985   27.948  1.00 24.01 ? 905  DC  E OP2   1 
ATOM   334  O  "O5'" . DC  B 2 5   ? -4.802  4.229   27.663  1.00 23.85 ? 905  DC  E "O5'" 1 
ATOM   335  C  "C5'" . DC  B 2 5   ? -3.467  4.760   27.697  1.00 21.02 ? 905  DC  E "C5'" 1 
ATOM   336  C  "C4'" . DC  B 2 5   ? -2.730  4.402   26.422  1.00 18.43 ? 905  DC  E "C4'" 1 
ATOM   337  O  "O4'" . DC  B 2 5   ? -2.082  3.114   26.542  1.00 18.59 ? 905  DC  E "O4'" 1 
ATOM   338  C  "C3'" . DC  B 2 5   ? -3.613  4.255   25.188  1.00 16.54 ? 905  DC  E "C3'" 1 
ATOM   339  O  "O3'" . DC  B 2 5   ? -3.905  5.534   24.624  1.00 11.26 ? 905  DC  E "O3'" 1 
ATOM   340  C  "C2'" . DC  B 2 5   ? -2.743  3.401   24.273  1.00 17.91 ? 905  DC  E "C2'" 1 
ATOM   341  C  "C1'" . DC  B 2 5   ? -1.825  2.641   25.230  1.00 19.22 ? 905  DC  E "C1'" 1 
ATOM   342  N  N1    . DC  B 2 5   ? -2.060  1.170   25.126  1.00 21.10 ? 905  DC  E N1    1 
ATOM   343  C  C2    . DC  B 2 5   ? -1.216  0.391   24.308  1.00 23.48 ? 905  DC  E C2    1 
ATOM   344  O  O2    . DC  B 2 5   ? -0.269  0.915   23.687  1.00 24.02 ? 905  DC  E O2    1 
ATOM   345  N  N3    . DC  B 2 5   ? -1.463  -0.946  24.214  1.00 24.27 ? 905  DC  E N3    1 
ATOM   346  C  C4    . DC  B 2 5   ? -2.484  -1.497  24.882  1.00 23.53 ? 905  DC  E C4    1 
ATOM   347  N  N4    . DC  B 2 5   ? -2.666  -2.818  24.756  1.00 23.70 ? 905  DC  E N4    1 
ATOM   348  C  C5    . DC  B 2 5   ? -3.349  -0.714  25.709  1.00 22.43 ? 905  DC  E C5    1 
ATOM   349  C  C6    . DC  B 2 5   ? -3.113  0.602   25.791  1.00 21.43 ? 905  DC  E C6    1 
HETATM 350  P  P     . 8OG B 2 6   ? -5.148  5.762   23.662  1.00 5.16  ? 906  8OG E P     1 
HETATM 351  O  OP1   . 8OG B 2 6   ? -6.035  6.763   24.344  1.00 4.61  ? 906  8OG E OP1   1 
HETATM 352  O  OP2   . 8OG B 2 6   ? -5.643  4.413   23.225  1.00 4.28  ? 906  8OG E OP2   1 
HETATM 353  O  "O5'" . 8OG B 2 6   ? -4.546  6.504   22.363  1.00 6.85  ? 906  8OG E "O5'" 1 
HETATM 354  C  "C5'" . 8OG B 2 6   ? -3.460  5.954   21.651  1.00 7.24  ? 906  8OG E "C5'" 1 
HETATM 355  C  "C4'" . 8OG B 2 6   ? -3.231  6.552   20.298  1.00 8.43  ? 906  8OG E "C4'" 1 
HETATM 356  O  "O4'" . 8OG B 2 6   ? -1.876  6.646   19.826  1.00 9.22  ? 906  8OG E "O4'" 1 
HETATM 357  C  "C3'" . 8OG B 2 6   ? -4.017  6.287   19.283  1.00 9.03  ? 906  8OG E "C3'" 1 
HETATM 358  O  "O3'" . 8OG B 2 6   ? -4.781  7.184   18.931  1.00 9.09  ? 906  8OG E "O3'" 1 
HETATM 359  C  "C2'" . 8OG B 2 6   ? -3.318  5.254   18.433  1.00 8.70  ? 906  8OG E "C2'" 1 
HETATM 360  C  "C1'" . 8OG B 2 6   ? -1.943  5.463   18.996  1.00 8.44  ? 906  8OG E "C1'" 1 
HETATM 361  N  N9    . 8OG B 2 6   ? -0.965  4.535   19.062  1.00 8.69  ? 906  8OG E N9    1 
HETATM 362  C  C8    . 8OG B 2 6   ? -0.971  3.492   19.878  1.00 8.29  ? 906  8OG E C8    1 
HETATM 363  N  N7    . 8OG B 2 6   ? 0.147   2.762   19.769  1.00 8.13  ? 906  8OG E N7    1 
HETATM 364  C  C5    . 8OG B 2 6   ? 0.901   3.395   18.838  1.00 7.84  ? 906  8OG E C5    1 
HETATM 365  C  C6    . 8OG B 2 6   ? 2.227   3.188   18.202  1.00 7.76  ? 906  8OG E C6    1 
HETATM 366  O  O6    . 8OG B 2 6   ? 2.973   2.227   18.482  1.00 7.40  ? 906  8OG E O6    1 
HETATM 367  N  N1    . 8OG B 2 6   ? 2.630   4.085   17.303  1.00 8.57  ? 906  8OG E N1    1 
HETATM 368  C  C2    . 8OG B 2 6   ? 1.882   5.142   16.946  1.00 8.16  ? 906  8OG E C2    1 
HETATM 369  N  N2    . 8OG B 2 6   ? 2.380   5.984   16.031  1.00 8.05  ? 906  8OG E N2    1 
HETATM 370  N  N3    . 8OG B 2 6   ? 0.676   5.400   17.459  1.00 7.97  ? 906  8OG E N3    1 
HETATM 371  C  C4    . 8OG B 2 6   ? 0.158   4.593   18.377  1.00 8.16  ? 906  8OG E C4    1 
HETATM 372  O  O8    . 8OG B 2 6   ? -1.949  3.200   20.662  1.00 7.84  ? 906  8OG E O8    1 
ATOM   373  P  P     . DC  B 2 7   ? -5.354  7.627   17.491  1.00 8.67  ? 907  DC  E P     1 
ATOM   374  O  OP1   . DC  B 2 7   ? -5.049  9.076   17.383  1.00 9.38  ? 907  DC  E OP1   1 
ATOM   375  O  OP2   . DC  B 2 7   ? -6.758  7.187   17.449  1.00 7.80  ? 907  DC  E OP2   1 
ATOM   376  O  "O5'" . DC  B 2 7   ? -4.601  6.852   16.310  1.00 8.65  ? 907  DC  E "O5'" 1 
ATOM   377  C  "C5'" . DC  B 2 7   ? -3.718  7.553   15.470  1.00 10.33 ? 907  DC  E "C5'" 1 
ATOM   378  C  "C4'" . DC  B 2 7   ? -2.896  6.642   14.576  1.00 11.34 ? 907  DC  E "C4'" 1 
ATOM   379  O  "O4'" . DC  B 2 7   ? -2.178  5.655   15.342  1.00 11.52 ? 907  DC  E "O4'" 1 
ATOM   380  C  "C3'" . DC  B 2 7   ? -3.695  5.834   13.560  1.00 12.72 ? 907  DC  E "C3'" 1 
ATOM   381  O  "O3'" . DC  B 2 7   ? -3.530  6.388   12.260  1.00 13.75 ? 907  DC  E "O3'" 1 
ATOM   382  C  "C2'" . DC  B 2 7   ? -3.116  4.428   13.674  1.00 12.56 ? 907  DC  E "C2'" 1 
ATOM   383  C  "C1'" . DC  B 2 7   ? -1.820  4.655   14.428  1.00 12.35 ? 907  DC  E "C1'" 1 
ATOM   384  N  N1    . DC  B 2 7   ? -1.295  3.450   15.161  1.00 12.88 ? 907  DC  E N1    1 
ATOM   385  C  C2    . DC  B 2 7   ? -0.009  2.926   14.879  1.00 12.39 ? 907  DC  E C2    1 
ATOM   386  O  O2    . DC  B 2 7   ? 0.713   3.457   14.025  1.00 10.73 ? 907  DC  E O2    1 
ATOM   387  N  N3    . DC  B 2 7   ? 0.416   1.831   15.575  1.00 11.87 ? 907  DC  E N3    1 
ATOM   388  C  C4    . DC  B 2 7   ? -0.364  1.262   16.501  1.00 10.92 ? 907  DC  E C4    1 
ATOM   389  N  N4    . DC  B 2 7   ? 0.101   0.192   17.154  1.00 8.84  ? 907  DC  E N4    1 
ATOM   390  C  C5    . DC  B 2 7   ? -1.662  1.777   16.790  1.00 11.47 ? 907  DC  E C5    1 
ATOM   391  C  C6    . DC  B 2 7   ? -2.084  2.852   16.109  1.00 11.86 ? 907  DC  E C6    1 
ATOM   392  P  P     . DT  B 2 8   ? -4.274  5.767   10.993  1.00 17.13 ? 908  DT  E P     1 
ATOM   393  O  OP1   . DT  B 2 8   ? -4.722  6.911   10.175  1.00 18.47 ? 908  DT  E OP1   1 
ATOM   394  O  OP2   . DT  B 2 8   ? -5.249  4.718   11.396  1.00 15.69 ? 908  DT  E OP2   1 
ATOM   395  O  "O5'" . DT  B 2 8   ? -3.067  5.101   10.198  1.00 14.81 ? 908  DT  E "O5'" 1 
ATOM   396  C  "C5'" . DT  B 2 8   ? -2.084  5.985   9.686   1.00 13.43 ? 908  DT  E "C5'" 1 
ATOM   397  C  "C4'" . DT  B 2 8   ? -1.068  5.226   8.880   1.00 12.20 ? 908  DT  E "C4'" 1 
ATOM   398  O  "O4'" . DT  B 2 8   ? -0.449  4.246   9.741   1.00 12.09 ? 908  DT  E "O4'" 1 
ATOM   399  C  "C3'" . DT  B 2 8   ? -1.692  4.462   7.737   1.00 12.47 ? 908  DT  E "C3'" 1 
ATOM   400  O  "O3'" . DT  B 2 8   ? -0.927  4.634   6.569   1.00 11.93 ? 908  DT  E "O3'" 1 
ATOM   401  C  "C2'" . DT  B 2 8   ? -1.724  3.012   8.233   1.00 12.90 ? 908  DT  E "C2'" 1 
ATOM   402  C  "C1'" . DT  B 2 8   ? -0.550  2.952   9.205   1.00 12.20 ? 908  DT  E "C1'" 1 
ATOM   403  N  N1    . DT  B 2 8   ? -0.662  1.974   10.357  1.00 12.02 ? 908  DT  E N1    1 
ATOM   404  C  C2    . DT  B 2 8   ? 0.415   1.168   10.678  1.00 11.54 ? 908  DT  E C2    1 
ATOM   405  O  O2    . DT  B 2 8   ? 1.468   1.194   10.100  1.00 11.86 ? 908  DT  E O2    1 
ATOM   406  N  N3    . DT  B 2 8   ? 0.237   0.314   11.732  1.00 11.39 ? 908  DT  E N3    1 
ATOM   407  C  C4    . DT  B 2 8   ? -0.898  0.173   12.495  1.00 10.81 ? 908  DT  E C4    1 
ATOM   408  O  O4    . DT  B 2 8   ? -0.930  -0.624  13.420  1.00 9.70  ? 908  DT  E O4    1 
ATOM   409  C  C5    . DT  B 2 8   ? -2.006  1.027   12.125  1.00 11.84 ? 908  DT  E C5    1 
ATOM   410  C  C7    . DT  B 2 8   ? -3.318  0.972   12.869  1.00 12.13 ? 908  DT  E C7    1 
ATOM   411  C  C6    . DT  B 2 8   ? -1.832  1.877   11.092  1.00 11.97 ? 908  DT  E C6    1 
ATOM   412  P  P     . DA  B 2 9   ? -1.525  4.135   5.180   1.00 10.84 ? 909  DA  E P     1 
ATOM   413  O  OP1   . DA  B 2 9   ? -0.846  4.908   4.124   1.00 13.31 ? 909  DA  E OP1   1 
ATOM   414  O  OP2   . DA  B 2 9   ? -2.992  4.149   5.242   1.00 10.54 ? 909  DA  E OP2   1 
ATOM   415  O  "O5'" . DA  B 2 9   ? -1.043  2.625   5.109   1.00 11.57 ? 909  DA  E "O5'" 1 
ATOM   416  C  "C5'" . DA  B 2 9   ? 0.345   2.355   5.142   1.00 12.82 ? 909  DA  E "C5'" 1 
ATOM   417  C  "C4'" . DA  B 2 9   ? 0.619   0.881   5.358   1.00 13.11 ? 909  DA  E "C4'" 1 
ATOM   418  O  "O4'" . DA  B 2 9   ? 0.130   0.530   6.665   1.00 13.93 ? 909  DA  E "O4'" 1 
ATOM   419  C  "C3'" . DA  B 2 9   ? -0.069  -0.096  4.398   1.00 13.98 ? 909  DA  E "C3'" 1 
ATOM   420  O  "O3'" . DA  B 2 9   ? 0.877   -0.586  3.408   1.00 14.66 ? 909  DA  E "O3'" 1 
ATOM   421  C  "C2'" . DA  B 2 9   ? -0.635  -1.179  5.332   1.00 14.03 ? 909  DA  E "C2'" 1 
ATOM   422  C  "C1'" . DA  B 2 9   ? 0.024   -0.871  6.668   1.00 13.91 ? 909  DA  E "C1'" 1 
ATOM   423  N  N9    . DA  B 2 9   ? -0.738  -1.249  7.849   1.00 14.21 ? 909  DA  E N9    1 
ATOM   424  C  C8    . DA  B 2 9   ? -2.016  -0.879  8.118   1.00 14.49 ? 909  DA  E C8    1 
ATOM   425  N  N7    . DA  B 2 9   ? -2.493  -1.354  9.247   1.00 14.03 ? 909  DA  E N7    1 
ATOM   426  C  C5    . DA  B 2 9   ? -1.439  -2.085  9.770   1.00 12.61 ? 909  DA  E C5    1 
ATOM   427  C  C6    . DA  B 2 9   ? -1.298  -2.826  10.965  1.00 10.83 ? 909  DA  E C6    1 
ATOM   428  N  N6    . DA  B 2 9   ? -2.253  -2.980  11.891  1.00 7.68  ? 909  DA  E N6    1 
ATOM   429  N  N1    . DA  B 2 9   ? -0.109  -3.421  11.166  1.00 11.81 ? 909  DA  E N1    1 
ATOM   430  C  C2    . DA  B 2 9   ? 0.869   -3.296  10.243  1.00 12.92 ? 909  DA  E C2    1 
ATOM   431  N  N3    . DA  B 2 9   ? 0.857   -2.615  9.091   1.00 13.49 ? 909  DA  E N3    1 
ATOM   432  C  C4    . DA  B 2 9   ? -0.342  -2.025  8.915   1.00 13.69 ? 909  DA  E C4    1 
ATOM   433  P  P     . DC  B 2 10  ? 0.531   -1.731  2.343   1.00 15.52 ? 910  DC  E P     1 
ATOM   434  O  OP1   . DC  B 2 10  ? 1.385   -1.472  1.177   1.00 18.15 ? 910  DC  E OP1   1 
ATOM   435  O  OP2   . DC  B 2 10  ? -0.931  -1.925  2.201   1.00 15.13 ? 910  DC  E OP2   1 
ATOM   436  O  "O5'" . DC  B 2 10  ? 1.072   -3.080  3.009   1.00 15.23 ? 910  DC  E "O5'" 1 
ATOM   437  C  "C5'" . DC  B 2 10  ? 2.424   -3.162  3.421   1.00 15.41 ? 910  DC  E "C5'" 1 
ATOM   438  C  "C4'" . DC  B 2 10  ? 2.591   -4.302  4.390   1.00 14.84 ? 910  DC  E "C4'" 1 
ATOM   439  O  "O4'" . DC  B 2 10  ? 1.816   -4.006  5.577   1.00 14.45 ? 910  DC  E "O4'" 1 
ATOM   440  C  "C3'" . DC  B 2 10  ? 2.050   -5.615  3.863   1.00 14.87 ? 910  DC  E "C3'" 1 
ATOM   441  O  "O3'" . DC  B 2 10  ? 3.064   -6.393  3.261   1.00 13.99 ? 910  DC  E "O3'" 1 
ATOM   442  C  "C2'" . DC  B 2 10  ? 1.505   -6.292  5.116   1.00 15.21 ? 910  DC  E "C2'" 1 
ATOM   443  C  "C1'" . DC  B 2 10  ? 1.470   -5.223  6.196   1.00 14.24 ? 910  DC  E "C1'" 1 
ATOM   444  N  N1    . DC  B 2 10  ? 0.116   -5.161  6.860   1.00 13.33 ? 910  DC  E N1    1 
ATOM   445  C  C2    . DC  B 2 10  ? -0.028  -5.697  8.137   1.00 12.30 ? 910  DC  E C2    1 
ATOM   446  O  O2    . DC  B 2 10  ? 0.951   -6.190  8.689   1.00 12.67 ? 910  DC  E O2    1 
ATOM   447  N  N3    . DC  B 2 10  ? -1.230  -5.653  8.756   1.00 12.97 ? 910  DC  E N3    1 
ATOM   448  C  C4    . DC  B 2 10  ? -2.284  -5.113  8.157   1.00 13.46 ? 910  DC  E C4    1 
ATOM   449  N  N4    . DC  B 2 10  ? -3.435  -5.113  8.841   1.00 11.64 ? 910  DC  E N4    1 
ATOM   450  C  C5    . DC  B 2 10  ? -2.170  -4.561  6.835   1.00 13.61 ? 910  DC  E C5    1 
ATOM   451  C  C6    . DC  B 2 10  ? -0.966  -4.607  6.231   1.00 13.21 ? 910  DC  E C6    1 
ATOM   452  P  P     . DC  B 2 11  ? 2.693   -7.792  2.577   1.00 15.06 ? 911  DC  E P     1 
ATOM   453  O  OP1   . DC  B 2 11  ? 3.886   -8.185  1.780   1.00 15.45 ? 911  DC  E OP1   1 
ATOM   454  O  OP2   . DC  B 2 11  ? 1.359   -7.727  1.931   1.00 13.80 ? 911  DC  E OP2   1 
ATOM   455  O  "O5'" . DC  B 2 11  ? 2.503   -8.830  3.785   1.00 14.16 ? 911  DC  E "O5'" 1 
ATOM   456  C  "C5'" . DC  B 2 11  ? 3.599   -9.171  4.606   1.00 13.72 ? 911  DC  E "C5'" 1 
ATOM   457  C  "C4'" . DC  B 2 11  ? 3.166   -10.179 5.640   1.00 13.21 ? 911  DC  E "C4'" 1 
ATOM   458  O  "O4'" . DC  B 2 11  ? 2.082   -9.631  6.432   1.00 13.20 ? 911  DC  E "O4'" 1 
ATOM   459  C  "C3'" . DC  B 2 11  ? 2.645   -11.474 5.050   1.00 13.37 ? 911  DC  E "C3'" 1 
ATOM   460  O  "O3'" . DC  B 2 11  ? 3.250   -12.569 5.694   1.00 14.31 ? 911  DC  E "O3'" 1 
ATOM   461  C  "C2'" . DC  B 2 11  ? 1.142   -11.422 5.312   1.00 13.83 ? 911  DC  E "C2'" 1 
ATOM   462  C  "C1'" . DC  B 2 11  ? 1.081   -10.618 6.599   1.00 12.84 ? 911  DC  E "C1'" 1 
ATOM   463  N  N1    . DC  B 2 11  ? -0.227  -9.941  6.832   1.00 11.22 ? 911  DC  E N1    1 
ATOM   464  C  C2    . DC  B 2 11  ? -1.020  -10.239 7.956   1.00 11.26 ? 911  DC  E C2    1 
ATOM   465  O  O2    . DC  B 2 11  ? -0.634  -11.086 8.764   1.00 11.23 ? 911  DC  E O2    1 
ATOM   466  N  N3    . DC  B 2 11  ? -2.210  -9.585  8.116   1.00 10.81 ? 911  DC  E N3    1 
ATOM   467  C  C4    . DC  B 2 11  ? -2.601  -8.666  7.224   1.00 9.48  ? 911  DC  E C4    1 
ATOM   468  N  N4    . DC  B 2 11  ? -3.756  -8.038  7.413   1.00 7.22  ? 911  DC  E N4    1 
ATOM   469  C  C5    . DC  B 2 11  ? -1.803  -8.351  6.084   1.00 10.14 ? 911  DC  E C5    1 
ATOM   470  C  C6    . DC  B 2 11  ? -0.644  -9.007  5.929   1.00 10.03 ? 911  DC  E C6    1 
ATOM   471  P  P     . DA  B 2 12  ? 2.891   -14.061 5.242   1.00 15.61 ? 912  DA  E P     1 
ATOM   472  O  OP1   . DA  B 2 12  ? 4.113   -14.855 5.493   1.00 15.46 ? 912  DA  E OP1   1 
ATOM   473  O  OP2   . DA  B 2 12  ? 2.217   -14.048 3.921   1.00 15.84 ? 912  DA  E OP2   1 
ATOM   474  O  "O5'" . DA  B 2 12  ? 1.775   -14.485 6.290   1.00 15.36 ? 912  DA  E "O5'" 1 
ATOM   475  C  "C5'" . DA  B 2 12  ? 2.076   -14.458 7.679   1.00 15.86 ? 912  DA  E "C5'" 1 
ATOM   476  C  "C4'" . DA  B 2 12  ? 1.135   -15.389 8.411   1.00 15.77 ? 912  DA  E "C4'" 1 
ATOM   477  O  "O4'" . DA  B 2 12  ? -0.109  -14.699 8.692   1.00 14.75 ? 912  DA  E "O4'" 1 
ATOM   478  C  "C3'" . DA  B 2 12  ? 0.745   -16.634 7.627   1.00 15.79 ? 912  DA  E "C3'" 1 
ATOM   479  O  "O3'" . DA  B 2 12  ? 0.621   -17.727 8.532   1.00 17.86 ? 912  DA  E "O3'" 1 
ATOM   480  C  "C2'" . DA  B 2 12  ? -0.570  -16.228 6.960   1.00 14.73 ? 912  DA  E "C2'" 1 
ATOM   481  C  "C1'" . DA  B 2 12  ? -1.178  -15.308 8.008   1.00 13.79 ? 912  DA  E "C1'" 1 
ATOM   482  N  N9    . DA  B 2 12  ? -2.025  -14.231 7.499   1.00 12.30 ? 912  DA  E N9    1 
ATOM   483  C  C8    . DA  B 2 12  ? -1.775  -13.358 6.480   1.00 11.17 ? 912  DA  E C8    1 
ATOM   484  N  N7    . DA  B 2 12  ? -2.747  -12.503 6.277   1.00 10.66 ? 912  DA  E N7    1 
ATOM   485  C  C5    . DA  B 2 12  ? -3.702  -12.844 7.221   1.00 10.63 ? 912  DA  E C5    1 
ATOM   486  C  C6    . DA  B 2 12  ? -4.981  -12.323 7.546   1.00 9.70  ? 912  DA  E C6    1 
ATOM   487  N  N6    . DA  B 2 12  ? -5.555  -11.293 6.920   1.00 8.91  ? 912  DA  E N6    1 
ATOM   488  N  N1    . DA  B 2 12  ? -5.654  -12.901 8.560   1.00 8.76  ? 912  DA  E N1    1 
ATOM   489  C  C2    . DA  B 2 12  ? -5.099  -13.932 9.212   1.00 9.45  ? 912  DA  E C2    1 
ATOM   490  N  N3    . DA  B 2 12  ? -3.917  -14.511 9.005   1.00 10.16 ? 912  DA  E N3    1 
ATOM   491  C  C4    . DA  B 2 12  ? -3.266  -13.909 7.987   1.00 11.24 ? 912  DA  E C4    1 
ATOM   492  P  P     . DT  B 2 13  ? 0.280   -19.192 7.977   1.00 19.61 ? 913  DT  E P     1 
ATOM   493  O  OP1   . DT  B 2 13  ? 1.066   -20.154 8.789   1.00 18.69 ? 913  DT  E OP1   1 
ATOM   494  O  OP2   . DT  B 2 13  ? 0.375   -19.151 6.495   1.00 19.14 ? 913  DT  E OP2   1 
ATOM   495  O  "O5'" . DT  B 2 13  ? -1.275  -19.340 8.345   1.00 18.52 ? 913  DT  E "O5'" 1 
ATOM   496  C  "C5'" . DT  B 2 13  ? -1.670  -19.259 9.724   1.00 17.85 ? 913  DT  E "C5'" 1 
ATOM   497  C  "C4'" . DT  B 2 13  ? -3.156  -19.509 9.854   1.00 17.21 ? 913  DT  E "C4'" 1 
ATOM   498  O  "O4'" . DT  B 2 13  ? -3.896  -18.364 9.355   1.00 17.45 ? 913  DT  E "O4'" 1 
ATOM   499  C  "C3'" . DT  B 2 13  ? -3.643  -20.688 9.029   1.00 17.44 ? 913  DT  E "C3'" 1 
ATOM   500  O  "O3'" . DT  B 2 13  ? -4.484  -21.487 9.847   1.00 18.03 ? 913  DT  E "O3'" 1 
ATOM   501  C  "C2'" . DT  B 2 13  ? -4.345  -20.044 7.826   1.00 16.43 ? 913  DT  E "C2'" 1 
ATOM   502  C  "C1'" . DT  B 2 13  ? -4.904  -18.780 8.460   1.00 15.82 ? 913  DT  E "C1'" 1 
ATOM   503  N  N1    . DT  B 2 13  ? -5.229  -17.601 7.575   1.00 14.06 ? 913  DT  E N1    1 
ATOM   504  C  C2    . DT  B 2 13  ? -6.392  -16.914 7.823   1.00 12.97 ? 913  DT  E C2    1 
ATOM   505  O  O2    . DT  B 2 13  ? -7.165  -17.214 8.703   1.00 12.95 ? 913  DT  E O2    1 
ATOM   506  N  N3    . DT  B 2 13  ? -6.654  -15.843 7.018   1.00 12.63 ? 913  DT  E N3    1 
ATOM   507  C  C4    . DT  B 2 13  ? -5.885  -15.393 5.967   1.00 13.04 ? 913  DT  E C4    1 
ATOM   508  O  O4    . DT  B 2 13  ? -6.235  -14.400 5.313   1.00 11.44 ? 913  DT  E O4    1 
ATOM   509  C  C5    . DT  B 2 13  ? -4.661  -16.154 5.750   1.00 13.37 ? 913  DT  E C5    1 
ATOM   510  C  C7    . DT  B 2 13  ? -3.696  -15.787 4.656   1.00 13.63 ? 913  DT  E C7    1 
ATOM   511  C  C6    . DT  B 2 13  ? -4.395  -17.198 6.553   1.00 13.47 ? 913  DT  E C6    1 
ATOM   512  P  P     . DC  B 2 14  ? -4.862  -22.975 9.407   1.00 18.19 ? 914  DC  E P     1 
ATOM   513  O  OP1   . DC  B 2 14  ? -4.672  -23.859 10.579  1.00 17.27 ? 914  DC  E OP1   1 
ATOM   514  O  OP2   . DC  B 2 14  ? -4.166  -23.262 8.129   1.00 18.17 ? 914  DC  E OP2   1 
ATOM   515  O  "O5'" . DC  B 2 14  ? -6.429  -22.811 9.109   1.00 16.87 ? 914  DC  E "O5'" 1 
ATOM   516  C  "C5'" . DC  B 2 14  ? -7.291  -22.229 10.089  1.00 16.03 ? 914  DC  E "C5'" 1 
ATOM   517  C  "C4'" . DC  B 2 14  ? -8.635  -21.851 9.486   1.00 16.15 ? 914  DC  E "C4'" 1 
ATOM   518  O  "O4'" . DC  B 2 14  ? -8.564  -20.632 8.700   1.00 15.70 ? 914  DC  E "O4'" 1 
ATOM   519  C  "C3'" . DC  B 2 14  ? -9.201  -22.908 8.551   1.00 15.90 ? 914  DC  E "C3'" 1 
ATOM   520  O  "O3'" . DC  B 2 14  ? -10.255 -23.508 9.258   1.00 16.32 ? 914  DC  E "O3'" 1 
ATOM   521  C  "C2'" . DC  B 2 14  ? -9.608  -22.163 7.274   1.00 15.38 ? 914  DC  E "C2'" 1 
ATOM   522  C  "C1'" . DC  B 2 14  ? -9.481  -20.688 7.628   1.00 14.66 ? 914  DC  E "C1'" 1 
ATOM   523  N  N1    . DC  B 2 14  ? -8.949  -19.774 6.556   1.00 13.82 ? 914  DC  E N1    1 
ATOM   524  C  C2    . DC  B 2 14  ? -9.646  -18.601 6.213   1.00 15.02 ? 914  DC  E C2    1 
ATOM   525  O  O2    . DC  B 2 14  ? -10.717 -18.332 6.768   1.00 16.22 ? 914  DC  E O2    1 
ATOM   526  N  N3    . DC  B 2 14  ? -9.134  -17.776 5.259   1.00 14.43 ? 914  DC  E N3    1 
ATOM   527  C  C4    . DC  B 2 14  ? -7.982  -18.074 4.655   1.00 13.76 ? 914  DC  E C4    1 
ATOM   528  N  N4    . DC  B 2 14  ? -7.543  -17.219 3.722   1.00 12.87 ? 914  DC  E N4    1 
ATOM   529  C  C5    . DC  B 2 14  ? -7.249  -19.260 4.993   1.00 12.85 ? 914  DC  E C5    1 
ATOM   530  C  C6    . DC  B 2 14  ? -7.764  -20.059 5.937   1.00 12.93 ? 914  DC  E C6    1 
ATOM   531  P  P     . DC  B 2 15  ? -11.097 -24.695 8.620   1.00 17.23 ? 915  DC  E P     1 
ATOM   532  O  OP1   . DC  B 2 15  ? -11.814 -25.355 9.733   1.00 15.99 ? 915  DC  E OP1   1 
ATOM   533  O  OP2   . DC  B 2 15  ? -10.224 -25.457 7.693   1.00 16.41 ? 915  DC  E OP2   1 
ATOM   534  O  "O5'" . DC  B 2 15  ? -12.136 -23.834 7.758   1.00 16.29 ? 915  DC  E "O5'" 1 
ATOM   535  C  "C5'" . DC  B 2 15  ? -13.030 -22.936 8.403   1.00 14.83 ? 915  DC  E "C5'" 1 
ATOM   536  C  "C4'" . DC  B 2 15  ? -13.879 -22.288 7.341   1.00 14.53 ? 915  DC  E "C4'" 1 
ATOM   537  O  "O4'" . DC  B 2 15  ? -13.029 -21.434 6.536   1.00 13.86 ? 915  DC  E "O4'" 1 
ATOM   538  C  "C3'" . DC  B 2 15  ? -14.527 -23.260 6.364   1.00 14.72 ? 915  DC  E "C3'" 1 
ATOM   539  O  "O3'" . DC  B 2 15  ? -15.931 -23.005 6.316   1.00 14.77 ? 915  DC  E "O3'" 1 
ATOM   540  C  "C2'" . DC  B 2 15  ? -13.771 -23.018 5.045   1.00 14.56 ? 915  DC  E "C2'" 1 
ATOM   541  C  "C1'" . DC  B 2 15  ? -13.366 -21.552 5.175   1.00 13.65 ? 915  DC  E "C1'" 1 
ATOM   542  N  N1    . DC  B 2 15  ? -12.196 -21.039 4.352   1.00 13.10 ? 915  DC  E N1    1 
ATOM   543  C  C2    . DC  B 2 15  ? -12.281 -19.789 3.677   1.00 13.76 ? 915  DC  E C2    1 
ATOM   544  O  O2    . DC  B 2 15  ? -13.312 -19.093 3.734   1.00 14.57 ? 915  DC  E O2    1 
ATOM   545  N  N3    . DC  B 2 15  ? -11.213 -19.354 2.953   1.00 12.09 ? 915  DC  E N3    1 
ATOM   546  C  C4    . DC  B 2 15  ? -10.099 -20.082 2.883   1.00 10.99 ? 915  DC  E C4    1 
ATOM   547  N  N4    . DC  B 2 15  ? -9.088  -19.593 2.161   1.00 8.59  ? 915  DC  E N4    1 
ATOM   548  C  C5    . DC  B 2 15  ? -9.988  -21.335 3.563   1.00 11.33 ? 915  DC  E C5    1 
ATOM   549  C  C6    . DC  B 2 15  ? -11.040 -21.766 4.277   1.00 11.47 ? 915  DC  E C6    1 
ATOM   550  P  P     . DA  B 2 16  ? -16.867 -23.890 5.369   1.00 16.53 ? 916  DA  E P     1 
ATOM   551  O  OP1   . DA  B 2 16  ? -18.177 -24.121 6.038   1.00 15.15 ? 916  DA  E OP1   1 
ATOM   552  O  OP2   . DA  B 2 16  ? -16.061 -25.050 4.911   1.00 17.51 ? 916  DA  E OP2   1 
ATOM   553  O  "O5'" . DA  B 2 16  ? -17.047 -22.916 4.120   1.00 15.12 ? 916  DA  E "O5'" 1 
ATOM   554  C  "C5'" . DA  B 2 16  ? -17.698 -21.678 4.346   1.00 15.25 ? 916  DA  E "C5'" 1 
ATOM   555  C  "C4'" . DA  B 2 16  ? -17.896 -20.960 3.036   1.00 15.03 ? 916  DA  E "C4'" 1 
ATOM   556  O  "O4'" . DA  B 2 16  ? -16.585 -20.580 2.560   1.00 14.74 ? 916  DA  E "O4'" 1 
ATOM   557  C  "C3'" . DA  B 2 16  ? -18.541 -21.801 1.936   1.00 15.02 ? 916  DA  E "C3'" 1 
ATOM   558  O  "O3'" . DA  B 2 16  ? -19.669 -21.107 1.384   1.00 15.20 ? 916  DA  E "O3'" 1 
ATOM   559  C  "C2'" . DA  B 2 16  ? -17.397 -22.037 0.943   1.00 14.84 ? 916  DA  E "C2'" 1 
ATOM   560  C  "C1'" . DA  B 2 16  ? -16.547 -20.794 1.170   1.00 14.17 ? 916  DA  E "C1'" 1 
ATOM   561  N  N9    . DA  B 2 16  ? -15.135 -20.874 0.846   1.00 13.13 ? 916  DA  E N9    1 
ATOM   562  C  C8    . DA  B 2 16  ? -14.249 -21.840 1.224   1.00 13.85 ? 916  DA  E C8    1 
ATOM   563  N  N7    . DA  B 2 16  ? -13.030 -21.626 0.793   1.00 13.92 ? 916  DA  E N7    1 
ATOM   564  C  C5    . DA  B 2 16  ? -13.129 -20.436 0.101   1.00 11.82 ? 916  DA  E C5    1 
ATOM   565  C  C6    . DA  B 2 16  ? -12.182 -19.669 -0.592  1.00 11.45 ? 916  DA  E C6    1 
ATOM   566  N  N6    . DA  B 2 16  ? -10.897 -20.010 -0.708  1.00 10.18 ? 916  DA  E N6    1 
ATOM   567  N  N1    . DA  B 2 16  ? -12.614 -18.531 -1.171  1.00 12.15 ? 916  DA  E N1    1 
ATOM   568  C  C2    . DA  B 2 16  ? -13.911 -18.190 -1.068  1.00 12.50 ? 916  DA  E C2    1 
ATOM   569  N  N3    . DA  B 2 16  ? -14.896 -18.832 -0.443  1.00 12.44 ? 916  DA  E N3    1 
ATOM   570  C  C4    . DA  B 2 16  ? -14.422 -19.957 0.127   1.00 12.46 ? 916  DA  E C4    1 
ATOM   571  P  P     . DA  B 2 17  ? -20.577 -21.789 0.239   1.00 15.16 ? 917  DA  E P     1 
ATOM   572  O  OP1   . DA  B 2 17  ? -21.940 -21.208 0.337   1.00 13.15 ? 917  DA  E OP1   1 
ATOM   573  O  OP2   . DA  B 2 17  ? -20.324 -23.255 0.225   1.00 12.86 ? 917  DA  E OP2   1 
ATOM   574  O  "O5'" . DA  B 2 17  ? -19.869 -21.177 -1.052  1.00 13.73 ? 917  DA  E "O5'" 1 
ATOM   575  C  "C5'" . DA  B 2 17  ? -19.757 -19.781 -1.216  1.00 11.74 ? 917  DA  E "C5'" 1 
ATOM   576  C  "C4'" . DA  B 2 17  ? -19.151 -19.528 -2.573  1.00 11.94 ? 917  DA  E "C4'" 1 
ATOM   577  O  "O4'" . DA  B 2 17  ? -17.724 -19.757 -2.453  1.00 12.24 ? 917  DA  E "O4'" 1 
ATOM   578  C  "C3'" . DA  B 2 17  ? -19.650 -20.432 -3.713  1.00 12.19 ? 917  DA  E "C3'" 1 
ATOM   579  O  "O3'" . DA  B 2 17  ? -20.123 -19.611 -4.767  1.00 13.55 ? 917  DA  E "O3'" 1 
ATOM   580  C  "C2'" . DA  B 2 17  ? -18.429 -21.272 -4.090  1.00 11.46 ? 917  DA  E "C2'" 1 
ATOM   581  C  "C1'" . DA  B 2 17  ? -17.282 -20.363 -3.649  1.00 11.40 ? 917  DA  E "C1'" 1 
ATOM   582  N  N9    . DA  B 2 17  ? -16.019 -21.026 -3.360  1.00 10.08 ? 917  DA  E N9    1 
ATOM   583  C  C8    . DA  B 2 17  ? -15.814 -22.147 -2.610  1.00 9.72  ? 917  DA  E C8    1 
ATOM   584  N  N7    . DA  B 2 17  ? -14.551 -22.500 -2.528  1.00 9.51  ? 917  DA  E N7    1 
ATOM   585  C  C5    . DA  B 2 17  ? -13.886 -21.541 -3.264  1.00 9.25  ? 917  DA  E C5    1 
ATOM   586  C  C6    . DA  B 2 17  ? -12.524 -21.341 -3.566  1.00 8.91  ? 917  DA  E C6    1 
ATOM   587  N  N6    . DA  B 2 17  ? -11.534 -22.135 -3.149  1.00 8.54  ? 917  DA  E N6    1 
ATOM   588  N  N1    . DA  B 2 17  ? -12.211 -20.279 -4.332  1.00 8.73  ? 917  DA  E N1    1 
ATOM   589  C  C2    . DA  B 2 17  ? -13.194 -19.473 -4.757  1.00 10.15 ? 917  DA  E C2    1 
ATOM   590  N  N3    . DA  B 2 17  ? -14.510 -19.554 -4.539  1.00 10.10 ? 917  DA  E N3    1 
ATOM   591  C  C4    . DA  B 2 17  ? -14.785 -20.623 -3.780  1.00 9.75  ? 917  DA  E C4    1 
ATOM   592  P  P     . DC  B 2 18  ? -20.818 -20.156 -6.109  1.00 16.24 ? 918  DC  E P     1 
ATOM   593  O  OP1   . DC  B 2 18  ? -21.658 -19.020 -6.566  1.00 16.47 ? 918  DC  E OP1   1 
ATOM   594  O  OP2   . DC  B 2 18  ? -21.352 -21.534 -5.960  1.00 13.26 ? 918  DC  E OP2   1 
ATOM   595  O  "O5'" . DC  B 2 18  ? -19.578 -20.252 -7.101  1.00 16.38 ? 918  DC  E "O5'" 1 
ATOM   596  C  "C5'" . DC  B 2 18  ? -18.876 -19.054 -7.404  1.00 16.06 ? 918  DC  E "C5'" 1 
ATOM   597  C  "C4'" . DC  B 2 18  ? -17.495 -19.386 -7.928  1.00 15.96 ? 918  DC  E "C4'" 1 
ATOM   598  O  "O4'" . DC  B 2 18  ? -16.748 -20.158 -6.962  1.00 15.47 ? 918  DC  E "O4'" 1 
ATOM   599  C  "C3'" . DC  B 2 18  ? -17.461 -20.286 -9.148  1.00 16.11 ? 918  DC  E "C3'" 1 
ATOM   600  O  "O3'" . DC  B 2 18  ? -17.801 -19.510 -10.325 1.00 16.17 ? 918  DC  E "O3'" 1 
ATOM   601  C  "C2'" . DC  B 2 18  ? -16.015 -20.797 -9.055  1.00 15.98 ? 918  DC  E "C2'" 1 
ATOM   602  C  "C1'" . DC  B 2 18  ? -15.562 -20.521 -7.624  1.00 14.89 ? 918  DC  E "C1'" 1 
ATOM   603  N  N1    . DC  B 2 18  ? -14.876 -21.696 -6.962  1.00 13.95 ? 918  DC  E N1    1 
ATOM   604  C  C2    . DC  B 2 18  ? -13.483 -21.812 -7.059  1.00 12.69 ? 918  DC  E C2    1 
ATOM   605  O  O2    . DC  B 2 18  ? -12.846 -20.957 -7.677  1.00 11.72 ? 918  DC  E O2    1 
ATOM   606  N  N3    . DC  B 2 18  ? -12.862 -22.862 -6.469  1.00 12.26 ? 918  DC  E N3    1 
ATOM   607  C  C4    . DC  B 2 18  ? -13.553 -23.789 -5.811  1.00 11.98 ? 918  DC  E C4    1 
ATOM   608  N  N4    . DC  B 2 18  ? -12.868 -24.802 -5.260  1.00 10.22 ? 918  DC  E N4    1 
ATOM   609  C  C5    . DC  B 2 18  ? -14.980 -23.694 -5.702  1.00 12.61 ? 918  DC  E C5    1 
ATOM   610  C  C6    . DC  B 2 18  ? -15.595 -22.653 -6.286  1.00 12.94 ? 918  DC  E C6    1 
ATOM   611  P  P     . DC  B 2 19  ? -18.083 -20.198 -11.743 1.00 16.51 ? 919  DC  E P     1 
ATOM   612  O  OP1   . DC  B 2 19  ? -19.337 -19.621 -12.260 1.00 17.17 ? 919  DC  E OP1   1 
ATOM   613  O  OP2   . DC  B 2 19  ? -18.027 -21.668 -11.604 1.00 17.41 ? 919  DC  E OP2   1 
ATOM   614  O  "O5'" . DC  B 2 19  ? -16.808 -19.751 -12.622 1.00 14.70 ? 919  DC  E "O5'" 1 
ATOM   615  C  "C5'" . DC  B 2 19  ? -15.531 -19.863 -12.022 1.00 13.30 ? 919  DC  E "C5'" 1 
ATOM   616  C  "C4'" . DC  B 2 19  ? -14.329 -19.945 -12.928 1.00 12.75 ? 919  DC  E "C4'" 1 
ATOM   617  O  "O4'" . DC  B 2 19  ? -13.218 -20.386 -12.094 1.00 12.77 ? 919  DC  E "O4'" 1 
ATOM   618  C  "C3'" . DC  B 2 19  ? -14.469 -20.937 -14.067 1.00 12.54 ? 919  DC  E "C3'" 1 
ATOM   619  O  "O3'" . DC  B 2 19  ? -14.175 -20.322 -15.304 1.00 13.72 ? 919  DC  E "O3'" 1 
ATOM   620  C  "C2'" . DC  B 2 19  ? -13.467 -22.039 -13.776 1.00 12.34 ? 919  DC  E "C2'" 1 
ATOM   621  C  "C1'" . DC  B 2 19  ? -12.731 -21.660 -12.494 1.00 12.47 ? 919  DC  E "C1'" 1 
ATOM   622  N  N1    . DC  B 2 19  ? -12.858 -22.736 -11.407 1.00 12.53 ? 919  DC  E N1    1 
ATOM   623  C  C2    . DC  B 2 19  ? -11.725 -23.250 -10.728 1.00 12.26 ? 919  DC  E C2    1 
ATOM   624  O  O2    . DC  B 2 19  ? -10.589 -22.841 -10.968 1.00 12.09 ? 919  DC  E O2    1 
ATOM   625  N  N3    . DC  B 2 19  ? -11.887 -24.209 -9.779  1.00 12.18 ? 919  DC  E N3    1 
ATOM   626  C  C4    . DC  B 2 19  ? -13.094 -24.690 -9.484  1.00 12.37 ? 919  DC  E C4    1 
ATOM   627  N  N4    . DC  B 2 19  ? -13.169 -25.639 -8.545  1.00 11.65 ? 919  DC  E N4    1 
ATOM   628  C  C5    . DC  B 2 19  ? -14.259 -24.205 -10.154 1.00 12.46 ? 919  DC  E C5    1 
ATOM   629  C  C6    . DC  B 2 19  ? -14.095 -23.249 -11.088 1.00 12.70 ? 919  DC  E C6    1 
ATOM   630  O  "O5'" . DG  C 1 1   ? 30.874  71.431  33.347  1.00 17.11 ? 1801 DG  H "O5'" 1 
ATOM   631  C  "C5'" . DG  C 1 1   ? 29.519  71.849  33.205  1.00 16.52 ? 1801 DG  H "C5'" 1 
ATOM   632  C  "C4'" . DG  C 1 1   ? 29.426  73.040  32.270  1.00 16.08 ? 1801 DG  H "C4'" 1 
ATOM   633  O  "O4'" . DG  C 1 1   ? 28.081  73.126  31.729  1.00 15.92 ? 1801 DG  H "O4'" 1 
ATOM   634  C  "C3'" . DG  C 1 1   ? 29.716  74.379  32.934  1.00 16.32 ? 1801 DG  H "C3'" 1 
ATOM   635  O  "O3'" . DG  C 1 1   ? 30.629  75.134  32.105  1.00 16.76 ? 1801 DG  H "O3'" 1 
ATOM   636  C  "C2'" . DG  C 1 1   ? 28.307  74.969  33.116  1.00 15.98 ? 1801 DG  H "C2'" 1 
ATOM   637  C  "C1'" . DG  C 1 1   ? 27.526  74.406  31.933  1.00 15.50 ? 1801 DG  H "C1'" 1 
ATOM   638  N  N9    . DG  C 1 1   ? 26.069  74.287  32.106  1.00 14.61 ? 1801 DG  H N9    1 
ATOM   639  C  C8    . DG  C 1 1   ? 25.373  73.601  33.080  1.00 14.32 ? 1801 DG  H C8    1 
ATOM   640  N  N7    . DG  C 1 1   ? 24.069  73.689  32.962  1.00 13.86 ? 1801 DG  H N7    1 
ATOM   641  C  C5    . DG  C 1 1   ? 23.878  74.484  31.837  1.00 13.17 ? 1801 DG  H C5    1 
ATOM   642  C  C6    . DG  C 1 1   ? 22.690  74.933  31.205  1.00 12.28 ? 1801 DG  H C6    1 
ATOM   643  O  O6    . DG  C 1 1   ? 21.509  74.720  31.509  1.00 12.00 ? 1801 DG  H O6    1 
ATOM   644  N  N1    . DG  C 1 1   ? 22.955  75.717  30.086  1.00 11.81 ? 1801 DG  H N1    1 
ATOM   645  C  C2    . DG  C 1 1   ? 24.210  76.036  29.635  1.00 11.64 ? 1801 DG  H C2    1 
ATOM   646  N  N2    . DG  C 1 1   ? 24.268  76.807  28.543  1.00 11.34 ? 1801 DG  H N2    1 
ATOM   647  N  N3    . DG  C 1 1   ? 25.329  75.626  30.208  1.00 12.42 ? 1801 DG  H N3    1 
ATOM   648  C  C4    . DG  C 1 1   ? 25.097  74.856  31.301  1.00 13.65 ? 1801 DG  H C4    1 
ATOM   649  P  P     . DG  C 1 2   ? 30.994  76.677  32.378  1.00 18.03 ? 1802 DG  H P     1 
ATOM   650  O  OP1   . DG  C 1 2   ? 32.372  76.905  31.882  1.00 17.86 ? 1802 DG  H OP1   1 
ATOM   651  O  OP2   . DG  C 1 2   ? 30.659  77.029  33.782  1.00 16.90 ? 1802 DG  H OP2   1 
ATOM   652  O  "O5'" . DG  C 1 2   ? 29.927  77.431  31.430  1.00 17.59 ? 1802 DG  H "O5'" 1 
ATOM   653  C  "C5'" . DG  C 1 2   ? 30.214  77.853  30.082  1.00 17.04 ? 1802 DG  H "C5'" 1 
ATOM   654  C  "C4'" . DG  C 1 2   ? 29.347  79.039  29.693  1.00 16.91 ? 1802 DG  H "C4'" 1 
ATOM   655  O  "O4'" . DG  C 1 2   ? 27.957  78.670  29.907  1.00 16.51 ? 1802 DG  H "O4'" 1 
ATOM   656  C  "C3'" . DG  C 1 2   ? 29.616  80.305  30.517  1.00 16.98 ? 1802 DG  H "C3'" 1 
ATOM   657  O  "O3'" . DG  C 1 2   ? 29.563  81.517  29.745  1.00 17.33 ? 1802 DG  H "O3'" 1 
ATOM   658  C  "C2'" . DG  C 1 2   ? 28.521  80.241  31.577  1.00 16.81 ? 1802 DG  H "C2'" 1 
ATOM   659  C  "C1'" . DG  C 1 2   ? 27.361  79.543  30.857  1.00 16.72 ? 1802 DG  H "C1'" 1 
ATOM   660  N  N9    . DG  C 1 2   ? 26.442  78.817  31.759  1.00 15.73 ? 1802 DG  H N9    1 
ATOM   661  C  C8    . DG  C 1 2   ? 26.764  77.971  32.802  1.00 15.68 ? 1802 DG  H C8    1 
ATOM   662  N  N7    . DG  C 1 2   ? 25.728  77.480  33.429  1.00 15.01 ? 1802 DG  H N7    1 
ATOM   663  C  C5    . DG  C 1 2   ? 24.642  78.038  32.772  1.00 13.95 ? 1802 DG  H C5    1 
ATOM   664  C  C6    . DG  C 1 2   ? 23.254  77.875  33.009  1.00 12.86 ? 1802 DG  H C6    1 
ATOM   665  O  O6    . DG  C 1 2   ? 22.692  77.184  33.877  1.00 12.24 ? 1802 DG  H O6    1 
ATOM   666  N  N1    . DG  C 1 2   ? 22.495  78.632  32.118  1.00 12.00 ? 1802 DG  H N1    1 
ATOM   667  C  C2    . DG  C 1 2   ? 23.028  79.424  31.119  1.00 11.93 ? 1802 DG  H C2    1 
ATOM   668  N  N2    . DG  C 1 2   ? 22.157  80.078  30.343  1.00 12.00 ? 1802 DG  H N2    1 
ATOM   669  N  N3    . DG  C 1 2   ? 24.319  79.587  30.886  1.00 12.23 ? 1802 DG  H N3    1 
ATOM   670  C  C4    . DG  C 1 2   ? 25.066  78.864  31.746  1.00 14.03 ? 1802 DG  H C4    1 
ATOM   671  P  P     . DT  C 1 3   ? 29.987  82.942  30.377  1.00 20.19 ? 1803 DT  H P     1 
ATOM   672  O  OP1   . DT  C 1 3   ? 30.990  83.555  29.470  1.00 19.76 ? 1803 DT  H OP1   1 
ATOM   673  O  OP2   . DT  C 1 3   ? 30.259  82.812  31.837  1.00 18.66 ? 1803 DT  H OP2   1 
ATOM   674  O  "O5'" . DT  C 1 3   ? 28.653  83.824  30.267  1.00 19.18 ? 1803 DT  H "O5'" 1 
ATOM   675  C  "C5'" . DT  C 1 3   ? 27.854  83.859  29.074  1.00 17.89 ? 1803 DT  H "C5'" 1 
ATOM   676  C  "C4'" . DT  C 1 3   ? 26.604  84.683  29.333  1.00 17.21 ? 1803 DT  H "C4'" 1 
ATOM   677  O  "O4'" . DT  C 1 3   ? 25.586  83.810  29.900  1.00 16.64 ? 1803 DT  H "O4'" 1 
ATOM   678  C  "C3'" . DT  C 1 3   ? 26.838  85.829  30.318  1.00 16.86 ? 1803 DT  H "C3'" 1 
ATOM   679  O  "O3'" . DT  C 1 3   ? 26.317  87.075  29.853  1.00 17.88 ? 1803 DT  H "O3'" 1 
ATOM   680  C  "C2'" . DT  C 1 3   ? 26.162  85.349  31.596  1.00 16.45 ? 1803 DT  H "C2'" 1 
ATOM   681  C  "C1'" . DT  C 1 3   ? 25.144  84.298  31.159  1.00 15.93 ? 1803 DT  H "C1'" 1 
ATOM   682  N  N1    . DT  C 1 3   ? 24.921  83.183  32.215  1.00 14.70 ? 1803 DT  H N1    1 
ATOM   683  C  C2    . DT  C 1 3   ? 23.626  82.788  32.503  1.00 13.89 ? 1803 DT  H C2    1 
ATOM   684  O  O2    . DT  C 1 3   ? 22.644  83.252  31.961  1.00 14.53 ? 1803 DT  H O2    1 
ATOM   685  N  N3    . DT  C 1 3   ? 23.492  81.807  33.452  1.00 13.01 ? 1803 DT  H N3    1 
ATOM   686  C  C4    . DT  C 1 3   ? 24.502  81.194  34.158  1.00 12.93 ? 1803 DT  H C4    1 
ATOM   687  O  O4    . DT  C 1 3   ? 24.263  80.326  34.989  1.00 13.25 ? 1803 DT  H O4    1 
ATOM   688  C  C5    . DT  C 1 3   ? 25.832  81.634  33.835  1.00 12.89 ? 1803 DT  H C5    1 
ATOM   689  C  C7    . DT  C 1 3   ? 27.004  81.027  34.543  1.00 12.95 ? 1803 DT  H C7    1 
ATOM   690  C  C6    . DT  C 1 3   ? 25.981  82.591  32.901  1.00 13.63 ? 1803 DT  H C6    1 
ATOM   691  P  P     . DT  C 1 4   ? 26.576  88.436  30.675  1.00 20.57 ? 1804 DT  H P     1 
ATOM   692  O  OP1   . DT  C 1 4   ? 27.128  89.442  29.735  1.00 20.07 ? 1804 DT  H OP1   1 
ATOM   693  O  OP2   . DT  C 1 4   ? 27.291  88.180  31.952  1.00 19.45 ? 1804 DT  H OP2   1 
ATOM   694  O  "O5'" . DT  C 1 4   ? 25.092  88.847  31.121  1.00 20.04 ? 1804 DT  H "O5'" 1 
ATOM   695  C  "C5'" . DT  C 1 4   ? 23.933  88.326  30.445  1.00 19.68 ? 1804 DT  H "C5'" 1 
ATOM   696  C  "C4'" . DT  C 1 4   ? 22.696  88.550  31.294  1.00 19.02 ? 1804 DT  H "C4'" 1 
ATOM   697  O  "O4'" . DT  C 1 4   ? 22.449  87.389  32.133  1.00 18.44 ? 1804 DT  H "O4'" 1 
ATOM   698  C  "C3'" . DT  C 1 4   ? 22.786  89.726  32.254  1.00 18.24 ? 1804 DT  H "C3'" 1 
ATOM   699  O  "O3'" . DT  C 1 4   ? 21.508  90.315  32.383  1.00 18.73 ? 1804 DT  H "O3'" 1 
ATOM   700  C  "C2'" . DT  C 1 4   ? 23.250  89.066  33.541  1.00 17.83 ? 1804 DT  H "C2'" 1 
ATOM   701  C  "C1'" . DT  C 1 4   ? 22.477  87.752  33.498  1.00 17.48 ? 1804 DT  H "C1'" 1 
ATOM   702  N  N1    . DT  C 1 4   ? 23.025  86.573  34.302  1.00 17.15 ? 1804 DT  H N1    1 
ATOM   703  C  C2    . DT  C 1 4   ? 22.122  85.656  34.828  1.00 16.58 ? 1804 DT  H C2    1 
ATOM   704  O  O2    . DT  C 1 4   ? 20.910  85.730  34.692  1.00 16.27 ? 1804 DT  H O2    1 
ATOM   705  N  N3    . DT  C 1 4   ? 22.686  84.617  35.528  1.00 15.94 ? 1804 DT  H N3    1 
ATOM   706  C  C4    . DT  C 1 4   ? 24.034  84.412  35.764  1.00 15.86 ? 1804 DT  H C4    1 
ATOM   707  O  O4    . DT  C 1 4   ? 24.419  83.444  36.412  1.00 16.50 ? 1804 DT  H O4    1 
ATOM   708  C  C5    . DT  C 1 4   ? 24.938  85.391  35.195  1.00 15.61 ? 1804 DT  H C5    1 
ATOM   709  C  C7    . DT  C 1 4   ? 26.431  85.277  35.375  1.00 15.02 ? 1804 DT  H C7    1 
ATOM   710  C  C6    . DT  C 1 4   ? 24.394  86.407  34.505  1.00 16.17 ? 1804 DT  H C6    1 
ATOM   711  P  P     . DG  C 1 5   ? 21.315  91.799  32.948  1.00 19.74 ? 1805 DG  H P     1 
ATOM   712  O  OP1   . DG  C 1 5   ? 20.433  92.514  31.989  1.00 19.52 ? 1805 DG  H OP1   1 
ATOM   713  O  OP2   . DG  C 1 5   ? 22.635  92.353  33.353  1.00 19.49 ? 1805 DG  H OP2   1 
ATOM   714  O  "O5'" . DG  C 1 5   ? 20.500  91.535  34.302  1.00 18.61 ? 1805 DG  H "O5'" 1 
ATOM   715  C  "C5'" . DG  C 1 5   ? 19.292  90.779  34.273  1.00 16.98 ? 1805 DG  H "C5'" 1 
ATOM   716  C  "C4'" . DG  C 1 5   ? 18.964  90.233  35.644  1.00 16.01 ? 1805 DG  H "C4'" 1 
ATOM   717  O  "O4'" . DG  C 1 5   ? 19.842  89.121  35.941  1.00 15.61 ? 1805 DG  H "O4'" 1 
ATOM   718  C  "C3'" . DG  C 1 5   ? 19.122  91.210  36.812  1.00 15.68 ? 1805 DG  H "C3'" 1 
ATOM   719  O  "O3'" . DG  C 1 5   ? 17.813  91.523  37.280  1.00 15.28 ? 1805 DG  H "O3'" 1 
ATOM   720  C  "C2'" . DG  C 1 5   ? 19.990  90.450  37.829  1.00 15.37 ? 1805 DG  H "C2'" 1 
ATOM   721  C  "C1'" . DG  C 1 5   ? 19.873  89.006  37.342  1.00 15.06 ? 1805 DG  H "C1'" 1 
ATOM   722  N  N9    . DG  C 1 5   ? 20.967  88.113  37.694  1.00 14.68 ? 1805 DG  H N9    1 
ATOM   723  C  C8    . DG  C 1 5   ? 22.290  88.230  37.323  1.00 15.44 ? 1805 DG  H C8    1 
ATOM   724  N  N7    . DG  C 1 5   ? 23.054  87.272  37.787  1.00 14.92 ? 1805 DG  H N7    1 
ATOM   725  C  C5    . DG  C 1 5   ? 22.173  86.470  38.504  1.00 13.54 ? 1805 DG  H C5    1 
ATOM   726  C  C6    . DG  C 1 5   ? 22.409  85.285  39.223  1.00 12.05 ? 1805 DG  H C6    1 
ATOM   727  O  O6    . DG  C 1 5   ? 23.490  84.714  39.362  1.00 13.14 ? 1805 DG  H O6    1 
ATOM   728  N  N1    . DG  C 1 5   ? 21.260  84.769  39.818  1.00 10.81 ? 1805 DG  H N1    1 
ATOM   729  C  C2    . DG  C 1 5   ? 20.017  85.341  39.710  1.00 10.46 ? 1805 DG  H C2    1 
ATOM   730  N  N2    . DG  C 1 5   ? 19.009  84.729  40.340  1.00 9.14  ? 1805 DG  H N2    1 
ATOM   731  N  N3    . DG  C 1 5   ? 19.776  86.452  39.033  1.00 12.17 ? 1805 DG  H N3    1 
ATOM   732  C  C4    . DG  C 1 5   ? 20.890  86.965  38.454  1.00 13.65 ? 1805 DG  H C4    1 
ATOM   733  P  P     . DG  C 1 6   ? 17.541  92.623  38.396  1.00 15.26 ? 1806 DG  H P     1 
ATOM   734  O  OP1   . DG  C 1 6   ? 16.178  93.162  38.229  1.00 14.73 ? 1806 DG  H OP1   1 
ATOM   735  O  OP2   . DG  C 1 6   ? 18.724  93.505  38.423  1.00 15.31 ? 1806 DG  H OP2   1 
ATOM   736  O  "O5'" . DG  C 1 6   ? 17.487  91.742  39.720  1.00 15.82 ? 1806 DG  H "O5'" 1 
ATOM   737  C  "C5'" . DG  C 1 6   ? 16.373  90.875  39.934  1.00 14.90 ? 1806 DG  H "C5'" 1 
ATOM   738  C  "C4'" . DG  C 1 6   ? 16.671  90.040  41.154  1.00 15.08 ? 1806 DG  H "C4'" 1 
ATOM   739  O  "O4'" . DG  C 1 6   ? 17.918  89.341  40.899  1.00 15.47 ? 1806 DG  H "O4'" 1 
ATOM   740  C  "C3'" . DG  C 1 6   ? 16.893  90.847  42.440  1.00 14.76 ? 1806 DG  H "C3'" 1 
ATOM   741  O  "O3'" . DG  C 1 6   ? 16.233  90.233  43.551  1.00 15.00 ? 1806 DG  H "O3'" 1 
ATOM   742  C  "C2'" . DG  C 1 6   ? 18.410  90.824  42.597  1.00 14.77 ? 1806 DG  H "C2'" 1 
ATOM   743  C  "C1'" . DG  C 1 6   ? 18.694  89.426  42.077  1.00 15.33 ? 1806 DG  H "C1'" 1 
ATOM   744  N  N9    . DG  C 1 6   ? 20.092  89.091  41.789  1.00 15.47 ? 1806 DG  H N9    1 
ATOM   745  C  C8    . DG  C 1 6   ? 21.030  89.792  41.063  1.00 15.61 ? 1806 DG  H C8    1 
ATOM   746  N  N7    . DG  C 1 6   ? 22.198  89.199  41.003  1.00 15.40 ? 1806 DG  H N7    1 
ATOM   747  C  C5    . DG  C 1 6   ? 22.019  88.024  41.736  1.00 15.24 ? 1806 DG  H C5    1 
ATOM   748  C  C6    . DG  C 1 6   ? 22.913  86.960  42.042  1.00 14.73 ? 1806 DG  H C6    1 
ATOM   749  O  O6    . DG  C 1 6   ? 24.103  86.820  41.716  1.00 15.33 ? 1806 DG  H O6    1 
ATOM   750  N  N1    . DG  C 1 6   ? 22.315  85.974  42.824  1.00 14.04 ? 1806 DG  H N1    1 
ATOM   751  C  C2    . DG  C 1 6   ? 21.011  85.995  43.260  1.00 13.96 ? 1806 DG  H C2    1 
ATOM   752  N  N2    . DG  C 1 6   ? 20.600  84.951  43.998  1.00 12.85 ? 1806 DG  H N2    1 
ATOM   753  N  N3    . DG  C 1 6   ? 20.168  86.980  42.986  1.00 14.66 ? 1806 DG  H N3    1 
ATOM   754  C  C4    . DG  C 1 6   ? 20.731  87.952  42.223  1.00 14.99 ? 1806 DG  H C4    1 
ATOM   755  P  P     . DA  C 1 7   ? 15.858  91.077  44.860  1.00 14.59 ? 1807 DA  H P     1 
ATOM   756  O  OP1   . DA  C 1 7   ? 14.413  91.375  44.845  1.00 14.54 ? 1807 DA  H OP1   1 
ATOM   757  O  OP2   . DA  C 1 7   ? 16.889  92.123  45.000  1.00 14.81 ? 1807 DA  H OP2   1 
ATOM   758  O  "O5'" . DA  C 1 7   ? 16.098  90.115  46.096  1.00 15.05 ? 1807 DA  H "O5'" 1 
ATOM   759  C  "C5'" . DA  C 1 7   ? 15.945  88.703  46.025  1.00 15.06 ? 1807 DA  H "C5'" 1 
ATOM   760  C  "C4'" . DA  C 1 7   ? 17.040  88.019  46.829  1.00 14.43 ? 1807 DA  H "C4'" 1 
ATOM   761  O  "O4'" . DA  C 1 7   ? 18.279  88.099  46.085  1.00 13.90 ? 1807 DA  H "O4'" 1 
ATOM   762  C  "C3'" . DA  C 1 7   ? 17.346  88.624  48.203  1.00 13.72 ? 1807 DA  H "C3'" 1 
ATOM   763  O  "O3'" . DA  C 1 7   ? 17.061  87.672  49.214  1.00 14.05 ? 1807 DA  H "O3'" 1 
ATOM   764  C  "C2'" . DA  C 1 7   ? 18.829  89.000  48.113  1.00 13.59 ? 1807 DA  H "C2'" 1 
ATOM   765  C  "C1'" . DA  C 1 7   ? 19.324  88.068  47.022  1.00 12.94 ? 1807 DA  H "C1'" 1 
ATOM   766  N  N9    . DA  C 1 7   ? 20.518  88.424  46.274  1.00 11.88 ? 1807 DA  H N9    1 
ATOM   767  C  C8    . DA  C 1 7   ? 20.697  89.506  45.462  1.00 12.50 ? 1807 DA  H C8    1 
ATOM   768  N  N7    . DA  C 1 7   ? 21.876  89.562  44.886  1.00 12.03 ? 1807 DA  H N7    1 
ATOM   769  C  C5    . DA  C 1 7   ? 22.503  88.423  45.345  1.00 10.99 ? 1807 DA  H C5    1 
ATOM   770  C  C6    . DA  C 1 7   ? 23.779  87.894  45.100  1.00 10.39 ? 1807 DA  H C6    1 
ATOM   771  N  N6    . DA  C 1 7   ? 24.673  88.479  44.300  1.00 9.97  ? 1807 DA  H N6    1 
ATOM   772  N  N1    . DA  C 1 7   ? 24.090  86.730  45.714  1.00 11.02 ? 1807 DA  H N1    1 
ATOM   773  C  C2    . DA  C 1 7   ? 23.187  86.140  46.515  1.00 10.87 ? 1807 DA  H C2    1 
ATOM   774  N  N3    . DA  C 1 7   ? 21.958  86.552  46.824  1.00 11.08 ? 1807 DA  H N3    1 
ATOM   775  C  C4    . DA  C 1 7   ? 21.678  87.707  46.197  1.00 11.25 ? 1807 DA  H C4    1 
ATOM   776  P  P     . DT  C 1 8   ? 17.169  88.056  50.765  1.00 16.82 ? 1808 DT  H P     1 
ATOM   777  O  OP1   . DT  C 1 8   ? 16.157  87.307  51.554  1.00 14.81 ? 1808 DT  H OP1   1 
ATOM   778  O  OP2   . DT  C 1 8   ? 17.303  89.532  50.914  1.00 15.64 ? 1808 DT  H OP2   1 
ATOM   779  O  "O5'" . DT  C 1 8   ? 18.615  87.477  51.100  1.00 16.77 ? 1808 DT  H "O5'" 1 
ATOM   780  C  "C5'" . DT  C 1 8   ? 18.916  86.095  51.061  1.00 16.16 ? 1808 DT  H "C5'" 1 
ATOM   781  C  "C4'" . DT  C 1 8   ? 20.403  85.983  51.311  1.00 15.82 ? 1808 DT  H "C4'" 1 
ATOM   782  O  "O4'" . DT  C 1 8   ? 21.096  86.621  50.209  1.00 14.96 ? 1808 DT  H "O4'" 1 
ATOM   783  C  "C3'" . DT  C 1 8   ? 20.900  86.687  52.582  1.00 15.71 ? 1808 DT  H "C3'" 1 
ATOM   784  O  "O3'" . DT  C 1 8   ? 21.228  85.688  53.571  1.00 16.40 ? 1808 DT  H "O3'" 1 
ATOM   785  C  "C2'" . DT  C 1 8   ? 22.084  87.532  52.097  1.00 15.08 ? 1808 DT  H "C2'" 1 
ATOM   786  C  "C1'" . DT  C 1 8   ? 22.365  86.995  50.693  1.00 14.42 ? 1808 DT  H "C1'" 1 
ATOM   787  N  N1    . DT  C 1 8   ? 22.993  87.975  49.735  1.00 13.47 ? 1808 DT  H N1    1 
ATOM   788  C  C2    . DT  C 1 8   ? 24.234  87.725  49.168  1.00 12.16 ? 1808 DT  H C2    1 
ATOM   789  O  O2    . DT  C 1 8   ? 24.891  86.726  49.381  1.00 12.16 ? 1808 DT  H O2    1 
ATOM   790  N  N3    . DT  C 1 8   ? 24.701  88.686  48.307  1.00 11.38 ? 1808 DT  H N3    1 
ATOM   791  C  C4    . DT  C 1 8   ? 24.065  89.869  47.973  1.00 12.38 ? 1808 DT  H C4    1 
ATOM   792  O  O4    . DT  C 1 8   ? 24.582  90.661  47.184  1.00 11.67 ? 1808 DT  H O4    1 
ATOM   793  C  C5    . DT  C 1 8   ? 22.765  90.081  48.595  1.00 13.01 ? 1808 DT  H C5    1 
ATOM   794  C  C7    . DT  C 1 8   ? 21.945  91.313  48.325  1.00 13.08 ? 1808 DT  H C7    1 
ATOM   795  C  C6    . DT  C 1 8   ? 22.305  89.139  49.435  1.00 13.25 ? 1808 DT  H C6    1 
ATOM   796  P  P     . DG  C 1 9   ? 21.767  85.946  55.068  1.00 16.75 ? 1809 DG  H P     1 
ATOM   797  O  OP1   . DG  C 1 9   ? 21.483  84.669  55.762  1.00 16.52 ? 1809 DG  H OP1   1 
ATOM   798  O  OP2   . DG  C 1 9   ? 21.312  87.236  55.676  1.00 14.63 ? 1809 DG  H OP2   1 
ATOM   799  O  "O5'" . DG  C 1 9   ? 23.348  86.037  54.804  1.00 16.63 ? 1809 DG  H "O5'" 1 
ATOM   800  C  "C5'" . DG  C 1 9   ? 24.076  84.920  54.251  1.00 15.97 ? 1809 DG  H "C5'" 1 
ATOM   801  C  "C4'" . DG  C 1 9   ? 25.566  85.225  54.095  1.00 15.89 ? 1809 DG  H "C4'" 1 
ATOM   802  O  "O4'" . DG  C 1 9   ? 25.785  85.999  52.876  1.00 15.49 ? 1809 DG  H "O4'" 1 
ATOM   803  C  "C3'" . DG  C 1 9   ? 26.202  86.027  55.243  1.00 15.42 ? 1809 DG  H "C3'" 1 
ATOM   804  O  "O3'" . DG  C 1 9   ? 27.426  85.454  55.676  1.00 15.78 ? 1809 DG  H "O3'" 1 
ATOM   805  C  "C2'" . DG  C 1 9   ? 26.412  87.414  54.646  1.00 14.86 ? 1809 DG  H "C2'" 1 
ATOM   806  C  "C1'" . DG  C 1 9   ? 26.645  87.087  53.176  1.00 14.36 ? 1809 DG  H "C1'" 1 
ATOM   807  N  N9    . DG  C 1 9   ? 26.409  88.249  52.316  1.00 11.78 ? 1809 DG  H N9    1 
ATOM   808  C  C8    . DG  C 1 9   ? 25.312  89.070  52.281  1.00 10.66 ? 1809 DG  H C8    1 
ATOM   809  N  N7    . DG  C 1 9   ? 25.418  90.037  51.414  1.00 10.29 ? 1809 DG  H N7    1 
ATOM   810  C  C5    . DG  C 1 9   ? 26.667  89.849  50.846  1.00 9.44  ? 1809 DG  H C5    1 
ATOM   811  C  C6    . DG  C 1 9   ? 27.349  90.583  49.843  1.00 9.04  ? 1809 DG  H C6    1 
ATOM   812  O  O6    . DG  C 1 9   ? 26.965  91.586  49.228  1.00 8.75  ? 1809 DG  H O6    1 
ATOM   813  N  N1    . DG  C 1 9   ? 28.610  90.055  49.553  1.00 8.27  ? 1809 DG  H N1    1 
ATOM   814  C  C2    . DG  C 1 9   ? 29.145  88.954  50.180  1.00 7.47  ? 1809 DG  H C2    1 
ATOM   815  N  N2    . DG  C 1 9   ? 30.362  88.574  49.781  1.00 5.44  ? 1809 DG  H N2    1 
ATOM   816  N  N3    . DG  C 1 9   ? 28.512  88.251  51.108  1.00 9.02  ? 1809 DG  H N3    1 
ATOM   817  C  C4    . DG  C 1 9   ? 27.287  88.756  51.394  1.00 9.96  ? 1809 DG  H C4    1 
ATOM   818  P  P     . DG  C 1 10  ? 28.252  86.094  56.898  1.00 17.04 ? 1810 DG  H P     1 
ATOM   819  O  OP1   . DG  C 1 10  ? 28.843  84.988  57.676  1.00 16.13 ? 1810 DG  H OP1   1 
ATOM   820  O  OP2   . DG  C 1 10  ? 27.471  87.165  57.567  1.00 17.08 ? 1810 DG  H OP2   1 
ATOM   821  O  "O5'" . DG  C 1 10  ? 29.432  86.833  56.121  1.00 17.60 ? 1810 DG  H "O5'" 1 
ATOM   822  C  "C5'" . DG  C 1 10  ? 30.168  86.124  55.130  1.00 17.54 ? 1810 DG  H "C5'" 1 
ATOM   823  C  "C4'" . DG  C 1 10  ? 30.971  87.111  54.315  1.00 17.42 ? 1810 DG  H "C4'" 1 
ATOM   824  O  "O4'" . DG  C 1 10  ? 30.106  88.104  53.720  1.00 16.56 ? 1810 DG  H "O4'" 1 
ATOM   825  C  "C3'" . DG  C 1 10  ? 31.972  87.908  55.136  1.00 17.44 ? 1810 DG  H "C3'" 1 
ATOM   826  O  "O3'" . DG  C 1 10  ? 33.225  87.243  55.021  1.00 18.87 ? 1810 DG  H "O3'" 1 
ATOM   827  C  "C2'" . DG  C 1 10  ? 31.923  89.306  54.507  1.00 17.15 ? 1810 DG  H "C2'" 1 
ATOM   828  C  "C1'" . DG  C 1 10  ? 30.936  89.173  53.356  1.00 15.81 ? 1810 DG  H "C1'" 1 
ATOM   829  N  N9    . DG  C 1 10  ? 30.106  90.350  53.118  1.00 15.43 ? 1810 DG  H N9    1 
ATOM   830  C  C8    . DG  C 1 10  ? 28.879  90.659  53.664  1.00 15.38 ? 1810 DG  H C8    1 
ATOM   831  N  N7    . DG  C 1 10  ? 28.391  91.796  53.228  1.00 15.02 ? 1810 DG  H N7    1 
ATOM   832  C  C5    . DG  C 1 10  ? 29.352  92.271  52.351  1.00 13.83 ? 1810 DG  H C5    1 
ATOM   833  C  C6    . DG  C 1 10  ? 29.388  93.451  51.571  1.00 14.31 ? 1810 DG  H C6    1 
ATOM   834  O  O6    . DG  C 1 10  ? 28.547  94.355  51.503  1.00 15.87 ? 1810 DG  H O6    1 
ATOM   835  N  N1    . DG  C 1 10  ? 30.546  93.552  50.802  1.00 13.99 ? 1810 DG  H N1    1 
ATOM   836  C  C2    . DG  C 1 10  ? 31.543  92.597  50.794  1.00 13.11 ? 1810 DG  H C2    1 
ATOM   837  N  N2    . DG  C 1 10  ? 32.596  92.826  50.003  1.00 12.44 ? 1810 DG  H N2    1 
ATOM   838  N  N3    . DG  C 1 10  ? 31.524  91.491  51.519  1.00 13.06 ? 1810 DG  H N3    1 
ATOM   839  C  C4    . DG  C 1 10  ? 30.404  91.391  52.269  1.00 14.13 ? 1810 DG  H C4    1 
ATOM   840  P  P     . DT  C 1 11  ? 34.524  87.694  55.835  1.00 20.70 ? 1811 DT  H P     1 
ATOM   841  O  OP1   . DT  C 1 11  ? 35.528  86.599  55.704  1.00 19.69 ? 1811 DT  H OP1   1 
ATOM   842  O  OP2   . DT  C 1 11  ? 34.105  88.172  57.176  1.00 21.38 ? 1811 DT  H OP2   1 
ATOM   843  O  "O5'" . DT  C 1 11  ? 35.025  88.987  55.020  1.00 18.75 ? 1811 DT  H "O5'" 1 
ATOM   844  C  "C5'" . DT  C 1 11  ? 35.581  88.856  53.697  1.00 16.46 ? 1811 DT  H "C5'" 1 
ATOM   845  C  "C4'" . DT  C 1 11  ? 36.182  90.167  53.238  1.00 15.20 ? 1811 DT  H "C4'" 1 
ATOM   846  O  "O4'" . DT  C 1 11  ? 35.082  91.033  52.859  1.00 14.04 ? 1811 DT  H "O4'" 1 
ATOM   847  C  "C3'" . DT  C 1 11  ? 37.006  90.917  54.288  1.00 14.55 ? 1811 DT  H "C3'" 1 
ATOM   848  O  "O3'" . DT  C 1 11  ? 38.366  91.041  53.887  1.00 14.84 ? 1811 DT  H "O3'" 1 
ATOM   849  C  "C2'" . DT  C 1 11  ? 36.314  92.270  54.417  1.00 13.96 ? 1811 DT  H "C2'" 1 
ATOM   850  C  "C1'" . DT  C 1 11  ? 35.446  92.351  53.167  1.00 13.64 ? 1811 DT  H "C1'" 1 
ATOM   851  N  N1    . DT  C 1 11  ? 34.229  93.206  53.360  1.00 12.35 ? 1811 DT  H N1    1 
ATOM   852  C  C2    . DT  C 1 11  ? 34.129  94.348  52.605  1.00 12.48 ? 1811 DT  H C2    1 
ATOM   853  O  O2    . DT  C 1 11  ? 34.977  94.673  51.792  1.00 12.89 ? 1811 DT  H O2    1 
ATOM   854  N  N3    . DT  C 1 11  ? 33.010  95.106  52.843  1.00 12.45 ? 1811 DT  H N3    1 
ATOM   855  C  C4    . DT  C 1 11  ? 31.995  94.815  53.741  1.00 12.53 ? 1811 DT  H C4    1 
ATOM   856  O  O4    . DT  C 1 11  ? 31.026  95.565  53.861  1.00 12.76 ? 1811 DT  H O4    1 
ATOM   857  C  C5    . DT  C 1 11  ? 32.163  93.599  54.512  1.00 11.73 ? 1811 DT  H C5    1 
ATOM   858  C  C7    . DT  C 1 11  ? 31.141  93.170  55.528  1.00 11.97 ? 1811 DT  H C7    1 
ATOM   859  C  C6    . DT  C 1 11  ? 33.258  92.865  54.282  1.00 11.32 ? 1811 DT  H C6    1 
ATOM   860  P  P     . DA  C 1 12  ? 39.420  91.825  54.806  1.00 15.82 ? 1812 DA  H P     1 
ATOM   861  O  OP1   . DA  C 1 12  ? 40.702  91.122  54.685  1.00 15.99 ? 1812 DA  H OP1   1 
ATOM   862  O  OP2   . DA  C 1 12  ? 38.890  92.102  56.165  1.00 14.97 ? 1812 DA  H OP2   1 
ATOM   863  O  "O5'" . DA  C 1 12  ? 39.491  93.215  54.014  1.00 14.16 ? 1812 DA  H "O5'" 1 
ATOM   864  C  "C5'" . DA  C 1 12  ? 39.899  93.272  52.654  1.00 12.68 ? 1812 DA  H "C5'" 1 
ATOM   865  C  "C4'" . DA  C 1 12  ? 40.200  94.704  52.236  1.00 12.00 ? 1812 DA  H "C4'" 1 
ATOM   866  O  "O4'" . DA  C 1 12  ? 38.982  95.491  52.213  1.00 10.96 ? 1812 DA  H "O4'" 1 
ATOM   867  C  "C3'" . DA  C 1 12  ? 41.131  95.489  53.148  1.00 11.75 ? 1812 DA  H "C3'" 1 
ATOM   868  O  "O3'" . DA  C 1 12  ? 41.892  96.401  52.369  1.00 12.60 ? 1812 DA  H "O3'" 1 
ATOM   869  C  "C2'" . DA  C 1 12  ? 40.175  96.196  54.098  1.00 10.89 ? 1812 DA  H "C2'" 1 
ATOM   870  C  "C1'" . DA  C 1 12  ? 39.051  96.547  53.149  1.00 10.71 ? 1812 DA  H "C1'" 1 
ATOM   871  N  N9    . DA  C 1 12  ? 37.721  96.683  53.736  1.00 10.58 ? 1812 DA  H N9    1 
ATOM   872  C  C8    . DA  C 1 12  ? 37.116  95.927  54.701  1.00 10.26 ? 1812 DA  H C8    1 
ATOM   873  N  N7    . DA  C 1 12  ? 35.893  96.304  54.983  1.00 9.67  ? 1812 DA  H N7    1 
ATOM   874  C  C5    . DA  C 1 12  ? 35.681  97.381  54.146  1.00 10.00 ? 1812 DA  H C5    1 
ATOM   875  C  C6    . DA  C 1 12  ? 34.580  98.242  53.944  1.00 9.97  ? 1812 DA  H C6    1 
ATOM   876  N  N6    . DA  C 1 12  ? 33.425  98.147  54.602  1.00 9.11  ? 1812 DA  H N6    1 
ATOM   877  N  N1    . DA  C 1 12  ? 34.712  99.215  53.015  1.00 10.45 ? 1812 DA  H N1    1 
ATOM   878  C  C2    . DA  C 1 12  ? 35.857  99.315  52.326  1.00 10.81 ? 1812 DA  H C2    1 
ATOM   879  N  N3    . DA  C 1 12  ? 36.956  98.567  52.426  1.00 10.68 ? 1812 DA  H N3    1 
ATOM   880  C  C4    . DA  C 1 12  ? 36.796  97.616  53.364  1.00 10.37 ? 1812 DA  H C4    1 
ATOM   881  P  P     . DG  C 1 13  ? 43.124  97.191  52.998  1.00 14.32 ? 1813 DG  H P     1 
ATOM   882  O  OP1   . DG  C 1 13  ? 44.026  97.549  51.886  1.00 15.05 ? 1813 DG  H OP1   1 
ATOM   883  O  OP2   . DG  C 1 13  ? 43.643  96.406  54.146  1.00 15.08 ? 1813 DG  H OP2   1 
ATOM   884  O  "O5'" . DG  C 1 13  ? 42.433  98.531  53.510  1.00 15.17 ? 1813 DG  H "O5'" 1 
ATOM   885  C  "C5'" . DG  C 1 13  ? 41.881  99.352  52.488  1.00 17.79 ? 1813 DG  H "C5'" 1 
ATOM   886  C  "C4'" . DG  C 1 13  ? 41.147  100.554 53.027  1.00 19.56 ? 1813 DG  H "C4'" 1 
ATOM   887  O  "O4'" . DG  C 1 13  ? 39.851  100.128 53.521  1.00 19.28 ? 1813 DG  H "O4'" 1 
ATOM   888  C  "C3'" . DG  C 1 13  ? 41.856  101.260 54.177  1.00 22.16 ? 1813 DG  H "C3'" 1 
ATOM   889  O  "O3'" . DG  C 1 13  ? 41.736  102.677 54.000  1.00 27.88 ? 1813 DG  H "O3'" 1 
ATOM   890  C  "C2'" . DG  C 1 13  ? 41.105  100.711 55.385  1.00 20.91 ? 1813 DG  H "C2'" 1 
ATOM   891  C  "C1'" . DG  C 1 13  ? 39.702  100.727 54.784  1.00 19.75 ? 1813 DG  H "C1'" 1 
ATOM   892  N  N9    . DG  C 1 13  ? 38.660  100.055 55.555  1.00 17.92 ? 1813 DG  H N9    1 
ATOM   893  C  C8    . DG  C 1 13  ? 38.703  98.898  56.301  1.00 16.83 ? 1813 DG  H C8    1 
ATOM   894  N  N7    . DG  C 1 13  ? 37.556  98.616  56.865  1.00 15.93 ? 1813 DG  H N7    1 
ATOM   895  C  C5    . DG  C 1 13  ? 36.721  99.662  56.474  1.00 15.41 ? 1813 DG  H C5    1 
ATOM   896  C  C6    . DG  C 1 13  ? 35.364  99.939  56.757  1.00 14.35 ? 1813 DG  H C6    1 
ATOM   897  O  O6    . DG  C 1 13  ? 34.572  99.292  57.448  1.00 14.85 ? 1813 DG  H O6    1 
ATOM   898  N  N1    . DG  C 1 13  ? 34.923  101.110 56.153  1.00 14.07 ? 1813 DG  H N1    1 
ATOM   899  C  C2    . DG  C 1 13  ? 35.692  101.932 55.361  1.00 14.86 ? 1813 DG  H C2    1 
ATOM   900  N  N2    . DG  C 1 13  ? 35.106  103.027 54.845  1.00 13.37 ? 1813 DG  H N2    1 
ATOM   901  N  N3    . DG  C 1 13  ? 36.961  101.684 55.086  1.00 15.54 ? 1813 DG  H N3    1 
ATOM   902  C  C4    . DG  C 1 13  ? 37.393  100.545 55.672  1.00 16.16 ? 1813 DG  H C4    1 
HETATM 903  N  N1    . DOC C 1 14  ? 38.562  105.489 56.139  1.00 32.77 ? 1814 DOC H N1    1 
HETATM 904  C  C2    . DOC C 1 14  ? 37.284  105.425 56.738  1.00 31.18 ? 1814 DOC H C2    1 
HETATM 905  N  N3    . DOC C 1 14  ? 36.998  104.365 57.526  1.00 29.51 ? 1814 DOC H N3    1 
HETATM 906  C  C4    . DOC C 1 14  ? 37.898  103.409 57.730  1.00 29.32 ? 1814 DOC H C4    1 
HETATM 907  C  C5    . DOC C 1 14  ? 39.197  103.451 57.135  1.00 29.94 ? 1814 DOC H C5    1 
HETATM 908  C  C6    . DOC C 1 14  ? 39.493  104.500 56.350  1.00 30.81 ? 1814 DOC H C6    1 
HETATM 909  O  O2    . DOC C 1 14  ? 36.447  106.321 56.540  1.00 30.09 ? 1814 DOC H O2    1 
HETATM 910  N  N4    . DOC C 1 14  ? 37.530  102.404 58.526  1.00 29.05 ? 1814 DOC H N4    1 
HETATM 911  C  "C1'" . DOC C 1 14  ? 38.904  106.647 55.256  1.00 34.51 ? 1814 DOC H "C1'" 1 
HETATM 912  C  "C2'" . DOC C 1 14  ? 39.994  107.564 55.800  1.00 35.87 ? 1814 DOC H "C2'" 1 
HETATM 913  C  "C3'" . DOC C 1 14  ? 41.109  107.566 54.750  1.00 36.96 ? 1814 DOC H "C3'" 1 
HETATM 914  C  "C4'" . DOC C 1 14  ? 40.605  106.661 53.620  1.00 36.83 ? 1814 DOC H "C4'" 1 
HETATM 915  O  "O4'" . DOC C 1 14  ? 39.339  106.092 54.038  1.00 35.90 ? 1814 DOC H "O4'" 1 
HETATM 916  C  "C5'" . DOC C 1 14  ? 41.537  105.512 53.308  1.00 35.83 ? 1814 DOC H "C5'" 1 
HETATM 917  O  "O5'" . DOC C 1 14  ? 42.038  105.018 54.541  1.00 34.34 ? 1814 DOC H "O5'" 1 
HETATM 918  P  P     . DOC C 1 14  ? 42.886  103.684 54.504  1.00 33.46 ? 1814 DOC H P     1 
HETATM 919  O  OP1   . DOC C 1 14  ? 43.865  103.903 53.415  1.00 35.60 ? 1814 DOC H OP1   1 
HETATM 920  O  OP2   . DOC C 1 14  ? 43.313  103.226 55.852  1.00 32.27 ? 1814 DOC H OP2   1 
ATOM   921  O  "O5'" . DA  D 2 3   ? 33.106  91.095  72.837  1.00 18.69 ? 1903 DA  J "O5'" 1 
ATOM   922  C  "C5'" . DA  D 2 3   ? 32.985  92.028  71.749  1.00 19.84 ? 1903 DA  J "C5'" 1 
ATOM   923  C  "C4'" . DA  D 2 3   ? 31.631  92.734  71.726  1.00 20.30 ? 1903 DA  J "C4'" 1 
ATOM   924  O  "O4'" . DA  D 2 3   ? 31.316  93.236  73.058  1.00 20.08 ? 1903 DA  J "O4'" 1 
ATOM   925  C  "C3'" . DA  D 2 3   ? 31.523  93.961  70.813  1.00 21.14 ? 1903 DA  J "C3'" 1 
ATOM   926  O  "O3'" . DA  D 2 3   ? 30.181  94.063  70.265  1.00 23.29 ? 1903 DA  J "O3'" 1 
ATOM   927  C  "C2'" . DA  D 2 3   ? 31.881  95.071  71.797  1.00 20.19 ? 1903 DA  J "C2'" 1 
ATOM   928  C  "C1'" . DA  D 2 3   ? 31.018  94.618  72.967  1.00 19.55 ? 1903 DA  J "C1'" 1 
ATOM   929  N  N9    . DA  D 2 3   ? 31.246  95.256  74.261  1.00 18.76 ? 1903 DA  J N9    1 
ATOM   930  C  C8    . DA  D 2 3   ? 32.396  95.273  75.005  1.00 19.02 ? 1903 DA  J C8    1 
ATOM   931  N  N7    . DA  D 2 3   ? 32.287  95.923  76.146  1.00 18.78 ? 1903 DA  J N7    1 
ATOM   932  C  C5    . DA  D 2 3   ? 30.972  96.362  76.146  1.00 18.41 ? 1903 DA  J C5    1 
ATOM   933  C  C6    . DA  D 2 3   ? 30.217  97.113  77.073  1.00 18.11 ? 1903 DA  J C6    1 
ATOM   934  N  N6    . DA  D 2 3   ? 30.715  97.572  78.226  1.00 17.92 ? 1903 DA  J N6    1 
ATOM   935  N  N1    . DA  D 2 3   ? 28.925  97.377  76.760  1.00 18.20 ? 1903 DA  J N1    1 
ATOM   936  C  C2    . DA  D 2 3   ? 28.421  96.917  75.603  1.00 17.92 ? 1903 DA  J C2    1 
ATOM   937  N  N3    . DA  D 2 3   ? 29.032  96.201  74.659  1.00 17.88 ? 1903 DA  J N3    1 
ATOM   938  C  C4    . DA  D 2 3   ? 30.315  95.956  74.993  1.00 18.31 ? 1903 DA  J C4    1 
ATOM   939  P  P     . DA  D 2 4   ? 29.643  95.284  69.350  1.00 26.24 ? 1904 DA  J P     1 
ATOM   940  O  OP1   . DA  D 2 4   ? 28.334  94.843  68.804  1.00 25.99 ? 1904 DA  J OP1   1 
ATOM   941  O  OP2   . DA  D 2 4   ? 30.703  95.663  68.370  1.00 25.72 ? 1904 DA  J OP2   1 
ATOM   942  O  "O5'" . DA  D 2 4   ? 29.397  96.512  70.392  1.00 24.69 ? 1904 DA  J "O5'" 1 
ATOM   943  C  "C5'" . DA  D 2 4   ? 28.082  97.094  70.587  1.00 23.57 ? 1904 DA  J "C5'" 1 
ATOM   944  C  "C4'" . DA  D 2 4   ? 28.050  98.400  71.383  1.00 23.20 ? 1904 DA  J "C4'" 1 
ATOM   945  O  "O4'" . DA  D 2 4   ? 29.074  98.403  72.425  1.00 23.01 ? 1904 DA  J "O4'" 1 
ATOM   946  C  "C3'" . DA  D 2 4   ? 28.281  99.699  70.597  1.00 22.88 ? 1904 DA  J "C3'" 1 
ATOM   947  O  "O3'" . DA  D 2 4   ? 27.556  100.821 71.176  1.00 23.66 ? 1904 DA  J "O3'" 1 
ATOM   948  C  "C2'" . DA  D 2 4   ? 29.783  99.845  70.779  1.00 22.57 ? 1904 DA  J "C2'" 1 
ATOM   949  C  "C1'" . DA  D 2 4   ? 29.846  99.579  72.276  1.00 22.39 ? 1904 DA  J "C1'" 1 
ATOM   950  N  N9    . DA  D 2 4   ? 31.192  99.414  72.816  1.00 22.47 ? 1904 DA  J N9    1 
ATOM   951  C  C8    . DA  D 2 4   ? 32.342  99.071  72.143  1.00 22.52 ? 1904 DA  J C8    1 
ATOM   952  N  N7    . DA  D 2 4   ? 33.411  99.017  72.916  1.00 22.73 ? 1904 DA  J N7    1 
ATOM   953  C  C5    . DA  D 2 4   ? 32.928  99.349  74.172  1.00 22.01 ? 1904 DA  J C5    1 
ATOM   954  C  C6    . DA  D 2 4   ? 33.561  99.468  75.422  1.00 21.87 ? 1904 DA  J C6    1 
ATOM   955  N  N6    . DA  D 2 4   ? 34.872  99.249  75.595  1.00 21.91 ? 1904 DA  J N6    1 
ATOM   956  N  N1    . DA  D 2 4   ? 32.788  99.820  76.478  1.00 21.66 ? 1904 DA  J N1    1 
ATOM   957  C  C2    . DA  D 2 4   ? 31.476  100.043 76.293  1.00 21.48 ? 1904 DA  J C2    1 
ATOM   958  N  N3    . DA  D 2 4   ? 30.768  99.955  75.165  1.00 21.36 ? 1904 DA  J N3    1 
ATOM   959  C  C4    . DA  D 2 4   ? 31.562  99.601  74.133  1.00 22.13 ? 1904 DA  J C4    1 
ATOM   960  P  P     . DC  D 2 5   ? 27.364  102.254 70.449  1.00 24.46 ? 1905 DC  J P     1 
ATOM   961  O  OP1   . DC  D 2 5   ? 27.416  103.361 71.439  1.00 21.91 ? 1905 DC  J OP1   1 
ATOM   962  O  OP2   . DC  D 2 5   ? 26.196  102.114 69.533  1.00 23.80 ? 1905 DC  J OP2   1 
ATOM   963  O  "O5'" . DC  D 2 5   ? 28.669  102.390 69.541  1.00 22.27 ? 1905 DC  J "O5'" 1 
ATOM   964  C  "C5'" . DC  D 2 5   ? 28.622  103.094 68.324  1.00 19.51 ? 1905 DC  J "C5'" 1 
ATOM   965  C  "C4'" . DC  D 2 5   ? 28.649  102.178 67.120  1.00 17.30 ? 1905 DC  J "C4'" 1 
ATOM   966  O  "O4'" . DC  D 2 5   ? 28.762  100.763 67.402  1.00 17.78 ? 1905 DC  J "O4'" 1 
ATOM   967  C  "C3'" . DC  D 2 5   ? 27.374  102.252 66.304  1.00 15.79 ? 1905 DC  J "C3'" 1 
ATOM   968  O  "O3'" . DC  D 2 5   ? 27.470  103.402 65.485  1.00 10.52 ? 1905 DC  J "O3'" 1 
ATOM   969  C  "C2'" . DC  D 2 5   ? 27.361  100.918 65.552  1.00 16.87 ? 1905 DC  J "C2'" 1 
ATOM   970  C  "C1'" . DC  D 2 5   ? 28.577  100.184 66.126  1.00 18.24 ? 1905 DC  J "C1'" 1 
ATOM   971  N  N1    . DC  D 2 5   ? 28.425  98.687  66.144  1.00 20.60 ? 1905 DC  J N1    1 
ATOM   972  C  C2    . DC  D 2 5   ? 29.273  97.887  65.334  1.00 22.58 ? 1905 DC  J C2    1 
ATOM   973  O  O2    . DC  D 2 5   ? 30.162  98.406  64.631  1.00 23.83 ? 1905 DC  J O2    1 
ATOM   974  N  N3    . DC  D 2 5   ? 29.111  96.536  65.340  1.00 22.62 ? 1905 DC  J N3    1 
ATOM   975  C  C4    . DC  D 2 5   ? 28.162  95.986  66.095  1.00 23.15 ? 1905 DC  J C4    1 
ATOM   976  N  N4    . DC  D 2 5   ? 28.055  94.653  66.064  1.00 23.95 ? 1905 DC  J N4    1 
ATOM   977  C  C5    . DC  D 2 5   ? 27.289  96.775  66.918  1.00 22.67 ? 1905 DC  J C5    1 
ATOM   978  C  C6    . DC  D 2 5   ? 27.448  98.107  66.909  1.00 21.41 ? 1905 DC  J C6    1 
HETATM 979  P  P     . 8OG D 2 6   ? 26.168  104.037 64.875  1.00 4.86  ? 1906 8OG J P     1 
HETATM 980  O  OP1   . 8OG D 2 6   ? 25.534  104.935 65.899  1.00 6.44  ? 1906 8OG J OP1   1 
HETATM 981  O  OP2   . 8OG D 2 6   ? 25.415  102.918 64.224  1.00 4.62  ? 1906 8OG J OP2   1 
HETATM 982  O  "O5'" . 8OG D 2 6   ? 26.756  104.984 63.725  1.00 7.30  ? 1906 8OG J "O5'" 1 
HETATM 983  C  "C5'" . 8OG D 2 6   ? 27.975  104.635 63.103  1.00 6.32  ? 1906 8OG J "C5'" 1 
HETATM 984  C  "C4'" . 8OG D 2 6   ? 28.207  105.385 61.846  1.00 6.72  ? 1906 8OG J "C4'" 1 
HETATM 985  O  "O4'" . 8OG D 2 6   ? 29.575  105.502 61.476  1.00 7.99  ? 1906 8OG J "O4'" 1 
HETATM 986  C  "C3'" . 8OG D 2 6   ? 27.457  105.339 60.770  1.00 7.48  ? 1906 8OG J "C3'" 1 
HETATM 987  O  "O3'" . 8OG D 2 6   ? 26.966  106.415 60.435  1.00 7.50  ? 1906 8OG J "O3'" 1 
HETATM 988  C  "C2'" . 8OG D 2 6   ? 28.140  104.406 59.796  1.00 7.63  ? 1906 8OG J "C2'" 1 
HETATM 989  C  "C1'" . 8OG D 2 6   ? 29.524  104.544 60.381  1.00 8.07  ? 1906 8OG J "C1'" 1 
HETATM 990  N  N9    . 8OG D 2 6   ? 30.570  103.707 60.311  1.00 7.22  ? 1906 8OG J N9    1 
HETATM 991  C  C8    . 8OG D 2 6   ? 30.620  102.575 60.963  1.00 6.52  ? 1906 8OG J C8    1 
HETATM 992  N  N7    . 8OG D 2 6   ? 31.796  101.968 60.809  1.00 6.43  ? 1906 8OG J N7    1 
HETATM 993  C  C5    . 8OG D 2 6   ? 32.542  102.812 60.068  1.00 6.56  ? 1906 8OG J C5    1 
HETATM 994  C  C6    . 8OG D 2 6   ? 33.915  102.821 59.519  1.00 7.21  ? 1906 8OG J C6    1 
HETATM 995  O  O6    . 8OG D 2 6   ? 34.708  101.867 59.729  1.00 8.55  ? 1906 8OG J O6    1 
HETATM 996  N  N1    . 8OG D 2 6   ? 34.291  103.890 58.797  1.00 7.07  ? 1906 8OG J N1    1 
HETATM 997  C  C2    . 8OG D 2 6   ? 33.474  104.941 58.544  1.00 7.90  ? 1906 8OG J C2    1 
HETATM 998  N  N2    . 8OG D 2 6   ? 33.929  105.983 57.800  1.00 6.17  ? 1906 8OG J N2    1 
HETATM 999  N  N3    . 8OG D 2 6   ? 32.211  104.997 59.007  1.00 8.42  ? 1906 8OG J N3    1 
HETATM 1000 C  C4    . 8OG D 2 6   ? 31.725  104.004 59.760  1.00 7.75  ? 1906 8OG J C4    1 
HETATM 1001 O  O8    . 8OG D 2 6   ? 29.614  102.098 61.604  1.00 6.83  ? 1906 8OG J O8    1 
ATOM   1002 P  P     . DC  D 2 7   ? 26.017  106.695 59.171  1.00 6.70  ? 1907 DC  J P     1 
ATOM   1003 O  OP1   . DC  D 2 7   ? 25.753  108.136 59.149  1.00 7.86  ? 1907 DC  J OP1   1 
ATOM   1004 O  OP2   . DC  D 2 7   ? 24.894  105.761 59.230  1.00 7.61  ? 1907 DC  J OP2   1 
ATOM   1005 O  "O5'" . DC  D 2 7   ? 26.844  106.301 57.861  1.00 9.51  ? 1907 DC  J "O5'" 1 
ATOM   1006 C  "C5'" . DC  D 2 7   ? 27.618  107.275 57.184  1.00 10.84 ? 1907 DC  J "C5'" 1 
ATOM   1007 C  "C4'" . DC  D 2 7   ? 28.573  106.631 56.198  1.00 11.08 ? 1907 DC  J "C4'" 1 
ATOM   1008 O  "O4'" . DC  D 2 7   ? 29.346  105.603 56.846  1.00 11.64 ? 1907 DC  J "O4'" 1 
ATOM   1009 C  "C3'" . DC  D 2 7   ? 27.907  105.935 55.023  1.00 10.92 ? 1907 DC  J "C3'" 1 
ATOM   1010 O  "O3'" . DC  D 2 7   ? 27.989  106.739 53.861  1.00 10.91 ? 1907 DC  J "O3'" 1 
ATOM   1011 C  "C2'" . DC  D 2 7   ? 28.686  104.634 54.889  1.00 11.41 ? 1907 DC  J "C2'" 1 
ATOM   1012 C  "C1'" . DC  D 2 7   ? 29.860  104.796 55.819  1.00 11.42 ? 1907 DC  J "C1'" 1 
ATOM   1013 N  N1    . DC  D 2 7   ? 30.371  103.497 56.376  1.00 11.93 ? 1907 DC  J N1    1 
ATOM   1014 C  C2    . DC  D 2 7   ? 31.659  103.055 56.057  1.00 12.47 ? 1907 DC  J C2    1 
ATOM   1015 O  O2    . DC  D 2 7   ? 32.372  103.732 55.300  1.00 13.64 ? 1907 DC  J O2    1 
ATOM   1016 N  N3    . DC  D 2 7   ? 32.093  101.886 56.584  1.00 11.99 ? 1907 DC  J N3    1 
ATOM   1017 C  C4    . DC  D 2 7   ? 31.318  101.162 57.380  1.00 11.38 ? 1907 DC  J C4    1 
ATOM   1018 N  N4    . DC  D 2 7   ? 31.809  100.015 57.863  1.00 10.30 ? 1907 DC  J N4    1 
ATOM   1019 C  C5    . DC  D 2 7   ? 30.003  101.596 57.713  1.00 11.54 ? 1907 DC  J C5    1 
ATOM   1020 C  C6    . DC  D 2 7   ? 29.578  102.751 57.197  1.00 11.25 ? 1907 DC  J C6    1 
ATOM   1021 P  P     . DT  D 2 8   ? 27.664  106.174 52.400  1.00 13.40 ? 1908 DT  J P     1 
ATOM   1022 O  OP1   . DT  D 2 8   ? 27.268  107.337 51.568  1.00 14.24 ? 1908 DT  J OP1   1 
ATOM   1023 O  OP2   . DT  D 2 8   ? 26.800  104.971 52.452  1.00 12.62 ? 1908 DT  J OP2   1 
ATOM   1024 O  "O5'" . DT  D 2 8   ? 29.086  105.673 51.889  1.00 11.49 ? 1908 DT  J "O5'" 1 
ATOM   1025 C  "C5'" . DT  D 2 8   ? 30.089  106.625 51.607  1.00 11.41 ? 1908 DT  J "C5'" 1 
ATOM   1026 C  "C4'" . DT  D 2 8   ? 31.043  106.011 50.625  1.00 11.35 ? 1908 DT  J "C4'" 1 
ATOM   1027 O  "O4'" . DT  D 2 8   ? 31.682  104.888 51.272  1.00 10.92 ? 1908 DT  J "O4'" 1 
ATOM   1028 C  "C3'" . DT  D 2 8   ? 30.344  105.483 49.384  1.00 11.20 ? 1908 DT  J "C3'" 1 
ATOM   1029 O  "O3'" . DT  D 2 8   ? 31.120  105.795 48.272  1.00 12.06 ? 1908 DT  J "O3'" 1 
ATOM   1030 C  "C2'" . DT  D 2 8   ? 30.233  103.983 49.624  1.00 11.47 ? 1908 DT  J "C2'" 1 
ATOM   1031 C  "C1'" . DT  D 2 8   ? 31.401  103.694 50.574  1.00 11.39 ? 1908 DT  J "C1'" 1 
ATOM   1032 N  N1    . DT  D 2 8   ? 31.232  102.602 51.612  1.00 11.11 ? 1908 DT  J N1    1 
ATOM   1033 C  C2    . DT  D 2 8   ? 32.334  101.829 51.908  1.00 10.67 ? 1908 DT  J C2    1 
ATOM   1034 O  O2    . DT  D 2 8   ? 33.420  101.977 51.371  1.00 9.80  ? 1908 DT  J O2    1 
ATOM   1035 N  N3    . DT  D 2 8   ? 32.130  100.870 52.879  1.00 10.84 ? 1908 DT  J N3    1 
ATOM   1036 C  C4    . DT  D 2 8   ? 30.960  100.594 53.554  1.00 9.95  ? 1908 DT  J C4    1 
ATOM   1037 O  O4    . DT  D 2 8   ? 30.935  99.691  54.385  1.00 8.56  ? 1908 DT  J O4    1 
ATOM   1038 C  C5    . DT  D 2 8   ? 29.831  101.438 53.204  1.00 9.99  ? 1908 DT  J C5    1 
ATOM   1039 C  C7    . DT  D 2 8   ? 28.481  101.265 53.841  1.00 9.89  ? 1908 DT  J C7    1 
ATOM   1040 C  C6    . DT  D 2 8   ? 30.022  102.387 52.271  1.00 10.87 ? 1908 DT  J C6    1 
ATOM   1041 P  P     . DA  D 2 9   ? 30.543  105.651 46.802  1.00 13.64 ? 1909 DA  J P     1 
ATOM   1042 O  OP1   . DA  D 2 9   ? 31.110  106.721 45.970  1.00 15.36 ? 1909 DA  J OP1   1 
ATOM   1043 O  OP2   . DA  D 2 9   ? 29.083  105.495 46.880  1.00 16.01 ? 1909 DA  J OP2   1 
ATOM   1044 O  "O5'" . DA  D 2 9   ? 31.174  104.277 46.343  1.00 13.57 ? 1909 DA  J "O5'" 1 
ATOM   1045 C  "C5'" . DA  D 2 9   ? 32.593  104.154 46.377  1.00 13.72 ? 1909 DA  J "C5'" 1 
ATOM   1046 C  "C4'" . DA  D 2 9   ? 32.996  102.695 46.417  1.00 13.34 ? 1909 DA  J "C4'" 1 
ATOM   1047 O  "O4'" . DA  D 2 9   ? 32.491  102.097 47.625  1.00 11.89 ? 1909 DA  J "O4'" 1 
ATOM   1048 C  "C3'" . DA  D 2 9   ? 32.421  101.854 45.284  1.00 14.01 ? 1909 DA  J "C3'" 1 
ATOM   1049 O  "O3'" . DA  D 2 9   ? 33.489  101.477 44.462  1.00 15.53 ? 1909 DA  J "O3'" 1 
ATOM   1050 C  "C2'" . DA  D 2 9   ? 31.728  100.683 45.987  1.00 13.72 ? 1909 DA  J "C2'" 1 
ATOM   1051 C  "C1'" . DA  D 2 9   ? 32.325  100.724 47.383  1.00 12.58 ? 1909 DA  J "C1'" 1 
ATOM   1052 N  N9    . DA  D 2 9   ? 31.495  100.142 48.441  1.00 13.24 ? 1909 DA  J N9    1 
ATOM   1053 C  C8    . DA  D 2 9   ? 30.190  100.440 48.738  1.00 13.32 ? 1909 DA  J C8    1 
ATOM   1054 N  N7    . DA  D 2 9   ? 29.708  99.756  49.755  1.00 13.49 ? 1909 DA  J N7    1 
ATOM   1055 C  C5    . DA  D 2 9   ? 30.765  98.953  50.159  1.00 12.44 ? 1909 DA  J C5    1 
ATOM   1056 C  C6    . DA  D 2 9   ? 30.897  97.993  51.192  1.00 12.14 ? 1909 DA  J C6    1 
ATOM   1057 N  N6    . DA  D 2 9   ? 29.924  97.649  52.049  1.00 11.09 ? 1909 DA  J N6    1 
ATOM   1058 N  N1    . DA  D 2 9   ? 32.093  97.382  51.305  1.00 12.46 ? 1909 DA  J N1    1 
ATOM   1059 C  C2    . DA  D 2 9   ? 33.082  97.705  50.453  1.00 12.38 ? 1909 DA  J C2    1 
ATOM   1060 N  N3    . DA  D 2 9   ? 33.080  98.586  49.456  1.00 11.95 ? 1909 DA  J N3    1 
ATOM   1061 C  C4    . DA  D 2 9   ? 31.877  99.181  49.360  1.00 12.70 ? 1909 DA  J C4    1 
ATOM   1062 P  P     . DC  D 2 10  ? 33.274  100.486 43.231  1.00 16.70 ? 1910 DC  J P     1 
ATOM   1063 O  OP1   . DC  D 2 10  ? 34.235  100.981 42.227  1.00 16.78 ? 1910 DC  J OP1   1 
ATOM   1064 O  OP2   . DC  D 2 10  ? 31.826  100.310 42.929  1.00 15.60 ? 1910 DC  J OP2   1 
ATOM   1065 O  "O5'" . DC  D 2 10  ? 33.792  99.082  43.810  1.00 15.44 ? 1910 DC  J "O5'" 1 
ATOM   1066 C  "C5'" . DC  D 2 10  ? 35.126  98.887  44.262  1.00 15.43 ? 1910 DC  J "C5'" 1 
ATOM   1067 C  "C4'" . DC  D 2 10  ? 35.196  97.558  44.997  1.00 15.94 ? 1910 DC  J "C4'" 1 
ATOM   1068 O  "O4'" . DC  D 2 10  ? 34.296  97.616  46.141  1.00 15.39 ? 1910 DC  J "O4'" 1 
ATOM   1069 C  "C3'" . DC  D 2 10  ? 34.769  96.330  44.177  1.00 15.51 ? 1910 DC  J "C3'" 1 
ATOM   1070 O  "O3'" . DC  D 2 10  ? 35.894  95.543  43.763  1.00 16.94 ? 1910 DC  J "O3'" 1 
ATOM   1071 C  "C2'" . DC  D 2 10  ? 33.886  95.518  45.112  1.00 14.50 ? 1910 DC  J "C2'" 1 
ATOM   1072 C  "C1'" . DC  D 2 10  ? 33.871  96.298  46.418  1.00 13.85 ? 1910 DC  J "C1'" 1 
ATOM   1073 N  N1    . DC  D 2 10  ? 32.508  96.304  47.003  1.00 12.07 ? 1910 DC  J N1    1 
ATOM   1074 C  C2    . DC  D 2 10  ? 32.225  95.448  48.074  1.00 11.51 ? 1910 DC  J C2    1 
ATOM   1075 O  O2    . DC  D 2 10  ? 33.114  94.718  48.528  1.00 11.36 ? 1910 DC  J O2    1 
ATOM   1076 N  N3    . DC  D 2 10  ? 30.976  95.446  48.596  1.00 10.84 ? 1910 DC  J N3    1 
ATOM   1077 C  C4    . DC  D 2 10  ? 30.041  96.242  48.091  1.00 9.95  ? 1910 DC  J C4    1 
ATOM   1078 N  N4    . DC  D 2 10  ? 28.837  96.185  48.660  1.00 9.80  ? 1910 DC  J N4    1 
ATOM   1079 C  C5    . DC  D 2 10  ? 30.306  97.115  46.993  1.00 9.97  ? 1910 DC  J C5    1 
ATOM   1080 C  C6    . DC  D 2 10  ? 31.539  97.114  46.478  1.00 10.50 ? 1910 DC  J C6    1 
ATOM   1081 P  P     . DC  D 2 11  ? 35.775  94.381  42.658  1.00 17.51 ? 1911 DC  J P     1 
ATOM   1082 O  OP1   . DC  D 2 11  ? 37.116  94.272  42.033  1.00 17.93 ? 1911 DC  J OP1   1 
ATOM   1083 O  OP2   . DC  D 2 11  ? 34.565  94.604  41.822  1.00 17.37 ? 1911 DC  J OP2   1 
ATOM   1084 O  "O5'" . DC  D 2 11  ? 35.519  93.079  43.541  1.00 15.79 ? 1911 DC  J "O5'" 1 
ATOM   1085 C  "C5'" . DC  D 2 11  ? 36.435  92.746  44.566  1.00 15.01 ? 1911 DC  J "C5'" 1 
ATOM   1086 C  "C4'" . DC  D 2 11  ? 35.943  91.530  45.324  1.00 14.72 ? 1911 DC  J "C4'" 1 
ATOM   1087 O  "O4'" . DC  D 2 11  ? 34.789  91.930  46.106  1.00 13.77 ? 1911 DC  J "O4'" 1 
ATOM   1088 C  "C3'" . DC  D 2 11  ? 35.505  90.345  44.457  1.00 14.78 ? 1911 DC  J "C3'" 1 
ATOM   1089 O  "O3'" . DC  D 2 11  ? 36.253  89.170  44.832  1.00 15.89 ? 1911 DC  J "O3'" 1 
ATOM   1090 C  "C2'" . DC  D 2 11  ? 33.990  90.305  44.690  1.00 14.13 ? 1911 DC  J "C2'" 1 
ATOM   1091 C  "C1'" . DC  D 2 11  ? 33.866  90.869  46.092  1.00 13.78 ? 1911 DC  J "C1'" 1 
ATOM   1092 N  N1    . DC  D 2 11  ? 32.509  91.392  46.466  1.00 14.17 ? 1911 DC  J N1    1 
ATOM   1093 C  C2    . DC  D 2 11  ? 31.770  90.779  47.490  1.00 13.39 ? 1911 DC  J C2    1 
ATOM   1094 O  O2    . DC  D 2 11  ? 32.230  89.807  48.080  1.00 14.03 ? 1911 DC  J O2    1 
ATOM   1095 N  N3    . DC  D 2 11  ? 30.551  91.269  47.818  1.00 14.01 ? 1911 DC  J N3    1 
ATOM   1096 C  C4    . DC  D 2 11  ? 30.040  92.326  47.170  1.00 14.72 ? 1911 DC  J C4    1 
ATOM   1097 N  N4    . DC  D 2 11  ? 28.826  92.754  47.542  1.00 13.84 ? 1911 DC  J N4    1 
ATOM   1098 C  C5    . DC  D 2 11  ? 30.764  92.971  46.114  1.00 14.32 ? 1911 DC  J C5    1 
ATOM   1099 C  C6    . DC  D 2 11  ? 31.978  92.476  45.800  1.00 14.63 ? 1911 DC  J C6    1 
ATOM   1100 P  P     . DA  D 2 12  ? 35.717  87.654  44.708  1.00 17.54 ? 1912 DA  J P     1 
ATOM   1101 O  OP1   . DA  D 2 12  ? 36.883  86.747  44.878  1.00 16.38 ? 1912 DA  J OP1   1 
ATOM   1102 O  OP2   . DA  D 2 12  ? 34.859  87.524  43.505  1.00 16.16 ? 1912 DA  J OP2   1 
ATOM   1103 O  "O5'" . DA  D 2 12  ? 34.757  87.610  45.994  1.00 16.90 ? 1912 DA  J "O5'" 1 
ATOM   1104 C  "C5'" . DA  D 2 12  ? 35.100  86.974  47.216  1.00 16.93 ? 1912 DA  J "C5'" 1 
ATOM   1105 C  "C4'" . DA  D 2 12  ? 34.054  85.920  47.509  1.00 16.92 ? 1912 DA  J "C4'" 1 
ATOM   1106 O  "O4'" . DA  D 2 12  ? 32.750  86.554  47.580  1.00 16.03 ? 1912 DA  J "O4'" 1 
ATOM   1107 C  "C3'" . DA  D 2 12  ? 33.949  84.821  46.450  1.00 17.67 ? 1912 DA  J "C3'" 1 
ATOM   1108 O  "O3'" . DA  D 2 12  ? 33.897  83.538  47.122  1.00 19.39 ? 1912 DA  J "O3'" 1 
ATOM   1109 C  "C2'" . DA  D 2 12  ? 32.699  85.211  45.641  1.00 16.77 ? 1912 DA  J "C2'" 1 
ATOM   1110 C  "C1'" . DA  D 2 12  ? 31.847  85.938  46.675  1.00 15.89 ? 1912 DA  J "C1'" 1 
ATOM   1111 N  N9    . DA  D 2 12  ? 30.975  87.013  46.202  1.00 14.28 ? 1912 DA  J N9    1 
ATOM   1112 C  C8    . DA  D 2 12  ? 31.213  87.959  45.242  1.00 13.53 ? 1912 DA  J C8    1 
ATOM   1113 N  N7    . DA  D 2 12  ? 30.216  88.804  45.083  1.00 13.41 ? 1912 DA  J N7    1 
ATOM   1114 C  C5    . DA  D 2 12  ? 29.269  88.389  46.007  1.00 12.41 ? 1912 DA  J C5    1 
ATOM   1115 C  C6    . DA  D 2 12  ? 27.982  88.859  46.354  1.00 11.95 ? 1912 DA  J C6    1 
ATOM   1116 N  N6    . DA  D 2 12  ? 27.385  89.911  45.784  1.00 11.07 ? 1912 DA  J N6    1 
ATOM   1117 N  N1    . DA  D 2 12  ? 27.316  88.194  47.327  1.00 12.30 ? 1912 DA  J N1    1 
ATOM   1118 C  C2    . DA  D 2 12  ? 27.884  87.133  47.920  1.00 11.62 ? 1912 DA  J C2    1 
ATOM   1119 N  N3    . DA  D 2 12  ? 29.087  86.610  47.682  1.00 11.83 ? 1912 DA  J N3    1 
ATOM   1120 C  C4    . DA  D 2 12  ? 29.727  87.286  46.707  1.00 12.85 ? 1912 DA  J C4    1 
ATOM   1121 P  P     . DT  D 2 13  ? 33.455  82.171  46.402  1.00 20.70 ? 1913 DT  J P     1 
ATOM   1122 O  OP1   . DT  D 2 13  ? 34.068  81.063  47.185  1.00 20.18 ? 1913 DT  J OP1   1 
ATOM   1123 O  OP2   . DT  D 2 13  ? 33.698  82.315  44.948  1.00 20.53 ? 1913 DT  J OP2   1 
ATOM   1124 O  "O5'" . DT  D 2 13  ? 31.861  82.155  46.610  1.00 19.88 ? 1913 DT  J "O5'" 1 
ATOM   1125 C  "C5'" . DT  D 2 13  ? 31.325  82.148  47.944  1.00 18.90 ? 1913 DT  J "C5'" 1 
ATOM   1126 C  "C4'" . DT  D 2 13  ? 29.886  81.670  47.966  1.00 18.14 ? 1913 DT  J "C4'" 1 
ATOM   1127 O  "O4'" . DT  D 2 13  ? 28.993  82.746  47.581  1.00 17.15 ? 1913 DT  J "O4'" 1 
ATOM   1128 C  "C3'" . DT  D 2 13  ? 29.574  80.521  47.015  1.00 18.19 ? 1913 DT  J "C3'" 1 
ATOM   1129 O  "O3'" . DT  D 2 13  ? 28.643  79.660  47.637  1.00 19.92 ? 1913 DT  J "O3'" 1 
ATOM   1130 C  "C2'" . DT  D 2 13  ? 28.980  81.212  45.793  1.00 17.59 ? 1913 DT  J "C2'" 1 
ATOM   1131 C  "C1'" . DT  D 2 13  ? 28.226  82.370  46.445  1.00 16.58 ? 1913 DT  J "C1'" 1 
ATOM   1132 N  N1    . DT  D 2 13  ? 27.984  83.634  45.625  1.00 14.40 ? 1913 DT  J N1    1 
ATOM   1133 C  C2    . DT  D 2 13  ? 26.836  84.361  45.902  1.00 13.31 ? 1913 DT  J C2    1 
ATOM   1134 O  O2    . DT  D 2 13  ? 26.022  84.024  46.752  1.00 13.49 ? 1913 DT  J O2    1 
ATOM   1135 N  N3    . DT  D 2 13  ? 26.667  85.507  45.158  1.00 11.75 ? 1913 DT  J N3    1 
ATOM   1136 C  C4    . DT  D 2 13  ? 27.513  85.983  44.172  1.00 11.28 ? 1913 DT  J C4    1 
ATOM   1137 O  O4    . DT  D 2 13  ? 27.248  87.023  43.576  1.00 10.18 ? 1913 DT  J O4    1 
ATOM   1138 C  C5    . DT  D 2 13  ? 28.705  85.188  43.923  1.00 11.77 ? 1913 DT  J C5    1 
ATOM   1139 C  C7    . DT  D 2 13  ? 29.716  85.592  42.883  1.00 11.29 ? 1913 DT  J C7    1 
ATOM   1140 C  C6    . DT  D 2 13  ? 28.880  84.068  44.652  1.00 12.74 ? 1913 DT  J C6    1 
ATOM   1141 P  P     . DC  D 2 14  ? 28.419  78.159  47.142  1.00 21.29 ? 1914 DC  J P     1 
ATOM   1142 O  OP1   . DC  D 2 14  ? 28.503  77.249  48.307  1.00 20.87 ? 1914 DC  J OP1   1 
ATOM   1143 O  OP2   . DC  D 2 14  ? 29.239  77.923  45.929  1.00 21.42 ? 1914 DC  J OP2   1 
ATOM   1144 O  "O5'" . DC  D 2 14  ? 26.886  78.250  46.712  1.00 20.94 ? 1914 DC  J "O5'" 1 
ATOM   1145 C  "C5'" . DC  D 2 14  ? 25.916  78.399  47.737  1.00 20.38 ? 1914 DC  J "C5'" 1 
ATOM   1146 C  "C4'" . DC  D 2 14  ? 24.705  79.110  47.187  1.00 19.89 ? 1914 DC  J "C4'" 1 
ATOM   1147 O  "O4'" . DC  D 2 14  ? 25.126  80.306  46.493  1.00 19.92 ? 1914 DC  J "O4'" 1 
ATOM   1148 C  "C3'" . DC  D 2 14  ? 23.927  78.303  46.156  1.00 19.58 ? 1914 DC  J "C3'" 1 
ATOM   1149 O  "O3'" . DC  D 2 14  ? 22.831  77.613  46.783  1.00 19.78 ? 1914 DC  J "O3'" 1 
ATOM   1150 C  "C2'" . DC  D 2 14  ? 23.491  79.347  45.121  1.00 19.32 ? 1914 DC  J "C2'" 1 
ATOM   1151 C  "C1'" . DC  D 2 14  ? 24.051  80.661  45.648  1.00 19.27 ? 1914 DC  J "C1'" 1 
ATOM   1152 N  N1    . DC  D 2 14  ? 24.531  81.638  44.597  1.00 18.91 ? 1914 DC  J N1    1 
ATOM   1153 C  C2    . DC  D 2 14  ? 23.751  82.774  44.304  1.00 18.72 ? 1914 DC  J C2    1 
ATOM   1154 O  O2    . DC  D 2 14  ? 22.675  82.953  44.899  1.00 18.35 ? 1914 DC  J O2    1 
ATOM   1155 N  N3    . DC  D 2 14  ? 24.199  83.655  43.361  1.00 18.35 ? 1914 DC  J N3    1 
ATOM   1156 C  C4    . DC  D 2 14  ? 25.355  83.463  42.722  1.00 17.97 ? 1914 DC  J C4    1 
ATOM   1157 N  N4    . DC  D 2 14  ? 25.717  84.376  41.807  1.00 16.45 ? 1914 DC  J N4    1 
ATOM   1158 C  C5    . DC  D 2 14  ? 26.167  82.313  43.007  1.00 17.97 ? 1914 DC  J C5    1 
ATOM   1159 C  C6    . DC  D 2 14  ? 25.723  81.443  43.937  1.00 18.37 ? 1914 DC  J C6    1 
ATOM   1160 P  P     . DC  D 2 15  ? 21.973  76.492  46.002  1.00 20.53 ? 1915 DC  J P     1 
ATOM   1161 O  OP1   . DC  D 2 15  ? 21.301  75.630  47.006  1.00 19.74 ? 1915 DC  J OP1   1 
ATOM   1162 O  OP2   . DC  D 2 15  ? 22.814  75.886  44.938  1.00 19.86 ? 1915 DC  J OP2   1 
ATOM   1163 O  "O5'" . DC  D 2 15  ? 20.838  77.360  45.281  1.00 18.94 ? 1915 DC  J "O5'" 1 
ATOM   1164 C  "C5'" . DC  D 2 15  ? 20.048  78.230  46.089  1.00 17.85 ? 1915 DC  J "C5'" 1 
ATOM   1165 C  "C4'" . DC  D 2 15  ? 18.961  78.908  45.291  1.00 16.55 ? 1915 DC  J "C4'" 1 
ATOM   1166 O  "O4'" . DC  D 2 15  ? 19.552  80.013  44.551  1.00 15.90 ? 1915 DC  J "O4'" 1 
ATOM   1167 C  "C3'" . DC  D 2 15  ? 18.265  78.005  44.285  1.00 15.51 ? 1915 DC  J "C3'" 1 
ATOM   1168 O  "O3'" . DC  D 2 15  ? 16.876  78.299  44.325  1.00 15.35 ? 1915 DC  J "O3'" 1 
ATOM   1169 C  "C2'" . DC  D 2 15  ? 18.988  78.340  42.978  1.00 15.02 ? 1915 DC  J "C2'" 1 
ATOM   1170 C  "C1'" . DC  D 2 15  ? 19.381  79.809  43.163  1.00 14.98 ? 1915 DC  J "C1'" 1 
ATOM   1171 N  N1    . DC  D 2 15  ? 20.638  80.284  42.455  1.00 13.66 ? 1915 DC  J N1    1 
ATOM   1172 C  C2    . DC  D 2 15  ? 20.683  81.598  41.941  1.00 12.74 ? 1915 DC  J C2    1 
ATOM   1173 O  O2    . DC  D 2 15  ? 19.707  82.349  42.075  1.00 11.61 ? 1915 DC  J O2    1 
ATOM   1174 N  N3    . DC  D 2 15  ? 21.814  82.020  41.305  1.00 12.47 ? 1915 DC  J N3    1 
ATOM   1175 C  C4    . DC  D 2 15  ? 22.867  81.204  41.168  1.00 12.30 ? 1915 DC  J C4    1 
ATOM   1176 N  N4    . DC  D 2 15  ? 23.948  81.678  40.536  1.00 10.64 ? 1915 DC  J N4    1 
ATOM   1177 C  C5    . DC  D 2 15  ? 22.840  79.864  41.680  1.00 12.67 ? 1915 DC  J C5    1 
ATOM   1178 C  C6    . DC  D 2 15  ? 21.725  79.451  42.312  1.00 12.98 ? 1915 DC  J C6    1 
ATOM   1179 P  P     . DA  D 2 16  ? 15.873  77.726  43.229  1.00 16.14 ? 1916 DA  J P     1 
ATOM   1180 O  OP1   . DA  D 2 16  ? 14.520  77.698  43.830  1.00 16.62 ? 1916 DA  J OP1   1 
ATOM   1181 O  OP2   . DA  D 2 16  ? 16.478  76.513  42.620  1.00 15.88 ? 1916 DA  J OP2   1 
ATOM   1182 O  "O5'" . DA  D 2 16  ? 15.873  78.868  42.119  1.00 15.24 ? 1916 DA  J "O5'" 1 
ATOM   1183 C  "C5'" . DA  D 2 16  ? 15.311  80.135  42.400  1.00 14.27 ? 1916 DA  J "C5'" 1 
ATOM   1184 C  "C4'" . DA  D 2 16  ? 15.218  80.888  41.099  1.00 13.81 ? 1916 DA  J "C4'" 1 
ATOM   1185 O  "O4'" . DA  D 2 16  ? 16.558  81.247  40.675  1.00 13.81 ? 1916 DA  J "O4'" 1 
ATOM   1186 C  "C3'" . DA  D 2 16  ? 14.618  80.070  39.969  1.00 13.17 ? 1916 DA  J "C3'" 1 
ATOM   1187 O  "O3'" . DA  D 2 16  ? 13.659  80.823  39.267  1.00 13.34 ? 1916 DA  J "O3'" 1 
ATOM   1188 C  "C2'" . DA  D 2 16  ? 15.811  79.717  39.092  1.00 13.12 ? 1916 DA  J "C2'" 1 
ATOM   1189 C  "C1'" . DA  D 2 16  ? 16.740  80.899  39.320  1.00 13.26 ? 1916 DA  J "C1'" 1 
ATOM   1190 N  N9    . DA  D 2 16  ? 18.167  80.647  39.087  1.00 12.88 ? 1916 DA  J N9    1 
ATOM   1191 C  C8    . DA  D 2 16  ? 18.910  79.580  39.517  1.00 12.52 ? 1916 DA  J C8    1 
ATOM   1192 N  N7    . DA  D 2 16  ? 20.170  79.634  39.154  1.00 12.57 ? 1916 DA  J N7    1 
ATOM   1193 C  C5    . DA  D 2 16  ? 20.268  80.818  38.433  1.00 12.59 ? 1916 DA  J C5    1 
ATOM   1194 C  C6    . DA  D 2 16  ? 21.345  81.468  37.774  1.00 12.20 ? 1916 DA  J C6    1 
ATOM   1195 N  N6    . DA  D 2 16  ? 22.596  80.993  37.723  1.00 12.81 ? 1916 DA  J N6    1 
ATOM   1196 N  N1    . DA  D 2 16  ? 21.096  82.637  37.156  1.00 11.33 ? 1916 DA  J N1    1 
ATOM   1197 C  C2    . DA  D 2 16  ? 19.853  83.133  37.196  1.00 11.59 ? 1916 DA  J C2    1 
ATOM   1198 N  N3    . DA  D 2 16  ? 18.767  82.624  37.781  1.00 11.91 ? 1916 DA  J N3    1 
ATOM   1199 C  C4    . DA  D 2 16  ? 19.039  81.453  38.387  1.00 12.50 ? 1916 DA  J C4    1 
ATOM   1200 P  P     . DA  D 2 17  ? 12.506  80.037  38.482  1.00 13.98 ? 1917 DA  J P     1 
ATOM   1201 O  OP1   . DA  D 2 17  ? 11.322  80.013  39.366  1.00 14.56 ? 1917 DA  J OP1   1 
ATOM   1202 O  OP2   . DA  D 2 17  ? 13.066  78.758  37.975  1.00 13.27 ? 1917 DA  J OP2   1 
ATOM   1203 O  "O5'" . DA  D 2 17  ? 12.163  80.963  37.223  1.00 13.45 ? 1917 DA  J "O5'" 1 
ATOM   1204 C  "C5'" . DA  D 2 17  ? 12.795  82.215  36.955  1.00 13.18 ? 1917 DA  J "C5'" 1 
ATOM   1205 C  "C4'" . DA  D 2 17  ? 13.616  82.189  35.674  1.00 13.14 ? 1917 DA  J "C4'" 1 
ATOM   1206 O  "O4'" . DA  D 2 17  ? 14.967  81.760  35.963  1.00 13.08 ? 1917 DA  J "O4'" 1 
ATOM   1207 C  "C3'" . DA  D 2 17  ? 13.135  81.263  34.548  1.00 13.26 ? 1917 DA  J "C3'" 1 
ATOM   1208 O  "O3'" . DA  D 2 17  ? 12.767  82.041  33.421  1.00 13.39 ? 1917 DA  J "O3'" 1 
ATOM   1209 C  "C2'" . DA  D 2 17  ? 14.331  80.357  34.251  1.00 12.86 ? 1917 DA  J "C2'" 1 
ATOM   1210 C  "C1'" . DA  D 2 17  ? 15.468  81.223  34.756  1.00 13.10 ? 1917 DA  J "C1'" 1 
ATOM   1211 N  N9    . DA  D 2 17  ? 16.715  80.536  35.049  1.00 12.82 ? 1917 DA  J N9    1 
ATOM   1212 C  C8    . DA  D 2 17  ? 16.898  79.398  35.786  1.00 12.80 ? 1917 DA  J C8    1 
ATOM   1213 N  N7    . DA  D 2 17  ? 18.155  79.029  35.883  1.00 12.19 ? 1917 DA  J N7    1 
ATOM   1214 C  C5    . DA  D 2 17  ? 18.834  79.993  35.163  1.00 11.28 ? 1917 DA  J C5    1 
ATOM   1215 C  C6    . DA  D 2 17  ? 20.196  80.177  34.878  1.00 10.32 ? 1917 DA  J C6    1 
ATOM   1216 N  N6    . DA  D 2 17  ? 21.157  79.356  35.308  1.00 9.93  ? 1917 DA  J N6    1 
ATOM   1217 N  N1    . DA  D 2 17  ? 20.528  81.249  34.128  1.00 9.90  ? 1917 DA  J N1    1 
ATOM   1218 C  C2    . DA  D 2 17  ? 19.571  82.075  33.694  1.00 9.65  ? 1917 DA  J C2    1 
ATOM   1219 N  N3    . DA  D 2 17  ? 18.256  82.005  33.896  1.00 10.26 ? 1917 DA  J N3    1 
ATOM   1220 C  C4    . DA  D 2 17  ? 17.960  80.933  34.645  1.00 11.68 ? 1917 DA  J C4    1 
ATOM   1221 P  P     . DC  D 2 18  ? 11.968  81.392  32.201  1.00 14.71 ? 1918 DC  J P     1 
ATOM   1222 O  OP1   . DC  D 2 18  ? 10.889  82.330  31.815  1.00 14.82 ? 1918 DC  J OP1   1 
ATOM   1223 O  OP2   . DC  D 2 18  ? 11.641  79.982  32.519  1.00 13.97 ? 1918 DC  J OP2   1 
ATOM   1224 O  "O5'" . DC  D 2 18  ? 13.073  81.376  31.047  1.00 15.24 ? 1918 DC  J "O5'" 1 
ATOM   1225 C  "C5'" . DC  D 2 18  ? 13.923  82.499  30.820  1.00 15.15 ? 1918 DC  J "C5'" 1 
ATOM   1226 C  "C4'" . DC  D 2 18  ? 15.298  82.028  30.383  1.00 15.24 ? 1918 DC  J "C4'" 1 
ATOM   1227 O  "O4'" . DC  D 2 18  ? 15.968  81.270  31.426  1.00 15.70 ? 1918 DC  J "O4'" 1 
ATOM   1228 C  "C3'" . DC  D 2 18  ? 15.331  81.072  29.203  1.00 14.44 ? 1918 DC  J "C3'" 1 
ATOM   1229 O  "O3'" . DC  D 2 18  ? 15.225  81.805  27.995  1.00 14.71 ? 1918 DC  J "O3'" 1 
ATOM   1230 C  "C2'" . DC  D 2 18  ? 16.691  80.402  29.372  1.00 14.76 ? 1918 DC  J "C2'" 1 
ATOM   1231 C  "C1'" . DC  D 2 18  ? 17.122  80.748  30.802  1.00 14.96 ? 1918 DC  J "C1'" 1 
ATOM   1232 N  N1    . DC  D 2 18  ? 17.688  79.566  31.546  1.00 14.50 ? 1918 DC  J N1    1 
ATOM   1233 C  C2    . DC  D 2 18  ? 19.073  79.390  31.552  1.00 13.79 ? 1918 DC  J C2    1 
ATOM   1234 O  O2    . DC  D 2 18  ? 19.773  80.214  30.961  1.00 13.03 ? 1918 DC  J O2    1 
ATOM   1235 N  N3    . DC  D 2 18  ? 19.605  78.325  32.205  1.00 14.08 ? 1918 DC  J N3    1 
ATOM   1236 C  C4    . DC  D 2 18  ? 18.818  77.443  32.833  1.00 14.59 ? 1918 DC  J C4    1 
ATOM   1237 N  N4    . DC  D 2 18  ? 19.402  76.410  33.459  1.00 13.97 ? 1918 DC  J N4    1 
ATOM   1238 C  C5    . DC  D 2 18  ? 17.396  77.599  32.837  1.00 14.55 ? 1918 DC  J C5    1 
ATOM   1239 C  C6    . DC  D 2 18  ? 16.882  78.659  32.187  1.00 14.60 ? 1918 DC  J C6    1 
ATOM   1240 P  P     . DC  D 2 19  ? 14.918  81.084  26.590  1.00 17.10 ? 1919 DC  J P     1 
ATOM   1241 O  OP1   . DC  D 2 19  ? 14.227  82.070  25.717  1.00 15.98 ? 1919 DC  J OP1   1 
ATOM   1242 O  OP2   . DC  D 2 19  ? 14.299  79.744  26.788  1.00 14.97 ? 1919 DC  J OP2   1 
ATOM   1243 O  "O5'" . DC  D 2 19  ? 16.424  80.866  26.076  1.00 16.01 ? 1919 DC  J "O5'" 1 
ATOM   1244 C  "C5'" . DC  D 2 19  ? 16.673  80.122  24.887  1.00 15.28 ? 1919 DC  J "C5'" 1 
ATOM   1245 C  "C4'" . DC  D 2 19  ? 18.163  80.019  24.625  1.00 14.22 ? 1919 DC  J "C4'" 1 
ATOM   1246 O  "O4'" . DC  D 2 19  ? 18.845  80.016  25.906  1.00 13.53 ? 1919 DC  J "O4'" 1 
ATOM   1247 C  "C3'" . DC  D 2 19  ? 18.578  78.766  23.868  1.00 13.38 ? 1919 DC  J "C3'" 1 
ATOM   1248 O  "O3'" . DC  D 2 19  ? 18.970  79.071  22.541  1.00 53.05 ? 1919 DC  J "O3'" 1 
ATOM   1249 C  "C2'" . DC  D 2 19  ? 19.799  78.267  24.632  1.00 13.58 ? 1919 DC  J "C2'" 1 
ATOM   1250 C  "C1'" . DC  D 2 19  ? 19.792  78.970  25.983  1.00 13.36 ? 1919 DC  J "C1'" 1 
ATOM   1251 N  N1    . DC  D 2 19  ? 19.455  78.051  27.137  1.00 13.32 ? 1919 DC  J N1    1 
ATOM   1252 C  C2    . DC  D 2 19  ? 20.477  77.502  27.929  1.00 13.53 ? 1919 DC  J C2    1 
ATOM   1253 O  O2    . DC  D 2 19  ? 21.656  77.778  27.676  1.00 14.04 ? 1919 DC  J O2    1 
ATOM   1254 N  N3    . DC  D 2 19  ? 20.149  76.677  28.966  1.00 13.42 ? 1919 DC  J N3    1 
ATOM   1255 C  C4    . DC  D 2 19  ? 18.872  76.381  29.226  1.00 13.11 ? 1919 DC  J C4    1 
ATOM   1256 N  N4    . DC  D 2 19  ? 18.608  75.564  30.251  1.00 12.40 ? 1919 DC  J N4    1 
ATOM   1257 C  C5    . DC  D 2 19  ? 17.816  76.923  28.434  1.00 13.02 ? 1919 DC  J C5    1 
ATOM   1258 C  C6    . DC  D 2 19  ? 18.148  77.739  27.417  1.00 13.40 ? 1919 DC  J C6    1 
ATOM   1259 N  N     . GLY E 3 9   ? 26.810  -5.240  -6.953  1.00 12.60 ? 1    GLY A N     1 
ATOM   1260 C  CA    . GLY E 3 9   ? 26.090  -3.935  -6.794  1.00 12.73 ? 1    GLY A CA    1 
ATOM   1261 C  C     . GLY E 3 9   ? 26.293  -3.266  -5.440  1.00 12.61 ? 1    GLY A C     1 
ATOM   1262 O  O     . GLY E 3 9   ? 26.651  -3.934  -4.464  1.00 12.62 ? 1    GLY A O     1 
ATOM   1263 N  N     . ILE E 3 10  ? 26.064  -1.950  -5.386  1.00 12.33 ? 2    ILE A N     1 
ATOM   1264 C  CA    . ILE E 3 10  ? 26.222  -1.157  -4.157  1.00 12.17 ? 2    ILE A CA    1 
ATOM   1265 C  C     . ILE E 3 10  ? 24.939  -0.385  -3.837  1.00 12.18 ? 2    ILE A C     1 
ATOM   1266 O  O     . ILE E 3 10  ? 24.301  0.167   -4.728  1.00 12.15 ? 2    ILE A O     1 
ATOM   1267 C  CB    . ILE E 3 10  ? 27.408  -0.167  -4.282  1.00 12.10 ? 2    ILE A CB    1 
ATOM   1268 C  CG1   . ILE E 3 10  ? 28.722  -0.908  -4.565  1.00 12.35 ? 2    ILE A CG1   1 
ATOM   1269 C  CG2   . ILE E 3 10  ? 27.572  0.654   -3.013  1.00 11.89 ? 2    ILE A CG2   1 
ATOM   1270 C  CD1   . ILE E 3 10  ? 29.517  -0.314  -5.706  1.00 11.96 ? 2    ILE A CD1   1 
ATOM   1271 N  N     . VAL E 3 11  ? 24.590  -0.334  -2.552  1.00 12.19 ? 3    VAL A N     1 
ATOM   1272 C  CA    . VAL E 3 11  ? 23.345  0.276   -2.085  1.00 12.20 ? 3    VAL A CA    1 
ATOM   1273 C  C     . VAL E 3 11  ? 23.640  1.239   -0.930  1.00 12.43 ? 3    VAL A C     1 
ATOM   1274 O  O     . VAL E 3 11  ? 24.427  0.922   -0.034  1.00 12.60 ? 3    VAL A O     1 
ATOM   1275 C  CB    . VAL E 3 11  ? 22.329  -0.806  -1.619  1.00 12.09 ? 3    VAL A CB    1 
ATOM   1276 C  CG1   . VAL E 3 11  ? 21.121  -0.177  -0.972  1.00 11.56 ? 3    VAL A CG1   1 
ATOM   1277 C  CG2   . VAL E 3 11  ? 21.900  -1.687  -2.791  1.00 12.19 ? 3    VAL A CG2   1 
ATOM   1278 N  N     . LEU E 3 12  ? 23.001  2.407   -0.956  1.00 12.35 ? 4    LEU A N     1 
ATOM   1279 C  CA    . LEU E 3 12  ? 23.203  3.428   0.056   1.00 12.52 ? 4    LEU A CA    1 
ATOM   1280 C  C     . LEU E 3 12  ? 21.875  3.791   0.735   1.00 12.55 ? 4    LEU A C     1 
ATOM   1281 O  O     . LEU E 3 12  ? 20.932  4.207   0.101   1.00 12.79 ? 4    LEU A O     1 
ATOM   1282 C  CB    . LEU E 3 12  ? 23.862  4.656   -0.566  1.00 12.39 ? 4    LEU A CB    1 
ATOM   1283 C  CG    . LEU E 3 12  ? 24.473  5.630   0.447   1.00 12.81 ? 4    LEU A CG    1 
ATOM   1284 C  CD1   . LEU E 3 12  ? 25.615  6.409   -0.193  1.00 13.17 ? 4    LEU A CD1   1 
ATOM   1285 C  CD2   . LEU E 3 12  ? 23.419  6.597   1.041   1.00 12.81 ? 4    LEU A CD2   1 
ATOM   1286 N  N     . PHE E 3 13  ? 21.824  3.647   2.045   1.00 12.82 ? 5    PHE A N     1 
ATOM   1287 C  CA    . PHE E 3 13  ? 20.597  3.803   2.798   1.00 13.01 ? 5    PHE A CA    1 
ATOM   1288 C  C     . PHE E 3 13  ? 20.744  5.000   3.721   1.00 13.07 ? 5    PHE A C     1 
ATOM   1289 O  O     . PHE E 3 13  ? 21.688  5.074   4.496   1.00 12.63 ? 5    PHE A O     1 
ATOM   1290 C  CB    . PHE E 3 13  ? 20.354  2.539   3.602   1.00 13.10 ? 5    PHE A CB    1 
ATOM   1291 C  CG    . PHE E 3 13  ? 19.188  2.622   4.521   1.00 13.74 ? 5    PHE A CG    1 
ATOM   1292 C  CD1   . PHE E 3 13  ? 17.901  2.525   4.032   1.00 14.55 ? 5    PHE A CD1   1 
ATOM   1293 C  CD2   . PHE E 3 13  ? 19.379  2.782   5.892   1.00 14.76 ? 5    PHE A CD2   1 
ATOM   1294 C  CE1   . PHE E 3 13  ? 16.814  2.589   4.891   1.00 15.77 ? 5    PHE A CE1   1 
ATOM   1295 C  CE2   . PHE E 3 13  ? 18.308  2.851   6.762   1.00 14.77 ? 5    PHE A CE2   1 
ATOM   1296 C  CZ    . PHE E 3 13  ? 17.021  2.752   6.270   1.00 15.27 ? 5    PHE A CZ    1 
ATOM   1297 N  N     . VAL E 3 14  ? 19.816  5.945   3.613   1.00 13.20 ? 6    VAL A N     1 
ATOM   1298 C  CA    . VAL E 3 14  ? 19.805  7.128   4.454   1.00 13.05 ? 6    VAL A CA    1 
ATOM   1299 C  C     . VAL E 3 14  ? 18.663  6.978   5.441   1.00 12.99 ? 6    VAL A C     1 
ATOM   1300 O  O     . VAL E 3 14  ? 17.549  6.656   5.053   1.00 12.80 ? 6    VAL A O     1 
ATOM   1301 C  CB    . VAL E 3 14  ? 19.605  8.395   3.612   1.00 12.95 ? 6    VAL A CB    1 
ATOM   1302 C  CG1   . VAL E 3 14  ? 19.886  9.649   4.446   1.00 12.93 ? 6    VAL A CG1   1 
ATOM   1303 C  CG2   . VAL E 3 14  ? 20.495  8.352   2.385   1.00 13.04 ? 6    VAL A CG2   1 
ATOM   1304 N  N     . ASP E 3 15  ? 18.951  7.195   6.719   1.00 13.27 ? 7    ASP A N     1 
ATOM   1305 C  CA    . ASP E 3 15  ? 17.937  7.186   7.783   1.00 13.33 ? 7    ASP A CA    1 
ATOM   1306 C  C     . ASP E 3 15  ? 18.093  8.494   8.527   1.00 12.99 ? 7    ASP A C     1 
ATOM   1307 O  O     . ASP E 3 15  ? 19.187  8.828   8.962   1.00 12.83 ? 7    ASP A O     1 
ATOM   1308 C  CB    . ASP E 3 15  ? 18.152  6.010   8.744   1.00 13.44 ? 7    ASP A CB    1 
ATOM   1309 C  CG    . ASP E 3 15  ? 17.030  5.866   9.795   1.00 15.01 ? 7    ASP A CG    1 
ATOM   1310 O  OD1   . ASP E 3 15  ? 16.773  6.802   10.592  1.00 15.92 ? 7    ASP A OD1   1 
ATOM   1311 O  OD2   . ASP E 3 15  ? 16.361  4.814   9.917   1.00 16.79 ? 7    ASP A OD2   1 
ATOM   1312 N  N     . PHE E 3 16  ? 17.000  9.224   8.681   1.00 13.14 ? 8    PHE A N     1 
ATOM   1313 C  CA    . PHE E 3 16  ? 17.018  10.495  9.387   1.00 13.23 ? 8    PHE A CA    1 
ATOM   1314 C  C     . PHE E 3 16  ? 16.834  10.181  10.869  1.00 13.55 ? 8    PHE A C     1 
ATOM   1315 O  O     . PHE E 3 16  ? 15.893  9.472   11.240  1.00 13.46 ? 8    PHE A O     1 
ATOM   1316 C  CB    . PHE E 3 16  ? 15.898  11.411  8.886   1.00 13.36 ? 8    PHE A CB    1 
ATOM   1317 C  CG    . PHE E 3 16  ? 15.725  11.432  7.380   1.00 13.38 ? 8    PHE A CG    1 
ATOM   1318 C  CD1   . PHE E 3 16  ? 16.770  11.110  6.516   1.00 13.85 ? 8    PHE A CD1   1 
ATOM   1319 C  CD2   . PHE E 3 16  ? 14.504  11.789  6.830   1.00 13.97 ? 8    PHE A CD2   1 
ATOM   1320 C  CE1   . PHE E 3 16  ? 16.592  11.148  5.146   1.00 13.86 ? 8    PHE A CE1   1 
ATOM   1321 C  CE2   . PHE E 3 16  ? 14.322  11.831  5.457   1.00 14.08 ? 8    PHE A CE2   1 
ATOM   1322 C  CZ    . PHE E 3 16  ? 15.370  11.512  4.615   1.00 14.12 ? 8    PHE A CZ    1 
ATOM   1323 N  N     . ASP E 3 17  ? 17.732  10.696  11.709  1.00 13.88 ? 9    ASP A N     1 
ATOM   1324 C  CA    . ASP E 3 17  ? 17.771  10.307  13.123  1.00 14.22 ? 9    ASP A CA    1 
ATOM   1325 C  C     . ASP E 3 17  ? 16.629  10.921  13.900  1.00 14.48 ? 9    ASP A C     1 
ATOM   1326 O  O     . ASP E 3 17  ? 16.321  12.102  13.708  1.00 14.84 ? 9    ASP A O     1 
ATOM   1327 C  CB    . ASP E 3 17  ? 19.077  10.731  13.802  1.00 14.27 ? 9    ASP A CB    1 
ATOM   1328 C  CG    . ASP E 3 17  ? 20.293  10.415  12.984  1.00 14.53 ? 9    ASP A CG    1 
ATOM   1329 O  OD1   . ASP E 3 17  ? 20.489  9.227   12.657  1.00 15.50 ? 9    ASP A OD1   1 
ATOM   1330 O  OD2   . ASP E 3 17  ? 21.103  11.295  12.635  1.00 13.83 ? 9    ASP A OD2   1 
ATOM   1331 N  N     . TYR E 3 18  ? 16.043  10.133  14.806  1.00 14.57 ? 10   TYR A N     1 
ATOM   1332 C  CA    . TYR E 3 18  ? 14.940  10.576  15.656  1.00 14.97 ? 10   TYR A CA    1 
ATOM   1333 C  C     . TYR E 3 18  ? 14.163  11.696  14.951  1.00 13.94 ? 10   TYR A C     1 
ATOM   1334 O  O     . TYR E 3 18  ? 14.002  12.791  15.464  1.00 13.26 ? 10   TYR A O     1 
ATOM   1335 C  CB    . TYR E 3 18  ? 15.447  10.986  17.059  1.00 15.61 ? 10   TYR A CB    1 
ATOM   1336 C  CG    . TYR E 3 18  ? 16.538  12.059  17.101  1.00 20.12 ? 10   TYR A CG    1 
ATOM   1337 C  CD1   . TYR E 3 18  ? 16.244  13.377  17.507  1.00 24.81 ? 10   TYR A CD1   1 
ATOM   1338 C  CD2   . TYR E 3 18  ? 17.858  11.773  16.755  1.00 24.11 ? 10   TYR A CD2   1 
ATOM   1339 C  CE1   . TYR E 3 18  ? 17.242  14.393  17.558  1.00 26.15 ? 10   TYR A CE1   1 
ATOM   1340 C  CE2   . TYR E 3 18  ? 18.859  12.777  16.783  1.00 26.57 ? 10   TYR A CE2   1 
ATOM   1341 C  CZ    . TYR E 3 18  ? 18.542  14.086  17.185  1.00 27.36 ? 10   TYR A CZ    1 
ATOM   1342 O  OH    . TYR E 3 18  ? 19.513  15.071  17.213  1.00 28.00 ? 10   TYR A OH    1 
ATOM   1343 N  N     . PHE E 3 19  ? 13.678  11.373  13.758  1.00 13.53 ? 11   PHE A N     1 
ATOM   1344 C  CA    . PHE E 3 19  ? 13.252  12.362  12.769  1.00 13.01 ? 11   PHE A CA    1 
ATOM   1345 C  C     . PHE E 3 19  ? 12.210  13.373  13.254  1.00 12.76 ? 11   PHE A C     1 
ATOM   1346 O  O     . PHE E 3 19  ? 12.455  14.569  13.187  1.00 12.01 ? 11   PHE A O     1 
ATOM   1347 C  CB    . PHE E 3 19  ? 12.743  11.648  11.517  1.00 12.88 ? 11   PHE A CB    1 
ATOM   1348 C  CG    . PHE E 3 19  ? 12.307  12.579  10.433  1.00 12.99 ? 11   PHE A CG    1 
ATOM   1349 C  CD1   . PHE E 3 19  ? 13.160  13.565  9.964   1.00 13.13 ? 11   PHE A CD1   1 
ATOM   1350 C  CD2   . PHE E 3 19  ? 11.037  12.481  9.889   1.00 12.98 ? 11   PHE A CD2   1 
ATOM   1351 C  CE1   . PHE E 3 19  ? 12.760  14.434  8.963   1.00 13.77 ? 11   PHE A CE1   1 
ATOM   1352 C  CE2   . PHE E 3 19  ? 10.635  13.345  8.881   1.00 14.04 ? 11   PHE A CE2   1 
ATOM   1353 C  CZ    . PHE E 3 19  ? 11.499  14.324  8.418   1.00 13.70 ? 11   PHE A CZ    1 
ATOM   1354 N  N     . TYR E 3 20  ? 11.056  12.900  13.731  1.00 12.77 ? 12   TYR A N     1 
ATOM   1355 C  CA    . TYR E 3 20  ? 10.007  13.808  14.226  1.00 12.71 ? 12   TYR A CA    1 
ATOM   1356 C  C     . TYR E 3 20  ? 10.555  14.722  15.305  1.00 12.39 ? 12   TYR A C     1 
ATOM   1357 O  O     . TYR E 3 20  ? 10.222  15.903  15.348  1.00 12.21 ? 12   TYR A O     1 
ATOM   1358 C  CB    . TYR E 3 20  ? 8.804   13.069  14.829  1.00 12.79 ? 12   TYR A CB    1 
ATOM   1359 C  CG    . TYR E 3 20  ? 8.080   12.124  13.913  1.00 13.44 ? 12   TYR A CG    1 
ATOM   1360 C  CD1   . TYR E 3 20  ? 8.388   12.060  12.556  1.00 13.83 ? 12   TYR A CD1   1 
ATOM   1361 C  CD2   . TYR E 3 20  ? 7.071   11.289  14.399  1.00 13.66 ? 12   TYR A CD2   1 
ATOM   1362 C  CE1   . TYR E 3 20  ? 7.719   11.201  11.715  1.00 13.97 ? 12   TYR A CE1   1 
ATOM   1363 C  CE2   . TYR E 3 20  ? 6.400   10.415  13.552  1.00 14.18 ? 12   TYR A CE2   1 
ATOM   1364 C  CZ    . TYR E 3 20  ? 6.742   10.387  12.206  1.00 14.22 ? 12   TYR A CZ    1 
ATOM   1365 O  OH    . TYR E 3 20  ? 6.123   9.549   11.323  1.00 16.60 ? 12   TYR A OH    1 
ATOM   1366 N  N     . ALA E 3 21  ? 11.362  14.164  16.198  1.00 12.05 ? 13   ALA A N     1 
ATOM   1367 C  CA    . ALA E 3 21  ? 11.989  14.973  17.234  1.00 12.06 ? 13   ALA A CA    1 
ATOM   1368 C  C     . ALA E 3 21  ? 13.006  15.965  16.657  1.00 11.86 ? 13   ALA A C     1 
ATOM   1369 O  O     . ALA E 3 21  ? 13.114  17.084  17.146  1.00 12.29 ? 13   ALA A O     1 
ATOM   1370 C  CB    . ALA E 3 21  ? 12.631  14.093  18.281  1.00 12.06 ? 13   ALA A CB    1 
ATOM   1371 N  N     . GLN E 3 22  ? 13.731  15.578  15.613  1.00 11.51 ? 14   GLN A N     1 
ATOM   1372 C  CA    . GLN E 3 22  ? 14.679  16.494  14.981  1.00 11.25 ? 14   GLN A CA    1 
ATOM   1373 C  C     . GLN E 3 22  ? 13.985  17.675  14.329  1.00 10.96 ? 14   GLN A C     1 
ATOM   1374 O  O     . GLN E 3 22  ? 14.487  18.787  14.416  1.00 10.94 ? 14   GLN A O     1 
ATOM   1375 C  CB    . GLN E 3 22  ? 15.597  15.796  13.965  1.00 11.19 ? 14   GLN A CB    1 
ATOM   1376 C  CG    . GLN E 3 22  ? 17.039  15.820  14.382  1.00 11.29 ? 14   GLN A CG    1 
ATOM   1377 C  CD    . GLN E 3 22  ? 18.016  15.613  13.250  1.00 11.85 ? 14   GLN A CD    1 
ATOM   1378 O  OE1   . GLN E 3 22  ? 18.007  14.573  12.579  1.00 12.48 ? 14   GLN A OE1   1 
ATOM   1379 N  NE2   . GLN E 3 22  ? 18.892  16.584  13.060  1.00 10.91 ? 14   GLN A NE2   1 
ATOM   1380 N  N     . VAL E 3 23  ? 12.849  17.444  13.682  1.00 10.81 ? 15   VAL A N     1 
ATOM   1381 C  CA    . VAL E 3 23  ? 12.150  18.532  13.002  1.00 11.16 ? 15   VAL A CA    1 
ATOM   1382 C  C     . VAL E 3 23  ? 11.587  19.501  14.034  1.00 11.49 ? 15   VAL A C     1 
ATOM   1383 O  O     . VAL E 3 23  ? 11.605  20.710  13.822  1.00 11.19 ? 15   VAL A O     1 
ATOM   1384 C  CB    . VAL E 3 23  ? 11.000  18.043  12.079  1.00 10.83 ? 15   VAL A CB    1 
ATOM   1385 C  CG1   . VAL E 3 23  ? 10.241  19.228  11.502  1.00 10.77 ? 15   VAL A CG1   1 
ATOM   1386 C  CG2   . VAL E 3 23  ? 11.528  17.201  10.962  1.00 10.75 ? 15   VAL A CG2   1 
ATOM   1387 N  N     . GLU E 3 24  ? 11.086  18.966  15.145  1.00 12.15 ? 16   GLU A N     1 
ATOM   1388 C  CA    . GLU E 3 24  ? 10.555  19.804  16.210  1.00 12.99 ? 16   GLU A CA    1 
ATOM   1389 C  C     . GLU E 3 24  ? 11.642  20.763  16.745  1.00 13.50 ? 16   GLU A C     1 
ATOM   1390 O  O     . GLU E 3 24  ? 11.349  21.889  17.148  1.00 13.53 ? 16   GLU A O     1 
ATOM   1391 C  CB    . GLU E 3 24  ? 9.974   18.947  17.345  1.00 13.05 ? 16   GLU A CB    1 
ATOM   1392 C  CG    . GLU E 3 24  ? 8.619   18.303  17.045  1.00 13.71 ? 16   GLU A CG    1 
ATOM   1393 C  CD    . GLU E 3 24  ? 7.512   19.294  16.721  1.00 14.35 ? 16   GLU A CD    1 
ATOM   1394 O  OE1   . GLU E 3 24  ? 7.682   20.481  17.060  1.00 16.81 ? 16   GLU A OE1   1 
ATOM   1395 O  OE2   . GLU E 3 24  ? 6.470   18.895  16.132  1.00 13.11 ? 16   GLU A OE2   1 
ATOM   1396 N  N     . GLU E 3 25  ? 12.888  20.305  16.724  1.00 13.91 ? 17   GLU A N     1 
ATOM   1397 C  CA    . GLU E 3 25  ? 14.027  21.089  17.169  1.00 14.47 ? 17   GLU A CA    1 
ATOM   1398 C  C     . GLU E 3 25  ? 14.518  22.110  16.143  1.00 14.34 ? 17   GLU A C     1 
ATOM   1399 O  O     . GLU E 3 25  ? 14.997  23.179  16.521  1.00 14.20 ? 17   GLU A O     1 
ATOM   1400 C  CB    . GLU E 3 25  ? 15.178  20.154  17.520  1.00 14.92 ? 17   GLU A CB    1 
ATOM   1401 C  CG    . GLU E 3 25  ? 16.283  20.815  18.334  1.00 16.31 ? 17   GLU A CG    1 
ATOM   1402 C  CD    . GLU E 3 25  ? 17.542  19.985  18.342  1.00 18.01 ? 17   GLU A CD    1 
ATOM   1403 O  OE1   . GLU E 3 25  ? 18.656  20.574  18.227  1.00 19.13 ? 17   GLU A OE1   1 
ATOM   1404 O  OE2   . GLU E 3 25  ? 17.393  18.744  18.442  1.00 18.52 ? 17   GLU A OE2   1 
ATOM   1405 N  N     . VAL E 3 26  ? 14.439  21.771  14.857  1.00 14.24 ? 18   VAL A N     1 
ATOM   1406 C  CA    . VAL E 3 26  ? 14.718  22.738  13.797  1.00 14.09 ? 18   VAL A CA    1 
ATOM   1407 C  C     . VAL E 3 26  ? 13.731  23.908  13.927  1.00 13.75 ? 18   VAL A C     1 
ATOM   1408 O  O     . VAL E 3 26  ? 14.114  25.068  13.785  1.00 13.40 ? 18   VAL A O     1 
ATOM   1409 C  CB    . VAL E 3 26  ? 14.622  22.098  12.384  1.00 14.18 ? 18   VAL A CB    1 
ATOM   1410 C  CG1   . VAL E 3 26  ? 14.630  23.163  11.293  1.00 14.59 ? 18   VAL A CG1   1 
ATOM   1411 C  CG2   . VAL E 3 26  ? 15.763  21.138  12.155  1.00 14.66 ? 18   VAL A CG2   1 
ATOM   1412 N  N     . LEU E 3 27  ? 12.473  23.583  14.233  1.00 13.47 ? 19   LEU A N     1 
ATOM   1413 C  CA    . LEU E 3 27  ? 11.408  24.575  14.381  1.00 13.24 ? 19   LEU A CA    1 
ATOM   1414 C  C     . LEU E 3 27  ? 11.453  25.313  15.727  1.00 12.94 ? 19   LEU A C     1 
ATOM   1415 O  O     . LEU E 3 27  ? 10.848  26.364  15.882  1.00 12.97 ? 19   LEU A O     1 
ATOM   1416 C  CB    . LEU E 3 27  ? 10.043  23.914  14.176  1.00 13.07 ? 19   LEU A CB    1 
ATOM   1417 C  CG    . LEU E 3 27  ? 9.537   23.873  12.730  1.00 13.62 ? 19   LEU A CG    1 
ATOM   1418 C  CD1   . LEU E 3 27  ? 10.602  23.398  11.743  1.00 13.78 ? 19   LEU A CD1   1 
ATOM   1419 C  CD2   . LEU E 3 27  ? 8.315   22.983  12.651  1.00 14.17 ? 19   LEU A CD2   1 
ATOM   1420 N  N     . ASN E 3 28  ? 12.173  24.763  16.692  1.00 12.81 ? 20   ASN A N     1 
ATOM   1421 C  CA    . ASN E 3 28  ? 12.369  25.413  17.982  1.00 12.71 ? 20   ASN A CA    1 
ATOM   1422 C  C     . ASN E 3 28  ? 13.712  24.972  18.549  1.00 12.77 ? 20   ASN A C     1 
ATOM   1423 O  O     . ASN E 3 28  ? 13.766  24.017  19.320  1.00 12.74 ? 20   ASN A O     1 
ATOM   1424 C  CB    . ASN E 3 28  ? 11.229  25.049  18.937  1.00 12.56 ? 20   ASN A CB    1 
ATOM   1425 C  CG    . ASN E 3 28  ? 11.321  25.766  20.279  1.00 12.24 ? 20   ASN A CG    1 
ATOM   1426 O  OD1   . ASN E 3 28  ? 10.615  25.420  21.217  1.00 12.10 ? 20   ASN A OD1   1 
ATOM   1427 N  ND2   . ASN E 3 28  ? 12.183  26.766  20.370  1.00 12.35 ? 20   ASN A ND2   1 
ATOM   1428 N  N     . PRO E 3 29  ? 14.795  25.640  18.141  1.00 12.75 ? 21   PRO A N     1 
ATOM   1429 C  CA    . PRO E 3 29  ? 16.153  25.270  18.569  1.00 12.73 ? 21   PRO A CA    1 
ATOM   1430 C  C     . PRO E 3 29  ? 16.413  25.291  20.066  1.00 12.61 ? 21   PRO A C     1 
ATOM   1431 O  O     . PRO E 3 29  ? 17.489  24.866  20.457  1.00 12.61 ? 21   PRO A O     1 
ATOM   1432 C  CB    . PRO E 3 29  ? 17.045  26.305  17.864  1.00 12.50 ? 21   PRO A CB    1 
ATOM   1433 C  CG    . PRO E 3 29  ? 16.258  26.780  16.729  1.00 12.53 ? 21   PRO A CG    1 
ATOM   1434 C  CD    . PRO E 3 29  ? 14.822  26.761  17.185  1.00 12.84 ? 21   PRO A CD    1 
ATOM   1435 N  N     . SER E 3 30  ? 15.472  25.762  20.875  1.00 12.94 ? 22   SER A N     1 
ATOM   1436 C  CA    . SER E 3 30  ? 15.632  25.751  22.333  1.00 13.36 ? 22   SER A CA    1 
ATOM   1437 C  C     . SER E 3 30  ? 15.419  24.352  22.935  1.00 13.48 ? 22   SER A C     1 
ATOM   1438 O  O     . SER E 3 30  ? 15.501  24.165  24.150  1.00 13.76 ? 22   SER A O     1 
ATOM   1439 C  CB    . SER E 3 30  ? 14.663  26.742  22.972  1.00 13.24 ? 22   SER A CB    1 
ATOM   1440 O  OG    . SER E 3 30  ? 13.343  26.238  22.910  1.00 13.76 ? 22   SER A OG    1 
ATOM   1441 N  N     . LEU E 3 31  ? 15.135  23.381  22.080  1.00 13.54 ? 23   LEU A N     1 
ATOM   1442 C  CA    . LEU E 3 31  ? 14.988  21.997  22.491  1.00 13.64 ? 23   LEU A CA    1 
ATOM   1443 C  C     . LEU E 3 31  ? 16.333  21.269  22.472  1.00 13.63 ? 23   LEU A C     1 
ATOM   1444 O  O     . LEU E 3 31  ? 16.418  20.150  22.960  1.00 13.58 ? 23   LEU A O     1 
ATOM   1445 C  CB    . LEU E 3 31  ? 13.980  21.273  21.575  1.00 13.68 ? 23   LEU A CB    1 
ATOM   1446 C  CG    . LEU E 3 31  ? 12.482  21.239  21.942  1.00 13.96 ? 23   LEU A CG    1 
ATOM   1447 C  CD1   . LEU E 3 31  ? 12.043  22.270  22.970  1.00 14.18 ? 23   LEU A CD1   1 
ATOM   1448 C  CD2   . LEU E 3 31  ? 11.646  21.392  20.692  1.00 14.54 ? 23   LEU A CD2   1 
ATOM   1449 N  N     . LYS E 3 32  ? 17.377  21.887  21.915  1.00 13.73 ? 24   LYS A N     1 
ATOM   1450 C  CA    . LYS E 3 32  ? 18.708  21.267  21.891  1.00 14.02 ? 24   LYS A CA    1 
ATOM   1451 C  C     . LYS E 3 32  ? 19.094  20.849  23.305  1.00 13.57 ? 24   LYS A C     1 
ATOM   1452 O  O     . LYS E 3 32  ? 18.966  21.638  24.234  1.00 13.56 ? 24   LYS A O     1 
ATOM   1453 C  CB    . LYS E 3 32  ? 19.758  22.226  21.316  1.00 14.32 ? 24   LYS A CB    1 
ATOM   1454 C  CG    . LYS E 3 32  ? 21.194  21.636  21.182  1.00 15.93 ? 24   LYS A CG    1 
ATOM   1455 C  CD    . LYS E 3 32  ? 21.732  21.633  19.730  1.00 17.87 ? 24   LYS A CD    1 
ATOM   1456 C  CE    . LYS E 3 32  ? 21.964  20.199  19.162  1.00 18.58 ? 24   LYS A CE    1 
ATOM   1457 N  NZ    . LYS E 3 32  ? 20.782  19.624  18.432  1.00 16.91 ? 24   LYS A NZ    1 
ATOM   1458 N  N     . GLY E 3 33  ? 19.512  19.594  23.462  1.00 13.26 ? 25   GLY A N     1 
ATOM   1459 C  CA    . GLY E 3 33  ? 19.929  19.061  24.749  1.00 13.06 ? 25   GLY A CA    1 
ATOM   1460 C  C     . GLY E 3 33  ? 18.819  18.521  25.643  1.00 12.88 ? 25   GLY A C     1 
ATOM   1461 O  O     . GLY E 3 33  ? 19.104  17.784  26.590  1.00 12.82 ? 25   GLY A O     1 
ATOM   1462 N  N     . LYS E 3 34  ? 17.566  18.882  25.366  1.00 12.39 ? 26   LYS A N     1 
ATOM   1463 C  CA    . LYS E 3 34  ? 16.439  18.423  26.173  1.00 12.34 ? 26   LYS A CA    1 
ATOM   1464 C  C     . LYS E 3 34  ? 15.826  17.097  25.669  1.00 12.04 ? 26   LYS A C     1 
ATOM   1465 O  O     . LYS E 3 34  ? 15.849  16.797  24.474  1.00 11.40 ? 26   LYS A O     1 
ATOM   1466 C  CB    . LYS E 3 34  ? 15.351  19.494  26.218  1.00 12.53 ? 26   LYS A CB    1 
ATOM   1467 C  CG    . LYS E 3 34  ? 15.839  20.881  26.619  1.00 13.33 ? 26   LYS A CG    1 
ATOM   1468 C  CD    . LYS E 3 34  ? 14.690  21.733  27.158  1.00 14.34 ? 26   LYS A CD    1 
ATOM   1469 C  CE    . LYS E 3 34  ? 15.080  23.200  27.349  1.00 14.50 ? 26   LYS A CE    1 
ATOM   1470 N  NZ    . LYS E 3 34  ? 13.945  24.108  26.998  1.00 14.21 ? 26   LYS A NZ    1 
ATOM   1471 N  N     . PRO E 3 35  ? 15.264  16.307  26.581  1.00 11.78 ? 27   PRO A N     1 
ATOM   1472 C  CA    . PRO E 3 35  ? 14.481  15.139  26.172  1.00 11.55 ? 27   PRO A CA    1 
ATOM   1473 C  C     . PRO E 3 35  ? 13.187  15.580  25.481  1.00 11.01 ? 27   PRO A C     1 
ATOM   1474 O  O     . PRO E 3 35  ? 12.372  16.254  26.098  1.00 10.33 ? 27   PRO A O     1 
ATOM   1475 C  CB    . PRO E 3 35  ? 14.196  14.403  27.493  1.00 11.45 ? 27   PRO A CB    1 
ATOM   1476 C  CG    . PRO E 3 35  ? 14.435  15.382  28.572  1.00 11.66 ? 27   PRO A CG    1 
ATOM   1477 C  CD    . PRO E 3 35  ? 15.324  16.458  28.045  1.00 11.72 ? 27   PRO A CD    1 
ATOM   1478 N  N     . VAL E 3 36  ? 13.048  15.219  24.208  1.00 10.81 ? 28   VAL A N     1 
ATOM   1479 C  CA    . VAL E 3 36  ? 11.877  15.527  23.396  1.00 10.87 ? 28   VAL A CA    1 
ATOM   1480 C  C     . VAL E 3 36  ? 11.150  14.241  23.013  1.00 10.88 ? 28   VAL A C     1 
ATOM   1481 O  O     . VAL E 3 36  ? 11.740  13.311  22.472  1.00 10.75 ? 28   VAL A O     1 
ATOM   1482 C  CB    . VAL E 3 36  ? 12.258  16.298  22.112  1.00 10.73 ? 28   VAL A CB    1 
ATOM   1483 C  CG1   . VAL E 3 36  ? 11.045  16.567  21.269  1.00 10.57 ? 28   VAL A CG1   1 
ATOM   1484 C  CG2   . VAL E 3 36  ? 12.940  17.612  22.462  1.00 11.38 ? 28   VAL A CG2   1 
ATOM   1485 N  N     . VAL E 3 37  ? 9.849   14.232  23.272  1.00 11.10 ? 29   VAL A N     1 
ATOM   1486 C  CA    . VAL E 3 37  ? 8.996   13.067  23.111  1.00 11.08 ? 29   VAL A CA    1 
ATOM   1487 C  C     . VAL E 3 37  ? 7.798   13.470  22.235  1.00 10.91 ? 29   VAL A C     1 
ATOM   1488 O  O     . VAL E 3 37  ? 6.871   14.136  22.688  1.00 10.68 ? 29   VAL A O     1 
ATOM   1489 C  CB    . VAL E 3 37  ? 8.534   12.557  24.510  1.00 11.21 ? 29   VAL A CB    1 
ATOM   1490 C  CG1   . VAL E 3 37  ? 7.847   11.200  24.424  1.00 11.32 ? 29   VAL A CG1   1 
ATOM   1491 C  CG2   . VAL E 3 37  ? 9.724   12.473  25.456  1.00 11.65 ? 29   VAL A CG2   1 
ATOM   1492 N  N     . VAL E 3 38  ? 7.846   13.106  20.961  1.00 10.96 ? 30   VAL A N     1 
ATOM   1493 C  CA    . VAL E 3 38  ? 6.705   13.311  20.063  1.00 11.01 ? 30   VAL A CA    1 
ATOM   1494 C  C     . VAL E 3 38  ? 5.591   12.262  20.286  1.00 11.14 ? 30   VAL A C     1 
ATOM   1495 O  O     . VAL E 3 38  ? 5.841   11.061  20.294  1.00 10.63 ? 30   VAL A O     1 
ATOM   1496 C  CB    . VAL E 3 38  ? 7.144   13.334  18.604  1.00 10.62 ? 30   VAL A CB    1 
ATOM   1497 C  CG1   . VAL E 3 38  ? 5.939   13.484  17.698  1.00 11.09 ? 30   VAL A CG1   1 
ATOM   1498 C  CG2   . VAL E 3 38  ? 8.117   14.485  18.380  1.00 10.44 ? 30   VAL A CG2   1 
ATOM   1499 N  N     . CYS E 3 39  ? 4.363   12.748  20.439  1.00 11.56 ? 31   CYS A N     1 
ATOM   1500 C  CA    . CYS E 3 39  ? 3.253   11.954  20.957  1.00 12.26 ? 31   CYS A CA    1 
ATOM   1501 C  C     . CYS E 3 39  ? 2.014   12.016  20.070  1.00 12.55 ? 31   CYS A C     1 
ATOM   1502 O  O     . CYS E 3 39  ? 1.778   12.996  19.371  1.00 12.51 ? 31   CYS A O     1 
ATOM   1503 C  CB    . CYS E 3 39  ? 2.857   12.445  22.351  1.00 12.08 ? 31   CYS A CB    1 
ATOM   1504 S  SG    . CYS E 3 39  ? 4.195   12.507  23.553  1.00 13.09 ? 31   CYS A SG    1 
ATOM   1505 N  N     . VAL E 3 40  ? 1.219   10.956  20.144  1.00 13.08 ? 32   VAL A N     1 
ATOM   1506 C  CA    . VAL E 3 40  ? -0.046  10.842  19.442  1.00 13.55 ? 32   VAL A CA    1 
ATOM   1507 C  C     . VAL E 3 40  ? -1.120  10.865  20.500  1.00 14.02 ? 32   VAL A C     1 
ATOM   1508 O  O     . VAL E 3 40  ? -1.340  9.874   21.182  1.00 13.77 ? 32   VAL A O     1 
ATOM   1509 C  CB    . VAL E 3 40  ? -0.139  9.523   18.655  1.00 13.65 ? 32   VAL A CB    1 
ATOM   1510 C  CG1   . VAL E 3 40  ? -1.329  9.542   17.734  1.00 13.13 ? 32   VAL A CG1   1 
ATOM   1511 C  CG2   . VAL E 3 40  ? 1.147   9.277   17.872  1.00 13.81 ? 32   VAL A CG2   1 
ATOM   1512 N  N     . PHE E 3 41  ? -1.761  12.021  20.646  1.00 14.86 ? 33   PHE A N     1 
ATOM   1513 C  CA    . PHE E 3 41  ? -2.770  12.250  21.667  1.00 15.06 ? 33   PHE A CA    1 
ATOM   1514 C  C     . PHE E 3 41  ? -4.119  11.800  21.122  1.00 15.95 ? 33   PHE A C     1 
ATOM   1515 O  O     . PHE E 3 41  ? -4.514  12.222  20.033  1.00 16.41 ? 33   PHE A O     1 
ATOM   1516 C  CB    . PHE E 3 41  ? -2.815  13.736  22.047  1.00 14.82 ? 33   PHE A CB    1 
ATOM   1517 C  CG    . PHE E 3 41  ? -1.576  14.228  22.759  1.00 13.70 ? 33   PHE A CG    1 
ATOM   1518 C  CD1   . PHE E 3 41  ? -1.418  14.028  24.125  1.00 13.16 ? 33   PHE A CD1   1 
ATOM   1519 C  CD2   . PHE E 3 41  ? -0.570  14.891  22.067  1.00 12.71 ? 33   PHE A CD2   1 
ATOM   1520 C  CE1   . PHE E 3 41  ? -0.281  14.483  24.794  1.00 12.48 ? 33   PHE A CE1   1 
ATOM   1521 C  CE2   . PHE E 3 41  ? 0.569   15.344  22.728  1.00 12.34 ? 33   PHE A CE2   1 
ATOM   1522 C  CZ    . PHE E 3 41  ? 0.713   15.133  24.092  1.00 12.36 ? 33   PHE A CZ    1 
ATOM   1523 N  N     . SER E 3 42  ? -4.824  10.958  21.882  1.00 16.67 ? 34   SER A N     1 
ATOM   1524 C  CA    . SER E 3 42  ? -6.116  10.402  21.451  1.00 17.07 ? 34   SER A CA    1 
ATOM   1525 C  C     . SER E 3 42  ? -7.319  11.316  21.670  1.00 17.62 ? 34   SER A C     1 
ATOM   1526 O  O     . SER E 3 42  ? -8.351  11.123  21.024  1.00 18.43 ? 34   SER A O     1 
ATOM   1527 C  CB    . SER E 3 42  ? -6.393  9.059   22.145  1.00 16.87 ? 34   SER A CB    1 
ATOM   1528 O  OG    . SER E 3 42  ? -6.504  9.202   23.550  1.00 16.21 ? 34   SER A OG    1 
ATOM   1529 N  N     . GLY E 3 43  ? -7.205  12.279  22.583  1.00 17.83 ? 35   GLY A N     1 
ATOM   1530 C  CA    . GLY E 3 43  ? -8.328  13.129  22.953  1.00 18.17 ? 35   GLY A CA    1 
ATOM   1531 C  C     . GLY E 3 43  ? -9.216  12.613  24.086  1.00 18.49 ? 35   GLY A C     1 
ATOM   1532 O  O     . GLY E 3 43  ? -10.194 13.270  24.434  1.00 18.47 ? 35   GLY A O     1 
ATOM   1533 N  N     . ARG E 3 44  ? -8.874  11.460  24.667  1.00 19.07 ? 36   ARG A N     1 
ATOM   1534 C  CA    . ARG E 3 44  ? -9.657  10.837  25.743  1.00 19.56 ? 36   ARG A CA    1 
ATOM   1535 C  C     . ARG E 3 44  ? -9.564  11.603  27.059  1.00 19.92 ? 36   ARG A C     1 
ATOM   1536 O  O     . ARG E 3 44  ? -10.570 11.937  27.683  1.00 19.78 ? 36   ARG A O     1 
ATOM   1537 C  CB    . ARG E 3 44  ? -9.142  9.421   26.021  1.00 19.72 ? 36   ARG A CB    1 
ATOM   1538 C  CG    . ARG E 3 44  ? -9.391  8.410   24.930  1.00 20.55 ? 36   ARG A CG    1 
ATOM   1539 C  CD    . ARG E 3 44  ? -10.328 7.298   25.341  1.00 22.45 ? 36   ARG A CD    1 
ATOM   1540 N  NE    . ARG E 3 44  ? -11.400 7.118   24.370  1.00 24.53 ? 36   ARG A NE    1 
ATOM   1541 C  CZ    . ARG E 3 44  ? -12.510 6.418   24.586  1.00 25.65 ? 36   ARG A CZ    1 
ATOM   1542 N  NH1   . ARG E 3 44  ? -12.724 5.810   25.753  1.00 26.28 ? 36   ARG A NH1   1 
ATOM   1543 N  NH2   . ARG E 3 44  ? -13.413 6.319   23.618  1.00 26.03 ? 36   ARG A NH2   1 
ATOM   1544 N  N     . PHE E 3 45  ? -8.328  11.819  27.488  1.00 20.37 ? 37   PHE A N     1 
ATOM   1545 C  CA    . PHE E 3 45  ? -8.023  12.462  28.755  1.00 20.56 ? 37   PHE A CA    1 
ATOM   1546 C  C     . PHE E 3 45  ? -6.931  13.489  28.506  1.00 20.85 ? 37   PHE A C     1 
ATOM   1547 O  O     . PHE E 3 45  ? -6.457  13.646  27.382  1.00 21.46 ? 37   PHE A O     1 
ATOM   1548 C  CB    . PHE E 3 45  ? -7.509  11.427  29.767  1.00 20.61 ? 37   PHE A CB    1 
ATOM   1549 C  CG    . PHE E 3 45  ? -8.471  10.299  30.046  1.00 20.47 ? 37   PHE A CG    1 
ATOM   1550 C  CD1   . PHE E 3 45  ? -8.421  9.127   29.299  1.00 20.98 ? 37   PHE A CD1   1 
ATOM   1551 C  CD2   . PHE E 3 45  ? -9.412  10.403  31.070  1.00 20.56 ? 37   PHE A CD2   1 
ATOM   1552 C  CE1   . PHE E 3 45  ? -9.316  8.073   29.555  1.00 21.73 ? 37   PHE A CE1   1 
ATOM   1553 C  CE2   . PHE E 3 45  ? -10.311 9.359   31.333  1.00 20.48 ? 37   PHE A CE2   1 
ATOM   1554 C  CZ    . PHE E 3 45  ? -10.263 8.194   30.581  1.00 21.05 ? 37   PHE A CZ    1 
ATOM   1555 N  N     . GLU E 3 46  ? -6.518  14.189  29.551  1.00 21.04 ? 38   GLU A N     1 
ATOM   1556 C  CA    . GLU E 3 46  ? -5.254  14.901  29.491  1.00 21.10 ? 38   GLU A CA    1 
ATOM   1557 C  C     . GLU E 3 46  ? -4.162  13.835  29.296  1.00 21.08 ? 38   GLU A C     1 
ATOM   1558 O  O     . GLU E 3 46  ? -4.126  12.828  30.032  1.00 21.70 ? 38   GLU A O     1 
ATOM   1559 C  CB    . GLU E 3 46  ? -5.015  15.738  30.774  1.00 21.23 ? 38   GLU A CB    1 
ATOM   1560 C  CG    . GLU E 3 46  ? -4.904  14.975  32.104  1.00 21.42 ? 38   GLU A CG    1 
ATOM   1561 C  CD    . GLU E 3 46  ? -4.049  15.700  33.152  1.00 22.17 ? 38   GLU A CD    1 
ATOM   1562 O  OE1   . GLU E 3 46  ? -2.944  15.201  33.495  1.00 21.46 ? 38   GLU A OE1   1 
ATOM   1563 O  OE2   . GLU E 3 46  ? -4.485  16.769  33.643  1.00 22.23 ? 38   GLU A OE2   1 
ATOM   1564 N  N     . ASP E 3 47  ? -3.300  14.007  28.298  1.00 20.08 ? 39   ASP A N     1 
ATOM   1565 C  CA    . ASP E 3 47  ? -2.086  13.184  28.233  1.00 19.58 ? 39   ASP A CA    1 
ATOM   1566 C  C     . ASP E 3 47  ? -2.343  11.683  27.924  1.00 18.30 ? 39   ASP A C     1 
ATOM   1567 O  O     . ASP E 3 47  ? -1.491  10.826  28.217  1.00 18.55 ? 39   ASP A O     1 
ATOM   1568 C  CB    . ASP E 3 47  ? -1.275  13.312  29.560  1.00 19.86 ? 39   ASP A CB    1 
ATOM   1569 C  CG    . ASP E 3 47  ? -0.694  14.728  29.791  1.00 21.70 ? 39   ASP A CG    1 
ATOM   1570 O  OD1   . ASP E 3 47  ? -0.811  15.612  28.899  1.00 24.16 ? 39   ASP A OD1   1 
ATOM   1571 O  OD2   . ASP E 3 47  ? -0.069  15.041  30.840  1.00 22.84 ? 39   ASP A OD2   1 
ATOM   1572 N  N     . SER E 3 48  ? -3.495  11.349  27.345  1.00 16.53 ? 40   SER A N     1 
ATOM   1573 C  CA    . SER E 3 48  ? -3.738  9.968   26.920  1.00 15.08 ? 40   SER A CA    1 
ATOM   1574 C  C     . SER E 3 48  ? -3.301  9.774   25.466  1.00 14.24 ? 40   SER A C     1 
ATOM   1575 O  O     . SER E 3 48  ? -3.737  10.499  24.573  1.00 14.21 ? 40   SER A O     1 
ATOM   1576 C  CB    . SER E 3 48  ? -5.199  9.561   27.116  1.00 14.86 ? 40   SER A CB    1 
ATOM   1577 O  OG    . SER E 3 48  ? -6.073  10.262  26.260  1.00 13.83 ? 40   SER A OG    1 
ATOM   1578 N  N     . GLY E 3 49  ? -2.423  8.799   25.251  1.00 13.06 ? 41   GLY A N     1 
ATOM   1579 C  CA    . GLY E 3 49  ? -1.942  8.462   23.934  1.00 12.33 ? 41   GLY A CA    1 
ATOM   1580 C  C     . GLY E 3 49  ? -0.735  7.534   23.926  1.00 12.07 ? 41   GLY A C     1 
ATOM   1581 O  O     . GLY E 3 49  ? -0.514  6.748   24.835  1.00 11.80 ? 41   GLY A O     1 
ATOM   1582 N  N     . ALA E 3 50  ? 0.049   7.625   22.861  1.00 11.94 ? 42   ALA A N     1 
ATOM   1583 C  CA    . ALA E 3 50  ? 1.219   6.784   22.684  1.00 11.81 ? 42   ALA A CA    1 
ATOM   1584 C  C     . ALA E 3 50  ? 2.369   7.601   22.100  1.00 11.60 ? 42   ALA A C     1 
ATOM   1585 O  O     . ALA E 3 50  ? 2.158   8.563   21.363  1.00 11.53 ? 42   ALA A O     1 
ATOM   1586 C  CB    . ALA E 3 50  ? 0.881   5.595   21.780  1.00 11.76 ? 42   ALA A CB    1 
ATOM   1587 N  N     . VAL E 3 51  ? 3.589   7.221   22.448  1.00 11.30 ? 43   VAL A N     1 
ATOM   1588 C  CA    . VAL E 3 51  ? 4.760   7.911   21.947  1.00 11.08 ? 43   VAL A CA    1 
ATOM   1589 C  C     . VAL E 3 51  ? 4.965   7.477   20.493  1.00 11.08 ? 43   VAL A C     1 
ATOM   1590 O  O     . VAL E 3 51  ? 4.964   6.290   20.189  1.00 11.07 ? 43   VAL A O     1 
ATOM   1591 C  CB    . VAL E 3 51  ? 5.977   7.587   22.816  1.00 10.97 ? 43   VAL A CB    1 
ATOM   1592 C  CG1   . VAL E 3 51  ? 7.267   8.183   22.225  1.00 11.43 ? 43   VAL A CG1   1 
ATOM   1593 C  CG2   . VAL E 3 51  ? 5.749   8.088   24.224  1.00 10.07 ? 43   VAL A CG2   1 
ATOM   1594 N  N     . ALA E 3 52  ? 5.080   8.442   19.589  1.00 11.10 ? 44   ALA A N     1 
ATOM   1595 C  CA    . ALA E 3 52  ? 5.395   8.152   18.187  1.00 11.17 ? 44   ALA A CA    1 
ATOM   1596 C  C     . ALA E 3 52  ? 6.886   7.974   18.001  1.00 11.05 ? 44   ALA A C     1 
ATOM   1597 O  O     . ALA E 3 52  ? 7.307   7.140   17.219  1.00 11.48 ? 44   ALA A O     1 
ATOM   1598 C  CB    . ALA E 3 52  ? 4.886   9.266   17.264  1.00 10.88 ? 44   ALA A CB    1 
ATOM   1599 N  N     . THR E 3 53  ? 7.670   8.783   18.705  1.00 11.16 ? 45   THR A N     1 
ATOM   1600 C  CA    . THR E 3 53  ? 9.129   8.765   18.610  1.00 11.73 ? 45   THR A CA    1 
ATOM   1601 C  C     . THR E 3 53  ? 9.726   9.746   19.604  1.00 11.66 ? 45   THR A C     1 
ATOM   1602 O  O     . THR E 3 53  ? 9.115   10.747  19.925  1.00 11.73 ? 45   THR A O     1 
ATOM   1603 C  CB    . THR E 3 53  ? 9.615   9.122   17.189  1.00 11.59 ? 45   THR A CB    1 
ATOM   1604 O  OG1   . THR E 3 53  ? 11.006  9.453   17.205  1.00 13.59 ? 45   THR A OG1   1 
ATOM   1605 C  CG2   . THR E 3 53  ? 9.040   10.382  16.744  1.00 12.55 ? 45   THR A CG2   1 
ATOM   1606 N  N     . ALA E 3 54  ? 10.922  9.445   20.084  1.00 11.81 ? 46   ALA A N     1 
ATOM   1607 C  CA    . ALA E 3 54  ? 11.615  10.312  21.032  1.00 12.16 ? 46   ALA A CA    1 
ATOM   1608 C  C     . ALA E 3 54  ? 13.079  10.430  20.648  1.00 12.38 ? 46   ALA A C     1 
ATOM   1609 O  O     . ALA E 3 54  ? 13.617  9.566   19.952  1.00 12.80 ? 46   ALA A O     1 
ATOM   1610 C  CB    . ALA E 3 54  ? 11.474  9.774   22.446  1.00 12.03 ? 46   ALA A CB    1 
ATOM   1611 N  N     . ASN E 3 55  ? 13.720  11.508  21.085  1.00 12.50 ? 47   ASN A N     1 
ATOM   1612 C  CA    . ASN E 3 55  ? 15.114  11.740  20.736  1.00 12.61 ? 47   ASN A CA    1 
ATOM   1613 C  C     . ASN E 3 55  ? 16.020  11.009  21.709  1.00 13.50 ? 47   ASN A C     1 
ATOM   1614 O  O     . ASN E 3 55  ? 15.553  10.480  22.719  1.00 12.91 ? 47   ASN A O     1 
ATOM   1615 C  CB    . ASN E 3 55  ? 15.435  13.242  20.635  1.00 12.43 ? 47   ASN A CB    1 
ATOM   1616 C  CG    . ASN E 3 55  ? 15.426  13.955  21.970  1.00 10.73 ? 47   ASN A CG    1 
ATOM   1617 O  OD1   . ASN E 3 55  ? 15.016  13.407  22.973  1.00 9.45  ? 47   ASN A OD1   1 
ATOM   1618 N  ND2   . ASN E 3 55  ? 15.901  15.190  21.978  1.00 9.22  ? 47   ASN A ND2   1 
ATOM   1619 N  N     . TYR E 3 56  ? 17.313  10.978  21.402  1.00 14.72 ? 48   TYR A N     1 
ATOM   1620 C  CA    . TYR E 3 56  ? 18.244  10.129  22.146  1.00 16.07 ? 48   TYR A CA    1 
ATOM   1621 C  C     . TYR E 3 56  ? 18.360  10.423  23.644  1.00 16.11 ? 48   TYR A C     1 
ATOM   1622 O  O     . TYR E 3 56  ? 18.654  9.521   24.407  1.00 16.19 ? 48   TYR A O     1 
ATOM   1623 C  CB    . TYR E 3 56  ? 19.618  10.063  21.450  1.00 16.75 ? 48   TYR A CB    1 
ATOM   1624 C  CG    . TYR E 3 56  ? 19.681  8.864   20.485  1.00 20.38 ? 48   TYR A CG    1 
ATOM   1625 C  CD1   . TYR E 3 56  ? 19.447  9.023   19.107  1.00 20.47 ? 48   TYR A CD1   1 
ATOM   1626 C  CD2   . TYR E 3 56  ? 19.890  7.555   20.971  1.00 23.28 ? 48   TYR A CD2   1 
ATOM   1627 C  CE1   . TYR E 3 56  ? 19.442  7.926   18.257  1.00 21.50 ? 48   TYR A CE1   1 
ATOM   1628 C  CE2   . TYR E 3 56  ? 19.893  6.447   20.116  1.00 23.24 ? 48   TYR A CE2   1 
ATOM   1629 C  CZ    . TYR E 3 56  ? 19.674  6.639   18.769  1.00 23.77 ? 48   TYR A CZ    1 
ATOM   1630 O  OH    . TYR E 3 56  ? 19.701  5.534   17.931  1.00 26.02 ? 48   TYR A OH    1 
ATOM   1631 N  N     . GLU E 3 57  ? 18.081  11.653  24.065  1.00 16.39 ? 49   GLU A N     1 
ATOM   1632 C  CA    . GLU E 3 57  ? 18.122  12.012  25.485  1.00 16.78 ? 49   GLU A CA    1 
ATOM   1633 C  C     . GLU E 3 57  ? 16.932  11.448  26.281  1.00 16.70 ? 49   GLU A C     1 
ATOM   1634 O  O     . GLU E 3 57  ? 17.007  11.326  27.496  1.00 16.71 ? 49   GLU A O     1 
ATOM   1635 C  CB    . GLU E 3 57  ? 18.181  13.542  25.666  1.00 17.31 ? 49   GLU A CB    1 
ATOM   1636 C  CG    . GLU E 3 57  ? 19.582  14.151  25.654  1.00 18.60 ? 49   GLU A CG    1 
ATOM   1637 C  CD    . GLU E 3 57  ? 20.198  14.260  24.247  1.00 22.49 ? 49   GLU A CD    1 
ATOM   1638 O  OE1   . GLU E 3 57  ? 19.427  14.366  23.231  1.00 22.86 ? 49   GLU A OE1   1 
ATOM   1639 O  OE2   . GLU E 3 57  ? 21.467  14.249  24.155  1.00 22.97 ? 49   GLU A OE2   1 
ATOM   1640 N  N     . ALA E 3 58  ? 15.828  11.145  25.600  1.00 16.93 ? 50   ALA A N     1 
ATOM   1641 C  CA    . ALA E 3 58  ? 14.646  10.524  26.223  1.00 16.60 ? 50   ALA A CA    1 
ATOM   1642 C  C     . ALA E 3 58  ? 14.720  8.996   26.202  1.00 16.58 ? 50   ALA A C     1 
ATOM   1643 O  O     . ALA E 3 58  ? 14.327  8.341   27.164  1.00 16.37 ? 50   ALA A O     1 
ATOM   1644 C  CB    . ALA E 3 58  ? 13.395  10.981  25.521  1.00 16.47 ? 50   ALA A CB    1 
ATOM   1645 N  N     . ARG E 3 59  ? 15.218  8.442   25.095  1.00 16.68 ? 51   ARG A N     1 
ATOM   1646 C  CA    . ARG E 3 59  ? 15.414  6.998   24.950  1.00 16.63 ? 51   ARG A CA    1 
ATOM   1647 C  C     . ARG E 3 59  ? 16.382  6.465   25.990  1.00 16.08 ? 51   ARG A C     1 
ATOM   1648 O  O     . ARG E 3 59  ? 16.243  5.332   26.437  1.00 16.20 ? 51   ARG A O     1 
ATOM   1649 C  CB    . ARG E 3 59  ? 15.936  6.664   23.556  1.00 16.88 ? 51   ARG A CB    1 
ATOM   1650 C  CG    . ARG E 3 59  ? 14.876  6.694   22.497  1.00 18.41 ? 51   ARG A CG    1 
ATOM   1651 C  CD    . ARG E 3 59  ? 15.276  6.016   21.204  1.00 21.01 ? 51   ARG A CD    1 
ATOM   1652 N  NE    . ARG E 3 59  ? 15.044  6.895   20.060  1.00 24.55 ? 51   ARG A NE    1 
ATOM   1653 C  CZ    . ARG E 3 59  ? 15.693  6.813   18.891  1.00 28.63 ? 51   ARG A CZ    1 
ATOM   1654 N  NH1   . ARG E 3 59  ? 16.608  5.868   18.674  1.00 31.05 ? 51   ARG A NH1   1 
ATOM   1655 N  NH2   . ARG E 3 59  ? 15.417  7.669   17.915  1.00 29.11 ? 51   ARG A NH2   1 
ATOM   1656 N  N     . LYS E 3 60  ? 17.362  7.291   26.354  1.00 15.51 ? 52   LYS A N     1 
ATOM   1657 C  CA    . LYS E 3 60  ? 18.294  7.028   27.453  1.00 15.19 ? 52   LYS A CA    1 
ATOM   1658 C  C     . LYS E 3 60  ? 17.613  6.411   28.695  1.00 14.77 ? 52   LYS A C     1 
ATOM   1659 O  O     . LYS E 3 60  ? 18.193  5.573   29.375  1.00 14.22 ? 52   LYS A O     1 
ATOM   1660 C  CB    . LYS E 3 60  ? 18.969  8.350   27.873  1.00 15.46 ? 52   LYS A CB    1 
ATOM   1661 C  CG    . LYS E 3 60  ? 20.501  8.360   27.797  1.00 16.42 ? 52   LYS A CG    1 
ATOM   1662 C  CD    . LYS E 3 60  ? 21.057  9.661   27.210  1.00 16.90 ? 52   LYS A CD    1 
ATOM   1663 C  CE    . LYS E 3 60  ? 22.422  9.418   26.533  1.00 18.43 ? 52   LYS A CE    1 
ATOM   1664 N  NZ    . LYS E 3 60  ? 22.332  8.980   25.098  1.00 17.49 ? 52   LYS A NZ    1 
ATOM   1665 N  N     . PHE E 3 61  ? 16.392  6.852   28.986  1.00 14.32 ? 53   PHE A N     1 
ATOM   1666 C  CA    . PHE E 3 61  ? 15.705  6.496   30.218  1.00 14.04 ? 53   PHE A CA    1 
ATOM   1667 C  C     . PHE E 3 61  ? 14.497  5.563   30.024  1.00 14.27 ? 53   PHE A C     1 
ATOM   1668 O  O     . PHE E 3 61  ? 13.795  5.271   30.984  1.00 14.10 ? 53   PHE A O     1 
ATOM   1669 C  CB    . PHE E 3 61  ? 15.302  7.783   30.944  1.00 13.71 ? 53   PHE A CB    1 
ATOM   1670 C  CG    . PHE E 3 61  ? 16.485  8.636   31.370  1.00 13.34 ? 53   PHE A CG    1 
ATOM   1671 C  CD1   . PHE E 3 61  ? 17.347  8.204   32.384  1.00 11.37 ? 53   PHE A CD1   1 
ATOM   1672 C  CD2   . PHE E 3 61  ? 16.752  9.859   30.748  1.00 13.06 ? 53   PHE A CD2   1 
ATOM   1673 C  CE1   . PHE E 3 61  ? 18.442  8.970   32.765  1.00 11.13 ? 53   PHE A CE1   1 
ATOM   1674 C  CE2   . PHE E 3 61  ? 17.851  10.638  31.139  1.00 12.58 ? 53   PHE A CE2   1 
ATOM   1675 C  CZ    . PHE E 3 61  ? 18.692  10.195  32.149  1.00 11.51 ? 53   PHE A CZ    1 
ATOM   1676 N  N     . GLY E 3 62  ? 14.276  5.082   28.797  1.00 14.47 ? 54   GLY A N     1 
ATOM   1677 C  CA    . GLY E 3 62  ? 13.224  4.115   28.502  1.00 14.67 ? 54   GLY A CA    1 
ATOM   1678 C  C     . GLY E 3 62  ? 12.068  4.639   27.655  1.00 15.19 ? 54   GLY A C     1 
ATOM   1679 O  O     . GLY E 3 62  ? 11.137  3.899   27.364  1.00 15.56 ? 54   GLY A O     1 
ATOM   1680 N  N     . VAL E 3 63  ? 12.124  5.905   27.251  1.00 15.36 ? 55   VAL A N     1 
ATOM   1681 C  CA    . VAL E 3 63  ? 10.990  6.564   26.633  1.00 15.51 ? 55   VAL A CA    1 
ATOM   1682 C  C     . VAL E 3 63  ? 11.081  6.346   25.138  1.00 16.07 ? 55   VAL A C     1 
ATOM   1683 O  O     . VAL E 3 63  ? 11.801  7.065   24.447  1.00 16.42 ? 55   VAL A O     1 
ATOM   1684 C  CB    . VAL E 3 63  ? 10.972  8.066   26.979  1.00 15.37 ? 55   VAL A CB    1 
ATOM   1685 C  CG1   . VAL E 3 63  ? 9.849   8.795   26.250  1.00 15.13 ? 55   VAL A CG1   1 
ATOM   1686 C  CG2   . VAL E 3 63  ? 10.832  8.248   28.480  1.00 15.48 ? 55   VAL A CG2   1 
ATOM   1687 N  N     . LYS E 3 64  ? 10.355  5.342   24.643  1.00 16.46 ? 56   LYS A N     1 
ATOM   1688 C  CA    . LYS E 3 64  ? 10.466  4.920   23.240  1.00 16.49 ? 56   LYS A CA    1 
ATOM   1689 C  C     . LYS E 3 64  ? 9.110   4.827   22.559  1.00 16.15 ? 56   LYS A C     1 
ATOM   1690 O  O     . LYS E 3 64  ? 8.069   4.792   23.223  1.00 15.79 ? 56   LYS A O     1 
ATOM   1691 C  CB    . LYS E 3 64  ? 11.227  3.583   23.116  1.00 16.82 ? 56   LYS A CB    1 
ATOM   1692 C  CG    . LYS E 3 64  ? 10.730  2.432   24.017  1.00 17.47 ? 56   LYS A CG    1 
ATOM   1693 C  CD    . LYS E 3 64  ? 11.630  1.184   23.868  1.00 18.34 ? 56   LYS A CD    1 
ATOM   1694 C  CE    . LYS E 3 64  ? 10.860  -0.142  24.078  1.00 19.45 ? 56   LYS A CE    1 
ATOM   1695 N  NZ    . LYS E 3 64  ? 9.873   -0.146  25.227  1.00 19.47 ? 56   LYS A NZ    1 
ATOM   1696 N  N     . ALA E 3 65  ? 9.136   4.801   21.224  1.00 15.85 ? 57   ALA A N     1 
ATOM   1697 C  CA    . ALA E 3 65  ? 7.914   4.707   20.433  1.00 15.56 ? 57   ALA A CA    1 
ATOM   1698 C  C     . ALA E 3 65  ? 7.206   3.429   20.812  1.00 15.33 ? 57   ALA A C     1 
ATOM   1699 O  O     . ALA E 3 65  ? 7.859   2.408   21.001  1.00 15.38 ? 57   ALA A O     1 
ATOM   1700 C  CB    . ALA E 3 65  ? 8.220   4.724   18.952  1.00 15.47 ? 57   ALA A CB    1 
ATOM   1701 N  N     . GLY E 3 66  ? 5.884   3.498   20.961  1.00 15.10 ? 58   GLY A N     1 
ATOM   1702 C  CA    . GLY E 3 66  ? 5.104   2.360   21.400  1.00 15.02 ? 58   GLY A CA    1 
ATOM   1703 C  C     . GLY E 3 66  ? 4.530   2.534   22.786  1.00 14.87 ? 58   GLY A C     1 
ATOM   1704 O  O     . GLY E 3 66  ? 3.335   2.379   22.960  1.00 15.21 ? 58   GLY A O     1 
ATOM   1705 N  N     . ILE E 3 67  ? 5.359   2.862   23.775  1.00 14.76 ? 59   ILE A N     1 
ATOM   1706 C  CA    . ILE E 3 67  ? 4.861   2.946   25.159  1.00 14.70 ? 59   ILE A CA    1 
ATOM   1707 C  C     . ILE E 3 67  ? 3.811   4.052   25.376  1.00 14.35 ? 59   ILE A C     1 
ATOM   1708 O  O     . ILE E 3 67  ? 3.825   5.085   24.700  1.00 14.09 ? 59   ILE A O     1 
ATOM   1709 C  CB    . ILE E 3 67  ? 6.009   3.104   26.185  1.00 14.65 ? 59   ILE A CB    1 
ATOM   1710 C  CG1   . ILE E 3 67  ? 6.773   4.419   25.982  1.00 15.22 ? 59   ILE A CG1   1 
ATOM   1711 C  CG2   . ILE E 3 67  ? 6.952   1.906   26.114  1.00 14.97 ? 59   ILE A CG2   1 
ATOM   1712 C  CD1   . ILE E 3 67  ? 7.407   4.973   27.260  1.00 15.27 ? 59   ILE A CD1   1 
ATOM   1713 N  N     . PRO E 3 68  ? 2.905   3.838   26.322  1.00 13.94 ? 60   PRO A N     1 
ATOM   1714 C  CA    . PRO E 3 68  ? 1.913   4.867   26.659  1.00 13.86 ? 60   PRO A CA    1 
ATOM   1715 C  C     . PRO E 3 68  ? 2.551   6.156   27.179  1.00 13.80 ? 60   PRO A C     1 
ATOM   1716 O  O     . PRO E 3 68  ? 3.622   6.119   27.788  1.00 13.81 ? 60   PRO A O     1 
ATOM   1717 C  CB    . PRO E 3 68  ? 1.065   4.205   27.760  1.00 13.76 ? 60   PRO A CB    1 
ATOM   1718 C  CG    . PRO E 3 68  ? 1.357   2.746   27.681  1.00 13.53 ? 60   PRO A CG    1 
ATOM   1719 C  CD    . PRO E 3 68  ? 2.735   2.616   27.129  1.00 13.87 ? 60   PRO A CD    1 
ATOM   1720 N  N     . ILE E 3 69  ? 1.882   7.279   26.948  1.00 13.81 ? 61   ILE A N     1 
ATOM   1721 C  CA    . ILE E 3 69  ? 2.342   8.578   27.427  1.00 13.86 ? 61   ILE A CA    1 
ATOM   1722 C  C     . ILE E 3 69  ? 2.457   8.623   28.955  1.00 13.97 ? 61   ILE A C     1 
ATOM   1723 O  O     . ILE E 3 69  ? 3.311   9.303   29.497  1.00 13.63 ? 61   ILE A O     1 
ATOM   1724 C  CB    . ILE E 3 69  ? 1.396   9.697   26.911  1.00 13.83 ? 61   ILE A CB    1 
ATOM   1725 C  CG1   . ILE E 3 69  ? 1.598   9.908   25.415  1.00 13.33 ? 61   ILE A CG1   1 
ATOM   1726 C  CG2   . ILE E 3 69  ? 1.651   11.023  27.618  1.00 14.21 ? 61   ILE A CG2   1 
ATOM   1727 C  CD1   . ILE E 3 69  ? 0.590   10.852  24.809  1.00 13.05 ? 61   ILE A CD1   1 
ATOM   1728 N  N     . VAL E 3 70  ? 1.602   7.892   29.652  1.00 14.68 ? 62   VAL A N     1 
ATOM   1729 C  CA    . VAL E 3 70  ? 1.627   7.914   31.106  1.00 15.13 ? 62   VAL A CA    1 
ATOM   1730 C  C     . VAL E 3 70  ? 2.842   7.156   31.618  1.00 15.41 ? 62   VAL A C     1 
ATOM   1731 O  O     . VAL E 3 70  ? 3.398   7.519   32.652  1.00 15.48 ? 62   VAL A O     1 
ATOM   1732 C  CB    . VAL E 3 70  ? 0.312   7.379   31.725  1.00 15.16 ? 62   VAL A CB    1 
ATOM   1733 C  CG1   . VAL E 3 70  ? 0.456   7.147   33.239  1.00 15.61 ? 62   VAL A CG1   1 
ATOM   1734 C  CG2   . VAL E 3 70  ? -0.800  8.369   31.482  1.00 15.30 ? 62   VAL A CG2   1 
ATOM   1735 N  N     . GLU E 3 71  ? 3.263   6.114   30.908  1.00 15.80 ? 63   GLU A N     1 
ATOM   1736 C  CA    . GLU E 3 71  ? 4.534   5.475   31.249  1.00 16.42 ? 63   GLU A CA    1 
ATOM   1737 C  C     . GLU E 3 71  ? 5.672   6.488   31.144  1.00 15.91 ? 63   GLU A C     1 
ATOM   1738 O  O     . GLU E 3 71  ? 6.504   6.579   32.048  1.00 16.03 ? 63   GLU A O     1 
ATOM   1739 C  CB    . GLU E 3 71  ? 4.843   4.247   30.368  1.00 16.96 ? 63   GLU A CB    1 
ATOM   1740 C  CG    . GLU E 3 71  ? 5.473   3.092   31.161  1.00 18.84 ? 63   GLU A CG    1 
ATOM   1741 C  CD    . GLU E 3 71  ? 6.565   2.323   30.417  1.00 20.47 ? 63   GLU A CD    1 
ATOM   1742 O  OE1   . GLU E 3 71  ? 6.394   2.016   29.216  1.00 20.65 ? 63   GLU A OE1   1 
ATOM   1743 O  OE2   . GLU E 3 71  ? 7.590   1.992   31.064  1.00 22.66 ? 63   GLU A OE2   1 
ATOM   1744 N  N     . ALA E 3 72  ? 5.676   7.260   30.058  1.00 15.41 ? 64   ALA A N     1 
ATOM   1745 C  CA    . ALA E 3 72  ? 6.734   8.226   29.786  1.00 15.00 ? 64   ALA A CA    1 
ATOM   1746 C  C     . ALA E 3 72  ? 6.777   9.340   30.811  1.00 14.72 ? 64   ALA A C     1 
ATOM   1747 O  O     . ALA E 3 72  ? 7.849   9.784   31.195  1.00 14.43 ? 64   ALA A O     1 
ATOM   1748 C  CB    . ALA E 3 72  ? 6.573   8.810   28.398  1.00 15.08 ? 64   ALA A CB    1 
ATOM   1749 N  N     . LYS E 3 73  ? 5.615   9.790   31.268  1.00 14.81 ? 65   LYS A N     1 
ATOM   1750 C  CA    . LYS E 3 73  ? 5.558   10.916  32.207  1.00 14.51 ? 65   LYS A CA    1 
ATOM   1751 C  C     . LYS E 3 73  ? 5.955   10.479  33.606  1.00 14.40 ? 65   LYS A C     1 
ATOM   1752 O  O     . LYS E 3 73  ? 6.369   11.300  34.420  1.00 14.40 ? 65   LYS A O     1 
ATOM   1753 C  CB    . LYS E 3 73  ? 4.192   11.611  32.172  1.00 14.36 ? 65   LYS A CB    1 
ATOM   1754 C  CG    . LYS E 3 73  ? 4.214   12.821  31.232  1.00 15.12 ? 65   LYS A CG    1 
ATOM   1755 C  CD    . LYS E 3 73  ? 2.841   13.448  30.974  1.00 16.09 ? 65   LYS A CD    1 
ATOM   1756 C  CE    . LYS E 3 73  ? 2.786   14.121  29.587  1.00 16.26 ? 65   LYS A CE    1 
ATOM   1757 N  NZ    . LYS E 3 73  ? 2.160   15.469  29.619  1.00 16.36 ? 65   LYS A NZ    1 
ATOM   1758 N  N     . LYS E 3 74  ? 5.862   9.176   33.861  1.00 14.48 ? 66   LYS A N     1 
ATOM   1759 C  CA    . LYS E 3 74  ? 6.421   8.564   35.061  1.00 14.49 ? 66   LYS A CA    1 
ATOM   1760 C  C     . LYS E 3 74  ? 7.950   8.542   34.997  1.00 14.46 ? 66   LYS A C     1 
ATOM   1761 O  O     . LYS E 3 74  ? 8.623   8.750   36.003  1.00 14.81 ? 66   LYS A O     1 
ATOM   1762 C  CB    . LYS E 3 74  ? 5.879   7.142   35.249  1.00 14.55 ? 66   LYS A CB    1 
ATOM   1763 C  CG    . LYS E 3 74  ? 4.593   7.088   36.075  1.00 15.22 ? 66   LYS A CG    1 
ATOM   1764 C  CD    . LYS E 3 74  ? 3.703   5.903   35.701  1.00 16.59 ? 66   LYS A CD    1 
ATOM   1765 C  CE    . LYS E 3 74  ? 2.256   6.101   36.177  1.00 17.68 ? 66   LYS A CE    1 
ATOM   1766 N  NZ    . LYS E 3 74  ? 2.084   5.756   37.620  1.00 18.32 ? 66   LYS A NZ    1 
ATOM   1767 N  N     . ILE E 3 75  ? 8.504   8.288   33.821  1.00 14.27 ? 67   ILE A N     1 
ATOM   1768 C  CA    . ILE E 3 75  ? 9.953   8.256   33.679  1.00 14.16 ? 67   ILE A CA    1 
ATOM   1769 C  C     . ILE E 3 75  ? 10.547  9.664   33.569  1.00 14.38 ? 67   ILE A C     1 
ATOM   1770 O  O     . ILE E 3 75  ? 11.518  9.975   34.250  1.00 14.45 ? 67   ILE A O     1 
ATOM   1771 C  CB    . ILE E 3 75  ? 10.372  7.392   32.475  1.00 13.91 ? 67   ILE A CB    1 
ATOM   1772 C  CG1   . ILE E 3 75  ? 9.915   5.942   32.680  1.00 13.43 ? 67   ILE A CG1   1 
ATOM   1773 C  CG2   . ILE E 3 75  ? 11.873  7.442   32.310  1.00 13.74 ? 67   ILE A CG2   1 
ATOM   1774 C  CD1   . ILE E 3 75  ? 9.973   5.075   31.448  1.00 12.73 ? 67   ILE A CD1   1 
ATOM   1775 N  N     . LEU E 3 76  ? 9.975   10.503  32.706  1.00 14.52 ? 68   LEU A N     1 
ATOM   1776 C  CA    . LEU E 3 76  ? 10.496  11.846  32.460  1.00 14.44 ? 68   LEU A CA    1 
ATOM   1777 C  C     . LEU E 3 76  ? 9.387   12.897  32.517  1.00 14.36 ? 68   LEU A C     1 
ATOM   1778 O  O     . LEU E 3 76  ? 8.933   13.376  31.487  1.00 14.42 ? 68   LEU A O     1 
ATOM   1779 C  CB    . LEU E 3 76  ? 11.215  11.896  31.103  1.00 14.38 ? 68   LEU A CB    1 
ATOM   1780 C  CG    . LEU E 3 76  ? 12.584  11.209  31.031  1.00 14.41 ? 68   LEU A CG    1 
ATOM   1781 C  CD1   . LEU E 3 76  ? 13.192  11.354  29.637  1.00 14.32 ? 68   LEU A CD1   1 
ATOM   1782 C  CD2   . LEU E 3 76  ? 13.548  11.737  32.084  1.00 14.04 ? 68   LEU A CD2   1 
ATOM   1783 N  N     . PRO E 3 77  ? 8.941   13.250  33.718  1.00 14.35 ? 69   PRO A N     1 
ATOM   1784 C  CA    . PRO E 3 77  ? 7.907   14.281  33.880  1.00 14.49 ? 69   PRO A CA    1 
ATOM   1785 C  C     . PRO E 3 77  ? 8.277   15.661  33.330  1.00 14.48 ? 69   PRO A C     1 
ATOM   1786 O  O     . PRO E 3 77  ? 7.363   16.365  32.876  1.00 14.84 ? 69   PRO A O     1 
ATOM   1787 C  CB    . PRO E 3 77  ? 7.693   14.352  35.403  1.00 14.52 ? 69   PRO A CB    1 
ATOM   1788 C  CG    . PRO E 3 77  ? 8.817   13.613  36.018  1.00 14.51 ? 69   PRO A CG    1 
ATOM   1789 C  CD    . PRO E 3 77  ? 9.338   12.657  35.005  1.00 14.58 ? 69   PRO A CD    1 
ATOM   1790 N  N     . ASN E 3 78  ? 9.559   16.034  33.370  1.00 14.02 ? 70   ASN A N     1 
ATOM   1791 C  CA    . ASN E 3 78  ? 10.002  17.348  32.894  1.00 13.60 ? 70   ASN A CA    1 
ATOM   1792 C  C     . ASN E 3 78  ? 10.449  17.375  31.441  1.00 13.01 ? 70   ASN A C     1 
ATOM   1793 O  O     . ASN E 3 78  ? 10.976  18.382  30.980  1.00 12.89 ? 70   ASN A O     1 
ATOM   1794 C  CB    . ASN E 3 78  ? 11.146  17.866  33.760  1.00 13.80 ? 70   ASN A CB    1 
ATOM   1795 C  CG    . ASN E 3 78  ? 10.766  17.981  35.203  1.00 13.86 ? 70   ASN A CG    1 
ATOM   1796 O  OD1   . ASN E 3 78  ? 9.596   17.858  35.561  1.00 13.41 ? 70   ASN A OD1   1 
ATOM   1797 N  ND2   . ASN E 3 78  ? 11.754  18.220  36.050  1.00 14.98 ? 70   ASN A ND2   1 
ATOM   1798 N  N     . ALA E 3 79  ? 10.261  16.273  30.725  1.00 12.50 ? 71   ALA A N     1 
ATOM   1799 C  CA    . ALA E 3 79  ? 10.565  16.228  29.294  1.00 12.07 ? 71   ALA A CA    1 
ATOM   1800 C  C     . ALA E 3 79  ? 9.552   17.061  28.512  1.00 11.41 ? 71   ALA A C     1 
ATOM   1801 O  O     . ALA E 3 79  ? 8.428   17.262  28.959  1.00 11.03 ? 71   ALA A O     1 
ATOM   1802 C  CB    . ALA E 3 79  ? 10.571  14.799  28.791  1.00 12.06 ? 71   ALA A CB    1 
ATOM   1803 N  N     . VAL E 3 80  ? 9.975   17.567  27.360  1.00 10.85 ? 72   VAL A N     1 
ATOM   1804 C  CA    . VAL E 3 80  ? 9.078   18.290  26.478  1.00 10.59 ? 72   VAL A CA    1 
ATOM   1805 C  C     . VAL E 3 80  ? 8.269   17.281  25.672  1.00 10.35 ? 72   VAL A C     1 
ATOM   1806 O  O     . VAL E 3 80  ? 8.825   16.519  24.880  1.00 9.27  ? 72   VAL A O     1 
ATOM   1807 C  CB    . VAL E 3 80  ? 9.826   19.228  25.529  1.00 10.56 ? 72   VAL A CB    1 
ATOM   1808 C  CG1   . VAL E 3 80  ? 8.831   19.969  24.641  1.00 10.74 ? 72   VAL A CG1   1 
ATOM   1809 C  CG2   . VAL E 3 80  ? 10.677  20.220  26.310  1.00 10.45 ? 72   VAL A CG2   1 
ATOM   1810 N  N     . TYR E 3 81  ? 6.956   17.287  25.912  1.00 10.40 ? 73   TYR A N     1 
ATOM   1811 C  CA    . TYR E 3 81  ? 6.010   16.413  25.235  1.00 10.52 ? 73   TYR A CA    1 
ATOM   1812 C  C     . TYR E 3 81  ? 5.262   17.203  24.181  1.00 10.68 ? 73   TYR A C     1 
ATOM   1813 O  O     . TYR E 3 81  ? 4.473   18.067  24.492  1.00 10.50 ? 73   TYR A O     1 
ATOM   1814 C  CB    . TYR E 3 81  ? 5.042   15.794  26.242  1.00 10.54 ? 73   TYR A CB    1 
ATOM   1815 C  CG    . TYR E 3 81  ? 5.724   14.803  27.150  1.00 10.45 ? 73   TYR A CG    1 
ATOM   1816 C  CD1   . TYR E 3 81  ? 5.833   13.470  26.788  1.00 11.28 ? 73   TYR A CD1   1 
ATOM   1817 C  CD2   . TYR E 3 81  ? 6.295   15.205  28.343  1.00 10.53 ? 73   TYR A CD2   1 
ATOM   1818 C  CE1   . TYR E 3 81  ? 6.474   12.557  27.594  1.00 11.41 ? 73   TYR A CE1   1 
ATOM   1819 C  CE2   . TYR E 3 81  ? 6.943   14.301  29.161  1.00 10.94 ? 73   TYR A CE2   1 
ATOM   1820 C  CZ    . TYR E 3 81  ? 7.029   12.976  28.778  1.00 11.17 ? 73   TYR A CZ    1 
ATOM   1821 O  OH    . TYR E 3 81  ? 7.663   12.052  29.563  1.00 10.94 ? 73   TYR A OH    1 
ATOM   1822 N  N     . LEU E 3 82  ? 5.535   16.907  22.922  1.00 11.34 ? 74   LEU A N     1 
ATOM   1823 C  CA    . LEU E 3 82  ? 4.943   17.639  21.818  1.00 11.70 ? 74   LEU A CA    1 
ATOM   1824 C  C     . LEU E 3 82  ? 3.925   16.778  21.087  1.00 11.99 ? 74   LEU A C     1 
ATOM   1825 O  O     . LEU E 3 82  ? 4.103   15.560  20.963  1.00 11.58 ? 74   LEU A O     1 
ATOM   1826 C  CB    . LEU E 3 82  ? 6.040   18.061  20.840  1.00 11.71 ? 74   LEU A CB    1 
ATOM   1827 C  CG    . LEU E 3 82  ? 7.084   19.022  21.398  1.00 12.16 ? 74   LEU A CG    1 
ATOM   1828 C  CD1   . LEU E 3 82  ? 8.295   19.105  20.465  1.00 13.14 ? 74   LEU A CD1   1 
ATOM   1829 C  CD2   . LEU E 3 82  ? 6.476   20.409  21.620  1.00 12.18 ? 74   LEU A CD2   1 
ATOM   1830 N  N     . PRO E 3 83  ? 2.868   17.408  20.578  1.00 12.55 ? 75   PRO A N     1 
ATOM   1831 C  CA    . PRO E 3 83  ? 1.922   16.700  19.717  1.00 13.01 ? 75   PRO A CA    1 
ATOM   1832 C  C     . PRO E 3 83  ? 2.557   16.472  18.349  1.00 13.73 ? 75   PRO A C     1 
ATOM   1833 O  O     . PRO E 3 83  ? 3.417   17.258  17.915  1.00 13.77 ? 75   PRO A O     1 
ATOM   1834 C  CB    . PRO E 3 83  ? 0.737   17.659  19.630  1.00 12.64 ? 75   PRO A CB    1 
ATOM   1835 C  CG    . PRO E 3 83  ? 1.306   18.998  19.857  1.00 12.13 ? 75   PRO A CG    1 
ATOM   1836 C  CD    . PRO E 3 83  ? 2.501   18.826  20.741  1.00 12.34 ? 75   PRO A CD    1 
ATOM   1837 N  N     . MET E 3 84  ? 2.119   15.411  17.685  1.00 14.40 ? 76   MET A N     1 
ATOM   1838 C  CA    . MET E 3 84  ? 2.678   15.011  16.406  1.00 15.02 ? 76   MET A CA    1 
ATOM   1839 C  C     . MET E 3 84  ? 2.133   15.880  15.295  1.00 14.94 ? 76   MET A C     1 
ATOM   1840 O  O     . MET E 3 84  ? 0.948   16.166  15.253  1.00 15.61 ? 76   MET A O     1 
ATOM   1841 C  CB    . MET E 3 84  ? 2.361   13.548  16.125  1.00 15.18 ? 76   MET A CB    1 
ATOM   1842 C  CG    . MET E 3 84  ? 2.590   13.149  14.707  1.00 16.66 ? 76   MET A CG    1 
ATOM   1843 S  SD    . MET E 3 84  ? 3.028   11.441  14.572  1.00 20.41 ? 76   MET A SD    1 
ATOM   1844 C  CE    . MET E 3 84  ? 1.520   10.814  13.878  1.00 19.85 ? 76   MET A CE    1 
ATOM   1845 N  N     . ARG E 3 85  ? 3.010   16.282  14.387  1.00 15.05 ? 77   ARG A N     1 
ATOM   1846 C  CA    . ARG E 3 85  ? 2.640   17.128  13.269  1.00 15.39 ? 77   ARG A CA    1 
ATOM   1847 C  C     . ARG E 3 85  ? 3.096   16.466  11.969  1.00 16.05 ? 77   ARG A C     1 
ATOM   1848 O  O     . ARG E 3 85  ? 4.081   16.907  11.349  1.00 16.12 ? 77   ARG A O     1 
ATOM   1849 C  CB    . ARG E 3 85  ? 3.281   18.507  13.458  1.00 15.43 ? 77   ARG A CB    1 
ATOM   1850 C  CG    . ARG E 3 85  ? 2.601   19.346  14.550  1.00 14.71 ? 77   ARG A CG    1 
ATOM   1851 C  CD    . ARG E 3 85  ? 2.920   20.829  14.505  1.00 14.20 ? 77   ARG A CD    1 
ATOM   1852 N  NE    . ARG E 3 85  ? 4.313   21.070  14.851  1.00 14.41 ? 77   ARG A NE    1 
ATOM   1853 C  CZ    . ARG E 3 85  ? 4.860   22.261  15.006  1.00 13.33 ? 77   ARG A CZ    1 
ATOM   1854 N  NH1   . ARG E 3 85  ? 4.146   23.357  14.852  1.00 13.30 ? 77   ARG A NH1   1 
ATOM   1855 N  NH2   . ARG E 3 85  ? 6.140   22.355  15.315  1.00 13.99 ? 77   ARG A NH2   1 
ATOM   1856 N  N     . LYS E 3 86  ? 2.385   15.398  11.575  1.00 16.50 ? 78   LYS A N     1 
ATOM   1857 C  CA    . LYS E 3 86  ? 2.798   14.523  10.461  1.00 16.91 ? 78   LYS A CA    1 
ATOM   1858 C  C     . LYS E 3 86  ? 2.900   15.286  9.155   1.00 16.64 ? 78   LYS A C     1 
ATOM   1859 O  O     . LYS E 3 86  ? 3.771   15.028  8.337   1.00 16.79 ? 78   LYS A O     1 
ATOM   1860 C  CB    . LYS E 3 86  ? 1.814   13.364  10.280  1.00 17.45 ? 78   LYS A CB    1 
ATOM   1861 C  CG    . LYS E 3 86  ? 2.284   12.225  9.327   1.00 19.37 ? 78   LYS A CG    1 
ATOM   1862 C  CD    . LYS E 3 86  ? 2.732   10.952  10.082  1.00 21.83 ? 78   LYS A CD    1 
ATOM   1863 C  CE    . LYS E 3 86  ? 2.625   9.680   9.223   1.00 23.23 ? 78   LYS A CE    1 
ATOM   1864 N  NZ    . LYS E 3 86  ? 1.494   8.761   9.654   1.00 24.35 ? 78   LYS A NZ    1 
ATOM   1865 N  N     . GLU E 3 87  ? 1.996   16.231  8.974   1.00 16.29 ? 79   GLU A N     1 
ATOM   1866 C  CA    . GLU E 3 87  ? 1.964   17.050  7.774   1.00 16.15 ? 79   GLU A CA    1 
ATOM   1867 C  C     . GLU E 3 87  ? 3.274   17.852  7.637   1.00 15.62 ? 79   GLU A C     1 
ATOM   1868 O  O     . GLU E 3 87  ? 3.771   18.061  6.524   1.00 15.48 ? 79   GLU A O     1 
ATOM   1869 C  CB    . GLU E 3 87  ? 0.752   17.997  7.798   1.00 16.27 ? 79   GLU A CB    1 
ATOM   1870 C  CG    . GLU E 3 87  ? -0.475  17.507  8.581   1.00 18.33 ? 79   GLU A CG    1 
ATOM   1871 C  CD    . GLU E 3 87  ? -0.440  17.784  10.112  1.00 21.02 ? 79   GLU A CD    1 
ATOM   1872 O  OE1   . GLU E 3 87  ? 0.406   18.588  10.626  1.00 21.45 ? 79   GLU A OE1   1 
ATOM   1873 O  OE2   . GLU E 3 87  ? -1.287  17.178  10.819  1.00 21.61 ? 79   GLU A OE2   1 
ATOM   1874 N  N     . VAL E 3 88  ? 3.824   18.299  8.768   1.00 14.82 ? 80   VAL A N     1 
ATOM   1875 C  CA    . VAL E 3 88  ? 5.064   19.084  8.774   1.00 14.21 ? 80   VAL A CA    1 
ATOM   1876 C  C     . VAL E 3 88  ? 6.271   18.193  8.477   1.00 13.65 ? 80   VAL A C     1 
ATOM   1877 O  O     . VAL E 3 88  ? 7.133   18.553  7.693   1.00 13.42 ? 80   VAL A O     1 
ATOM   1878 C  CB    . VAL E 3 88  ? 5.295   19.816  10.129  1.00 14.36 ? 80   VAL A CB    1 
ATOM   1879 C  CG1   . VAL E 3 88  ? 6.537   20.695  10.075  1.00 14.08 ? 80   VAL A CG1   1 
ATOM   1880 C  CG2   . VAL E 3 88  ? 4.078   20.664  10.527  1.00 14.89 ? 80   VAL A CG2   1 
ATOM   1881 N  N     . TYR E 3 89  ? 6.324   17.027  9.108   1.00 13.29 ? 81   TYR A N     1 
ATOM   1882 C  CA    . TYR E 3 89  ? 7.432   16.108  8.910   1.00 12.75 ? 81   TYR A CA    1 
ATOM   1883 C  C     . TYR E 3 89  ? 7.390   15.601  7.494   1.00 12.84 ? 81   TYR A C     1 
ATOM   1884 O  O     . TYR E 3 89  ? 8.430   15.381  6.898   1.00 12.96 ? 81   TYR A O     1 
ATOM   1885 C  CB    . TYR E 3 89  ? 7.397   14.922  9.893   1.00 12.37 ? 81   TYR A CB    1 
ATOM   1886 C  CG    . TYR E 3 89  ? 7.059   15.294  11.318  1.00 10.90 ? 81   TYR A CG    1 
ATOM   1887 C  CD1   . TYR E 3 89  ? 7.524   16.475  11.879  1.00 9.07  ? 81   TYR A CD1   1 
ATOM   1888 C  CD2   . TYR E 3 89  ? 6.257   14.465  12.099  1.00 9.89  ? 81   TYR A CD2   1 
ATOM   1889 C  CE1   . TYR E 3 89  ? 7.208   16.821  13.181  1.00 8.97  ? 81   TYR A CE1   1 
ATOM   1890 C  CE2   . TYR E 3 89  ? 5.935   14.797  13.413  1.00 9.01  ? 81   TYR A CE2   1 
ATOM   1891 C  CZ    . TYR E 3 89  ? 6.408   15.981  13.949  1.00 8.37  ? 81   TYR A CZ    1 
ATOM   1892 O  OH    . TYR E 3 89  ? 6.077   16.342  15.235  1.00 4.87  ? 81   TYR A OH    1 
ATOM   1893 N  N     . GLN E 3 90  ? 6.193   15.436  6.948   1.00 13.10 ? 82   GLN A N     1 
ATOM   1894 C  CA    . GLN E 3 90  ? 6.048   14.913  5.601   1.00 13.70 ? 82   GLN A CA    1 
ATOM   1895 C  C     . GLN E 3 90  ? 6.655   15.888  4.616   1.00 13.34 ? 82   GLN A C     1 
ATOM   1896 O  O     . GLN E 3 90  ? 7.414   15.499  3.737   1.00 13.35 ? 82   GLN A O     1 
ATOM   1897 C  CB    . GLN E 3 90  ? 4.579   14.644  5.257   1.00 14.28 ? 82   GLN A CB    1 
ATOM   1898 C  CG    . GLN E 3 90  ? 4.336   14.061  3.833   1.00 16.27 ? 82   GLN A CG    1 
ATOM   1899 C  CD    . GLN E 3 90  ? 5.203   12.832  3.515   1.00 19.75 ? 82   GLN A CD    1 
ATOM   1900 O  OE1   . GLN E 3 90  ? 5.086   11.777  4.180   1.00 22.88 ? 82   GLN A OE1   1 
ATOM   1901 N  NE2   . GLN E 3 90  ? 6.072   12.963  2.509   1.00 18.99 ? 82   GLN A NE2   1 
ATOM   1902 N  N     . GLN E 3 91  ? 6.327   17.158  4.767   1.00 13.31 ? 83   GLN A N     1 
ATOM   1903 C  CA    . GLN E 3 91  ? 6.909   18.187  3.918   1.00 13.61 ? 83   GLN A CA    1 
ATOM   1904 C  C     . GLN E 3 91  ? 8.438   18.204  3.991   1.00 13.39 ? 83   GLN A C     1 
ATOM   1905 O  O     . GLN E 3 91  ? 9.110   18.297  2.949   1.00 13.48 ? 83   GLN A O     1 
ATOM   1906 C  CB    . GLN E 3 91  ? 6.382   19.569  4.295   1.00 13.83 ? 83   GLN A CB    1 
ATOM   1907 C  CG    . GLN E 3 91  ? 5.666   20.283  3.163   1.00 15.46 ? 83   GLN A CG    1 
ATOM   1908 C  CD    . GLN E 3 91  ? 4.300   20.750  3.572   1.00 16.95 ? 83   GLN A CD    1 
ATOM   1909 O  OE1   . GLN E 3 91  ? 4.142   21.877  4.060   1.00 16.74 ? 83   GLN A OE1   1 
ATOM   1910 N  NE2   . GLN E 3 91  ? 3.303   19.883  3.402   1.00 17.82 ? 83   GLN A NE2   1 
ATOM   1911 N  N     . VAL E 3 92  ? 8.976   18.130  5.214   1.00 12.61 ? 84   VAL A N     1 
ATOM   1912 C  CA    . VAL E 3 92  ? 10.416  18.145  5.424   1.00 12.14 ? 84   VAL A CA    1 
ATOM   1913 C  C     . VAL E 3 92  ? 11.031  16.920  4.740   1.00 11.73 ? 84   VAL A C     1 
ATOM   1914 O  O     . VAL E 3 92  ? 11.949  17.047  3.941   1.00 11.30 ? 84   VAL A O     1 
ATOM   1915 C  CB    . VAL E 3 92  ? 10.789  18.197  6.929   1.00 11.99 ? 84   VAL A CB    1 
ATOM   1916 C  CG1   . VAL E 3 92  ? 12.286  18.060  7.126   1.00 11.90 ? 84   VAL A CG1   1 
ATOM   1917 C  CG2   . VAL E 3 92  ? 10.331  19.496  7.554   1.00 12.14 ? 84   VAL A CG2   1 
ATOM   1918 N  N     . SER E 3 93  ? 10.491  15.746  5.033   1.00 11.49 ? 85   SER A N     1 
ATOM   1919 C  CA    . SER E 3 93  ? 10.935  14.510  4.404   1.00 11.66 ? 85   SER A CA    1 
ATOM   1920 C  C     . SER E 3 93  ? 11.023  14.605  2.882   1.00 12.27 ? 85   SER A C     1 
ATOM   1921 O  O     . SER E 3 93  ? 12.013  14.188  2.288   1.00 12.24 ? 85   SER A O     1 
ATOM   1922 C  CB    . SER E 3 93  ? 9.991   13.379  4.759   1.00 11.51 ? 85   SER A CB    1 
ATOM   1923 O  OG    . SER E 3 93  ? 10.320  12.209  4.037   1.00 11.40 ? 85   SER A OG    1 
ATOM   1924 N  N     . SER E 3 94  ? 9.974   15.153  2.270   1.00 12.74 ? 86   SER A N     1 
ATOM   1925 C  CA    . SER E 3 94  ? 9.879   15.295  0.827   1.00 12.81 ? 86   SER A CA    1 
ATOM   1926 C  C     . SER E 3 94  ? 10.936  16.217  0.253   1.00 12.63 ? 86   SER A C     1 
ATOM   1927 O  O     . SER E 3 94  ? 11.413  15.984  -0.851  1.00 12.80 ? 86   SER A O     1 
ATOM   1928 C  CB    . SER E 3 94  ? 8.494   15.804  0.442   1.00 13.05 ? 86   SER A CB    1 
ATOM   1929 O  OG    . SER E 3 94  ? 7.590   14.720  0.339   1.00 14.53 ? 86   SER A OG    1 
ATOM   1930 N  N     . ARG E 3 95  ? 11.289  17.266  0.986   1.00 12.60 ? 87   ARG A N     1 
ATOM   1931 C  CA    . ARG E 3 95  ? 12.373  18.159  0.575   1.00 12.53 ? 87   ARG A CA    1 
ATOM   1932 C  C     . ARG E 3 95  ? 13.735  17.482  0.697   1.00 12.55 ? 87   ARG A C     1 
ATOM   1933 O  O     . ARG E 3 95  ? 14.631  17.777  -0.091  1.00 13.00 ? 87   ARG A O     1 
ATOM   1934 C  CB    . ARG E 3 95  ? 12.361  19.458  1.389   1.00 12.60 ? 87   ARG A CB    1 
ATOM   1935 C  CG    . ARG E 3 95  ? 11.161  20.361  1.100   1.00 12.11 ? 87   ARG A CG    1 
ATOM   1936 C  CD    . ARG E 3 95  ? 11.395  21.837  1.406   1.00 11.44 ? 87   ARG A CD    1 
ATOM   1937 N  NE    . ARG E 3 95  ? 11.921  22.076  2.752   1.00 11.24 ? 87   ARG A NE    1 
ATOM   1938 C  CZ    . ARG E 3 95  ? 11.188  22.193  3.867   1.00 11.35 ? 87   ARG A CZ    1 
ATOM   1939 N  NH1   . ARG E 3 95  ? 9.863   22.092  3.848   1.00 11.15 ? 87   ARG A NH1   1 
ATOM   1940 N  NH2   . ARG E 3 95  ? 11.791  22.418  5.023   1.00 11.45 ? 87   ARG A NH2   1 
ATOM   1941 N  N     . ILE E 3 96  ? 13.894  16.579  1.667   1.00 12.56 ? 88   ILE A N     1 
ATOM   1942 C  CA    . ILE E 3 96  ? 15.130  15.807  1.791   1.00 12.91 ? 88   ILE A CA    1 
ATOM   1943 C  C     . ILE E 3 96  ? 15.229  14.745  0.701   1.00 12.90 ? 88   ILE A C     1 
ATOM   1944 O  O     . ILE E 3 96  ? 16.309  14.516  0.178   1.00 13.02 ? 88   ILE A O     1 
ATOM   1945 C  CB    . ILE E 3 96  ? 15.291  15.158  3.194   1.00 13.06 ? 88   ILE A CB    1 
ATOM   1946 C  CG1   . ILE E 3 96  ? 15.352  16.235  4.286   1.00 13.38 ? 88   ILE A CG1   1 
ATOM   1947 C  CG2   . ILE E 3 96  ? 16.582  14.336  3.257   1.00 12.79 ? 88   ILE A CG2   1 
ATOM   1948 C  CD1   . ILE E 3 96  ? 15.355  15.691  5.721   1.00 12.64 ? 88   ILE A CD1   1 
ATOM   1949 N  N     . MET E 3 97  ? 14.111  14.112  0.362   1.00 13.16 ? 89   MET A N     1 
ATOM   1950 C  CA    . MET E 3 97  ? 14.073  13.094  -0.691  1.00 13.53 ? 89   MET A CA    1 
ATOM   1951 C  C     . MET E 3 97  ? 14.435  13.700  -2.041  1.00 13.89 ? 89   MET A C     1 
ATOM   1952 O  O     . MET E 3 97  ? 15.057  13.052  -2.871  1.00 13.80 ? 89   MET A O     1 
ATOM   1953 C  CB    . MET E 3 97  ? 12.687  12.436  -0.786  1.00 13.53 ? 89   MET A CB    1 
ATOM   1954 C  CG    . MET E 3 97  ? 12.234  11.592  0.450   1.00 13.50 ? 89   MET A CG    1 
ATOM   1955 S  SD    . MET E 3 97  ? 13.410  10.363  1.100   1.00 12.65 ? 89   MET A SD    1 
ATOM   1956 C  CE    . MET E 3 97  ? 12.525  9.696   2.572   1.00 12.52 ? 89   MET A CE    1 
ATOM   1957 N  N     . ASN E 3 98  ? 14.057  14.954  -2.250  1.00 14.44 ? 90   ASN A N     1 
ATOM   1958 C  CA    . ASN E 3 98  ? 14.400  15.662  -3.474  1.00 14.82 ? 90   ASN A CA    1 
ATOM   1959 C  C     . ASN E 3 98  ? 15.914  15.853  -3.601  1.00 15.26 ? 90   ASN A C     1 
ATOM   1960 O  O     . ASN E 3 98  ? 16.471  15.707  -4.687  1.00 15.56 ? 90   ASN A O     1 
ATOM   1961 C  CB    . ASN E 3 98  ? 13.687  17.020  -3.525  1.00 15.05 ? 90   ASN A CB    1 
ATOM   1962 C  CG    . ASN E 3 98  ? 12.255  16.931  -4.072  1.00 15.34 ? 90   ASN A CG    1 
ATOM   1963 O  OD1   . ASN E 3 98  ? 11.698  15.846  -4.257  1.00 15.01 ? 90   ASN A OD1   1 
ATOM   1964 N  ND2   . ASN E 3 98  ? 11.660  18.091  -4.333  1.00 16.24 ? 90   ASN A ND2   1 
ATOM   1965 N  N     . LEU E 3 99  ? 16.575  16.180  -2.494  1.00 15.70 ? 91   LEU A N     1 
ATOM   1966 C  CA    . LEU E 3 99  ? 18.033  16.271  -2.468  1.00 15.89 ? 91   LEU A CA    1 
ATOM   1967 C  C     . LEU E 3 99  ? 18.654  14.928  -2.799  1.00 16.07 ? 91   LEU A C     1 
ATOM   1968 O  O     . LEU E 3 99  ? 19.680  14.861  -3.465  1.00 16.07 ? 91   LEU A O     1 
ATOM   1969 C  CB    . LEU E 3 99  ? 18.539  16.701  -1.089  1.00 16.11 ? 91   LEU A CB    1 
ATOM   1970 C  CG    . LEU E 3 99  ? 18.056  18.030  -0.498  1.00 16.30 ? 91   LEU A CG    1 
ATOM   1971 C  CD1   . LEU E 3 99  ? 18.625  18.188  0.903   1.00 16.19 ? 91   LEU A CD1   1 
ATOM   1972 C  CD2   . LEU E 3 99  ? 18.458  19.206  -1.387  1.00 16.41 ? 91   LEU A CD2   1 
ATOM   1973 N  N     . LEU E 3 100 ? 18.036  13.853  -2.326  1.00 16.37 ? 92   LEU A N     1 
ATOM   1974 C  CA    . LEU E 3 100 ? 18.578  12.522  -2.553  1.00 16.78 ? 92   LEU A CA    1 
ATOM   1975 C  C     . LEU E 3 100 ? 18.544  12.132  -4.039  1.00 17.27 ? 92   LEU A C     1 
ATOM   1976 O  O     . LEU E 3 100 ? 19.427  11.417  -4.507  1.00 17.31 ? 92   LEU A O     1 
ATOM   1977 C  CB    . LEU E 3 100 ? 17.860  11.481  -1.679  1.00 16.74 ? 92   LEU A CB    1 
ATOM   1978 C  CG    . LEU E 3 100 ? 18.125  11.588  -0.170  1.00 16.22 ? 92   LEU A CG    1 
ATOM   1979 C  CD1   . LEU E 3 100 ? 17.191  10.682  0.606   1.00 15.84 ? 92   LEU A CD1   1 
ATOM   1980 C  CD2   . LEU E 3 100 ? 19.569  11.253  0.153   1.00 15.70 ? 92   LEU A CD2   1 
ATOM   1981 N  N     . ARG E 3 101 ? 17.551  12.627  -4.778  1.00 17.80 ? 93   ARG A N     1 
ATOM   1982 C  CA    . ARG E 3 101 ? 17.421  12.334  -6.210  1.00 18.20 ? 93   ARG A CA    1 
ATOM   1983 C  C     . ARG E 3 101 ? 18.539  12.957  -7.053  1.00 18.55 ? 93   ARG A C     1 
ATOM   1984 O  O     . ARG E 3 101 ? 18.825  12.488  -8.149  1.00 18.72 ? 93   ARG A O     1 
ATOM   1985 C  CB    . ARG E 3 101 ? 16.067  12.812  -6.734  1.00 18.40 ? 93   ARG A CB    1 
ATOM   1986 C  CG    . ARG E 3 101 ? 14.860  12.074  -6.148  1.00 18.73 ? 93   ARG A CG    1 
ATOM   1987 C  CD    . ARG E 3 101 ? 13.519  12.605  -6.644  1.00 19.48 ? 93   ARG A CD    1 
ATOM   1988 N  NE    . ARG E 3 101 ? 12.499  12.625  -5.594  1.00 21.02 ? 93   ARG A NE    1 
ATOM   1989 C  CZ    . ARG E 3 101 ? 11.717  11.595  -5.263  1.00 22.70 ? 93   ARG A CZ    1 
ATOM   1990 N  NH1   . ARG E 3 101 ? 11.821  10.417  -5.885  1.00 23.02 ? 93   ARG A NH1   1 
ATOM   1991 N  NH2   . ARG E 3 101 ? 10.825  11.738  -4.285  1.00 23.37 ? 93   ARG A NH2   1 
ATOM   1992 N  N     . GLU E 3 102 ? 19.170  14.006  -6.531  1.00 18.90 ? 94   GLU A N     1 
ATOM   1993 C  CA    . GLU E 3 102 ? 20.319  14.637  -7.181  1.00 19.06 ? 94   GLU A CA    1 
ATOM   1994 C  C     . GLU E 3 102 ? 21.527  13.689  -7.247  1.00 18.90 ? 94   GLU A C     1 
ATOM   1995 O  O     . GLU E 3 102 ? 22.428  13.895  -8.054  1.00 19.07 ? 94   GLU A O     1 
ATOM   1996 C  CB    . GLU E 3 102 ? 20.731  15.936  -6.458  1.00 19.18 ? 94   GLU A CB    1 
ATOM   1997 C  CG    . GLU E 3 102 ? 19.610  16.933  -6.174  1.00 20.59 ? 94   GLU A CG    1 
ATOM   1998 C  CD    . GLU E 3 102 ? 19.278  17.827  -7.360  1.00 23.61 ? 94   GLU A CD    1 
ATOM   1999 O  OE1   . GLU E 3 102 ? 20.024  18.818  -7.584  1.00 25.95 ? 94   GLU A OE1   1 
ATOM   2000 O  OE2   . GLU E 3 102 ? 18.270  17.549  -8.067  1.00 24.41 ? 94   GLU A OE2   1 
ATOM   2001 N  N     . TYR E 3 103 ? 21.546  12.667  -6.394  1.00 18.81 ? 95   TYR A N     1 
ATOM   2002 C  CA    . TYR E 3 103 ? 22.652  11.707  -6.334  1.00 18.73 ? 95   TYR A CA    1 
ATOM   2003 C  C     . TYR E 3 103 ? 22.343  10.392  -7.032  1.00 19.02 ? 95   TYR A C     1 
ATOM   2004 O  O     . TYR E 3 103 ? 23.266  9.679   -7.421  1.00 19.41 ? 95   TYR A O     1 
ATOM   2005 C  CB    . TYR E 3 103 ? 23.043  11.440  -4.879  1.00 18.49 ? 95   TYR A CB    1 
ATOM   2006 C  CG    . TYR E 3 103 ? 23.482  12.701  -4.179  1.00 17.85 ? 95   TYR A CG    1 
ATOM   2007 C  CD1   . TYR E 3 103 ? 24.765  13.210  -4.380  1.00 17.04 ? 95   TYR A CD1   1 
ATOM   2008 C  CD2   . TYR E 3 103 ? 22.602  13.419  -3.362  1.00 16.32 ? 95   TYR A CD2   1 
ATOM   2009 C  CE1   . TYR E 3 103 ? 25.175  14.377  -3.769  1.00 16.32 ? 95   TYR A CE1   1 
ATOM   2010 C  CE2   . TYR E 3 103 ? 23.000  14.592  -2.747  1.00 15.79 ? 95   TYR A CE2   1 
ATOM   2011 C  CZ    . TYR E 3 103 ? 24.292  15.062  -2.955  1.00 16.26 ? 95   TYR A CZ    1 
ATOM   2012 O  OH    . TYR E 3 103 ? 24.722  16.214  -2.355  1.00 16.48 ? 95   TYR A OH    1 
ATOM   2013 N  N     . SER E 3 104 ? 21.060  10.068  -7.191  1.00 19.14 ? 96   SER A N     1 
ATOM   2014 C  CA    . SER E 3 104 ? 20.662  8.853   -7.910  1.00 19.11 ? 96   SER A CA    1 
ATOM   2015 C  C     . SER E 3 104 ? 19.222  8.895   -8.420  1.00 19.37 ? 96   SER A C     1 
ATOM   2016 O  O     . SER E 3 104 ? 18.300  9.281   -7.703  1.00 19.25 ? 96   SER A O     1 
ATOM   2017 C  CB    . SER E 3 104 ? 20.850  7.609   -7.031  1.00 19.17 ? 96   SER A CB    1 
ATOM   2018 O  OG    . SER E 3 104 ? 20.423  6.428   -7.700  1.00 18.20 ? 96   SER A OG    1 
ATOM   2019 N  N     . GLU E 3 105 ? 19.054  8.463   -9.666  1.00 19.68 ? 97   GLU A N     1 
ATOM   2020 C  CA    . GLU E 3 105 ? 17.743  8.291   -10.279 1.00 19.87 ? 97   GLU A CA    1 
ATOM   2021 C  C     . GLU E 3 105 ? 17.000  7.090   -9.633  1.00 19.79 ? 97   GLU A C     1 
ATOM   2022 O  O     . GLU E 3 105 ? 15.795  7.150   -9.380  1.00 19.76 ? 97   GLU A O     1 
ATOM   2023 C  CB    . GLU E 3 105 ? 17.921  8.104   -11.797 1.00 20.05 ? 97   GLU A CB    1 
ATOM   2024 C  CG    . GLU E 3 105 ? 18.322  9.384   -12.550 1.00 21.10 ? 97   GLU A CG    1 
ATOM   2025 C  CD    . GLU E 3 105 ? 19.822  9.496   -12.884 1.00 22.16 ? 97   GLU A CD    1 
ATOM   2026 O  OE1   . GLU E 3 105 ? 20.659  9.623   -11.946 1.00 21.92 ? 97   GLU A OE1   1 
ATOM   2027 O  OE2   . GLU E 3 105 ? 20.167  9.489   -14.096 1.00 21.21 ? 97   GLU A OE2   1 
ATOM   2028 N  N     . LYS E 3 106 ? 17.735  6.015   -9.349  1.00 19.70 ? 98   LYS A N     1 
ATOM   2029 C  CA    . LYS E 3 106 ? 17.167  4.822   -8.717  1.00 19.50 ? 98   LYS A CA    1 
ATOM   2030 C  C     . LYS E 3 106 ? 17.113  5.012   -7.207  1.00 19.02 ? 98   LYS A C     1 
ATOM   2031 O  O     . LYS E 3 106 ? 18.133  5.011   -6.533  1.00 19.36 ? 98   LYS A O     1 
ATOM   2032 C  CB    . LYS E 3 106 ? 17.976  3.567   -9.072  1.00 19.67 ? 98   LYS A CB    1 
ATOM   2033 C  CG    . LYS E 3 106 ? 17.694  3.030   -10.483 1.00 20.15 ? 98   LYS A CG    1 
ATOM   2034 C  CD    . LYS E 3 106 ? 18.767  2.021   -10.952 1.00 20.63 ? 98   LYS A CD    1 
ATOM   2035 C  CE    . LYS E 3 106 ? 19.283  2.315   -12.368 1.00 20.65 ? 98   LYS A CE    1 
ATOM   2036 N  NZ    . LYS E 3 106 ? 20.743  2.025   -12.513 1.00 21.02 ? 98   LYS A NZ    1 
ATOM   2037 N  N     . ILE E 3 107 ? 15.903  5.180   -6.695  1.00 18.45 ? 99   ILE A N     1 
ATOM   2038 C  CA    . ILE E 3 107 ? 15.665  5.470   -5.291  1.00 17.88 ? 99   ILE A CA    1 
ATOM   2039 C  C     . ILE E 3 107 ? 14.442  4.695   -4.826  1.00 17.38 ? 99   ILE A C     1 
ATOM   2040 O  O     . ILE E 3 107 ? 13.579  4.361   -5.631  1.00 17.30 ? 99   ILE A O     1 
ATOM   2041 C  CB    . ILE E 3 107 ? 15.435  6.986   -5.104  1.00 18.02 ? 99   ILE A CB    1 
ATOM   2042 C  CG1   . ILE E 3 107 ? 15.309  7.342   -3.624  1.00 18.18 ? 99   ILE A CG1   1 
ATOM   2043 C  CG2   . ILE E 3 107 ? 14.174  7.450   -5.863  1.00 18.28 ? 99   ILE A CG2   1 
ATOM   2044 C  CD1   . ILE E 3 107 ? 15.430  8.804   -3.362  1.00 18.62 ? 99   ILE A CD1   1 
ATOM   2045 N  N     . GLU E 3 108 ? 14.366  4.427   -3.526  1.00 16.92 ? 100  GLU A N     1 
ATOM   2046 C  CA    . GLU E 3 108 ? 13.214  3.768   -2.933  1.00 16.80 ? 100  GLU A CA    1 
ATOM   2047 C  C     . GLU E 3 108 ? 12.888  4.498   -1.630  1.00 16.91 ? 100  GLU A C     1 
ATOM   2048 O  O     . GLU E 3 108 ? 13.711  4.540   -0.717  1.00 16.77 ? 100  GLU A O     1 
ATOM   2049 C  CB    . GLU E 3 108 ? 13.509  2.284   -2.683  1.00 16.73 ? 100  GLU A CB    1 
ATOM   2050 C  CG    . GLU E 3 108 ? 12.495  1.563   -1.795  1.00 17.42 ? 100  GLU A CG    1 
ATOM   2051 C  CD    . GLU E 3 108 ? 12.561  0.038   -1.886  1.00 18.44 ? 100  GLU A CD    1 
ATOM   2052 O  OE1   . GLU E 3 108 ? 13.192  -0.516  -2.825  1.00 18.37 ? 100  GLU A OE1   1 
ATOM   2053 O  OE2   . GLU E 3 108 ? 11.966  -0.618  -1.005  1.00 17.64 ? 100  GLU A OE2   1 
ATOM   2054 N  N     . ILE E 3 109 ? 11.698  5.092   -1.566  1.00 16.64 ? 101  ILE A N     1 
ATOM   2055 C  CA    . ILE E 3 109 ? 11.208  5.698   -0.344  1.00 16.72 ? 101  ILE A CA    1 
ATOM   2056 C  C     . ILE E 3 109 ? 10.593  4.557   0.460   1.00 16.87 ? 101  ILE A C     1 
ATOM   2057 O  O     . ILE E 3 109 ? 9.482   4.115   0.153   1.00 17.76 ? 101  ILE A O     1 
ATOM   2058 C  CB    . ILE E 3 109 ? 10.135  6.791   -0.628  1.00 16.69 ? 101  ILE A CB    1 
ATOM   2059 C  CG1   . ILE E 3 109 ? 10.517  7.694   -1.803  1.00 16.66 ? 101  ILE A CG1   1 
ATOM   2060 C  CG2   . ILE E 3 109 ? 9.910   7.639   0.597   1.00 16.93 ? 101  ILE A CG2   1 
ATOM   2061 C  CD1   . ILE E 3 109 ? 11.855  8.348   -1.680  1.00 17.27 ? 101  ILE A CD1   1 
ATOM   2062 N  N     . ALA E 3 110 ? 11.316  4.059   1.460   1.00 16.57 ? 102  ALA A N     1 
ATOM   2063 C  CA    . ALA E 3 110 ? 10.800  2.999   2.323   1.00 16.36 ? 102  ALA A CA    1 
ATOM   2064 C  C     . ALA E 3 110 ? 9.834   3.551   3.329   1.00 16.47 ? 102  ALA A C     1 
ATOM   2065 O  O     . ALA E 3 110 ? 8.869   2.892   3.678   1.00 17.04 ? 102  ALA A O     1 
ATOM   2066 C  CB    . ALA E 3 110 ? 11.923  2.287   3.037   1.00 16.34 ? 102  ALA A CB    1 
ATOM   2067 N  N     . SER E 3 111 ? 10.111  4.745   3.835   1.00 16.49 ? 103  SER A N     1 
ATOM   2068 C  CA    . SER E 3 111 ? 9.190   5.387   4.762   1.00 16.50 ? 103  SER A CA    1 
ATOM   2069 C  C     . SER E 3 111 ? 9.385   6.901   4.794   1.00 16.28 ? 103  SER A C     1 
ATOM   2070 O  O     . SER E 3 111 ? 10.020  7.478   3.912   1.00 15.98 ? 103  SER A O     1 
ATOM   2071 C  CB    . SER E 3 111 ? 9.310   4.763   6.157   1.00 16.55 ? 103  SER A CB    1 
ATOM   2072 O  OG    . SER E 3 111 ? 10.510  5.143   6.810   1.00 17.69 ? 103  SER A OG    1 
ATOM   2073 N  N     . ILE E 3 112 ? 8.799   7.542   5.798   1.00 16.02 ? 104  ILE A N     1 
ATOM   2074 C  CA    . ILE E 3 112 ? 8.837   8.991   5.900   1.00 15.81 ? 104  ILE A CA    1 
ATOM   2075 C  C     . ILE E 3 112 ? 10.240  9.490   6.261   1.00 15.66 ? 104  ILE A C     1 
ATOM   2076 O  O     . ILE E 3 112 ? 10.575  10.645  6.000   1.00 15.34 ? 104  ILE A O     1 
ATOM   2077 C  CB    . ILE E 3 112 ? 7.787   9.474   6.930   1.00 16.01 ? 104  ILE A CB    1 
ATOM   2078 C  CG1   . ILE E 3 112 ? 7.664   10.993  6.878   1.00 16.25 ? 104  ILE A CG1   1 
ATOM   2079 C  CG2   . ILE E 3 112 ? 8.134   9.005   8.360   1.00 15.78 ? 104  ILE A CG2   1 
ATOM   2080 C  CD1   . ILE E 3 112 ? 6.508   11.504  7.633   1.00 17.51 ? 104  ILE A CD1   1 
ATOM   2081 N  N     . ASP E 3 113 ? 11.055  8.611   6.847   1.00 15.33 ? 105  ASP A N     1 
ATOM   2082 C  CA    . ASP E 3 113 ? 12.430  8.949   7.203   1.00 15.36 ? 105  ASP A CA    1 
ATOM   2083 C  C     . ASP E 3 113 ? 13.526  7.994   6.670   1.00 15.22 ? 105  ASP A C     1 
ATOM   2084 O  O     . ASP E 3 113 ? 14.660  8.066   7.127   1.00 15.31 ? 105  ASP A O     1 
ATOM   2085 C  CB    . ASP E 3 113 ? 12.530  9.050   8.726   1.00 15.32 ? 105  ASP A CB    1 
ATOM   2086 C  CG    . ASP E 3 113 ? 12.549  7.706   9.397   1.00 15.45 ? 105  ASP A CG    1 
ATOM   2087 O  OD1   . ASP E 3 113 ? 11.866  6.787   8.908   1.00 14.08 ? 105  ASP A OD1   1 
ATOM   2088 O  OD2   . ASP E 3 113 ? 13.228  7.462   10.418  1.00 17.41 ? 105  ASP A OD2   1 
ATOM   2089 N  N     . GLU E 3 114 ? 13.198  7.121   5.713   1.00 15.00 ? 106  GLU A N     1 
ATOM   2090 C  CA    . GLU E 3 114 ? 14.143  6.110   5.192   1.00 14.57 ? 106  GLU A CA    1 
ATOM   2091 C  C     . GLU E 3 114 ? 14.143  6.049   3.668   1.00 13.75 ? 106  GLU A C     1 
ATOM   2092 O  O     . GLU E 3 114 ? 13.097  5.901   3.062   1.00 13.43 ? 106  GLU A O     1 
ATOM   2093 C  CB    . GLU E 3 114 ? 13.738  4.708   5.658   1.00 14.73 ? 106  GLU A CB    1 
ATOM   2094 C  CG    . GLU E 3 114 ? 13.880  4.405   7.137   1.00 15.52 ? 106  GLU A CG    1 
ATOM   2095 C  CD    . GLU E 3 114 ? 13.302  3.033   7.478   1.00 17.46 ? 106  GLU A CD    1 
ATOM   2096 O  OE1   . GLU E 3 114 ? 12.256  2.950   8.180   1.00 17.65 ? 106  GLU A OE1   1 
ATOM   2097 O  OE2   . GLU E 3 114 ? 13.887  2.024   7.026   1.00 18.91 ? 106  GLU A OE2   1 
ATOM   2098 N  N     . ALA E 3 115 ? 15.308  6.109   3.046   1.00 13.11 ? 107  ALA A N     1 
ATOM   2099 C  CA    . ALA E 3 115 ? 15.391  5.877   1.608   1.00 12.61 ? 107  ALA A CA    1 
ATOM   2100 C  C     . ALA E 3 115 ? 16.640  5.089   1.205   1.00 12.31 ? 107  ALA A C     1 
ATOM   2101 O  O     . ALA E 3 115 ? 17.701  5.230   1.814   1.00 12.06 ? 107  ALA A O     1 
ATOM   2102 C  CB    . ALA E 3 115 ? 15.318  7.186   0.866   1.00 12.62 ? 107  ALA A CB    1 
ATOM   2103 N  N     . TYR E 3 116 ? 16.488  4.241   0.187   1.00 12.07 ? 108  TYR A N     1 
ATOM   2104 C  CA    . TYR E 3 116 ? 17.594  3.489   -0.397  1.00 11.76 ? 108  TYR A CA    1 
ATOM   2105 C  C     . TYR E 3 116 ? 17.918  4.062   -1.752  1.00 11.95 ? 108  TYR A C     1 
ATOM   2106 O  O     . TYR E 3 116 ? 17.031  4.308   -2.549  1.00 11.93 ? 108  TYR A O     1 
ATOM   2107 C  CB    . TYR E 3 116 ? 17.212  2.032   -0.608  1.00 11.61 ? 108  TYR A CB    1 
ATOM   2108 C  CG    . TYR E 3 116 ? 16.863  1.282   0.643   1.00 11.13 ? 108  TYR A CG    1 
ATOM   2109 C  CD1   . TYR E 3 116 ? 17.809  0.497   1.294   1.00 10.78 ? 108  TYR A CD1   1 
ATOM   2110 C  CD2   . TYR E 3 116 ? 15.581  1.337   1.166   1.00 10.44 ? 108  TYR A CD2   1 
ATOM   2111 C  CE1   . TYR E 3 116 ? 17.485  -0.201  2.437   1.00 10.86 ? 108  TYR A CE1   1 
ATOM   2112 C  CE2   . TYR E 3 116 ? 15.254  0.657   2.309   1.00 10.70 ? 108  TYR A CE2   1 
ATOM   2113 C  CZ    . TYR E 3 116 ? 16.203  -0.115  2.944   1.00 10.97 ? 108  TYR A CZ    1 
ATOM   2114 O  OH    . TYR E 3 116 ? 15.861  -0.803  4.081   1.00 10.52 ? 108  TYR A OH    1 
ATOM   2115 N  N     . LEU E 3 117 ? 19.199  4.239   -2.021  1.00 12.34 ? 109  LEU A N     1 
ATOM   2116 C  CA    . LEU E 3 117 ? 19.669  4.717   -3.304  1.00 12.55 ? 109  LEU A CA    1 
ATOM   2117 C  C     . LEU E 3 117 ? 20.526  3.625   -3.916  1.00 12.58 ? 109  LEU A C     1 
ATOM   2118 O  O     . LEU E 3 117 ? 21.485  3.199   -3.294  1.00 12.37 ? 109  LEU A O     1 
ATOM   2119 C  CB    . LEU E 3 117 ? 20.527  5.966   -3.104  1.00 12.71 ? 109  LEU A CB    1 
ATOM   2120 C  CG    . LEU E 3 117 ? 19.810  7.305   -2.968  1.00 13.01 ? 109  LEU A CG    1 
ATOM   2121 C  CD1   . LEU E 3 117 ? 18.926  7.307   -1.739  1.00 14.44 ? 109  LEU A CD1   1 
ATOM   2122 C  CD2   . LEU E 3 117 ? 20.825  8.418   -2.885  1.00 13.05 ? 109  LEU A CD2   1 
ATOM   2123 N  N     . ASP E 3 118 ? 20.183  3.158   -5.111  1.00 12.70 ? 110  ASP A N     1 
ATOM   2124 C  CA    . ASP E 3 118 ? 21.092  2.303   -5.863  1.00 13.28 ? 110  ASP A CA    1 
ATOM   2125 C  C     . ASP E 3 118 ? 22.142  3.199   -6.504  1.00 13.17 ? 110  ASP A C     1 
ATOM   2126 O  O     . ASP E 3 118 ? 21.816  4.052   -7.319  1.00 13.18 ? 110  ASP A O     1 
ATOM   2127 C  CB    . ASP E 3 118 ? 20.349  1.495   -6.934  1.00 13.68 ? 110  ASP A CB    1 
ATOM   2128 C  CG    . ASP E 3 118 ? 21.195  0.358   -7.509  1.00 14.88 ? 110  ASP A CG    1 
ATOM   2129 O  OD1   . ASP E 3 118 ? 22.390  0.577   -7.783  1.00 15.46 ? 110  ASP A OD1   1 
ATOM   2130 O  OD2   . ASP E 3 118 ? 20.749  -0.794  -7.714  1.00 17.06 ? 110  ASP A OD2   1 
ATOM   2131 N  N     . ILE E 3 119 ? 23.401  3.010   -6.125  1.00 13.19 ? 111  ILE A N     1 
ATOM   2132 C  CA    . ILE E 3 119 ? 24.489  3.862   -6.619  1.00 13.04 ? 111  ILE A CA    1 
ATOM   2133 C  C     . ILE E 3 119 ? 25.553  3.058   -7.394  1.00 13.04 ? 111  ILE A C     1 
ATOM   2134 O  O     . ILE E 3 119 ? 26.741  3.330   -7.289  1.00 13.06 ? 111  ILE A O     1 
ATOM   2135 C  CB    . ILE E 3 119 ? 25.107  4.667   -5.438  1.00 12.78 ? 111  ILE A CB    1 
ATOM   2136 C  CG1   . ILE E 3 119 ? 25.603  3.744   -4.321  1.00 12.17 ? 111  ILE A CG1   1 
ATOM   2137 C  CG2   . ILE E 3 119 ? 24.082  5.618   -4.869  1.00 12.72 ? 111  ILE A CG2   1 
ATOM   2138 C  CD1   . ILE E 3 119 ? 26.542  4.425   -3.342  1.00 11.62 ? 111  ILE A CD1   1 
ATOM   2139 N  N     . SER E 3 120 ? 25.096  2.087   -8.184  1.00 13.15 ? 112  SER A N     1 
ATOM   2140 C  CA    . SER E 3 120 ? 25.966  1.178   -8.943  1.00 13.33 ? 112  SER A CA    1 
ATOM   2141 C  C     . SER E 3 120 ? 26.582  1.839   -10.188 1.00 13.67 ? 112  SER A C     1 
ATOM   2142 O  O     . SER E 3 120 ? 27.653  1.454   -10.643 1.00 13.51 ? 112  SER A O     1 
ATOM   2143 C  CB    . SER E 3 120 ? 25.180  -0.063  -9.390  1.00 13.20 ? 112  SER A CB    1 
ATOM   2144 O  OG    . SER E 3 120 ? 24.554  -0.719  -8.307  1.00 12.68 ? 112  SER A OG    1 
ATOM   2145 N  N     . ASP E 3 121 ? 25.872  2.812   -10.748 1.00 14.26 ? 113  ASP A N     1 
ATOM   2146 C  CA    . ASP E 3 121 ? 26.351  3.589   -11.884 1.00 14.64 ? 113  ASP A CA    1 
ATOM   2147 C  C     . ASP E 3 121 ? 26.804  4.976   -11.444 1.00 14.78 ? 113  ASP A C     1 
ATOM   2148 O  O     . ASP E 3 121 ? 26.951  5.868   -12.273 1.00 15.06 ? 113  ASP A O     1 
ATOM   2149 C  CB    . ASP E 3 121 ? 25.238  3.734   -12.925 1.00 14.82 ? 113  ASP A CB    1 
ATOM   2150 C  CG    . ASP E 3 121 ? 24.586  2.412   -13.271 1.00 15.80 ? 113  ASP A CG    1 
ATOM   2151 O  OD1   . ASP E 3 121 ? 25.231  1.358   -13.065 1.00 16.92 ? 113  ASP A OD1   1 
ATOM   2152 O  OD2   . ASP E 3 121 ? 23.431  2.332   -13.754 1.00 17.59 ? 113  ASP A OD2   1 
ATOM   2153 N  N     . LYS E 3 122 ? 26.991  5.165   -10.141 1.00 14.93 ? 114  LYS A N     1 
ATOM   2154 C  CA    . LYS E 3 122 ? 27.481  6.429   -9.602  1.00 15.08 ? 114  LYS A CA    1 
ATOM   2155 C  C     . LYS E 3 122 ? 28.862  6.276   -8.954  1.00 15.03 ? 114  LYS A C     1 
ATOM   2156 O  O     . LYS E 3 122 ? 29.624  7.226   -8.921  1.00 15.19 ? 114  LYS A O     1 
ATOM   2157 C  CB    . LYS E 3 122 ? 26.474  7.024   -8.601  1.00 15.13 ? 114  LYS A CB    1 
ATOM   2158 C  CG    . LYS E 3 122 ? 24.985  6.835   -8.970  1.00 15.72 ? 114  LYS A CG    1 
ATOM   2159 C  CD    . LYS E 3 122 ? 24.650  7.242   -10.425 1.00 16.39 ? 114  LYS A CD    1 
ATOM   2160 C  CE    . LYS E 3 122 ? 23.371  8.087   -10.552 1.00 16.56 ? 114  LYS A CE    1 
ATOM   2161 N  NZ    . LYS E 3 122 ? 23.663  9.557   -10.753 1.00 15.77 ? 114  LYS A NZ    1 
ATOM   2162 N  N     . VAL E 3 123 ? 29.186  5.086   -8.454  1.00 15.07 ? 115  VAL A N     1 
ATOM   2163 C  CA    . VAL E 3 123 ? 30.477  4.830   -7.808  1.00 15.01 ? 115  VAL A CA    1 
ATOM   2164 C  C     . VAL E 3 123 ? 30.998  3.428   -8.117  1.00 15.14 ? 115  VAL A C     1 
ATOM   2165 O  O     . VAL E 3 123 ? 30.213  2.493   -8.270  1.00 15.51 ? 115  VAL A O     1 
ATOM   2166 C  CB    . VAL E 3 123 ? 30.391  5.004   -6.278  1.00 14.91 ? 115  VAL A CB    1 
ATOM   2167 C  CG1   . VAL E 3 123 ? 30.229  6.466   -5.925  1.00 15.12 ? 115  VAL A CG1   1 
ATOM   2168 C  CG2   . VAL E 3 123 ? 29.241  4.199   -5.691  1.00 14.80 ? 115  VAL A CG2   1 
ATOM   2169 N  N     . ARG E 3 124 ? 32.321  3.289   -8.191  1.00 14.98 ? 116  ARG A N     1 
ATOM   2170 C  CA    . ARG E 3 124 ? 32.961  2.011   -8.519  1.00 14.87 ? 116  ARG A CA    1 
ATOM   2171 C  C     . ARG E 3 124 ? 33.146  1.073   -7.320  1.00 14.62 ? 116  ARG A C     1 
ATOM   2172 O  O     . ARG E 3 124 ? 32.833  -0.112  -7.417  1.00 15.06 ? 116  ARG A O     1 
ATOM   2173 C  CB    . ARG E 3 124 ? 34.322  2.253   -9.170  1.00 14.90 ? 116  ARG A CB    1 
ATOM   2174 C  CG    . ARG E 3 124 ? 34.237  2.806   -10.576 1.00 15.23 ? 116  ARG A CG    1 
ATOM   2175 C  CD    . ARG E 3 124 ? 35.484  3.535   -11.021 1.00 15.39 ? 116  ARG A CD    1 
ATOM   2176 N  NE    . ARG E 3 124 ? 35.620  4.828   -10.357 1.00 15.39 ? 116  ARG A NE    1 
ATOM   2177 C  CZ    . ARG E 3 124 ? 36.639  5.660   -10.531 1.00 14.60 ? 116  ARG A CZ    1 
ATOM   2178 N  NH1   . ARG E 3 124 ? 37.636  5.350   -11.355 1.00 14.07 ? 116  ARG A NH1   1 
ATOM   2179 N  NH2   . ARG E 3 124 ? 36.655  6.814   -9.877  1.00 14.44 ? 116  ARG A NH2   1 
ATOM   2180 N  N     . ASP E 3 125 ? 33.671  1.598   -6.213  1.00 14.16 ? 117  ASP A N     1 
ATOM   2181 C  CA    . ASP E 3 125 ? 33.997  0.787   -5.028  1.00 13.93 ? 117  ASP A CA    1 
ATOM   2182 C  C     . ASP E 3 125 ? 33.448  1.401   -3.732  1.00 13.87 ? 117  ASP A C     1 
ATOM   2183 O  O     . ASP E 3 125 ? 32.913  2.505   -3.743  1.00 13.98 ? 117  ASP A O     1 
ATOM   2184 C  CB    . ASP E 3 125 ? 35.518  0.585   -4.915  1.00 13.71 ? 117  ASP A CB    1 
ATOM   2185 C  CG    . ASP E 3 125 ? 36.289  1.892   -4.929  1.00 12.98 ? 117  ASP A CG    1 
ATOM   2186 O  OD1   . ASP E 3 125 ? 37.467  1.887   -5.337  1.00 13.04 ? 117  ASP A OD1   1 
ATOM   2187 O  OD2   . ASP E 3 125 ? 35.801  2.978   -4.567  1.00 11.34 ? 117  ASP A OD2   1 
ATOM   2188 N  N     . TYR E 3 126 ? 33.597  0.688   -2.617  1.00 13.80 ? 118  TYR A N     1 
ATOM   2189 C  CA    . TYR E 3 126 ? 33.086  1.159   -1.320  1.00 13.91 ? 118  TYR A CA    1 
ATOM   2190 C  C     . TYR E 3 126 ? 33.796  2.407   -0.777  1.00 14.00 ? 118  TYR A C     1 
ATOM   2191 O  O     . TYR E 3 126 ? 33.271  3.064   0.125   1.00 13.97 ? 118  TYR A O     1 
ATOM   2192 C  CB    . TYR E 3 126 ? 33.158  0.047   -0.265  1.00 13.79 ? 118  TYR A CB    1 
ATOM   2193 C  CG    . TYR E 3 126 ? 32.154  -1.067  -0.477  1.00 14.15 ? 118  TYR A CG    1 
ATOM   2194 C  CD1   . TYR E 3 126 ? 30.789  -0.807  -0.488  1.00 14.25 ? 118  TYR A CD1   1 
ATOM   2195 C  CD2   . TYR E 3 126 ? 32.569  -2.381  -0.663  1.00 14.50 ? 118  TYR A CD2   1 
ATOM   2196 C  CE1   . TYR E 3 126 ? 29.868  -1.821  -0.680  1.00 14.18 ? 118  TYR A CE1   1 
ATOM   2197 C  CE2   . TYR E 3 126 ? 31.652  -3.397  -0.859  1.00 14.66 ? 118  TYR A CE2   1 
ATOM   2198 C  CZ    . TYR E 3 126 ? 30.306  -3.109  -0.867  1.00 14.29 ? 118  TYR A CZ    1 
ATOM   2199 O  OH    . TYR E 3 126 ? 29.391  -4.115  -1.058  1.00 15.66 ? 118  TYR A OH    1 
ATOM   2200 N  N     . ARG E 3 127 ? 34.986  2.721   -1.293  1.00 13.84 ? 119  ARG A N     1 
ATOM   2201 C  CA    . ARG E 3 127 ? 35.690  3.934   -0.881  1.00 13.89 ? 119  ARG A CA    1 
ATOM   2202 C  C     . ARG E 3 127 ? 34.883  5.160   -1.319  1.00 13.59 ? 119  ARG A C     1 
ATOM   2203 O  O     . ARG E 3 127 ? 34.627  6.064   -0.533  1.00 13.27 ? 119  ARG A O     1 
ATOM   2204 C  CB    . ARG E 3 127 ? 37.104  3.977   -1.486  1.00 14.18 ? 119  ARG A CB    1 
ATOM   2205 C  CG    . ARG E 3 127 ? 38.041  5.056   -0.903  1.00 14.85 ? 119  ARG A CG    1 
ATOM   2206 C  CD    . ARG E 3 127 ? 39.420  5.146   -1.594  1.00 15.72 ? 119  ARG A CD    1 
ATOM   2207 N  NE    . ARG E 3 127 ? 39.321  5.640   -2.971  1.00 16.24 ? 119  ARG A NE    1 
ATOM   2208 C  CZ    . ARG E 3 127 ? 39.139  6.917   -3.324  1.00 16.21 ? 119  ARG A CZ    1 
ATOM   2209 N  NH1   . ARG E 3 127 ? 39.043  7.880   -2.409  1.00 16.07 ? 119  ARG A NH1   1 
ATOM   2210 N  NH2   . ARG E 3 127 ? 39.048  7.233   -4.610  1.00 16.14 ? 119  ARG A NH2   1 
ATOM   2211 N  N     . GLU E 3 128 ? 34.477  5.162   -2.582  1.00 13.40 ? 120  GLU A N     1 
ATOM   2212 C  CA    . GLU E 3 128 ? 33.737  6.270   -3.166  1.00 13.22 ? 120  GLU A CA    1 
ATOM   2213 C  C     . GLU E 3 128 ? 32.375  6.385   -2.525  1.00 12.68 ? 120  GLU A C     1 
ATOM   2214 O  O     . GLU E 3 128 ? 31.869  7.481   -2.328  1.00 12.47 ? 120  GLU A O     1 
ATOM   2215 C  CB    . GLU E 3 128 ? 33.542  6.055   -4.666  1.00 13.39 ? 120  GLU A CB    1 
ATOM   2216 C  CG    . GLU E 3 128 ? 34.593  6.678   -5.551  1.00 14.32 ? 120  GLU A CG    1 
ATOM   2217 C  CD    . GLU E 3 128 ? 34.411  6.254   -6.992  1.00 16.28 ? 120  GLU A CD    1 
ATOM   2218 O  OE1   . GLU E 3 128 ? 33.769  6.999   -7.775  1.00 16.02 ? 120  GLU A OE1   1 
ATOM   2219 O  OE2   . GLU E 3 128 ? 34.900  5.155   -7.329  1.00 18.21 ? 120  GLU A OE2   1 
ATOM   2220 N  N     . ALA E 3 129 ? 31.778  5.238   -2.227  1.00 12.38 ? 121  ALA A N     1 
ATOM   2221 C  CA    . ALA E 3 129 ? 30.460  5.192   -1.609  1.00 12.08 ? 121  ALA A CA    1 
ATOM   2222 C  C     . ALA E 3 129 ? 30.482  5.941   -0.290  1.00 11.77 ? 121  ALA A C     1 
ATOM   2223 O  O     . ALA E 3 129 ? 29.591  6.724   -0.004  1.00 11.96 ? 121  ALA A O     1 
ATOM   2224 C  CB    . ALA E 3 129 ? 30.032  3.755   -1.396  1.00 12.13 ? 121  ALA A CB    1 
ATOM   2225 N  N     . TYR E 3 130 ? 31.512  5.700   0.507   1.00 11.59 ? 122  TYR A N     1 
ATOM   2226 C  CA    . TYR E 3 130 ? 31.689  6.409   1.759   1.00 11.69 ? 122  TYR A CA    1 
ATOM   2227 C  C     . TYR E 3 130 ? 31.742  7.916   1.496   1.00 11.68 ? 122  TYR A C     1 
ATOM   2228 O  O     . TYR E 3 130 ? 31.067  8.688   2.174   1.00 11.41 ? 122  TYR A O     1 
ATOM   2229 C  CB    . TYR E 3 130 ? 32.956  5.910   2.466   1.00 11.70 ? 122  TYR A CB    1 
ATOM   2230 C  CG    . TYR E 3 130 ? 33.230  6.525   3.823   1.00 12.33 ? 122  TYR A CG    1 
ATOM   2231 C  CD1   . TYR E 3 130 ? 32.839  5.885   4.995   1.00 13.71 ? 122  TYR A CD1   1 
ATOM   2232 C  CD2   . TYR E 3 130 ? 33.906  7.738   3.936   1.00 12.69 ? 122  TYR A CD2   1 
ATOM   2233 C  CE1   . TYR E 3 130 ? 33.101  6.451   6.250   1.00 13.91 ? 122  TYR A CE1   1 
ATOM   2234 C  CE2   . TYR E 3 130 ? 34.177  8.302   5.172   1.00 12.86 ? 122  TYR A CE2   1 
ATOM   2235 C  CZ    . TYR E 3 130 ? 33.775  7.656   6.323   1.00 14.01 ? 122  TYR A CZ    1 
ATOM   2236 O  OH    . TYR E 3 130 ? 34.043  8.224   7.542   1.00 14.97 ? 122  TYR A OH    1 
ATOM   2237 N  N     . ASN E 3 131 ? 32.523  8.319   0.494   1.00 11.84 ? 123  ASN A N     1 
ATOM   2238 C  CA    . ASN E 3 131 ? 32.723  9.732   0.185   1.00 11.99 ? 123  ASN A CA    1 
ATOM   2239 C  C     . ASN E 3 131 ? 31.462  10.435  -0.297  1.00 12.28 ? 123  ASN A C     1 
ATOM   2240 O  O     . ASN E 3 131 ? 31.255  11.621  -0.029  1.00 12.49 ? 123  ASN A O     1 
ATOM   2241 C  CB    . ASN E 3 131 ? 33.833  9.908   -0.852  1.00 11.86 ? 123  ASN A CB    1 
ATOM   2242 C  CG    . ASN E 3 131 ? 35.207  9.659   -0.281  1.00 11.44 ? 123  ASN A CG    1 
ATOM   2243 O  OD1   . ASN E 3 131 ? 35.440  9.826   0.918   1.00 10.06 ? 123  ASN A OD1   1 
ATOM   2244 N  ND2   . ASN E 3 131 ? 36.132  9.246   -1.141  1.00 12.03 ? 123  ASN A ND2   1 
ATOM   2245 N  N     . LEU E 3 132 ? 30.626  9.700   -1.012  1.00 12.49 ? 124  LEU A N     1 
ATOM   2246 C  CA    . LEU E 3 132 ? 29.361  10.222  -1.486  1.00 12.59 ? 124  LEU A CA    1 
ATOM   2247 C  C     . LEU E 3 132 ? 28.418  10.261  -0.302  1.00 12.72 ? 124  LEU A C     1 
ATOM   2248 O  O     . LEU E 3 132 ? 27.579  11.143  -0.199  1.00 12.78 ? 124  LEU A O     1 
ATOM   2249 C  CB    . LEU E 3 132 ? 28.817  9.326   -2.593  1.00 12.60 ? 124  LEU A CB    1 
ATOM   2250 C  CG    . LEU E 3 132 ? 27.426  9.629   -3.122  1.00 13.17 ? 124  LEU A CG    1 
ATOM   2251 C  CD1   . LEU E 3 132 ? 27.360  11.024  -3.678  1.00 13.69 ? 124  LEU A CD1   1 
ATOM   2252 C  CD2   . LEU E 3 132 ? 27.087  8.615   -4.181  1.00 13.87 ? 124  LEU A CD2   1 
ATOM   2253 N  N     . GLY E 3 133 ? 28.570  9.295   0.596   1.00 12.92 ? 125  GLY A N     1 
ATOM   2254 C  CA    . GLY E 3 133 ? 27.808  9.252   1.825   1.00 13.15 ? 125  GLY A CA    1 
ATOM   2255 C  C     . GLY E 3 133 ? 28.024  10.489  2.674   1.00 13.49 ? 125  GLY A C     1 
ATOM   2256 O  O     . GLY E 3 133 ? 27.063  11.034  3.210   1.00 13.48 ? 125  GLY A O     1 
ATOM   2257 N  N     . LEU E 3 134 ? 29.276  10.939  2.796   1.00 13.80 ? 126  LEU A N     1 
ATOM   2258 C  CA    . LEU E 3 134 ? 29.583  12.176  3.519   1.00 13.94 ? 126  LEU A CA    1 
ATOM   2259 C  C     . LEU E 3 134 ? 29.062  13.368  2.744   1.00 13.93 ? 126  LEU A C     1 
ATOM   2260 O  O     . LEU E 3 134 ? 28.755  14.394  3.323   1.00 14.09 ? 126  LEU A O     1 
ATOM   2261 C  CB    . LEU E 3 134 ? 31.085  12.375  3.702   1.00 14.08 ? 126  LEU A CB    1 
ATOM   2262 C  CG    . LEU E 3 134 ? 31.925  11.335  4.434   1.00 14.45 ? 126  LEU A CG    1 
ATOM   2263 C  CD1   . LEU E 3 134 ? 33.375  11.807  4.426   1.00 14.64 ? 126  LEU A CD1   1 
ATOM   2264 C  CD2   . LEU E 3 134 ? 31.433  11.116  5.846   1.00 14.73 ? 126  LEU A CD2   1 
ATOM   2265 N  N     . GLU E 3 135 ? 29.000  13.243  1.424   1.00 13.86 ? 127  GLU A N     1 
ATOM   2266 C  CA    . GLU E 3 135 ? 28.440  14.295  0.600   1.00 13.82 ? 127  GLU A CA    1 
ATOM   2267 C  C     . GLU E 3 135 ? 26.926  14.378  0.748   1.00 13.51 ? 127  GLU A C     1 
ATOM   2268 O  O     . GLU E 3 135 ? 26.350  15.428  0.546   1.00 13.86 ? 127  GLU A O     1 
ATOM   2269 C  CB    . GLU E 3 135 ? 28.834  14.125  -0.869  1.00 14.02 ? 127  GLU A CB    1 
ATOM   2270 C  CG    . GLU E 3 135 ? 28.871  15.459  -1.600  1.00 15.18 ? 127  GLU A CG    1 
ATOM   2271 C  CD    . GLU E 3 135 ? 29.201  15.333  -3.066  1.00 16.39 ? 127  GLU A CD    1 
ATOM   2272 O  OE1   . GLU E 3 135 ? 30.091  14.519  -3.404  1.00 18.36 ? 127  GLU A OE1   1 
ATOM   2273 O  OE2   . GLU E 3 135 ? 28.577  16.062  -3.872  1.00 16.35 ? 127  GLU A OE2   1 
ATOM   2274 N  N     . ILE E 3 136 ? 26.278  13.284  1.111   1.00 13.36 ? 128  ILE A N     1 
ATOM   2275 C  CA    . ILE E 3 136 ? 24.845  13.324  1.349   1.00 13.26 ? 128  ILE A CA    1 
ATOM   2276 C  C     . ILE E 3 136 ? 24.587  13.839  2.756   1.00 13.18 ? 128  ILE A C     1 
ATOM   2277 O  O     . ILE E 3 136 ? 23.687  14.634  2.961   1.00 13.15 ? 128  ILE A O     1 
ATOM   2278 C  CB    . ILE E 3 136 ? 24.205  11.949  1.104   1.00 13.22 ? 128  ILE A CB    1 
ATOM   2279 C  CG1   . ILE E 3 136 ? 24.266  11.614  -0.395  1.00 13.15 ? 128  ILE A CG1   1 
ATOM   2280 C  CG2   . ILE E 3 136 ? 22.755  11.927  1.600   1.00 12.72 ? 128  ILE A CG2   1 
ATOM   2281 C  CD1   . ILE E 3 136 ? 24.188  10.121  -0.706  1.00 13.44 ? 128  ILE A CD1   1 
ATOM   2282 N  N     . LYS E 3 137 ? 25.392  13.397  3.715   1.00 13.26 ? 129  LYS A N     1 
ATOM   2283 C  CA    . LYS E 3 137 ? 25.310  13.887  5.090   1.00 13.18 ? 129  LYS A CA    1 
ATOM   2284 C  C     . LYS E 3 137 ? 25.463  15.404  5.134   1.00 13.13 ? 129  LYS A C     1 
ATOM   2285 O  O     . LYS E 3 137 ? 24.615  16.090  5.693   1.00 12.96 ? 129  LYS A O     1 
ATOM   2286 C  CB    . LYS E 3 137 ? 26.373  13.226  5.977   1.00 12.98 ? 129  LYS A CB    1 
ATOM   2287 C  CG    . LYS E 3 137 ? 25.886  11.943  6.620   1.00 13.50 ? 129  LYS A CG    1 
ATOM   2288 C  CD    . LYS E 3 137 ? 26.983  11.173  7.347   1.00 13.18 ? 129  LYS A CD    1 
ATOM   2289 C  CE    . LYS E 3 137 ? 27.188  11.639  8.789   1.00 13.96 ? 129  LYS A CE    1 
ATOM   2290 N  NZ    . LYS E 3 137 ? 25.943  11.861  9.586   1.00 14.47 ? 129  LYS A NZ    1 
ATOM   2291 N  N     . ASN E 3 138 ? 26.531  15.919  4.525   1.00 13.17 ? 130  ASN A N     1 
ATOM   2292 C  CA    . ASN E 3 138 ? 26.827  17.358  4.554   1.00 13.25 ? 130  ASN A CA    1 
ATOM   2293 C  C     . ASN E 3 138 ? 25.740  18.162  3.859   1.00 12.93 ? 130  ASN A C     1 
ATOM   2294 O  O     . ASN E 3 138 ? 25.369  19.230  4.331   1.00 12.71 ? 130  ASN A O     1 
ATOM   2295 C  CB    . ASN E 3 138 ? 28.189  17.687  3.914   1.00 13.29 ? 130  ASN A CB    1 
ATOM   2296 C  CG    . ASN E 3 138 ? 29.362  17.028  4.634   1.00 14.43 ? 130  ASN A CG    1 
ATOM   2297 O  OD1   . ASN E 3 138 ? 29.264  16.639  5.806   1.00 15.54 ? 130  ASN A OD1   1 
ATOM   2298 N  ND2   . ASN E 3 138 ? 30.481  16.879  3.920   1.00 15.52 ? 130  ASN A ND2   1 
ATOM   2299 N  N     . LYS E 3 139 ? 25.237  17.636  2.746   1.00 12.77 ? 131  LYS A N     1 
ATOM   2300 C  CA    . LYS E 3 139 ? 24.202  18.303  1.965   1.00 12.85 ? 131  LYS A CA    1 
ATOM   2301 C  C     . LYS E 3 139 ? 22.903  18.478  2.734   1.00 12.86 ? 131  LYS A C     1 
ATOM   2302 O  O     . LYS E 3 139 ? 22.265  19.514  2.633   1.00 13.29 ? 131  LYS A O     1 
ATOM   2303 C  CB    . LYS E 3 139 ? 23.925  17.538  0.658   1.00 12.85 ? 131  LYS A CB    1 
ATOM   2304 C  CG    . LYS E 3 139 ? 22.835  18.140  -0.241  1.00 12.90 ? 131  LYS A CG    1 
ATOM   2305 C  CD    . LYS E 3 139 ? 23.157  19.561  -0.721  1.00 14.11 ? 131  LYS A CD    1 
ATOM   2306 C  CE    . LYS E 3 139 ? 24.179  19.575  -1.872  1.00 14.77 ? 131  LYS A CE    1 
ATOM   2307 N  NZ    . LYS E 3 139 ? 24.869  20.894  -2.041  1.00 15.47 ? 131  LYS A NZ    1 
ATOM   2308 N  N     . ILE E 3 140 ? 22.497  17.465  3.486   1.00 13.20 ? 132  ILE A N     1 
ATOM   2309 C  CA    . ILE E 3 140 ? 21.222  17.513  4.191   1.00 13.28 ? 132  ILE A CA    1 
ATOM   2310 C  C     . ILE E 3 140 ? 21.379  18.380  5.413   1.00 13.73 ? 132  ILE A C     1 
ATOM   2311 O  O     . ILE E 3 140 ? 20.451  19.072  5.796   1.00 14.38 ? 132  ILE A O     1 
ATOM   2312 C  CB    . ILE E 3 140 ? 20.733  16.104  4.555   1.00 13.07 ? 132  ILE A CB    1 
ATOM   2313 C  CG1   . ILE E 3 140 ? 20.449  15.312  3.276   1.00 12.66 ? 132  ILE A CG1   1 
ATOM   2314 C  CG2   . ILE E 3 140 ? 19.465  16.178  5.393   1.00 13.37 ? 132  ILE A CG2   1 
ATOM   2315 C  CD1   . ILE E 3 140 ? 20.209  13.832  3.510   1.00 12.66 ? 132  ILE A CD1   1 
ATOM   2316 N  N     . LEU E 3 141 ? 22.562  18.357  6.011   1.00 14.23 ? 133  LEU A N     1 
ATOM   2317 C  CA    . LEU E 3 141 ? 22.883  19.244  7.122   1.00 14.76 ? 133  LEU A CA    1 
ATOM   2318 C  C     . LEU E 3 141 ? 22.841  20.705  6.680   1.00 15.18 ? 133  LEU A C     1 
ATOM   2319 O  O     . LEU E 3 141 ? 22.407  21.577  7.426   1.00 15.31 ? 133  LEU A O     1 
ATOM   2320 C  CB    . LEU E 3 141 ? 24.269  18.904  7.672   1.00 14.79 ? 133  LEU A CB    1 
ATOM   2321 C  CG    . LEU E 3 141 ? 24.663  19.378  9.079   1.00 15.27 ? 133  LEU A CG    1 
ATOM   2322 C  CD1   . LEU E 3 141 ? 23.543  19.202  10.102  1.00 14.68 ? 133  LEU A CD1   1 
ATOM   2323 C  CD2   . LEU E 3 141 ? 25.928  18.624  9.531   1.00 16.01 ? 133  LEU A CD2   1 
ATOM   2324 N  N     . GLU E 3 142 ? 23.280  20.941  5.447   1.00 15.79 ? 134  GLU A N     1 
ATOM   2325 C  CA    . GLU E 3 142 ? 23.412  22.276  4.865   1.00 16.27 ? 134  GLU A CA    1 
ATOM   2326 C  C     . GLU E 3 142 ? 22.052  22.912  4.657   1.00 16.14 ? 134  GLU A C     1 
ATOM   2327 O  O     . GLU E 3 142 ? 21.839  24.059  5.042   1.00 16.33 ? 134  GLU A O     1 
ATOM   2328 C  CB    . GLU E 3 142 ? 24.119  22.201  3.493   1.00 16.56 ? 134  GLU A CB    1 
ATOM   2329 C  CG    . GLU E 3 142 ? 25.566  22.673  3.455   1.00 17.95 ? 134  GLU A CG    1 
ATOM   2330 C  CD    . GLU E 3 142 ? 26.107  22.799  2.029   1.00 20.10 ? 134  GLU A CD    1 
ATOM   2331 O  OE1   . GLU E 3 142 ? 25.361  23.276  1.136   1.00 21.65 ? 134  GLU A OE1   1 
ATOM   2332 O  OE2   . GLU E 3 142 ? 27.280  22.428  1.795   1.00 20.43 ? 134  GLU A OE2   1 
ATOM   2333 N  N     . LYS E 3 143 ? 21.145  22.162  4.033   1.00 16.01 ? 135  LYS A N     1 
ATOM   2334 C  CA    . LYS E 3 143 ? 19.864  22.696  3.578   1.00 16.15 ? 135  LYS A CA    1 
ATOM   2335 C  C     . LYS E 3 143 ? 18.779  22.639  4.649   1.00 16.07 ? 135  LYS A C     1 
ATOM   2336 O  O     . LYS E 3 143 ? 18.033  23.592  4.815   1.00 16.47 ? 135  LYS A O     1 
ATOM   2337 C  CB    . LYS E 3 143 ? 19.377  21.943  2.336   1.00 16.36 ? 135  LYS A CB    1 
ATOM   2338 C  CG    . LYS E 3 143 ? 20.344  21.967  1.144   1.00 16.87 ? 135  LYS A CG    1 
ATOM   2339 C  CD    . LYS E 3 143 ? 20.225  23.257  0.315   1.00 17.54 ? 135  LYS A CD    1 
ATOM   2340 C  CE    . LYS E 3 143 ? 21.582  23.719  -0.249  1.00 17.74 ? 135  LYS A CE    1 
ATOM   2341 N  NZ    . LYS E 3 143 ? 21.474  24.169  -1.668  1.00 18.11 ? 135  LYS A NZ    1 
ATOM   2342 N  N     . GLU E 3 144 ? 18.688  21.529  5.371   1.00 15.95 ? 136  GLU A N     1 
ATOM   2343 C  CA    . GLU E 3 144 ? 17.583  21.299  6.301   1.00 15.89 ? 136  GLU A CA    1 
ATOM   2344 C  C     . GLU E 3 144 ? 17.999  21.209  7.766   1.00 15.75 ? 136  GLU A C     1 
ATOM   2345 O  O     . GLU E 3 144 ? 17.166  20.986  8.640   1.00 15.65 ? 136  GLU A O     1 
ATOM   2346 C  CB    . GLU E 3 144 ? 16.869  20.018  5.901   1.00 16.02 ? 136  GLU A CB    1 
ATOM   2347 C  CG    . GLU E 3 144 ? 16.369  20.022  4.468   1.00 16.56 ? 136  GLU A CG    1 
ATOM   2348 C  CD    . GLU E 3 144 ? 15.241  21.010  4.264   1.00 17.47 ? 136  GLU A CD    1 
ATOM   2349 O  OE1   . GLU E 3 144 ? 14.330  21.012  5.118   1.00 18.09 ? 136  GLU A OE1   1 
ATOM   2350 O  OE2   . GLU E 3 144 ? 15.268  21.775  3.265   1.00 16.96 ? 136  GLU A OE2   1 
ATOM   2351 N  N     . LYS E 3 145 ? 19.286  21.385  8.037   1.00 15.74 ? 137  LYS A N     1 
ATOM   2352 C  CA    . LYS E 3 145 ? 19.822  21.255  9.398   1.00 15.60 ? 137  LYS A CA    1 
ATOM   2353 C  C     . LYS E 3 145 ? 19.423  19.929  10.079  1.00 14.77 ? 137  LYS A C     1 
ATOM   2354 O  O     . LYS E 3 145 ? 19.265  19.886  11.290  1.00 14.57 ? 137  LYS A O     1 
ATOM   2355 C  CB    . LYS E 3 145 ? 19.407  22.464  10.254  1.00 15.70 ? 137  LYS A CB    1 
ATOM   2356 C  CG    . LYS E 3 145 ? 19.808  23.817  9.670   1.00 16.32 ? 137  LYS A CG    1 
ATOM   2357 C  CD    . LYS E 3 145 ? 21.304  24.099  9.873   1.00 17.82 ? 137  LYS A CD    1 
ATOM   2358 C  CE    . LYS E 3 145 ? 21.890  25.008  8.771   1.00 18.51 ? 137  LYS A CE    1 
ATOM   2359 N  NZ    . LYS E 3 145 ? 23.124  24.438  8.156   1.00 18.56 ? 137  LYS A NZ    1 
ATOM   2360 N  N     . ILE E 3 146 ? 19.295  18.863  9.283   1.00 14.07 ? 138  ILE A N     1 
ATOM   2361 C  CA    . ILE E 3 146 ? 18.949  17.520  9.762   1.00 13.53 ? 138  ILE A CA    1 
ATOM   2362 C  C     . ILE E 3 146 ? 20.146  16.565  9.639   1.00 13.41 ? 138  ILE A C     1 
ATOM   2363 O  O     . ILE E 3 146 ? 20.722  16.397  8.562   1.00 13.33 ? 138  ILE A O     1 
ATOM   2364 C  CB    . ILE E 3 146 ? 17.762  16.953  8.940   1.00 13.24 ? 138  ILE A CB    1 
ATOM   2365 C  CG1   . ILE E 3 146 ? 16.485  17.743  9.205   1.00 12.91 ? 138  ILE A CG1   1 
ATOM   2366 C  CG2   . ILE E 3 146 ? 17.534  15.472  9.230   1.00 13.16 ? 138  ILE A CG2   1 
ATOM   2367 C  CD1   . ILE E 3 146 ? 15.865  17.511  10.577  1.00 13.06 ? 138  ILE A CD1   1 
ATOM   2368 N  N     . THR E 3 147 ? 20.509  15.934  10.746  1.00 13.18 ? 139  THR A N     1 
ATOM   2369 C  CA    . THR E 3 147 ? 21.495  14.865  10.734  1.00 13.09 ? 139  THR A CA    1 
ATOM   2370 C  C     . THR E 3 147 ? 20.836  13.572  10.284  1.00 13.20 ? 139  THR A C     1 
ATOM   2371 O  O     . THR E 3 147 ? 19.653  13.340  10.540  1.00 13.76 ? 139  THR A O     1 
ATOM   2372 C  CB    . THR E 3 147 ? 22.111  14.662  12.141  1.00 13.11 ? 139  THR A CB    1 
ATOM   2373 O  OG1   . THR E 3 147 ? 21.080  14.325  13.091  1.00 14.00 ? 139  THR A OG1   1 
ATOM   2374 C  CG2   . THR E 3 147 ? 22.746  15.955  12.672  1.00 12.20 ? 139  THR A CG2   1 
ATOM   2375 N  N     . VAL E 3 148 ? 21.611  12.724  9.622   1.00 13.17 ? 140  VAL A N     1 
ATOM   2376 C  CA    . VAL E 3 148 ? 21.153  11.400  9.207   1.00 13.08 ? 140  VAL A CA    1 
ATOM   2377 C  C     . VAL E 3 148 ? 22.266  10.382  9.391   1.00 13.12 ? 140  VAL A C     1 
ATOM   2378 O  O     . VAL E 3 148 ? 23.438  10.733  9.584   1.00 13.29 ? 140  VAL A O     1 
ATOM   2379 C  CB    . VAL E 3 148 ? 20.730  11.370  7.719   1.00 13.05 ? 140  VAL A CB    1 
ATOM   2380 C  CG1   . VAL E 3 148 ? 19.749  12.492  7.411   1.00 13.20 ? 140  VAL A CG1   1 
ATOM   2381 C  CG2   . VAL E 3 148 ? 21.950  11.451  6.807   1.00 13.05 ? 140  VAL A CG2   1 
ATOM   2382 N  N     . THR E 3 149 ? 21.897  9.114   9.312   1.00 12.78 ? 141  THR A N     1 
ATOM   2383 C  CA    . THR E 3 149 ? 22.872  8.046   9.307   1.00 12.83 ? 141  THR A CA    1 
ATOM   2384 C  C     . THR E 3 149 ? 22.905  7.392   7.927   1.00 12.58 ? 141  THR A C     1 
ATOM   2385 O  O     . THR E 3 149 ? 21.857  7.118   7.338   1.00 12.85 ? 141  THR A O     1 
ATOM   2386 C  CB    . THR E 3 149 ? 22.525  7.042   10.389  1.00 12.64 ? 141  THR A CB    1 
ATOM   2387 O  OG1   . THR E 3 149 ? 22.674  7.670   11.661  1.00 13.81 ? 141  THR A OG1   1 
ATOM   2388 C  CG2   . THR E 3 149 ? 23.533  5.925   10.439  1.00 12.95 ? 141  THR A CG2   1 
ATOM   2389 N  N     . VAL E 3 150 ? 24.106  7.168   7.409   1.00 12.08 ? 142  VAL A N     1 
ATOM   2390 C  CA    . VAL E 3 150 ? 24.272  6.540   6.113   1.00 12.08 ? 142  VAL A CA    1 
ATOM   2391 C  C     . VAL E 3 150 ? 24.834  5.143   6.327   1.00 12.46 ? 142  VAL A C     1 
ATOM   2392 O  O     . VAL E 3 150 ? 25.775  4.966   7.091   1.00 12.69 ? 142  VAL A O     1 
ATOM   2393 C  CB    . VAL E 3 150 ? 25.218  7.363   5.220   1.00 11.91 ? 142  VAL A CB    1 
ATOM   2394 C  CG1   . VAL E 3 150 ? 25.531  6.625   3.922   1.00 11.25 ? 142  VAL A CG1   1 
ATOM   2395 C  CG2   . VAL E 3 150 ? 24.609  8.744   4.935   1.00 11.79 ? 142  VAL A CG2   1 
ATOM   2396 N  N     . GLY E 3 151 ? 24.241  4.156   5.666   1.00 12.72 ? 143  GLY A N     1 
ATOM   2397 C  CA    . GLY E 3 151 ? 24.759  2.798   5.651   1.00 12.86 ? 143  GLY A CA    1 
ATOM   2398 C  C     . GLY E 3 151 ? 24.960  2.330   4.223   1.00 12.88 ? 143  GLY A C     1 
ATOM   2399 O  O     . GLY E 3 151 ? 24.096  2.527   3.382   1.00 12.43 ? 143  GLY A O     1 
ATOM   2400 N  N     . ILE E 3 152 ? 26.110  1.722   3.944   1.00 13.33 ? 144  ILE A N     1 
ATOM   2401 C  CA    . ILE E 3 152 ? 26.437  1.252   2.596   1.00 13.33 ? 144  ILE A CA    1 
ATOM   2402 C  C     . ILE E 3 152 ? 26.766  -0.246  2.619   1.00 13.23 ? 144  ILE A C     1 
ATOM   2403 O  O     . ILE E 3 152 ? 27.562  -0.686  3.436   1.00 13.08 ? 144  ILE A O     1 
ATOM   2404 C  CB    . ILE E 3 152 ? 27.618  2.073   2.014   1.00 13.29 ? 144  ILE A CB    1 
ATOM   2405 C  CG1   . ILE E 3 152 ? 27.189  3.518   1.721   1.00 13.26 ? 144  ILE A CG1   1 
ATOM   2406 C  CG2   . ILE E 3 152 ? 28.136  1.433   0.724   1.00 13.86 ? 144  ILE A CG2   1 
ATOM   2407 C  CD1   . ILE E 3 152 ? 28.251  4.565   1.992   1.00 12.58 ? 144  ILE A CD1   1 
ATOM   2408 N  N     . SER E 3 153 ? 26.130  -1.018  1.738   1.00 13.24 ? 145  SER A N     1 
ATOM   2409 C  CA    . SER E 3 153 ? 26.445  -2.444  1.563   1.00 13.35 ? 145  SER A CA    1 
ATOM   2410 C  C     . SER E 3 153 ? 26.141  -2.945  0.143   1.00 13.22 ? 145  SER A C     1 
ATOM   2411 O  O     . SER E 3 153 ? 25.900  -2.145  -0.760  1.00 13.12 ? 145  SER A O     1 
ATOM   2412 C  CB    . SER E 3 153 ? 25.683  -3.284  2.585   1.00 13.41 ? 145  SER A CB    1 
ATOM   2413 O  OG    . SER E 3 153 ? 26.426  -4.442  2.925   1.00 13.88 ? 145  SER A OG    1 
ATOM   2414 N  N     . LYS E 3 154 ? 26.163  -4.264  -0.046  1.00 13.15 ? 146  LYS A N     1 
ATOM   2415 C  CA    . LYS E 3 154 ? 25.848  -4.886  -1.341  1.00 13.27 ? 146  LYS A CA    1 
ATOM   2416 C  C     . LYS E 3 154 ? 24.347  -5.082  -1.606  1.00 13.13 ? 146  LYS A C     1 
ATOM   2417 O  O     . LYS E 3 154 ? 23.958  -5.396  -2.729  1.00 13.04 ? 146  LYS A O     1 
ATOM   2418 C  CB    . LYS E 3 154 ? 26.547  -6.239  -1.457  1.00 13.45 ? 146  LYS A CB    1 
ATOM   2419 C  CG    . LYS E 3 154 ? 25.897  -7.356  -0.628  1.00 14.24 ? 146  LYS A CG    1 
ATOM   2420 C  CD    . LYS E 3 154 ? 26.844  -8.532  -0.378  1.00 14.66 ? 146  LYS A CD    1 
ATOM   2421 C  CE    . LYS E 3 154 ? 26.734  -9.577  -1.477  1.00 15.15 ? 146  LYS A CE    1 
ATOM   2422 N  NZ    . LYS E 3 154 ? 27.969  -10.403 -1.562  1.00 15.42 ? 146  LYS A NZ    1 
ATOM   2423 N  N     . ASN E 3 155 ? 23.519  -4.930  -0.573  1.00 13.07 ? 147  ASN A N     1 
ATOM   2424 C  CA    . ASN E 3 155 ? 22.064  -5.046  -0.706  1.00 12.91 ? 147  ASN A CA    1 
ATOM   2425 C  C     . ASN E 3 155 ? 21.306  -4.208  0.320   1.00 12.79 ? 147  ASN A C     1 
ATOM   2426 O  O     . ASN E 3 155 ? 21.873  -3.765  1.320   1.00 12.95 ? 147  ASN A O     1 
ATOM   2427 C  CB    . ASN E 3 155 ? 21.627  -6.505  -0.601  1.00 12.92 ? 147  ASN A CB    1 
ATOM   2428 C  CG    . ASN E 3 155 ? 21.967  -7.129  0.741   1.00 13.71 ? 147  ASN A CG    1 
ATOM   2429 O  OD1   . ASN E 3 155 ? 21.203  -7.037  1.697   1.00 15.12 ? 147  ASN A OD1   1 
ATOM   2430 N  ND2   . ASN E 3 155 ? 23.118  -7.778  0.814   1.00 14.97 ? 147  ASN A ND2   1 
ATOM   2431 N  N     . LYS E 3 156 ? 20.020  -3.999  0.060   1.00 12.54 ? 148  LYS A N     1 
ATOM   2432 C  CA    . LYS E 3 156 ? 19.182  -3.141  0.886   1.00 12.47 ? 148  LYS A CA    1 
ATOM   2433 C  C     . LYS E 3 156 ? 19.276  -3.495  2.363   1.00 12.54 ? 148  LYS A C     1 
ATOM   2434 O  O     . LYS E 3 156 ? 19.417  -2.618  3.205   1.00 12.53 ? 148  LYS A O     1 
ATOM   2435 C  CB    . LYS E 3 156 ? 17.718  -3.223  0.434   1.00 12.61 ? 148  LYS A CB    1 
ATOM   2436 C  CG    . LYS E 3 156 ? 17.395  -2.399  -0.814  1.00 12.55 ? 148  LYS A CG    1 
ATOM   2437 C  CD    . LYS E 3 156 ? 15.895  -2.178  -0.979  1.00 13.35 ? 148  LYS A CD    1 
ATOM   2438 C  CE    . LYS E 3 156 ? 15.187  -3.406  -1.553  1.00 13.81 ? 148  LYS A CE    1 
ATOM   2439 N  NZ    . LYS E 3 156 ? 13.845  -3.062  -2.114  1.00 14.67 ? 148  LYS A NZ    1 
ATOM   2440 N  N     . VAL E 3 157 ? 19.208  -4.782  2.677   1.00 12.72 ? 149  VAL A N     1 
ATOM   2441 C  CA    . VAL E 3 157 ? 19.177  -5.221  4.072   1.00 12.96 ? 149  VAL A CA    1 
ATOM   2442 C  C     . VAL E 3 157 ? 20.469  -4.939  4.855   1.00 13.27 ? 149  VAL A C     1 
ATOM   2443 O  O     . VAL E 3 157 ? 20.418  -4.463  5.984   1.00 13.37 ? 149  VAL A O     1 
ATOM   2444 C  CB    . VAL E 3 157 ? 18.820  -6.707  4.174   1.00 12.78 ? 149  VAL A CB    1 
ATOM   2445 C  CG1   . VAL E 3 157 ? 19.056  -7.221  5.587   1.00 12.78 ? 149  VAL A CG1   1 
ATOM   2446 C  CG2   . VAL E 3 157 ? 17.373  -6.919  3.740   1.00 12.26 ? 149  VAL A CG2   1 
ATOM   2447 N  N     . PHE E 3 158 ? 21.622  -5.223  4.275   1.00 13.62 ? 150  PHE A N     1 
ATOM   2448 C  CA    . PHE E 3 158 ? 22.859  -5.016  5.017   1.00 14.05 ? 150  PHE A CA    1 
ATOM   2449 C  C     . PHE E 3 158 ? 23.265  -3.548  5.048   1.00 14.20 ? 150  PHE A C     1 
ATOM   2450 O  O     . PHE E 3 158 ? 23.975  -3.131  5.950   1.00 14.34 ? 150  PHE A O     1 
ATOM   2451 C  CB    . PHE E 3 158 ? 23.970  -5.922  4.491   1.00 14.08 ? 150  PHE A CB    1 
ATOM   2452 C  CG    . PHE E 3 158 ? 23.881  -7.326  5.026   1.00 14.77 ? 150  PHE A CG    1 
ATOM   2453 C  CD1   . PHE E 3 158 ? 24.387  -7.637  6.283   1.00 14.93 ? 150  PHE A CD1   1 
ATOM   2454 C  CD2   . PHE E 3 158 ? 23.245  -8.323  4.301   1.00 15.14 ? 150  PHE A CD2   1 
ATOM   2455 C  CE1   . PHE E 3 158 ? 24.295  -8.917  6.786   1.00 14.72 ? 150  PHE A CE1   1 
ATOM   2456 C  CE2   . PHE E 3 158 ? 23.145  -9.605  4.807   1.00 15.05 ? 150  PHE A CE2   1 
ATOM   2457 C  CZ    . PHE E 3 158 ? 23.678  -9.901  6.051   1.00 14.88 ? 150  PHE A CZ    1 
ATOM   2458 N  N     . ALA E 3 159 ? 22.796  -2.770  4.076   1.00 14.34 ? 151  ALA A N     1 
ATOM   2459 C  CA    . ALA E 3 159 ? 22.900  -1.312  4.115   1.00 14.26 ? 151  ALA A CA    1 
ATOM   2460 C  C     . ALA E 3 159 ? 22.069  -0.706  5.268   1.00 14.40 ? 151  ALA A C     1 
ATOM   2461 O  O     . ALA E 3 159 ? 22.480  0.268   5.890   1.00 14.42 ? 151  ALA A O     1 
ATOM   2462 C  CB    . ALA E 3 159 ? 22.455  -0.738  2.797   1.00 14.26 ? 151  ALA A CB    1 
ATOM   2463 N  N     . LYS E 3 160 ? 20.910  -1.289  5.557   1.00 14.33 ? 152  LYS A N     1 
ATOM   2464 C  CA    . LYS E 3 160 ? 20.089  -0.831  6.674   1.00 14.49 ? 152  LYS A CA    1 
ATOM   2465 C  C     . LYS E 3 160 ? 20.688  -1.242  8.038   1.00 14.44 ? 152  LYS A C     1 
ATOM   2466 O  O     . LYS E 3 160 ? 20.577  -0.486  9.005   1.00 14.57 ? 152  LYS A O     1 
ATOM   2467 C  CB    . LYS E 3 160 ? 18.647  -1.341  6.537   1.00 14.48 ? 152  LYS A CB    1 
ATOM   2468 C  CG    . LYS E 3 160 ? 17.682  -0.741  7.559   1.00 15.03 ? 152  LYS A CG    1 
ATOM   2469 C  CD    . LYS E 3 160 ? 16.232  -1.218  7.354   1.00 15.90 ? 152  LYS A CD    1 
ATOM   2470 C  CE    . LYS E 3 160 ? 15.343  -0.932  8.563   1.00 15.94 ? 152  LYS A CE    1 
ATOM   2471 N  NZ    . LYS E 3 160 ? 15.019  0.514   8.718   1.00 14.90 ? 152  LYS A NZ    1 
ATOM   2472 N  N     . ILE E 3 161 ? 21.310  -2.425  8.115   1.00 13.98 ? 153  ILE A N     1 
ATOM   2473 C  CA    . ILE E 3 161 ? 21.984  -2.875  9.342   1.00 13.44 ? 153  ILE A CA    1 
ATOM   2474 C  C     . ILE E 3 161 ? 23.191  -1.993  9.618   1.00 13.77 ? 153  ILE A C     1 
ATOM   2475 O  O     . ILE E 3 161 ? 23.540  -1.763  10.768  1.00 13.54 ? 153  ILE A O     1 
ATOM   2476 C  CB    . ILE E 3 161 ? 22.437  -4.365  9.235   1.00 13.22 ? 153  ILE A CB    1 
ATOM   2477 C  CG1   . ILE E 3 161 ? 21.244  -5.308  9.348   1.00 11.37 ? 153  ILE A CG1   1 
ATOM   2478 C  CG2   . ILE E 3 161 ? 23.471  -4.727  10.314  1.00 13.00 ? 153  ILE A CG2   1 
ATOM   2479 C  CD1   . ILE E 3 161 ? 21.441  -6.614  8.657   1.00 10.20 ? 153  ILE A CD1   1 
ATOM   2480 N  N     . ALA E 3 162 ? 23.833  -1.512  8.555   1.00 14.47 ? 154  ALA A N     1 
ATOM   2481 C  CA    . ALA E 3 162 ? 25.019  -0.667  8.685   1.00 14.88 ? 154  ALA A CA    1 
ATOM   2482 C  C     . ALA E 3 162 ? 24.643  0.656   9.330   1.00 15.31 ? 154  ALA A C     1 
ATOM   2483 O  O     . ALA E 3 162 ? 25.378  1.184   10.164  1.00 15.43 ? 154  ALA A O     1 
ATOM   2484 C  CB    . ALA E 3 162 ? 25.658  -0.431  7.346   1.00 14.76 ? 154  ALA A CB    1 
ATOM   2485 N  N     . ALA E 3 163 ? 23.486  1.183   8.953   1.00 15.68 ? 155  ALA A N     1 
ATOM   2486 C  CA    . ALA E 3 163 ? 22.997  2.408   9.554   1.00 15.98 ? 155  ALA A CA    1 
ATOM   2487 C  C     . ALA E 3 163 ? 22.643  2.185   11.022  1.00 16.30 ? 155  ALA A C     1 
ATOM   2488 O  O     . ALA E 3 163 ? 22.884  3.048   11.856  1.00 16.14 ? 155  ALA A O     1 
ATOM   2489 C  CB    . ALA E 3 163 ? 21.802  2.920   8.786   1.00 16.11 ? 155  ALA A CB    1 
ATOM   2490 N  N     . ASP E 3 164 ? 22.088  1.020   11.340  1.00 16.96 ? 156  ASP A N     1 
ATOM   2491 C  CA    . ASP E 3 164 ? 21.667  0.716   12.716  1.00 17.53 ? 156  ASP A CA    1 
ATOM   2492 C  C     . ASP E 3 164 ? 22.826  0.654   13.711  1.00 17.77 ? 156  ASP A C     1 
ATOM   2493 O  O     . ASP E 3 164 ? 22.674  1.044   14.862  1.00 18.33 ? 156  ASP A O     1 
ATOM   2494 C  CB    . ASP E 3 164 ? 20.877  -0.589  12.769  1.00 17.57 ? 156  ASP A CB    1 
ATOM   2495 C  CG    . ASP E 3 164 ? 19.486  -0.454  12.172  1.00 19.04 ? 156  ASP A CG    1 
ATOM   2496 O  OD1   . ASP E 3 164 ? 18.899  0.655   12.230  1.00 20.11 ? 156  ASP A OD1   1 
ATOM   2497 O  OD2   . ASP E 3 164 ? 18.898  -1.411  11.620  1.00 21.51 ? 156  ASP A OD2   1 
ATOM   2498 N  N     . MET E 3 165 ? 23.978  0.180   13.256  1.00 18.08 ? 157  MET A N     1 
ATOM   2499 C  CA    . MET E 3 165 ? 25.163  0.062   14.094  1.00 18.15 ? 157  MET A CA    1 
ATOM   2500 C  C     . MET E 3 165 ? 25.828  1.412   14.309  1.00 18.30 ? 157  MET A C     1 
ATOM   2501 O  O     . MET E 3 165 ? 26.429  1.666   15.348  1.00 18.29 ? 157  MET A O     1 
ATOM   2502 C  CB    . MET E 3 165 ? 26.163  -0.896  13.445  1.00 18.31 ? 157  MET A CB    1 
ATOM   2503 C  CG    . MET E 3 165 ? 25.664  -2.336  13.321  1.00 18.45 ? 157  MET A CG    1 
ATOM   2504 S  SD    . MET E 3 165 ? 26.732  -3.298  12.245  1.00 19.12 ? 157  MET A SD    1 
ATOM   2505 C  CE    . MET E 3 165 ? 26.364  -5.006  12.847  1.00 19.73 ? 157  MET A CE    1 
ATOM   2506 N  N     . ALA E 3 166 ? 25.718  2.278   13.315  1.00 18.76 ? 158  ALA A N     1 
ATOM   2507 C  CA    . ALA E 3 166 ? 26.352  3.585   13.366  1.00 18.95 ? 158  ALA A CA    1 
ATOM   2508 C  C     . ALA E 3 166 ? 25.404  4.684   13.819  1.00 19.07 ? 158  ALA A C     1 
ATOM   2509 O  O     . ALA E 3 166 ? 25.782  5.843   13.786  1.00 18.74 ? 158  ALA A O     1 
ATOM   2510 C  CB    . ALA E 3 166 ? 26.930  3.929   11.998  1.00 19.09 ? 158  ALA A CB    1 
ATOM   2511 N  N     . LYS E 3 167 ? 24.185  4.338   14.238  1.00 19.81 ? 159  LYS A N     1 
ATOM   2512 C  CA    . LYS E 3 167 ? 23.185  5.346   14.640  1.00 20.33 ? 159  LYS A CA    1 
ATOM   2513 C  C     . LYS E 3 167 ? 23.853  6.467   15.461  1.00 20.51 ? 159  LYS A C     1 
ATOM   2514 O  O     . LYS E 3 167 ? 25.025  6.340   15.829  1.00 21.15 ? 159  LYS A O     1 
ATOM   2515 C  CB    . LYS E 3 167 ? 21.990  4.689   15.352  1.00 20.52 ? 159  LYS A CB    1 
ATOM   2516 C  CG    . LYS E 3 167 ? 20.899  4.207   14.377  1.00 21.24 ? 159  LYS A CG    1 
ATOM   2517 C  CD    . LYS E 3 167 ? 19.540  3.980   15.062  1.00 22.08 ? 159  LYS A CD    1 
ATOM   2518 C  CE    . LYS E 3 167 ? 18.382  3.915   14.048  1.00 22.86 ? 159  LYS A CE    1 
ATOM   2519 N  NZ    . LYS E 3 167 ? 17.446  2.746   14.251  1.00 23.45 ? 159  LYS A NZ    1 
ATOM   2520 N  N     . PRO E 3 168 ? 23.082  7.430   15.940  1.00 20.15 ? 160  PRO A N     1 
ATOM   2521 C  CA    . PRO E 3 168 ? 23.137  8.856   15.580  1.00 19.66 ? 160  PRO A CA    1 
ATOM   2522 C  C     . PRO E 3 168 ? 24.285  9.350   14.700  1.00 19.07 ? 160  PRO A C     1 
ATOM   2523 O  O     . PRO E 3 168 ? 25.426  8.935   14.857  1.00 18.74 ? 160  PRO A O     1 
ATOM   2524 C  CB    . PRO E 3 168 ? 23.173  9.562   16.950  1.00 19.41 ? 160  PRO A CB    1 
ATOM   2525 C  CG    . PRO E 3 168 ? 22.990  8.452   17.954  1.00 20.23 ? 160  PRO A CG    1 
ATOM   2526 C  CD    . PRO E 3 168 ? 22.375  7.265   17.203  1.00 20.51 ? 160  PRO A CD    1 
ATOM   2527 N  N     . ASN E 3 169 ? 23.942  10.254  13.785  1.00 18.63 ? 161  ASN A N     1 
ATOM   2528 C  CA    . ASN E 3 169 ? 24.903  11.035  13.014  1.00 18.60 ? 161  ASN A CA    1 
ATOM   2529 C  C     . ASN E 3 169 ? 26.099  10.244  12.472  1.00 18.19 ? 161  ASN A C     1 
ATOM   2530 O  O     . ASN E 3 169 ? 27.207  10.758  12.412  1.00 18.56 ? 161  ASN A O     1 
ATOM   2531 C  CB    . ASN E 3 169 ? 25.390  12.211  13.867  1.00 18.73 ? 161  ASN A CB    1 
ATOM   2532 C  CG    . ASN E 3 169 ? 26.099  13.297  13.038  1.00 20.00 ? 161  ASN A CG    1 
ATOM   2533 O  OD1   . ASN E 3 169 ? 26.277  13.159  11.815  1.00 20.97 ? 161  ASN A OD1   1 
ATOM   2534 N  ND2   . ASN E 3 169 ? 26.515  14.378  13.709  1.00 19.94 ? 161  ASN A ND2   1 
ATOM   2535 N  N     . GLY E 3 170 ? 25.866  9.006   12.056  1.00 17.71 ? 162  GLY A N     1 
ATOM   2536 C  CA    . GLY E 3 170 ? 26.943  8.112   11.688  1.00 17.32 ? 162  GLY A CA    1 
ATOM   2537 C  C     . GLY E 3 170 ? 27.059  7.804   10.211  1.00 17.04 ? 162  GLY A C     1 
ATOM   2538 O  O     . GLY E 3 170 ? 26.316  8.324   9.379   1.00 16.96 ? 162  GLY A O     1 
ATOM   2539 N  N     . ILE E 3 171 ? 28.031  6.954   9.904   1.00 16.69 ? 163  ILE A N     1 
ATOM   2540 C  CA    . ILE E 3 171 ? 28.245  6.441   8.557   1.00 16.62 ? 163  ILE A CA    1 
ATOM   2541 C  C     . ILE E 3 171 ? 29.073  5.165   8.661   1.00 16.27 ? 163  ILE A C     1 
ATOM   2542 O  O     . ILE E 3 171 ? 30.002  5.099   9.457   1.00 16.75 ? 163  ILE A O     1 
ATOM   2543 C  CB    . ILE E 3 171 ? 28.913  7.496   7.639   1.00 16.61 ? 163  ILE A CB    1 
ATOM   2544 C  CG1   . ILE E 3 171 ? 28.996  6.969   6.200   1.00 16.83 ? 163  ILE A CG1   1 
ATOM   2545 C  CG2   . ILE E 3 171 ? 30.292  7.888   8.148   1.00 16.90 ? 163  ILE A CG2   1 
ATOM   2546 C  CD1   . ILE E 3 171 ? 29.123  8.053   5.135   1.00 16.37 ? 163  ILE A CD1   1 
ATOM   2547 N  N     . LYS E 3 172 ? 28.714  4.143   7.891   1.00 15.84 ? 164  LYS A N     1 
ATOM   2548 C  CA    . LYS E 3 172 ? 29.310  2.819   8.056   1.00 15.54 ? 164  LYS A CA    1 
ATOM   2549 C  C     . LYS E 3 172 ? 29.111  1.946   6.825   1.00 14.97 ? 164  LYS A C     1 
ATOM   2550 O  O     . LYS E 3 172 ? 27.987  1.707   6.388   1.00 14.58 ? 164  LYS A O     1 
ATOM   2551 C  CB    . LYS E 3 172 ? 28.738  2.122   9.301   1.00 15.67 ? 164  LYS A CB    1 
ATOM   2552 C  CG    . LYS E 3 172 ? 29.205  0.670   9.531   1.00 16.46 ? 164  LYS A CG    1 
ATOM   2553 C  CD    . LYS E 3 172 ? 30.543  0.591   10.280  1.00 17.86 ? 164  LYS A CD    1 
ATOM   2554 C  CE    . LYS E 3 172 ? 30.887  -0.849  10.733  1.00 18.24 ? 164  LYS A CE    1 
ATOM   2555 N  NZ    . LYS E 3 172 ? 32.034  -1.451  9.960   1.00 17.99 ? 164  LYS A NZ    1 
ATOM   2556 N  N     . VAL E 3 173 ? 30.233  1.480   6.281   1.00 14.57 ? 165  VAL A N     1 
ATOM   2557 C  CA    . VAL E 3 173 ? 30.253  0.477   5.225   1.00 14.03 ? 165  VAL A CA    1 
ATOM   2558 C  C     . VAL E 3 173 ? 30.309  -0.940  5.823   1.00 13.77 ? 165  VAL A C     1 
ATOM   2559 O  O     . VAL E 3 173 ? 30.860  -1.156  6.897   1.00 13.58 ? 165  VAL A O     1 
ATOM   2560 C  CB    . VAL E 3 173 ? 31.462  0.692   4.294   1.00 13.72 ? 165  VAL A CB    1 
ATOM   2561 C  CG1   . VAL E 3 173 ? 31.550  -0.414  3.254   1.00 13.88 ? 165  VAL A CG1   1 
ATOM   2562 C  CG2   . VAL E 3 173 ? 31.367  2.035   3.608   1.00 13.20 ? 165  VAL A CG2   1 
ATOM   2563 N  N     . ILE E 3 174 ? 29.717  -1.890  5.111   1.00 13.68 ? 166  ILE A N     1 
ATOM   2564 C  CA    . ILE E 3 174 ? 29.811  -3.306  5.424   1.00 13.78 ? 166  ILE A CA    1 
ATOM   2565 C  C     . ILE E 3 174 ? 30.245  -3.994  4.136   1.00 13.99 ? 166  ILE A C     1 
ATOM   2566 O  O     . ILE E 3 174 ? 29.423  -4.208  3.243   1.00 13.79 ? 166  ILE A O     1 
ATOM   2567 C  CB    . ILE E 3 174 ? 28.445  -3.848  5.916   1.00 13.62 ? 166  ILE A CB    1 
ATOM   2568 C  CG1   . ILE E 3 174 ? 28.121  -3.277  7.286   1.00 13.64 ? 166  ILE A CG1   1 
ATOM   2569 C  CG2   . ILE E 3 174 ? 28.449  -5.370  6.023   1.00 14.00 ? 166  ILE A CG2   1 
ATOM   2570 C  CD1   . ILE E 3 174 ? 26.818  -3.766  7.844   1.00 14.13 ? 166  ILE A CD1   1 
ATOM   2571 N  N     . ASP E 3 175 ? 31.532  -4.322  4.025   1.00 14.50 ? 167  ASP A N     1 
ATOM   2572 C  CA    . ASP E 3 175 ? 32.029  -4.945  2.795   1.00 15.11 ? 167  ASP A CA    1 
ATOM   2573 C  C     . ASP E 3 175 ? 31.637  -6.418  2.755   1.00 15.41 ? 167  ASP A C     1 
ATOM   2574 O  O     . ASP E 3 175 ? 31.060  -6.942  3.713   1.00 15.05 ? 167  ASP A O     1 
ATOM   2575 C  CB    . ASP E 3 175 ? 33.545  -4.715  2.553   1.00 15.13 ? 167  ASP A CB    1 
ATOM   2576 C  CG    . ASP E 3 175 ? 34.436  -5.264  3.658   1.00 15.57 ? 167  ASP A CG    1 
ATOM   2577 O  OD1   . ASP E 3 175 ? 34.211  -6.396  4.141   1.00 16.56 ? 167  ASP A OD1   1 
ATOM   2578 O  OD2   . ASP E 3 175 ? 35.421  -4.623  4.083   1.00 15.67 ? 167  ASP A OD2   1 
ATOM   2579 N  N     . ASP E 3 176 ? 31.933  -7.061  1.630   1.00 15.82 ? 168  ASP A N     1 
ATOM   2580 C  CA    . ASP E 3 176 ? 31.459  -8.415  1.348   1.00 16.26 ? 168  ASP A CA    1 
ATOM   2581 C  C     . ASP E 3 176 ? 31.889  -9.427  2.397   1.00 16.30 ? 168  ASP A C     1 
ATOM   2582 O  O     . ASP E 3 176 ? 31.162  -10.376 2.674   1.00 16.23 ? 168  ASP A O     1 
ATOM   2583 C  CB    . ASP E 3 176 ? 31.946  -8.879  -0.039  1.00 16.47 ? 168  ASP A CB    1 
ATOM   2584 C  CG    . ASP E 3 176 ? 31.041  -8.412  -1.169  1.00 16.76 ? 168  ASP A CG    1 
ATOM   2585 O  OD1   . ASP E 3 176 ? 30.235  -7.476  -0.958  1.00 17.87 ? 168  ASP A OD1   1 
ATOM   2586 O  OD2   . ASP E 3 176 ? 31.072  -8.929  -2.302  1.00 16.55 ? 168  ASP A OD2   1 
ATOM   2587 N  N     . GLU E 3 177 ? 33.067  -9.228  2.972   1.00 16.53 ? 169  GLU A N     1 
ATOM   2588 C  CA    . GLU E 3 177 ? 33.603  -10.186 3.932   1.00 16.78 ? 169  GLU A CA    1 
ATOM   2589 C  C     . GLU E 3 177 ? 32.963  -10.018 5.309   1.00 16.88 ? 169  GLU A C     1 
ATOM   2590 O  O     . GLU E 3 177 ? 32.857  -10.990 6.055   1.00 17.06 ? 169  GLU A O     1 
ATOM   2591 C  CB    . GLU E 3 177 ? 35.135  -10.098 3.999   1.00 16.74 ? 169  GLU A CB    1 
ATOM   2592 C  CG    . GLU E 3 177 ? 35.821  -10.482 2.687   1.00 16.86 ? 169  GLU A CG    1 
ATOM   2593 C  CD    . GLU E 3 177 ? 36.018  -11.982 2.512   1.00 17.33 ? 169  GLU A CD    1 
ATOM   2594 O  OE1   . GLU E 3 177 ? 37.188  -12.427 2.444   1.00 17.15 ? 169  GLU A OE1   1 
ATOM   2595 O  OE2   . GLU E 3 177 ? 35.009  -12.719 2.420   1.00 17.76 ? 169  GLU A OE2   1 
ATOM   2596 N  N     . GLU E 3 178 ? 32.530  -8.800  5.639   1.00 16.95 ? 170  GLU A N     1 
ATOM   2597 C  CA    . GLU E 3 178 ? 31.755  -8.575  6.863   1.00 17.07 ? 170  GLU A CA    1 
ATOM   2598 C  C     . GLU E 3 178 ? 30.292  -9.028  6.706   1.00 16.85 ? 170  GLU A C     1 
ATOM   2599 O  O     . GLU E 3 178 ? 29.642  -9.351  7.691   1.00 17.00 ? 170  GLU A O     1 
ATOM   2600 C  CB    . GLU E 3 178 ? 31.829  -7.110  7.335   1.00 17.23 ? 170  GLU A CB    1 
ATOM   2601 C  CG    . GLU E 3 178 ? 32.048  -6.952  8.845   1.00 18.04 ? 170  GLU A CG    1 
ATOM   2602 C  CD    . GLU E 3 178 ? 31.413  -5.694  9.425   1.00 19.43 ? 170  GLU A CD    1 
ATOM   2603 O  OE1   . GLU E 3 178 ? 31.361  -4.665  8.711   1.00 20.53 ? 170  GLU A OE1   1 
ATOM   2604 O  OE2   . GLU E 3 178 ? 30.962  -5.724  10.598  1.00 18.62 ? 170  GLU A OE2   1 
ATOM   2605 N  N     . VAL E 3 179 ? 29.773  -9.066  5.483   1.00 16.58 ? 171  VAL A N     1 
ATOM   2606 C  CA    . VAL E 3 179 ? 28.467  -9.675  5.257   1.00 16.38 ? 171  VAL A CA    1 
ATOM   2607 C  C     . VAL E 3 179 ? 28.578  -11.148 5.642   1.00 16.47 ? 171  VAL A C     1 
ATOM   2608 O  O     . VAL E 3 179 ? 27.760  -11.659 6.402   1.00 16.26 ? 171  VAL A O     1 
ATOM   2609 C  CB    . VAL E 3 179 ? 27.990  -9.558  3.786   1.00 16.28 ? 171  VAL A CB    1 
ATOM   2610 C  CG1   . VAL E 3 179 ? 26.735  -10.396 3.559   1.00 16.44 ? 171  VAL A CG1   1 
ATOM   2611 C  CG2   . VAL E 3 179 ? 27.717  -8.109  3.408   1.00 16.08 ? 171  VAL A CG2   1 
ATOM   2612 N  N     . LYS E 3 180 ? 29.605  -11.818 5.120   1.00 16.67 ? 172  LYS A N     1 
ATOM   2613 C  CA    . LYS E 3 180 ? 29.852  -13.228 5.419   1.00 16.70 ? 172  LYS A CA    1 
ATOM   2614 C  C     . LYS E 3 180 ? 29.907  -13.440 6.931   1.00 16.40 ? 172  LYS A C     1 
ATOM   2615 O  O     . LYS E 3 180 ? 29.281  -14.360 7.463   1.00 16.28 ? 172  LYS A O     1 
ATOM   2616 C  CB    . LYS E 3 180 ? 31.162  -13.711 4.763   1.00 17.01 ? 172  LYS A CB    1 
ATOM   2617 C  CG    . LYS E 3 180 ? 31.055  -14.118 3.278   1.00 17.59 ? 172  LYS A CG    1 
ATOM   2618 C  CD    . LYS E 3 180 ? 29.844  -15.022 3.006   1.00 18.41 ? 172  LYS A CD    1 
ATOM   2619 C  CE    . LYS E 3 180 ? 30.053  -15.917 1.784   1.00 19.04 ? 172  LYS A CE    1 
ATOM   2620 N  NZ    . LYS E 3 180 ? 28.754  -16.470 1.288   1.00 19.08 ? 172  LYS A NZ    1 
ATOM   2621 N  N     . ARG E 3 181 ? 30.632  -12.552 7.606   1.00 16.01 ? 173  ARG A N     1 
ATOM   2622 C  CA    . ARG E 3 181 ? 30.808  -12.605 9.054   1.00 15.73 ? 173  ARG A CA    1 
ATOM   2623 C  C     . ARG E 3 181 ? 29.504  -12.397 9.816   1.00 15.75 ? 173  ARG A C     1 
ATOM   2624 O  O     . ARG E 3 181 ? 29.282  -13.015 10.848  1.00 15.67 ? 173  ARG A O     1 
ATOM   2625 C  CB    . ARG E 3 181 ? 31.811  -11.538 9.491   1.00 15.48 ? 173  ARG A CB    1 
ATOM   2626 C  CG    . ARG E 3 181 ? 32.491  -11.841 10.798  1.00 15.24 ? 173  ARG A CG    1 
ATOM   2627 C  CD    . ARG E 3 181 ? 33.523  -10.815 11.188  1.00 15.15 ? 173  ARG A CD    1 
ATOM   2628 N  NE    . ARG E 3 181 ? 32.907  -9.506  11.355  1.00 15.66 ? 173  ARG A NE    1 
ATOM   2629 C  CZ    . ARG E 3 181 ? 32.174  -9.139  12.401  1.00 15.61 ? 173  ARG A CZ    1 
ATOM   2630 N  NH1   . ARG E 3 181 ? 31.953  -9.970  13.416  1.00 15.60 ? 173  ARG A NH1   1 
ATOM   2631 N  NH2   . ARG E 3 181 ? 31.657  -7.923  12.437  1.00 15.93 ? 173  ARG A NH2   1 
ATOM   2632 N  N     . LEU E 3 182 ? 28.653  -11.515 9.304   1.00 15.92 ? 174  LEU A N     1 
ATOM   2633 C  CA    . LEU E 3 182 ? 27.415  -11.139 9.983   1.00 15.95 ? 174  LEU A CA    1 
ATOM   2634 C  C     . LEU E 3 182 ? 26.308  -12.188 9.804   1.00 15.86 ? 174  LEU A C     1 
ATOM   2635 O  O     . LEU E 3 182 ? 25.490  -12.388 10.702  1.00 15.88 ? 174  LEU A O     1 
ATOM   2636 C  CB    . LEU E 3 182 ? 26.944  -9.762  9.504   1.00 15.80 ? 174  LEU A CB    1 
ATOM   2637 C  CG    . LEU E 3 182 ? 27.774  -8.556  9.961   1.00 16.17 ? 174  LEU A CG    1 
ATOM   2638 C  CD1   . LEU E 3 182 ? 27.065  -7.255  9.572   1.00 16.66 ? 174  LEU A CD1   1 
ATOM   2639 C  CD2   . LEU E 3 182 ? 28.068  -8.568  11.456  1.00 16.43 ? 174  LEU A CD2   1 
ATOM   2640 N  N     . ILE E 3 183 ? 26.281  -12.855 8.654   1.00 15.65 ? 175  ILE A N     1 
ATOM   2641 C  CA    . ILE E 3 183 ? 25.412  -14.006 8.461   1.00 15.56 ? 175  ILE A CA    1 
ATOM   2642 C  C     . ILE E 3 183 ? 25.706  -15.005 9.579   1.00 15.83 ? 175  ILE A C     1 
ATOM   2643 O  O     . ILE E 3 183 ? 24.794  -15.638 10.111  1.00 15.90 ? 175  ILE A O     1 
ATOM   2644 C  CB    . ILE E 3 183 ? 25.634  -14.634 7.056   1.00 15.50 ? 175  ILE A CB    1 
ATOM   2645 C  CG1   . ILE E 3 183 ? 25.018  -13.741 5.979   1.00 15.77 ? 175  ILE A CG1   1 
ATOM   2646 C  CG2   . ILE E 3 183 ? 25.026  -16.029 6.958   1.00 15.14 ? 175  ILE A CG2   1 
ATOM   2647 C  CD1   . ILE E 3 183 ? 25.503  -14.050 4.582   1.00 15.92 ? 175  ILE A CD1   1 
ATOM   2648 N  N     . ARG E 3 184 ? 26.980  -15.119 9.949   1.00 16.07 ? 176  ARG A N     1 
ATOM   2649 C  CA    . ARG E 3 184 ? 27.406  -16.024 11.016  1.00 16.34 ? 176  ARG A CA    1 
ATOM   2650 C  C     . ARG E 3 184 ? 27.148  -15.495 12.438  1.00 16.40 ? 176  ARG A C     1 
ATOM   2651 O  O     . ARG E 3 184 ? 26.664  -16.243 13.280  1.00 16.71 ? 176  ARG A O     1 
ATOM   2652 C  CB    . ARG E 3 184 ? 28.894  -16.387 10.853  1.00 16.46 ? 176  ARG A CB    1 
ATOM   2653 C  CG    . ARG E 3 184 ? 29.157  -17.486 9.818   1.00 16.72 ? 176  ARG A CG    1 
ATOM   2654 C  CD    . ARG E 3 184 ? 30.592  -18.001 9.778   1.00 17.00 ? 176  ARG A CD    1 
ATOM   2655 N  NE    . ARG E 3 184 ? 31.417  -17.232 8.842   1.00 18.12 ? 176  ARG A NE    1 
ATOM   2656 C  CZ    . ARG E 3 184 ? 32.200  -16.192 9.165   1.00 18.76 ? 176  ARG A CZ    1 
ATOM   2657 N  NH1   . ARG E 3 184 ? 32.300  -15.760 10.424  1.00 19.03 ? 176  ARG A NH1   1 
ATOM   2658 N  NH2   . ARG E 3 184 ? 32.893  -15.571 8.211   1.00 18.52 ? 176  ARG A NH2   1 
ATOM   2659 N  N     . GLU E 3 185 ? 27.429  -14.217 12.698  1.00 16.42 ? 177  GLU A N     1 
ATOM   2660 C  CA    . GLU E 3 185 ? 27.564  -13.714 14.079  1.00 16.54 ? 177  GLU A CA    1 
ATOM   2661 C  C     . GLU E 3 185 ? 26.602  -12.610 14.538  1.00 16.10 ? 177  GLU A C     1 
ATOM   2662 O  O     . GLU E 3 185 ? 26.593  -12.265 15.718  1.00 15.94 ? 177  GLU A O     1 
ATOM   2663 C  CB    . GLU E 3 185 ? 29.010  -13.251 14.312  1.00 16.86 ? 177  GLU A CB    1 
ATOM   2664 C  CG    . GLU E 3 185 ? 29.886  -14.318 14.966  1.00 18.25 ? 177  GLU A CG    1 
ATOM   2665 C  CD    . GLU E 3 185 ? 31.371  -14.125 14.708  1.00 20.25 ? 177  GLU A CD    1 
ATOM   2666 O  OE1   . GLU E 3 185 ? 31.743  -13.159 13.997  1.00 21.73 ? 177  GLU A OE1   1 
ATOM   2667 O  OE2   . GLU E 3 185 ? 32.174  -14.944 15.222  1.00 21.08 ? 177  GLU A OE2   1 
ATOM   2668 N  N     . LEU E 3 186 ? 25.806  -12.054 13.629  1.00 15.90 ? 178  LEU A N     1 
ATOM   2669 C  CA    . LEU E 3 186 ? 24.825  -11.022 13.986  1.00 15.57 ? 178  LEU A CA    1 
ATOM   2670 C  C     . LEU E 3 186 ? 23.601  -11.624 14.684  1.00 15.48 ? 178  LEU A C     1 
ATOM   2671 O  O     . LEU E 3 186 ? 22.953  -12.533 14.156  1.00 14.84 ? 178  LEU A O     1 
ATOM   2672 C  CB    . LEU E 3 186 ? 24.377  -10.243 12.741  1.00 15.53 ? 178  LEU A CB    1 
ATOM   2673 C  CG    . LEU E 3 186 ? 23.229  -9.230  12.877  1.00 15.32 ? 178  LEU A CG    1 
ATOM   2674 C  CD1   . LEU E 3 186 ? 23.638  -8.040  13.738  1.00 15.64 ? 178  LEU A CD1   1 
ATOM   2675 C  CD2   . LEU E 3 186 ? 22.756  -8.765  11.513  1.00 14.78 ? 178  LEU A CD2   1 
ATOM   2676 N  N     . ASP E 3 187 ? 23.299  -11.102 15.873  1.00 15.74 ? 179  ASP A N     1 
ATOM   2677 C  CA    . ASP E 3 187 ? 22.020  -11.343 16.548  1.00 15.96 ? 179  ASP A CA    1 
ATOM   2678 C  C     . ASP E 3 187 ? 20.929  -11.237 15.506  1.00 15.77 ? 179  ASP A C     1 
ATOM   2679 O  O     . ASP E 3 187 ? 20.845  -10.229 14.804  1.00 15.70 ? 179  ASP A O     1 
ATOM   2680 C  CB    . ASP E 3 187 ? 21.784  -10.283 17.631  1.00 16.34 ? 179  ASP A CB    1 
ATOM   2681 C  CG    . ASP E 3 187 ? 20.989  -10.809 18.815  1.00 17.63 ? 179  ASP A CG    1 
ATOM   2682 O  OD1   . ASP E 3 187 ? 19.876  -11.359 18.606  1.00 19.11 ? 179  ASP A OD1   1 
ATOM   2683 O  OD2   . ASP E 3 187 ? 21.402  -10.694 19.995  1.00 18.47 ? 179  ASP A OD2   1 
ATOM   2684 N  N     . ILE E 3 188 ? 20.094  -12.260 15.384  1.00 15.57 ? 180  ILE A N     1 
ATOM   2685 C  CA    . ILE E 3 188 ? 19.134  -12.282 14.288  1.00 15.62 ? 180  ILE A CA    1 
ATOM   2686 C  C     . ILE E 3 188 ? 17.987  -11.301 14.526  1.00 15.54 ? 180  ILE A C     1 
ATOM   2687 O  O     . ILE E 3 188 ? 17.306  -10.919 13.586  1.00 15.49 ? 180  ILE A O     1 
ATOM   2688 C  CB    . ILE E 3 188 ? 18.625  -13.722 13.996  1.00 15.76 ? 180  ILE A CB    1 
ATOM   2689 C  CG1   . ILE E 3 188 ? 18.199  -13.820 12.529  1.00 15.96 ? 180  ILE A CG1   1 
ATOM   2690 C  CG2   . ILE E 3 188 ? 17.478  -14.113 14.931  1.00 15.94 ? 180  ILE A CG2   1 
ATOM   2691 C  CD1   . ILE E 3 188 ? 17.874  -15.206 12.070  1.00 16.48 ? 180  ILE A CD1   1 
ATOM   2692 N  N     . ALA E 3 189 ? 17.801  -10.881 15.778  1.00 15.54 ? 181  ALA A N     1 
ATOM   2693 C  CA    . ALA E 3 189 ? 16.791  -9.879  16.126  1.00 15.54 ? 181  ALA A CA    1 
ATOM   2694 C  C     . ALA E 3 189 ? 17.102  -8.479  15.594  1.00 15.54 ? 181  ALA A C     1 
ATOM   2695 O  O     . ALA E 3 189 ? 16.215  -7.619  15.563  1.00 15.94 ? 181  ALA A O     1 
ATOM   2696 C  CB    . ALA E 3 189 ? 16.594  -9.824  17.636  1.00 15.49 ? 181  ALA A CB    1 
ATOM   2697 N  N     . ASP E 3 190 ? 18.352  -8.249  15.195  1.00 15.50 ? 182  ASP A N     1 
ATOM   2698 C  CA    . ASP E 3 190 ? 18.769  -6.982  14.590  1.00 15.33 ? 182  ASP A CA    1 
ATOM   2699 C  C     . ASP E 3 190 ? 18.657  -6.966  13.062  1.00 15.11 ? 182  ASP A C     1 
ATOM   2700 O  O     . ASP E 3 190 ? 19.027  -5.982  12.427  1.00 15.15 ? 182  ASP A O     1 
ATOM   2701 C  CB    . ASP E 3 190 ? 20.189  -6.642  15.028  1.00 15.34 ? 182  ASP A CB    1 
ATOM   2702 C  CG    . ASP E 3 190 ? 20.317  -6.543  16.540  1.00 16.41 ? 182  ASP A CG    1 
ATOM   2703 O  OD1   . ASP E 3 190 ? 19.287  -6.276  17.202  1.00 18.08 ? 182  ASP A OD1   1 
ATOM   2704 O  OD2   . ASP E 3 190 ? 21.393  -6.728  17.156  1.00 16.74 ? 182  ASP A OD2   1 
ATOM   2705 N  N     . VAL E 3 191 ? 18.133  -8.045  12.479  1.00 14.80 ? 183  VAL A N     1 
ATOM   2706 C  CA    . VAL E 3 191 ? 17.798  -8.072  11.060  1.00 14.54 ? 183  VAL A CA    1 
ATOM   2707 C  C     . VAL E 3 191 ? 16.511  -7.277  10.825  1.00 14.60 ? 183  VAL A C     1 
ATOM   2708 O  O     . VAL E 3 191 ? 15.493  -7.555  11.455  1.00 14.40 ? 183  VAL A O     1 
ATOM   2709 C  CB    . VAL E 3 191 ? 17.583  -9.508  10.566  1.00 14.47 ? 183  VAL A CB    1 
ATOM   2710 C  CG1   . VAL E 3 191 ? 16.964  -9.518  9.170   1.00 14.30 ? 183  VAL A CG1   1 
ATOM   2711 C  CG2   . VAL E 3 191 ? 18.905  -10.275 10.570  1.00 14.59 ? 183  VAL A CG2   1 
ATOM   2712 N  N     . PRO E 3 192 ? 16.544  -6.297  9.924   1.00 14.54 ? 184  PRO A N     1 
ATOM   2713 C  CA    . PRO E 3 192 ? 15.342  -5.531  9.582   1.00 14.57 ? 184  PRO A CA    1 
ATOM   2714 C  C     . PRO E 3 192 ? 14.131  -6.394  9.291   1.00 14.80 ? 184  PRO A C     1 
ATOM   2715 O  O     . PRO E 3 192 ? 14.244  -7.431  8.636   1.00 14.70 ? 184  PRO A O     1 
ATOM   2716 C  CB    . PRO E 3 192 ? 15.761  -4.774  8.331   1.00 14.53 ? 184  PRO A CB    1 
ATOM   2717 C  CG    . PRO E 3 192 ? 17.210  -4.547  8.548   1.00 14.73 ? 184  PRO A CG    1 
ATOM   2718 C  CD    . PRO E 3 192 ? 17.717  -5.820  9.177   1.00 14.42 ? 184  PRO A CD    1 
ATOM   2719 N  N     . GLY E 3 193 ? 12.982  -5.951  9.800   1.00 15.35 ? 185  GLY A N     1 
ATOM   2720 C  CA    . GLY E 3 193 ? 11.726  -6.674  9.688   1.00 15.56 ? 185  GLY A CA    1 
ATOM   2721 C  C     . GLY E 3 193 ? 11.489  -7.698  10.788  1.00 15.84 ? 185  GLY A C     1 
ATOM   2722 O  O     . GLY E 3 193 ? 10.404  -8.276  10.864  1.00 16.01 ? 185  GLY A O     1 
ATOM   2723 N  N     . ILE E 3 194 ? 12.481  -7.918  11.648  1.00 16.04 ? 186  ILE A N     1 
ATOM   2724 C  CA    . ILE E 3 194 ? 12.377  -8.923  12.701  1.00 16.37 ? 186  ILE A CA    1 
ATOM   2725 C  C     . ILE E 3 194 ? 12.205  -8.259  14.068  1.00 16.75 ? 186  ILE A C     1 
ATOM   2726 O  O     . ILE E 3 194 ? 13.180  -7.907  14.750  1.00 17.03 ? 186  ILE A O     1 
ATOM   2727 C  CB    . ILE E 3 194 ? 13.618  -9.849  12.676  1.00 16.42 ? 186  ILE A CB    1 
ATOM   2728 C  CG1   . ILE E 3 194 ? 13.717  -10.566 11.323  1.00 15.88 ? 186  ILE A CG1   1 
ATOM   2729 C  CG2   . ILE E 3 194 ? 13.585  -10.862 13.841  1.00 16.43 ? 186  ILE A CG2   1 
ATOM   2730 C  CD1   . ILE E 3 194 ? 12.528  -11.461 10.994  1.00 15.59 ? 186  ILE A CD1   1 
ATOM   2731 N  N     . GLY E 3 195 ? 10.947  -8.094  14.459  1.00 17.08 ? 187  GLY A N     1 
ATOM   2732 C  CA    . GLY E 3 195 ? 10.604  -7.491  15.736  1.00 17.36 ? 187  GLY A CA    1 
ATOM   2733 C  C     . GLY E 3 195 ? 10.824  -8.428  16.901  1.00 17.74 ? 187  GLY A C     1 
ATOM   2734 O  O     . GLY E 3 195 ? 11.270  -9.569  16.717  1.00 17.94 ? 187  GLY A O     1 
ATOM   2735 N  N     . ASN E 3 196 ? 10.504  -7.951  18.104  1.00 17.99 ? 188  ASN A N     1 
ATOM   2736 C  CA    . ASN E 3 196 ? 10.728  -8.731  19.319  1.00 18.10 ? 188  ASN A CA    1 
ATOM   2737 C  C     . ASN E 3 196 ? 9.849   -9.975  19.397  1.00 18.06 ? 188  ASN A C     1 
ATOM   2738 O  O     . ASN E 3 196 ? 10.293  -10.995 19.919  1.00 18.32 ? 188  ASN A O     1 
ATOM   2739 C  CB    . ASN E 3 196 ? 10.559  -7.868  20.572  1.00 18.28 ? 188  ASN A CB    1 
ATOM   2740 C  CG    . ASN E 3 196 ? 11.590  -6.750  20.649  1.00 19.01 ? 188  ASN A CG    1 
ATOM   2741 O  OD1   . ASN E 3 196 ? 11.374  -5.650  20.139  1.00 20.00 ? 188  ASN A OD1   1 
ATOM   2742 N  ND2   . ASN E 3 196 ? 12.726  -7.038  21.267  1.00 20.25 ? 188  ASN A ND2   1 
ATOM   2743 N  N     . ILE E 3 197 ? 8.628   -9.920  18.867  1.00 17.97 ? 189  ILE A N     1 
ATOM   2744 C  CA    . ILE E 3 197 ? 7.783   -11.121 18.846  1.00 18.08 ? 189  ILE A CA    1 
ATOM   2745 C  C     . ILE E 3 197 ? 8.476   -12.227 18.034  1.00 18.19 ? 189  ILE A C     1 
ATOM   2746 O  O     . ILE E 3 197 ? 8.699   -13.346 18.535  1.00 18.79 ? 189  ILE A O     1 
ATOM   2747 C  CB    . ILE E 3 197 ? 6.341   -10.837 18.282  1.00 18.15 ? 189  ILE A CB    1 
ATOM   2748 C  CG1   . ILE E 3 197 ? 5.558   -9.814  19.140  1.00 17.75 ? 189  ILE A CG1   1 
ATOM   2749 C  CG2   . ILE E 3 197 ? 5.540   -12.134 18.156  1.00 17.58 ? 189  ILE A CG2   1 
ATOM   2750 C  CD1   . ILE E 3 197 ? 5.913   -9.775  20.621  1.00 17.86 ? 189  ILE A CD1   1 
ATOM   2751 N  N     . THR E 3 198 ? 8.834   -11.906 16.795  1.00 17.84 ? 190  THR A N     1 
ATOM   2752 C  CA    . THR E 3 198 ? 9.501   -12.867 15.916  1.00 17.40 ? 190  THR A CA    1 
ATOM   2753 C  C     . THR E 3 198 ? 10.869  -13.313 16.454  1.00 17.32 ? 190  THR A C     1 
ATOM   2754 O  O     . THR E 3 198 ? 11.258  -14.458 16.256  1.00 17.15 ? 190  THR A O     1 
ATOM   2755 C  CB    . THR E 3 198 ? 9.646   -12.303 14.495  1.00 17.04 ? 190  THR A CB    1 
ATOM   2756 O  OG1   . THR E 3 198 ? 8.367   -11.909 13.987  1.00 16.57 ? 190  THR A OG1   1 
ATOM   2757 C  CG2   . THR E 3 198 ? 10.073  -13.385 13.535  1.00 17.51 ? 190  THR A CG2   1 
ATOM   2758 N  N     . ALA E 3 199 ? 11.588  -12.427 17.138  1.00 17.19 ? 191  ALA A N     1 
ATOM   2759 C  CA    . ALA E 3 199 ? 12.882  -12.790 17.712  1.00 17.22 ? 191  ALA A CA    1 
ATOM   2760 C  C     . ALA E 3 199 ? 12.729  -13.847 18.800  1.00 17.53 ? 191  ALA A C     1 
ATOM   2761 O  O     . ALA E 3 199 ? 13.578  -14.724 18.934  1.00 17.53 ? 191  ALA A O     1 
ATOM   2762 C  CB    . ALA E 3 199 ? 13.588  -11.575 18.264  1.00 17.13 ? 191  ALA A CB    1 
ATOM   2763 N  N     . GLU E 3 200 ? 11.644  -13.775 19.567  1.00 17.86 ? 192  GLU A N     1 
ATOM   2764 C  CA    . GLU E 3 200 ? 11.398  -14.766 20.611  1.00 18.14 ? 192  GLU A CA    1 
ATOM   2765 C  C     . GLU E 3 200 ? 10.937  -16.110 20.045  1.00 17.79 ? 192  GLU A C     1 
ATOM   2766 O  O     . GLU E 3 200 ? 11.258  -17.147 20.613  1.00 17.99 ? 192  GLU A O     1 
ATOM   2767 C  CB    . GLU E 3 200 ? 10.399  -14.243 21.656  1.00 18.54 ? 192  GLU A CB    1 
ATOM   2768 C  CG    . GLU E 3 200 ? 10.954  -13.167 22.599  1.00 19.71 ? 192  GLU A CG    1 
ATOM   2769 C  CD    . GLU E 3 200 ? 12.244  -13.570 23.327  1.00 21.35 ? 192  GLU A CD    1 
ATOM   2770 O  OE1   . GLU E 3 200 ? 12.281  -14.647 23.981  1.00 20.26 ? 192  GLU A OE1   1 
ATOM   2771 O  OE2   . GLU E 3 200 ? 13.232  -12.795 23.245  1.00 23.20 ? 192  GLU A OE2   1 
ATOM   2772 N  N     . LYS E 3 201 ? 10.194  -16.103 18.942  1.00 17.53 ? 193  LYS A N     1 
ATOM   2773 C  CA    . LYS E 3 201 ? 9.742   -17.351 18.320  1.00 17.41 ? 193  LYS A CA    1 
ATOM   2774 C  C     . LYS E 3 201 ? 10.924  -18.084 17.689  1.00 17.15 ? 193  LYS A C     1 
ATOM   2775 O  O     . LYS E 3 201 ? 11.022  -19.311 17.772  1.00 17.00 ? 193  LYS A O     1 
ATOM   2776 C  CB    . LYS E 3 201 ? 8.697   -17.085 17.232  1.00 17.70 ? 193  LYS A CB    1 
ATOM   2777 C  CG    . LYS E 3 201 ? 7.385   -16.449 17.688  1.00 17.95 ? 193  LYS A CG    1 
ATOM   2778 C  CD    . LYS E 3 201 ? 6.630   -15.868 16.486  1.00 18.20 ? 193  LYS A CD    1 
ATOM   2779 C  CE    . LYS E 3 201 ? 5.141   -16.187 16.495  1.00 18.55 ? 193  LYS A CE    1 
ATOM   2780 N  NZ    . LYS E 3 201 ? 4.473   -15.688 15.245  1.00 19.25 ? 193  LYS A NZ    1 
ATOM   2781 N  N     . LEU E 3 202 ? 11.801  -17.315 17.043  1.00 16.78 ? 194  LEU A N     1 
ATOM   2782 C  CA    . LEU E 3 202 ? 13.043  -17.828 16.468  1.00 16.59 ? 194  LEU A CA    1 
ATOM   2783 C  C     . LEU E 3 202 ? 13.970  -18.399 17.534  1.00 16.64 ? 194  LEU A C     1 
ATOM   2784 O  O     . LEU E 3 202 ? 14.577  -19.443 17.333  1.00 16.71 ? 194  LEU A O     1 
ATOM   2785 C  CB    . LEU E 3 202 ? 13.780  -16.723 15.702  1.00 16.32 ? 194  LEU A CB    1 
ATOM   2786 C  CG    . LEU E 3 202 ? 13.114  -16.226 14.421  1.00 16.10 ? 194  LEU A CG    1 
ATOM   2787 C  CD1   . LEU E 3 202 ? 13.866  -15.026 13.903  1.00 16.54 ? 194  LEU A CD1   1 
ATOM   2788 C  CD2   . LEU E 3 202 ? 13.042  -17.309 13.358  1.00 15.76 ? 194  LEU A CD2   1 
ATOM   2789 N  N     . LYS E 3 203 ? 14.072  -17.710 18.666  1.00 16.77 ? 195  LYS A N     1 
ATOM   2790 C  CA    . LYS E 3 203 ? 14.909  -18.152 19.777  1.00 16.88 ? 195  LYS A CA    1 
ATOM   2791 C  C     . LYS E 3 203 ? 14.380  -19.459 20.373  1.00 16.63 ? 195  LYS A C     1 
ATOM   2792 O  O     . LYS E 3 203 ? 15.146  -20.246 20.923  1.00 17.06 ? 195  LYS A O     1 
ATOM   2793 C  CB    . LYS E 3 203 ? 14.976  -17.054 20.842  1.00 17.12 ? 195  LYS A CB    1 
ATOM   2794 C  CG    . LYS E 3 203 ? 16.100  -17.202 21.866  1.00 18.47 ? 195  LYS A CG    1 
ATOM   2795 C  CD    . LYS E 3 203 ? 16.574  -15.821 22.388  1.00 19.99 ? 195  LYS A CD    1 
ATOM   2796 C  CE    . LYS E 3 203 ? 17.047  -15.876 23.857  1.00 20.73 ? 195  LYS A CE    1 
ATOM   2797 N  NZ    . LYS E 3 203 ? 17.447  -14.516 24.352  1.00 21.10 ? 195  LYS A NZ    1 
ATOM   2798 N  N     . LYS E 3 204 ? 13.074  -19.689 20.249  1.00 16.26 ? 196  LYS A N     1 
ATOM   2799 C  CA    . LYS E 3 204 ? 12.445  -20.935 20.702  1.00 15.90 ? 196  LYS A CA    1 
ATOM   2800 C  C     . LYS E 3 204 ? 12.729  -22.113 19.769  1.00 15.31 ? 196  LYS A C     1 
ATOM   2801 O  O     . LYS E 3 204 ? 12.681  -23.257 20.191  1.00 15.55 ? 196  LYS A O     1 
ATOM   2802 C  CB    . LYS E 3 204 ? 10.925  -20.754 20.851  1.00 16.04 ? 196  LYS A CB    1 
ATOM   2803 C  CG    . LYS E 3 204 ? 10.454  -20.619 22.296  1.00 16.34 ? 196  LYS A CG    1 
ATOM   2804 C  CD    . LYS E 3 204 ? 10.613  -21.938 23.078  1.00 17.00 ? 196  LYS A CD    1 
ATOM   2805 C  CE    . LYS E 3 204 ? 9.519   -22.136 24.130  1.00 16.78 ? 196  LYS A CE    1 
ATOM   2806 N  NZ    . LYS E 3 204 ? 9.394   -20.974 25.056  1.00 16.27 ? 196  LYS A NZ    1 
ATOM   2807 N  N     . LEU E 3 205 ? 12.990  -21.829 18.499  1.00 14.79 ? 197  LEU A N     1 
ATOM   2808 C  CA    . LEU E 3 205 ? 13.409  -22.840 17.532  1.00 14.40 ? 197  LEU A CA    1 
ATOM   2809 C  C     . LEU E 3 205 ? 14.923  -23.070 17.547  1.00 14.19 ? 197  LEU A C     1 
ATOM   2810 O  O     . LEU E 3 205 ? 15.421  -24.005 16.909  1.00 13.93 ? 197  LEU A O     1 
ATOM   2811 C  CB    . LEU E 3 205 ? 13.006  -22.419 16.121  1.00 14.37 ? 197  LEU A CB    1 
ATOM   2812 C  CG    . LEU E 3 205 ? 11.518  -22.364 15.791  1.00 14.56 ? 197  LEU A CG    1 
ATOM   2813 C  CD1   . LEU E 3 205 ? 11.325  -21.755 14.401  1.00 14.24 ? 197  LEU A CD1   1 
ATOM   2814 C  CD2   . LEU E 3 205 ? 10.887  -23.750 15.880  1.00 14.58 ? 197  LEU A CD2   1 
ATOM   2815 N  N     . GLY E 3 206 ? 15.654  -22.214 18.257  1.00 13.85 ? 198  GLY A N     1 
ATOM   2816 C  CA    . GLY E 3 206 ? 17.102  -22.330 18.341  1.00 13.73 ? 198  GLY A CA    1 
ATOM   2817 C  C     . GLY E 3 206 ? 17.827  -21.626 17.205  1.00 13.43 ? 198  GLY A C     1 
ATOM   2818 O  O     . GLY E 3 206 ? 18.936  -22.009 16.834  1.00 13.23 ? 198  GLY A O     1 
ATOM   2819 N  N     . ILE E 3 207 ? 17.190  -20.598 16.655  1.00 13.20 ? 199  ILE A N     1 
ATOM   2820 C  CA    . ILE E 3 207 ? 17.796  -19.747 15.647  1.00 13.17 ? 199  ILE A CA    1 
ATOM   2821 C  C     . ILE E 3 207 ? 18.181  -18.413 16.284  1.00 13.07 ? 199  ILE A C     1 
ATOM   2822 O  O     . ILE E 3 207 ? 17.325  -17.583 16.572  1.00 12.42 ? 199  ILE A O     1 
ATOM   2823 C  CB    . ILE E 3 207 ? 16.827  -19.547 14.475  1.00 13.20 ? 199  ILE A CB    1 
ATOM   2824 C  CG1   . ILE E 3 207 ? 16.626  -20.878 13.750  1.00 13.53 ? 199  ILE A CG1   1 
ATOM   2825 C  CG2   . ILE E 3 207 ? 17.349  -18.480 13.500  1.00 12.91 ? 199  ILE A CG2   1 
ATOM   2826 C  CD1   . ILE E 3 207 ? 15.384  -20.924 12.909  1.00 14.38 ? 199  ILE A CD1   1 
ATOM   2827 N  N     . ASN E 3 208 ? 19.481  -18.236 16.517  1.00 13.17 ? 200  ASN A N     1 
ATOM   2828 C  CA    . ASN E 3 208 ? 20.017  -17.002 17.094  1.00 13.18 ? 200  ASN A CA    1 
ATOM   2829 C  C     . ASN E 3 208 ? 20.768  -16.141 16.082  1.00 13.20 ? 200  ASN A C     1 
ATOM   2830 O  O     . ASN E 3 208 ? 20.903  -14.947 16.285  1.00 13.28 ? 200  ASN A O     1 
ATOM   2831 C  CB    . ASN E 3 208 ? 20.940  -17.324 18.276  1.00 13.19 ? 200  ASN A CB    1 
ATOM   2832 C  CG    . ASN E 3 208 ? 20.461  -18.517 19.083  1.00 12.46 ? 200  ASN A CG    1 
ATOM   2833 O  OD1   . ASN E 3 208 ? 19.412  -18.466 19.722  1.00 11.78 ? 200  ASN A OD1   1 
ATOM   2834 N  ND2   . ASN E 3 208 ? 21.226  -19.596 19.049  1.00 11.16 ? 200  ASN A ND2   1 
ATOM   2835 N  N     . LYS E 3 209 ? 21.269  -16.759 15.012  1.00 13.23 ? 201  LYS A N     1 
ATOM   2836 C  CA    . LYS E 3 209 ? 21.990  -16.064 13.944  1.00 13.14 ? 201  LYS A CA    1 
ATOM   2837 C  C     . LYS E 3 209 ? 21.369  -16.379 12.582  1.00 13.27 ? 201  LYS A C     1 
ATOM   2838 O  O     . LYS E 3 209 ? 20.659  -17.373 12.425  1.00 13.25 ? 201  LYS A O     1 
ATOM   2839 C  CB    . LYS E 3 209 ? 23.464  -16.475 13.936  1.00 12.99 ? 201  LYS A CB    1 
ATOM   2840 C  CG    . LYS E 3 209 ? 24.052  -16.747 15.308  1.00 13.21 ? 201  LYS A CG    1 
ATOM   2841 C  CD    . LYS E 3 209 ? 24.311  -15.472 16.100  1.00 13.93 ? 201  LYS A CD    1 
ATOM   2842 C  CE    . LYS E 3 209 ? 25.458  -15.667 17.085  1.00 14.63 ? 201  LYS A CE    1 
ATOM   2843 N  NZ    . LYS E 3 209 ? 25.841  -14.414 17.803  1.00 15.49 ? 201  LYS A NZ    1 
ATOM   2844 N  N     . LEU E 3 210 ? 21.638  -15.532 11.594  1.00 13.50 ? 202  LEU A N     1 
ATOM   2845 C  CA    . LEU E 3 210 ? 21.094  -15.739 10.251  1.00 13.68 ? 202  LEU A CA    1 
ATOM   2846 C  C     . LEU E 3 210 ? 21.417  -17.131 9.701   1.00 13.77 ? 202  LEU A C     1 
ATOM   2847 O  O     . LEU E 3 210 ? 20.570  -17.751 9.064   1.00 13.94 ? 202  LEU A O     1 
ATOM   2848 C  CB    . LEU E 3 210 ? 21.619  -14.677 9.276   1.00 13.73 ? 202  LEU A CB    1 
ATOM   2849 C  CG    . LEU E 3 210 ? 20.763  -13.424 9.111   1.00 13.92 ? 202  LEU A CG    1 
ATOM   2850 C  CD1   . LEU E 3 210 ? 21.570  -12.350 8.385   1.00 13.88 ? 202  LEU A CD1   1 
ATOM   2851 C  CD2   . LEU E 3 210 ? 19.443  -13.724 8.378   1.00 13.68 ? 202  LEU A CD2   1 
ATOM   2852 N  N     . VAL E 3 211 ? 22.632  -17.619 9.956   1.00 13.77 ? 203  VAL A N     1 
ATOM   2853 C  CA    . VAL E 3 211 ? 23.097  -18.886 9.383   1.00 13.81 ? 203  VAL A CA    1 
ATOM   2854 C  C     . VAL E 3 211 ? 22.336  -20.099 9.935   1.00 13.78 ? 203  VAL A C     1 
ATOM   2855 O  O     . VAL E 3 211 ? 22.296  -21.154 9.298   1.00 13.80 ? 203  VAL A O     1 
ATOM   2856 C  CB    . VAL E 3 211 ? 24.633  -19.084 9.593   1.00 13.89 ? 203  VAL A CB    1 
ATOM   2857 C  CG1   . VAL E 3 211 ? 24.949  -19.593 11.006  1.00 13.69 ? 203  VAL A CG1   1 
ATOM   2858 C  CG2   . VAL E 3 211 ? 25.209  -20.014 8.533   1.00 13.74 ? 203  VAL A CG2   1 
ATOM   2859 N  N     . ASP E 3 212 ? 21.743  -19.939 11.118  1.00 13.56 ? 204  ASP A N     1 
ATOM   2860 C  CA    . ASP E 3 212 ? 20.959  -20.993 11.750  1.00 13.43 ? 204  ASP A CA    1 
ATOM   2861 C  C     . ASP E 3 212 ? 19.663  -21.320 11.009  1.00 13.19 ? 204  ASP A C     1 
ATOM   2862 O  O     . ASP E 3 212 ? 19.072  -22.364 11.250  1.00 13.14 ? 204  ASP A O     1 
ATOM   2863 C  CB    . ASP E 3 212 ? 20.646  -20.628 13.208  1.00 13.52 ? 204  ASP A CB    1 
ATOM   2864 C  CG    . ASP E 3 212 ? 21.895  -20.518 14.070  1.00 14.11 ? 204  ASP A CG    1 
ATOM   2865 O  OD1   . ASP E 3 212 ? 22.989  -20.915 13.617  1.00 15.56 ? 204  ASP A OD1   1 
ATOM   2866 O  OD2   . ASP E 3 212 ? 21.886  -20.050 15.222  1.00 15.04 ? 204  ASP A OD2   1 
ATOM   2867 N  N     . THR E 3 213 ? 19.225  -20.447 10.105  1.00 13.03 ? 205  THR A N     1 
ATOM   2868 C  CA    . THR E 3 213 ? 17.999  -20.695 9.332   1.00 12.96 ? 205  THR A CA    1 
ATOM   2869 C  C     . THR E 3 213 ? 18.169  -21.771 8.244   1.00 13.02 ? 205  THR A C     1 
ATOM   2870 O  O     . THR E 3 213 ? 17.200  -22.122 7.567   1.00 12.61 ? 205  THR A O     1 
ATOM   2871 C  CB    . THR E 3 213 ? 17.454  -19.378 8.689   1.00 12.82 ? 205  THR A CB    1 
ATOM   2872 O  OG1   . THR E 3 213 ? 18.463  -18.761 7.890   1.00 12.22 ? 205  THR A OG1   1 
ATOM   2873 C  CG2   . THR E 3 213 ? 17.148  -18.328 9.735   1.00 12.78 ? 205  THR A CG2   1 
ATOM   2874 N  N     . LEU E 3 214 ? 19.388  -22.282 8.081   1.00 13.20 ? 206  LEU A N     1 
ATOM   2875 C  CA    . LEU E 3 214 ? 19.686  -23.293 7.072   1.00 13.55 ? 206  LEU A CA    1 
ATOM   2876 C  C     . LEU E 3 214 ? 19.895  -24.696 7.674   1.00 14.28 ? 206  LEU A C     1 
ATOM   2877 O  O     . LEU E 3 214 ? 20.216  -25.644 6.952   1.00 14.39 ? 206  LEU A O     1 
ATOM   2878 C  CB    . LEU E 3 214 ? 20.927  -22.877 6.270   1.00 13.45 ? 206  LEU A CB    1 
ATOM   2879 C  CG    . LEU E 3 214 ? 20.997  -21.423 5.779   1.00 12.68 ? 206  LEU A CG    1 
ATOM   2880 C  CD1   . LEU E 3 214 ? 22.282  -21.163 5.003   1.00 11.48 ? 206  LEU A CD1   1 
ATOM   2881 C  CD2   . LEU E 3 214 ? 19.784  -21.081 4.927   1.00 12.56 ? 206  LEU A CD2   1 
ATOM   2882 N  N     . SER E 3 215 ? 19.727  -24.825 8.990   1.00 14.83 ? 207  SER A N     1 
ATOM   2883 C  CA    . SER E 3 215 ? 19.812  -26.123 9.668   1.00 15.23 ? 207  SER A CA    1 
ATOM   2884 C  C     . SER E 3 215 ? 18.416  -26.701 9.874   1.00 15.36 ? 207  SER A C     1 
ATOM   2885 O  O     . SER E 3 215 ? 18.188  -27.909 9.725   1.00 15.55 ? 207  SER A O     1 
ATOM   2886 C  CB    . SER E 3 215 ? 20.511  -25.975 11.022  1.00 15.32 ? 207  SER A CB    1 
ATOM   2887 O  OG    . SER E 3 215 ? 21.645  -25.135 10.916  1.00 15.70 ? 207  SER A OG    1 
ATOM   2888 N  N     . ILE E 3 216 ? 17.495  -25.820 10.236  1.00 15.40 ? 208  ILE A N     1 
ATOM   2889 C  CA    . ILE E 3 216 ? 16.096  -26.165 10.417  1.00 15.64 ? 208  ILE A CA    1 
ATOM   2890 C  C     . ILE E 3 216 ? 15.406  -26.403 9.062   1.00 15.46 ? 208  ILE A C     1 
ATOM   2891 O  O     . ILE E 3 216 ? 15.671  -25.695 8.093   1.00 15.21 ? 208  ILE A O     1 
ATOM   2892 C  CB    . ILE E 3 216 ? 15.404  -25.019 11.198  1.00 15.87 ? 208  ILE A CB    1 
ATOM   2893 C  CG1   . ILE E 3 216 ? 14.080  -25.485 11.811  1.00 16.50 ? 208  ILE A CG1   1 
ATOM   2894 C  CG2   . ILE E 3 216 ? 15.203  -23.784 10.293  1.00 15.95 ? 208  ILE A CG2   1 
ATOM   2895 C  CD1   . ILE E 3 216 ? 13.195  -24.320 12.282  1.00 17.51 ? 208  ILE A CD1   1 
ATOM   2896 N  N     . GLU E 3 217 ? 14.523  -27.399 8.999   1.00 15.42 ? 209  GLU A N     1 
ATOM   2897 C  CA    . GLU E 3 217 ? 13.753  -27.659 7.780   1.00 15.44 ? 209  GLU A CA    1 
ATOM   2898 C  C     . GLU E 3 217 ? 12.897  -26.446 7.436   1.00 15.43 ? 209  GLU A C     1 
ATOM   2899 O  O     . GLU E 3 217 ? 12.416  -25.748 8.325   1.00 15.45 ? 209  GLU A O     1 
ATOM   2900 C  CB    . GLU E 3 217 ? 12.873  -28.912 7.924   1.00 15.45 ? 209  GLU A CB    1 
ATOM   2901 C  CG    . GLU E 3 217 ? 13.361  -30.102 7.097   1.00 15.55 ? 209  GLU A CG    1 
ATOM   2902 C  CD    . GLU E 3 217 ? 12.577  -31.376 7.358   1.00 15.51 ? 209  GLU A CD    1 
ATOM   2903 O  OE1   . GLU E 3 217 ? 13.126  -32.475 7.107   1.00 15.57 ? 209  GLU A OE1   1 
ATOM   2904 O  OE2   . GLU E 3 217 ? 11.415  -31.282 7.816   1.00 14.91 ? 209  GLU A OE2   1 
ATOM   2905 N  N     . PHE E 3 218 ? 12.711  -26.196 6.145   1.00 15.52 ? 210  PHE A N     1 
ATOM   2906 C  CA    . PHE E 3 218 ? 11.987  -25.008 5.690   1.00 15.47 ? 210  PHE A CA    1 
ATOM   2907 C  C     . PHE E 3 218 ? 10.546  -24.927 6.224   1.00 15.68 ? 210  PHE A C     1 
ATOM   2908 O  O     . PHE E 3 218 ? 10.086  -23.844 6.579   1.00 16.06 ? 210  PHE A O     1 
ATOM   2909 C  CB    . PHE E 3 218 ? 11.982  -24.925 4.157   1.00 15.24 ? 210  PHE A CB    1 
ATOM   2910 C  CG    . PHE E 3 218 ? 11.122  -23.818 3.619   1.00 15.19 ? 210  PHE A CG    1 
ATOM   2911 C  CD1   . PHE E 3 218 ? 11.623  -22.528 3.511   1.00 14.68 ? 210  PHE A CD1   1 
ATOM   2912 C  CD2   . PHE E 3 218 ? 9.802   -24.056 3.251   1.00 15.05 ? 210  PHE A CD2   1 
ATOM   2913 C  CE1   . PHE E 3 218 ? 10.841  -21.497 3.031   1.00 14.33 ? 210  PHE A CE1   1 
ATOM   2914 C  CE2   . PHE E 3 218 ? 9.006   -23.024 2.776   1.00 15.32 ? 210  PHE A CE2   1 
ATOM   2915 C  CZ    . PHE E 3 218 ? 9.529   -21.739 2.665   1.00 14.80 ? 210  PHE A CZ    1 
ATOM   2916 N  N     . ASP E 3 219 ? 9.840   -26.057 6.268   1.00 15.86 ? 211  ASP A N     1 
ATOM   2917 C  CA    . ASP E 3 219 ? 8.425   -26.084 6.668   1.00 15.88 ? 211  ASP A CA    1 
ATOM   2918 C  C     . ASP E 3 219 ? 8.226   -25.824 8.168   1.00 15.93 ? 211  ASP A C     1 
ATOM   2919 O  O     . ASP E 3 219 ? 7.161   -25.364 8.592   1.00 15.96 ? 211  ASP A O     1 
ATOM   2920 C  CB    . ASP E 3 219 ? 7.773   -27.428 6.289   1.00 15.90 ? 211  ASP A CB    1 
ATOM   2921 C  CG    . ASP E 3 219 ? 7.445   -27.540 4.796   1.00 16.43 ? 211  ASP A CG    1 
ATOM   2922 O  OD1   . ASP E 3 219 ? 7.275   -26.490 4.133   1.00 17.29 ? 211  ASP A OD1   1 
ATOM   2923 O  OD2   . ASP E 3 219 ? 7.324   -28.644 4.203   1.00 16.83 ? 211  ASP A OD2   1 
ATOM   2924 N  N     . LYS E 3 220 ? 9.244   -26.138 8.965   1.00 15.96 ? 212  LYS A N     1 
ATOM   2925 C  CA    . LYS E 3 220 ? 9.209   -25.901 10.404  1.00 15.99 ? 212  LYS A CA    1 
ATOM   2926 C  C     . LYS E 3 220 ? 9.433   -24.420 10.691  1.00 16.11 ? 212  LYS A C     1 
ATOM   2927 O  O     . LYS E 3 220 ? 8.924   -23.903 11.678  1.00 16.35 ? 212  LYS A O     1 
ATOM   2928 C  CB    . LYS E 3 220 ? 10.270  -26.760 11.113  1.00 16.02 ? 212  LYS A CB    1 
ATOM   2929 C  CG    . LYS E 3 220 ? 10.113  -26.840 12.628  1.00 16.11 ? 212  LYS A CG    1 
ATOM   2930 C  CD    . LYS E 3 220 ? 10.596  -28.174 13.182  1.00 16.32 ? 212  LYS A CD    1 
ATOM   2931 C  CE    . LYS E 3 220 ? 10.615  -28.174 14.711  1.00 16.59 ? 212  LYS A CE    1 
ATOM   2932 N  NZ    . LYS E 3 220 ? 10.436  -29.550 15.284  1.00 16.62 ? 212  LYS A NZ    1 
ATOM   2933 N  N     . LEU E 3 221 ? 10.198  -23.752 9.825   1.00 16.24 ? 213  LEU A N     1 
ATOM   2934 C  CA    . LEU E 3 221 ? 10.432  -22.310 9.914   1.00 16.32 ? 213  LEU A CA    1 
ATOM   2935 C  C     . LEU E 3 221 ? 9.249   -21.515 9.371   1.00 16.60 ? 213  LEU A C     1 
ATOM   2936 O  O     . LEU E 3 221 ? 8.913   -20.471 9.919   1.00 16.64 ? 213  LEU A O     1 
ATOM   2937 C  CB    . LEU E 3 221 ? 11.703  -21.914 9.144   1.00 16.28 ? 213  LEU A CB    1 
ATOM   2938 C  CG    . LEU E 3 221 ? 12.106  -20.429 9.185   1.00 15.84 ? 213  LEU A CG    1 
ATOM   2939 C  CD1   . LEU E 3 221 ? 12.446  -20.008 10.611  1.00 15.80 ? 213  LEU A CD1   1 
ATOM   2940 C  CD2   . LEU E 3 221 ? 13.274  -20.111 8.241   1.00 14.99 ? 213  LEU A CD2   1 
ATOM   2941 N  N     . LYS E 3 222 ? 8.645   -22.005 8.286   1.00 16.80 ? 214  LYS A N     1 
ATOM   2942 C  CA    . LYS E 3 222 ? 7.480   -21.373 7.655   1.00 16.95 ? 214  LYS A CA    1 
ATOM   2943 C  C     . LYS E 3 222 ? 6.262   -21.511 8.562   1.00 17.09 ? 214  LYS A C     1 
ATOM   2944 O  O     . LYS E 3 222 ? 5.408   -20.628 8.611   1.00 16.95 ? 214  LYS A O     1 
ATOM   2945 C  CB    . LYS E 3 222 ? 7.219   -22.014 6.280   1.00 17.08 ? 214  LYS A CB    1 
ATOM   2946 C  CG    . LYS E 3 222 ? 5.832   -21.780 5.637   1.00 17.42 ? 214  LYS A CG    1 
ATOM   2947 C  CD    . LYS E 3 222 ? 5.455   -22.949 4.697   1.00 18.28 ? 214  LYS A CD    1 
ATOM   2948 C  CE    . LYS E 3 222 ? 4.455   -22.547 3.596   1.00 18.47 ? 214  LYS A CE    1 
ATOM   2949 N  NZ    . LYS E 3 222 ? 3.176   -21.974 4.122   1.00 17.50 ? 214  LYS A NZ    1 
ATOM   2950 N  N     . GLY E 3 223 ? 6.202   -22.617 9.296   1.00 17.35 ? 215  GLY A N     1 
ATOM   2951 C  CA    . GLY E 3 223 ? 5.080   -22.909 10.166  1.00 17.60 ? 215  GLY A CA    1 
ATOM   2952 C  C     . GLY E 3 223 ? 5.066   -22.024 11.392  1.00 17.82 ? 215  GLY A C     1 
ATOM   2953 O  O     . GLY E 3 223 ? 4.051   -21.934 12.086  1.00 18.17 ? 215  GLY A O     1 
ATOM   2954 N  N     . MET E 3 224 ? 6.193   -21.369 11.653  1.00 17.86 ? 216  MET A N     1 
ATOM   2955 C  CA    . MET E 3 224 ? 6.363   -20.553 12.846  1.00 17.83 ? 216  MET A CA    1 
ATOM   2956 C  C     . MET E 3 224 ? 6.286   -19.049 12.561  1.00 17.39 ? 216  MET A C     1 
ATOM   2957 O  O     . MET E 3 224 ? 5.676   -18.317 13.344  1.00 17.68 ? 216  MET A O     1 
ATOM   2958 C  CB    . MET E 3 224 ? 7.697   -20.906 13.514  1.00 17.95 ? 216  MET A CB    1 
ATOM   2959 C  CG    . MET E 3 224 ? 7.883   -20.349 14.923  1.00 18.97 ? 216  MET A CG    1 
ATOM   2960 S  SD    . MET E 3 224 ? 6.550   -20.709 16.104  1.00 20.80 ? 216  MET A SD    1 
ATOM   2961 C  CE    . MET E 3 224 ? 6.260   -22.519 15.867  1.00 20.75 ? 216  MET A CE    1 
ATOM   2962 N  N     . ILE E 3 225 ? 6.877   -18.591 11.454  1.00 16.76 ? 217  ILE A N     1 
ATOM   2963 C  CA    . ILE E 3 225 ? 6.998   -17.149 11.183  1.00 16.49 ? 217  ILE A CA    1 
ATOM   2964 C  C     . ILE E 3 225 ? 6.429   -16.685 9.835   1.00 16.21 ? 217  ILE A C     1 
ATOM   2965 O  O     . ILE E 3 225 ? 6.670   -15.543 9.424   1.00 15.97 ? 217  ILE A O     1 
ATOM   2966 C  CB    . ILE E 3 225 ? 8.482   -16.699 11.318  1.00 16.43 ? 217  ILE A CB    1 
ATOM   2967 C  CG1   . ILE E 3 225 ? 9.367   -17.388 10.276  1.00 16.20 ? 217  ILE A CG1   1 
ATOM   2968 C  CG2   . ILE E 3 225 ? 9.003   -16.997 12.728  1.00 16.74 ? 217  ILE A CG2   1 
ATOM   2969 C  CD1   . ILE E 3 225 ? 10.611  -16.621 9.924   1.00 15.62 ? 217  ILE A CD1   1 
ATOM   2970 N  N     . GLY E 3 226 ? 5.673   -17.563 9.169   1.00 15.90 ? 218  GLY A N     1 
ATOM   2971 C  CA    . GLY E 3 226 ? 5.119   -17.298 7.848   1.00 15.63 ? 218  GLY A CA    1 
ATOM   2972 C  C     . GLY E 3 226 ? 6.097   -17.519 6.702   1.00 15.49 ? 218  GLY A C     1 
ATOM   2973 O  O     . GLY E 3 226 ? 7.303   -17.410 6.878   1.00 15.49 ? 218  GLY A O     1 
ATOM   2974 N  N     . GLU E 3 227 ? 5.574   -17.805 5.514   1.00 15.42 ? 219  GLU A N     1 
ATOM   2975 C  CA    . GLU E 3 227 ? 6.410   -18.036 4.335   1.00 15.55 ? 219  GLU A CA    1 
ATOM   2976 C  C     . GLU E 3 227 ? 7.258   -16.825 3.948   1.00 15.27 ? 219  GLU A C     1 
ATOM   2977 O  O     . GLU E 3 227 ? 8.356   -16.977 3.438   1.00 15.02 ? 219  GLU A O     1 
ATOM   2978 C  CB    . GLU E 3 227 ? 5.540   -18.446 3.140   1.00 15.85 ? 219  GLU A CB    1 
ATOM   2979 C  CG    . GLU E 3 227 ? 6.306   -18.734 1.852   1.00 16.98 ? 219  GLU A CG    1 
ATOM   2980 C  CD    . GLU E 3 227 ? 5.412   -19.229 0.722   1.00 18.84 ? 219  GLU A CD    1 
ATOM   2981 O  OE1   . GLU E 3 227 ? 4.903   -18.377 -0.053  1.00 18.94 ? 219  GLU A OE1   1 
ATOM   2982 O  OE2   . GLU E 3 227 ? 5.231   -20.469 0.604   1.00 19.57 ? 219  GLU A OE2   1 
ATOM   2983 N  N     . ALA E 3 228 ? 6.737   -15.627 4.176   1.00 15.33 ? 220  ALA A N     1 
ATOM   2984 C  CA    . ALA E 3 228 ? 7.383   -14.399 3.724   1.00 15.21 ? 220  ALA A CA    1 
ATOM   2985 C  C     . ALA E 3 228 ? 8.693   -14.161 4.467   1.00 15.48 ? 220  ALA A C     1 
ATOM   2986 O  O     . ALA E 3 228 ? 9.765   -14.083 3.849   1.00 15.39 ? 220  ALA A O     1 
ATOM   2987 C  CB    . ALA E 3 228 ? 6.442   -13.215 3.901   1.00 15.00 ? 220  ALA A CB    1 
ATOM   2988 N  N     . LYS E 3 229 ? 8.603   -14.067 5.794   1.00 15.61 ? 221  LYS A N     1 
ATOM   2989 C  CA    . LYS E 3 229 ? 9.794   -13.896 6.633   1.00 15.66 ? 221  LYS A CA    1 
ATOM   2990 C  C     . LYS E 3 229 ? 10.690  -15.131 6.601   1.00 15.20 ? 221  LYS A C     1 
ATOM   2991 O  O     . LYS E 3 229 ? 11.890  -15.027 6.826   1.00 15.20 ? 221  LYS A O     1 
ATOM   2992 C  CB    . LYS E 3 229 ? 9.412   -13.545 8.082   1.00 15.85 ? 221  LYS A CB    1 
ATOM   2993 C  CG    . LYS E 3 229 ? 9.320   -12.049 8.342   1.00 16.87 ? 221  LYS A CG    1 
ATOM   2994 C  CD    . LYS E 3 229 ? 8.367   -11.708 9.480   1.00 18.55 ? 221  LYS A CD    1 
ATOM   2995 C  CE    . LYS E 3 229 ? 8.278   -10.186 9.677   1.00 20.10 ? 221  LYS A CE    1 
ATOM   2996 N  NZ    . LYS E 3 229 ? 6.955   -9.597  9.284   1.00 21.29 ? 221  LYS A NZ    1 
ATOM   2997 N  N     . ALA E 3 230 ? 10.112  -16.295 6.323   1.00 14.93 ? 222  ALA A N     1 
ATOM   2998 C  CA    . ALA E 3 230 ? 10.903  -17.515 6.151   1.00 14.78 ? 222  ALA A CA    1 
ATOM   2999 C  C     . ALA E 3 230 ? 11.882  -17.359 4.984   1.00 14.76 ? 222  ALA A C     1 
ATOM   3000 O  O     . ALA E 3 230 ? 13.090  -17.344 5.201   1.00 14.82 ? 222  ALA A O     1 
ATOM   3001 C  CB    . ALA E 3 230 ? 10.007  -18.721 5.949   1.00 14.44 ? 222  ALA A CB    1 
ATOM   3002 N  N     . LYS E 3 231 ? 11.348  -17.210 3.768   1.00 14.85 ? 223  LYS A N     1 
ATOM   3003 C  CA    . LYS E 3 231 ? 12.136  -17.024 2.529   1.00 14.79 ? 223  LYS A CA    1 
ATOM   3004 C  C     . LYS E 3 231 ? 13.142  -15.879 2.619   1.00 14.40 ? 223  LYS A C     1 
ATOM   3005 O  O     . LYS E 3 231 ? 14.225  -15.948 2.052   1.00 14.18 ? 223  LYS A O     1 
ATOM   3006 C  CB    . LYS E 3 231 ? 11.210  -16.745 1.333   1.00 14.80 ? 223  LYS A CB    1 
ATOM   3007 C  CG    . LYS E 3 231 ? 10.535  -17.974 0.742   1.00 15.84 ? 223  LYS A CG    1 
ATOM   3008 C  CD    . LYS E 3 231 ? 10.051  -17.726 -0.696  1.00 17.56 ? 223  LYS A CD    1 
ATOM   3009 C  CE    . LYS E 3 231 ? 9.960   -19.024 -1.526  1.00 18.51 ? 223  LYS A CE    1 
ATOM   3010 N  NZ    . LYS E 3 231 ? 10.997  -19.138 -2.611  1.00 18.65 ? 223  LYS A NZ    1 
ATOM   3011 N  N     . TYR E 3 232 ? 12.751  -14.829 3.328   1.00 14.15 ? 224  TYR A N     1 
ATOM   3012 C  CA    . TYR E 3 232 ? 13.550  -13.622 3.489   1.00 14.05 ? 224  TYR A CA    1 
ATOM   3013 C  C     . TYR E 3 232 ? 14.832  -13.939 4.249   1.00 13.93 ? 224  TYR A C     1 
ATOM   3014 O  O     . TYR E 3 232 ? 15.922  -13.583 3.805   1.00 14.12 ? 224  TYR A O     1 
ATOM   3015 C  CB    . TYR E 3 232 ? 12.692  -12.579 4.218   1.00 14.00 ? 224  TYR A CB    1 
ATOM   3016 C  CG    . TYR E 3 232 ? 13.343  -11.283 4.654   1.00 14.22 ? 224  TYR A CG    1 
ATOM   3017 C  CD1   . TYR E 3 232 ? 13.891  -10.401 3.737   1.00 14.85 ? 224  TYR A CD1   1 
ATOM   3018 C  CD2   . TYR E 3 232 ? 13.347  -10.913 5.996   1.00 14.71 ? 224  TYR A CD2   1 
ATOM   3019 C  CE1   . TYR E 3 232 ? 14.451  -9.193  4.153   1.00 15.15 ? 224  TYR A CE1   1 
ATOM   3020 C  CE2   . TYR E 3 232 ? 13.909  -9.717  6.418   1.00 14.61 ? 224  TYR A CE2   1 
ATOM   3021 C  CZ    . TYR E 3 232 ? 14.453  -8.860  5.495   1.00 14.67 ? 224  TYR A CZ    1 
ATOM   3022 O  OH    . TYR E 3 232 ? 15.005  -7.675  5.918   1.00 14.55 ? 224  TYR A OH    1 
ATOM   3023 N  N     . LEU E 3 233 ? 14.701  -14.630 5.378   1.00 13.83 ? 225  LEU A N     1 
ATOM   3024 C  CA    . LEU E 3 233 ? 15.846  -14.946 6.231   1.00 13.63 ? 225  LEU A CA    1 
ATOM   3025 C  C     . LEU E 3 233 ? 16.752  -15.996 5.600   1.00 13.63 ? 225  LEU A C     1 
ATOM   3026 O  O     . LEU E 3 233 ? 17.968  -15.861 5.651   1.00 13.49 ? 225  LEU A O     1 
ATOM   3027 C  CB    . LEU E 3 233 ? 15.384  -15.403 7.613   1.00 13.46 ? 225  LEU A CB    1 
ATOM   3028 C  CG    . LEU E 3 233 ? 14.630  -14.338 8.414   1.00 13.24 ? 225  LEU A CG    1 
ATOM   3029 C  CD1   . LEU E 3 233 ? 13.830  -14.975 9.540   1.00 12.37 ? 225  LEU A CD1   1 
ATOM   3030 C  CD2   . LEU E 3 233 ? 15.595  -13.290 8.954   1.00 13.02 ? 225  LEU A CD2   1 
ATOM   3031 N  N     . ILE E 3 234 ? 16.167  -17.030 4.997   1.00 13.72 ? 226  ILE A N     1 
ATOM   3032 C  CA    . ILE E 3 234 ? 16.954  -18.059 4.313   1.00 13.93 ? 226  ILE A CA    1 
ATOM   3033 C  C     . ILE E 3 234 ? 17.751  -17.450 3.169   1.00 13.97 ? 226  ILE A C     1 
ATOM   3034 O  O     . ILE E 3 234 ? 18.849  -17.901 2.871   1.00 13.65 ? 226  ILE A O     1 
ATOM   3035 C  CB    . ILE E 3 234 ? 16.049  -19.196 3.781   1.00 14.04 ? 226  ILE A CB    1 
ATOM   3036 C  CG1   . ILE E 3 234 ? 15.495  -20.020 4.940   1.00 14.17 ? 226  ILE A CG1   1 
ATOM   3037 C  CG2   . ILE E 3 234 ? 16.805  -20.122 2.804   1.00 13.86 ? 226  ILE A CG2   1 
ATOM   3038 C  CD1   . ILE E 3 234 ? 14.120  -20.559 4.648   1.00 14.70 ? 226  ILE A CD1   1 
ATOM   3039 N  N     . SER E 3 235 ? 17.190  -16.416 2.550   1.00 14.18 ? 227  SER A N     1 
ATOM   3040 C  CA    . SER E 3 235 ? 17.802  -15.768 1.402   1.00 14.43 ? 227  SER A CA    1 
ATOM   3041 C  C     . SER E 3 235 ? 19.027  -14.956 1.800   1.00 14.54 ? 227  SER A C     1 
ATOM   3042 O  O     . SER E 3 235 ? 20.079  -15.054 1.169   1.00 14.29 ? 227  SER A O     1 
ATOM   3043 C  CB    . SER E 3 235 ? 16.794  -14.863 0.729   1.00 14.23 ? 227  SER A CB    1 
ATOM   3044 O  OG    . SER E 3 235 ? 17.345  -14.365 -0.462  1.00 15.88 ? 227  SER A OG    1 
ATOM   3045 N  N     . LEU E 3 236 ? 18.866  -14.155 2.850   1.00 14.92 ? 228  LEU A N     1 
ATOM   3046 C  CA    . LEU E 3 236 ? 19.959  -13.396 3.453   1.00 15.22 ? 228  LEU A CA    1 
ATOM   3047 C  C     . LEU E 3 236 ? 21.060  -14.319 3.929   1.00 15.51 ? 228  LEU A C     1 
ATOM   3048 O  O     . LEU E 3 236 ? 22.238  -13.963 3.903   1.00 15.67 ? 228  LEU A O     1 
ATOM   3049 C  CB    . LEU E 3 236 ? 19.454  -12.619 4.666   1.00 15.13 ? 228  LEU A CB    1 
ATOM   3050 C  CG    . LEU E 3 236 ? 18.446  -11.518 4.401   1.00 15.20 ? 228  LEU A CG    1 
ATOM   3051 C  CD1   . LEU E 3 236 ? 17.694  -11.171 5.674   1.00 15.50 ? 228  LEU A CD1   1 
ATOM   3052 C  CD2   . LEU E 3 236 ? 19.161  -10.299 3.845   1.00 15.49 ? 228  LEU A CD2   1 
ATOM   3053 N  N     . ALA E 3 237 ? 20.660  -15.502 4.385   1.00 15.93 ? 229  ALA A N     1 
ATOM   3054 C  CA    . ALA E 3 237 ? 21.584  -16.469 4.965   1.00 16.25 ? 229  ALA A CA    1 
ATOM   3055 C  C     . ALA E 3 237 ? 22.454  -17.094 3.894   1.00 16.48 ? 229  ALA A C     1 
ATOM   3056 O  O     . ALA E 3 237 ? 23.616  -17.403 4.153   1.00 16.49 ? 229  ALA A O     1 
ATOM   3057 C  CB    . ALA E 3 237 ? 20.825  -17.542 5.713   1.00 16.28 ? 229  ALA A CB    1 
ATOM   3058 N  N     . ARG E 3 238 ? 21.888  -17.269 2.696   1.00 16.92 ? 230  ARG A N     1 
ATOM   3059 C  CA    . ARG E 3 238 ? 22.623  -17.810 1.548   1.00 17.11 ? 230  ARG A CA    1 
ATOM   3060 C  C     . ARG E 3 238 ? 23.530  -16.761 0.927   1.00 17.43 ? 230  ARG A C     1 
ATOM   3061 O  O     . ARG E 3 238 ? 24.432  -17.108 0.164   1.00 17.64 ? 230  ARG A O     1 
ATOM   3062 C  CB    . ARG E 3 238 ? 21.676  -18.309 0.450   1.00 17.06 ? 230  ARG A CB    1 
ATOM   3063 C  CG    . ARG E 3 238 ? 20.477  -19.092 0.921   1.00 16.73 ? 230  ARG A CG    1 
ATOM   3064 C  CD    . ARG E 3 238 ? 20.029  -20.183 -0.014  1.00 16.35 ? 230  ARG A CD    1 
ATOM   3065 N  NE    . ARG E 3 238 ? 20.349  -21.499 0.539   1.00 16.77 ? 230  ARG A NE    1 
ATOM   3066 C  CZ    . ARG E 3 238 ? 19.488  -22.499 0.710   1.00 16.75 ? 230  ARG A CZ    1 
ATOM   3067 N  NH1   . ARG E 3 238 ? 18.204  -22.373 0.370   1.00 16.68 ? 230  ARG A NH1   1 
ATOM   3068 N  NH2   . ARG E 3 238 ? 19.921  -23.646 1.228   1.00 16.64 ? 230  ARG A NH2   1 
ATOM   3069 N  N     . ASP E 3 239 ? 23.274  -15.490 1.250   1.00 17.85 ? 231  ASP A N     1 
ATOM   3070 C  CA    . ASP E 3 239 ? 23.932  -14.347 0.616   1.00 18.22 ? 231  ASP A CA    1 
ATOM   3071 C  C     . ASP E 3 239 ? 23.397  -14.202 -0.812  1.00 18.21 ? 231  ASP A C     1 
ATOM   3072 O  O     . ASP E 3 239 ? 24.112  -13.768 -1.709  1.00 18.35 ? 231  ASP A O     1 
ATOM   3073 C  CB    . ASP E 3 239 ? 25.462  -14.515 0.630   1.00 18.40 ? 231  ASP A CB    1 
ATOM   3074 C  CG    . ASP E 3 239 ? 26.212  -13.202 0.450   1.00 19.42 ? 231  ASP A CG    1 
ATOM   3075 O  OD1   . ASP E 3 239 ? 25.592  -12.113 0.534   1.00 20.82 ? 231  ASP A OD1   1 
ATOM   3076 O  OD2   . ASP E 3 239 ? 27.442  -13.173 0.220   1.00 20.32 ? 231  ASP A OD2   1 
ATOM   3077 N  N     . GLU E 3 240 ? 22.135  -14.578 -1.010  1.00 18.17 ? 232  GLU A N     1 
ATOM   3078 C  CA    . GLU E 3 240 ? 21.504  -14.558 -2.327  1.00 18.10 ? 232  GLU A CA    1 
ATOM   3079 C  C     . GLU E 3 240 ? 20.515  -13.402 -2.486  1.00 17.96 ? 232  GLU A C     1 
ATOM   3080 O  O     . GLU E 3 240 ? 20.083  -13.121 -3.599  1.00 18.25 ? 232  GLU A O     1 
ATOM   3081 C  CB    . GLU E 3 240 ? 20.811  -15.902 -2.609  1.00 18.09 ? 232  GLU A CB    1 
ATOM   3082 C  CG    . GLU E 3 240 ? 21.790  -17.020 -2.979  1.00 18.69 ? 232  GLU A CG    1 
ATOM   3083 C  CD    . GLU E 3 240 ? 21.129  -18.244 -3.607  1.00 19.13 ? 232  GLU A CD    1 
ATOM   3084 O  OE1   . GLU E 3 240 ? 19.902  -18.450 -3.409  1.00 19.27 ? 232  GLU A OE1   1 
ATOM   3085 O  OE2   . GLU E 3 240 ? 21.847  -19.006 -4.301  1.00 18.21 ? 232  GLU A OE2   1 
ATOM   3086 N  N     . TYR E 3 241 ? 20.168  -12.733 -1.387  1.00 17.62 ? 233  TYR A N     1 
ATOM   3087 C  CA    . TYR E 3 241 ? 19.221  -11.615 -1.419  1.00 17.38 ? 233  TYR A CA    1 
ATOM   3088 C  C     . TYR E 3 241 ? 19.722  -10.493 -2.330  1.00 17.30 ? 233  TYR A C     1 
ATOM   3089 O  O     . TYR E 3 241 ? 20.873  -10.073 -2.229  1.00 17.00 ? 233  TYR A O     1 
ATOM   3090 C  CB    . TYR E 3 241 ? 18.984  -11.082 0.001   1.00 17.27 ? 233  TYR A CB    1 
ATOM   3091 C  CG    . TYR E 3 241 ? 17.997  -9.936  0.088   1.00 17.40 ? 233  TYR A CG    1 
ATOM   3092 C  CD1   . TYR E 3 241 ? 16.651  -10.174 0.339   1.00 17.10 ? 233  TYR A CD1   1 
ATOM   3093 C  CD2   . TYR E 3 241 ? 18.415  -8.609  -0.071  1.00 17.21 ? 233  TYR A CD2   1 
ATOM   3094 C  CE1   . TYR E 3 241 ? 15.735  -9.124  0.425   1.00 16.96 ? 233  TYR A CE1   1 
ATOM   3095 C  CE2   . TYR E 3 241 ? 17.513  -7.554  0.011   1.00 16.92 ? 233  TYR A CE2   1 
ATOM   3096 C  CZ    . TYR E 3 241 ? 16.167  -7.819  0.257   1.00 17.23 ? 233  TYR A CZ    1 
ATOM   3097 O  OH    . TYR E 3 241 ? 15.254  -6.789  0.341   1.00 16.47 ? 233  TYR A OH    1 
ATOM   3098 N  N     . ASN E 3 242 ? 18.854  -10.029 -3.227  1.00 17.50 ? 234  ASN A N     1 
ATOM   3099 C  CA    . ASN E 3 242 ? 19.206  -8.970  -4.176  1.00 17.80 ? 234  ASN A CA    1 
ATOM   3100 C  C     . ASN E 3 242 ? 17.983  -8.253  -4.763  1.00 17.87 ? 234  ASN A C     1 
ATOM   3101 O  O     . ASN E 3 242 ? 17.932  -7.990  -5.968  1.00 18.20 ? 234  ASN A O     1 
ATOM   3102 C  CB    . ASN E 3 242 ? 20.082  -9.535  -5.304  1.00 17.81 ? 234  ASN A CB    1 
ATOM   3103 C  CG    . ASN E 3 242 ? 21.259  -8.620  -5.659  1.00 18.83 ? 234  ASN A CG    1 
ATOM   3104 O  OD1   . ASN E 3 242 ? 22.066  -8.247  -4.797  1.00 20.25 ? 234  ASN A OD1   1 
ATOM   3105 N  ND2   . ASN E 3 242 ? 21.369  -8.271  -6.936  1.00 19.67 ? 234  ASN A ND2   1 
ATOM   3106 N  N     . GLU E 3 243 ? 17.005  -7.934  -3.911  1.00 17.68 ? 235  GLU A N     1 
ATOM   3107 C  CA    . GLU E 3 243 ? 15.806  -7.216  -4.343  1.00 17.56 ? 235  GLU A CA    1 
ATOM   3108 C  C     . GLU E 3 243 ? 16.183  -5.841  -4.903  1.00 17.57 ? 235  GLU A C     1 
ATOM   3109 O  O     . GLU E 3 243 ? 16.974  -5.120  -4.289  1.00 17.58 ? 235  GLU A O     1 
ATOM   3110 C  CB    . GLU E 3 243 ? 14.839  -7.018  -3.169  1.00 17.58 ? 235  GLU A CB    1 
ATOM   3111 C  CG    . GLU E 3 243 ? 14.161  -8.282  -2.681  1.00 17.94 ? 235  GLU A CG    1 
ATOM   3112 C  CD    . GLU E 3 243 ? 13.211  -8.855  -3.712  1.00 18.85 ? 235  GLU A CD    1 
ATOM   3113 O  OE1   . GLU E 3 243 ? 12.072  -8.342  -3.821  1.00 19.80 ? 235  GLU A OE1   1 
ATOM   3114 O  OE2   . GLU E 3 243 ? 13.612  -9.807  -4.421  1.00 18.25 ? 235  GLU A OE2   1 
ATOM   3115 N  N     . PRO E 3 244 ? 15.618  -5.461  -6.048  1.00 17.51 ? 236  PRO A N     1 
ATOM   3116 C  CA    . PRO E 3 244 ? 15.920  -4.151  -6.638  1.00 17.46 ? 236  PRO A CA    1 
ATOM   3117 C  C     . PRO E 3 244 ? 15.391  -2.983  -5.810  1.00 17.45 ? 236  PRO A C     1 
ATOM   3118 O  O     . PRO E 3 244 ? 14.496  -3.143  -4.970  1.00 17.64 ? 236  PRO A O     1 
ATOM   3119 C  CB    . PRO E 3 244 ? 15.227  -4.203  -8.005  1.00 17.33 ? 236  PRO A CB    1 
ATOM   3120 C  CG    . PRO E 3 244 ? 14.158  -5.224  -7.858  1.00 17.50 ? 236  PRO A CG    1 
ATOM   3121 C  CD    . PRO E 3 244 ? 14.661  -6.225  -6.868  1.00 17.58 ? 236  PRO A CD    1 
ATOM   3122 N  N     . ILE E 3 245 ? 15.977  -1.817  -6.051  1.00 17.37 ? 237  ILE A N     1 
ATOM   3123 C  CA    . ILE E 3 245 ? 15.530  -0.570  -5.455  1.00 17.31 ? 237  ILE A CA    1 
ATOM   3124 C  C     . ILE E 3 245 ? 14.386  -0.051  -6.334  1.00 17.96 ? 237  ILE A C     1 
ATOM   3125 O  O     . ILE E 3 245 ? 14.592  0.203   -7.516  1.00 17.75 ? 237  ILE A O     1 
ATOM   3126 C  CB    . ILE E 3 245 ? 16.722  0.420   -5.385  1.00 16.84 ? 237  ILE A CB    1 
ATOM   3127 C  CG1   . ILE E 3 245 ? 17.592  0.118   -4.168  1.00 16.08 ? 237  ILE A CG1   1 
ATOM   3128 C  CG2   . ILE E 3 245 ? 16.259  1.849   -5.311  1.00 16.64 ? 237  ILE A CG2   1 
ATOM   3129 C  CD1   . ILE E 3 245 ? 18.156  -1.273  -4.144  1.00 15.59 ? 237  ILE A CD1   1 
ATOM   3130 N  N     . ARG E 3 246 ? 13.187  0.076   -5.765  1.00 18.76 ? 238  ARG A N     1 
ATOM   3131 C  CA    . ARG E 3 246 ? 12.002  0.453   -6.536  1.00 19.82 ? 238  ARG A CA    1 
ATOM   3132 C  C     . ARG E 3 246 ? 10.920  1.177   -5.713  1.00 20.26 ? 238  ARG A C     1 
ATOM   3133 O  O     . ARG E 3 246 ? 10.766  0.966   -4.500  1.00 19.99 ? 238  ARG A O     1 
ATOM   3134 C  CB    . ARG E 3 246 ? 11.384  -0.780  -7.226  1.00 20.11 ? 238  ARG A CB    1 
ATOM   3135 C  CG    . ARG E 3 246 ? 11.292  -2.059  -6.343  1.00 22.60 ? 238  ARG A CG    1 
ATOM   3136 C  CD    . ARG E 3 246 ? 10.497  -1.918  -4.998  1.00 24.88 ? 238  ARG A CD    1 
ATOM   3137 N  NE    . ARG E 3 246 ? 9.687   -3.102  -4.651  1.00 27.12 ? 238  ARG A NE    1 
ATOM   3138 C  CZ    . ARG E 3 246 ? 8.488   -3.411  -5.187  1.00 28.07 ? 238  ARG A CZ    1 
ATOM   3139 N  NH1   . ARG E 3 246 ? 7.845   -4.513  -4.792  1.00 27.53 ? 238  ARG A NH1   1 
ATOM   3140 N  NH2   . ARG E 3 246 ? 7.931   -2.633  -6.123  1.00 28.14 ? 238  ARG A NH2   1 
ATOM   3141 N  N     . THR E 3 247 ? 10.173  2.030   -6.414  1.00 20.76 ? 239  THR A N     1 
ATOM   3142 C  CA    . THR E 3 247 ? 8.971   2.679   -5.887  1.00 20.89 ? 239  THR A CA    1 
ATOM   3143 C  C     . THR E 3 247 ? 8.087   1.636   -5.208  1.00 20.69 ? 239  THR A C     1 
ATOM   3144 O  O     . THR E 3 247 ? 7.618   0.704   -5.857  1.00 20.98 ? 239  THR A O     1 
ATOM   3145 C  CB    . THR E 3 247 ? 8.171   3.383   -7.068  1.00 21.00 ? 239  THR A CB    1 
ATOM   3146 O  OG1   . THR E 3 247 ? 9.026   4.281   -7.800  1.00 20.92 ? 239  THR A OG1   1 
ATOM   3147 C  CG2   . THR E 3 247 ? 7.048   4.299   -6.544  1.00 20.86 ? 239  THR A CG2   1 
ATOM   3148 N  N     . ARG E 3 248 ? 7.878   1.788   -3.909  1.00 20.64 ? 240  ARG A N     1 
ATOM   3149 C  CA    . ARG E 3 248 ? 7.001   0.906   -3.141  1.00 20.97 ? 240  ARG A CA    1 
ATOM   3150 C  C     . ARG E 3 248 ? 5.542   1.175   -3.477  1.00 20.91 ? 240  ARG A C     1 
ATOM   3151 O  O     . ARG E 3 248 ? 5.035   2.247   -3.152  1.00 21.56 ? 240  ARG A O     1 
ATOM   3152 C  CB    . ARG E 3 248 ? 7.183   1.168   -1.645  1.00 21.29 ? 240  ARG A CB    1 
ATOM   3153 C  CG    . ARG E 3 248 ? 8.609   1.014   -1.111  1.00 22.14 ? 240  ARG A CG    1 
ATOM   3154 C  CD    . ARG E 3 248 ? 8.642   0.488   0.311   1.00 24.48 ? 240  ARG A CD    1 
ATOM   3155 N  NE    . ARG E 3 248 ? 9.931   -0.115  0.662   1.00 26.80 ? 240  ARG A NE    1 
ATOM   3156 C  CZ    . ARG E 3 248 ? 10.112  -1.012  1.640   1.00 27.60 ? 240  ARG A CZ    1 
ATOM   3157 N  NH1   . ARG E 3 248 ? 9.087   -1.419  2.393   1.00 27.74 ? 240  ARG A NH1   1 
ATOM   3158 N  NH2   . ARG E 3 248 ? 11.335  -1.504  1.870   1.00 28.25 ? 240  ARG A NH2   1 
ATOM   3159 N  N     . VAL E 3 249 ? 4.855   0.227   -4.109  1.00 20.45 ? 241  VAL A N     1 
ATOM   3160 C  CA    . VAL E 3 249 ? 3.440   0.423   -4.429  1.00 20.21 ? 241  VAL A CA    1 
ATOM   3161 C  C     . VAL E 3 249 ? 2.552   0.081   -3.235  1.00 19.68 ? 241  VAL A C     1 
ATOM   3162 O  O     . VAL E 3 249 ? 2.484   -1.057  -2.801  1.00 19.49 ? 241  VAL A O     1 
ATOM   3163 C  CB    . VAL E 3 249 ? 2.964   -0.390  -5.667  1.00 20.51 ? 241  VAL A CB    1 
ATOM   3164 C  CG1   . VAL E 3 249 ? 1.520   -0.013  -6.013  1.00 20.34 ? 241  VAL A CG1   1 
ATOM   3165 C  CG2   . VAL E 3 249 ? 3.881   -0.147  -6.893  1.00 20.60 ? 241  VAL A CG2   1 
ATOM   3166 N  N     . ARG E 3 250 ? 1.853   1.090   -2.740  1.00 19.57 ? 242  ARG A N     1 
ATOM   3167 C  CA    . ARG E 3 250 ? 0.969   0.984   -1.576  1.00 19.52 ? 242  ARG A CA    1 
ATOM   3168 C  C     . ARG E 3 250 ? -0.288  0.164   -1.939  1.00 18.62 ? 242  ARG A C     1 
ATOM   3169 O  O     . ARG E 3 250 ? -1.001  0.494   -2.883  1.00 18.57 ? 242  ARG A O     1 
ATOM   3170 C  CB    . ARG E 3 250 ? 0.634   2.413   -1.130  1.00 19.80 ? 242  ARG A CB    1 
ATOM   3171 C  CG    . ARG E 3 250 ? -0.360  2.595   -0.018  1.00 22.70 ? 242  ARG A CG    1 
ATOM   3172 C  CD    . ARG E 3 250 ? 0.203   2.604   1.417   1.00 26.10 ? 242  ARG A CD    1 
ATOM   3173 N  NE    . ARG E 3 250 ? 1.443   3.365   1.631   1.00 28.88 ? 242  ARG A NE    1 
ATOM   3174 C  CZ    . ARG E 3 250 ? 2.680   2.833   1.690   1.00 31.20 ? 242  ARG A CZ    1 
ATOM   3175 N  NH1   . ARG E 3 250 ? 2.883   1.522   1.502   1.00 31.32 ? 242  ARG A NH1   1 
ATOM   3176 N  NH2   . ARG E 3 250 ? 3.730   3.629   1.923   1.00 31.48 ? 242  ARG A NH2   1 
ATOM   3177 N  N     . LYS E 3 251 ? -0.534  -0.921  -1.205  1.00 17.77 ? 243  LYS A N     1 
ATOM   3178 C  CA    . LYS E 3 251 ? -1.654  -1.836  -1.495  1.00 17.11 ? 243  LYS A CA    1 
ATOM   3179 C  C     . LYS E 3 251 ? -2.977  -1.427  -0.835  1.00 15.91 ? 243  LYS A C     1 
ATOM   3180 O  O     . LYS E 3 251 ? -4.037  -1.826  -1.294  1.00 15.95 ? 243  LYS A O     1 
ATOM   3181 C  CB    . LYS E 3 251 ? -1.328  -3.272  -1.060  1.00 17.22 ? 243  LYS A CB    1 
ATOM   3182 C  CG    . LYS E 3 251 ? -0.702  -4.140  -2.126  1.00 18.44 ? 243  LYS A CG    1 
ATOM   3183 C  CD    . LYS E 3 251 ? 0.556   -4.841  -1.587  1.00 21.28 ? 243  LYS A CD    1 
ATOM   3184 C  CE    . LYS E 3 251 ? 1.119   -5.903  -2.587  1.00 23.07 ? 243  LYS A CE    1 
ATOM   3185 N  NZ    . LYS E 3 251 ? 2.085   -6.871  -1.970  1.00 22.44 ? 243  LYS A NZ    1 
ATOM   3186 N  N     . SER E 3 252 ? -2.914  -0.667  0.249   1.00 14.51 ? 244  SER A N     1 
ATOM   3187 C  CA    . SER E 3 252 ? -4.119  -0.194  0.900   1.00 13.78 ? 244  SER A CA    1 
ATOM   3188 C  C     . SER E 3 252 ? -3.887  1.157   1.597   1.00 13.57 ? 244  SER A C     1 
ATOM   3189 O  O     . SER E 3 252 ? -2.758  1.498   1.934   1.00 14.06 ? 244  SER A O     1 
ATOM   3190 C  CB    . SER E 3 252 ? -4.642  -1.260  1.863   1.00 13.52 ? 244  SER A CB    1 
ATOM   3191 O  OG    . SER E 3 252 ? -4.024  -1.171  3.124   1.00 12.73 ? 244  SER A OG    1 
ATOM   3192 N  N     . ILE E 3 253 ? -4.956  1.934   1.769   1.00 12.91 ? 245  ILE A N     1 
ATOM   3193 C  CA    . ILE E 3 253 ? -4.891  3.265   2.375   1.00 12.62 ? 245  ILE A CA    1 
ATOM   3194 C  C     . ILE E 3 253 ? -6.145  3.511   3.218   1.00 12.55 ? 245  ILE A C     1 
ATOM   3195 O  O     . ILE E 3 253 ? -7.220  3.017   2.903   1.00 12.15 ? 245  ILE A O     1 
ATOM   3196 C  CB    . ILE E 3 253 ? -4.754  4.357   1.271   1.00 12.51 ? 245  ILE A CB    1 
ATOM   3197 C  CG1   . ILE E 3 253 ? -3.505  4.110   0.418   1.00 12.57 ? 245  ILE A CG1   1 
ATOM   3198 C  CG2   . ILE E 3 253 ? -4.686  5.745   1.881   1.00 12.69 ? 245  ILE A CG2   1 
ATOM   3199 C  CD1   . ILE E 3 253 ? -3.201  5.210   -0.590  1.00 12.49 ? 245  ILE A CD1   1 
ATOM   3200 N  N     . GLY E 3 254 ? -6.009  4.287   4.288   1.00 12.69 ? 246  GLY A N     1 
ATOM   3201 C  CA    . GLY E 3 254 ? -7.107  4.467   5.215   1.00 12.85 ? 246  GLY A CA    1 
ATOM   3202 C  C     . GLY E 3 254 ? -6.768  5.214   6.483   1.00 13.08 ? 246  GLY A C     1 
ATOM   3203 O  O     . GLY E 3 254 ? -5.617  5.531   6.739   1.00 13.16 ? 246  GLY A O     1 
ATOM   3204 N  N     . ARG E 3 255 ? -7.798  5.488   7.277   1.00 13.34 ? 247  ARG A N     1 
ATOM   3205 C  CA    . ARG E 3 255 ? -7.656  6.150   8.569   1.00 13.55 ? 247  ARG A CA    1 
ATOM   3206 C  C     . ARG E 3 255 ? -8.567  5.490   9.606   1.00 13.21 ? 247  ARG A C     1 
ATOM   3207 O  O     . ARG E 3 255 ? -9.692  5.094   9.297   1.00 13.10 ? 247  ARG A O     1 
ATOM   3208 C  CB    . ARG E 3 255 ? -8.030  7.634   8.427   1.00 13.92 ? 247  ARG A CB    1 
ATOM   3209 C  CG    . ARG E 3 255 ? -7.878  8.472   9.704   1.00 15.16 ? 247  ARG A CG    1 
ATOM   3210 C  CD    . ARG E 3 255 ? -6.794  9.519   9.609   1.00 17.24 ? 247  ARG A CD    1 
ATOM   3211 N  NE    . ARG E 3 255 ? -6.785  10.472  10.728  1.00 18.78 ? 247  ARG A NE    1 
ATOM   3212 C  CZ    . ARG E 3 255 ? -6.025  10.372  11.815  1.00 20.46 ? 247  ARG A CZ    1 
ATOM   3213 N  NH1   . ARG E 3 255 ? -5.233  9.327   12.028  1.00 22.36 ? 247  ARG A NH1   1 
ATOM   3214 N  NH2   . ARG E 3 255 ? -6.088  11.316  12.731  1.00 22.15 ? 247  ARG A NH2   1 
ATOM   3215 N  N     . ILE E 3 256 ? -8.085  5.367   10.835  1.00 12.81 ? 248  ILE A N     1 
ATOM   3216 C  CA    . ILE E 3 256 ? -8.995  5.099   11.941  1.00 12.83 ? 248  ILE A CA    1 
ATOM   3217 C  C     . ILE E 3 256 ? -8.681  6.016   13.126  1.00 12.34 ? 248  ILE A C     1 
ATOM   3218 O  O     . ILE E 3 256 ? -7.542  6.218   13.495  1.00 12.66 ? 248  ILE A O     1 
ATOM   3219 C  CB    . ILE E 3 256 ? -9.084  3.578   12.321  1.00 12.90 ? 248  ILE A CB    1 
ATOM   3220 C  CG1   . ILE E 3 256 ? -8.956  3.376   13.820  1.00 12.97 ? 248  ILE A CG1   1 
ATOM   3221 C  CG2   . ILE E 3 256 ? -8.067  2.702   11.548  1.00 13.20 ? 248  ILE A CG2   1 
ATOM   3222 C  CD1   . ILE E 3 256 ? -8.966  1.944   14.206  1.00 14.26 ? 248  ILE A CD1   1 
ATOM   3223 N  N     . VAL E 3 257 ? -9.732  6.584   13.685  1.00 11.84 ? 249  VAL A N     1 
ATOM   3224 C  CA    . VAL E 3 257 ? -9.635  7.602   14.700  1.00 11.62 ? 249  VAL A CA    1 
ATOM   3225 C  C     . VAL E 3 257 ? -10.158 7.077   16.025  1.00 11.11 ? 249  VAL A C     1 
ATOM   3226 O  O     . VAL E 3 257 ? -10.959 6.143   16.063  1.00 10.07 ? 249  VAL A O     1 
ATOM   3227 C  CB    . VAL E 3 257 ? -10.456 8.854   14.295  1.00 11.97 ? 249  VAL A CB    1 
ATOM   3228 C  CG1   . VAL E 3 257 ? -9.843  9.539   13.065  1.00 12.21 ? 249  VAL A CG1   1 
ATOM   3229 C  CG2   . VAL E 3 257 ? -11.921 8.505   14.028  1.00 12.35 ? 249  VAL A CG2   1 
ATOM   3230 N  N     . THR E 3 258 ? -9.708  7.705   17.109  1.00 11.00 ? 250  THR A N     1 
ATOM   3231 C  CA    . THR E 3 258 ? -10.240 7.423   18.435  1.00 10.83 ? 250  THR A CA    1 
ATOM   3232 C  C     . THR E 3 258 ? -11.411 8.323   18.724  1.00 11.19 ? 250  THR A C     1 
ATOM   3233 O  O     . THR E 3 258 ? -11.353 9.524   18.514  1.00 10.90 ? 250  THR A O     1 
ATOM   3234 C  CB    . THR E 3 258 ? -9.187  7.611   19.489  1.00 10.66 ? 250  THR A CB    1 
ATOM   3235 O  OG1   . THR E 3 258 ? -8.290  6.498   19.457  1.00 10.07 ? 250  THR A OG1   1 
ATOM   3236 C  CG2   . THR E 3 258 ? -9.809  7.568   20.900  1.00 11.06 ? 250  THR A CG2   1 
ATOM   3237 N  N     . MET E 3 259 ? -12.489 7.725   19.200  1.00 12.26 ? 251  MET A N     1 
ATOM   3238 C  CA    . MET E 3 259 ? -13.695 8.474   19.516  1.00 13.15 ? 251  MET A CA    1 
ATOM   3239 C  C     . MET E 3 259 ? -13.541 9.103   20.874  1.00 13.65 ? 251  MET A C     1 
ATOM   3240 O  O     . MET E 3 259 ? -12.742 8.662   21.678  1.00 13.81 ? 251  MET A O     1 
ATOM   3241 C  CB    . MET E 3 259 ? -14.921 7.571   19.475  1.00 13.17 ? 251  MET A CB    1 
ATOM   3242 C  CG    . MET E 3 259 ? -15.232 7.090   18.076  1.00 14.06 ? 251  MET A CG    1 
ATOM   3243 S  SD    . MET E 3 259 ? -16.852 6.375   17.961  1.00 15.55 ? 251  MET A SD    1 
ATOM   3244 C  CE    . MET E 3 259 ? -16.533 4.836   18.868  1.00 15.10 ? 251  MET A CE    1 
ATOM   3245 N  N     . LYS E 3 260 ? -14.304 10.150  21.121  1.00 14.64 ? 252  LYS A N     1 
ATOM   3246 C  CA    . LYS E 3 260 ? -14.192 10.867  22.372  1.00 15.66 ? 252  LYS A CA    1 
ATOM   3247 C  C     . LYS E 3 260 ? -14.581 9.900   23.512  1.00 16.05 ? 252  LYS A C     1 
ATOM   3248 O  O     . LYS E 3 260 ? -13.812 9.735   24.469  1.00 16.35 ? 252  LYS A O     1 
ATOM   3249 C  CB    . LYS E 3 260 ? -15.056 12.131  22.336  1.00 15.92 ? 252  LYS A CB    1 
ATOM   3250 C  CG    . LYS E 3 260 ? -14.782 13.110  23.449  1.00 16.98 ? 252  LYS A CG    1 
ATOM   3251 C  CD    . LYS E 3 260 ? -13.460 13.854  23.270  1.00 17.88 ? 252  LYS A CD    1 
ATOM   3252 C  CE    . LYS E 3 260 ? -13.180 14.797  24.469  1.00 18.93 ? 252  LYS A CE    1 
ATOM   3253 N  NZ    . LYS E 3 260 ? -14.355 14.993  25.398  1.00 18.39 ? 252  LYS A NZ    1 
ATOM   3254 N  N     . ARG E 3 261 ? -15.729 9.229   23.366  1.00 15.84 ? 253  ARG A N     1 
ATOM   3255 C  CA    . ARG E 3 261 ? -16.162 8.184   24.307  1.00 15.95 ? 253  ARG A CA    1 
ATOM   3256 C  C     . ARG E 3 261 ? -16.606 6.905   23.579  1.00 15.43 ? 253  ARG A C     1 
ATOM   3257 O  O     . ARG E 3 261 ? -17.060 6.963   22.430  1.00 15.62 ? 253  ARG A O     1 
ATOM   3258 C  CB    . ARG E 3 261 ? -17.297 8.698   25.206  1.00 16.24 ? 253  ARG A CB    1 
ATOM   3259 C  CG    . ARG E 3 261 ? -18.022 9.935   24.669  1.00 17.64 ? 253  ARG A CG    1 
ATOM   3260 C  CD    . ARG E 3 261 ? -19.292 10.294  25.410  1.00 18.14 ? 253  ARG A CD    1 
ATOM   3261 N  NE    . ARG E 3 261 ? -20.355 9.336   25.112  1.00 19.11 ? 253  ARG A NE    1 
ATOM   3262 C  CZ    . ARG E 3 261 ? -21.592 9.406   25.599  1.00 18.50 ? 253  ARG A CZ    1 
ATOM   3263 N  NH1   . ARG E 3 261 ? -21.930 10.397  26.410  1.00 18.22 ? 253  ARG A NH1   1 
ATOM   3264 N  NH2   . ARG E 3 261 ? -22.493 8.485   25.270  1.00 17.93 ? 253  ARG A NH2   1 
ATOM   3265 N  N     . ASN E 3 262 ? -16.481 5.754   24.244  1.00 14.79 ? 254  ASN A N     1 
ATOM   3266 C  CA    . ASN E 3 262 ? -16.921 4.488   23.648  1.00 14.49 ? 254  ASN A CA    1 
ATOM   3267 C  C     . ASN E 3 262 ? -18.412 4.566   23.341  1.00 14.31 ? 254  ASN A C     1 
ATOM   3268 O  O     . ASN E 3 262 ? -19.140 5.296   24.008  1.00 14.38 ? 254  ASN A O     1 
ATOM   3269 C  CB    . ASN E 3 262 ? -16.692 3.281   24.564  1.00 14.42 ? 254  ASN A CB    1 
ATOM   3270 C  CG    . ASN E 3 262 ? -15.260 3.131   25.022  1.00 14.52 ? 254  ASN A CG    1 
ATOM   3271 O  OD1   . ASN E 3 262 ? -14.317 3.366   24.279  1.00 14.70 ? 254  ASN A OD1   1 
ATOM   3272 N  ND2   . ASN E 3 262 ? -15.097 2.705   26.260  1.00 16.43 ? 254  ASN A ND2   1 
ATOM   3273 N  N     . SER E 3 263 ? -18.871 3.795   22.359  1.00 14.09 ? 255  SER A N     1 
ATOM   3274 C  CA    . SER E 3 263 ? -20.246 3.911   21.870  1.00 13.70 ? 255  SER A CA    1 
ATOM   3275 C  C     . SER E 3 263 ? -20.690 2.747   20.985  1.00 13.44 ? 255  SER A C     1 
ATOM   3276 O  O     . SER E 3 263 ? -19.869 2.029   20.413  1.00 13.26 ? 255  SER A O     1 
ATOM   3277 C  CB    . SER E 3 263 ? -20.405 5.223   21.090  1.00 13.71 ? 255  SER A CB    1 
ATOM   3278 O  OG    . SER E 3 263 ? -21.752 5.456   20.736  1.00 13.17 ? 255  SER A OG    1 
ATOM   3279 N  N     . ARG E 3 264 ? -22.010 2.588   20.899  1.00 13.37 ? 256  ARG A N     1 
ATOM   3280 C  CA    . ARG E 3 264 ? -22.675 1.666   19.981  1.00 13.28 ? 256  ARG A CA    1 
ATOM   3281 C  C     . ARG E 3 264 ? -23.814 2.384   19.263  1.00 13.43 ? 256  ARG A C     1 
ATOM   3282 O  O     . ARG E 3 264 ? -24.769 1.756   18.806  1.00 13.49 ? 256  ARG A O     1 
ATOM   3283 C  CB    . ARG E 3 264 ? -23.272 0.491   20.741  1.00 13.31 ? 256  ARG A CB    1 
ATOM   3284 C  CG    . ARG E 3 264 ? -22.307 -0.291  21.586  1.00 13.50 ? 256  ARG A CG    1 
ATOM   3285 C  CD    . ARG E 3 264 ? -22.954 -1.475  22.322  1.00 13.30 ? 256  ARG A CD    1 
ATOM   3286 N  NE    . ARG E 3 264 ? -23.865 -2.239  21.474  1.00 13.03 ? 256  ARG A NE    1 
ATOM   3287 C  CZ    . ARG E 3 264 ? -23.486 -2.976  20.430  1.00 14.19 ? 256  ARG A CZ    1 
ATOM   3288 N  NH1   . ARG E 3 264 ? -22.208 -3.070  20.089  1.00 15.10 ? 256  ARG A NH1   1 
ATOM   3289 N  NH2   . ARG E 3 264 ? -24.386 -3.632  19.716  1.00 14.25 ? 256  ARG A NH2   1 
ATOM   3290 N  N     . ASN E 3 265 ? -23.708 3.701   19.162  1.00 13.71 ? 257  ASN A N     1 
ATOM   3291 C  CA    . ASN E 3 265 ? -24.789 4.531   18.666  1.00 14.06 ? 257  ASN A CA    1 
ATOM   3292 C  C     . ASN E 3 265 ? -24.444 5.019   17.276  1.00 14.16 ? 257  ASN A C     1 
ATOM   3293 O  O     . ASN E 3 265 ? -23.563 5.860   17.111  1.00 14.24 ? 257  ASN A O     1 
ATOM   3294 C  CB    . ASN E 3 265 ? -25.012 5.716   19.603  1.00 14.25 ? 257  ASN A CB    1 
ATOM   3295 C  CG    . ASN E 3 265 ? -26.209 6.554   19.207  1.00 15.20 ? 257  ASN A CG    1 
ATOM   3296 O  OD1   . ASN E 3 265 ? -26.411 6.847   18.030  1.00 17.08 ? 257  ASN A OD1   1 
ATOM   3297 N  ND2   . ASN E 3 265 ? -27.007 6.952   20.191  1.00 15.40 ? 257  ASN A ND2   1 
ATOM   3298 N  N     . LEU E 3 266 ? -25.140 4.479   16.282  1.00 14.26 ? 258  LEU A N     1 
ATOM   3299 C  CA    . LEU E 3 266 ? -24.873 4.789   14.882  1.00 14.55 ? 258  LEU A CA    1 
ATOM   3300 C  C     . LEU E 3 266 ? -24.632 6.285   14.632  1.00 15.07 ? 258  LEU A C     1 
ATOM   3301 O  O     . LEU E 3 266 ? -23.654 6.658   14.004  1.00 14.75 ? 258  LEU A O     1 
ATOM   3302 C  CB    . LEU E 3 266 ? -26.042 4.299   14.032  1.00 14.50 ? 258  LEU A CB    1 
ATOM   3303 C  CG    . LEU E 3 266 ? -25.883 4.260   12.521  1.00 14.57 ? 258  LEU A CG    1 
ATOM   3304 C  CD1   . LEU E 3 266 ? -24.776 3.277   12.133  1.00 15.40 ? 258  LEU A CD1   1 
ATOM   3305 C  CD2   . LEU E 3 266 ? -27.206 3.859   11.883  1.00 14.32 ? 258  LEU A CD2   1 
ATOM   3306 N  N     . GLU E 3 267 ? -25.525 7.135   15.134  1.00 15.84 ? 259  GLU A N     1 
ATOM   3307 C  CA    . GLU E 3 267 ? -25.447 8.580   14.879  1.00 16.24 ? 259  GLU A CA    1 
ATOM   3308 C  C     . GLU E 3 267 ? -24.315 9.270   15.647  1.00 16.33 ? 259  GLU A C     1 
ATOM   3309 O  O     . GLU E 3 267 ? -23.860 10.343  15.246  1.00 16.50 ? 259  GLU A O     1 
ATOM   3310 C  CB    . GLU E 3 267 ? -26.770 9.275   15.218  1.00 16.38 ? 259  GLU A CB    1 
ATOM   3311 C  CG    . GLU E 3 267 ? -28.015 8.652   14.606  1.00 17.20 ? 259  GLU A CG    1 
ATOM   3312 C  CD    . GLU E 3 267 ? -27.975 8.584   13.089  1.00 17.81 ? 259  GLU A CD    1 
ATOM   3313 O  OE1   . GLU E 3 267 ? -27.677 9.615   12.450  1.00 17.52 ? 259  GLU A OE1   1 
ATOM   3314 O  OE2   . GLU E 3 267 ? -28.268 7.497   12.538  1.00 18.58 ? 259  GLU A OE2   1 
ATOM   3315 N  N     . GLU E 3 268 ? -23.889 8.681   16.760  1.00 16.32 ? 260  GLU A N     1 
ATOM   3316 C  CA    . GLU E 3 268 ? -22.734 9.188   17.500  1.00 16.53 ? 260  GLU A CA    1 
ATOM   3317 C  C     . GLU E 3 268 ? -21.399 8.819   16.809  1.00 16.35 ? 260  GLU A C     1 
ATOM   3318 O  O     . GLU E 3 268 ? -20.414 9.553   16.934  1.00 16.30 ? 260  GLU A O     1 
ATOM   3319 C  CB    . GLU E 3 268 ? -22.763 8.668   18.948  1.00 16.72 ? 260  GLU A CB    1 
ATOM   3320 C  CG    . GLU E 3 268 ? -21.882 9.445   19.920  1.00 17.46 ? 260  GLU A CG    1 
ATOM   3321 C  CD    . GLU E 3 268 ? -21.896 8.872   21.333  1.00 19.09 ? 260  GLU A CD    1 
ATOM   3322 O  OE1   . GLU E 3 268 ? -22.757 8.017   21.636  1.00 19.94 ? 260  GLU A OE1   1 
ATOM   3323 O  OE2   . GLU E 3 268 ? -21.042 9.283   22.156  1.00 20.29 ? 260  GLU A OE2   1 
ATOM   3324 N  N     . ILE E 3 269 ? -21.385 7.699   16.081  1.00 16.13 ? 261  ILE A N     1 
ATOM   3325 C  CA    . ILE E 3 269 ? -20.180 7.164   15.422  1.00 16.02 ? 261  ILE A CA    1 
ATOM   3326 C  C     . ILE E 3 269 ? -20.039 7.706   14.004  1.00 16.24 ? 261  ILE A C     1 
ATOM   3327 O  O     . ILE E 3 269 ? -18.928 8.020   13.561  1.00 16.03 ? 261  ILE A O     1 
ATOM   3328 C  CB    . ILE E 3 269 ? -20.222 5.603   15.377  1.00 15.78 ? 261  ILE A CB    1 
ATOM   3329 C  CG1   . ILE E 3 269 ? -20.212 5.014   16.788  1.00 15.60 ? 261  ILE A CG1   1 
ATOM   3330 C  CG2   . ILE E 3 269 ? -19.047 5.035   14.604  1.00 15.59 ? 261  ILE A CG2   1 
ATOM   3331 C  CD1   . ILE E 3 269 ? -20.938 3.690   16.887  1.00 15.45 ? 261  ILE A CD1   1 
ATOM   3332 N  N     . LYS E 3 270 ? -21.173 7.794   13.304  1.00 16.43 ? 262  LYS A N     1 
ATOM   3333 C  CA    . LYS E 3 270 ? -21.267 8.361   11.956  1.00 16.63 ? 262  LYS A CA    1 
ATOM   3334 C  C     . LYS E 3 270 ? -20.248 9.485   11.688  1.00 16.45 ? 262  LYS A C     1 
ATOM   3335 O  O     . LYS E 3 270 ? -19.482 9.393   10.738  1.00 16.58 ? 262  LYS A O     1 
ATOM   3336 C  CB    . LYS E 3 270 ? -22.699 8.878   11.684  1.00 16.90 ? 262  LYS A CB    1 
ATOM   3337 C  CG    . LYS E 3 270 ? -23.477 8.148   10.559  1.00 17.61 ? 262  LYS A CG    1 
ATOM   3338 C  CD    . LYS E 3 270 ? -25.009 8.361   10.688  1.00 18.17 ? 262  LYS A CD    1 
ATOM   3339 C  CE    . LYS E 3 270 ? -25.728 8.514   9.338   1.00 18.76 ? 262  LYS A CE    1 
ATOM   3340 N  NZ    . LYS E 3 270 ? -26.763 7.457   9.096   1.00 18.60 ? 262  LYS A NZ    1 
ATOM   3341 N  N     . PRO E 3 271 ? -20.224 10.532  12.510  1.00 16.24 ? 263  PRO A N     1 
ATOM   3342 C  CA    . PRO E 3 271 ? -19.345 11.673  12.238  1.00 16.28 ? 263  PRO A CA    1 
ATOM   3343 C  C     . PRO E 3 271 ? -17.878 11.282  12.156  1.00 16.05 ? 263  PRO A C     1 
ATOM   3344 O  O     . PRO E 3 271 ? -17.210 11.766  11.259  1.00 16.42 ? 263  PRO A O     1 
ATOM   3345 C  CB    . PRO E 3 271 ? -19.592 12.618  13.429  1.00 16.21 ? 263  PRO A CB    1 
ATOM   3346 C  CG    . PRO E 3 271 ? -20.899 12.211  13.980  1.00 16.28 ? 263  PRO A CG    1 
ATOM   3347 C  CD    . PRO E 3 271 ? -20.994 10.729  13.751  1.00 16.39 ? 263  PRO A CD    1 
ATOM   3348 N  N     . TYR E 3 272 ? -17.407 10.434  13.070  1.00 15.88 ? 264  TYR A N     1 
ATOM   3349 C  CA    . TYR E 3 272 ? -16.018 9.938   13.077  1.00 15.37 ? 264  TYR A CA    1 
ATOM   3350 C  C     . TYR E 3 272 ? -15.665 9.103   11.856  1.00 15.38 ? 264  TYR A C     1 
ATOM   3351 O  O     . TYR E 3 272 ? -14.589 9.279   11.275  1.00 15.56 ? 264  TYR A O     1 
ATOM   3352 C  CB    . TYR E 3 272 ? -15.752 9.067   14.302  1.00 15.10 ? 264  TYR A CB    1 
ATOM   3353 C  CG    . TYR E 3 272 ? -15.763 9.815   15.596  1.00 14.42 ? 264  TYR A CG    1 
ATOM   3354 C  CD1   . TYR E 3 272 ? -14.627 10.476  16.038  1.00 13.99 ? 264  TYR A CD1   1 
ATOM   3355 C  CD2   . TYR E 3 272 ? -16.908 9.864   16.384  1.00 12.59 ? 264  TYR A CD2   1 
ATOM   3356 C  CE1   . TYR E 3 272 ? -14.630 11.174  17.225  1.00 13.47 ? 264  TYR A CE1   1 
ATOM   3357 C  CE2   . TYR E 3 272 ? -16.914 10.545  17.561  1.00 13.12 ? 264  TYR A CE2   1 
ATOM   3358 C  CZ    . TYR E 3 272 ? -15.768 11.205  17.978  1.00 13.20 ? 264  TYR A CZ    1 
ATOM   3359 O  OH    . TYR E 3 272 ? -15.759 11.899  19.153  1.00 13.60 ? 264  TYR A OH    1 
ATOM   3360 N  N     . LEU E 3 273 ? -16.547 8.168   11.504  1.00 14.92 ? 265  LEU A N     1 
ATOM   3361 C  CA    . LEU E 3 273 ? -16.334 7.311   10.348  1.00 14.80 ? 265  LEU A CA    1 
ATOM   3362 C  C     . LEU E 3 273 ? -16.266 8.149   9.079   1.00 14.70 ? 265  LEU A C     1 
ATOM   3363 O  O     . LEU E 3 273 ? -15.440 7.917   8.204   1.00 14.17 ? 265  LEU A O     1 
ATOM   3364 C  CB    . LEU E 3 273 ? -17.463 6.290   10.239  1.00 14.97 ? 265  LEU A CB    1 
ATOM   3365 C  CG    . LEU E 3 273 ? -17.497 5.401   8.992   1.00 14.61 ? 265  LEU A CG    1 
ATOM   3366 C  CD1   . LEU E 3 273 ? -16.210 4.612   8.860   1.00 14.26 ? 265  LEU A CD1   1 
ATOM   3367 C  CD2   . LEU E 3 273 ? -18.715 4.477   9.066   1.00 14.52 ? 265  LEU A CD2   1 
ATOM   3368 N  N     . PHE E 3 274 ? -17.150 9.133   9.002   1.00 14.90 ? 266  PHE A N     1 
ATOM   3369 C  CA    . PHE E 3 274 ? -17.223 10.034  7.859   1.00 14.98 ? 266  PHE A CA    1 
ATOM   3370 C  C     . PHE E 3 274 ? -15.971 10.900  7.781   1.00 15.08 ? 266  PHE A C     1 
ATOM   3371 O  O     . PHE E 3 274 ? -15.492 11.207  6.694   1.00 14.98 ? 266  PHE A O     1 
ATOM   3372 C  CB    . PHE E 3 274 ? -18.469 10.933  7.966   1.00 14.84 ? 266  PHE A CB    1 
ATOM   3373 C  CG    . PHE E 3 274 ? -19.787 10.235  7.674   1.00 14.82 ? 266  PHE A CG    1 
ATOM   3374 C  CD1   . PHE E 3 274 ? -19.847 8.992   7.054   1.00 15.14 ? 266  PHE A CD1   1 
ATOM   3375 C  CD2   . PHE E 3 274 ? -20.982 10.852  8.017   1.00 14.81 ? 266  PHE A CD2   1 
ATOM   3376 C  CE1   . PHE E 3 274 ? -21.070 8.395   6.783   1.00 14.71 ? 266  PHE A CE1   1 
ATOM   3377 C  CE2   . PHE E 3 274 ? -22.192 10.254  7.754   1.00 14.32 ? 266  PHE A CE2   1 
ATOM   3378 C  CZ    . PHE E 3 274 ? -22.237 9.028   7.135   1.00 14.12 ? 266  PHE A CZ    1 
ATOM   3379 N  N     . ARG E 3 275 ? -15.451 11.291  8.941   1.00 15.33 ? 267  ARG A N     1 
ATOM   3380 C  CA    . ARG E 3 275 ? -14.249 12.115  9.023   1.00 15.60 ? 267  ARG A CA    1 
ATOM   3381 C  C     . ARG E 3 275 ? -13.037 11.301  8.542   1.00 15.01 ? 267  ARG A C     1 
ATOM   3382 O  O     . ARG E 3 275 ? -12.174 11.824  7.862   1.00 14.97 ? 267  ARG A O     1 
ATOM   3383 C  CB    . ARG E 3 275 ? -14.059 12.616  10.463  1.00 15.91 ? 267  ARG A CB    1 
ATOM   3384 C  CG    . ARG E 3 275 ? -13.126 13.840  10.645  1.00 18.56 ? 267  ARG A CG    1 
ATOM   3385 C  CD    . ARG E 3 275 ? -13.191 14.517  12.080  1.00 20.81 ? 267  ARG A CD    1 
ATOM   3386 N  NE    . ARG E 3 275 ? -14.576 14.746  12.559  1.00 22.24 ? 267  ARG A NE    1 
ATOM   3387 C  CZ    . ARG E 3 275 ? -15.105 14.311  13.722  1.00 22.82 ? 267  ARG A CZ    1 
ATOM   3388 N  NH1   . ARG E 3 275 ? -14.400 13.592  14.601  1.00 23.32 ? 267  ARG A NH1   1 
ATOM   3389 N  NH2   . ARG E 3 275 ? -16.372 14.597  14.008  1.00 22.64 ? 267  ARG A NH2   1 
ATOM   3390 N  N     . ALA E 3 276 ? -13.011 10.017  8.884   1.00 14.54 ? 268  ALA A N     1 
ATOM   3391 C  CA    . ALA E 3 276 ? -11.933 9.110   8.510   1.00 14.37 ? 268  ALA A CA    1 
ATOM   3392 C  C     . ALA E 3 276 ? -11.933 8.803   7.011   1.00 14.30 ? 268  ALA A C     1 
ATOM   3393 O  O     . ALA E 3 276 ? -10.881 8.649   6.407   1.00 13.93 ? 268  ALA A O     1 
ATOM   3394 C  CB    . ALA E 3 276 ? -12.063 7.821   9.291   1.00 14.31 ? 268  ALA A CB    1 
ATOM   3395 N  N     . ILE E 3 277 ? -13.121 8.702   6.431   1.00 14.22 ? 269  ILE A N     1 
ATOM   3396 C  CA    . ILE E 3 277 ? -13.277 8.459   5.013   1.00 14.27 ? 269  ILE A CA    1 
ATOM   3397 C  C     . ILE E 3 277 ? -12.789 9.658   4.212   1.00 14.79 ? 269  ILE A C     1 
ATOM   3398 O  O     . ILE E 3 277 ? -12.138 9.496   3.179   1.00 15.01 ? 269  ILE A O     1 
ATOM   3399 C  CB    . ILE E 3 277 ? -14.751 8.155   4.700   1.00 14.30 ? 269  ILE A CB    1 
ATOM   3400 C  CG1   . ILE E 3 277 ? -15.087 6.747   5.205   1.00 13.99 ? 269  ILE A CG1   1 
ATOM   3401 C  CG2   . ILE E 3 277 ? -15.053 8.325   3.194   1.00 13.75 ? 269  ILE A CG2   1 
ATOM   3402 C  CD1   . ILE E 3 277 ? -16.528 6.348   5.011   1.00 13.92 ? 269  ILE A CD1   1 
ATOM   3403 N  N     . GLU E 3 278 ? -13.109 10.855  4.684   1.00 14.98 ? 270  GLU A N     1 
ATOM   3404 C  CA    . GLU E 3 278 ? -12.655 12.074  4.039   1.00 15.51 ? 270  GLU A CA    1 
ATOM   3405 C  C     . GLU E 3 278 ? -11.154 12.078  3.950   1.00 15.64 ? 270  GLU A C     1 
ATOM   3406 O  O     . GLU E 3 278 ? -10.585 12.244  2.872   1.00 15.38 ? 270  GLU A O     1 
ATOM   3407 C  CB    . GLU E 3 278 ? -13.079 13.305  4.837   1.00 15.87 ? 270  GLU A CB    1 
ATOM   3408 C  CG    . GLU E 3 278 ? -14.437 13.844  4.449   1.00 17.92 ? 270  GLU A CG    1 
ATOM   3409 C  CD    . GLU E 3 278 ? -14.365 14.925  3.387   1.00 20.87 ? 270  GLU A CD    1 
ATOM   3410 O  OE1   . GLU E 3 278 ? -13.536 15.859  3.569   1.00 21.98 ? 270  GLU A OE1   1 
ATOM   3411 O  OE2   . GLU E 3 278 ? -15.149 14.842  2.389   1.00 21.75 ? 270  GLU A OE2   1 
ATOM   3412 N  N     . GLU E 3 279 ? -10.517 11.915  5.106   1.00 15.98 ? 271  GLU A N     1 
ATOM   3413 C  CA    . GLU E 3 279 ? -9.069  12.004  5.196   1.00 16.54 ? 271  GLU A CA    1 
ATOM   3414 C  C     . GLU E 3 279 ? -8.415  10.912  4.361   1.00 16.50 ? 271  GLU A C     1 
ATOM   3415 O  O     . GLU E 3 279 ? -7.416  11.146  3.699   1.00 16.73 ? 271  GLU A O     1 
ATOM   3416 C  CB    . GLU E 3 279 ? -8.603  11.971  6.659   1.00 16.69 ? 271  GLU A CB    1 
ATOM   3417 C  CG    . GLU E 3 279 ? -8.641  13.351  7.303   1.00 17.80 ? 271  GLU A CG    1 
ATOM   3418 C  CD    . GLU E 3 279 ? -8.643  13.325  8.827   1.00 19.06 ? 271  GLU A CD    1 
ATOM   3419 O  OE1   . GLU E 3 279 ? -7.956  12.458  9.411   1.00 19.39 ? 271  GLU A OE1   1 
ATOM   3420 O  OE2   . GLU E 3 279 ? -9.323  14.191  9.438   1.00 18.83 ? 271  GLU A OE2   1 
ATOM   3421 N  N     . SER E 3 280 ? -9.020  9.737   4.352   1.00 16.73 ? 272  SER A N     1 
ATOM   3422 C  CA    . SER E 3 280 ? -8.528  8.626   3.555   1.00 16.81 ? 272  SER A CA    1 
ATOM   3423 C  C     . SER E 3 280 ? -8.542  8.953   2.068   1.00 17.03 ? 272  SER A C     1 
ATOM   3424 O  O     . SER E 3 280 ? -7.626  8.586   1.355   1.00 16.65 ? 272  SER A O     1 
ATOM   3425 C  CB    . SER E 3 280 ? -9.377  7.378   3.818   1.00 16.95 ? 272  SER A CB    1 
ATOM   3426 O  OG    . SER E 3 280 ? -9.293  6.961   5.172   1.00 16.35 ? 272  SER A OG    1 
ATOM   3427 N  N     . TYR E 3 281 ? -9.579  9.648   1.613   1.00 17.89 ? 273  TYR A N     1 
ATOM   3428 C  CA    . TYR E 3 281 ? -9.768  9.932   0.180   1.00 18.74 ? 273  TYR A CA    1 
ATOM   3429 C  C     . TYR E 3 281 ? -8.793  10.952  -0.373  1.00 19.49 ? 273  TYR A C     1 
ATOM   3430 O  O     . TYR E 3 281 ? -8.388  10.869  -1.525  1.00 19.39 ? 273  TYR A O     1 
ATOM   3431 C  CB    . TYR E 3 281 ? -11.198 10.399  -0.116  1.00 18.66 ? 273  TYR A CB    1 
ATOM   3432 C  CG    . TYR E 3 281 ? -11.930 9.357   -0.871  1.00 18.46 ? 273  TYR A CG    1 
ATOM   3433 C  CD1   . TYR E 3 281 ? -12.097 9.449   -2.241  1.00 18.04 ? 273  TYR A CD1   1 
ATOM   3434 C  CD2   . TYR E 3 281 ? -12.394 8.232   -0.219  1.00 19.52 ? 273  TYR A CD2   1 
ATOM   3435 C  CE1   . TYR E 3 281 ? -12.744 8.458   -2.931  1.00 19.56 ? 273  TYR A CE1   1 
ATOM   3436 C  CE2   . TYR E 3 281 ? -13.042 7.243   -0.893  1.00 20.19 ? 273  TYR A CE2   1 
ATOM   3437 C  CZ    . TYR E 3 281 ? -13.215 7.353   -2.243  1.00 20.45 ? 273  TYR A CZ    1 
ATOM   3438 O  OH    . TYR E 3 281 ? -13.866 6.337   -2.887  1.00 23.40 ? 273  TYR A OH    1 
ATOM   3439 N  N     . TYR E 3 282 ? -8.452  11.928  0.455   1.00 20.63 ? 274  TYR A N     1 
ATOM   3440 C  CA    . TYR E 3 282 ? -7.387  12.864  0.153   1.00 21.66 ? 274  TYR A CA    1 
ATOM   3441 C  C     . TYR E 3 282 ? -6.046  12.124  0.075   1.00 21.65 ? 274  TYR A C     1 
ATOM   3442 O  O     . TYR E 3 282 ? -5.240  12.383  -0.813  1.00 22.18 ? 274  TYR A O     1 
ATOM   3443 C  CB    . TYR E 3 282 ? -7.340  13.953  1.224   1.00 22.22 ? 274  TYR A CB    1 
ATOM   3444 C  CG    . TYR E 3 282 ? -6.290  15.018  0.983   1.00 24.41 ? 274  TYR A CG    1 
ATOM   3445 C  CD1   . TYR E 3 282 ? -6.477  15.996  0.002   1.00 25.36 ? 274  TYR A CD1   1 
ATOM   3446 C  CD2   . TYR E 3 282 ? -5.108  15.052  1.742   1.00 25.79 ? 274  TYR A CD2   1 
ATOM   3447 C  CE1   . TYR E 3 282 ? -5.521  16.979  -0.221  1.00 26.11 ? 274  TYR A CE1   1 
ATOM   3448 C  CE2   . TYR E 3 282 ? -4.145  16.026  1.518   1.00 26.93 ? 274  TYR A CE2   1 
ATOM   3449 C  CZ    . TYR E 3 282 ? -4.362  16.987  0.538   1.00 27.19 ? 274  TYR A CZ    1 
ATOM   3450 O  OH    . TYR E 3 282 ? -3.413  17.960  0.320   1.00 29.78 ? 274  TYR A OH    1 
ATOM   3451 N  N     . LYS E 3 283 ? -5.813  11.189  0.985   1.00 21.51 ? 275  LYS A N     1 
ATOM   3452 C  CA    . LYS E 3 283 ? -4.597  10.385  0.919   1.00 21.47 ? 275  LYS A CA    1 
ATOM   3453 C  C     . LYS E 3 283 ? -4.550  9.543   -0.374  1.00 21.29 ? 275  LYS A C     1 
ATOM   3454 O  O     . LYS E 3 283 ? -3.463  9.341   -0.918  1.00 21.64 ? 275  LYS A O     1 
ATOM   3455 C  CB    . LYS E 3 283 ? -4.417  9.531   2.189   1.00 21.45 ? 275  LYS A CB    1 
ATOM   3456 C  CG    . LYS E 3 283 ? -4.084  10.380  3.445   1.00 22.24 ? 275  LYS A CG    1 
ATOM   3457 C  CD    . LYS E 3 283 ? -3.851  9.539   4.730   1.00 24.21 ? 275  LYS A CD    1 
ATOM   3458 C  CE    . LYS E 3 283 ? -3.043  10.324  5.834   1.00 25.49 ? 275  LYS A CE    1 
ATOM   3459 N  NZ    . LYS E 3 283 ? -3.825  10.743  7.084   1.00 24.98 ? 275  LYS A NZ    1 
ATOM   3460 N  N     . LEU E 3 284 ? -5.705  9.110   -0.893  1.00 20.86 ? 276  LEU A N     1 
ATOM   3461 C  CA    . LEU E 3 284 ? -5.744  8.249   -2.092  1.00 20.71 ? 276  LEU A CA    1 
ATOM   3462 C  C     . LEU E 3 284 ? -5.230  8.973   -3.330  1.00 20.71 ? 276  LEU A C     1 
ATOM   3463 O  O     . LEU E 3 284 ? -4.533  8.382   -4.144  1.00 20.74 ? 276  LEU A O     1 
ATOM   3464 C  CB    . LEU E 3 284 ? -7.158  7.739   -2.394  1.00 20.70 ? 276  LEU A CB    1 
ATOM   3465 C  CG    . LEU E 3 284 ? -7.785  6.647   -1.531  1.00 20.03 ? 276  LEU A CG    1 
ATOM   3466 C  CD1   . LEU E 3 284 ? -9.253  6.472   -1.893  1.00 19.77 ? 276  LEU A CD1   1 
ATOM   3467 C  CD2   . LEU E 3 284 ? -7.057  5.356   -1.712  1.00 20.08 ? 276  LEU A CD2   1 
ATOM   3468 N  N     . ASP E 3 285 ? -5.610  10.242  -3.471  1.00 20.82 ? 277  ASP A N     1 
ATOM   3469 C  CA    . ASP E 3 285 ? -5.078  11.136  -4.508  1.00 20.91 ? 277  ASP A CA    1 
ATOM   3470 C  C     . ASP E 3 285 ? -5.054  10.504  -5.909  1.00 20.55 ? 277  ASP A C     1 
ATOM   3471 O  O     . ASP E 3 285 ? -3.989  10.101  -6.411  1.00 20.67 ? 277  ASP A O     1 
ATOM   3472 C  CB    . ASP E 3 285 ? -3.684  11.634  -4.092  1.00 21.13 ? 277  ASP A CB    1 
ATOM   3473 C  CG    . ASP E 3 285 ? -2.950  12.352  -5.211  1.00 22.65 ? 277  ASP A CG    1 
ATOM   3474 O  OD1   . ASP E 3 285 ? -1.821  11.917  -5.550  1.00 25.68 ? 277  ASP A OD1   1 
ATOM   3475 O  OD2   . ASP E 3 285 ? -3.418  13.346  -5.813  1.00 23.69 ? 277  ASP A OD2   1 
ATOM   3476 N  N     . LYS E 3 286 ? -6.240  10.416  -6.521  1.00 19.85 ? 278  LYS A N     1 
ATOM   3477 C  CA    . LYS E 3 286 ? -6.422  9.896   -7.885  1.00 19.29 ? 278  LYS A CA    1 
ATOM   3478 C  C     . LYS E 3 286 ? -6.491  8.364   -7.989  1.00 18.76 ? 278  LYS A C     1 
ATOM   3479 O  O     . LYS E 3 286 ? -6.942  7.840   -9.010  1.00 19.08 ? 278  LYS A O     1 
ATOM   3480 C  CB    . LYS E 3 286 ? -5.357  10.434  -8.858  1.00 19.32 ? 278  LYS A CB    1 
ATOM   3481 C  CG    . LYS E 3 286 ? -5.232  11.958  -8.894  1.00 19.91 ? 278  LYS A CG    1 
ATOM   3482 C  CD    . LYS E 3 286 ? -6.026  12.575  -10.041 1.00 20.34 ? 278  LYS A CD    1 
ATOM   3483 C  CE    . LYS E 3 286 ? -5.310  12.445  -11.395 1.00 20.59 ? 278  LYS A CE    1 
ATOM   3484 N  NZ    . LYS E 3 286 ? -5.407  13.703  -12.206 1.00 20.26 ? 278  LYS A NZ    1 
ATOM   3485 N  N     . ARG E 3 287 ? -6.057  7.644   -6.957  1.00 17.89 ? 279  ARG A N     1 
ATOM   3486 C  CA    . ARG E 3 287 ? -6.197  6.191   -6.936  1.00 17.42 ? 279  ARG A CA    1 
ATOM   3487 C  C     . ARG E 3 287 ? -7.666  5.822   -6.720  1.00 16.53 ? 279  ARG A C     1 
ATOM   3488 O  O     . ARG E 3 287 ? -8.345  6.463   -5.925  1.00 16.81 ? 279  ARG A O     1 
ATOM   3489 C  CB    . ARG E 3 287 ? -5.304  5.579   -5.849  1.00 17.56 ? 279  ARG A CB    1 
ATOM   3490 C  CG    . ARG E 3 287 ? -3.822  5.601   -6.219  1.00 19.17 ? 279  ARG A CG    1 
ATOM   3491 C  CD    . ARG E 3 287 ? -2.923  4.788   -5.317  1.00 21.59 ? 279  ARG A CD    1 
ATOM   3492 N  NE    . ARG E 3 287 ? -2.502  5.566   -4.157  1.00 24.17 ? 279  ARG A NE    1 
ATOM   3493 C  CZ    . ARG E 3 287 ? -1.315  6.159   -4.000  1.00 26.24 ? 279  ARG A CZ    1 
ATOM   3494 N  NH1   . ARG E 3 287 ? -0.358  6.079   -4.922  1.00 27.41 ? 279  ARG A NH1   1 
ATOM   3495 N  NH2   . ARG E 3 287 ? -1.078  6.845   -2.891  1.00 27.04 ? 279  ARG A NH2   1 
ATOM   3496 N  N     . ILE E 3 288 ? -8.159  4.822   -7.451  1.00 15.49 ? 280  ILE A N     1 
ATOM   3497 C  CA    . ILE E 3 288 ? -9.551  4.370   -7.331  1.00 14.77 ? 280  ILE A CA    1 
ATOM   3498 C  C     . ILE E 3 288 ? -9.595  2.994   -6.678  1.00 14.03 ? 280  ILE A C     1 
ATOM   3499 O  O     . ILE E 3 288 ? -9.160  2.020   -7.277  1.00 13.98 ? 280  ILE A O     1 
ATOM   3500 C  CB    . ILE E 3 288 ? -10.248 4.265   -8.716  1.00 14.77 ? 280  ILE A CB    1 
ATOM   3501 C  CG1   . ILE E 3 288 ? -10.078 5.537   -9.558  1.00 15.65 ? 280  ILE A CG1   1 
ATOM   3502 C  CG2   . ILE E 3 288 ? -11.733 3.956   -8.533  1.00 14.91 ? 280  ILE A CG2   1 
ATOM   3503 C  CD1   . ILE E 3 288 ? -10.496 6.821   -8.860  1.00 16.52 ? 280  ILE A CD1   1 
ATOM   3504 N  N     . PRO E 3 289 ? -10.135 2.888   -5.470  1.00 13.29 ? 281  PRO A N     1 
ATOM   3505 C  CA    . PRO E 3 289 ? -10.237 1.584   -4.811  1.00 12.88 ? 281  PRO A CA    1 
ATOM   3506 C  C     . PRO E 3 289 ? -11.509 0.851   -5.229  1.00 12.54 ? 281  PRO A C     1 
ATOM   3507 O  O     . PRO E 3 289 ? -12.508 1.496   -5.554  1.00 12.19 ? 281  PRO A O     1 
ATOM   3508 C  CB    . PRO E 3 289 ? -10.281 1.954   -3.330  1.00 12.69 ? 281  PRO A CB    1 
ATOM   3509 C  CG    . PRO E 3 289 ? -10.928 3.285   -3.305  1.00 13.19 ? 281  PRO A CG    1 
ATOM   3510 C  CD    . PRO E 3 289 ? -10.686 3.962   -4.631  1.00 13.12 ? 281  PRO A CD    1 
ATOM   3511 N  N     . LYS E 3 290 ? -11.453 -0.479  -5.231  1.00 12.07 ? 282  LYS A N     1 
ATOM   3512 C  CA    . LYS E 3 290 ? -12.615 -1.315  -5.497  1.00 11.80 ? 282  LYS A CA    1 
ATOM   3513 C  C     . LYS E 3 290 ? -13.137 -1.934  -4.197  1.00 11.52 ? 282  LYS A C     1 
ATOM   3514 O  O     . LYS E 3 290 ? -14.197 -2.553  -4.188  1.00 11.45 ? 282  LYS A O     1 
ATOM   3515 C  CB    . LYS E 3 290 ? -12.259 -2.430  -6.479  1.00 12.00 ? 282  LYS A CB    1 
ATOM   3516 C  CG    . LYS E 3 290 ? -12.062 -1.993  -7.916  1.00 12.92 ? 282  LYS A CG    1 
ATOM   3517 C  CD    . LYS E 3 290 ? -11.540 -3.144  -8.769  1.00 15.07 ? 282  LYS A CD    1 
ATOM   3518 C  CE    . LYS E 3 290 ? -12.079 -3.084  -10.202 1.00 18.08 ? 282  LYS A CE    1 
ATOM   3519 N  NZ    . LYS E 3 290 ? -13.121 -4.141  -10.519 1.00 19.13 ? 282  LYS A NZ    1 
ATOM   3520 N  N     . ALA E 3 291 ? -12.408 -1.762  -3.095  1.00 11.14 ? 283  ALA A N     1 
ATOM   3521 C  CA    . ALA E 3 291 ? -12.782 -2.406  -1.841  1.00 10.63 ? 283  ALA A CA    1 
ATOM   3522 C  C     . ALA E 3 291 ? -12.715 -1.458  -0.653  1.00 9.98  ? 283  ALA A C     1 
ATOM   3523 O  O     . ALA E 3 291 ? -11.820 -0.622  -0.561  1.00 9.31  ? 283  ALA A O     1 
ATOM   3524 C  CB    . ALA E 3 291 ? -11.912 -3.637  -1.605  1.00 10.62 ? 283  ALA A CB    1 
ATOM   3525 N  N     . ILE E 3 292 ? -13.689 -1.604  0.243   1.00 9.61  ? 284  ILE A N     1 
ATOM   3526 C  CA    . ILE E 3 292 ? -13.758 -0.850  1.496   1.00 9.30  ? 284  ILE A CA    1 
ATOM   3527 C  C     . ILE E 3 292 ? -13.941 -1.816  2.663   1.00 8.85  ? 284  ILE A C     1 
ATOM   3528 O  O     . ILE E 3 292 ? -14.743 -2.720  2.589   1.00 8.90  ? 284  ILE A O     1 
ATOM   3529 C  CB    . ILE E 3 292 ? -14.918 0.195   1.452   1.00 9.32  ? 284  ILE A CB    1 
ATOM   3530 C  CG1   . ILE E 3 292 ? -15.091 0.884   2.810   1.00 9.80  ? 284  ILE A CG1   1 
ATOM   3531 C  CG2   . ILE E 3 292 ? -16.238 -0.428  1.031   1.00 9.08  ? 284  ILE A CG2   1 
ATOM   3532 C  CD1   . ILE E 3 292 ? -15.747 2.284   2.736   1.00 9.46  ? 284  ILE A CD1   1 
ATOM   3533 N  N     . HIS E 3 293 ? -13.170 -1.630  3.725   1.00 8.75  ? 285  HIS A N     1 
ATOM   3534 C  CA    . HIS E 3 293 ? -13.400 -2.303  4.998   1.00 8.65  ? 285  HIS A CA    1 
ATOM   3535 C  C     . HIS E 3 293 ? -13.568 -1.229  6.061   1.00 8.34  ? 285  HIS A C     1 
ATOM   3536 O  O     . HIS E 3 293 ? -12.738 -0.336  6.181   1.00 7.97  ? 285  HIS A O     1 
ATOM   3537 C  CB    . HIS E 3 293 ? -12.235 -3.223  5.369   1.00 8.94  ? 285  HIS A CB    1 
ATOM   3538 C  CG    . HIS E 3 293 ? -12.112 -4.425  4.486   1.00 10.34 ? 285  HIS A CG    1 
ATOM   3539 N  ND1   . HIS E 3 293 ? -12.808 -5.590  4.719   1.00 12.23 ? 285  HIS A ND1   1 
ATOM   3540 C  CD2   . HIS E 3 293 ? -11.385 -4.641  3.363   1.00 11.60 ? 285  HIS A CD2   1 
ATOM   3541 C  CE1   . HIS E 3 293 ? -12.520 -6.469  3.774   1.00 13.07 ? 285  HIS A CE1   1 
ATOM   3542 N  NE2   . HIS E 3 293 ? -11.653 -5.919  2.942   1.00 11.99 ? 285  HIS A NE2   1 
ATOM   3543 N  N     . VAL E 3 294 ? -14.668 -1.299  6.804   1.00 8.12  ? 286  VAL A N     1 
ATOM   3544 C  CA    . VAL E 3 294 ? -14.794 -0.571  8.057   1.00 8.04  ? 286  VAL A CA    1 
ATOM   3545 C  C     . VAL E 3 294 ? -14.127 -1.378  9.185   1.00 7.86  ? 286  VAL A C     1 
ATOM   3546 O  O     . VAL E 3 294 ? -14.406 -2.546  9.370   1.00 7.36  ? 286  VAL A O     1 
ATOM   3547 C  CB    . VAL E 3 294 ? -16.262 -0.288  8.382   1.00 7.99  ? 286  VAL A CB    1 
ATOM   3548 C  CG1   . VAL E 3 294 ? -16.410 0.291   9.785   1.00 8.14  ? 286  VAL A CG1   1 
ATOM   3549 C  CG2   . VAL E 3 294 ? -16.837 0.660   7.355   1.00 8.19  ? 286  VAL A CG2   1 
ATOM   3550 N  N     . VAL E 3 295 ? -13.220 -0.738  9.908   1.00 8.22  ? 287  VAL A N     1 
ATOM   3551 C  CA    . VAL E 3 295 ? -12.532 -1.340  11.045  1.00 8.40  ? 287  VAL A CA    1 
ATOM   3552 C  C     . VAL E 3 295 ? -12.997 -0.641  12.315  1.00 8.82  ? 287  VAL A C     1 
ATOM   3553 O  O     . VAL E 3 295 ? -12.754 0.554   12.493  1.00 8.67  ? 287  VAL A O     1 
ATOM   3554 C  CB    . VAL E 3 295 ? -10.998 -1.174  10.947  1.00 8.17  ? 287  VAL A CB    1 
ATOM   3555 C  CG1   . VAL E 3 295 ? -10.311 -1.948  12.051  1.00 8.39  ? 287  VAL A CG1   1 
ATOM   3556 C  CG2   . VAL E 3 295 ? -10.483 -1.611  9.587   1.00 7.77  ? 287  VAL A CG2   1 
ATOM   3557 N  N     . ALA E 3 296 ? -13.670 -1.397  13.182  1.00 9.53  ? 288  ALA A N     1 
ATOM   3558 C  CA    . ALA E 3 296 ? -14.030 -0.954  14.526  1.00 10.06 ? 288  ALA A CA    1 
ATOM   3559 C  C     . ALA E 3 296 ? -13.058 -1.594  15.501  1.00 10.57 ? 288  ALA A C     1 
ATOM   3560 O  O     . ALA E 3 296 ? -12.901 -2.800  15.491  1.00 10.53 ? 288  ALA A O     1 
ATOM   3561 C  CB    . ALA E 3 296 ? -15.453 -1.377  14.854  1.00 9.95  ? 288  ALA A CB    1 
ATOM   3562 N  N     . VAL E 3 297 ? -12.364 -0.787  16.300  1.00 11.45 ? 289  VAL A N     1 
ATOM   3563 C  CA    . VAL E 3 297 ? -11.594 -1.302  17.430  1.00 12.13 ? 289  VAL A CA    1 
ATOM   3564 C  C     . VAL E 3 297 ? -12.459 -1.191  18.671  1.00 12.88 ? 289  VAL A C     1 
ATOM   3565 O  O     . VAL E 3 297 ? -12.964 -0.128  18.976  1.00 12.73 ? 289  VAL A O     1 
ATOM   3566 C  CB    . VAL E 3 297 ? -10.296 -0.531  17.675  1.00 11.94 ? 289  VAL A CB    1 
ATOM   3567 C  CG1   . VAL E 3 297 ? -9.509  -1.174  18.793  1.00 12.27 ? 289  VAL A CG1   1 
ATOM   3568 C  CG2   . VAL E 3 297 ? -9.454  -0.500  16.445  1.00 12.29 ? 289  VAL A CG2   1 
ATOM   3569 N  N     . THR E 3 298 ? -12.595 -2.291  19.393  1.00 14.03 ? 290  THR A N     1 
ATOM   3570 C  CA    . THR E 3 298 ? -13.551 -2.396  20.485  1.00 15.17 ? 290  THR A CA    1 
ATOM   3571 C  C     . THR E 3 298 ? -12.998 -1.871  21.818  1.00 15.94 ? 290  THR A C     1 
ATOM   3572 O  O     . THR E 3 298 ? -11.819 -1.536  21.919  1.00 15.93 ? 290  THR A O     1 
ATOM   3573 C  CB    . THR E 3 298 ? -13.977 -3.869  20.641  1.00 15.32 ? 290  THR A CB    1 
ATOM   3574 O  OG1   . THR E 3 298 ? -12.828 -4.680  20.925  1.00 15.63 ? 290  THR A OG1   1 
ATOM   3575 C  CG2   . THR E 3 298 ? -14.498 -4.423  19.322  1.00 15.54 ? 290  THR A CG2   1 
ATOM   3576 N  N     . GLU E 3 299 ? -13.877 -1.825  22.825  1.00 16.90 ? 291  GLU A N     1 
ATOM   3577 C  CA    . GLU E 3 299 ? -13.574 -1.427  24.218  1.00 17.65 ? 291  GLU A CA    1 
ATOM   3578 C  C     . GLU E 3 299 ? -12.274 -2.027  24.787  1.00 17.88 ? 291  GLU A C     1 
ATOM   3579 O  O     . GLU E 3 299 ? -11.604 -1.391  25.591  1.00 17.96 ? 291  GLU A O     1 
ATOM   3580 C  CB    . GLU E 3 299 ? -14.756 -1.851  25.119  1.00 17.90 ? 291  GLU A CB    1 
ATOM   3581 C  CG    . GLU E 3 299 ? -14.874 -1.146  26.468  1.00 19.27 ? 291  GLU A CG    1 
ATOM   3582 C  CD    . GLU E 3 299 ? -16.293 -1.212  27.046  1.00 20.62 ? 291  GLU A CD    1 
ATOM   3583 O  OE1   . GLU E 3 299 ? -16.918 -2.294  26.983  1.00 21.02 ? 291  GLU A OE1   1 
ATOM   3584 O  OE2   . GLU E 3 299 ? -16.791 -0.181  27.558  1.00 20.94 ? 291  GLU A OE2   1 
ATOM   3585 N  N     . ASP E 3 300 ? -11.938 -3.243  24.358  1.00 18.35 ? 292  ASP A N     1 
ATOM   3586 C  CA    . ASP E 3 300 ? -10.762 -3.992  24.831  1.00 18.75 ? 292  ASP A CA    1 
ATOM   3587 C  C     . ASP E 3 300 ? -9.636  -4.100  23.777  1.00 19.06 ? 292  ASP A C     1 
ATOM   3588 O  O     . ASP E 3 300 ? -8.873  -5.063  23.770  1.00 19.48 ? 292  ASP A O     1 
ATOM   3589 C  CB    . ASP E 3 300 ? -11.200 -5.400  25.246  1.00 18.87 ? 292  ASP A CB    1 
ATOM   3590 C  CG    . ASP E 3 300 ? -12.205 -6.012  24.275  1.00 19.39 ? 292  ASP A CG    1 
ATOM   3591 O  OD1   . ASP E 3 300 ? -13.255 -6.508  24.727  1.00 21.38 ? 292  ASP A OD1   1 
ATOM   3592 O  OD2   . ASP E 3 300 ? -12.050 -6.015  23.042  1.00 19.88 ? 292  ASP A OD2   1 
ATOM   3593 N  N     . LEU E 3 301 ? -9.539  -3.107  22.897  1.00 19.14 ? 293  LEU A N     1 
ATOM   3594 C  CA    . LEU E 3 301 ? -8.576  -3.082  21.783  1.00 19.02 ? 293  LEU A CA    1 
ATOM   3595 C  C     . LEU E 3 301 ? -8.519  -4.319  20.850  1.00 18.91 ? 293  LEU A C     1 
ATOM   3596 O  O     . LEU E 3 301 ? -7.522  -4.504  20.140  1.00 18.93 ? 293  LEU A O     1 
ATOM   3597 C  CB    . LEU E 3 301 ? -7.183  -2.719  22.302  1.00 19.08 ? 293  LEU A CB    1 
ATOM   3598 C  CG    . LEU E 3 301 ? -7.140  -1.516  23.261  1.00 19.50 ? 293  LEU A CG    1 
ATOM   3599 C  CD1   . LEU E 3 301 ? -5.712  -1.234  23.736  1.00 18.92 ? 293  LEU A CD1   1 
ATOM   3600 C  CD2   . LEU E 3 301 ? -7.741  -0.258  22.616  1.00 19.98 ? 293  LEU A CD2   1 
ATOM   3601 N  N     . ASP E 3 302 ? -9.586  -5.130  20.828  1.00 18.59 ? 294  ASP A N     1 
ATOM   3602 C  CA    . ASP E 3 302 ? -9.773  -6.164  19.792  1.00 18.60 ? 294  ASP A CA    1 
ATOM   3603 C  C     . ASP E 3 302 ? -10.308 -5.484  18.529  1.00 17.83 ? 294  ASP A C     1 
ATOM   3604 O  O     . ASP E 3 302 ? -10.675 -4.317  18.574  1.00 17.57 ? 294  ASP A O     1 
ATOM   3605 C  CB    . ASP E 3 302 ? -10.743 -7.265  20.261  1.00 18.94 ? 294  ASP A CB    1 
ATOM   3606 C  CG    . ASP E 3 302 ? -10.463 -8.625  19.614  1.00 21.06 ? 294  ASP A CG    1 
ATOM   3607 O  OD1   . ASP E 3 302 ? -9.321  -9.119  19.754  1.00 24.62 ? 294  ASP A OD1   1 
ATOM   3608 O  OD2   . ASP E 3 302 ? -11.315 -9.285  18.964  1.00 23.12 ? 294  ASP A OD2   1 
ATOM   3609 N  N     . ILE E 3 303 ? -10.350 -6.202  17.408  1.00 17.11 ? 295  ILE A N     1 
ATOM   3610 C  CA    . ILE E 3 303 ? -10.731 -5.596  16.125  1.00 16.50 ? 295  ILE A CA    1 
ATOM   3611 C  C     . ILE E 3 303 ? -11.849 -6.354  15.430  1.00 15.76 ? 295  ILE A C     1 
ATOM   3612 O  O     . ILE E 3 303 ? -11.877 -7.576  15.441  1.00 15.90 ? 295  ILE A O     1 
ATOM   3613 C  CB    . ILE E 3 303 ? -9.497  -5.470  15.221  1.00 16.62 ? 295  ILE A CB    1 
ATOM   3614 C  CG1   . ILE E 3 303 ? -8.621  -4.331  15.752  1.00 17.39 ? 295  ILE A CG1   1 
ATOM   3615 C  CG2   . ILE E 3 303 ? -9.900  -5.224  13.748  1.00 16.53 ? 295  ILE A CG2   1 
ATOM   3616 C  CD1   . ILE E 3 303 ? -7.243  -4.262  15.153  1.00 18.37 ? 295  ILE A CD1   1 
ATOM   3617 N  N     . VAL E 3 304 ? -12.764 -5.603  14.824  1.00 15.17 ? 296  VAL A N     1 
ATOM   3618 C  CA    . VAL E 3 304 ? -13.938 -6.148  14.139  1.00 14.83 ? 296  VAL A CA    1 
ATOM   3619 C  C     . VAL E 3 304 ? -14.055 -5.469  12.777  1.00 14.37 ? 296  VAL A C     1 
ATOM   3620 O  O     . VAL E 3 304 ? -14.529 -4.332  12.682  1.00 13.94 ? 296  VAL A O     1 
ATOM   3621 C  CB    . VAL E 3 304 ? -15.228 -5.895  14.942  1.00 14.83 ? 296  VAL A CB    1 
ATOM   3622 C  CG1   . VAL E 3 304 ? -16.408 -6.563  14.284  1.00 14.93 ? 296  VAL A CG1   1 
ATOM   3623 C  CG2   . VAL E 3 304 ? -15.070 -6.389  16.374  1.00 15.49 ? 296  VAL A CG2   1 
ATOM   3624 N  N     . SER E 3 305 ? -13.588 -6.167  11.740  1.00 13.79 ? 297  SER A N     1 
ATOM   3625 C  CA    . SER E 3 305 ? -13.673 -5.699  10.361  1.00 13.41 ? 297  SER A CA    1 
ATOM   3626 C  C     . SER E 3 305 ? -14.922 -6.223  9.635   1.00 12.90 ? 297  SER A C     1 
ATOM   3627 O  O     . SER E 3 305 ? -15.201 -7.412  9.688   1.00 12.86 ? 297  SER A O     1 
ATOM   3628 C  CB    . SER E 3 305 ? -12.429 -6.151  9.602   1.00 13.41 ? 297  SER A CB    1 
ATOM   3629 O  OG    . SER E 3 305 ? -12.549 -5.911  8.210   1.00 13.72 ? 297  SER A OG    1 
ATOM   3630 N  N     . ARG E 3 306 ? -15.669 -5.328  8.981   1.00 12.43 ? 298  ARG A N     1 
ATOM   3631 C  CA    . ARG E 3 306 ? -16.642 -5.697  7.935   1.00 12.17 ? 298  ARG A CA    1 
ATOM   3632 C  C     . ARG E 3 306 ? -16.321 -5.001  6.602   1.00 11.75 ? 298  ARG A C     1 
ATOM   3633 O  O     . ARG E 3 306 ? -16.065 -3.805  6.570   1.00 11.37 ? 298  ARG A O     1 
ATOM   3634 C  CB    . ARG E 3 306 ? -18.056 -5.315  8.356   1.00 12.24 ? 298  ARG A CB    1 
ATOM   3635 C  CG    . ARG E 3 306 ? -18.625 -6.163  9.457   1.00 13.15 ? 298  ARG A CG    1 
ATOM   3636 C  CD    . ARG E 3 306 ? -18.989 -7.559  9.021   1.00 15.19 ? 298  ARG A CD    1 
ATOM   3637 N  NE    . ARG E 3 306 ? -19.328 -8.437  10.143  1.00 16.98 ? 298  ARG A NE    1 
ATOM   3638 C  CZ    . ARG E 3 306 ? -18.438 -8.990  10.960  1.00 17.95 ? 298  ARG A CZ    1 
ATOM   3639 N  NH1   . ARG E 3 306 ? -17.144 -8.741  10.821  1.00 19.12 ? 298  ARG A NH1   1 
ATOM   3640 N  NH2   . ARG E 3 306 ? -18.846 -9.783  11.934  1.00 17.82 ? 298  ARG A NH2   1 
ATOM   3641 N  N     . GLY E 3 307 ? -16.358 -5.742  5.500   1.00 11.60 ? 299  GLY A N     1 
ATOM   3642 C  CA    . GLY E 3 307 ? -15.959 -5.194  4.209   1.00 11.64 ? 299  GLY A CA    1 
ATOM   3643 C  C     . GLY E 3 307 ? -16.771 -5.648  3.009   1.00 11.69 ? 299  GLY A C     1 
ATOM   3644 O  O     . GLY E 3 307 ? -17.628 -6.514  3.125   1.00 11.32 ? 299  GLY A O     1 
ATOM   3645 N  N     . ARG E 3 308 ? -16.492 -5.032  1.860   1.00 11.89 ? 300  ARG A N     1 
ATOM   3646 C  CA    . ARG E 3 308 ? -17.132 -5.350  0.578   1.00 12.01 ? 300  ARG A CA    1 
ATOM   3647 C  C     . ARG E 3 308 ? -16.165 -5.052  -0.565  1.00 11.70 ? 300  ARG A C     1 
ATOM   3648 O  O     . ARG E 3 308 ? -15.466 -4.041  -0.550  1.00 11.53 ? 300  ARG A O     1 
ATOM   3649 C  CB    . ARG E 3 308 ? -18.410 -4.517  0.394   1.00 12.20 ? 300  ARG A CB    1 
ATOM   3650 C  CG    . ARG E 3 308 ? -19.289 -4.899  -0.809  1.00 13.31 ? 300  ARG A CG    1 
ATOM   3651 C  CD    . ARG E 3 308 ? -20.811 -4.941  -0.499  1.00 15.88 ? 300  ARG A CD    1 
ATOM   3652 N  NE    . ARG E 3 308 ? -21.611 -5.134  -1.716  1.00 18.89 ? 300  ARG A NE    1 
ATOM   3653 C  CZ    . ARG E 3 308 ? -22.703 -4.419  -2.073  1.00 22.21 ? 300  ARG A CZ    1 
ATOM   3654 N  NH1   . ARG E 3 308 ? -23.189 -3.444  -1.300  1.00 23.17 ? 300  ARG A NH1   1 
ATOM   3655 N  NH2   . ARG E 3 308 ? -23.327 -4.684  -3.226  1.00 22.54 ? 300  ARG A NH2   1 
ATOM   3656 N  N     . THR E 3 309 ? -16.122 -5.937  -1.553  1.00 11.67 ? 301  THR A N     1 
ATOM   3657 C  CA    . THR E 3 309 ? -15.434 -5.652  -2.811  1.00 11.55 ? 301  THR A CA    1 
ATOM   3658 C  C     . THR E 3 309 ? -16.498 -5.417  -3.875  1.00 11.49 ? 301  THR A C     1 
ATOM   3659 O  O     . THR E 3 309 ? -17.472 -6.146  -3.951  1.00 11.23 ? 301  THR A O     1 
ATOM   3660 C  CB    . THR E 3 309 ? -14.491 -6.804  -3.215  1.00 11.35 ? 301  THR A CB    1 
ATOM   3661 O  OG1   . THR E 3 309 ? -13.275 -6.711  -2.472  1.00 11.35 ? 301  THR A OG1   1 
ATOM   3662 C  CG2   . THR E 3 309 ? -14.013 -6.657  -4.650  1.00 11.09 ? 301  THR A CG2   1 
ATOM   3663 N  N     . PHE E 3 310 ? -16.295 -4.393  -4.691  1.00 11.77 ? 302  PHE A N     1 
ATOM   3664 C  CA    . PHE E 3 310 ? -17.252 -4.008  -5.713  1.00 12.20 ? 302  PHE A CA    1 
ATOM   3665 C  C     . PHE E 3 310 ? -16.773 -4.430  -7.095  1.00 12.43 ? 302  PHE A C     1 
ATOM   3666 O  O     . PHE E 3 310 ? -15.572 -4.521  -7.335  1.00 12.20 ? 302  PHE A O     1 
ATOM   3667 C  CB    . PHE E 3 310 ? -17.482 -2.495  -5.672  1.00 12.11 ? 302  PHE A CB    1 
ATOM   3668 C  CG    . PHE E 3 310 ? -18.327 -2.060  -4.520  1.00 11.56 ? 302  PHE A CG    1 
ATOM   3669 C  CD1   . PHE E 3 310 ? -17.746 -1.656  -3.325  1.00 10.68 ? 302  PHE A CD1   1 
ATOM   3670 C  CD2   . PHE E 3 310 ? -19.708 -2.092  -4.624  1.00 10.63 ? 302  PHE A CD2   1 
ATOM   3671 C  CE1   . PHE E 3 310 ? -18.524 -1.279  -2.275  1.00 9.94  ? 302  PHE A CE1   1 
ATOM   3672 C  CE2   . PHE E 3 310 ? -20.489 -1.718  -3.588  1.00 10.24 ? 302  PHE A CE2   1 
ATOM   3673 C  CZ    . PHE E 3 310 ? -19.908 -1.312  -2.410  1.00 11.20 ? 302  PHE A CZ    1 
ATOM   3674 N  N     . PRO E 3 311 ? -17.712 -4.684  -8.005  1.00 12.97 ? 303  PRO A N     1 
ATOM   3675 C  CA    . PRO E 3 311 ? -17.357 -4.947  -9.405  1.00 13.26 ? 303  PRO A CA    1 
ATOM   3676 C  C     . PRO E 3 311 ? -16.690 -3.716  -10.033 1.00 13.92 ? 303  PRO A C     1 
ATOM   3677 O  O     . PRO E 3 311 ? -15.860 -3.850  -10.933 1.00 14.26 ? 303  PRO A O     1 
ATOM   3678 C  CB    . PRO E 3 311 ? -18.708 -5.233  -10.078 1.00 12.91 ? 303  PRO A CB    1 
ATOM   3679 C  CG    . PRO E 3 311 ? -19.687 -5.427  -8.996  1.00 12.91 ? 303  PRO A CG    1 
ATOM   3680 C  CD    . PRO E 3 311 ? -19.170 -4.728  -7.779  1.00 12.99 ? 303  PRO A CD    1 
ATOM   3681 N  N     . HIS E 3 312 ? -17.058 -2.536  -9.531  1.00 14.40 ? 304  HIS A N     1 
ATOM   3682 C  CA    . HIS E 3 312 ? -16.626 -1.254  -10.064 1.00 14.67 ? 304  HIS A CA    1 
ATOM   3683 C  C     . HIS E 3 312 ? -15.907 -0.418  -8.960  1.00 13.97 ? 304  HIS A C     1 
ATOM   3684 O  O     . HIS E 3 312 ? -15.792 -0.853  -7.810  1.00 13.79 ? 304  HIS A O     1 
ATOM   3685 C  CB    . HIS E 3 312 ? -17.856 -0.530  -10.644 1.00 15.08 ? 304  HIS A CB    1 
ATOM   3686 C  CG    . HIS E 3 312 ? -18.503 -1.230  -11.829 1.00 18.52 ? 304  HIS A CG    1 
ATOM   3687 N  ND1   . HIS E 3 312 ? -17.783 -1.823  -12.853 1.00 20.39 ? 304  HIS A ND1   1 
ATOM   3688 C  CD2   . HIS E 3 312 ? -19.815 -1.386  -12.167 1.00 20.02 ? 304  HIS A CD2   1 
ATOM   3689 C  CE1   . HIS E 3 312 ? -18.620 -2.322  -13.753 1.00 20.19 ? 304  HIS A CE1   1 
ATOM   3690 N  NE2   . HIS E 3 312 ? -19.857 -2.073  -13.359 1.00 18.92 ? 304  HIS A NE2   1 
ATOM   3691 N  N     . GLY E 3 313 ? -15.391 0.756   -9.319  1.00 13.10 ? 305  GLY A N     1 
ATOM   3692 C  CA    . GLY E 3 313 ? -14.670 1.613   -8.383  1.00 12.51 ? 305  GLY A CA    1 
ATOM   3693 C  C     . GLY E 3 313 ? -15.527 2.340   -7.351  1.00 11.83 ? 305  GLY A C     1 
ATOM   3694 O  O     . GLY E 3 313 ? -16.723 2.511   -7.544  1.00 11.91 ? 305  GLY A O     1 
ATOM   3695 N  N     . ILE E 3 314 ? -14.900 2.801   -6.271  1.00 11.04 ? 306  ILE A N     1 
ATOM   3696 C  CA    . ILE E 3 314 ? -15.608 3.405   -5.143  1.00 10.57 ? 306  ILE A CA    1 
ATOM   3697 C  C     . ILE E 3 314 ? -15.393 4.919   -5.086  1.00 9.91  ? 306  ILE A C     1 
ATOM   3698 O  O     . ILE E 3 314 ? -14.274 5.387   -4.933  1.00 9.62  ? 306  ILE A O     1 
ATOM   3699 C  CB    . ILE E 3 314 ? -15.150 2.778   -3.810  1.00 10.75 ? 306  ILE A CB    1 
ATOM   3700 C  CG1   . ILE E 3 314 ? -15.319 1.254   -3.823  1.00 10.52 ? 306  ILE A CG1   1 
ATOM   3701 C  CG2   . ILE E 3 314 ? -15.971 3.337   -2.661  1.00 11.25 ? 306  ILE A CG2   1 
ATOM   3702 C  CD1   . ILE E 3 314 ? -14.780 0.570   -2.578  1.00 10.43 ? 306  ILE A CD1   1 
ATOM   3703 N  N     . SER E 3 315 ? -16.476 5.678   -5.200  1.00 9.34  ? 307  SER A N     1 
ATOM   3704 C  CA    . SER E 3 315 ? -16.431 7.126   -5.077  1.00 8.76  ? 307  SER A CA    1 
ATOM   3705 C  C     . SER E 3 315 ? -16.551 7.488   -3.618  1.00 8.79  ? 307  SER A C     1 
ATOM   3706 O  O     . SER E 3 315 ? -17.074 6.708   -2.824  1.00 8.10  ? 307  SER A O     1 
ATOM   3707 C  CB    . SER E 3 315 ? -17.569 7.778   -5.876  1.00 8.81  ? 307  SER A CB    1 
ATOM   3708 O  OG    . SER E 3 315 ? -18.856 7.490   -5.344  1.00 6.77  ? 307  SER A OG    1 
ATOM   3709 N  N     . LYS E 3 316 ? -16.055 8.671   -3.266  1.00 9.25  ? 308  LYS A N     1 
ATOM   3710 C  CA    . LYS E 3 316 ? -16.168 9.197   -1.893  1.00 9.59  ? 308  LYS A CA    1 
ATOM   3711 C  C     . LYS E 3 316 ? -17.588 9.054   -1.332  1.00 9.57  ? 308  LYS A C     1 
ATOM   3712 O  O     . LYS E 3 316 ? -17.788 8.643   -0.187  1.00 9.20  ? 308  LYS A O     1 
ATOM   3713 C  CB    . LYS E 3 316 ? -15.759 10.670  -1.848  1.00 9.44  ? 308  LYS A CB    1 
ATOM   3714 C  CG    . LYS E 3 316 ? -15.738 11.235  -0.444  1.00 10.31 ? 308  LYS A CG    1 
ATOM   3715 C  CD    . LYS E 3 316 ? -14.918 12.505  -0.340  1.00 11.75 ? 308  LYS A CD    1 
ATOM   3716 C  CE    . LYS E 3 316 ? -15.673 13.712  -0.875  1.00 11.70 ? 308  LYS A CE    1 
ATOM   3717 N  NZ    . LYS E 3 316 ? -14.871 14.929  -0.615  1.00 12.32 ? 308  LYS A NZ    1 
ATOM   3718 N  N     . GLU E 3 317 ? -18.555 9.369   -2.180  1.00 9.74  ? 309  GLU A N     1 
ATOM   3719 C  CA    . GLU E 3 317 ? -19.956 9.459   -1.815  1.00 10.37 ? 309  GLU A CA    1 
ATOM   3720 C  C     . GLU E 3 317 ? -20.540 8.053   -1.611  1.00 10.18 ? 309  GLU A C     1 
ATOM   3721 O  O     . GLU E 3 317 ? -21.368 7.828   -0.730  1.00 10.32 ? 309  GLU A O     1 
ATOM   3722 C  CB    . GLU E 3 317 ? -20.709 10.237  -2.906  1.00 10.62 ? 309  GLU A CB    1 
ATOM   3723 C  CG    . GLU E 3 317 ? -20.147 11.645  -3.198  1.00 12.79 ? 309  GLU A CG    1 
ATOM   3724 C  CD    . GLU E 3 317 ? -18.845 11.692  -4.046  1.00 15.05 ? 309  GLU A CD    1 
ATOM   3725 O  OE1   . GLU E 3 317 ? -18.514 10.711  -4.765  1.00 14.97 ? 309  GLU A OE1   1 
ATOM   3726 O  OE2   . GLU E 3 317 ? -18.132 12.734  -3.994  1.00 15.94 ? 309  GLU A OE2   1 
ATOM   3727 N  N     . THR E 3 318 ? -20.082 7.109   -2.419  1.00 9.92  ? 310  THR A N     1 
ATOM   3728 C  CA    . THR E 3 318 ? -20.458 5.712   -2.274  1.00 9.85  ? 310  THR A CA    1 
ATOM   3729 C  C     . THR E 3 318 ? -19.830 5.102   -1.027  1.00 9.80  ? 310  THR A C     1 
ATOM   3730 O  O     . THR E 3 318 ? -20.400 4.201   -0.415  1.00 9.13  ? 310  THR A O     1 
ATOM   3731 C  CB    . THR E 3 318 ? -20.026 4.943   -3.531  1.00 9.74  ? 310  THR A CB    1 
ATOM   3732 O  OG1   . THR E 3 318 ? -20.675 5.514   -4.667  1.00 9.82  ? 310  THR A OG1   1 
ATOM   3733 C  CG2   . THR E 3 318 ? -20.512 3.511   -3.520  1.00 9.36  ? 310  THR A CG2   1 
ATOM   3734 N  N     . ALA E 3 319 ? -18.652 5.596   -0.664  1.00 10.10 ? 311  ALA A N     1 
ATOM   3735 C  CA    . ALA E 3 319 ? -17.957 5.137   0.527   1.00 10.48 ? 311  ALA A CA    1 
ATOM   3736 C  C     . ALA E 3 319 ? -18.754 5.486   1.785   1.00 10.91 ? 311  ALA A C     1 
ATOM   3737 O  O     . ALA E 3 319 ? -18.806 4.692   2.707   1.00 10.92 ? 311  ALA A O     1 
ATOM   3738 C  CB    . ALA E 3 319 ? -16.564 5.734   0.593   1.00 10.37 ? 311  ALA A CB    1 
ATOM   3739 N  N     . TYR E 3 320 ? -19.390 6.656   1.816   1.00 11.41 ? 312  TYR A N     1 
ATOM   3740 C  CA    . TYR E 3 320 ? -20.182 7.048   2.975   1.00 12.00 ? 312  TYR A CA    1 
ATOM   3741 C  C     . TYR E 3 320 ? -21.357 6.086   3.117   1.00 12.19 ? 312  TYR A C     1 
ATOM   3742 O  O     . TYR E 3 320 ? -21.535 5.466   4.161   1.00 12.27 ? 312  TYR A O     1 
ATOM   3743 C  CB    . TYR E 3 320 ? -20.723 8.475   2.844   1.00 12.28 ? 312  TYR A CB    1 
ATOM   3744 C  CG    . TYR E 3 320 ? -19.722 9.613   2.920   1.00 13.28 ? 312  TYR A CG    1 
ATOM   3745 C  CD1   . TYR E 3 320 ? -18.799 9.701   3.953   1.00 15.39 ? 312  TYR A CD1   1 
ATOM   3746 C  CD2   . TYR E 3 320 ? -19.737 10.635  1.971   1.00 14.32 ? 312  TYR A CD2   1 
ATOM   3747 C  CE1   . TYR E 3 320 ? -17.899 10.774  4.028   1.00 16.31 ? 312  TYR A CE1   1 
ATOM   3748 C  CE2   . TYR E 3 320 ? -18.847 11.695  2.029   1.00 14.58 ? 312  TYR A CE2   1 
ATOM   3749 C  CZ    . TYR E 3 320 ? -17.932 11.767  3.057   1.00 16.12 ? 312  TYR A CZ    1 
ATOM   3750 O  OH    . TYR E 3 320 ? -17.054 12.834  3.114   1.00 17.71 ? 312  TYR A OH    1 
ATOM   3751 N  N     . SER E 3 321 ? -22.148 5.970   2.054   1.00 12.49 ? 313  SER A N     1 
ATOM   3752 C  CA    . SER E 3 321 ? -23.291 5.052   2.011   1.00 13.13 ? 313  SER A CA    1 
ATOM   3753 C  C     . SER E 3 321 ? -22.939 3.626   2.410   1.00 13.56 ? 313  SER A C     1 
ATOM   3754 O  O     . SER E 3 321 ? -23.680 2.969   3.135   1.00 13.99 ? 313  SER A O     1 
ATOM   3755 C  CB    . SER E 3 321 ? -23.876 5.000   0.604   1.00 12.88 ? 313  SER A CB    1 
ATOM   3756 O  OG    . SER E 3 321 ? -24.551 6.198   0.318   1.00 13.49 ? 313  SER A OG    1 
ATOM   3757 N  N     . GLU E 3 322 ? -21.806 3.151   1.926   1.00 14.04 ? 314  GLU A N     1 
ATOM   3758 C  CA    . GLU E 3 322 ? -21.441 1.764   2.101   1.00 14.63 ? 314  GLU A CA    1 
ATOM   3759 C  C     . GLU E 3 322 ? -20.824 1.494   3.468   1.00 14.42 ? 314  GLU A C     1 
ATOM   3760 O  O     . GLU E 3 322 ? -20.889 0.379   3.965   1.00 14.15 ? 314  GLU A O     1 
ATOM   3761 C  CB    . GLU E 3 322 ? -20.471 1.349   1.001   1.00 15.15 ? 314  GLU A CB    1 
ATOM   3762 C  CG    . GLU E 3 322 ? -20.372 -0.153  0.825   1.00 16.76 ? 314  GLU A CG    1 
ATOM   3763 C  CD    . GLU E 3 322 ? -21.722 -0.798  0.546   1.00 18.67 ? 314  GLU A CD    1 
ATOM   3764 O  OE1   . GLU E 3 322 ? -21.965 -1.865  1.157   1.00 20.56 ? 314  GLU A OE1   1 
ATOM   3765 O  OE2   . GLU E 3 322 ? -22.533 -0.231  -0.249  1.00 17.67 ? 314  GLU A OE2   1 
ATOM   3766 N  N     . SER E 3 323 ? -20.240 2.522   4.075   1.00 14.17 ? 315  SER A N     1 
ATOM   3767 C  CA    . SER E 3 323 ? -19.584 2.367   5.366   1.00 14.12 ? 315  SER A CA    1 
ATOM   3768 C  C     . SER E 3 323 ? -20.607 2.338   6.494   1.00 13.79 ? 315  SER A C     1 
ATOM   3769 O  O     . SER E 3 323 ? -20.353 1.763   7.543   1.00 13.94 ? 315  SER A O     1 
ATOM   3770 C  CB    . SER E 3 323 ? -18.580 3.494   5.600   1.00 13.95 ? 315  SER A CB    1 
ATOM   3771 O  OG    . SER E 3 323 ? -19.267 4.719   5.783   1.00 14.40 ? 315  SER A OG    1 
ATOM   3772 N  N     . VAL E 3 324 ? -21.753 2.974   6.285   1.00 13.41 ? 316  VAL A N     1 
ATOM   3773 C  CA    . VAL E 3 324 ? -22.818 2.944   7.276   1.00 13.20 ? 316  VAL A CA    1 
ATOM   3774 C  C     . VAL E 3 324 ? -23.419 1.533   7.275   1.00 13.15 ? 316  VAL A C     1 
ATOM   3775 O  O     . VAL E 3 324 ? -23.638 0.950   8.326   1.00 12.87 ? 316  VAL A O     1 
ATOM   3776 C  CB    . VAL E 3 324 ? -23.899 4.028   7.005   1.00 13.09 ? 316  VAL A CB    1 
ATOM   3777 C  CG1   . VAL E 3 324 ? -25.021 3.955   8.035   1.00 12.95 ? 316  VAL A CG1   1 
ATOM   3778 C  CG2   . VAL E 3 324 ? -23.291 5.411   7.036   1.00 12.95 ? 316  VAL A CG2   1 
ATOM   3779 N  N     . LYS E 3 325 ? -23.663 0.983   6.087   1.00 13.21 ? 317  LYS A N     1 
ATOM   3780 C  CA    . LYS E 3 325 ? -24.122 -0.402  5.959   1.00 13.12 ? 317  LYS A CA    1 
ATOM   3781 C  C     . LYS E 3 325 ? -23.206 -1.352  6.726   1.00 12.90 ? 317  LYS A C     1 
ATOM   3782 O  O     . LYS E 3 325 ? -23.671 -2.154  7.533   1.00 13.03 ? 317  LYS A O     1 
ATOM   3783 C  CB    . LYS E 3 325 ? -24.193 -0.820  4.488   1.00 13.16 ? 317  LYS A CB    1 
ATOM   3784 C  CG    . LYS E 3 325 ? -25.541 -0.531  3.835   1.00 13.35 ? 317  LYS A CG    1 
ATOM   3785 C  CD    . LYS E 3 325 ? -25.490 -0.619  2.303   1.00 13.33 ? 317  LYS A CD    1 
ATOM   3786 C  CE    . LYS E 3 325 ? -26.217 0.557   1.643   1.00 13.52 ? 317  LYS A CE    1 
ATOM   3787 N  NZ    . LYS E 3 325 ? -27.004 0.142   0.451   1.00 13.83 ? 317  LYS A NZ    1 
ATOM   3788 N  N     . LEU E 3 326 ? -21.906 -1.228  6.484   1.00 12.49 ? 318  LEU A N     1 
ATOM   3789 C  CA    . LEU E 3 326 ? -20.910 -2.094  7.100   1.00 12.33 ? 318  LEU A CA    1 
ATOM   3790 C  C     . LEU E 3 326 ? -20.788 -1.902  8.622   1.00 12.54 ? 318  LEU A C     1 
ATOM   3791 O  O     . LEU E 3 326 ? -20.575 -2.871  9.360   1.00 12.60 ? 318  LEU A O     1 
ATOM   3792 C  CB    . LEU E 3 326 ? -19.549 -1.876  6.438   1.00 12.02 ? 318  LEU A CB    1 
ATOM   3793 C  CG    . LEU E 3 326 ? -19.443 -2.293  4.971   1.00 11.23 ? 318  LEU A CG    1 
ATOM   3794 C  CD1   . LEU E 3 326 ? -18.108 -1.850  4.393   1.00 11.35 ? 318  LEU A CD1   1 
ATOM   3795 C  CD2   . LEU E 3 326 ? -19.621 -3.782  4.802   1.00 10.69 ? 318  LEU A CD2   1 
ATOM   3796 N  N     . LEU E 3 327 ? -20.930 -0.669  9.087   1.00 12.61 ? 319  LEU A N     1 
ATOM   3797 C  CA    . LEU E 3 327 ? -20.883 -0.376  10.518  1.00 12.98 ? 319  LEU A CA    1 
ATOM   3798 C  C     . LEU E 3 327 ? -22.104 -0.944  11.233  1.00 13.44 ? 319  LEU A C     1 
ATOM   3799 O  O     . LEU E 3 327 ? -21.980 -1.486  12.332  1.00 13.65 ? 319  LEU A O     1 
ATOM   3800 C  CB    . LEU E 3 327 ? -20.802 1.130   10.759  1.00 12.86 ? 319  LEU A CB    1 
ATOM   3801 C  CG    . LEU E 3 327 ? -20.854 1.593   12.207  1.00 12.86 ? 319  LEU A CG    1 
ATOM   3802 C  CD1   . LEU E 3 327 ? -19.761 0.951   13.022  1.00 13.22 ? 319  LEU A CD1   1 
ATOM   3803 C  CD2   . LEU E 3 327 ? -20.743 3.104   12.263  1.00 13.26 ? 319  LEU A CD2   1 
ATOM   3804 N  N     . GLN E 3 328 ? -23.273 -0.799  10.607  1.00 13.82 ? 320  GLN A N     1 
ATOM   3805 C  CA    . GLN E 3 328 ? -24.521 -1.369  11.107  1.00 14.34 ? 320  GLN A CA    1 
ATOM   3806 C  C     . GLN E 3 328 ? -24.353 -2.867  11.288  1.00 14.61 ? 320  GLN A C     1 
ATOM   3807 O  O     . GLN E 3 328 ? -24.927 -3.465  12.208  1.00 14.77 ? 320  GLN A O     1 
ATOM   3808 C  CB    . GLN E 3 328 ? -25.692 -1.107  10.135  1.00 14.40 ? 320  GLN A CB    1 
ATOM   3809 C  CG    . GLN E 3 328 ? -26.219 0.318   10.186  1.00 14.95 ? 320  GLN A CG    1 
ATOM   3810 C  CD    . GLN E 3 328 ? -27.366 0.585   9.225   1.00 15.68 ? 320  GLN A CD    1 
ATOM   3811 O  OE1   . GLN E 3 328 ? -27.283 0.281   8.033   1.00 16.44 ? 320  GLN A OE1   1 
ATOM   3812 N  NE2   . GLN E 3 328 ? -28.435 1.181   9.742   1.00 16.11 ? 320  GLN A NE2   1 
ATOM   3813 N  N     . LYS E 3 329 ? -23.565 -3.460  10.395  1.00 14.66 ? 321  LYS A N     1 
ATOM   3814 C  CA    . LYS E 3 329 ? -23.321 -4.893  10.405  1.00 14.83 ? 321  LYS A CA    1 
ATOM   3815 C  C     . LYS E 3 329 ? -22.440 -5.280  11.597  1.00 14.94 ? 321  LYS A C     1 
ATOM   3816 O  O     . LYS E 3 329 ? -22.653 -6.318  12.203  1.00 14.86 ? 321  LYS A O     1 
ATOM   3817 C  CB    . LYS E 3 329 ? -22.705 -5.342  9.071   1.00 14.80 ? 321  LYS A CB    1 
ATOM   3818 C  CG    . LYS E 3 329 ? -23.008 -6.774  8.696   1.00 14.39 ? 321  LYS A CG    1 
ATOM   3819 C  CD    . LYS E 3 329 ? -22.390 -7.156  7.355   1.00 13.89 ? 321  LYS A CD    1 
ATOM   3820 C  CE    . LYS E 3 329 ? -22.146 -8.664  7.258   1.00 13.89 ? 321  LYS A CE    1 
ATOM   3821 N  NZ    . LYS E 3 329 ? -23.429 -9.422  7.378   1.00 13.51 ? 321  LYS A NZ    1 
ATOM   3822 N  N     . ILE E 3 330 ? -21.476 -4.435  11.949  1.00 15.28 ? 322  ILE A N     1 
ATOM   3823 C  CA    . ILE E 3 330 ? -20.632 -4.684  13.126  1.00 15.53 ? 322  ILE A CA    1 
ATOM   3824 C  C     . ILE E 3 330 ? -21.453 -4.621  14.415  1.00 15.76 ? 322  ILE A C     1 
ATOM   3825 O  O     . ILE E 3 330 ? -21.232 -5.413  15.335  1.00 15.67 ? 322  ILE A O     1 
ATOM   3826 C  CB    . ILE E 3 330 ? -19.462 -3.677  13.198  1.00 15.51 ? 322  ILE A CB    1 
ATOM   3827 C  CG1   . ILE E 3 330 ? -18.524 -3.849  11.998  1.00 15.69 ? 322  ILE A CG1   1 
ATOM   3828 C  CG2   . ILE E 3 330 ? -18.677 -3.862  14.498  1.00 15.79 ? 322  ILE A CG2   1 
ATOM   3829 C  CD1   . ILE E 3 330 ? -17.628 -2.647  11.737  1.00 16.34 ? 322  ILE A CD1   1 
ATOM   3830 N  N     . LEU E 3 331 ? -22.391 -3.673  14.469  1.00 15.99 ? 323  LEU A N     1 
ATOM   3831 C  CA    . LEU E 3 331 ? -23.254 -3.481  15.633  1.00 16.08 ? 323  LEU A CA    1 
ATOM   3832 C  C     . LEU E 3 331 ? -24.241 -4.646  15.807  1.00 16.40 ? 323  LEU A C     1 
ATOM   3833 O  O     . LEU E 3 331 ? -24.647 -4.940  16.921  1.00 16.39 ? 323  LEU A O     1 
ATOM   3834 C  CB    . LEU E 3 331 ? -24.017 -2.140  15.533  1.00 15.98 ? 323  LEU A CB    1 
ATOM   3835 C  CG    . LEU E 3 331 ? -23.447 -0.817  16.099  1.00 15.64 ? 323  LEU A CG    1 
ATOM   3836 C  CD1   . LEU E 3 331 ? -22.053 -0.947  16.720  1.00 15.49 ? 323  LEU A CD1   1 
ATOM   3837 C  CD2   . LEU E 3 331 ? -23.442 0.286   15.035  1.00 14.82 ? 323  LEU A CD2   1 
ATOM   3838 N  N     . GLU E 3 332 ? -24.622 -5.311  14.718  1.00 16.92 ? 324  GLU A N     1 
ATOM   3839 C  CA    . GLU E 3 332 ? -25.572 -6.435  14.801  1.00 17.41 ? 324  GLU A CA    1 
ATOM   3840 C  C     . GLU E 3 332 ? -24.866 -7.712  15.241  1.00 17.63 ? 324  GLU A C     1 
ATOM   3841 O  O     . GLU E 3 332 ? -25.353 -8.438  16.108  1.00 17.85 ? 324  GLU A O     1 
ATOM   3842 C  CB    . GLU E 3 332 ? -26.261 -6.690  13.452  1.00 17.35 ? 324  GLU A CB    1 
ATOM   3843 C  CG    . GLU E 3 332 ? -27.494 -5.838  13.187  1.00 18.17 ? 324  GLU A CG    1 
ATOM   3844 C  CD    . GLU E 3 332 ? -27.728 -5.584  11.704  1.00 19.74 ? 324  GLU A CD    1 
ATOM   3845 O  OE1   . GLU E 3 332 ? -28.147 -4.461  11.345  1.00 21.64 ? 324  GLU A OE1   1 
ATOM   3846 O  OE2   . GLU E 3 332 ? -27.490 -6.501  10.887  1.00 20.24 ? 324  GLU A OE2   1 
ATOM   3847 N  N     . GLU E 3 333 ? -23.708 -7.962  14.634  1.00 18.05 ? 325  GLU A N     1 
ATOM   3848 C  CA    . GLU E 3 333 ? -22.985 -9.230  14.768  1.00 18.10 ? 325  GLU A CA    1 
ATOM   3849 C  C     . GLU E 3 333 ? -22.018 -9.239  15.972  1.00 17.92 ? 325  GLU A C     1 
ATOM   3850 O  O     . GLU E 3 333 ? -21.496 -10.294 16.330  1.00 17.97 ? 325  GLU A O     1 
ATOM   3851 C  CB    . GLU E 3 333 ? -22.246 -9.556  13.446  1.00 18.06 ? 325  GLU A CB    1 
ATOM   3852 C  CG    . GLU E 3 333 ? -23.141 -10.211 12.386  1.00 18.47 ? 325  GLU A CG    1 
ATOM   3853 C  CD    . GLU E 3 333 ? -22.639 -10.075 10.944  1.00 18.76 ? 325  GLU A CD    1 
ATOM   3854 O  OE1   . GLU E 3 333 ? -21.481 -10.444 10.653  1.00 18.81 ? 325  GLU A OE1   1 
ATOM   3855 O  OE2   . GLU E 3 333 ? -23.424 -9.622  10.079  1.00 18.77 ? 325  GLU A OE2   1 
ATOM   3856 N  N     . ASP E 3 334 ? -21.810 -8.073  16.595  1.00 17.75 ? 326  ASP A N     1 
ATOM   3857 C  CA    . ASP E 3 334 ? -20.916 -7.914  17.759  1.00 17.60 ? 326  ASP A CA    1 
ATOM   3858 C  C     . ASP E 3 334 ? -21.457 -6.834  18.693  1.00 17.23 ? 326  ASP A C     1 
ATOM   3859 O  O     . ASP E 3 334 ? -21.720 -5.718  18.255  1.00 17.36 ? 326  ASP A O     1 
ATOM   3860 C  CB    . ASP E 3 334 ? -19.506 -7.522  17.303  1.00 17.71 ? 326  ASP A CB    1 
ATOM   3861 C  CG    . ASP E 3 334 ? -18.444 -7.808  18.353  1.00 18.13 ? 326  ASP A CG    1 
ATOM   3862 O  OD1   . ASP E 3 334 ? -18.437 -7.137  19.409  1.00 18.03 ? 326  ASP A OD1   1 
ATOM   3863 O  OD2   . ASP E 3 334 ? -17.569 -8.685  18.200  1.00 18.65 ? 326  ASP A OD2   1 
ATOM   3864 N  N     . GLU E 3 335 ? -21.604 -7.145  19.977  1.00 16.98 ? 327  GLU A N     1 
ATOM   3865 C  CA    . GLU E 3 335 ? -22.273 -6.213  20.903  1.00 16.93 ? 327  GLU A CA    1 
ATOM   3866 C  C     . GLU E 3 335 ? -21.331 -5.501  21.888  1.00 16.11 ? 327  GLU A C     1 
ATOM   3867 O  O     . GLU E 3 335 ? -21.798 -4.897  22.844  1.00 15.94 ? 327  GLU A O     1 
ATOM   3868 C  CB    . GLU E 3 335 ? -23.478 -6.850  21.659  1.00 17.26 ? 327  GLU A CB    1 
ATOM   3869 C  CG    . GLU E 3 335 ? -23.650 -8.368  21.595  1.00 18.51 ? 327  GLU A CG    1 
ATOM   3870 C  CD    . GLU E 3 335 ? -23.082 -9.064  22.820  1.00 20.05 ? 327  GLU A CD    1 
ATOM   3871 O  OE1   . GLU E 3 335 ? -23.812 -9.895  23.430  1.00 21.08 ? 327  GLU A OE1   1 
ATOM   3872 O  OE2   . GLU E 3 335 ? -21.905 -8.773  23.166  1.00 19.69 ? 327  GLU A OE2   1 
ATOM   3873 N  N     . ARG E 3 336 ? -20.022 -5.549  21.649  1.00 15.38 ? 328  ARG A N     1 
ATOM   3874 C  CA    . ARG E 3 336 ? -19.074 -4.788  22.468  1.00 14.86 ? 328  ARG A CA    1 
ATOM   3875 C  C     . ARG E 3 336 ? -19.147 -3.315  22.082  1.00 14.55 ? 328  ARG A C     1 
ATOM   3876 O  O     . ARG E 3 336 ? -19.535 -2.993  20.968  1.00 14.55 ? 328  ARG A O     1 
ATOM   3877 C  CB    . ARG E 3 336 ? -17.649 -5.302  22.281  1.00 14.74 ? 328  ARG A CB    1 
ATOM   3878 C  CG    . ARG E 3 336 ? -17.422 -6.710  22.760  1.00 14.40 ? 328  ARG A CG    1 
ATOM   3879 C  CD    . ARG E 3 336 ? -15.991 -7.185  22.596  1.00 14.68 ? 328  ARG A CD    1 
ATOM   3880 N  NE    . ARG E 3 336 ? -15.747 -7.793  21.288  1.00 15.64 ? 328  ARG A NE    1 
ATOM   3881 C  CZ    . ARG E 3 336 ? -14.580 -8.301  20.893  1.00 16.58 ? 328  ARG A CZ    1 
ATOM   3882 N  NH1   . ARG E 3 336 ? -13.517 -8.283  21.691  1.00 16.81 ? 328  ARG A NH1   1 
ATOM   3883 N  NH2   . ARG E 3 336 ? -14.475 -8.835  19.685  1.00 17.26 ? 328  ARG A NH2   1 
ATOM   3884 N  N     . LYS E 3 337 ? -18.796 -2.419  22.994  1.00 14.35 ? 329  LYS A N     1 
ATOM   3885 C  CA    . LYS E 3 337 ? -18.754 -0.999  22.651  1.00 14.48 ? 329  LYS A CA    1 
ATOM   3886 C  C     . LYS E 3 337 ? -17.553 -0.747  21.744  1.00 14.09 ? 329  LYS A C     1 
ATOM   3887 O  O     . LYS E 3 337 ? -16.524 -1.408  21.870  1.00 13.87 ? 329  LYS A O     1 
ATOM   3888 C  CB    . LYS E 3 337 ? -18.683 -0.105  23.899  1.00 14.67 ? 329  LYS A CB    1 
ATOM   3889 C  CG    . LYS E 3 337 ? -20.024 0.086   24.624  1.00 15.71 ? 329  LYS A CG    1 
ATOM   3890 C  CD    . LYS E 3 337 ? -20.003 1.232   25.671  1.00 16.56 ? 329  LYS A CD    1 
ATOM   3891 C  CE    . LYS E 3 337 ? -21.421 1.786   25.903  1.00 17.03 ? 329  LYS A CE    1 
ATOM   3892 N  NZ    . LYS E 3 337 ? -21.530 2.685   27.091  1.00 17.49 ? 329  LYS A NZ    1 
ATOM   3893 N  N     . ILE E 3 338 ? -17.702 0.187   20.812  1.00 13.86 ? 330  ILE A N     1 
ATOM   3894 C  CA    . ILE E 3 338 ? -16.611 0.582   19.926  1.00 13.73 ? 330  ILE A CA    1 
ATOM   3895 C  C     . ILE E 3 338 ? -15.853 1.746   20.554  1.00 13.39 ? 330  ILE A C     1 
ATOM   3896 O  O     . ILE E 3 338 ? -16.449 2.609   21.170  1.00 13.48 ? 330  ILE A O     1 
ATOM   3897 C  CB    . ILE E 3 338 ? -17.171 0.948   18.522  1.00 13.90 ? 330  ILE A CB    1 
ATOM   3898 C  CG1   . ILE E 3 338 ? -17.829 -0.280  17.889  1.00 13.99 ? 330  ILE A CG1   1 
ATOM   3899 C  CG2   . ILE E 3 338 ? -16.071 1.494   17.582  1.00 13.60 ? 330  ILE A CG2   1 
ATOM   3900 C  CD1   . ILE E 3 338 ? -18.768 0.056   16.762  1.00 14.34 ? 330  ILE A CD1   1 
ATOM   3901 N  N     . ARG E 3 339 ? -14.534 1.748   20.398  1.00 13.20 ? 331  ARG A N     1 
ATOM   3902 C  CA    . ARG E 3 339 ? -13.661 2.799   20.918  1.00 12.99 ? 331  ARG A CA    1 
ATOM   3903 C  C     . ARG E 3 339 ? -13.014 3.601   19.772  1.00 12.79 ? 331  ARG A C     1 
ATOM   3904 O  O     . ARG E 3 339 ? -12.994 4.831   19.805  1.00 12.41 ? 331  ARG A O     1 
ATOM   3905 C  CB    . ARG E 3 339 ? -12.590 2.161   21.803  1.00 13.12 ? 331  ARG A CB    1 
ATOM   3906 C  CG    . ARG E 3 339 ? -11.384 3.043   22.134  1.00 13.77 ? 331  ARG A CG    1 
ATOM   3907 C  CD    . ARG E 3 339 ? -10.830 2.801   23.513  1.00 15.06 ? 331  ARG A CD    1 
ATOM   3908 N  NE    . ARG E 3 339 ? -9.370  2.699   23.594  1.00 16.16 ? 331  ARG A NE    1 
ATOM   3909 C  CZ    . ARG E 3 339 ? -8.692  2.764   24.748  1.00 17.80 ? 331  ARG A CZ    1 
ATOM   3910 N  NH1   . ARG E 3 339 ? -9.340  2.929   25.907  1.00 19.40 ? 331  ARG A NH1   1 
ATOM   3911 N  NH2   . ARG E 3 339 ? -7.368  2.668   24.758  1.00 17.10 ? 331  ARG A NH2   1 
ATOM   3912 N  N     . ARG E 3 340 ? -12.464 2.896   18.782  1.00 12.54 ? 332  ARG A N     1 
ATOM   3913 C  CA    . ARG E 3 340 ? -11.945 3.518   17.551  1.00 12.23 ? 332  ARG A CA    1 
ATOM   3914 C  C     . ARG E 3 340 ? -12.732 3.028   16.362  1.00 11.65 ? 332  ARG A C     1 
ATOM   3915 O  O     . ARG E 3 340 ? -13.192 1.901   16.358  1.00 11.50 ? 332  ARG A O     1 
ATOM   3916 C  CB    . ARG E 3 340 ? -10.467 3.189   17.323  1.00 12.22 ? 332  ARG A CB    1 
ATOM   3917 C  CG    . ARG E 3 340 ? -9.582  3.416   18.524  1.00 11.96 ? 332  ARG A CG    1 
ATOM   3918 C  CD    . ARG E 3 340 ? -8.185  2.889   18.332  1.00 12.59 ? 332  ARG A CD    1 
ATOM   3919 N  NE    . ARG E 3 340 ? -7.474  2.780   19.598  1.00 12.77 ? 332  ARG A NE    1 
ATOM   3920 C  CZ    . ARG E 3 340 ? -6.247  2.293   19.739  1.00 13.62 ? 332  ARG A CZ    1 
ATOM   3921 N  NH1   . ARG E 3 340 ? -5.697  2.247   20.952  1.00 12.89 ? 332  ARG A NH1   1 
ATOM   3922 N  NH2   . ARG E 3 340 ? -5.566  1.850   18.678  1.00 13.86 ? 332  ARG A NH2   1 
ATOM   3923 N  N     . ILE E 3 341 ? -12.902 3.896   15.373  1.00 11.41 ? 333  ILE A N     1 
ATOM   3924 C  CA    . ILE E 3 341 ? -13.613 3.551   14.146  1.00 11.46 ? 333  ILE A CA    1 
ATOM   3925 C  C     . ILE E 3 341 ? -12.924 4.161   12.951  1.00 11.95 ? 333  ILE A C     1 
ATOM   3926 O  O     . ILE E 3 341 ? -12.352 5.245   13.028  1.00 12.08 ? 333  ILE A O     1 
ATOM   3927 C  CB    . ILE E 3 341 ? -15.069 4.039   14.181  1.00 11.11 ? 333  ILE A CB    1 
ATOM   3928 C  CG1   . ILE E 3 341 ? -15.875 3.463   13.017  1.00 10.15 ? 333  ILE A CG1   1 
ATOM   3929 C  CG2   . ILE E 3 341 ? -15.128 5.545   14.099  1.00 11.18 ? 333  ILE A CG2   1 
ATOM   3930 C  CD1   . ILE E 3 341 ? -15.990 1.990   13.025  1.00 9.49  ? 333  ILE A CD1   1 
ATOM   3931 N  N     . GLY E 3 342 ? -13.007 3.476   11.824  1.00 12.21 ? 334  GLY A N     1 
ATOM   3932 C  CA    . GLY E 3 342 ? -12.427 4.010   10.622  1.00 12.26 ? 334  GLY A CA    1 
ATOM   3933 C  C     . GLY E 3 342 ? -12.585 3.075   9.466   1.00 12.36 ? 334  GLY A C     1 
ATOM   3934 O  O     . GLY E 3 342 ? -13.489 2.247   9.437   1.00 12.05 ? 334  GLY A O     1 
ATOM   3935 N  N     . VAL E 3 343 ? -11.654 3.186   8.530   1.00 12.54 ? 335  VAL A N     1 
ATOM   3936 C  CA    . VAL E 3 343 ? -11.887 2.706   7.192   1.00 12.56 ? 335  VAL A CA    1 
ATOM   3937 C  C     . VAL E 3 343 ? -10.588 2.424   6.462   1.00 12.42 ? 335  VAL A C     1 
ATOM   3938 O  O     . VAL E 3 343 ? -9.568  3.077   6.663   1.00 12.17 ? 335  VAL A O     1 
ATOM   3939 C  CB    . VAL E 3 343 ? -12.738 3.749   6.432   1.00 12.59 ? 335  VAL A CB    1 
ATOM   3940 C  CG1   . VAL E 3 343 ? -11.987 5.071   6.345   1.00 13.26 ? 335  VAL A CG1   1 
ATOM   3941 C  CG2   . VAL E 3 343 ? -13.146 3.247   5.075   1.00 12.34 ? 335  VAL A CG2   1 
ATOM   3942 N  N     . ARG E 3 344 ? -10.662 1.462   5.565   1.00 12.81 ? 336  ARG A N     1 
ATOM   3943 C  CA    . ARG E 3 344 ? -9.496  0.919   4.910   1.00 12.94 ? 336  ARG A CA    1 
ATOM   3944 C  C     . ARG E 3 344 ? -9.879  0.620   3.466   1.00 12.22 ? 336  ARG A C     1 
ATOM   3945 O  O     . ARG E 3 344 ? -10.680 -0.275  3.221   1.00 11.36 ? 336  ARG A O     1 
ATOM   3946 C  CB    . ARG E 3 344 ? -9.112  -0.350  5.651   1.00 13.39 ? 336  ARG A CB    1 
ATOM   3947 C  CG    . ARG E 3 344 ? -7.921  -1.079  5.105   1.00 16.42 ? 336  ARG A CG    1 
ATOM   3948 C  CD    . ARG E 3 344 ? -6.665  -0.871  5.916   1.00 18.35 ? 336  ARG A CD    1 
ATOM   3949 N  NE    . ARG E 3 344 ? -6.209  0.512   5.804   1.00 18.63 ? 336  ARG A NE    1 
ATOM   3950 C  CZ    . ARG E 3 344 ? -5.355  1.073   6.622   1.00 18.73 ? 336  ARG A CZ    1 
ATOM   3951 N  NH1   . ARG E 3 344 ? -4.881  0.370   7.628   1.00 22.59 ? 336  ARG A NH1   1 
ATOM   3952 N  NH2   . ARG E 3 344 ? -4.975  2.333   6.457   1.00 17.58 ? 336  ARG A NH2   1 
ATOM   3953 N  N     . PHE E 3 345 ? -9.338  1.405   2.530   1.00 11.79 ? 337  PHE A N     1 
ATOM   3954 C  CA    . PHE E 3 345 ? -9.509  1.176   1.090   1.00 11.53 ? 337  PHE A CA    1 
ATOM   3955 C  C     . PHE E 3 345 ? -8.379  0.349   0.509   1.00 11.29 ? 337  PHE A C     1 
ATOM   3956 O  O     . PHE E 3 345 ? -7.260  0.398   0.984   1.00 11.33 ? 337  PHE A O     1 
ATOM   3957 C  CB    . PHE E 3 345 ? -9.612  2.497   0.341   1.00 11.55 ? 337  PHE A CB    1 
ATOM   3958 C  CG    . PHE E 3 345 ? -10.769 3.330   0.778   1.00 12.17 ? 337  PHE A CG    1 
ATOM   3959 C  CD1   . PHE E 3 345 ? -12.045 3.007   0.383   1.00 12.33 ? 337  PHE A CD1   1 
ATOM   3960 C  CD2   . PHE E 3 345 ? -10.586 4.411   1.621   1.00 14.18 ? 337  PHE A CD2   1 
ATOM   3961 C  CE1   . PHE E 3 345 ? -13.128 3.753   0.793   1.00 13.17 ? 337  PHE A CE1   1 
ATOM   3962 C  CE2   . PHE E 3 345 ? -11.671 5.170   2.033   1.00 15.21 ? 337  PHE A CE2   1 
ATOM   3963 C  CZ    . PHE E 3 345 ? -12.947 4.835   1.617   1.00 14.13 ? 337  PHE A CZ    1 
ATOM   3964 N  N     . SER E 3 346 ? -8.686  -0.414  -0.530  1.00 11.09 ? 338  SER A N     1 
ATOM   3965 C  CA    . SER E 3 346 ? -7.738  -1.360  -1.103  1.00 10.69 ? 338  SER A CA    1 
ATOM   3966 C  C     . SER E 3 346 ? -8.194  -1.787  -2.488  1.00 11.24 ? 338  SER A C     1 
ATOM   3967 O  O     . SER E 3 346 ? -9.245  -1.353  -2.956  1.00 11.42 ? 338  SER A O     1 
ATOM   3968 C  CB    . SER E 3 346 ? -7.582  -2.584  -0.188  1.00 10.43 ? 338  SER A CB    1 
ATOM   3969 O  OG    . SER E 3 346 ? -8.750  -3.383  -0.138  1.00 8.13  ? 338  SER A OG    1 
ATOM   3970 N  N     . LYS E 3 347 ? -7.409  -2.645  -3.135  1.00 11.62 ? 339  LYS A N     1 
ATOM   3971 C  CA    . LYS E 3 347 ? -7.699  -3.112  -4.493  1.00 11.93 ? 339  LYS A CA    1 
ATOM   3972 C  C     . LYS E 3 347 ? -7.817  -1.943  -5.488  1.00 11.97 ? 339  LYS A C     1 
ATOM   3973 O  O     . LYS E 3 347 ? -8.845  -1.741  -6.124  1.00 11.27 ? 339  LYS A O     1 
ATOM   3974 C  CB    . LYS E 3 347 ? -8.963  -4.001  -4.511  1.00 12.19 ? 339  LYS A CB    1 
ATOM   3975 C  CG    . LYS E 3 347 ? -8.813  -5.355  -3.813  1.00 12.17 ? 339  LYS A CG    1 
ATOM   3976 C  CD    . LYS E 3 347 ? -10.041 -6.236  -4.006  1.00 12.22 ? 339  LYS A CD    1 
ATOM   3977 C  CE    . LYS E 3 347 ? -10.129 -7.339  -2.947  1.00 13.05 ? 339  LYS A CE    1 
ATOM   3978 N  NZ    . LYS E 3 347 ? -11.077 -8.455  -3.312  1.00 13.11 ? 339  LYS A NZ    1 
ATOM   3979 N  N     . PHE E 3 348 ? -6.736  -1.185  -5.625  1.00 12.83 ? 340  PHE A N     1 
ATOM   3980 C  CA    . PHE E 3 348 ? -6.721  -0.029  -6.532  1.00 13.63 ? 340  PHE A CA    1 
ATOM   3981 C  C     . PHE E 3 348 ? -6.624  -0.450  -7.995  1.00 13.97 ? 340  PHE A C     1 
ATOM   3982 O  O     . PHE E 3 348 ? -6.011  -1.464  -8.321  1.00 14.25 ? 340  PHE A O     1 
ATOM   3983 C  CB    . PHE E 3 348 ? -5.566  0.923   -6.215  1.00 13.67 ? 340  PHE A CB    1 
ATOM   3984 C  CG    . PHE E 3 348 ? -5.439  1.258   -4.764  1.00 14.07 ? 340  PHE A CG    1 
ATOM   3985 C  CD1   . PHE E 3 348 ? -6.462  1.910   -4.104  1.00 14.33 ? 340  PHE A CD1   1 
ATOM   3986 C  CD2   . PHE E 3 348 ? -4.295  0.912   -4.052  1.00 15.18 ? 340  PHE A CD2   1 
ATOM   3987 C  CE1   . PHE E 3 348 ? -6.348  2.228   -2.767  1.00 14.68 ? 340  PHE A CE1   1 
ATOM   3988 C  CE2   . PHE E 3 348 ? -4.177  1.223   -2.707  1.00 15.05 ? 340  PHE A CE2   1 
ATOM   3989 C  CZ    . PHE E 3 348 ? -5.211  1.884   -2.067  1.00 15.14 ? 340  PHE A CZ    1 
ATOM   3990 N  N     . ILE E 3 349 ? -7.212  0.352   -8.872  1.00 14.43 ? 341  ILE A N     1 
ATOM   3991 C  CA    . ILE E 3 349 ? -7.178  0.075   -10.300 1.00 14.86 ? 341  ILE A CA    1 
ATOM   3992 C  C     . ILE E 3 349 ? -5.798  0.445   -10.823 1.00 15.13 ? 341  ILE A C     1 
ATOM   3993 O  O     . ILE E 3 349 ? -5.174  1.385   -10.333 1.00 15.40 ? 341  ILE A O     1 
ATOM   3994 C  CB    . ILE E 3 349 ? -8.304  0.848   -11.046 1.00 15.05 ? 341  ILE A CB    1 
ATOM   3995 C  CG1   . ILE E 3 349 ? -9.672  0.536   -10.398 1.00 15.16 ? 341  ILE A CG1   1 
ATOM   3996 C  CG2   . ILE E 3 349 ? -8.322  0.473   -12.549 1.00 14.52 ? 341  ILE A CG2   1 
ATOM   3997 C  CD1   . ILE E 3 349 ? -10.839 1.347   -10.929 1.00 15.08 ? 341  ILE A CD1   1 
ATOM   3998 N  N     . GLY F 3 9   ? 58.832  99.349  34.396  1.00 13.54 ? 1001 GLY B N     1 
ATOM   3999 C  CA    . GLY F 3 9   ? 58.283  100.668 34.836  1.00 13.50 ? 1001 GLY B CA    1 
ATOM   4000 C  C     . GLY F 3 9   ? 58.637  101.034 36.271  1.00 13.42 ? 1001 GLY B C     1 
ATOM   4001 O  O     . GLY F 3 9   ? 59.030  100.174 37.056  1.00 13.34 ? 1001 GLY B O     1 
ATOM   4002 N  N     . ILE F 3 10  ? 58.509  102.322 36.594  1.00 13.30 ? 1002 ILE B N     1 
ATOM   4003 C  CA    . ILE F 3 10  ? 58.682  102.841 37.956  1.00 13.19 ? 1002 ILE B CA    1 
ATOM   4004 C  C     . ILE F 3 10  ? 57.398  103.566 38.400  1.00 12.92 ? 1002 ILE B C     1 
ATOM   4005 O  O     . ILE F 3 10  ? 56.724  104.193 37.585  1.00 12.81 ? 1002 ILE B O     1 
ATOM   4006 C  CB    . ILE F 3 10  ? 59.917  103.781 38.014  1.00 13.30 ? 1002 ILE B CB    1 
ATOM   4007 C  CG1   . ILE F 3 10  ? 61.206  102.970 37.851  1.00 13.56 ? 1002 ILE B CG1   1 
ATOM   4008 C  CG2   . ILE F 3 10  ? 59.971  104.556 39.327  1.00 13.35 ? 1002 ILE B CG2   1 
ATOM   4009 C  CD1   . ILE F 3 10  ? 62.124  103.479 36.764  1.00 14.18 ? 1002 ILE B CD1   1 
ATOM   4010 N  N     . VAL F 3 11  ? 57.071  103.475 39.693  1.00 12.67 ? 1003 VAL B N     1 
ATOM   4011 C  CA    . VAL F 3 11  ? 55.777  103.929 40.222  1.00 12.30 ? 1003 VAL B CA    1 
ATOM   4012 C  C     . VAL F 3 11  ? 55.956  104.753 41.491  1.00 12.28 ? 1003 VAL B C     1 
ATOM   4013 O  O     . VAL F 3 11  ? 56.681  104.353 42.386  1.00 12.28 ? 1003 VAL B O     1 
ATOM   4014 C  CB    . VAL F 3 11  ? 54.852  102.739 40.552  1.00 12.13 ? 1003 VAL B CB    1 
ATOM   4015 C  CG1   . VAL F 3 11  ? 53.507  103.232 41.098  1.00 12.13 ? 1003 VAL B CG1   1 
ATOM   4016 C  CG2   . VAL F 3 11  ? 54.634  101.873 39.333  1.00 11.81 ? 1003 VAL B CG2   1 
ATOM   4017 N  N     . LEU F 3 12  ? 55.261  105.883 41.579  1.00 12.40 ? 1004 LEU B N     1 
ATOM   4018 C  CA    . LEU F 3 12  ? 55.393  106.799 42.713  1.00 12.52 ? 1004 LEU B CA    1 
ATOM   4019 C  C     . LEU F 3 12  ? 54.036  107.014 43.360  1.00 12.46 ? 1004 LEU B C     1 
ATOM   4020 O  O     . LEU F 3 12  ? 53.190  107.704 42.805  1.00 12.75 ? 1004 LEU B O     1 
ATOM   4021 C  CB    . LEU F 3 12  ? 55.995  108.140 42.258  1.00 12.56 ? 1004 LEU B CB    1 
ATOM   4022 C  CG    . LEU F 3 12  ? 56.543  109.032 43.379  1.00 12.34 ? 1004 LEU B CG    1 
ATOM   4023 C  CD1   . LEU F 3 12  ? 57.691  109.898 42.880  1.00 11.47 ? 1004 LEU B CD1   1 
ATOM   4024 C  CD2   . LEU F 3 12  ? 55.446  109.894 43.998  1.00 12.25 ? 1004 LEU B CD2   1 
ATOM   4025 N  N     . PHE F 3 13  ? 53.842  106.424 44.537  1.00 12.33 ? 1005 PHE B N     1 
ATOM   4026 C  CA    . PHE F 3 13  ? 52.569  106.456 45.246  1.00 12.22 ? 1005 PHE B CA    1 
ATOM   4027 C  C     . PHE F 3 13  ? 52.630  107.527 46.339  1.00 12.40 ? 1005 PHE B C     1 
ATOM   4028 O  O     . PHE F 3 13  ? 53.602  107.594 47.079  1.00 11.73 ? 1005 PHE B O     1 
ATOM   4029 C  CB    . PHE F 3 13  ? 52.294  105.058 45.818  1.00 12.23 ? 1005 PHE B CB    1 
ATOM   4030 C  CG    . PHE F 3 13  ? 51.166  104.990 46.826  1.00 12.30 ? 1005 PHE B CG    1 
ATOM   4031 C  CD1   . PHE F 3 13  ? 49.852  104.844 46.417  1.00 12.35 ? 1005 PHE B CD1   1 
ATOM   4032 C  CD2   . PHE F 3 13  ? 51.433  105.017 48.186  1.00 11.57 ? 1005 PHE B CD2   1 
ATOM   4033 C  CE1   . PHE F 3 13  ? 48.826  104.760 47.350  1.00 12.22 ? 1005 PHE B CE1   1 
ATOM   4034 C  CE2   . PHE F 3 13  ? 50.417  104.926 49.114  1.00 11.10 ? 1005 PHE B CE2   1 
ATOM   4035 C  CZ    . PHE F 3 13  ? 49.114  104.800 48.700  1.00 11.47 ? 1005 PHE B CZ    1 
ATOM   4036 N  N     . VAL F 3 14  ? 51.610  108.383 46.410  1.00 12.82 ? 1006 VAL B N     1 
ATOM   4037 C  CA    . VAL F 3 14  ? 51.518  109.402 47.454  1.00 13.04 ? 1006 VAL B CA    1 
ATOM   4038 C  C     . VAL F 3 14  ? 50.303  109.167 48.351  1.00 13.20 ? 1006 VAL B C     1 
ATOM   4039 O  O     . VAL F 3 14  ? 49.179  109.115 47.876  1.00 13.36 ? 1006 VAL B O     1 
ATOM   4040 C  CB    . VAL F 3 14  ? 51.422  110.806 46.860  1.00 13.04 ? 1006 VAL B CB    1 
ATOM   4041 C  CG1   . VAL F 3 14  ? 51.460  111.869 47.977  1.00 13.53 ? 1006 VAL B CG1   1 
ATOM   4042 C  CG2   . VAL F 3 14  ? 52.545  111.035 45.887  1.00 13.00 ? 1006 VAL B CG2   1 
ATOM   4043 N  N     . ASP F 3 15  ? 50.539  109.025 49.652  1.00 13.42 ? 1007 ASP B N     1 
ATOM   4044 C  CA    . ASP F 3 15  ? 49.463  108.916 50.637  1.00 13.54 ? 1007 ASP B CA    1 
ATOM   4045 C  C     . ASP F 3 15  ? 49.540  110.116 51.589  1.00 13.21 ? 1007 ASP B C     1 
ATOM   4046 O  O     . ASP F 3 15  ? 50.598  110.404 52.131  1.00 13.13 ? 1007 ASP B O     1 
ATOM   4047 C  CB    . ASP F 3 15  ? 49.577  107.589 51.402  1.00 13.64 ? 1007 ASP B CB    1 
ATOM   4048 C  CG    . ASP F 3 15  ? 48.511  107.427 52.473  1.00 14.32 ? 1007 ASP B CG    1 
ATOM   4049 O  OD1   . ASP F 3 15  ? 48.635  108.073 53.528  1.00 16.34 ? 1007 ASP B OD1   1 
ATOM   4050 O  OD2   . ASP F 3 15  ? 47.521  106.666 52.378  1.00 15.26 ? 1007 ASP B OD2   1 
ATOM   4051 N  N     . PHE F 3 16  ? 48.419  110.808 51.780  1.00 12.98 ? 1008 PHE B N     1 
ATOM   4052 C  CA    . PHE F 3 16  ? 48.354  111.956 52.683  1.00 12.67 ? 1008 PHE B CA    1 
ATOM   4053 C  C     . PHE F 3 16  ? 48.204  111.392 54.079  1.00 12.80 ? 1008 PHE B C     1 
ATOM   4054 O  O     . PHE F 3 16  ? 47.292  110.591 54.325  1.00 12.78 ? 1008 PHE B O     1 
ATOM   4055 C  CB    . PHE F 3 16  ? 47.167  112.874 52.356  1.00 12.49 ? 1008 PHE B CB    1 
ATOM   4056 C  CG    . PHE F 3 16  ? 46.955  113.128 50.868  1.00 11.78 ? 1008 PHE B CG    1 
ATOM   4057 C  CD1   . PHE F 3 16  ? 48.013  113.081 49.961  1.00 10.45 ? 1008 PHE B CD1   1 
ATOM   4058 C  CD2   . PHE F 3 16  ? 45.687  113.429 50.384  1.00 11.27 ? 1008 PHE B CD2   1 
ATOM   4059 C  CE1   . PHE F 3 16  ? 47.805  113.311 48.605  1.00 10.06 ? 1008 PHE B CE1   1 
ATOM   4060 C  CE2   . PHE F 3 16  ? 45.481  113.665 49.021  1.00 10.78 ? 1008 PHE B CE2   1 
ATOM   4061 C  CZ    . PHE F 3 16  ? 46.544  113.603 48.136  1.00 9.44  ? 1008 PHE B CZ    1 
ATOM   4062 N  N     . ASP F 3 17  ? 49.104  111.784 54.983  1.00 12.73 ? 1009 ASP B N     1 
ATOM   4063 C  CA    . ASP F 3 17  ? 49.113  111.233 56.339  1.00 12.67 ? 1009 ASP B CA    1 
ATOM   4064 C  C     . ASP F 3 17  ? 47.883  111.640 57.103  1.00 12.61 ? 1009 ASP B C     1 
ATOM   4065 O  O     . ASP F 3 17  ? 47.478  112.789 57.065  1.00 12.90 ? 1009 ASP B O     1 
ATOM   4066 C  CB    . ASP F 3 17  ? 50.336  111.687 57.134  1.00 12.77 ? 1009 ASP B CB    1 
ATOM   4067 C  CG    . ASP F 3 17  ? 51.631  111.447 56.404  1.00 12.22 ? 1009 ASP B CG    1 
ATOM   4068 O  OD1   . ASP F 3 17  ? 51.764  110.398 55.730  1.00 10.52 ? 1009 ASP B OD1   1 
ATOM   4069 O  OD2   . ASP F 3 17  ? 52.561  112.274 56.454  1.00 11.61 ? 1009 ASP B OD2   1 
ATOM   4070 N  N     . TYR F 3 18  ? 47.316  110.682 57.819  1.00 13.00 ? 1010 TYR B N     1 
ATOM   4071 C  CA    . TYR F 3 18  ? 46.086  110.855 58.566  1.00 13.12 ? 1010 TYR B CA    1 
ATOM   4072 C  C     . TYR F 3 18  ? 45.283  112.018 58.043  1.00 12.19 ? 1010 TYR B C     1 
ATOM   4073 O  O     . TYR F 3 18  ? 44.957  112.937 58.769  1.00 12.38 ? 1010 TYR B O     1 
ATOM   4074 C  CB    . TYR F 3 18  ? 46.382  110.963 60.058  1.00 13.72 ? 1010 TYR B CB    1 
ATOM   4075 C  CG    . TYR F 3 18  ? 47.202  112.156 60.551  1.00 18.52 ? 1010 TYR B CG    1 
ATOM   4076 C  CD1   . TYR F 3 18  ? 46.555  113.357 60.914  1.00 22.41 ? 1010 TYR B CD1   1 
ATOM   4077 C  CD2   . TYR F 3 18  ? 48.599  112.087 60.738  1.00 20.89 ? 1010 TYR B CD2   1 
ATOM   4078 C  CE1   . TYR F 3 18  ? 47.260  114.469 61.404  1.00 23.46 ? 1010 TYR B CE1   1 
ATOM   4079 C  CE2   . TYR F 3 18  ? 49.327  113.217 61.244  1.00 22.39 ? 1010 TYR B CE2   1 
ATOM   4080 C  CZ    . TYR F 3 18  ? 48.627  114.402 61.569  1.00 23.65 ? 1010 TYR B CZ    1 
ATOM   4081 O  OH    . TYR F 3 18  ? 49.231  115.541 62.057  1.00 24.55 ? 1010 TYR B OH    1 
ATOM   4082 N  N     . PHE F 3 19  ? 44.932  111.924 56.766  1.00 11.38 ? 1011 PHE B N     1 
ATOM   4083 C  CA    . PHE F 3 19  ? 44.460  113.048 55.976  1.00 10.87 ? 1011 PHE B CA    1 
ATOM   4084 C  C     . PHE F 3 19  ? 43.360  113.886 56.618  1.00 10.63 ? 1011 PHE B C     1 
ATOM   4085 O  O     . PHE F 3 19  ? 43.496  115.099 56.708  1.00 10.12 ? 1011 PHE B O     1 
ATOM   4086 C  CB    . PHE F 3 19  ? 44.016  112.552 54.593  1.00 11.20 ? 1011 PHE B CB    1 
ATOM   4087 C  CG    . PHE F 3 19  ? 43.586  113.649 53.644  1.00 10.79 ? 1011 PHE B CG    1 
ATOM   4088 C  CD1   . PHE F 3 19  ? 44.403  114.745 53.401  1.00 11.24 ? 1011 PHE B CD1   1 
ATOM   4089 C  CD2   . PHE F 3 19  ? 42.363  113.569 52.993  1.00 10.40 ? 1011 PHE B CD2   1 
ATOM   4090 C  CE1   . PHE F 3 19  ? 44.008  115.744 52.533  1.00 12.16 ? 1011 PHE B CE1   1 
ATOM   4091 C  CE2   . PHE F 3 19  ? 41.955  114.566 52.129  1.00 11.71 ? 1011 PHE B CE2   1 
ATOM   4092 C  CZ    . PHE F 3 19  ? 42.778  115.655 51.890  1.00 12.12 ? 1011 PHE B CZ    1 
ATOM   4093 N  N     . TYR F 3 20  ? 42.273  113.262 57.045  1.00 10.57 ? 1012 TYR B N     1 
ATOM   4094 C  CA    . TYR F 3 20  ? 41.142  114.024 57.599  1.00 10.98 ? 1012 TYR B CA    1 
ATOM   4095 C  C     . TYR F 3 20  ? 41.554  114.815 58.824  1.00 10.94 ? 1012 TYR B C     1 
ATOM   4096 O  O     . TYR F 3 20  ? 41.232  115.992 58.944  1.00 10.84 ? 1012 TYR B O     1 
ATOM   4097 C  CB    . TYR F 3 20  ? 39.979  113.122 58.011  1.00 10.94 ? 1012 TYR B CB    1 
ATOM   4098 C  CG    . TYR F 3 20  ? 39.298  112.369 56.900  1.00 11.72 ? 1012 TYR B CG    1 
ATOM   4099 C  CD1   . TYR F 3 20  ? 39.449  112.745 55.566  1.00 12.87 ? 1012 TYR B CD1   1 
ATOM   4100 C  CD2   . TYR F 3 20  ? 38.463  111.291 57.191  1.00 11.15 ? 1012 TYR B CD2   1 
ATOM   4101 C  CE1   . TYR F 3 20  ? 38.792  112.064 54.567  1.00 13.18 ? 1012 TYR B CE1   1 
ATOM   4102 C  CE2   . TYR F 3 20  ? 37.820  110.605 56.207  1.00 11.77 ? 1012 TYR B CE2   1 
ATOM   4103 C  CZ    . TYR F 3 20  ? 37.989  110.989 54.892  1.00 12.68 ? 1012 TYR B CZ    1 
ATOM   4104 O  OH    . TYR F 3 20  ? 37.342  110.306 53.897  1.00 13.83 ? 1012 TYR B OH    1 
ATOM   4105 N  N     . ALA F 3 21  ? 42.254  114.167 59.744  1.00 11.25 ? 1013 ALA B N     1 
ATOM   4106 C  CA    . ALA F 3 21  ? 42.708  114.864 60.941  1.00 11.56 ? 1013 ALA B CA    1 
ATOM   4107 C  C     . ALA F 3 21  ? 43.682  115.987 60.569  1.00 11.61 ? 1013 ALA B C     1 
ATOM   4108 O  O     . ALA F 3 21  ? 43.615  117.057 61.158  1.00 11.74 ? 1013 ALA B O     1 
ATOM   4109 C  CB    . ALA F 3 21  ? 43.316  113.890 61.970  1.00 11.35 ? 1013 ALA B CB    1 
ATOM   4110 N  N     . GLN F 3 22  ? 44.530  115.763 59.564  1.00 11.69 ? 1014 GLN B N     1 
ATOM   4111 C  CA    . GLN F 3 22  ? 45.504  116.771 59.138  1.00 12.10 ? 1014 GLN B CA    1 
ATOM   4112 C  C     . GLN F 3 22  ? 44.882  118.044 58.580  1.00 12.53 ? 1014 GLN B C     1 
ATOM   4113 O  O     . GLN F 3 22  ? 45.393  119.131 58.804  1.00 12.77 ? 1014 GLN B O     1 
ATOM   4114 C  CB    . GLN F 3 22  ? 46.498  116.208 58.117  1.00 12.08 ? 1014 GLN B CB    1 
ATOM   4115 C  CG    . GLN F 3 22  ? 47.774  117.046 58.067  1.00 12.64 ? 1014 GLN B CG    1 
ATOM   4116 C  CD    . GLN F 3 22  ? 48.893  116.463 57.205  1.00 14.14 ? 1014 GLN B CD    1 
ATOM   4117 O  OE1   . GLN F 3 22  ? 48.768  115.377 56.622  1.00 14.19 ? 1014 GLN B OE1   1 
ATOM   4118 N  NE2   . GLN F 3 22  ? 49.997  117.189 57.138  1.00 13.33 ? 1014 GLN B NE2   1 
ATOM   4119 N  N     . VAL F 3 23  ? 43.783  117.914 57.852  1.00 13.35 ? 1015 VAL B N     1 
ATOM   4120 C  CA    . VAL F 3 23  ? 43.110  119.068 57.265  1.00 13.73 ? 1015 VAL B CA    1 
ATOM   4121 C  C     . VAL F 3 23  ? 42.388  119.866 58.345  1.00 13.95 ? 1015 VAL B C     1 
ATOM   4122 O  O     . VAL F 3 23  ? 42.210  121.073 58.205  1.00 13.90 ? 1015 VAL B O     1 
ATOM   4123 C  CB    . VAL F 3 23  ? 42.104  118.642 56.173  1.00 13.87 ? 1015 VAL B CB    1 
ATOM   4124 C  CG1   . VAL F 3 23  ? 41.283  119.833 55.687  1.00 13.86 ? 1015 VAL B CG1   1 
ATOM   4125 C  CG2   . VAL F 3 23  ? 42.838  118.005 55.010  1.00 14.52 ? 1015 VAL B CG2   1 
ATOM   4126 N  N     . GLU F 3 24  ? 41.960  119.195 59.414  1.00 14.09 ? 1016 GLU B N     1 
ATOM   4127 C  CA    . GLU F 3 24  ? 41.406  119.902 60.560  1.00 14.13 ? 1016 GLU B CA    1 
ATOM   4128 C  C     . GLU F 3 24  ? 42.483  120.757 61.240  1.00 14.55 ? 1016 GLU B C     1 
ATOM   4129 O  O     . GLU F 3 24  ? 42.188  121.844 61.726  1.00 14.29 ? 1016 GLU B O     1 
ATOM   4130 C  CB    . GLU F 3 24  ? 40.758  118.938 61.553  1.00 13.89 ? 1016 GLU B CB    1 
ATOM   4131 C  CG    . GLU F 3 24  ? 39.518  118.222 61.010  1.00 13.21 ? 1016 GLU B CG    1 
ATOM   4132 C  CD    . GLU F 3 24  ? 38.355  119.155 60.730  1.00 12.58 ? 1016 GLU B CD    1 
ATOM   4133 O  OE1   . GLU F 3 24  ? 38.475  120.358 61.049  1.00 12.20 ? 1016 GLU B OE1   1 
ATOM   4134 O  OE2   . GLU F 3 24  ? 37.320  118.687 60.197  1.00 10.52 ? 1016 GLU B OE2   1 
ATOM   4135 N  N     . GLU F 3 25  ? 43.727  120.284 61.244  1.00 15.04 ? 1017 GLU B N     1 
ATOM   4136 C  CA    . GLU F 3 25  ? 44.844  121.052 61.818  1.00 15.78 ? 1017 GLU B CA    1 
ATOM   4137 C  C     . GLU F 3 25  ? 45.198  122.284 60.980  1.00 15.59 ? 1017 GLU B C     1 
ATOM   4138 O  O     . GLU F 3 25  ? 45.483  123.346 61.520  1.00 15.64 ? 1017 GLU B O     1 
ATOM   4139 C  CB    . GLU F 3 25  ? 46.093  120.180 61.984  1.00 16.01 ? 1017 GLU B CB    1 
ATOM   4140 C  CG    . GLU F 3 25  ? 46.050  119.263 63.189  1.00 18.24 ? 1017 GLU B CG    1 
ATOM   4141 C  CD    . GLU F 3 25  ? 47.197  118.260 63.211  1.00 21.75 ? 1017 GLU B CD    1 
ATOM   4142 O  OE1   . GLU F 3 25  ? 48.354  118.678 62.917  1.00 22.72 ? 1017 GLU B OE1   1 
ATOM   4143 O  OE2   . GLU F 3 25  ? 46.934  117.060 63.521  1.00 22.80 ? 1017 GLU B OE2   1 
ATOM   4144 N  N     . VAL F 3 26  ? 45.185  122.136 59.662  1.00 15.51 ? 1018 VAL B N     1 
ATOM   4145 C  CA    . VAL F 3 26  ? 45.489  123.248 58.769  1.00 15.37 ? 1018 VAL B CA    1 
ATOM   4146 C  C     . VAL F 3 26  ? 44.464  124.361 59.001  1.00 15.20 ? 1018 VAL B C     1 
ATOM   4147 O  O     . VAL F 3 26  ? 44.817  125.536 59.092  1.00 15.21 ? 1018 VAL B O     1 
ATOM   4148 C  CB    . VAL F 3 26  ? 45.499  122.785 57.289  1.00 15.38 ? 1018 VAL B CB    1 
ATOM   4149 C  CG1   . VAL F 3 26  ? 45.652  123.967 56.341  1.00 15.00 ? 1018 VAL B CG1   1 
ATOM   4150 C  CG2   . VAL F 3 26  ? 46.626  121.749 57.057  1.00 15.55 ? 1018 VAL B CG2   1 
ATOM   4151 N  N     . LEU F 3 27  ? 43.204  123.964 59.131  1.00 15.05 ? 1019 LEU B N     1 
ATOM   4152 C  CA    . LEU F 3 27  ? 42.100  124.881 59.375  1.00 15.12 ? 1019 LEU B CA    1 
ATOM   4153 C  C     . LEU F 3 27  ? 42.043  125.418 60.815  1.00 15.04 ? 1019 LEU B C     1 
ATOM   4154 O  O     . LEU F 3 27  ? 41.514  126.492 61.052  1.00 15.31 ? 1019 LEU B O     1 
ATOM   4155 C  CB    . LEU F 3 27  ? 40.777  124.195 59.030  1.00 15.22 ? 1019 LEU B CB    1 
ATOM   4156 C  CG    . LEU F 3 27  ? 40.293  124.442 57.602  1.00 16.06 ? 1019 LEU B CG    1 
ATOM   4157 C  CD1   . LEU F 3 27  ? 41.204  123.782 56.578  1.00 16.66 ? 1019 LEU B CD1   1 
ATOM   4158 C  CD2   . LEU F 3 27  ? 38.867  123.950 57.458  1.00 16.67 ? 1019 LEU B CD2   1 
ATOM   4159 N  N     . ASN F 3 28  ? 42.578  124.676 61.775  1.00 14.98 ? 1020 ASN B N     1 
ATOM   4160 C  CA    . ASN F 3 28  ? 42.623  125.122 63.168  1.00 14.65 ? 1020 ASN B CA    1 
ATOM   4161 C  C     . ASN F 3 28  ? 43.927  124.659 63.811  1.00 14.27 ? 1020 ASN B C     1 
ATOM   4162 O  O     . ASN F 3 28  ? 43.942  123.672 64.525  1.00 14.29 ? 1020 ASN B O     1 
ATOM   4163 C  CB    . ASN F 3 28  ? 41.413  124.582 63.937  1.00 14.70 ? 1020 ASN B CB    1 
ATOM   4164 C  CG    . ASN F 3 28  ? 41.379  125.036 65.392  1.00 15.33 ? 1020 ASN B CG    1 
ATOM   4165 O  OD1   . ASN F 3 28  ? 42.318  125.655 65.892  1.00 16.22 ? 1020 ASN B OD1   1 
ATOM   4166 N  ND2   . ASN F 3 28  ? 40.284  124.735 66.074  1.00 16.03 ? 1020 ASN B ND2   1 
ATOM   4167 N  N     . PRO F 3 29  ? 45.024  125.363 63.549  1.00 13.96 ? 1021 PRO B N     1 
ATOM   4168 C  CA    . PRO F 3 29  ? 46.337  124.980 64.090  1.00 13.92 ? 1021 PRO B CA    1 
ATOM   4169 C  C     . PRO F 3 29  ? 46.410  124.724 65.611  1.00 13.80 ? 1021 PRO B C     1 
ATOM   4170 O  O     . PRO F 3 29  ? 47.382  124.117 66.042  1.00 13.56 ? 1021 PRO B O     1 
ATOM   4171 C  CB    . PRO F 3 29  ? 47.231  126.170 63.699  1.00 13.86 ? 1021 PRO B CB    1 
ATOM   4172 C  CG    . PRO F 3 29  ? 46.589  126.739 62.495  1.00 13.57 ? 1021 PRO B CG    1 
ATOM   4173 C  CD    . PRO F 3 29  ? 45.116  126.556 62.691  1.00 13.73 ? 1021 PRO B CD    1 
ATOM   4174 N  N     . SER F 3 30  ? 45.443  125.186 66.403  1.00 13.80 ? 1022 SER B N     1 
ATOM   4175 C  CA    . SER F 3 30  ? 45.471  124.946 67.854  1.00 13.84 ? 1022 SER B CA    1 
ATOM   4176 C  C     . SER F 3 30  ? 45.359  123.451 68.212  1.00 13.91 ? 1022 SER B C     1 
ATOM   4177 O  O     . SER F 3 30  ? 45.803  123.022 69.279  1.00 13.72 ? 1022 SER B O     1 
ATOM   4178 C  CB    . SER F 3 30  ? 44.389  125.775 68.564  1.00 13.80 ? 1022 SER B CB    1 
ATOM   4179 O  OG    . SER F 3 30  ? 43.090  125.297 68.279  1.00 13.45 ? 1022 SER B OG    1 
ATOM   4180 N  N     . LEU F 3 31  ? 44.762  122.674 67.310  1.00 14.08 ? 1023 LEU B N     1 
ATOM   4181 C  CA    . LEU F 3 31  ? 44.794  121.207 67.355  1.00 13.93 ? 1023 LEU B CA    1 
ATOM   4182 C  C     . LEU F 3 31  ? 46.212  120.600 67.351  1.00 13.91 ? 1023 LEU B C     1 
ATOM   4183 O  O     . LEU F 3 31  ? 46.420  119.530 67.901  1.00 13.88 ? 1023 LEU B O     1 
ATOM   4184 C  CB    . LEU F 3 31  ? 44.008  120.638 66.160  1.00 13.84 ? 1023 LEU B CB    1 
ATOM   4185 C  CG    . LEU F 3 31  ? 42.499  120.371 66.280  1.00 13.87 ? 1023 LEU B CG    1 
ATOM   4186 C  CD1   . LEU F 3 31  ? 41.841  121.114 67.416  1.00 13.97 ? 1023 LEU B CD1   1 
ATOM   4187 C  CD2   . LEU F 3 31  ? 41.799  120.702 64.966  1.00 13.88 ? 1023 LEU B CD2   1 
ATOM   4188 N  N     . LYS F 3 32  ? 47.163  121.266 66.705  1.00 13.92 ? 1024 LYS B N     1 
ATOM   4189 C  CA    . LYS F 3 32  ? 48.544  120.786 66.610  1.00 14.30 ? 1024 LYS B CA    1 
ATOM   4190 C  C     . LYS F 3 32  ? 49.094  120.340 67.962  1.00 14.12 ? 1024 LYS B C     1 
ATOM   4191 O  O     . LYS F 3 32  ? 49.071  121.108 68.926  1.00 14.57 ? 1024 LYS B O     1 
ATOM   4192 C  CB    . LYS F 3 32  ? 49.453  121.872 66.019  1.00 14.47 ? 1024 LYS B CB    1 
ATOM   4193 C  CG    . LYS F 3 32  ? 50.747  121.344 65.392  1.00 16.40 ? 1024 LYS B CG    1 
ATOM   4194 C  CD    . LYS F 3 32  ? 50.581  120.993 63.876  1.00 18.09 ? 1024 LYS B CD    1 
ATOM   4195 C  CE    . LYS F 3 32  ? 51.530  119.838 63.423  1.00 18.32 ? 1024 LYS B CE    1 
ATOM   4196 N  NZ    . LYS F 3 32  ? 52.275  120.142 62.149  1.00 18.64 ? 1024 LYS B NZ    1 
ATOM   4197 N  N     . GLY F 3 33  ? 49.584  119.102 68.028  1.00 13.78 ? 1025 GLY B N     1 
ATOM   4198 C  CA    . GLY F 3 33  ? 50.124  118.539 69.262  1.00 13.62 ? 1025 GLY B CA    1 
ATOM   4199 C  C     . GLY F 3 33  ? 49.117  117.808 70.143  1.00 13.31 ? 1025 GLY B C     1 
ATOM   4200 O  O     . GLY F 3 33  ? 49.478  117.242 71.175  1.00 13.08 ? 1025 GLY B O     1 
ATOM   4201 N  N     . LYS F 3 34  ? 47.857  117.813 69.723  1.00 13.05 ? 1026 LYS B N     1 
ATOM   4202 C  CA    . LYS F 3 34  ? 46.778  117.167 70.459  1.00 12.86 ? 1026 LYS B CA    1 
ATOM   4203 C  C     . LYS F 3 34  ? 46.384  115.888 69.731  1.00 12.38 ? 1026 LYS B C     1 
ATOM   4204 O  O     . LYS F 3 34  ? 46.605  115.766 68.522  1.00 12.19 ? 1026 LYS B O     1 
ATOM   4205 C  CB    . LYS F 3 34  ? 45.557  118.100 70.574  1.00 13.02 ? 1026 LYS B CB    1 
ATOM   4206 C  CG    . LYS F 3 34  ? 45.894  119.543 71.020  1.00 12.77 ? 1026 LYS B CG    1 
ATOM   4207 C  CD    . LYS F 3 34  ? 45.019  120.043 72.172  1.00 12.33 ? 1026 LYS B CD    1 
ATOM   4208 C  CE    . LYS F 3 34  ? 43.868  120.929 71.714  1.00 11.86 ? 1026 LYS B CE    1 
ATOM   4209 N  NZ    . LYS F 3 34  ? 43.887  122.246 72.402  1.00 11.82 ? 1026 LYS B NZ    1 
ATOM   4210 N  N     . PRO F 3 35  ? 45.832  114.926 70.461  1.00 11.80 ? 1027 PRO B N     1 
ATOM   4211 C  CA    . PRO F 3 35  ? 45.197  113.777 69.830  1.00 11.44 ? 1027 PRO B CA    1 
ATOM   4212 C  C     . PRO F 3 35  ? 43.881  114.226 69.205  1.00 11.12 ? 1027 PRO B C     1 
ATOM   4213 O  O     . PRO F 3 35  ? 43.061  114.835 69.881  1.00 11.63 ? 1027 PRO B O     1 
ATOM   4214 C  CB    . PRO F 3 35  ? 44.991  112.810 70.995  1.00 11.20 ? 1027 PRO B CB    1 
ATOM   4215 C  CG    . PRO F 3 35  ? 44.907  113.627 72.160  1.00 11.70 ? 1027 PRO B CG    1 
ATOM   4216 C  CD    . PRO F 3 35  ? 45.776  114.834 71.927  1.00 12.00 ? 1027 PRO B CD    1 
ATOM   4217 N  N     . VAL F 3 36  ? 43.695  113.938 67.925  1.00 10.44 ? 1028 VAL B N     1 
ATOM   4218 C  CA    . VAL F 3 36  ? 42.548  114.418 67.180  1.00 9.97  ? 1028 VAL B CA    1 
ATOM   4219 C  C     . VAL F 3 36  ? 41.887  113.247 66.505  1.00 9.95  ? 1028 VAL B C     1 
ATOM   4220 O  O     . VAL F 3 36  ? 42.529  112.487 65.820  1.00 9.88  ? 1028 VAL B O     1 
ATOM   4221 C  CB    . VAL F 3 36  ? 42.958  115.425 66.112  1.00 9.64  ? 1028 VAL B CB    1 
ATOM   4222 C  CG1   . VAL F 3 36  ? 41.748  115.893 65.324  1.00 9.90  ? 1028 VAL B CG1   1 
ATOM   4223 C  CG2   . VAL F 3 36  ? 43.669  116.604 66.738  1.00 9.21  ? 1028 VAL B CG2   1 
ATOM   4224 N  N     . VAL F 3 37  ? 40.582  113.145 66.673  1.00 10.50 ? 1029 VAL B N     1 
ATOM   4225 C  CA    . VAL F 3 37  ? 39.817  111.991 66.257  1.00 10.83 ? 1029 VAL B CA    1 
ATOM   4226 C  C     . VAL F 3 37  ? 38.643  112.452 65.396  1.00 10.91 ? 1029 VAL B C     1 
ATOM   4227 O  O     . VAL F 3 37  ? 37.708  113.044 65.896  1.00 10.76 ? 1029 VAL B O     1 
ATOM   4228 C  CB    . VAL F 3 37  ? 39.322  111.247 67.495  1.00 10.72 ? 1029 VAL B CB    1 
ATOM   4229 C  CG1   . VAL F 3 37  ? 38.719  109.918 67.128  1.00 11.85 ? 1029 VAL B CG1   1 
ATOM   4230 C  CG2   . VAL F 3 37  ? 40.467  111.017 68.434  1.00 11.26 ? 1029 VAL B CG2   1 
ATOM   4231 N  N     . VAL F 3 38  ? 38.716  112.208 64.094  1.00 11.40 ? 1030 VAL B N     1 
ATOM   4232 C  CA    . VAL F 3 38  ? 37.636  112.573 63.172  1.00 11.74 ? 1030 VAL B CA    1 
ATOM   4233 C  C     . VAL F 3 38  ? 36.613  111.456 63.151  1.00 11.76 ? 1030 VAL B C     1 
ATOM   4234 O  O     . VAL F 3 38  ? 36.966  110.300 63.015  1.00 11.82 ? 1030 VAL B O     1 
ATOM   4235 C  CB    . VAL F 3 38  ? 38.167  112.850 61.741  1.00 11.79 ? 1030 VAL B CB    1 
ATOM   4236 C  CG1   . VAL F 3 38  ? 37.035  113.275 60.794  1.00 11.65 ? 1030 VAL B CG1   1 
ATOM   4237 C  CG2   . VAL F 3 38  ? 39.231  113.929 61.782  1.00 11.77 ? 1030 VAL B CG2   1 
ATOM   4238 N  N     . CYS F 3 39  ? 35.345  111.819 63.266  1.00 11.97 ? 1031 CYS B N     1 
ATOM   4239 C  CA    . CYS F 3 39  ? 34.294  110.867 63.579  1.00 12.49 ? 1031 CYS B CA    1 
ATOM   4240 C  C     . CYS F 3 39  ? 33.059  111.011 62.704  1.00 12.62 ? 1031 CYS B C     1 
ATOM   4241 O  O     . CYS F 3 39  ? 32.746  112.097 62.225  1.00 12.58 ? 1031 CYS B O     1 
ATOM   4242 C  CB    . CYS F 3 39  ? 33.849  111.062 65.022  1.00 12.54 ? 1031 CYS B CB    1 
ATOM   4243 S  SG    . CYS F 3 39  ? 35.123  110.794 66.252  1.00 13.45 ? 1031 CYS B SG    1 
ATOM   4244 N  N     . VAL F 3 40  ? 32.343  109.904 62.542  1.00 12.73 ? 1032 VAL B N     1 
ATOM   4245 C  CA    . VAL F 3 40  ? 31.045  109.897 61.895  1.00 13.12 ? 1032 VAL B CA    1 
ATOM   4246 C  C     . VAL F 3 40  ? 30.028  109.827 63.012  1.00 13.44 ? 1032 VAL B C     1 
ATOM   4247 O  O     . VAL F 3 40  ? 29.959  108.832 63.721  1.00 13.36 ? 1032 VAL B O     1 
ATOM   4248 C  CB    . VAL F 3 40  ? 30.879  108.673 60.959  1.00 13.06 ? 1032 VAL B CB    1 
ATOM   4249 C  CG1   . VAL F 3 40  ? 29.645  108.816 60.096  1.00 13.02 ? 1032 VAL B CG1   1 
ATOM   4250 C  CG2   . VAL F 3 40  ? 32.110  108.494 60.099  1.00 13.11 ? 1032 VAL B CG2   1 
ATOM   4251 N  N     . PHE F 3 41  ? 29.262  110.897 63.184  1.00 14.00 ? 1033 PHE B N     1 
ATOM   4252 C  CA    . PHE F 3 41  ? 28.266  110.966 64.241  1.00 14.34 ? 1033 PHE B CA    1 
ATOM   4253 C  C     . PHE F 3 41  ? 26.922  110.654 63.606  1.00 15.31 ? 1033 PHE B C     1 
ATOM   4254 O  O     . PHE F 3 41  ? 26.529  111.304 62.636  1.00 15.50 ? 1033 PHE B O     1 
ATOM   4255 C  CB    . PHE F 3 41  ? 28.234  112.355 64.877  1.00 14.16 ? 1033 PHE B CB    1 
ATOM   4256 C  CG    . PHE F 3 41  ? 29.372  112.628 65.811  1.00 12.71 ? 1033 PHE B CG    1 
ATOM   4257 C  CD1   . PHE F 3 41  ? 29.385  112.090 67.084  1.00 11.75 ? 1033 PHE B CD1   1 
ATOM   4258 C  CD2   . PHE F 3 41  ? 30.421  113.455 65.428  1.00 12.20 ? 1033 PHE B CD2   1 
ATOM   4259 C  CE1   . PHE F 3 41  ? 30.431  112.361 67.952  1.00 10.85 ? 1033 PHE B CE1   1 
ATOM   4260 C  CE2   . PHE F 3 41  ? 31.469  113.730 66.297  1.00 11.06 ? 1033 PHE B CE2   1 
ATOM   4261 C  CZ    . PHE F 3 41  ? 31.477  113.174 67.553  1.00 10.51 ? 1033 PHE B CZ    1 
ATOM   4262 N  N     . SER F 3 42  ? 26.222  109.676 64.173  1.00 16.39 ? 1034 SER B N     1 
ATOM   4263 C  CA    . SER F 3 42  ? 24.988  109.142 63.601  1.00 17.33 ? 1034 SER B CA    1 
ATOM   4264 C  C     . SER F 3 42  ? 23.743  109.957 63.948  1.00 18.23 ? 1034 SER B C     1 
ATOM   4265 O  O     . SER F 3 42  ? 22.798  110.004 63.157  1.00 18.79 ? 1034 SER B O     1 
ATOM   4266 C  CB    . SER F 3 42  ? 24.782  107.679 64.040  1.00 17.44 ? 1034 SER B CB    1 
ATOM   4267 O  OG    . SER F 3 42  ? 24.698  107.540 65.452  1.00 17.37 ? 1034 SER B OG    1 
ATOM   4268 N  N     . GLY F 3 43  ? 23.741  110.590 65.118  1.00 19.04 ? 1035 GLY B N     1 
ATOM   4269 C  CA    . GLY F 3 43  ? 22.579  111.314 65.604  1.00 19.67 ? 1035 GLY B CA    1 
ATOM   4270 C  C     . GLY F 3 43  ? 21.844  110.527 66.673  1.00 20.31 ? 1035 GLY B C     1 
ATOM   4271 O  O     . GLY F 3 43  ? 21.349  111.102 67.654  1.00 20.84 ? 1035 GLY B O     1 
ATOM   4272 N  N     . ARG F 3 44  ? 21.775  109.208 66.497  1.00 20.63 ? 1036 ARG B N     1 
ATOM   4273 C  CA    . ARG F 3 44  ? 21.137  108.328 67.479  1.00 20.98 ? 1036 ARG B CA    1 
ATOM   4274 C  C     . ARG F 3 44  ? 21.333  108.780 68.937  1.00 20.91 ? 1036 ARG B C     1 
ATOM   4275 O  O     . ARG F 3 44  ? 20.397  108.707 69.728  1.00 21.36 ? 1036 ARG B O     1 
ATOM   4276 C  CB    . ARG F 3 44  ? 21.636  106.890 67.319  1.00 21.23 ? 1036 ARG B CB    1 
ATOM   4277 C  CG    . ARG F 3 44  ? 20.658  105.930 66.656  1.00 21.79 ? 1036 ARG B CG    1 
ATOM   4278 C  CD    . ARG F 3 44  ? 21.160  104.483 66.695  1.00 23.56 ? 1036 ARG B CD    1 
ATOM   4279 N  NE    . ARG F 3 44  ? 20.116  103.479 66.457  1.00 24.42 ? 1036 ARG B NE    1 
ATOM   4280 C  CZ    . ARG F 3 44  ? 19.632  102.629 67.376  1.00 25.15 ? 1036 ARG B CZ    1 
ATOM   4281 N  NH1   . ARG F 3 44  ? 20.075  102.622 68.635  1.00 24.22 ? 1036 ARG B NH1   1 
ATOM   4282 N  NH2   . ARG F 3 44  ? 18.690  101.761 67.020  1.00 25.85 ? 1036 ARG B NH2   1 
ATOM   4283 N  N     . PHE F 3 45  ? 22.530  109.240 69.291  1.00 20.79 ? 1037 PHE B N     1 
ATOM   4284 C  CA    . PHE F 3 45  ? 22.785  109.767 70.638  1.00 20.85 ? 1037 PHE B CA    1 
ATOM   4285 C  C     . PHE F 3 45  ? 23.884  110.843 70.674  1.00 20.98 ? 1037 PHE B C     1 
ATOM   4286 O  O     . PHE F 3 45  ? 24.532  111.156 69.672  1.00 20.81 ? 1037 PHE B O     1 
ATOM   4287 C  CB    . PHE F 3 45  ? 23.198  108.641 71.611  1.00 20.84 ? 1037 PHE B CB    1 
ATOM   4288 C  CG    . PHE F 3 45  ? 22.203  107.501 71.725  1.00 20.31 ? 1037 PHE B CG    1 
ATOM   4289 C  CD1   . PHE F 3 45  ? 22.444  106.283 71.097  1.00 19.46 ? 1037 PHE B CD1   1 
ATOM   4290 C  CD2   . PHE F 3 45  ? 21.049  107.634 72.494  1.00 20.07 ? 1037 PHE B CD2   1 
ATOM   4291 C  CE1   . PHE F 3 45  ? 21.543  105.226 71.208  1.00 18.96 ? 1037 PHE B CE1   1 
ATOM   4292 C  CE2   . PHE F 3 45  ? 20.140  106.575 72.610  1.00 19.68 ? 1037 PHE B CE2   1 
ATOM   4293 C  CZ    . PHE F 3 45  ? 20.388  105.375 71.963  1.00 19.23 ? 1037 PHE B CZ    1 
ATOM   4294 N  N     . GLU F 3 46  ? 24.077  111.416 71.857  1.00 21.11 ? 1038 GLU B N     1 
ATOM   4295 C  CA    . GLU F 3 46  ? 25.324  112.108 72.162  1.00 21.30 ? 1038 GLU B CA    1 
ATOM   4296 C  C     . GLU F 3 46  ? 26.433  111.056 71.957  1.00 20.91 ? 1038 GLU B C     1 
ATOM   4297 O  O     . GLU F 3 46  ? 26.397  109.999 72.605  1.00 21.52 ? 1038 GLU B O     1 
ATOM   4298 C  CB    . GLU F 3 46  ? 25.326  112.606 73.628  1.00 21.45 ? 1038 GLU B CB    1 
ATOM   4299 C  CG    . GLU F 3 46  ? 25.731  114.063 73.849  1.00 22.34 ? 1038 GLU B CG    1 
ATOM   4300 C  CD    . GLU F 3 46  ? 25.363  114.568 75.248  1.00 23.80 ? 1038 GLU B CD    1 
ATOM   4301 O  OE1   . GLU F 3 46  ? 26.283  114.954 76.015  1.00 24.60 ? 1038 GLU B OE1   1 
ATOM   4302 O  OE2   . GLU F 3 46  ? 24.152  114.579 75.587  1.00 23.81 ? 1038 GLU B OE2   1 
ATOM   4303 N  N     . ASP F 3 47  ? 27.381  111.307 71.056  1.00 19.71 ? 1039 ASP B N     1 
ATOM   4304 C  CA    . ASP F 3 47  ? 28.559  110.433 70.906  1.00 18.97 ? 1039 ASP B CA    1 
ATOM   4305 C  C     . ASP F 3 47  ? 28.387  109.202 69.997  1.00 18.15 ? 1039 ASP B C     1 
ATOM   4306 O  O     . ASP F 3 47  ? 29.387  108.638 69.548  1.00 18.51 ? 1039 ASP B O     1 
ATOM   4307 C  CB    . ASP F 3 47  ? 29.092  109.933 72.268  1.00 19.07 ? 1039 ASP B CB    1 
ATOM   4308 C  CG    . ASP F 3 47  ? 29.705  111.035 73.117  1.00 19.84 ? 1039 ASP B CG    1 
ATOM   4309 O  OD1   . ASP F 3 47  ? 29.887  112.170 72.624  1.00 21.89 ? 1039 ASP B OD1   1 
ATOM   4310 O  OD2   . ASP F 3 47  ? 30.060  110.841 74.300  1.00 19.46 ? 1039 ASP B OD2   1 
ATOM   4311 N  N     . SER F 3 48  ? 27.164  108.756 69.730  1.00 16.79 ? 1040 SER B N     1 
ATOM   4312 C  CA    . SER F 3 48  ? 26.992  107.523 68.955  1.00 15.88 ? 1040 SER B CA    1 
ATOM   4313 C  C     . SER F 3 48  ? 27.711  107.647 67.613  1.00 15.02 ? 1040 SER B C     1 
ATOM   4314 O  O     . SER F 3 48  ? 27.574  108.657 66.941  1.00 15.09 ? 1040 SER B O     1 
ATOM   4315 C  CB    . SER F 3 48  ? 25.508  107.208 68.739  1.00 15.83 ? 1040 SER B CB    1 
ATOM   4316 O  OG    . SER F 3 48  ? 24.915  108.114 67.816  1.00 15.71 ? 1040 SER B OG    1 
ATOM   4317 N  N     . GLY F 3 49  ? 28.491  106.639 67.234  1.00 14.00 ? 1041 GLY B N     1 
ATOM   4318 C  CA    . GLY F 3 49  ? 29.198  106.681 65.960  1.00 13.22 ? 1041 GLY B CA    1 
ATOM   4319 C  C     . GLY F 3 49  ? 30.472  105.854 65.828  1.00 12.35 ? 1041 GLY B C     1 
ATOM   4320 O  O     . GLY F 3 49  ? 30.686  104.909 66.574  1.00 11.58 ? 1041 GLY B O     1 
ATOM   4321 N  N     . ALA F 3 50  ? 31.296  106.217 64.841  1.00 11.94 ? 1042 ALA B N     1 
ATOM   4322 C  CA    . ALA F 3 50  ? 32.529  105.503 64.507  1.00 11.73 ? 1042 ALA B CA    1 
ATOM   4323 C  C     . ALA F 3 50  ? 33.677  106.449 64.148  1.00 11.79 ? 1042 ALA B C     1 
ATOM   4324 O  O     . ALA F 3 50  ? 33.476  107.504 63.583  1.00 12.00 ? 1042 ALA B O     1 
ATOM   4325 C  CB    . ALA F 3 50  ? 32.282  104.560 63.358  1.00 11.64 ? 1042 ALA B CB    1 
ATOM   4326 N  N     . VAL F 3 51  ? 34.894  106.033 64.460  1.00 11.97 ? 1043 VAL B N     1 
ATOM   4327 C  CA    . VAL F 3 51  ? 36.093  106.792 64.150  1.00 11.82 ? 1043 VAL B CA    1 
ATOM   4328 C  C     . VAL F 3 51  ? 36.440  106.554 62.697  1.00 11.94 ? 1043 VAL B C     1 
ATOM   4329 O  O     . VAL F 3 51  ? 36.494  105.412 62.255  1.00 11.49 ? 1043 VAL B O     1 
ATOM   4330 C  CB    . VAL F 3 51  ? 37.267  106.317 65.027  1.00 11.94 ? 1043 VAL B CB    1 
ATOM   4331 C  CG1   . VAL F 3 51  ? 38.539  107.083 64.700  1.00 11.79 ? 1043 VAL B CG1   1 
ATOM   4332 C  CG2   . VAL F 3 51  ? 36.912  106.440 66.522  1.00 11.74 ? 1043 VAL B CG2   1 
ATOM   4333 N  N     . ALA F 3 52  ? 36.660  107.629 61.950  1.00 12.34 ? 1044 ALA B N     1 
ATOM   4334 C  CA    . ALA F 3 52  ? 37.013  107.522 60.539  1.00 12.63 ? 1044 ALA B CA    1 
ATOM   4335 C  C     . ALA F 3 52  ? 38.516  107.688 60.340  1.00 13.45 ? 1044 ALA B C     1 
ATOM   4336 O  O     . ALA F 3 52  ? 39.079  107.123 59.400  1.00 14.22 ? 1044 ALA B O     1 
ATOM   4337 C  CB    . ALA F 3 52  ? 36.249  108.532 59.727  1.00 12.31 ? 1044 ALA B CB    1 
ATOM   4338 N  N     . THR F 3 53  ? 39.160  108.495 61.181  1.00 13.76 ? 1045 THR B N     1 
ATOM   4339 C  CA    . THR F 3 53  ? 40.624  108.523 61.248  1.00 14.37 ? 1045 THR B CA    1 
ATOM   4340 C  C     . THR F 3 53  ? 41.143  109.380 62.393  1.00 14.19 ? 1045 THR B C     1 
ATOM   4341 O  O     . THR F 3 53  ? 40.488  110.300 62.851  1.00 14.83 ? 1045 THR B O     1 
ATOM   4342 C  CB    . THR F 3 53  ? 41.287  108.946 59.881  1.00 14.72 ? 1045 THR B CB    1 
ATOM   4343 O  OG1   . THR F 3 53  ? 42.457  109.750 60.105  1.00 15.84 ? 1045 THR B OG1   1 
ATOM   4344 C  CG2   . THR F 3 53  ? 40.421  109.841 59.103  1.00 15.31 ? 1045 THR B CG2   1 
ATOM   4345 N  N     . ALA F 3 54  ? 42.332  109.046 62.862  1.00 14.01 ? 1046 ALA B N     1 
ATOM   4346 C  CA    . ALA F 3 54  ? 42.946  109.727 63.992  1.00 13.57 ? 1046 ALA B CA    1 
ATOM   4347 C  C     . ALA F 3 54  ? 44.356  110.149 63.614  1.00 13.53 ? 1046 ALA B C     1 
ATOM   4348 O  O     . ALA F 3 54  ? 45.017  109.494 62.805  1.00 13.20 ? 1046 ALA B O     1 
ATOM   4349 C  CB    . ALA F 3 54  ? 42.973  108.809 65.174  1.00 13.28 ? 1046 ALA B CB    1 
ATOM   4350 N  N     . ASN F 3 55  ? 44.826  111.249 64.184  1.00 13.70 ? 1047 ASN B N     1 
ATOM   4351 C  CA    . ASN F 3 55  ? 46.203  111.667 63.932  1.00 13.75 ? 1047 ASN B CA    1 
ATOM   4352 C  C     . ASN F 3 55  ? 47.135  110.806 64.767  1.00 14.44 ? 1047 ASN B C     1 
ATOM   4353 O  O     . ASN F 3 55  ? 46.675  109.922 65.487  1.00 14.03 ? 1047 ASN B O     1 
ATOM   4354 C  CB    . ASN F 3 55  ? 46.404  113.172 64.170  1.00 13.43 ? 1047 ASN B CB    1 
ATOM   4355 C  CG    . ASN F 3 55  ? 46.151  113.597 65.602  1.00 11.87 ? 1047 ASN B CG    1 
ATOM   4356 O  OD1   . ASN F 3 55  ? 45.926  112.777 66.483  1.00 8.63  ? 1047 ASN B OD1   1 
ATOM   4357 N  ND2   . ASN F 3 55  ? 46.188  114.899 65.835  1.00 10.36 ? 1047 ASN B ND2   1 
ATOM   4358 N  N     . TYR F 3 56  ? 48.438  111.042 64.650  1.00 15.52 ? 1048 TYR B N     1 
ATOM   4359 C  CA    . TYR F 3 56  ? 49.420  110.209 65.337  1.00 16.56 ? 1048 TYR B CA    1 
ATOM   4360 C  C     . TYR F 3 56  ? 49.406  110.306 66.845  1.00 16.25 ? 1048 TYR B C     1 
ATOM   4361 O  O     . TYR F 3 56  ? 49.682  109.325 67.504  1.00 16.37 ? 1048 TYR B O     1 
ATOM   4362 C  CB    . TYR F 3 56  ? 50.829  110.390 64.747  1.00 17.08 ? 1048 TYR B CB    1 
ATOM   4363 C  CG    . TYR F 3 56  ? 50.883  109.590 63.478  1.00 20.75 ? 1048 TYR B CG    1 
ATOM   4364 C  CD1   . TYR F 3 56  ? 50.705  110.200 62.243  1.00 23.20 ? 1048 TYR B CD1   1 
ATOM   4365 C  CD2   . TYR F 3 56  ? 50.957  108.191 63.518  1.00 24.28 ? 1048 TYR B CD2   1 
ATOM   4366 C  CE1   . TYR F 3 56  ? 50.680  109.456 61.070  1.00 23.77 ? 1048 TYR B CE1   1 
ATOM   4367 C  CE2   . TYR F 3 56  ? 50.920  107.437 62.346  1.00 24.73 ? 1048 TYR B CE2   1 
ATOM   4368 C  CZ    . TYR F 3 56  ? 50.769  108.076 61.130  1.00 24.49 ? 1048 TYR B CZ    1 
ATOM   4369 O  OH    . TYR F 3 56  ? 50.738  107.345 59.960  1.00 26.49 ? 1048 TYR B OH    1 
ATOM   4370 N  N     . GLU F 3 57  ? 49.024  111.452 67.388  1.00 16.22 ? 1049 GLU B N     1 
ATOM   4371 C  CA    . GLU F 3 57  ? 48.924  111.605 68.844  1.00 16.27 ? 1049 GLU B CA    1 
ATOM   4372 C  C     . GLU F 3 57  ? 47.890  110.599 69.383  1.00 15.46 ? 1049 GLU B C     1 
ATOM   4373 O  O     . GLU F 3 57  ? 48.101  109.975 70.415  1.00 15.39 ? 1049 GLU B O     1 
ATOM   4374 C  CB    . GLU F 3 57  ? 48.534  113.042 69.232  1.00 16.56 ? 1049 GLU B CB    1 
ATOM   4375 C  CG    . GLU F 3 57  ? 49.587  114.139 69.023  1.00 18.57 ? 1049 GLU B CG    1 
ATOM   4376 C  CD    . GLU F 3 57  ? 50.147  114.242 67.594  1.00 21.82 ? 1049 GLU B CD    1 
ATOM   4377 O  OE1   . GLU F 3 57  ? 49.340  114.167 66.624  1.00 20.66 ? 1049 GLU B OE1   1 
ATOM   4378 O  OE2   . GLU F 3 57  ? 51.399  114.420 67.442  1.00 23.66 ? 1049 GLU B OE2   1 
ATOM   4379 N  N     . ALA F 3 58  ? 46.797  110.427 68.647  1.00 14.94 ? 1050 ALA B N     1 
ATOM   4380 C  CA    . ALA F 3 58  ? 45.704  109.520 69.027  1.00 14.68 ? 1050 ALA B CA    1 
ATOM   4381 C  C     . ALA F 3 58  ? 46.008  108.040 68.783  1.00 14.58 ? 1050 ALA B C     1 
ATOM   4382 O  O     . ALA F 3 58  ? 45.694  107.210 69.630  1.00 14.07 ? 1050 ALA B O     1 
ATOM   4383 C  CB    . ALA F 3 58  ? 44.410  109.915 68.300  1.00 14.28 ? 1050 ALA B CB    1 
ATOM   4384 N  N     . ARG F 3 59  ? 46.609  107.721 67.632  1.00 14.79 ? 1051 ARG B N     1 
ATOM   4385 C  CA    . ARG F 3 59  ? 46.938  106.332 67.262  1.00 14.98 ? 1051 ARG B CA    1 
ATOM   4386 C  C     . ARG F 3 59  ? 48.012  105.714 68.154  1.00 14.32 ? 1051 ARG B C     1 
ATOM   4387 O  O     . ARG F 3 59  ? 48.042  104.499 68.313  1.00 13.94 ? 1051 ARG B O     1 
ATOM   4388 C  CB    . ARG F 3 59  ? 47.407  106.233 65.805  1.00 15.36 ? 1051 ARG B CB    1 
ATOM   4389 C  CG    . ARG F 3 59  ? 46.323  106.356 64.752  1.00 17.54 ? 1051 ARG B CG    1 
ATOM   4390 C  CD    . ARG F 3 59  ? 46.808  105.913 63.375  1.00 21.54 ? 1051 ARG B CD    1 
ATOM   4391 N  NE    . ARG F 3 59  ? 45.995  106.409 62.258  1.00 24.44 ? 1051 ARG B NE    1 
ATOM   4392 C  CZ    . ARG F 3 59  ? 46.397  106.415 60.969  1.00 28.12 ? 1051 ARG B CZ    1 
ATOM   4393 N  NH1   . ARG F 3 59  ? 47.615  105.970 60.621  1.00 28.46 ? 1051 ARG B NH1   1 
ATOM   4394 N  NH2   . ARG F 3 59  ? 45.582  106.883 60.010  1.00 28.80 ? 1051 ARG B NH2   1 
ATOM   4395 N  N     . LYS F 3 60  ? 48.891  106.543 68.718  1.00 13.98 ? 1052 LYS B N     1 
ATOM   4396 C  CA    . LYS F 3 60  ? 49.936  106.071 69.636  1.00 13.96 ? 1052 LYS B CA    1 
ATOM   4397 C  C     . LYS F 3 60  ? 49.292  105.323 70.797  1.00 13.54 ? 1052 LYS B C     1 
ATOM   4398 O  O     . LYS F 3 60  ? 49.821  104.316 71.266  1.00 13.71 ? 1052 LYS B O     1 
ATOM   4399 C  CB    . LYS F 3 60  ? 50.774  107.237 70.197  1.00 14.12 ? 1052 LYS B CB    1 
ATOM   4400 C  CG    . LYS F 3 60  ? 52.105  107.510 69.485  1.00 15.03 ? 1052 LYS B CG    1 
ATOM   4401 C  CD    . LYS F 3 60  ? 52.710  108.879 69.891  1.00 16.65 ? 1052 LYS B CD    1 
ATOM   4402 C  CE    . LYS F 3 60  ? 53.804  109.369 68.899  1.00 17.77 ? 1052 LYS B CE    1 
ATOM   4403 N  NZ    . LYS F 3 60  ? 53.264  109.981 67.619  1.00 16.70 ? 1052 LYS B NZ    1 
ATOM   4404 N  N     . PHE F 3 61  ? 48.155  105.842 71.258  1.00 13.00 ? 1053 PHE B N     1 
ATOM   4405 C  CA    . PHE F 3 61  ? 47.434  105.278 72.392  1.00 12.39 ? 1053 PHE B CA    1 
ATOM   4406 C  C     . PHE F 3 61  ? 46.609  104.077 71.968  1.00 12.47 ? 1053 PHE B C     1 
ATOM   4407 O  O     . PHE F 3 61  ? 46.285  103.233 72.788  1.00 12.47 ? 1053 PHE B O     1 
ATOM   4408 C  CB    . PHE F 3 61  ? 46.561  106.342 73.062  1.00 12.06 ? 1053 PHE B CB    1 
ATOM   4409 C  CG    . PHE F 3 61  ? 47.342  107.310 73.884  1.00 10.91 ? 1053 PHE B CG    1 
ATOM   4410 C  CD1   . PHE F 3 61  ? 47.702  107.000 75.189  1.00 10.68 ? 1053 PHE B CD1   1 
ATOM   4411 C  CD2   . PHE F 3 61  ? 47.749  108.519 73.351  1.00 10.59 ? 1053 PHE B CD2   1 
ATOM   4412 C  CE1   . PHE F 3 61  ? 48.451  107.890 75.956  1.00 10.28 ? 1053 PHE B CE1   1 
ATOM   4413 C  CE2   . PHE F 3 61  ? 48.506  109.416 74.111  1.00 11.07 ? 1053 PHE B CE2   1 
ATOM   4414 C  CZ    . PHE F 3 61  ? 48.855  109.096 75.421  1.00 9.78  ? 1053 PHE B CZ    1 
ATOM   4415 N  N     . GLY F 3 62  ? 46.279  103.996 70.688  1.00 12.51 ? 1054 GLY B N     1 
ATOM   4416 C  CA    . GLY F 3 62  ? 45.609  102.830 70.148  1.00 12.79 ? 1054 GLY B CA    1 
ATOM   4417 C  C     . GLY F 3 62  ? 44.271  103.131 69.507  1.00 12.99 ? 1054 GLY B C     1 
ATOM   4418 O  O     . GLY F 3 62  ? 43.617  102.217 69.019  1.00 13.74 ? 1054 GLY B O     1 
ATOM   4419 N  N     . VAL F 3 63  ? 43.856  104.391 69.514  1.00 12.81 ? 1055 VAL B N     1 
ATOM   4420 C  CA    . VAL F 3 63  ? 42.653  104.806 68.817  1.00 12.99 ? 1055 VAL B CA    1 
ATOM   4421 C  C     . VAL F 3 63  ? 42.887  104.708 67.308  1.00 13.03 ? 1055 VAL B C     1 
ATOM   4422 O  O     . VAL F 3 63  ? 43.826  105.316 66.794  1.00 12.83 ? 1055 VAL B O     1 
ATOM   4423 C  CB    . VAL F 3 63  ? 42.288  106.266 69.166  1.00 12.92 ? 1055 VAL B CB    1 
ATOM   4424 C  CG1   . VAL F 3 63  ? 41.120  106.737 68.325  1.00 13.67 ? 1055 VAL B CG1   1 
ATOM   4425 C  CG2   . VAL F 3 63  ? 41.963  106.402 70.636  1.00 13.20 ? 1055 VAL B CG2   1 
ATOM   4426 N  N     . LYS F 3 64  ? 42.046  103.946 66.604  1.00 13.11 ? 1056 LYS B N     1 
ATOM   4427 C  CA    . LYS F 3 64  ? 42.150  103.825 65.135  1.00 13.24 ? 1056 LYS B CA    1 
ATOM   4428 C  C     . LYS F 3 64  ? 40.799  103.813 64.447  1.00 12.83 ? 1056 LYS B C     1 
ATOM   4429 O  O     . LYS F 3 64  ? 39.772  103.539 65.072  1.00 12.68 ? 1056 LYS B O     1 
ATOM   4430 C  CB    . LYS F 3 64  ? 42.949  102.570 64.722  1.00 13.53 ? 1056 LYS B CB    1 
ATOM   4431 C  CG    . LYS F 3 64  ? 42.316  101.234 65.131  1.00 14.27 ? 1056 LYS B CG    1 
ATOM   4432 C  CD    . LYS F 3 64  ? 43.345  100.113 65.257  1.00 15.47 ? 1056 LYS B CD    1 
ATOM   4433 C  CE    . LYS F 3 64  ? 42.675  98.789  65.687  1.00 17.47 ? 1056 LYS B CE    1 
ATOM   4434 N  NZ    . LYS F 3 64  ? 43.427  98.016  66.749  1.00 18.82 ? 1056 LYS B NZ    1 
ATOM   4435 N  N     . ALA F 3 65  ? 40.819  104.096 63.149  1.00 12.64 ? 1057 ALA B N     1 
ATOM   4436 C  CA    . ALA F 3 65  ? 39.609  104.101 62.330  1.00 12.64 ? 1057 ALA B CA    1 
ATOM   4437 C  C     . ALA F 3 65  ? 38.927  102.753 62.407  1.00 12.53 ? 1057 ALA B C     1 
ATOM   4438 O  O     . ALA F 3 65  ? 39.600  101.738 62.430  1.00 13.09 ? 1057 ALA B O     1 
ATOM   4439 C  CB    . ALA F 3 65  ? 39.950  104.422 60.898  1.00 12.71 ? 1057 ALA B CB    1 
ATOM   4440 N  N     . GLY F 3 66  ? 37.598  102.750 62.479  1.00 12.58 ? 1058 GLY B N     1 
ATOM   4441 C  CA    . GLY F 3 66  ? 36.805  101.531 62.568  1.00 12.26 ? 1058 GLY B CA    1 
ATOM   4442 C  C     . GLY F 3 66  ? 36.059  101.395 63.877  1.00 12.18 ? 1058 GLY B C     1 
ATOM   4443 O  O     . GLY F 3 66  ? 34.915  100.944 63.901  1.00 12.33 ? 1058 GLY B O     1 
ATOM   4444 N  N     . ILE F 3 67  ? 36.693  101.796 64.974  1.00 12.04 ? 1059 ILE B N     1 
ATOM   4445 C  CA    . ILE F 3 67  ? 36.139  101.539 66.298  1.00 11.93 ? 1059 ILE B CA    1 
ATOM   4446 C  C     . ILE F 3 67  ? 35.036  102.529 66.634  1.00 11.96 ? 1059 ILE B C     1 
ATOM   4447 O  O     . ILE F 3 67  ? 34.955  103.586 66.023  1.00 11.84 ? 1059 ILE B O     1 
ATOM   4448 C  CB    . ILE F 3 67  ? 37.242  101.568 67.372  1.00 11.99 ? 1059 ILE B CB    1 
ATOM   4449 C  CG1   . ILE F 3 67  ? 37.651  103.007 67.720  1.00 12.23 ? 1059 ILE B CG1   1 
ATOM   4450 C  CG2   . ILE F 3 67  ? 38.437  100.742 66.906  1.00 11.98 ? 1059 ILE B CG2   1 
ATOM   4451 C  CD1   . ILE F 3 67  ? 38.739  103.091 68.788  1.00 13.01 ? 1059 ILE B CD1   1 
ATOM   4452 N  N     . PRO F 3 68  ? 34.191  102.204 67.606  1.00 12.11 ? 1060 PRO B N     1 
ATOM   4453 C  CA    . PRO F 3 68  ? 33.142  103.132 68.025  1.00 12.23 ? 1060 PRO B CA    1 
ATOM   4454 C  C     . PRO F 3 68  ? 33.695  104.279 68.849  1.00 12.08 ? 1060 PRO B C     1 
ATOM   4455 O  O     . PRO F 3 68  ? 34.638  104.092 69.595  1.00 12.16 ? 1060 PRO B O     1 
ATOM   4456 C  CB    . PRO F 3 68  ? 32.209  102.259 68.878  1.00 12.42 ? 1060 PRO B CB    1 
ATOM   4457 C  CG    . PRO F 3 68  ? 32.692  100.862 68.712  1.00 12.50 ? 1060 PRO B CG    1 
ATOM   4458 C  CD    . PRO F 3 68  ? 34.143  100.957 68.386  1.00 12.30 ? 1060 PRO B CD    1 
ATOM   4459 N  N     . ILE F 3 69  ? 33.094  105.449 68.701  1.00 12.17 ? 1061 ILE B N     1 
ATOM   4460 C  CA    . ILE F 3 69  ? 33.508  106.648 69.405  1.00 12.47 ? 1061 ILE B CA    1 
ATOM   4461 C  C     . ILE F 3 69  ? 33.622  106.423 70.902  1.00 12.90 ? 1061 ILE B C     1 
ATOM   4462 O  O     . ILE F 3 69  ? 34.553  106.912 71.520  1.00 12.86 ? 1061 ILE B O     1 
ATOM   4463 C  CB    . ILE F 3 69  ? 32.512  107.780 69.110  1.00 12.35 ? 1061 ILE B CB    1 
ATOM   4464 C  CG1   . ILE F 3 69  ? 32.719  108.277 67.685  1.00 12.68 ? 1061 ILE B CG1   1 
ATOM   4465 C  CG2   . ILE F 3 69  ? 32.670  108.938 70.086  1.00 12.24 ? 1061 ILE B CG2   1 
ATOM   4466 C  CD1   . ILE F 3 69  ? 31.520  108.935 67.109  1.00 13.23 ? 1061 ILE B CD1   1 
ATOM   4467 N  N     . VAL F 3 70  ? 32.686  105.677 71.478  1.00 13.48 ? 1062 VAL B N     1 
ATOM   4468 C  CA    . VAL F 3 70  ? 32.693  105.436 72.919  1.00 14.25 ? 1062 VAL B CA    1 
ATOM   4469 C  C     . VAL F 3 70  ? 33.933  104.648 73.343  1.00 14.47 ? 1062 VAL B C     1 
ATOM   4470 O  O     . VAL F 3 70  ? 34.463  104.855 74.430  1.00 14.42 ? 1062 VAL B O     1 
ATOM   4471 C  CB    . VAL F 3 70  ? 31.407  104.714 73.385  1.00 14.25 ? 1062 VAL B CB    1 
ATOM   4472 C  CG1   . VAL F 3 70  ? 31.540  104.235 74.830  1.00 15.17 ? 1062 VAL B CG1   1 
ATOM   4473 C  CG2   . VAL F 3 70  ? 30.232  105.652 73.278  1.00 14.49 ? 1062 VAL B CG2   1 
ATOM   4474 N  N     . GLU F 3 71  ? 34.373  103.739 72.479  1.00 15.09 ? 1063 GLU B N     1 
ATOM   4475 C  CA    . GLU F 3 71  ? 35.614  103.000 72.692  1.00 15.53 ? 1063 GLU B CA    1 
ATOM   4476 C  C     . GLU F 3 71  ? 36.827  103.924 72.636  1.00 14.55 ? 1063 GLU B C     1 
ATOM   4477 O  O     . GLU F 3 71  ? 37.711  103.834 73.493  1.00 14.22 ? 1063 GLU B O     1 
ATOM   4478 C  CB    . GLU F 3 71  ? 35.770  101.860 71.678  1.00 16.19 ? 1063 GLU B CB    1 
ATOM   4479 C  CG    . GLU F 3 71  ? 36.471  100.641 72.261  1.00 19.09 ? 1063 GLU B CG    1 
ATOM   4480 C  CD    . GLU F 3 71  ? 36.611  99.495  71.270  1.00 23.34 ? 1063 GLU B CD    1 
ATOM   4481 O  OE1   . GLU F 3 71  ? 35.593  99.119  70.624  1.00 25.67 ? 1063 GLU B OE1   1 
ATOM   4482 O  OE2   . GLU F 3 71  ? 37.747  98.963  71.147  1.00 25.89 ? 1063 GLU B OE2   1 
ATOM   4483 N  N     . ALA F 3 72  ? 36.863  104.818 71.653  1.00 13.37 ? 1064 ALA B N     1 
ATOM   4484 C  CA    . ALA F 3 72  ? 37.936  105.802 71.597  1.00 13.11 ? 1064 ALA B CA    1 
ATOM   4485 C  C     . ALA F 3 72  ? 37.931  106.672 72.854  1.00 12.80 ? 1064 ALA B C     1 
ATOM   4486 O  O     . ALA F 3 72  ? 38.982  107.050 73.354  1.00 12.47 ? 1064 ALA B O     1 
ATOM   4487 C  CB    . ALA F 3 72  ? 37.823  106.661 70.355  1.00 13.04 ? 1064 ALA B CB    1 
ATOM   4488 N  N     . LYS F 3 73  ? 36.742  106.959 73.370  1.00 12.82 ? 1065 LYS B N     1 
ATOM   4489 C  CA    . LYS F 3 73  ? 36.580  107.801 74.553  1.00 12.66 ? 1065 LYS B CA    1 
ATOM   4490 C  C     . LYS F 3 73  ? 37.072  107.126 75.823  1.00 12.66 ? 1065 LYS B C     1 
ATOM   4491 O  O     . LYS F 3 73  ? 37.529  107.792 76.739  1.00 12.26 ? 1065 LYS B O     1 
ATOM   4492 C  CB    . LYS F 3 73  ? 35.125  108.246 74.701  1.00 12.38 ? 1065 LYS B CB    1 
ATOM   4493 C  CG    . LYS F 3 73  ? 34.707  109.265 73.649  1.00 12.22 ? 1065 LYS B CG    1 
ATOM   4494 C  CD    . LYS F 3 73  ? 33.648  110.205 74.142  1.00 12.29 ? 1065 LYS B CD    1 
ATOM   4495 C  CE    . LYS F 3 73  ? 33.138  111.077 73.020  1.00 12.96 ? 1065 LYS B CE    1 
ATOM   4496 N  NZ    . LYS F 3 73  ? 32.572  112.357 73.518  1.00 13.88 ? 1065 LYS B NZ    1 
ATOM   4497 N  N     . LYS F 3 74  ? 37.001  105.801 75.860  1.00 12.93 ? 1066 LYS B N     1 
ATOM   4498 C  CA    . LYS F 3 74  ? 37.565  105.041 76.966  1.00 13.07 ? 1066 LYS B CA    1 
ATOM   4499 C  C     . LYS F 3 74  ? 39.090  105.107 76.989  1.00 12.72 ? 1066 LYS B C     1 
ATOM   4500 O  O     . LYS F 3 74  ? 39.681  105.110 78.056  1.00 13.22 ? 1066 LYS B O     1 
ATOM   4501 C  CB    . LYS F 3 74  ? 37.096  103.586 76.914  1.00 13.45 ? 1066 LYS B CB    1 
ATOM   4502 C  CG    . LYS F 3 74  ? 35.659  103.395 77.390  1.00 14.78 ? 1066 LYS B CG    1 
ATOM   4503 C  CD    . LYS F 3 74  ? 35.153  101.972 77.132  1.00 16.09 ? 1066 LYS B CD    1 
ATOM   4504 C  CE    . LYS F 3 74  ? 34.395  101.396 78.326  1.00 16.97 ? 1066 LYS B CE    1 
ATOM   4505 N  NZ    . LYS F 3 74  ? 34.502  99.899  78.400  1.00 17.29 ? 1066 LYS B NZ    1 
ATOM   4506 N  N     . ILE F 3 75  ? 39.721  105.164 75.820  1.00 12.56 ? 1067 ILE B N     1 
ATOM   4507 C  CA    . ILE F 3 75  ? 41.182  105.265 75.715  1.00 12.14 ? 1067 ILE B CA    1 
ATOM   4508 C  C     . ILE F 3 75  ? 41.686  106.701 75.891  1.00 11.83 ? 1067 ILE B C     1 
ATOM   4509 O  O     . ILE F 3 75  ? 42.639  106.935 76.627  1.00 11.63 ? 1067 ILE B O     1 
ATOM   4510 C  CB    . ILE F 3 75  ? 41.662  104.713 74.356  1.00 12.27 ? 1067 ILE B CB    1 
ATOM   4511 C  CG1   . ILE F 3 75  ? 41.244  103.254 74.194  1.00 11.99 ? 1067 ILE B CG1   1 
ATOM   4512 C  CG2   . ILE F 3 75  ? 43.195  104.842 74.212  1.00 12.65 ? 1067 ILE B CG2   1 
ATOM   4513 C  CD1   . ILE F 3 75  ? 41.186  102.819 72.762  1.00 12.18 ? 1067 ILE B CD1   1 
ATOM   4514 N  N     . LEU F 3 76  ? 41.065  107.644 75.179  1.00 11.74 ? 1068 LEU B N     1 
ATOM   4515 C  CA    . LEU F 3 76  ? 41.377  109.079 75.272  1.00 11.42 ? 1068 LEU B CA    1 
ATOM   4516 C  C     . LEU F 3 76  ? 40.120  109.913 75.577  1.00 11.28 ? 1068 LEU B C     1 
ATOM   4517 O  O     . LEU F 3 76  ? 39.509  110.475 74.666  1.00 11.27 ? 1068 LEU B O     1 
ATOM   4518 C  CB    . LEU F 3 76  ? 42.003  109.572 73.967  1.00 11.25 ? 1068 LEU B CB    1 
ATOM   4519 C  CG    . LEU F 3 76  ? 43.429  109.100 73.684  1.00 11.41 ? 1068 LEU B CG    1 
ATOM   4520 C  CD1   . LEU F 3 76  ? 43.803  109.370 72.229  1.00 10.69 ? 1068 LEU B CD1   1 
ATOM   4521 C  CD2   . LEU F 3 76  ? 44.422  109.765 74.628  1.00 11.32 ? 1068 LEU B CD2   1 
ATOM   4522 N  N     . PRO F 3 77  ? 39.725  109.978 76.850  1.00 11.03 ? 1069 PRO B N     1 
ATOM   4523 C  CA    . PRO F 3 77  ? 38.579  110.800 77.266  1.00 10.87 ? 1069 PRO B CA    1 
ATOM   4524 C  C     . PRO F 3 77  ? 38.662  112.266 76.856  1.00 10.68 ? 1069 PRO B C     1 
ATOM   4525 O  O     . PRO F 3 77  ? 37.627  112.833 76.527  1.00 10.26 ? 1069 PRO B O     1 
ATOM   4526 C  CB    . PRO F 3 77  ? 38.594  110.692 78.797  1.00 10.75 ? 1069 PRO B CB    1 
ATOM   4527 C  CG    . PRO F 3 77  ? 39.336  109.457 79.108  1.00 10.90 ? 1069 PRO B CG    1 
ATOM   4528 C  CD    . PRO F 3 77  ? 40.301  109.230 77.979  1.00 10.96 ? 1069 PRO B CD    1 
ATOM   4529 N  N     . ASN F 3 78  ? 39.855  112.859 76.877  1.00 10.67 ? 1070 ASN B N     1 
ATOM   4530 C  CA    . ASN F 3 78  ? 39.996  114.291 76.595  1.00 10.86 ? 1070 ASN B CA    1 
ATOM   4531 C  C     . ASN F 3 78  ? 40.704  114.664 75.278  1.00 10.24 ? 1070 ASN B C     1 
ATOM   4532 O  O     . ASN F 3 78  ? 41.230  115.765 75.132  1.00 10.08 ? 1070 ASN B O     1 
ATOM   4533 C  CB    . ASN F 3 78  ? 40.619  115.006 77.803  1.00 11.05 ? 1070 ASN B CB    1 
ATOM   4534 C  CG    . ASN F 3 78  ? 39.566  115.502 78.772  1.00 12.47 ? 1070 ASN B CG    1 
ATOM   4535 O  OD1   . ASN F 3 78  ? 38.663  116.267 78.395  1.00 14.75 ? 1070 ASN B OD1   1 
ATOM   4536 N  ND2   . ASN F 3 78  ? 39.649  115.049 80.017  1.00 13.54 ? 1070 ASN B ND2   1 
ATOM   4537 N  N     . ALA F 3 79  ? 40.666  113.769 74.306  1.00 9.65  ? 1071 ALA B N     1 
ATOM   4538 C  CA    . ALA F 3 79  ? 41.073  114.134 72.960  1.00 9.81  ? 1071 ALA B CA    1 
ATOM   4539 C  C     . ALA F 3 79  ? 39.975  114.963 72.320  1.00 9.43  ? 1071 ALA B C     1 
ATOM   4540 O  O     . ALA F 3 79  ? 38.847  114.986 72.803  1.00 9.38  ? 1071 ALA B O     1 
ATOM   4541 C  CB    . ALA F 3 79  ? 41.361  112.892 72.123  1.00 10.09 ? 1071 ALA B CB    1 
ATOM   4542 N  N     . VAL F 3 80  ? 40.321  115.650 71.241  1.00 9.17  ? 1072 VAL B N     1 
ATOM   4543 C  CA    . VAL F 3 80  ? 39.368  116.464 70.496  1.00 9.14  ? 1072 VAL B CA    1 
ATOM   4544 C  C     . VAL F 3 80  ? 38.679  115.594 69.444  1.00 8.97  ? 1072 VAL B C     1 
ATOM   4545 O  O     . VAL F 3 80  ? 39.334  115.075 68.547  1.00 8.56  ? 1072 VAL B O     1 
ATOM   4546 C  CB    . VAL F 3 80  ? 40.062  117.648 69.786  1.00 9.26  ? 1072 VAL B CB    1 
ATOM   4547 C  CG1   . VAL F 3 80  ? 39.032  118.542 69.075  1.00 9.35  ? 1072 VAL B CG1   1 
ATOM   4548 C  CG2   . VAL F 3 80  ? 40.897  118.443 70.768  1.00 8.60  ? 1072 VAL B CG2   1 
ATOM   4549 N  N     . TYR F 3 81  ? 37.360  115.457 69.572  1.00 8.93  ? 1073 TYR B N     1 
ATOM   4550 C  CA    . TYR F 3 81  ? 36.535  114.637 68.690  1.00 8.86  ? 1073 TYR B CA    1 
ATOM   4551 C  C     . TYR F 3 81  ? 35.743  115.545 67.751  1.00 8.99  ? 1073 TYR B C     1 
ATOM   4552 O  O     . TYR F 3 81  ? 34.864  116.288 68.181  1.00 8.72  ? 1073 TYR B O     1 
ATOM   4553 C  CB    . TYR F 3 81  ? 35.585  113.761 69.530  1.00 8.98  ? 1073 TYR B CB    1 
ATOM   4554 C  CG    . TYR F 3 81  ? 36.298  112.694 70.336  1.00 8.42  ? 1073 TYR B CG    1 
ATOM   4555 C  CD1   . TYR F 3 81  ? 36.493  111.421 69.822  1.00 8.47  ? 1073 TYR B CD1   1 
ATOM   4556 C  CD2   . TYR F 3 81  ? 36.811  112.975 71.583  1.00 8.11  ? 1073 TYR B CD2   1 
ATOM   4557 C  CE1   . TYR F 3 81  ? 37.161  110.462 70.535  1.00 8.78  ? 1073 TYR B CE1   1 
ATOM   4558 C  CE2   . TYR F 3 81  ? 37.489  112.022 72.312  1.00 8.21  ? 1073 TYR B CE2   1 
ATOM   4559 C  CZ    . TYR F 3 81  ? 37.657  110.764 71.790  1.00 8.76  ? 1073 TYR B CZ    1 
ATOM   4560 O  OH    . TYR F 3 81  ? 38.324  109.806 72.517  1.00 7.08  ? 1073 TYR B OH    1 
ATOM   4561 N  N     . LEU F 3 82  ? 36.078  115.501 66.469  1.00 9.54  ? 1074 LEU B N     1 
ATOM   4562 C  CA    . LEU F 3 82  ? 35.445  116.350 65.459  1.00 10.01 ? 1074 LEU B CA    1 
ATOM   4563 C  C     . LEU F 3 82  ? 34.531  115.542 64.547  1.00 10.47 ? 1074 LEU B C     1 
ATOM   4564 O  O     . LEU F 3 82  ? 34.840  114.400 64.226  1.00 10.22 ? 1074 LEU B O     1 
ATOM   4565 C  CB    . LEU F 3 82  ? 36.507  117.020 64.604  1.00 9.71  ? 1074 LEU B CB    1 
ATOM   4566 C  CG    . LEU F 3 82  ? 37.452  117.948 65.365  1.00 9.84  ? 1074 LEU B CG    1 
ATOM   4567 C  CD1   . LEU F 3 82  ? 38.653  118.213 64.497  1.00 10.78 ? 1074 LEU B CD1   1 
ATOM   4568 C  CD2   . LEU F 3 82  ? 36.783  119.270 65.779  1.00 9.00  ? 1074 LEU B CD2   1 
ATOM   4569 N  N     . PRO F 3 83  ? 33.422  116.139 64.112  1.00 11.45 ? 1075 PRO B N     1 
ATOM   4570 C  CA    . PRO F 3 83  ? 32.533  115.493 63.133  1.00 11.95 ? 1075 PRO B CA    1 
ATOM   4571 C  C     . PRO F 3 83  ? 33.181  115.497 61.769  1.00 12.53 ? 1075 PRO B C     1 
ATOM   4572 O  O     . PRO F 3 83  ? 34.015  116.361 61.512  1.00 12.80 ? 1075 PRO B O     1 
ATOM   4573 C  CB    . PRO F 3 83  ? 31.303  116.403 63.123  1.00 11.89 ? 1075 PRO B CB    1 
ATOM   4574 C  CG    . PRO F 3 83  ? 31.829  117.754 63.530  1.00 11.29 ? 1075 PRO B CG    1 
ATOM   4575 C  CD    . PRO F 3 83  ? 32.951  117.491 64.475  1.00 11.20 ? 1075 PRO B CD    1 
ATOM   4576 N  N     . MET F 3 84  ? 32.806  114.571 60.905  1.00 13.64 ? 1076 MET B N     1 
ATOM   4577 C  CA    . MET F 3 84  ? 33.428  114.502 59.596  1.00 14.83 ? 1076 MET B CA    1 
ATOM   4578 C  C     . MET F 3 84  ? 32.906  115.590 58.682  1.00 15.00 ? 1076 MET B C     1 
ATOM   4579 O  O     . MET F 3 84  ? 31.708  115.877 58.657  1.00 15.53 ? 1076 MET B O     1 
ATOM   4580 C  CB    . MET F 3 84  ? 33.198  113.164 58.920  1.00 15.36 ? 1076 MET B CB    1 
ATOM   4581 C  CG    . MET F 3 84  ? 34.242  112.906 57.856  1.00 17.08 ? 1076 MET B CG    1 
ATOM   4582 S  SD    . MET F 3 84  ? 34.055  111.337 57.100  1.00 21.29 ? 1076 MET B SD    1 
ATOM   4583 C  CE    . MET F 3 84  ? 32.185  111.346 56.792  1.00 21.28 ? 1076 MET B CE    1 
ATOM   4584 N  N     . ARG F 3 85  ? 33.828  116.189 57.943  1.00 14.92 ? 1077 ARG B N     1 
ATOM   4585 C  CA    . ARG F 3 85  ? 33.522  117.223 56.984  1.00 15.09 ? 1077 ARG B CA    1 
ATOM   4586 C  C     . ARG F 3 85  ? 34.087  116.776 55.652  1.00 15.57 ? 1077 ARG B C     1 
ATOM   4587 O  O     . ARG F 3 85  ? 35.110  117.285 55.201  1.00 15.41 ? 1077 ARG B O     1 
ATOM   4588 C  CB    . ARG F 3 85  ? 34.152  118.533 57.431  1.00 15.01 ? 1077 ARG B CB    1 
ATOM   4589 C  CG    . ARG F 3 85  ? 33.550  119.082 58.701  1.00 14.20 ? 1077 ARG B CG    1 
ATOM   4590 C  CD    . ARG F 3 85  ? 33.708  120.572 58.856  1.00 13.49 ? 1077 ARG B CD    1 
ATOM   4591 N  NE    . ARG F 3 85  ? 35.048  120.938 59.281  1.00 14.11 ? 1077 ARG B NE    1 
ATOM   4592 C  CZ    . ARG F 3 85  ? 35.550  122.167 59.222  1.00 15.92 ? 1077 ARG B CZ    1 
ATOM   4593 N  NH1   . ARG F 3 85  ? 34.833  123.186 58.745  1.00 17.08 ? 1077 ARG B NH1   1 
ATOM   4594 N  NH2   . ARG F 3 85  ? 36.787  122.386 59.641  1.00 16.22 ? 1077 ARG B NH2   1 
ATOM   4595 N  N     . LYS F 3 86  ? 33.417  115.796 55.043  1.00 16.36 ? 1078 LYS B N     1 
ATOM   4596 C  CA    . LYS F 3 86  ? 33.922  115.135 53.835  1.00 16.86 ? 1078 LYS B CA    1 
ATOM   4597 C  C     . LYS F 3 86  ? 33.975  116.089 52.652  1.00 17.15 ? 1078 LYS B C     1 
ATOM   4598 O  O     . LYS F 3 86  ? 34.941  116.082 51.904  1.00 17.05 ? 1078 LYS B O     1 
ATOM   4599 C  CB    . LYS F 3 86  ? 33.058  113.930 53.479  1.00 16.95 ? 1078 LYS B CB    1 
ATOM   4600 C  CG    . LYS F 3 86  ? 33.630  113.065 52.371  1.00 17.83 ? 1078 LYS B CG    1 
ATOM   4601 C  CD    . LYS F 3 86  ? 33.918  111.648 52.859  1.00 19.15 ? 1078 LYS B CD    1 
ATOM   4602 C  CE    . LYS F 3 86  ? 34.554  110.813 51.760  1.00 19.50 ? 1078 LYS B CE    1 
ATOM   4603 N  NZ    . LYS F 3 86  ? 34.369  109.364 52.018  1.00 20.05 ? 1078 LYS B NZ    1 
ATOM   4604 N  N     . GLU F 3 87  ? 32.925  116.888 52.486  1.00 17.53 ? 1079 GLU B N     1 
ATOM   4605 C  CA    . GLU F 3 87  ? 32.905  117.955 51.484  1.00 18.02 ? 1079 GLU B CA    1 
ATOM   4606 C  C     . GLU F 3 87  ? 34.224  118.738 51.540  1.00 17.78 ? 1079 GLU B C     1 
ATOM   4607 O  O     . GLU F 3 87  ? 34.873  118.946 50.507  1.00 18.11 ? 1079 GLU B O     1 
ATOM   4608 C  CB    . GLU F 3 87  ? 31.712  118.922 51.669  1.00 18.53 ? 1079 GLU B CB    1 
ATOM   4609 C  CG    . GLU F 3 87  ? 30.532  118.459 52.550  1.00 20.88 ? 1079 GLU B CG    1 
ATOM   4610 C  CD    . GLU F 3 87  ? 30.792  118.576 54.068  1.00 22.39 ? 1079 GLU B CD    1 
ATOM   4611 O  OE1   . GLU F 3 87  ? 31.022  119.697 54.586  1.00 21.78 ? 1079 GLU B OE1   1 
ATOM   4612 O  OE2   . GLU F 3 87  ? 30.767  117.525 54.750  1.00 24.18 ? 1079 GLU B OE2   1 
ATOM   4613 N  N     . VAL F 3 88  ? 34.636  119.143 52.744  1.00 17.24 ? 1080 VAL B N     1 
ATOM   4614 C  CA    . VAL F 3 88  ? 35.872  119.918 52.921  1.00 16.74 ? 1080 VAL B CA    1 
ATOM   4615 C  C     . VAL F 3 88  ? 37.132  119.145 52.510  1.00 16.77 ? 1080 VAL B C     1 
ATOM   4616 O  O     . VAL F 3 88  ? 38.002  119.706 51.836  1.00 16.73 ? 1080 VAL B O     1 
ATOM   4617 C  CB    . VAL F 3 88  ? 36.078  120.393 54.379  1.00 16.56 ? 1080 VAL B CB    1 
ATOM   4618 C  CG1   . VAL F 3 88  ? 37.437  121.103 54.526  1.00 16.39 ? 1080 VAL B CG1   1 
ATOM   4619 C  CG2   . VAL F 3 88  ? 34.947  121.309 54.837  1.00 15.94 ? 1080 VAL B CG2   1 
ATOM   4620 N  N     . TYR F 3 89  ? 37.232  117.876 52.922  1.00 16.42 ? 1081 TYR B N     1 
ATOM   4621 C  CA    . TYR F 3 89  ? 38.439  117.077 52.660  1.00 16.26 ? 1081 TYR B CA    1 
ATOM   4622 C  C     . TYR F 3 89  ? 38.551  116.746 51.186  1.00 16.33 ? 1081 TYR B C     1 
ATOM   4623 O  O     . TYR F 3 89  ? 39.653  116.679 50.658  1.00 16.60 ? 1081 TYR B O     1 
ATOM   4624 C  CB    . TYR F 3 89  ? 38.473  115.773 53.474  1.00 16.14 ? 1081 TYR B CB    1 
ATOM   4625 C  CG    . TYR F 3 89  ? 38.069  115.926 54.912  1.00 15.06 ? 1081 TYR B CG    1 
ATOM   4626 C  CD1   . TYR F 3 89  ? 38.505  117.018 55.661  1.00 14.57 ? 1081 TYR B CD1   1 
ATOM   4627 C  CD2   . TYR F 3 89  ? 37.245  114.991 55.528  1.00 14.68 ? 1081 TYR B CD2   1 
ATOM   4628 C  CE1   . TYR F 3 89  ? 38.132  117.184 56.985  1.00 13.57 ? 1081 TYR B CE1   1 
ATOM   4629 C  CE2   . TYR F 3 89  ? 36.874  115.137 56.864  1.00 14.53 ? 1081 TYR B CE2   1 
ATOM   4630 C  CZ    . TYR F 3 89  ? 37.323  116.245 57.585  1.00 13.57 ? 1081 TYR B CZ    1 
ATOM   4631 O  OH    . TYR F 3 89  ? 36.953  116.437 58.890  1.00 12.05 ? 1081 TYR B OH    1 
ATOM   4632 N  N     . GLN F 3 90  ? 37.398  116.550 50.543  1.00 16.17 ? 1082 GLN B N     1 
ATOM   4633 C  CA    . GLN F 3 90  ? 37.304  116.223 49.123  1.00 15.93 ? 1082 GLN B CA    1 
ATOM   4634 C  C     . GLN F 3 90  ? 37.842  117.351 48.252  1.00 15.74 ? 1082 GLN B C     1 
ATOM   4635 O  O     . GLN F 3 90  ? 38.420  117.106 47.196  1.00 15.51 ? 1082 GLN B O     1 
ATOM   4636 C  CB    . GLN F 3 90  ? 35.845  115.940 48.755  1.00 15.87 ? 1082 GLN B CB    1 
ATOM   4637 C  CG    . GLN F 3 90  ? 35.614  115.571 47.297  1.00 16.09 ? 1082 GLN B CG    1 
ATOM   4638 C  CD    . GLN F 3 90  ? 36.489  114.426 46.838  1.00 16.41 ? 1082 GLN B CD    1 
ATOM   4639 O  OE1   . GLN F 3 90  ? 36.219  113.263 47.167  1.00 17.75 ? 1082 GLN B OE1   1 
ATOM   4640 N  NE2   . GLN F 3 90  ? 37.541  114.744 46.086  1.00 15.51 ? 1082 GLN B NE2   1 
ATOM   4641 N  N     . GLN F 3 91  ? 37.643  118.582 48.699  1.00 15.58 ? 1083 GLN B N     1 
ATOM   4642 C  CA    . GLN F 3 91  ? 38.163  119.736 47.984  1.00 15.81 ? 1083 GLN B CA    1 
ATOM   4643 C  C     . GLN F 3 91  ? 39.660  119.862 48.154  1.00 15.08 ? 1083 GLN B C     1 
ATOM   4644 O  O     . GLN F 3 91  ? 40.350  120.265 47.223  1.00 14.93 ? 1083 GLN B O     1 
ATOM   4645 C  CB    . GLN F 3 91  ? 37.494  121.026 48.459  1.00 16.35 ? 1083 GLN B CB    1 
ATOM   4646 C  CG    . GLN F 3 91  ? 36.052  121.168 48.007  1.00 18.40 ? 1083 GLN B CG    1 
ATOM   4647 C  CD    . GLN F 3 91  ? 35.857  122.360 47.113  1.00 22.37 ? 1083 GLN B CD    1 
ATOM   4648 O  OE1   . GLN F 3 91  ? 36.138  123.499 47.521  1.00 25.35 ? 1083 GLN B OE1   1 
ATOM   4649 N  NE2   . GLN F 3 91  ? 35.390  122.118 45.879  1.00 24.39 ? 1083 GLN B NE2   1 
ATOM   4650 N  N     . VAL F 3 92  ? 40.167  119.537 49.341  1.00 14.55 ? 1084 VAL B N     1 
ATOM   4651 C  CA    . VAL F 3 92  ? 41.602  119.640 49.581  1.00 14.01 ? 1084 VAL B CA    1 
ATOM   4652 C  C     . VAL F 3 92  ? 42.266  118.584 48.729  1.00 13.44 ? 1084 VAL B C     1 
ATOM   4653 O  O     . VAL F 3 92  ? 43.211  118.874 47.996  1.00 13.22 ? 1084 VAL B O     1 
ATOM   4654 C  CB    . VAL F 3 92  ? 41.991  119.462 51.061  1.00 13.95 ? 1084 VAL B CB    1 
ATOM   4655 C  CG1   . VAL F 3 92  ? 43.509  119.496 51.220  1.00 13.87 ? 1084 VAL B CG1   1 
ATOM   4656 C  CG2   . VAL F 3 92  ? 41.363  120.544 51.910  1.00 13.88 ? 1084 VAL B CG2   1 
ATOM   4657 N  N     . SER F 3 93  ? 41.731  117.371 48.793  1.00 12.85 ? 1085 SER B N     1 
ATOM   4658 C  CA    . SER F 3 93  ? 42.264  116.266 48.012  1.00 12.54 ? 1085 SER B CA    1 
ATOM   4659 C  C     . SER F 3 93  ? 42.346  116.606 46.533  1.00 12.27 ? 1085 SER B C     1 
ATOM   4660 O  O     . SER F 3 93  ? 43.342  116.311 45.893  1.00 12.34 ? 1085 SER B O     1 
ATOM   4661 C  CB    . SER F 3 93  ? 41.435  115.004 48.199  1.00 12.24 ? 1085 SER B CB    1 
ATOM   4662 O  OG    . SER F 3 93  ? 42.086  113.912 47.567  1.00 11.99 ? 1085 SER B OG    1 
ATOM   4663 N  N     . SER F 3 94  ? 41.305  117.241 46.008  1.00 12.03 ? 1086 SER B N     1 
ATOM   4664 C  CA    . SER F 3 94  ? 41.213  117.541 44.579  1.00 11.96 ? 1086 SER B CA    1 
ATOM   4665 C  C     . SER F 3 94  ? 42.231  118.593 44.129  1.00 11.90 ? 1086 SER B C     1 
ATOM   4666 O  O     . SER F 3 94  ? 42.771  118.496 43.035  1.00 11.78 ? 1086 SER B O     1 
ATOM   4667 C  CB    . SER F 3 94  ? 39.789  117.971 44.210  1.00 11.88 ? 1086 SER B CB    1 
ATOM   4668 O  OG    . SER F 3 94  ? 38.959  116.832 44.063  1.00 11.47 ? 1086 SER B OG    1 
ATOM   4669 N  N     . ARG F 3 95  ? 42.490  119.587 44.976  1.00 11.86 ? 1087 ARG B N     1 
ATOM   4670 C  CA    . ARG F 3 95  ? 43.573  120.532 44.742  1.00 11.75 ? 1087 ARG B CA    1 
ATOM   4671 C  C     . ARG F 3 95  ? 44.928  119.799 44.676  1.00 12.00 ? 1087 ARG B C     1 
ATOM   4672 O  O     . ARG F 3 95  ? 45.743  120.097 43.808  1.00 11.97 ? 1087 ARG B O     1 
ATOM   4673 C  CB    . ARG F 3 95  ? 43.587  121.620 45.825  1.00 11.67 ? 1087 ARG B CB    1 
ATOM   4674 C  CG    . ARG F 3 95  ? 42.412  122.628 45.745  1.00 11.71 ? 1087 ARG B CG    1 
ATOM   4675 C  CD    . ARG F 3 95  ? 42.690  124.020 46.351  1.00 10.56 ? 1087 ARG B CD    1 
ATOM   4676 N  NE    . ARG F 3 95  ? 42.996  123.989 47.789  1.00 10.35 ? 1087 ARG B NE    1 
ATOM   4677 C  CZ    . ARG F 3 95  ? 42.091  123.950 48.781  1.00 9.14  ? 1087 ARG B CZ    1 
ATOM   4678 N  NH1   . ARG F 3 95  ? 40.786  123.948 48.535  1.00 9.11  ? 1087 ARG B NH1   1 
ATOM   4679 N  NH2   . ARG F 3 95  ? 42.501  123.912 50.041  1.00 8.18  ? 1087 ARG B NH2   1 
ATOM   4680 N  N     . ILE F 3 96  ? 45.143  118.824 45.565  1.00 12.19 ? 1088 ILE B N     1 
ATOM   4681 C  CA    . ILE F 3 96  ? 46.403  118.078 45.631  1.00 12.26 ? 1088 ILE B CA    1 
ATOM   4682 C  C     . ILE F 3 96  ? 46.555  117.110 44.465  1.00 12.94 ? 1088 ILE B C     1 
ATOM   4683 O  O     . ILE F 3 96  ? 47.646  117.000 43.892  1.00 13.08 ? 1088 ILE B O     1 
ATOM   4684 C  CB    . ILE F 3 96  ? 46.541  117.309 46.960  1.00 12.11 ? 1088 ILE B CB    1 
ATOM   4685 C  CG1   . ILE F 3 96  ? 46.599  118.288 48.134  1.00 12.03 ? 1088 ILE B CG1   1 
ATOM   4686 C  CG2   . ILE F 3 96  ? 47.806  116.438 46.954  1.00 11.49 ? 1088 ILE B CG2   1 
ATOM   4687 C  CD1   . ILE F 3 96  ? 46.622  117.628 49.497  1.00 11.23 ? 1088 ILE B CD1   1 
ATOM   4688 N  N     . MET F 3 97  ? 45.478  116.410 44.109  1.00 13.37 ? 1089 MET B N     1 
ATOM   4689 C  CA    . MET F 3 97  ? 45.495  115.533 42.934  1.00 13.84 ? 1089 MET B CA    1 
ATOM   4690 C  C     . MET F 3 97  ? 45.877  116.298 41.660  1.00 13.91 ? 1089 MET B C     1 
ATOM   4691 O  O     . MET F 3 97  ? 46.486  115.730 40.756  1.00 13.80 ? 1089 MET B O     1 
ATOM   4692 C  CB    . MET F 3 97  ? 44.139  114.848 42.725  1.00 13.95 ? 1089 MET B CB    1 
ATOM   4693 C  CG    . MET F 3 97  ? 43.759  113.822 43.795  1.00 14.64 ? 1089 MET B CG    1 
ATOM   4694 S  SD    . MET F 3 97  ? 45.097  112.704 44.314  1.00 14.74 ? 1089 MET B SD    1 
ATOM   4695 C  CE    . MET F 3 97  ? 44.316  111.840 45.675  1.00 14.51 ? 1089 MET B CE    1 
ATOM   4696 N  N     . ASN F 3 98  ? 45.530  117.582 41.599  1.00 14.13 ? 1090 ASN B N     1 
ATOM   4697 C  CA    . ASN F 3 98  ? 45.881  118.408 40.451  1.00 14.37 ? 1090 ASN B CA    1 
ATOM   4698 C  C     . ASN F 3 98  ? 47.350  118.830 40.472  1.00 14.65 ? 1090 ASN B C     1 
ATOM   4699 O  O     . ASN F 3 98  ? 47.962  118.959 39.423  1.00 14.91 ? 1090 ASN B O     1 
ATOM   4700 C  CB    . ASN F 3 98  ? 44.936  119.608 40.329  1.00 14.30 ? 1090 ASN B CB    1 
ATOM   4701 C  CG    . ASN F 3 98  ? 43.610  119.244 39.652  1.00 14.56 ? 1090 ASN B CG    1 
ATOM   4702 O  OD1   . ASN F 3 98  ? 43.463  118.166 39.070  1.00 15.33 ? 1090 ASN B OD1   1 
ATOM   4703 N  ND2   . ASN F 3 98  ? 42.645  120.147 39.723  1.00 14.30 ? 1090 ASN B ND2   1 
ATOM   4704 N  N     . LEU F 3 99  ? 47.920  119.025 41.656  1.00 15.13 ? 1091 LEU B N     1 
ATOM   4705 C  CA    . LEU F 3 99  ? 49.362  119.236 41.787  1.00 15.25 ? 1091 LEU B CA    1 
ATOM   4706 C  C     . LEU F 3 99  ? 50.117  117.991 41.329  1.00 15.48 ? 1091 LEU B C     1 
ATOM   4707 O  O     . LEU F 3 99  ? 51.144  118.096 40.651  1.00 15.86 ? 1091 LEU B O     1 
ATOM   4708 C  CB    . LEU F 3 99  ? 49.750  119.540 43.237  1.00 15.31 ? 1091 LEU B CB    1 
ATOM   4709 C  CG    . LEU F 3 99  ? 49.292  120.866 43.843  1.00 15.35 ? 1091 LEU B CG    1 
ATOM   4710 C  CD1   . LEU F 3 99  ? 49.703  120.928 45.311  1.00 15.06 ? 1091 LEU B CD1   1 
ATOM   4711 C  CD2   . LEU F 3 99  ? 49.842  122.075 43.070  1.00 15.40 ? 1091 LEU B CD2   1 
ATOM   4712 N  N     . LEU F 3 100 ? 49.608  116.816 41.704  1.00 15.37 ? 1092 LEU B N     1 
ATOM   4713 C  CA    . LEU F 3 100 ? 50.192  115.548 41.272  1.00 15.05 ? 1092 LEU B CA    1 
ATOM   4714 C  C     . LEU F 3 100 ? 50.121  115.388 39.758  1.00 14.95 ? 1092 LEU B C     1 
ATOM   4715 O  O     . LEU F 3 100 ? 50.977  114.753 39.169  1.00 14.83 ? 1092 LEU B O     1 
ATOM   4716 C  CB    . LEU F 3 100 ? 49.487  114.364 41.937  1.00 14.82 ? 1092 LEU B CB    1 
ATOM   4717 C  CG    . LEU F 3 100 ? 49.666  114.204 43.448  1.00 14.79 ? 1092 LEU B CG    1 
ATOM   4718 C  CD1   . LEU F 3 100 ? 48.903  112.986 43.957  1.00 14.17 ? 1092 LEU B CD1   1 
ATOM   4719 C  CD2   . LEU F 3 100 ? 51.133  114.101 43.827  1.00 14.96 ? 1092 LEU B CD2   1 
ATOM   4720 N  N     . ARG F 3 101 ? 49.105  115.966 39.132  1.00 15.13 ? 1093 ARG B N     1 
ATOM   4721 C  CA    . ARG F 3 101 ? 48.928  115.827 37.690  1.00 15.54 ? 1093 ARG B CA    1 
ATOM   4722 C  C     . ARG F 3 101 ? 49.960  116.603 36.866  1.00 15.53 ? 1093 ARG B C     1 
ATOM   4723 O  O     . ARG F 3 101 ? 50.169  116.286 35.703  1.00 15.42 ? 1093 ARG B O     1 
ATOM   4724 C  CB    . ARG F 3 101 ? 47.496  116.184 37.254  1.00 15.69 ? 1093 ARG B CB    1 
ATOM   4725 C  CG    . ARG F 3 101 ? 46.701  114.966 36.756  1.00 16.73 ? 1093 ARG B CG    1 
ATOM   4726 C  CD    . ARG F 3 101 ? 45.216  115.217 36.525  1.00 18.10 ? 1093 ARG B CD    1 
ATOM   4727 N  NE    . ARG F 3 101 ? 44.430  114.995 37.748  1.00 19.00 ? 1093 ARG B NE    1 
ATOM   4728 C  CZ    . ARG F 3 101 ? 43.350  114.216 37.848  1.00 19.21 ? 1093 ARG B CZ    1 
ATOM   4729 N  NH1   . ARG F 3 101 ? 42.872  113.537 36.804  1.00 19.52 ? 1093 ARG B NH1   1 
ATOM   4730 N  NH2   . ARG F 3 101 ? 42.738  114.110 39.015  1.00 19.79 ? 1093 ARG B NH2   1 
ATOM   4731 N  N     . GLU F 3 102 ? 50.605  117.609 37.454  1.00 15.72 ? 1094 GLU B N     1 
ATOM   4732 C  CA    . GLU F 3 102 ? 51.678  118.316 36.749  1.00 15.95 ? 1094 GLU B CA    1 
ATOM   4733 C  C     . GLU F 3 102 ? 52.958  117.479 36.721  1.00 15.72 ? 1094 GLU B C     1 
ATOM   4734 O  O     . GLU F 3 102 ? 53.759  117.610 35.807  1.00 15.69 ? 1094 GLU B O     1 
ATOM   4735 C  CB    . GLU F 3 102 ? 51.944  119.708 37.354  1.00 16.16 ? 1094 GLU B CB    1 
ATOM   4736 C  CG    . GLU F 3 102 ? 51.512  120.872 36.454  1.00 17.22 ? 1094 GLU B CG    1 
ATOM   4737 C  CD    . GLU F 3 102 ? 52.541  121.264 35.379  1.00 18.14 ? 1094 GLU B CD    1 
ATOM   4738 O  OE1   . GLU F 3 102 ? 53.499  122.010 35.688  1.00 18.23 ? 1094 GLU B OE1   1 
ATOM   4739 O  OE2   . GLU F 3 102 ? 52.383  120.854 34.207  1.00 18.71 ? 1094 GLU B OE2   1 
ATOM   4740 N  N     . TYR F 3 103 ? 53.140  116.618 37.718  1.00 15.73 ? 1095 TYR B N     1 
ATOM   4741 C  CA    . TYR F 3 103 ? 54.301  115.726 37.772  1.00 15.73 ? 1095 TYR B CA    1 
ATOM   4742 C  C     . TYR F 3 103 ? 54.184  114.496 36.851  1.00 16.08 ? 1095 TYR B C     1 
ATOM   4743 O  O     . TYR F 3 103 ? 55.194  114.033 36.310  1.00 15.95 ? 1095 TYR B O     1 
ATOM   4744 C  CB    . TYR F 3 103 ? 54.584  115.321 39.219  1.00 15.46 ? 1095 TYR B CB    1 
ATOM   4745 C  CG    . TYR F 3 103 ? 55.115  116.478 40.033  1.00 15.17 ? 1095 TYR B CG    1 
ATOM   4746 C  CD1   . TYR F 3 103 ? 56.413  116.931 39.851  1.00 15.27 ? 1095 TYR B CD1   1 
ATOM   4747 C  CD2   . TYR F 3 103 ? 54.315  117.142 40.957  1.00 14.88 ? 1095 TYR B CD2   1 
ATOM   4748 C  CE1   . TYR F 3 103 ? 56.915  117.997 40.578  1.00 15.13 ? 1095 TYR B CE1   1 
ATOM   4749 C  CE2   . TYR F 3 103 ? 54.809  118.213 41.697  1.00 14.79 ? 1095 TYR B CE2   1 
ATOM   4750 C  CZ    . TYR F 3 103 ? 56.111  118.635 41.495  1.00 15.16 ? 1095 TYR B CZ    1 
ATOM   4751 O  OH    . TYR F 3 103 ? 56.625  119.695 42.196  1.00 15.76 ? 1095 TYR B OH    1 
ATOM   4752 N  N     . SER F 3 104 ? 52.966  113.975 36.671  1.00 16.43 ? 1096 SER B N     1 
ATOM   4753 C  CA    . SER F 3 104 ? 52.698  112.951 35.647  1.00 16.73 ? 1096 SER B CA    1 
ATOM   4754 C  C     . SER F 3 104 ? 51.258  112.970 35.130  1.00 16.95 ? 1096 SER B C     1 
ATOM   4755 O  O     . SER F 3 104 ? 50.328  113.364 35.835  1.00 17.06 ? 1096 SER B O     1 
ATOM   4756 C  CB    . SER F 3 104 ? 53.019  111.542 36.165  1.00 16.94 ? 1096 SER B CB    1 
ATOM   4757 O  OG    . SER F 3 104 ? 52.570  110.539 35.256  1.00 16.68 ? 1096 SER B OG    1 
ATOM   4758 N  N     . GLU F 3 105 ? 51.096  112.490 33.902  1.00 17.08 ? 1097 GLU B N     1 
ATOM   4759 C  CA    . GLU F 3 105 ? 49.805  112.436 33.228  1.00 17.23 ? 1097 GLU B CA    1 
ATOM   4760 C  C     . GLU F 3 105 ? 49.077  111.143 33.595  1.00 17.07 ? 1097 GLU B C     1 
ATOM   4761 O  O     . GLU F 3 105 ? 47.862  111.148 33.860  1.00 16.78 ? 1097 GLU B O     1 
ATOM   4762 C  CB    . GLU F 3 105 ? 50.011  112.519 31.711  1.00 17.55 ? 1097 GLU B CB    1 
ATOM   4763 C  CG    . GLU F 3 105 ? 50.555  113.868 31.224  1.00 18.42 ? 1097 GLU B CG    1 
ATOM   4764 C  CD    . GLU F 3 105 ? 52.072  113.902 31.021  1.00 19.22 ? 1097 GLU B CD    1 
ATOM   4765 O  OE1   . GLU F 3 105 ? 52.801  113.129 31.686  1.00 19.29 ? 1097 GLU B OE1   1 
ATOM   4766 O  OE2   . GLU F 3 105 ? 52.544  114.718 30.189  1.00 19.88 ? 1097 GLU B OE2   1 
ATOM   4767 N  N     . LYS F 3 106 ? 49.833  110.044 33.622  1.00 16.84 ? 1098 LYS B N     1 
ATOM   4768 C  CA    . LYS F 3 106 ? 49.292  108.733 33.973  1.00 16.66 ? 1098 LYS B CA    1 
ATOM   4769 C  C     . LYS F 3 106 ? 49.193  108.602 35.496  1.00 16.43 ? 1098 LYS B C     1 
ATOM   4770 O  O     . LYS F 3 106 ? 50.203  108.431 36.184  1.00 16.48 ? 1098 LYS B O     1 
ATOM   4771 C  CB    . LYS F 3 106 ? 50.160  107.620 33.380  1.00 16.81 ? 1098 LYS B CB    1 
ATOM   4772 C  CG    . LYS F 3 106 ? 50.457  107.782 31.882  1.00 17.18 ? 1098 LYS B CG    1 
ATOM   4773 C  CD    . LYS F 3 106 ? 50.675  106.438 31.169  1.00 17.40 ? 1098 LYS B CD    1 
ATOM   4774 C  CE    . LYS F 3 106 ? 50.861  106.620 29.660  1.00 17.66 ? 1098 LYS B CE    1 
ATOM   4775 N  NZ    . LYS F 3 106 ? 50.226  105.522 28.874  1.00 18.08 ? 1098 LYS B NZ    1 
ATOM   4776 N  N     . ILE F 3 107 ? 47.962  108.687 36.006  1.00 16.05 ? 1099 ILE B N     1 
ATOM   4777 C  CA    . ILE F 3 107 ? 47.691  108.762 37.440  1.00 15.51 ? 1099 ILE B CA    1 
ATOM   4778 C  C     . ILE F 3 107 ? 46.406  108.015 37.816  1.00 15.47 ? 1099 ILE B C     1 
ATOM   4779 O  O     . ILE F 3 107 ? 45.362  108.177 37.172  1.00 15.33 ? 1099 ILE B O     1 
ATOM   4780 C  CB    . ILE F 3 107 ? 47.601  110.238 37.900  1.00 15.43 ? 1099 ILE B CB    1 
ATOM   4781 C  CG1   . ILE F 3 107 ? 47.204  110.333 39.378  1.00 15.54 ? 1099 ILE B CG1   1 
ATOM   4782 C  CG2   . ILE F 3 107 ? 46.591  111.013 37.062  1.00 15.71 ? 1099 ILE B CG2   1 
ATOM   4783 C  CD1   . ILE F 3 107 ? 47.127  111.751 39.907  1.00 15.73 ? 1099 ILE B CD1   1 
ATOM   4784 N  N     . GLU F 3 108 ? 46.504  107.212 38.876  1.00 15.23 ? 1100 GLU B N     1 
ATOM   4785 C  CA    . GLU F 3 108 ? 45.395  106.452 39.420  1.00 15.27 ? 1100 GLU B CA    1 
ATOM   4786 C  C     . GLU F 3 108 ? 45.042  107.033 40.795  1.00 15.13 ? 1100 GLU B C     1 
ATOM   4787 O  O     . GLU F 3 108 ? 45.784  106.844 41.749  1.00 14.79 ? 1100 GLU B O     1 
ATOM   4788 C  CB    . GLU F 3 108 ? 45.808  104.971 39.537  1.00 15.44 ? 1100 GLU B CB    1 
ATOM   4789 C  CG    . GLU F 3 108 ? 44.729  103.991 40.009  1.00 15.97 ? 1100 GLU B CG    1 
ATOM   4790 C  CD    . GLU F 3 108 ? 45.051  102.529 39.681  1.00 17.44 ? 1100 GLU B CD    1 
ATOM   4791 O  OE1   . GLU F 3 108 ? 45.640  102.248 38.612  1.00 19.22 ? 1100 GLU B OE1   1 
ATOM   4792 O  OE2   . GLU F 3 108 ? 44.712  101.636 40.489  1.00 18.15 ? 1100 GLU B OE2   1 
ATOM   4793 N  N     . ILE F 3 109 ? 43.924  107.755 40.883  1.00 15.01 ? 1101 ILE B N     1 
ATOM   4794 C  CA    . ILE F 3 109 ? 43.407  108.235 42.166  1.00 14.76 ? 1101 ILE B CA    1 
ATOM   4795 C  C     . ILE F 3 109 ? 42.765  107.027 42.843  1.00 14.69 ? 1101 ILE B C     1 
ATOM   4796 O  O     . ILE F 3 109 ? 41.615  106.703 42.567  1.00 14.78 ? 1101 ILE B O     1 
ATOM   4797 C  CB    . ILE F 3 109 ? 42.342  109.382 42.005  1.00 14.81 ? 1101 ILE B CB    1 
ATOM   4798 C  CG1   . ILE F 3 109 ? 42.749  110.439 40.975  1.00 14.84 ? 1101 ILE B CG1   1 
ATOM   4799 C  CG2   . ILE F 3 109 ? 42.068  110.051 43.335  1.00 14.53 ? 1101 ILE B CG2   1 
ATOM   4800 C  CD1   . ILE F 3 109 ? 44.043  111.127 41.275  1.00 16.13 ? 1101 ILE B CD1   1 
ATOM   4801 N  N     . ALA F 3 110 ? 43.517  106.364 43.718  1.00 14.61 ? 1102 ALA B N     1 
ATOM   4802 C  CA    . ALA F 3 110 ? 43.036  105.180 44.430  1.00 14.38 ? 1102 ALA B CA    1 
ATOM   4803 C  C     . ALA F 3 110 ? 41.938  105.483 45.444  1.00 14.33 ? 1102 ALA B C     1 
ATOM   4804 O  O     . ALA F 3 110 ? 41.074  104.651 45.673  1.00 14.84 ? 1102 ALA B O     1 
ATOM   4805 C  CB    . ALA F 3 110 ? 44.184  104.496 45.116  1.00 14.32 ? 1102 ALA B CB    1 
ATOM   4806 N  N     . SER F 3 111 ? 42.001  106.653 46.074  1.00 14.11 ? 1103 SER B N     1 
ATOM   4807 C  CA    . SER F 3 111 ? 41.007  107.081 47.067  1.00 13.63 ? 1103 SER B CA    1 
ATOM   4808 C  C     . SER F 3 111 ? 41.188  108.563 47.384  1.00 13.43 ? 1103 SER B C     1 
ATOM   4809 O  O     . SER F 3 111 ? 42.006  109.233 46.777  1.00 13.27 ? 1103 SER B O     1 
ATOM   4810 C  CB    . SER F 3 111 ? 41.096  106.241 48.349  1.00 13.63 ? 1103 SER B CB    1 
ATOM   4811 O  OG    . SER F 3 111 ? 42.189  106.616 49.174  1.00 13.27 ? 1103 SER B OG    1 
ATOM   4812 N  N     . ILE F 3 112 ? 40.425  109.078 48.335  1.00 13.35 ? 1104 ILE B N     1 
ATOM   4813 C  CA    . ILE F 3 112 ? 40.510  110.491 48.667  1.00 13.56 ? 1104 ILE B CA    1 
ATOM   4814 C  C     . ILE F 3 112 ? 41.904  110.891 49.223  1.00 13.70 ? 1104 ILE B C     1 
ATOM   4815 O  O     . ILE F 3 112 ? 42.281  112.062 49.138  1.00 14.03 ? 1104 ILE B O     1 
ATOM   4816 C  CB    . ILE F 3 112 ? 39.343  110.905 49.631  1.00 13.74 ? 1104 ILE B CB    1 
ATOM   4817 C  CG1   . ILE F 3 112 ? 39.177  112.434 49.641  1.00 14.50 ? 1104 ILE B CG1   1 
ATOM   4818 C  CG2   . ILE F 3 112 ? 39.549  110.353 51.051  1.00 12.78 ? 1104 ILE B CG2   1 
ATOM   4819 C  CD1   . ILE F 3 112 ? 38.156  112.966 50.676  1.00 15.54 ? 1104 ILE B CD1   1 
ATOM   4820 N  N     . ASP F 3 113 ? 42.670  109.936 49.754  1.00 13.25 ? 1105 ASP B N     1 
ATOM   4821 C  CA    . ASP F 3 113 ? 44.030  110.219 50.231  1.00 13.50 ? 1105 ASP B CA    1 
ATOM   4822 C  C     . ASP F 3 113 ? 45.175  109.445 49.521  1.00 13.57 ? 1105 ASP B C     1 
ATOM   4823 O  O     . ASP F 3 113 ? 46.276  109.360 50.057  1.00 13.67 ? 1105 ASP B O     1 
ATOM   4824 C  CB    . ASP F 3 113 ? 44.104  109.959 51.739  1.00 13.67 ? 1105 ASP B CB    1 
ATOM   4825 C  CG    . ASP F 3 113 ? 44.102  108.490 52.069  1.00 13.85 ? 1105 ASP B CG    1 
ATOM   4826 O  OD1   . ASP F 3 113 ? 43.590  107.716 51.240  1.00 16.20 ? 1105 ASP B OD1   1 
ATOM   4827 O  OD2   . ASP F 3 113 ? 44.587  108.005 53.108  1.00 14.07 ? 1105 ASP B OD2   1 
ATOM   4828 N  N     . GLU F 3 114 ? 44.935  108.900 48.330  1.00 13.38 ? 1106 GLU B N     1 
ATOM   4829 C  CA    . GLU F 3 114 ? 45.908  108.014 47.684  1.00 13.54 ? 1106 GLU B CA    1 
ATOM   4830 C  C     . GLU F 3 114 ? 45.970  108.193 46.170  1.00 13.12 ? 1106 GLU B C     1 
ATOM   4831 O  O     . GLU F 3 114 ? 44.951  108.130 45.485  1.00 12.72 ? 1106 GLU B O     1 
ATOM   4832 C  CB    . GLU F 3 114 ? 45.551  106.548 47.953  1.00 13.92 ? 1106 GLU B CB    1 
ATOM   4833 C  CG    . GLU F 3 114 ? 45.687  106.097 49.388  1.00 15.40 ? 1106 GLU B CG    1 
ATOM   4834 C  CD    . GLU F 3 114 ? 45.256  104.649 49.581  1.00 18.69 ? 1106 GLU B CD    1 
ATOM   4835 O  OE1   . GLU F 3 114 ? 44.236  104.403 50.274  1.00 20.47 ? 1106 GLU B OE1   1 
ATOM   4836 O  OE2   . GLU F 3 114 ? 45.937  103.752 49.035  1.00 20.51 ? 1106 GLU B OE2   1 
ATOM   4837 N  N     . ALA F 3 115 ? 47.175  108.371 45.645  1.00 12.75 ? 1107 ALA B N     1 
ATOM   4838 C  CA    . ALA F 3 115 ? 47.386  108.387 44.202  1.00 12.48 ? 1107 ALA B CA    1 
ATOM   4839 C  C     . ALA F 3 115 ? 48.662  107.634 43.798  1.00 12.09 ? 1107 ALA B C     1 
ATOM   4840 O  O     . ALA F 3 115 ? 49.698  107.744 44.459  1.00 11.92 ? 1107 ALA B O     1 
ATOM   4841 C  CB    . ALA F 3 115 ? 47.429  109.822 43.698  1.00 12.63 ? 1107 ALA B CB    1 
ATOM   4842 N  N     . TYR F 3 116 ? 48.565  106.870 42.711  1.00 11.74 ? 1108 TYR B N     1 
ATOM   4843 C  CA    . TYR F 3 116 ? 49.702  106.193 42.096  1.00 11.16 ? 1108 TYR B CA    1 
ATOM   4844 C  C     . TYR F 3 116 ? 50.103  106.996 40.882  1.00 11.61 ? 1108 TYR B C     1 
ATOM   4845 O  O     . TYR F 3 116 ? 49.247  107.408 40.116  1.00 11.37 ? 1108 TYR B O     1 
ATOM   4846 C  CB    . TYR F 3 116 ? 49.316  104.777 41.662  1.00 10.73 ? 1108 TYR B CB    1 
ATOM   4847 C  CG    . TYR F 3 116 ? 48.984  103.857 42.809  1.00 9.57  ? 1108 TYR B CG    1 
ATOM   4848 C  CD1   . TYR F 3 116 ? 49.983  103.137 43.452  1.00 9.00  ? 1108 TYR B CD1   1 
ATOM   4849 C  CD2   . TYR F 3 116 ? 47.672  103.714 43.270  1.00 8.18  ? 1108 TYR B CD2   1 
ATOM   4850 C  CE1   . TYR F 3 116 ? 49.692  102.294 44.523  1.00 8.21  ? 1108 TYR B CE1   1 
ATOM   4851 C  CE2   . TYR F 3 116 ? 47.370  102.867 44.347  1.00 7.10  ? 1108 TYR B CE2   1 
ATOM   4852 C  CZ    . TYR F 3 116 ? 48.393  102.163 44.961  1.00 6.82  ? 1108 TYR B CZ    1 
ATOM   4853 O  OH    . TYR F 3 116 ? 48.145  101.327 46.009  1.00 5.25  ? 1108 TYR B OH    1 
ATOM   4854 N  N     . LEU F 3 117 ? 51.405  107.205 40.703  1.00 12.31 ? 1109 LEU B N     1 
ATOM   4855 C  CA    . LEU F 3 117 ? 51.940  107.929 39.554  1.00 12.89 ? 1109 LEU B CA    1 
ATOM   4856 C  C     . LEU F 3 117 ? 52.876  107.031 38.755  1.00 12.88 ? 1109 LEU B C     1 
ATOM   4857 O  O     . LEU F 3 117 ? 53.962  106.710 39.217  1.00 12.92 ? 1109 LEU B O     1 
ATOM   4858 C  CB    . LEU F 3 117 ? 52.733  109.171 40.009  1.00 13.23 ? 1109 LEU B CB    1 
ATOM   4859 C  CG    . LEU F 3 117 ? 51.992  110.393 40.575  1.00 14.05 ? 1109 LEU B CG    1 
ATOM   4860 C  CD1   . LEU F 3 117 ? 51.667  110.200 42.043  1.00 15.14 ? 1109 LEU B CD1   1 
ATOM   4861 C  CD2   . LEU F 3 117 ? 52.805  111.681 40.392  1.00 13.87 ? 1109 LEU B CD2   1 
ATOM   4862 N  N     . ASP F 3 118 ? 52.475  106.633 37.554  1.00 13.06 ? 1110 ASP B N     1 
ATOM   4863 C  CA    . ASP F 3 118 ? 53.431  106.047 36.612  1.00 13.02 ? 1110 ASP B CA    1 
ATOM   4864 C  C     . ASP F 3 118 ? 54.431  107.141 36.225  1.00 12.96 ? 1110 ASP B C     1 
ATOM   4865 O  O     . ASP F 3 118 ? 54.046  108.159 35.650  1.00 12.64 ? 1110 ASP B O     1 
ATOM   4866 C  CB    . ASP F 3 118 ? 52.724  105.497 35.367  1.00 13.08 ? 1110 ASP B CB    1 
ATOM   4867 C  CG    . ASP F 3 118 ? 53.597  104.539 34.559  1.00 12.82 ? 1110 ASP B CG    1 
ATOM   4868 O  OD1   . ASP F 3 118 ? 54.838  104.626 34.634  1.00 11.07 ? 1110 ASP B OD1   1 
ATOM   4869 O  OD2   . ASP F 3 118 ? 53.117  103.660 33.815  1.00 13.37 ? 1110 ASP B OD2   1 
ATOM   4870 N  N     . ILE F 3 119 ? 55.699  106.938 36.579  1.00 12.98 ? 1111 ILE B N     1 
ATOM   4871 C  CA    . ILE F 3 119 ? 56.767  107.891 36.269  1.00 13.17 ? 1111 ILE B CA    1 
ATOM   4872 C  C     . ILE F 3 119 ? 57.886  107.218 35.466  1.00 13.50 ? 1111 ILE B C     1 
ATOM   4873 O  O     . ILE F 3 119 ? 59.070  107.518 35.645  1.00 13.49 ? 1111 ILE B O     1 
ATOM   4874 C  CB    . ILE F 3 119 ? 57.327  108.543 37.569  1.00 13.10 ? 1111 ILE B CB    1 
ATOM   4875 C  CG1   . ILE F 3 119 ? 57.819  107.483 38.557  1.00 12.89 ? 1111 ILE B CG1   1 
ATOM   4876 C  CG2   . ILE F 3 119 ? 56.276  109.430 38.224  1.00 12.82 ? 1111 ILE B CG2   1 
ATOM   4877 C  CD1   . ILE F 3 119 ? 58.832  108.019 39.535  1.00 12.91 ? 1111 ILE B CD1   1 
ATOM   4878 N  N     . SER F 3 120 ? 57.492  106.306 34.583  1.00 13.83 ? 1112 SER B N     1 
ATOM   4879 C  CA    . SER F 3 120 ? 58.427  105.569 33.750  1.00 14.27 ? 1112 SER B CA    1 
ATOM   4880 C  C     . SER F 3 120 ? 59.014  106.505 32.701  1.00 14.77 ? 1112 SER B C     1 
ATOM   4881 O  O     . SER F 3 120 ? 60.200  106.420 32.362  1.00 14.57 ? 1112 SER B O     1 
ATOM   4882 C  CB    . SER F 3 120 ? 57.716  104.413 33.045  1.00 14.33 ? 1112 SER B CB    1 
ATOM   4883 O  OG    . SER F 3 120 ? 57.096  103.543 33.971  1.00 14.43 ? 1112 SER B OG    1 
ATOM   4884 N  N     . ASP F 3 121 ? 58.165  107.403 32.200  1.00 15.24 ? 1113 ASP B N     1 
ATOM   4885 C  CA    . ASP F 3 121 ? 58.551  108.355 31.169  1.00 15.52 ? 1113 ASP B CA    1 
ATOM   4886 C  C     . ASP F 3 121 ? 58.819  109.740 31.756  1.00 15.55 ? 1113 ASP B C     1 
ATOM   4887 O  O     . ASP F 3 121 ? 58.722  110.745 31.051  1.00 15.80 ? 1113 ASP B O     1 
ATOM   4888 C  CB    . ASP F 3 121 ? 57.455  108.442 30.102  1.00 15.71 ? 1113 ASP B CB    1 
ATOM   4889 C  CG    . ASP F 3 121 ? 56.916  107.079 29.701  1.00 16.24 ? 1113 ASP B CG    1 
ATOM   4890 O  OD1   . ASP F 3 121 ? 57.648  106.065 29.825  1.00 16.39 ? 1113 ASP B OD1   1 
ATOM   4891 O  OD2   . ASP F 3 121 ? 55.762  106.936 29.249  1.00 17.09 ? 1113 ASP B OD2   1 
ATOM   4892 N  N     . LYS F 3 122 ? 59.145  109.789 33.045  1.00 15.49 ? 1114 LYS B N     1 
ATOM   4893 C  CA    . LYS F 3 122 ? 59.559  111.030 33.699  1.00 15.53 ? 1114 LYS B CA    1 
ATOM   4894 C  C     . LYS F 3 122 ? 60.964  110.934 34.298  1.00 15.38 ? 1114 LYS B C     1 
ATOM   4895 O  O     . LYS F 3 122 ? 61.636  111.947 34.435  1.00 15.26 ? 1114 LYS B O     1 
ATOM   4896 C  CB    . LYS F 3 122 ? 58.555  111.417 34.792  1.00 15.74 ? 1114 LYS B CB    1 
ATOM   4897 C  CG    . LYS F 3 122 ? 57.147  111.699 34.278  1.00 16.11 ? 1114 LYS B CG    1 
ATOM   4898 C  CD    . LYS F 3 122 ? 57.052  113.068 33.613  1.00 16.70 ? 1114 LYS B CD    1 
ATOM   4899 C  CE    . LYS F 3 122 ? 55.823  113.190 32.712  1.00 16.89 ? 1114 LYS B CE    1 
ATOM   4900 N  NZ    . LYS F 3 122 ? 56.094  114.084 31.541  1.00 16.81 ? 1114 LYS B NZ    1 
ATOM   4901 N  N     . VAL F 3 123 ? 61.393  109.727 34.667  1.00 15.42 ? 1115 VAL B N     1 
ATOM   4902 C  CA    . VAL F 3 123 ? 62.727  109.498 35.237  1.00 15.50 ? 1115 VAL B CA    1 
ATOM   4903 C  C     . VAL F 3 123 ? 63.305  108.136 34.818  1.00 15.54 ? 1115 VAL B C     1 
ATOM   4904 O  O     . VAL F 3 123 ? 62.574  107.251 34.358  1.00 15.66 ? 1115 VAL B O     1 
ATOM   4905 C  CB    . VAL F 3 123 ? 62.716  109.597 36.788  1.00 15.55 ? 1115 VAL B CB    1 
ATOM   4906 C  CG1   . VAL F 3 123 ? 62.497  111.034 37.237  1.00 15.48 ? 1115 VAL B CG1   1 
ATOM   4907 C  CG2   . VAL F 3 123 ? 61.654  108.688 37.389  1.00 15.40 ? 1115 VAL B CG2   1 
ATOM   4908 N  N     . ARG F 3 124 ? 64.614  107.973 35.001  1.00 15.39 ? 1116 ARG B N     1 
ATOM   4909 C  CA    . ARG F 3 124 ? 65.334  106.807 34.486  1.00 15.39 ? 1116 ARG B CA    1 
ATOM   4910 C  C     . ARG F 3 124 ? 65.820  105.809 35.536  1.00 15.41 ? 1116 ARG B C     1 
ATOM   4911 O  O     . ARG F 3 124 ? 66.257  104.715 35.180  1.00 15.47 ? 1116 ARG B O     1 
ATOM   4912 C  CB    . ARG F 3 124 ? 66.532  107.277 33.666  1.00 15.43 ? 1116 ARG B CB    1 
ATOM   4913 C  CG    . ARG F 3 124 ? 66.148  107.745 32.292  1.00 15.31 ? 1116 ARG B CG    1 
ATOM   4914 C  CD    . ARG F 3 124 ? 67.317  108.069 31.420  1.00 15.01 ? 1116 ARG B CD    1 
ATOM   4915 N  NE    . ARG F 3 124 ? 67.871  109.387 31.710  1.00 14.50 ? 1116 ARG B NE    1 
ATOM   4916 C  CZ    . ARG F 3 124 ? 68.907  109.914 31.069  1.00 13.89 ? 1116 ARG B CZ    1 
ATOM   4917 N  NH1   . ARG F 3 124 ? 69.516  109.243 30.091  1.00 13.34 ? 1116 ARG B NH1   1 
ATOM   4918 N  NH2   . ARG F 3 124 ? 69.337  111.122 31.404  1.00 13.94 ? 1116 ARG B NH2   1 
ATOM   4919 N  N     . ASP F 3 125 ? 65.776  106.182 36.812  1.00 15.37 ? 1117 ASP B N     1 
ATOM   4920 C  CA    . ASP F 3 125 ? 66.174  105.268 37.888  1.00 15.48 ? 1117 ASP B CA    1 
ATOM   4921 C  C     . ASP F 3 125 ? 65.480  105.609 39.226  1.00 15.54 ? 1117 ASP B C     1 
ATOM   4922 O  O     . ASP F 3 125 ? 64.549  106.418 39.260  1.00 15.55 ? 1117 ASP B O     1 
ATOM   4923 C  CB    . ASP F 3 125 ? 67.709  105.235 38.011  1.00 15.38 ? 1117 ASP B CB    1 
ATOM   4924 C  CG    . ASP F 3 125 ? 68.315  106.616 38.182  1.00 15.49 ? 1117 ASP B CG    1 
ATOM   4925 O  OD1   . ASP F 3 125 ? 69.462  106.830 37.723  1.00 15.62 ? 1117 ASP B OD1   1 
ATOM   4926 O  OD2   . ASP F 3 125 ? 67.720  107.551 38.756  1.00 14.77 ? 1117 ASP B OD2   1 
ATOM   4927 N  N     . TYR F 3 126 ? 65.901  104.974 40.317  1.00 15.52 ? 1118 TYR B N     1 
ATOM   4928 C  CA    . TYR F 3 126 ? 65.289  105.234 41.620  1.00 15.73 ? 1118 TYR B CA    1 
ATOM   4929 C  C     . TYR F 3 126 ? 65.892  106.445 42.342  1.00 15.81 ? 1118 TYR B C     1 
ATOM   4930 O  O     . TYR F 3 126 ? 65.292  106.962 43.279  1.00 15.83 ? 1118 TYR B O     1 
ATOM   4931 C  CB    . TYR F 3 126 ? 65.361  103.987 42.517  1.00 15.76 ? 1118 TYR B CB    1 
ATOM   4932 C  CG    . TYR F 3 126 ? 64.419  102.860 42.116  1.00 15.56 ? 1118 TYR B CG    1 
ATOM   4933 C  CD1   . TYR F 3 126 ? 63.096  103.116 41.764  1.00 15.20 ? 1118 TYR B CD1   1 
ATOM   4934 C  CD2   . TYR F 3 126 ? 64.854  101.535 42.099  1.00 15.40 ? 1118 TYR B CD2   1 
ATOM   4935 C  CE1   . TYR F 3 126 ? 62.238  102.090 41.401  1.00 15.43 ? 1118 TYR B CE1   1 
ATOM   4936 C  CE2   . TYR F 3 126 ? 63.997  100.501 41.738  1.00 15.49 ? 1118 TYR B CE2   1 
ATOM   4937 C  CZ    . TYR F 3 126 ? 62.692  100.788 41.392  1.00 15.39 ? 1118 TYR B CZ    1 
ATOM   4938 O  OH    . TYR F 3 126 ? 61.833  99.777  41.036  1.00 15.27 ? 1118 TYR B OH    1 
ATOM   4939 N  N     . ARG F 3 127 ? 67.067  106.892 41.912  1.00 15.86 ? 1119 ARG B N     1 
ATOM   4940 C  CA    . ARG F 3 127 ? 67.671  108.111 42.454  1.00 15.93 ? 1119 ARG B CA    1 
ATOM   4941 C  C     . ARG F 3 127 ? 66.922  109.368 41.974  1.00 15.79 ? 1119 ARG B C     1 
ATOM   4942 O  O     . ARG F 3 127 ? 66.850  110.370 42.690  1.00 15.80 ? 1119 ARG B O     1 
ATOM   4943 C  CB    . ARG F 3 127 ? 69.149  108.193 42.048  1.00 15.99 ? 1119 ARG B CB    1 
ATOM   4944 C  CG    . ARG F 3 127 ? 69.997  109.101 42.935  1.00 16.49 ? 1119 ARG B CG    1 
ATOM   4945 C  CD    . ARG F 3 127 ? 71.455  109.250 42.493  1.00 17.16 ? 1119 ARG B CD    1 
ATOM   4946 N  NE    . ARG F 3 127 ? 71.621  109.288 41.032  1.00 18.21 ? 1119 ARG B NE    1 
ATOM   4947 C  CZ    . ARG F 3 127 ? 71.261  110.305 40.239  1.00 18.27 ? 1119 ARG B CZ    1 
ATOM   4948 N  NH1   . ARG F 3 127 ? 70.696  111.403 40.742  1.00 18.59 ? 1119 ARG B NH1   1 
ATOM   4949 N  NH2   . ARG F 3 127 ? 71.460  110.223 38.929  1.00 17.70 ? 1119 ARG B NH2   1 
ATOM   4950 N  N     . GLU F 3 128 ? 66.372  109.301 40.761  1.00 15.50 ? 1120 GLU B N     1 
ATOM   4951 C  CA    . GLU F 3 128 ? 65.673  110.429 40.146  1.00 15.29 ? 1120 GLU B CA    1 
ATOM   4952 C  C     . GLU F 3 128 ? 64.183  110.364 40.485  1.00 14.99 ? 1120 GLU B C     1 
ATOM   4953 O  O     . GLU F 3 128 ? 63.521  111.397 40.592  1.00 14.86 ? 1120 GLU B O     1 
ATOM   4954 C  CB    . GLU F 3 128 ? 65.900  110.461 38.619  1.00 15.32 ? 1120 GLU B CB    1 
ATOM   4955 C  CG    . GLU F 3 128 ? 67.021  111.402 38.185  1.00 15.55 ? 1120 GLU B CG    1 
ATOM   4956 C  CD    . GLU F 3 128 ? 67.598  111.083 36.808  1.00 15.76 ? 1120 GLU B CD    1 
ATOM   4957 O  OE1   . GLU F 3 128 ? 66.821  110.761 35.884  1.00 15.83 ? 1120 GLU B OE1   1 
ATOM   4958 O  OE2   . GLU F 3 128 ? 68.836  111.166 36.647  1.00 15.46 ? 1120 GLU B OE2   1 
ATOM   4959 N  N     . ALA F 3 129 ? 63.662  109.149 40.659  1.00 14.66 ? 1121 ALA B N     1 
ATOM   4960 C  CA    . ALA F 3 129 ? 62.314  108.954 41.202  1.00 14.26 ? 1121 ALA B CA    1 
ATOM   4961 C  C     . ALA F 3 129 ? 62.225  109.537 42.602  1.00 13.81 ? 1121 ALA B C     1 
ATOM   4962 O  O     . ALA F 3 129 ? 61.232  110.159 42.951  1.00 13.52 ? 1121 ALA B O     1 
ATOM   4963 C  CB    . ALA F 3 129 ? 61.955  107.482 41.232  1.00 14.18 ? 1121 ALA B CB    1 
ATOM   4964 N  N     . TYR F 3 130 ? 63.288  109.337 43.378  1.00 13.70 ? 1122 TYR B N     1 
ATOM   4965 C  CA    . TYR F 3 130 ? 63.365  109.759 44.775  1.00 13.58 ? 1122 TYR B CA    1 
ATOM   4966 C  C     . TYR F 3 130 ? 63.404  111.282 44.881  1.00 13.54 ? 1122 TYR B C     1 
ATOM   4967 O  O     . TYR F 3 130 ? 62.674  111.865 45.671  1.00 13.44 ? 1122 TYR B O     1 
ATOM   4968 C  CB    . TYR F 3 130 ? 64.602  109.124 45.438  1.00 13.50 ? 1122 TYR B CB    1 
ATOM   4969 C  CG    . TYR F 3 130 ? 64.862  109.539 46.867  1.00 13.10 ? 1122 TYR B CG    1 
ATOM   4970 C  CD1   . TYR F 3 130 ? 64.285  108.857 47.929  1.00 13.62 ? 1122 TYR B CD1   1 
ATOM   4971 C  CD2   . TYR F 3 130 ? 65.699  110.602 47.156  1.00 13.06 ? 1122 TYR B CD2   1 
ATOM   4972 C  CE1   . TYR F 3 130 ? 64.530  109.237 49.251  1.00 13.37 ? 1122 TYR B CE1   1 
ATOM   4973 C  CE2   . TYR F 3 130 ? 65.948  110.991 48.465  1.00 13.18 ? 1122 TYR B CE2   1 
ATOM   4974 C  CZ    . TYR F 3 130 ? 65.359  110.311 49.508  1.00 13.16 ? 1122 TYR B CZ    1 
ATOM   4975 O  OH    . TYR F 3 130 ? 65.603  110.701 50.804  1.00 12.55 ? 1122 TYR B OH    1 
ATOM   4976 N  N     . ASN F 3 131 ? 64.246  111.921 44.073  1.00 13.73 ? 1123 ASN B N     1 
ATOM   4977 C  CA    . ASN F 3 131 ? 64.349  113.388 44.065  1.00 13.72 ? 1123 ASN B CA    1 
ATOM   4978 C  C     . ASN F 3 131 ? 63.062  114.062 43.598  1.00 13.76 ? 1123 ASN B C     1 
ATOM   4979 O  O     . ASN F 3 131 ? 62.792  115.203 43.963  1.00 13.81 ? 1123 ASN B O     1 
ATOM   4980 C  CB    . ASN F 3 131 ? 65.530  113.856 43.206  1.00 13.66 ? 1123 ASN B CB    1 
ATOM   4981 C  CG    . ASN F 3 131 ? 66.803  114.073 44.019  1.00 13.85 ? 1123 ASN B CG    1 
ATOM   4982 O  OD1   . ASN F 3 131 ? 66.959  113.532 45.121  1.00 13.05 ? 1123 ASN B OD1   1 
ATOM   4983 N  ND2   . ASN F 3 131 ? 67.723  114.875 43.474  1.00 13.30 ? 1123 ASN B ND2   1 
ATOM   4984 N  N     . LEU F 3 132 ? 62.280  113.348 42.792  1.00 13.81 ? 1124 LEU B N     1 
ATOM   4985 C  CA    . LEU F 3 132 ? 60.945  113.787 42.391  1.00 13.71 ? 1124 LEU B CA    1 
ATOM   4986 C  C     . LEU F 3 132 ? 59.946  113.627 43.528  1.00 13.64 ? 1124 LEU B C     1 
ATOM   4987 O  O     . LEU F 3 132 ? 59.031  114.432 43.673  1.00 13.85 ? 1124 LEU B O     1 
ATOM   4988 C  CB    . LEU F 3 132 ? 60.467  112.981 41.184  1.00 13.76 ? 1124 LEU B CB    1 
ATOM   4989 C  CG    . LEU F 3 132 ? 59.141  113.382 40.546  1.00 13.72 ? 1124 LEU B CG    1 
ATOM   4990 C  CD1   . LEU F 3 132 ? 59.063  114.879 40.335  1.00 13.78 ? 1124 LEU B CD1   1 
ATOM   4991 C  CD2   . LEU F 3 132 ? 58.986  112.652 39.224  1.00 14.22 ? 1124 LEU B CD2   1 
ATOM   4992 N  N     . GLY F 3 133 ? 60.113  112.575 44.322  1.00 13.53 ? 1125 GLY B N     1 
ATOM   4993 C  CA    . GLY F 3 133 ? 59.313  112.381 45.516  1.00 13.33 ? 1125 GLY B CA    1 
ATOM   4994 C  C     . GLY F 3 133 ? 59.520  113.506 46.510  1.00 13.20 ? 1125 GLY B C     1 
ATOM   4995 O  O     . GLY F 3 133 ? 58.584  113.923 47.168  1.00 13.18 ? 1125 GLY B O     1 
ATOM   4996 N  N     . LEU F 3 134 ? 60.750  113.998 46.605  1.00 13.25 ? 1126 LEU B N     1 
ATOM   4997 C  CA    . LEU F 3 134 ? 61.077  115.137 47.460  1.00 13.31 ? 1126 LEU B CA    1 
ATOM   4998 C  C     . LEU F 3 134 ? 60.465  116.430 46.927  1.00 13.25 ? 1126 LEU B C     1 
ATOM   4999 O  O     . LEU F 3 134 ? 60.071  117.302 47.697  1.00 13.05 ? 1126 LEU B O     1 
ATOM   5000 C  CB    . LEU F 3 134 ? 62.596  115.295 47.576  1.00 13.14 ? 1126 LEU B CB    1 
ATOM   5001 C  CG    . LEU F 3 134 ? 63.301  114.172 48.335  1.00 13.81 ? 1126 LEU B CG    1 
ATOM   5002 C  CD1   . LEU F 3 134 ? 64.789  114.204 48.081  1.00 14.67 ? 1126 LEU B CD1   1 
ATOM   5003 C  CD2   . LEU F 3 134 ? 63.025  114.265 49.826  1.00 14.50 ? 1126 LEU B CD2   1 
ATOM   5004 N  N     . GLU F 3 135 ? 60.407  116.543 45.605  1.00 13.47 ? 1127 GLU B N     1 
ATOM   5005 C  CA    . GLU F 3 135 ? 59.822  117.698 44.931  1.00 13.61 ? 1127 GLU B CA    1 
ATOM   5006 C  C     . GLU F 3 135 ? 58.326  117.714 45.160  1.00 13.62 ? 1127 GLU B C     1 
ATOM   5007 O  O     . GLU F 3 135 ? 57.728  118.770 45.294  1.00 13.50 ? 1127 GLU B O     1 
ATOM   5008 C  CB    . GLU F 3 135 ? 60.080  117.635 43.422  1.00 13.74 ? 1127 GLU B CB    1 
ATOM   5009 C  CG    . GLU F 3 135 ? 61.115  118.604 42.897  1.00 13.83 ? 1127 GLU B CG    1 
ATOM   5010 C  CD    . GLU F 3 135 ? 61.375  118.383 41.422  1.00 14.52 ? 1127 GLU B CD    1 
ATOM   5011 O  OE1   . GLU F 3 135 ? 62.116  117.430 41.088  1.00 14.02 ? 1127 GLU B OE1   1 
ATOM   5012 O  OE2   . GLU F 3 135 ? 60.824  119.151 40.599  1.00 15.58 ? 1127 GLU B OE2   1 
ATOM   5013 N  N     . ILE F 3 136 ? 57.725  116.531 45.187  1.00 13.70 ? 1128 ILE B N     1 
ATOM   5014 C  CA    . ILE F 3 136 ? 56.294  116.411 45.401  1.00 13.77 ? 1128 ILE B CA    1 
ATOM   5015 C  C     . ILE F 3 136 ? 55.972  116.734 46.847  1.00 13.58 ? 1128 ILE B C     1 
ATOM   5016 O  O     . ILE F 3 136 ? 55.023  117.458 47.110  1.00 13.52 ? 1128 ILE B O     1 
ATOM   5017 C  CB    . ILE F 3 136 ? 55.808  114.996 45.029  1.00 13.92 ? 1128 ILE B CB    1 
ATOM   5018 C  CG1   . ILE F 3 136 ? 55.872  114.816 43.512  1.00 13.85 ? 1128 ILE B CG1   1 
ATOM   5019 C  CG2   . ILE F 3 136 ? 54.380  114.757 45.524  1.00 13.85 ? 1128 ILE B CG2   1 
ATOM   5020 C  CD1   . ILE F 3 136 ? 55.944  113.391 43.098  1.00 14.42 ? 1128 ILE B CD1   1 
ATOM   5021 N  N     . LYS F 3 137 ? 56.778  116.208 47.770  1.00 13.56 ? 1129 LYS B N     1 
ATOM   5022 C  CA    . LYS F 3 137 ? 56.550  116.371 49.214  1.00 13.62 ? 1129 LYS B CA    1 
ATOM   5023 C  C     . LYS F 3 137 ? 56.669  117.831 49.617  1.00 13.64 ? 1129 LYS B C     1 
ATOM   5024 O  O     . LYS F 3 137 ? 55.836  118.341 50.359  1.00 13.54 ? 1129 LYS B O     1 
ATOM   5025 C  CB    . LYS F 3 137 ? 57.550  115.548 50.043  1.00 13.51 ? 1129 LYS B CB    1 
ATOM   5026 C  CG    . LYS F 3 137 ? 57.046  114.205 50.508  1.00 13.86 ? 1129 LYS B CG    1 
ATOM   5027 C  CD    . LYS F 3 137 ? 58.157  113.384 51.165  1.00 14.71 ? 1129 LYS B CD    1 
ATOM   5028 C  CE    . LYS F 3 137 ? 58.328  113.706 52.665  1.00 15.21 ? 1129 LYS B CE    1 
ATOM   5029 N  NZ    . LYS F 3 137 ? 57.218  113.191 53.540  1.00 14.52 ? 1129 LYS B NZ    1 
ATOM   5030 N  N     . ASN F 3 138 ? 57.717  118.492 49.134  1.00 13.71 ? 1130 ASN B N     1 
ATOM   5031 C  CA    . ASN F 3 138 ? 57.916  119.904 49.424  1.00 13.91 ? 1130 ASN B CA    1 
ATOM   5032 C  C     . ASN F 3 138 ? 56.824  120.744 48.779  1.00 13.87 ? 1130 ASN B C     1 
ATOM   5033 O  O     . ASN F 3 138 ? 56.322  121.671 49.402  1.00 14.09 ? 1130 ASN B O     1 
ATOM   5034 C  CB    . ASN F 3 138 ? 59.299  120.386 48.963  1.00 13.89 ? 1130 ASN B CB    1 
ATOM   5035 C  CG    . ASN F 3 138 ? 60.430  119.875 49.847  1.00 14.32 ? 1130 ASN B CG    1 
ATOM   5036 O  OD1   . ASN F 3 138 ? 60.225  119.104 50.785  1.00 14.93 ? 1130 ASN B OD1   1 
ATOM   5037 N  ND2   . ASN F 3 138 ? 61.641  120.299 49.534  1.00 15.64 ? 1130 ASN B ND2   1 
ATOM   5038 N  N     . LYS F 3 139 ? 56.444  120.408 47.548  1.00 13.68 ? 1131 LYS B N     1 
ATOM   5039 C  CA    . LYS F 3 139 ? 55.481  121.211 46.796  1.00 13.76 ? 1131 LYS B CA    1 
ATOM   5040 C  C     . LYS F 3 139 ? 54.094  121.193 47.424  1.00 13.77 ? 1131 LYS B C     1 
ATOM   5041 O  O     . LYS F 3 139 ? 53.394  122.198 47.391  1.00 13.68 ? 1131 LYS B O     1 
ATOM   5042 C  CB    . LYS F 3 139 ? 55.399  120.739 45.341  1.00 13.88 ? 1131 LYS B CB    1 
ATOM   5043 C  CG    . LYS F 3 139 ? 54.484  121.568 44.407  1.00 14.44 ? 1131 LYS B CG    1 
ATOM   5044 C  CD    . LYS F 3 139 ? 54.748  123.082 44.442  1.00 15.05 ? 1131 LYS B CD    1 
ATOM   5045 C  CE    . LYS F 3 139 ? 56.186  123.442 44.086  1.00 15.47 ? 1131 LYS B CE    1 
ATOM   5046 N  NZ    . LYS F 3 139 ? 56.235  124.517 43.045  1.00 16.68 ? 1131 LYS B NZ    1 
ATOM   5047 N  N     . ILE F 3 140 ? 53.709  120.056 47.997  1.00 13.86 ? 1132 ILE B N     1 
ATOM   5048 C  CA    . ILE F 3 140 ? 52.407  119.910 48.636  1.00 13.88 ? 1132 ILE B CA    1 
ATOM   5049 C  C     . ILE F 3 140 ? 52.406  120.640 49.985  1.00 14.38 ? 1132 ILE B C     1 
ATOM   5050 O  O     . ILE F 3 140 ? 51.378  121.173 50.404  1.00 14.50 ? 1132 ILE B O     1 
ATOM   5051 C  CB    . ILE F 3 140 ? 52.022  118.399 48.777  1.00 13.61 ? 1132 ILE B CB    1 
ATOM   5052 C  CG1   . ILE F 3 140 ? 51.730  117.802 47.397  1.00 13.16 ? 1132 ILE B CG1   1 
ATOM   5053 C  CG2   . ILE F 3 140 ? 50.791  118.212 49.673  1.00 13.23 ? 1132 ILE B CG2   1 
ATOM   5054 C  CD1   . ILE F 3 140 ? 51.657  116.292 47.356  1.00 12.69 ? 1132 ILE B CD1   1 
ATOM   5055 N  N     . LEU F 3 141 ? 53.560  120.679 50.646  1.00 14.75 ? 1133 LEU B N     1 
ATOM   5056 C  CA    . LEU F 3 141 ? 53.698  121.343 51.944  1.00 15.01 ? 1133 LEU B CA    1 
ATOM   5057 C  C     . LEU F 3 141 ? 53.627  122.870 51.794  1.00 15.18 ? 1133 LEU B C     1 
ATOM   5058 O  O     . LEU F 3 141 ? 52.948  123.545 52.557  1.00 15.24 ? 1133 LEU B O     1 
ATOM   5059 C  CB    . LEU F 3 141 ? 55.018  120.923 52.600  1.00 15.07 ? 1133 LEU B CB    1 
ATOM   5060 C  CG    . LEU F 3 141 ? 55.235  121.146 54.097  1.00 15.55 ? 1133 LEU B CG    1 
ATOM   5061 C  CD1   . LEU F 3 141 ? 54.028  120.700 54.925  1.00 15.92 ? 1133 LEU B CD1   1 
ATOM   5062 C  CD2   . LEU F 3 141 ? 56.493  120.404 54.548  1.00 16.04 ? 1133 LEU B CD2   1 
ATOM   5063 N  N     . GLU F 3 142 ? 54.346  123.402 50.813  1.00 15.59 ? 1134 GLU B N     1 
ATOM   5064 C  CA    . GLU F 3 142 ? 54.239  124.805 50.422  1.00 16.02 ? 1134 GLU B CA    1 
ATOM   5065 C  C     . GLU F 3 142 ? 52.773  125.204 50.223  1.00 15.90 ? 1134 GLU B C     1 
ATOM   5066 O  O     . GLU F 3 142 ? 52.311  126.193 50.794  1.00 15.79 ? 1134 GLU B O     1 
ATOM   5067 C  CB    . GLU F 3 142 ? 55.007  125.054 49.105  1.00 16.34 ? 1134 GLU B CB    1 
ATOM   5068 C  CG    . GLU F 3 142 ? 56.492  125.402 49.257  1.00 17.82 ? 1134 GLU B CG    1 
ATOM   5069 C  CD    . GLU F 3 142 ? 57.339  125.040 48.025  1.00 19.72 ? 1134 GLU B CD    1 
ATOM   5070 O  OE1   . GLU F 3 142 ? 57.277  125.775 46.999  1.00 20.00 ? 1134 GLU B OE1   1 
ATOM   5071 O  OE2   . GLU F 3 142 ? 58.078  124.019 48.081  1.00 19.79 ? 1134 GLU B OE2   1 
ATOM   5072 N  N     . LYS F 3 143 ? 52.052  124.388 49.448  1.00 15.82 ? 1135 LYS B N     1 
ATOM   5073 C  CA    . LYS F 3 143 ? 50.789  124.777 48.806  1.00 15.78 ? 1135 LYS B CA    1 
ATOM   5074 C  C     . LYS F 3 143 ? 49.515  124.447 49.581  1.00 15.58 ? 1135 LYS B C     1 
ATOM   5075 O  O     . LYS F 3 143 ? 48.513  125.135 49.421  1.00 15.90 ? 1135 LYS B O     1 
ATOM   5076 C  CB    . LYS F 3 143 ? 50.691  124.142 47.405  1.00 15.91 ? 1135 LYS B CB    1 
ATOM   5077 C  CG    . LYS F 3 143 ? 51.551  124.827 46.331  1.00 16.25 ? 1135 LYS B CG    1 
ATOM   5078 C  CD    . LYS F 3 143 ? 50.732  125.711 45.396  1.00 16.70 ? 1135 LYS B CD    1 
ATOM   5079 C  CE    . LYS F 3 143 ? 51.528  126.930 44.953  1.00 17.49 ? 1135 LYS B CE    1 
ATOM   5080 N  NZ    . LYS F 3 143 ? 50.778  127.775 43.963  1.00 18.13 ? 1135 LYS B NZ    1 
ATOM   5081 N  N     . GLU F 3 144 ? 49.538  123.383 50.376  1.00 15.38 ? 1136 GLU B N     1 
ATOM   5082 C  CA    . GLU F 3 144 ? 48.381  122.982 51.184  1.00 15.17 ? 1136 GLU B CA    1 
ATOM   5083 C  C     . GLU F 3 144 ? 48.741  122.683 52.631  1.00 14.88 ? 1136 GLU B C     1 
ATOM   5084 O  O     . GLU F 3 144 ? 47.875  122.324 53.413  1.00 14.92 ? 1136 GLU B O     1 
ATOM   5085 C  CB    . GLU F 3 144 ? 47.712  121.740 50.578  1.00 15.13 ? 1136 GLU B CB    1 
ATOM   5086 C  CG    . GLU F 3 144 ? 47.197  121.913 49.159  1.00 15.59 ? 1136 GLU B CG    1 
ATOM   5087 C  CD    . GLU F 3 144 ? 46.177  123.031 49.011  1.00 16.52 ? 1136 GLU B CD    1 
ATOM   5088 O  OE1   . GLU F 3 144 ? 45.431  123.293 49.963  1.00 17.22 ? 1136 GLU B OE1   1 
ATOM   5089 O  OE2   . GLU F 3 144 ? 46.115  123.654 47.932  1.00 18.56 ? 1136 GLU B OE2   1 
ATOM   5090 N  N     . LYS F 3 145 ? 50.014  122.823 52.980  1.00 14.89 ? 1137 LYS B N     1 
ATOM   5091 C  CA    . LYS F 3 145 ? 50.514  122.507 54.320  1.00 15.15 ? 1137 LYS B CA    1 
ATOM   5092 C  C     . LYS F 3 145 ? 50.261  121.047 54.762  1.00 15.02 ? 1137 LYS B C     1 
ATOM   5093 O  O     . LYS F 3 145 ? 50.185  120.757 55.955  1.00 15.23 ? 1137 LYS B O     1 
ATOM   5094 C  CB    . LYS F 3 145 ? 49.947  123.501 55.343  1.00 15.16 ? 1137 LYS B CB    1 
ATOM   5095 C  CG    . LYS F 3 145 ? 50.204  124.964 54.984  1.00 16.00 ? 1137 LYS B CG    1 
ATOM   5096 C  CD    . LYS F 3 145 ? 51.475  125.508 55.646  1.00 17.26 ? 1137 LYS B CD    1 
ATOM   5097 C  CE    . LYS F 3 145 ? 51.412  127.029 55.845  1.00 17.58 ? 1137 LYS B CE    1 
ATOM   5098 N  NZ    . LYS F 3 145 ? 51.586  127.775 54.568  1.00 17.08 ? 1137 LYS B NZ    1 
ATOM   5099 N  N     . ILE F 3 146 ? 50.150  120.137 53.797  1.00 14.79 ? 1138 ILE B N     1 
ATOM   5100 C  CA    . ILE F 3 146 ? 49.909  118.730 54.071  1.00 14.69 ? 1138 ILE B CA    1 
ATOM   5101 C  C     . ILE F 3 146 ? 51.188  117.939 53.845  1.00 14.79 ? 1138 ILE B C     1 
ATOM   5102 O  O     . ILE F 3 146 ? 51.761  117.958 52.749  1.00 15.17 ? 1138 ILE B O     1 
ATOM   5103 C  CB    . ILE F 3 146 ? 48.797  118.185 53.145  1.00 14.78 ? 1138 ILE B CB    1 
ATOM   5104 C  CG1   . ILE F 3 146 ? 47.455  118.889 53.413  1.00 15.14 ? 1138 ILE B CG1   1 
ATOM   5105 C  CG2   . ILE F 3 146 ? 48.661  116.668 53.287  1.00 14.46 ? 1138 ILE B CG2   1 
ATOM   5106 C  CD1   . ILE F 3 146 ? 46.983  118.861 54.868  1.00 15.36 ? 1138 ILE B CD1   1 
ATOM   5107 N  N     . THR F 3 147 ? 51.646  117.271 54.898  1.00 14.66 ? 1139 THR B N     1 
ATOM   5108 C  CA    . THR F 3 147 ? 52.686  116.260 54.790  1.00 14.53 ? 1139 THR B CA    1 
ATOM   5109 C  C     . THR F 3 147 ? 52.068  115.010 54.169  1.00 14.16 ? 1139 THR B C     1 
ATOM   5110 O  O     . THR F 3 147 ? 50.898  114.697 54.392  1.00 13.85 ? 1139 THR B O     1 
ATOM   5111 C  CB    . THR F 3 147 ? 53.288  115.905 56.173  1.00 14.61 ? 1139 THR B CB    1 
ATOM   5112 O  OG1   . THR F 3 147 ? 52.316  115.209 56.972  1.00 15.82 ? 1139 THR B OG1   1 
ATOM   5113 C  CG2   . THR F 3 147 ? 53.609  117.150 56.981  1.00 14.58 ? 1139 THR B CG2   1 
ATOM   5114 N  N     . VAL F 3 148 ? 52.863  114.308 53.379  1.00 13.86 ? 1140 VAL B N     1 
ATOM   5115 C  CA    . VAL F 3 148 ? 52.416  113.087 52.739  1.00 13.72 ? 1140 VAL B CA    1 
ATOM   5116 C  C     . VAL F 3 148 ? 53.517  112.074 52.888  1.00 13.46 ? 1140 VAL B C     1 
ATOM   5117 O  O     . VAL F 3 148 ? 54.545  112.367 53.471  1.00 14.28 ? 1140 VAL B O     1 
ATOM   5118 C  CB    . VAL F 3 148 ? 52.068  113.319 51.243  1.00 13.77 ? 1140 VAL B CB    1 
ATOM   5119 C  CG1   . VAL F 3 148 ? 50.950  114.335 51.112  1.00 13.32 ? 1140 VAL B CG1   1 
ATOM   5120 C  CG2   . VAL F 3 148 ? 53.290  113.775 50.441  1.00 14.24 ? 1140 VAL B CG2   1 
ATOM   5121 N  N     . THR F 3 149 ? 53.303  110.880 52.372  1.00 13.19 ? 1141 THR B N     1 
ATOM   5122 C  CA    . THR F 3 149 ? 54.353  109.877 52.328  1.00 13.30 ? 1141 THR B CA    1 
ATOM   5123 C  C     . THR F 3 149 ? 54.459  109.309 50.910  1.00 12.99 ? 1141 THR B C     1 
ATOM   5124 O  O     . THR F 3 149 ? 53.448  109.056 50.260  1.00 13.16 ? 1141 THR B O     1 
ATOM   5125 C  CB    . THR F 3 149 ? 54.051  108.788 53.367  1.00 13.33 ? 1141 THR B CB    1 
ATOM   5126 O  OG1   . THR F 3 149 ? 54.074  109.368 54.680  1.00 13.47 ? 1141 THR B OG1   1 
ATOM   5127 C  CG2   . THR F 3 149 ? 55.145  107.728 53.411  1.00 13.54 ? 1141 THR B CG2   1 
ATOM   5128 N  N     . VAL F 3 150 ? 55.678  109.124 50.432  1.00 12.55 ? 1142 VAL B N     1 
ATOM   5129 C  CA    . VAL F 3 150 ? 55.894  108.644 49.077  1.00 12.59 ? 1142 VAL B CA    1 
ATOM   5130 C  C     . VAL F 3 150 ? 56.567  107.280 49.123  1.00 12.47 ? 1142 VAL B C     1 
ATOM   5131 O  O     . VAL F 3 150 ? 57.546  107.115 49.822  1.00 12.61 ? 1142 VAL B O     1 
ATOM   5132 C  CB    . VAL F 3 150 ? 56.798  109.615 48.294  1.00 12.65 ? 1142 VAL B CB    1 
ATOM   5133 C  CG1   . VAL F 3 150 ? 57.071  109.098 46.880  1.00 12.88 ? 1142 VAL B CG1   1 
ATOM   5134 C  CG2   . VAL F 3 150 ? 56.195  111.011 48.255  1.00 12.73 ? 1142 VAL B CG2   1 
ATOM   5135 N  N     . GLY F 3 151 ? 56.034  106.309 48.388  1.00 12.51 ? 1143 GLY B N     1 
ATOM   5136 C  CA    . GLY F 3 151 ? 56.715  105.044 48.147  1.00 12.57 ? 1143 GLY B CA    1 
ATOM   5137 C  C     . GLY F 3 151 ? 57.027  104.840 46.673  1.00 12.56 ? 1143 GLY B C     1 
ATOM   5138 O  O     . GLY F 3 151 ? 56.235  105.200 45.815  1.00 12.36 ? 1143 GLY B O     1 
ATOM   5139 N  N     . ILE F 3 152 ? 58.185  104.255 46.379  1.00 12.96 ? 1144 ILE B N     1 
ATOM   5140 C  CA    . ILE F 3 152 ? 58.639  104.052 44.996  1.00 13.09 ? 1144 ILE B CA    1 
ATOM   5141 C  C     . ILE F 3 152 ? 59.021  102.582 44.757  1.00 13.25 ? 1144 ILE B C     1 
ATOM   5142 O  O     . ILE F 3 152 ? 59.657  101.970 45.614  1.00 13.47 ? 1144 ILE B O     1 
ATOM   5143 C  CB    . ILE F 3 152 ? 59.827  104.995 44.686  1.00 12.99 ? 1144 ILE B CB    1 
ATOM   5144 C  CG1   . ILE F 3 152 ? 59.361  106.453 44.633  1.00 12.75 ? 1144 ILE B CG1   1 
ATOM   5145 C  CG2   . ILE F 3 152 ? 60.484  104.636 43.356  1.00 13.38 ? 1144 ILE B CG2   1 
ATOM   5146 C  CD1   . ILE F 3 152 ? 60.414  107.437 45.089  1.00 12.56 ? 1144 ILE B CD1   1 
ATOM   5147 N  N     . SER F 3 153 ? 58.616  102.022 43.610  1.00 13.39 ? 1145 SER B N     1 
ATOM   5148 C  CA    . SER F 3 153 ? 58.942  100.631 43.232  1.00 13.75 ? 1145 SER B CA    1 
ATOM   5149 C  C     . SER F 3 153 ? 58.505  100.269 41.805  1.00 13.82 ? 1145 SER B C     1 
ATOM   5150 O  O     . SER F 3 153 ? 57.999  101.108 41.072  1.00 14.01 ? 1145 SER B O     1 
ATOM   5151 C  CB    . SER F 3 153 ? 58.316  99.632  44.218  1.00 14.03 ? 1145 SER B CB    1 
ATOM   5152 O  OG    . SER F 3 153 ? 59.291  98.749  44.749  1.00 14.34 ? 1145 SER B OG    1 
ATOM   5153 N  N     . LYS F 3 154 ? 58.696  99.010  41.418  1.00 13.84 ? 1146 LYS B N     1 
ATOM   5154 C  CA    . LYS F 3 154 ? 58.388  98.577  40.052  1.00 13.98 ? 1146 LYS B CA    1 
ATOM   5155 C  C     . LYS F 3 154 ? 56.891  98.425  39.781  1.00 14.00 ? 1146 LYS B C     1 
ATOM   5156 O  O     . LYS F 3 154 ? 56.465  98.506  38.634  1.00 14.17 ? 1146 LYS B O     1 
ATOM   5157 C  CB    . LYS F 3 154 ? 59.147  97.291  39.664  1.00 14.15 ? 1146 LYS B CB    1 
ATOM   5158 C  CG    . LYS F 3 154 ? 59.203  96.184  40.724  1.00 14.67 ? 1146 LYS B CG    1 
ATOM   5159 C  CD    . LYS F 3 154 ? 59.553  94.824  40.107  1.00 15.20 ? 1146 LYS B CD    1 
ATOM   5160 C  CE    . LYS F 3 154 ? 58.295  94.038  39.739  1.00 15.54 ? 1146 LYS B CE    1 
ATOM   5161 N  NZ    . LYS F 3 154 ? 58.535  93.052  38.656  1.00 16.09 ? 1146 LYS B NZ    1 
ATOM   5162 N  N     . ASN F 3 155 ? 56.094  98.197  40.820  1.00 14.00 ? 1147 ASN B N     1 
ATOM   5163 C  CA    . ASN F 3 155 ? 54.642  98.098  40.648  1.00 13.96 ? 1147 ASN B CA    1 
ATOM   5164 C  C     . ASN F 3 155 ? 53.849  98.848  41.722  1.00 13.96 ? 1147 ASN B C     1 
ATOM   5165 O  O     . ASN F 3 155 ? 54.417  99.380  42.679  1.00 13.63 ? 1147 ASN B O     1 
ATOM   5166 C  CB    . ASN F 3 155 ? 54.199  96.628  40.566  1.00 14.00 ? 1147 ASN B CB    1 
ATOM   5167 C  CG    . ASN F 3 155 ? 54.651  95.797  41.764  1.00 14.05 ? 1147 ASN B CG    1 
ATOM   5168 O  OD1   . ASN F 3 155 ? 54.333  96.109  42.912  1.00 14.69 ? 1147 ASN B OD1   1 
ATOM   5169 N  ND2   . ASN F 3 155 ? 55.383  94.726  41.493  1.00 13.38 ? 1147 ASN B ND2   1 
ATOM   5170 N  N     . LYS F 3 156 ? 52.534  98.900  41.515  1.00 13.98 ? 1148 LYS B N     1 
ATOM   5171 C  CA    . LYS F 3 156 ? 51.591  99.571  42.412  1.00 13.98 ? 1148 LYS B CA    1 
ATOM   5172 C  C     . LYS F 3 156 ? 51.667  99.047  43.845  1.00 13.86 ? 1148 LYS B C     1 
ATOM   5173 O  O     . LYS F 3 156 ? 51.735  99.823  44.803  1.00 13.58 ? 1148 LYS B O     1 
ATOM   5174 C  CB    . LYS F 3 156 ? 50.150  99.383  41.899  1.00 14.06 ? 1148 LYS B CB    1 
ATOM   5175 C  CG    . LYS F 3 156 ? 49.676  100.445 40.916  1.00 14.39 ? 1148 LYS B CG    1 
ATOM   5176 C  CD    . LYS F 3 156 ? 48.151  100.454 40.780  1.00 14.94 ? 1148 LYS B CD    1 
ATOM   5177 C  CE    . LYS F 3 156 ? 47.671  99.373  39.815  1.00 15.60 ? 1148 LYS B CE    1 
ATOM   5178 N  NZ    . LYS F 3 156 ? 46.180  99.224  39.801  1.00 16.43 ? 1148 LYS B NZ    1 
ATOM   5179 N  N     . VAL F 3 157 ? 51.647  97.728  43.984  1.00 13.76 ? 1149 VAL B N     1 
ATOM   5180 C  CA    . VAL F 3 157 ? 51.579  97.104  45.298  1.00 13.81 ? 1149 VAL B CA    1 
ATOM   5181 C  C     . VAL F 3 157 ? 52.795  97.432  46.154  1.00 13.68 ? 1149 VAL B C     1 
ATOM   5182 O  O     . VAL F 3 157 ? 52.649  97.811  47.314  1.00 13.76 ? 1149 VAL B O     1 
ATOM   5183 C  CB    . VAL F 3 157 ? 51.407  95.583  45.177  1.00 13.88 ? 1149 VAL B CB    1 
ATOM   5184 C  CG1   . VAL F 3 157 ? 51.683  94.880  46.509  1.00 13.86 ? 1149 VAL B CG1   1 
ATOM   5185 C  CG2   . VAL F 3 157 ? 50.004  95.272  44.675  1.00 14.11 ? 1149 VAL B CG2   1 
ATOM   5186 N  N     . PHE F 3 158 ? 53.988  97.311  45.590  1.00 13.37 ? 1150 PHE B N     1 
ATOM   5187 C  CA    . PHE F 3 158 ? 55.191  97.554  46.375  1.00 13.27 ? 1150 PHE B CA    1 
ATOM   5188 C  C     . PHE F 3 158 ? 55.493  99.041  46.598  1.00 13.14 ? 1150 PHE B C     1 
ATOM   5189 O  O     . PHE F 3 158 ? 56.240  99.394  47.512  1.00 13.12 ? 1150 PHE B O     1 
ATOM   5190 C  CB    . PHE F 3 158 ? 56.376  96.801  45.782  1.00 13.15 ? 1150 PHE B CB    1 
ATOM   5191 C  CG    . PHE F 3 158 ? 56.417  95.370  46.203  1.00 12.97 ? 1150 PHE B CG    1 
ATOM   5192 C  CD1   . PHE F 3 158 ? 56.938  95.020  47.445  1.00 12.62 ? 1150 PHE B CD1   1 
ATOM   5193 C  CD2   . PHE F 3 158 ? 55.890  94.376  45.387  1.00 12.82 ? 1150 PHE B CD2   1 
ATOM   5194 C  CE1   . PHE F 3 158 ? 56.963  93.698  47.856  1.00 12.62 ? 1150 PHE B CE1   1 
ATOM   5195 C  CE2   . PHE F 3 158 ? 55.908  93.054  45.788  1.00 12.86 ? 1150 PHE B CE2   1 
ATOM   5196 C  CZ    . PHE F 3 158 ? 56.442  92.714  47.030  1.00 13.14 ? 1150 PHE B CZ    1 
ATOM   5197 N  N     . ALA F 3 159 ? 54.889  99.904  45.788  1.00 12.87 ? 1151 ALA B N     1 
ATOM   5198 C  CA    . ALA F 3 159 ? 54.967  101.339 46.004  1.00 12.85 ? 1151 ALA B CA    1 
ATOM   5199 C  C     . ALA F 3 159 ? 54.133  101.715 47.218  1.00 13.07 ? 1151 ALA B C     1 
ATOM   5200 O  O     . ALA F 3 159 ? 54.547  102.546 48.017  1.00 13.26 ? 1151 ALA B O     1 
ATOM   5201 C  CB    . ALA F 3 159 ? 54.477  102.084 44.781  1.00 13.02 ? 1151 ALA B CB    1 
ATOM   5202 N  N     . LYS F 3 160 ? 52.957  101.106 47.363  1.00 13.18 ? 1152 LYS B N     1 
ATOM   5203 C  CA    . LYS F 3 160 ? 52.158  101.301 48.568  1.00 13.11 ? 1152 LYS B CA    1 
ATOM   5204 C  C     . LYS F 3 160 ? 52.868  100.736 49.797  1.00 13.16 ? 1152 LYS B C     1 
ATOM   5205 O  O     . LYS F 3 160 ? 53.000  101.429 50.800  1.00 13.16 ? 1152 LYS B O     1 
ATOM   5206 C  CB    . LYS F 3 160 ? 50.765  100.683 48.441  1.00 13.02 ? 1152 LYS B CB    1 
ATOM   5207 C  CG    . LYS F 3 160 ? 49.868  101.076 49.606  1.00 13.43 ? 1152 LYS B CG    1 
ATOM   5208 C  CD    . LYS F 3 160 ? 48.374  101.013 49.289  1.00 13.95 ? 1152 LYS B CD    1 
ATOM   5209 C  CE    . LYS F 3 160 ? 47.551  100.913 50.584  1.00 13.60 ? 1152 LYS B CE    1 
ATOM   5210 N  NZ    . LYS F 3 160 ? 46.244  101.620 50.480  1.00 13.83 ? 1152 LYS B NZ    1 
ATOM   5211 N  N     . ILE F 3 161 ? 53.336  99.491  49.721  1.00 13.15 ? 1153 ILE B N     1 
ATOM   5212 C  CA    . ILE F 3 161 ? 54.040  98.884  50.851  1.00 13.31 ? 1153 ILE B CA    1 
ATOM   5213 C  C     . ILE F 3 161 ? 55.141  99.821  51.356  1.00 13.74 ? 1153 ILE B C     1 
ATOM   5214 O  O     . ILE F 3 161 ? 55.267  100.041 52.556  1.00 13.95 ? 1153 ILE B O     1 
ATOM   5215 C  CB    . ILE F 3 161 ? 54.632  97.509  50.477  1.00 13.18 ? 1153 ILE B CB    1 
ATOM   5216 C  CG1   . ILE F 3 161 ? 53.522  96.461  50.360  1.00 13.26 ? 1153 ILE B CG1   1 
ATOM   5217 C  CG2   . ILE F 3 161 ? 55.655  97.054  51.517  1.00 12.77 ? 1153 ILE B CG2   1 
ATOM   5218 C  CD1   . ILE F 3 161 ? 53.906  95.243  49.532  1.00 13.21 ? 1153 ILE B CD1   1 
ATOM   5219 N  N     . ALA F 3 162 ? 55.925  100.370 50.429  1.00 14.07 ? 1154 ALA B N     1 
ATOM   5220 C  CA    . ALA F 3 162 ? 56.995  101.306 50.755  1.00 14.07 ? 1154 ALA B CA    1 
ATOM   5221 C  C     . ALA F 3 162 ? 56.484  102.472 51.585  1.00 14.16 ? 1154 ALA B C     1 
ATOM   5222 O  O     . ALA F 3 162 ? 57.132  102.879 52.536  1.00 14.15 ? 1154 ALA B O     1 
ATOM   5223 C  CB    . ALA F 3 162 ? 57.654  101.817 49.487  1.00 14.05 ? 1154 ALA B CB    1 
ATOM   5224 N  N     . ALA F 3 163 ? 55.326  103.010 51.225  1.00 14.48 ? 1155 ALA B N     1 
ATOM   5225 C  CA    . ALA F 3 163 ? 54.738  104.113 51.980  1.00 14.85 ? 1155 ALA B CA    1 
ATOM   5226 C  C     . ALA F 3 163 ? 54.288  103.690 53.384  1.00 15.33 ? 1155 ALA B C     1 
ATOM   5227 O  O     . ALA F 3 163 ? 54.422  104.463 54.325  1.00 15.64 ? 1155 ALA B O     1 
ATOM   5228 C  CB    . ALA F 3 163 ? 53.585  104.743 51.210  1.00 14.59 ? 1155 ALA B CB    1 
ATOM   5229 N  N     . ASP F 3 164 ? 53.771  102.470 53.531  1.00 15.86 ? 1156 ASP B N     1 
ATOM   5230 C  CA    . ASP F 3 164 ? 53.314  101.984 54.839  1.00 16.35 ? 1156 ASP B CA    1 
ATOM   5231 C  C     . ASP F 3 164 ? 54.463  101.854 55.838  1.00 16.21 ? 1156 ASP B C     1 
ATOM   5232 O  O     . ASP F 3 164 ? 54.251  101.959 57.044  1.00 15.92 ? 1156 ASP B O     1 
ATOM   5233 C  CB    . ASP F 3 164 ? 52.565  100.650 54.709  1.00 16.55 ? 1156 ASP B CB    1 
ATOM   5234 C  CG    . ASP F 3 164 ? 51.242  100.785 53.939  1.00 17.76 ? 1156 ASP B CG    1 
ATOM   5235 O  OD1   . ASP F 3 164 ? 50.838  101.924 53.593  1.00 18.00 ? 1156 ASP B OD1   1 
ATOM   5236 O  OD2   . ASP F 3 164 ? 50.540  99.795  53.628  1.00 19.52 ? 1156 ASP B OD2   1 
ATOM   5237 N  N     . MET F 3 165 ? 55.671  101.658 55.321  1.00 16.39 ? 1157 MET B N     1 
ATOM   5238 C  CA    . MET F 3 165 ? 56.876  101.572 56.137  1.00 16.70 ? 1157 MET B CA    1 
ATOM   5239 C  C     . MET F 3 165 ? 57.394  102.960 56.541  1.00 16.83 ? 1157 MET B C     1 
ATOM   5240 O  O     . MET F 3 165 ? 57.783  103.176 57.683  1.00 16.79 ? 1157 MET B O     1 
ATOM   5241 C  CB    . MET F 3 165 ? 57.965  100.815 55.373  1.00 16.66 ? 1157 MET B CB    1 
ATOM   5242 C  CG    . MET F 3 165 ? 57.595  99.384  55.003  1.00 16.93 ? 1157 MET B CG    1 
ATOM   5243 S  SD    . MET F 3 165 ? 58.949  98.508  54.157  1.00 18.35 ? 1157 MET B SD    1 
ATOM   5244 C  CE    . MET F 3 165 ? 58.360  96.805  54.201  1.00 17.74 ? 1157 MET B CE    1 
ATOM   5245 N  N     . ALA F 3 166 ? 57.385  103.900 55.604  1.00 17.20 ? 1158 ALA B N     1 
ATOM   5246 C  CA    . ALA F 3 166 ? 57.974  105.226 55.821  1.00 17.56 ? 1158 ALA B CA    1 
ATOM   5247 C  C     . ALA F 3 166 ? 57.038  106.224 56.498  1.00 18.08 ? 1158 ALA B C     1 
ATOM   5248 O  O     . ALA F 3 166 ? 57.424  107.378 56.710  1.00 17.57 ? 1158 ALA B O     1 
ATOM   5249 C  CB    . ALA F 3 166 ? 58.446  105.799 54.496  1.00 17.56 ? 1158 ALA B CB    1 
ATOM   5250 N  N     . LYS F 3 167 ? 55.817  105.782 56.824  1.00 18.94 ? 1159 LYS B N     1 
ATOM   5251 C  CA    . LYS F 3 167 ? 54.773  106.633 57.408  1.00 19.50 ? 1159 LYS B CA    1 
ATOM   5252 C  C     . LYS F 3 167 ? 55.287  107.584 58.506  1.00 19.62 ? 1159 LYS B C     1 
ATOM   5253 O  O     . LYS F 3 167 ? 56.387  107.411 59.021  1.00 20.14 ? 1159 LYS B O     1 
ATOM   5254 C  CB    . LYS F 3 167 ? 53.609  105.770 57.892  1.00 19.82 ? 1159 LYS B CB    1 
ATOM   5255 C  CG    . LYS F 3 167 ? 52.702  105.329 56.752  1.00 21.33 ? 1159 LYS B CG    1 
ATOM   5256 C  CD    . LYS F 3 167 ? 51.394  106.131 56.707  1.00 23.00 ? 1159 LYS B CD    1 
ATOM   5257 C  CE    . LYS F 3 167 ? 50.365  105.449 55.798  1.00 23.94 ? 1159 LYS B CE    1 
ATOM   5258 N  NZ    . LYS F 3 167 ? 49.811  104.158 56.361  1.00 23.31 ? 1159 LYS B NZ    1 
ATOM   5259 N  N     . PRO F 3 168 ? 54.411  108.426 59.022  1.00 19.26 ? 1160 PRO B N     1 
ATOM   5260 C  CA    . PRO F 3 168 ? 54.449  109.885 58.923  1.00 18.72 ? 1160 PRO B CA    1 
ATOM   5261 C  C     . PRO F 3 168 ? 55.600  110.516 58.153  1.00 18.29 ? 1160 PRO B C     1 
ATOM   5262 O  O     . PRO F 3 168 ? 56.768  110.235 58.413  1.00 18.35 ? 1160 PRO B O     1 
ATOM   5263 C  CB    . PRO F 3 168 ? 54.479  110.314 60.397  1.00 18.83 ? 1160 PRO B CB    1 
ATOM   5264 C  CG    . PRO F 3 168 ? 54.023  109.052 61.171  1.00 19.28 ? 1160 PRO B CG    1 
ATOM   5265 C  CD    . PRO F 3 168 ? 53.545  108.030 60.127  1.00 19.38 ? 1160 PRO B CD    1 
ATOM   5266 N  N     . ASN F 3 169 ? 55.251  111.371 57.197  1.00 17.81 ? 1161 ASN B N     1 
ATOM   5267 C  CA    . ASN F 3 169 ? 56.184  112.341 56.660  1.00 17.39 ? 1161 ASN B CA    1 
ATOM   5268 C  C     . ASN F 3 169 ? 57.406  111.623 56.087  1.00 17.04 ? 1161 ASN B C     1 
ATOM   5269 O  O     . ASN F 3 169 ? 58.543  111.910 56.457  1.00 16.94 ? 1161 ASN B O     1 
ATOM   5270 C  CB    . ASN F 3 169 ? 56.563  113.307 57.794  1.00 17.31 ? 1161 ASN B CB    1 
ATOM   5271 C  CG    . ASN F 3 169 ? 57.207  114.588 57.304  1.00 17.63 ? 1161 ASN B CG    1 
ATOM   5272 O  OD1   . ASN F 3 169 ? 57.055  114.990 56.147  1.00 18.71 ? 1161 ASN B OD1   1 
ATOM   5273 N  ND2   . ASN F 3 169 ? 57.934  115.245 58.198  1.00 17.44 ? 1161 ASN B ND2   1 
ATOM   5274 N  N     . GLY F 3 170 ? 57.152  110.682 55.177  1.00 16.60 ? 1162 GLY B N     1 
ATOM   5275 C  CA    . GLY F 3 170 ? 58.166  109.728 54.751  1.00 16.19 ? 1162 GLY B CA    1 
ATOM   5276 C  C     . GLY F 3 170 ? 58.531  109.726 53.283  1.00 15.79 ? 1162 GLY B C     1 
ATOM   5277 O  O     . GLY F 3 170 ? 57.933  110.422 52.461  1.00 15.65 ? 1162 GLY B O     1 
ATOM   5278 N  N     . ILE F 3 171 ? 59.546  108.927 52.977  1.00 15.42 ? 1163 ILE B N     1 
ATOM   5279 C  CA    . ILE F 3 171 ? 59.972  108.662 51.600  1.00 15.22 ? 1163 ILE B CA    1 
ATOM   5280 C  C     . ILE F 3 171 ? 60.841  107.394 51.600  1.00 14.97 ? 1163 ILE B C     1 
ATOM   5281 O  O     . ILE F 3 171 ? 61.829  107.316 52.333  1.00 14.99 ? 1163 ILE B O     1 
ATOM   5282 C  CB    . ILE F 3 171 ? 60.718  109.895 50.983  1.00 15.15 ? 1163 ILE B CB    1 
ATOM   5283 C  CG1   . ILE F 3 171 ? 61.313  109.564 49.611  1.00 15.04 ? 1163 ILE B CG1   1 
ATOM   5284 C  CG2   . ILE F 3 171 ? 61.826  110.410 51.903  1.00 15.01 ? 1163 ILE B CG2   1 
ATOM   5285 C  CD1   . ILE F 3 171 ? 60.308  109.371 48.535  1.00 15.22 ? 1163 ILE B CD1   1 
ATOM   5286 N  N     . LYS F 3 172 ? 60.461  106.403 50.794  1.00 14.67 ? 1164 LYS B N     1 
ATOM   5287 C  CA    . LYS F 3 172 ? 61.153  105.118 50.774  1.00 14.74 ? 1164 LYS B CA    1 
ATOM   5288 C  C     . LYS F 3 172 ? 61.164  104.486 49.384  1.00 14.65 ? 1164 LYS B C     1 
ATOM   5289 O  O     . LYS F 3 172 ? 60.210  104.611 48.620  1.00 14.42 ? 1164 LYS B O     1 
ATOM   5290 C  CB    . LYS F 3 172 ? 60.521  104.150 51.781  1.00 14.85 ? 1164 LYS B CB    1 
ATOM   5291 C  CG    . LYS F 3 172 ? 61.337  102.882 52.066  1.00 15.35 ? 1164 LYS B CG    1 
ATOM   5292 C  CD    . LYS F 3 172 ? 61.297  102.509 53.561  1.00 16.35 ? 1164 LYS B CD    1 
ATOM   5293 C  CE    . LYS F 3 172 ? 62.007  101.181 53.870  1.00 16.09 ? 1164 LYS B CE    1 
ATOM   5294 N  NZ    . LYS F 3 172 ? 63.489  101.285 53.772  1.00 16.37 ? 1164 LYS B NZ    1 
ATOM   5295 N  N     . VAL F 3 173 ? 62.269  103.816 49.077  1.00 14.60 ? 1165 VAL B N     1 
ATOM   5296 C  CA    . VAL F 3 173 ? 62.446  103.098 47.827  1.00 14.50 ? 1165 VAL B CA    1 
ATOM   5297 C  C     . VAL F 3 173 ? 62.546  101.612 48.175  1.00 14.49 ? 1165 VAL B C     1 
ATOM   5298 O  O     . VAL F 3 173 ? 63.216  101.252 49.143  1.00 14.60 ? 1165 VAL B O     1 
ATOM   5299 C  CB    . VAL F 3 173 ? 63.731  103.605 47.101  1.00 14.60 ? 1165 VAL B CB    1 
ATOM   5300 C  CG1   . VAL F 3 173 ? 64.470  102.483 46.346  1.00 14.48 ? 1165 VAL B CG1   1 
ATOM   5301 C  CG2   . VAL F 3 173 ? 63.397  104.753 46.163  1.00 14.32 ? 1165 VAL B CG2   1 
ATOM   5302 N  N     . ILE F 3 174 ? 61.867  100.764 47.403  1.00 14.58 ? 1166 ILE B N     1 
ATOM   5303 C  CA    . ILE F 3 174 ? 62.001  99.303  47.511  1.00 14.76 ? 1166 ILE B CA    1 
ATOM   5304 C  C     . ILE F 3 174 ? 62.494  98.764  46.166  1.00 14.93 ? 1166 ILE B C     1 
ATOM   5305 O  O     . ILE F 3 174 ? 61.688  98.448  45.300  1.00 14.83 ? 1166 ILE B O     1 
ATOM   5306 C  CB    . ILE F 3 174 ? 60.642  98.654  47.928  1.00 14.59 ? 1166 ILE B CB    1 
ATOM   5307 C  CG1   . ILE F 3 174 ? 60.296  99.050  49.366  1.00 14.40 ? 1166 ILE B CG1   1 
ATOM   5308 C  CG2   . ILE F 3 174 ? 60.686  97.131  47.821  1.00 14.36 ? 1166 ILE B CG2   1 
ATOM   5309 C  CD1   . ILE F 3 174 ? 58.953  98.547  49.863  1.00 14.18 ? 1166 ILE B CD1   1 
ATOM   5310 N  N     . ASP F 3 175 ? 63.814  98.682  45.988  1.00 15.42 ? 1167 ASP B N     1 
ATOM   5311 C  CA    . ASP F 3 175 ? 64.399  98.288  44.689  1.00 15.95 ? 1167 ASP B CA    1 
ATOM   5312 C  C     . ASP F 3 175 ? 64.095  96.832  44.326  1.00 16.18 ? 1167 ASP B C     1 
ATOM   5313 O  O     . ASP F 3 175 ? 63.536  96.102  45.133  1.00 16.05 ? 1167 ASP B O     1 
ATOM   5314 C  CB    . ASP F 3 175 ? 65.918  98.605  44.607  1.00 16.02 ? 1167 ASP B CB    1 
ATOM   5315 C  CG    . ASP F 3 175 ? 66.800  97.694  45.482  1.00 16.27 ? 1167 ASP B CG    1 
ATOM   5316 O  OD1   . ASP F 3 175 ? 66.318  97.113  46.475  1.00 16.17 ? 1167 ASP B OD1   1 
ATOM   5317 O  OD2   . ASP F 3 175 ? 68.022  97.523  45.246  1.00 16.99 ? 1167 ASP B OD2   1 
ATOM   5318 N  N     . ASP F 3 176 ? 64.447  96.423  43.108  1.00 16.60 ? 1168 ASP B N     1 
ATOM   5319 C  CA    . ASP F 3 176 ? 64.187  95.049  42.639  1.00 16.88 ? 1168 ASP B CA    1 
ATOM   5320 C  C     . ASP F 3 176 ? 64.644  93.967  43.650  1.00 17.07 ? 1168 ASP B C     1 
ATOM   5321 O  O     . ASP F 3 176 ? 63.986  92.930  43.808  1.00 16.72 ? 1168 ASP B O     1 
ATOM   5322 C  CB    . ASP F 3 176 ? 64.854  94.813  41.273  1.00 16.88 ? 1168 ASP B CB    1 
ATOM   5323 C  CG    . ASP F 3 176 ? 64.064  95.412  40.114  1.00 16.94 ? 1168 ASP B CG    1 
ATOM   5324 O  OD1   . ASP F 3 176 ? 63.465  96.492  40.287  1.00 16.77 ? 1168 ASP B OD1   1 
ATOM   5325 O  OD2   . ASP F 3 176 ? 63.998  94.877  38.984  1.00 17.40 ? 1168 ASP B OD2   1 
ATOM   5326 N  N     . GLU F 3 177 ? 65.758  94.233  44.334  1.00 17.39 ? 1169 GLU B N     1 
ATOM   5327 C  CA    . GLU F 3 177 ? 66.334  93.303  45.312  1.00 17.62 ? 1169 GLU B CA    1 
ATOM   5328 C  C     . GLU F 3 177 ? 65.531  93.174  46.609  1.00 17.49 ? 1169 GLU B C     1 
ATOM   5329 O  O     . GLU F 3 177 ? 65.352  92.063  47.110  1.00 17.59 ? 1169 GLU B O     1 
ATOM   5330 C  CB    . GLU F 3 177 ? 67.781  93.699  45.648  1.00 17.76 ? 1169 GLU B CB    1 
ATOM   5331 C  CG    . GLU F 3 177 ? 68.809  93.286  44.606  1.00 18.24 ? 1169 GLU B CG    1 
ATOM   5332 C  CD    . GLU F 3 177 ? 69.067  91.789  44.599  1.00 19.11 ? 1169 GLU B CD    1 
ATOM   5333 O  OE1   . GLU F 3 177 ? 70.200  91.364  44.930  1.00 19.41 ? 1169 GLU B OE1   1 
ATOM   5334 O  OE2   . GLU F 3 177 ? 68.130  91.034  44.256  1.00 20.09 ? 1169 GLU B OE2   1 
ATOM   5335 N  N     . GLU F 3 178 ? 65.073  94.299  47.159  1.00 17.37 ? 1170 GLU B N     1 
ATOM   5336 C  CA    . GLU F 3 178 ? 64.261  94.285  48.387  1.00 17.36 ? 1170 GLU B CA    1 
ATOM   5337 C  C     . GLU F 3 178 ? 62.815  93.833  48.132  1.00 17.03 ? 1170 GLU B C     1 
ATOM   5338 O  O     . GLU F 3 178 ? 62.122  93.438  49.063  1.00 17.04 ? 1170 GLU B O     1 
ATOM   5339 C  CB    . GLU F 3 178 ? 64.277  95.647  49.100  1.00 17.42 ? 1170 GLU B CB    1 
ATOM   5340 C  CG    . GLU F 3 178 ? 63.981  95.556  50.595  1.00 18.23 ? 1170 GLU B CG    1 
ATOM   5341 C  CD    . GLU F 3 178 ? 64.134  96.884  51.320  1.00 19.62 ? 1170 GLU B CD    1 
ATOM   5342 O  OE1   . GLU F 3 178 ? 65.221  97.493  51.211  1.00 20.41 ? 1170 GLU B OE1   1 
ATOM   5343 O  OE2   . GLU F 3 178 ? 63.173  97.318  52.005  1.00 19.90 ? 1170 GLU B OE2   1 
ATOM   5344 N  N     . VAL F 3 179 ? 62.372  93.880  46.879  1.00 16.73 ? 1171 VAL B N     1 
ATOM   5345 C  CA    . VAL F 3 179 ? 61.116  93.259  46.487  1.00 16.58 ? 1171 VAL B CA    1 
ATOM   5346 C  C     . VAL F 3 179 ? 61.238  91.749  46.692  1.00 16.77 ? 1171 VAL B C     1 
ATOM   5347 O  O     . VAL F 3 179 ? 60.389  91.140  47.347  1.00 16.66 ? 1171 VAL B O     1 
ATOM   5348 C  CB    . VAL F 3 179 ? 60.750  93.566  45.010  1.00 16.51 ? 1171 VAL B CB    1 
ATOM   5349 C  CG1   . VAL F 3 179 ? 59.599  92.679  44.526  1.00 16.41 ? 1171 VAL B CG1   1 
ATOM   5350 C  CG2   . VAL F 3 179 ? 60.386  95.031  44.842  1.00 16.14 ? 1171 VAL B CG2   1 
ATOM   5351 N  N     . LYS F 3 180 ? 62.306  91.158  46.147  1.00 16.91 ? 1172 LYS B N     1 
ATOM   5352 C  CA    . LYS F 3 180 ? 62.518  89.706  46.222  1.00 16.88 ? 1172 LYS B CA    1 
ATOM   5353 C  C     . LYS F 3 180 ? 62.643  89.215  47.663  1.00 16.83 ? 1172 LYS B C     1 
ATOM   5354 O  O     . LYS F 3 180 ? 62.223  88.099  47.978  1.00 16.91 ? 1172 LYS B O     1 
ATOM   5355 C  CB    . LYS F 3 180 ? 63.747  89.283  45.407  1.00 17.01 ? 1172 LYS B CB    1 
ATOM   5356 C  CG    . LYS F 3 180 ? 63.534  89.297  43.882  1.00 17.45 ? 1172 LYS B CG    1 
ATOM   5357 C  CD    . LYS F 3 180 ? 62.528  88.230  43.409  1.00 17.80 ? 1172 LYS B CD    1 
ATOM   5358 C  CE    . LYS F 3 180 ? 62.971  87.554  42.107  1.00 18.01 ? 1172 LYS B CE    1 
ATOM   5359 N  NZ    . LYS F 3 180 ? 61.942  86.622  41.560  1.00 17.91 ? 1172 LYS B NZ    1 
ATOM   5360 N  N     . ARG F 3 181 ? 63.201  90.057  48.531  1.00 16.76 ? 1173 ARG B N     1 
ATOM   5361 C  CA    . ARG F 3 181 ? 63.363  89.731  49.949  1.00 16.75 ? 1173 ARG B CA    1 
ATOM   5362 C  C     . ARG F 3 181 ? 62.038  89.824  50.715  1.00 16.52 ? 1173 ARG B C     1 
ATOM   5363 O  O     . ARG F 3 181 ? 61.781  89.010  51.596  1.00 16.35 ? 1173 ARG B O     1 
ATOM   5364 C  CB    . ARG F 3 181 ? 64.402  90.658  50.594  1.00 16.83 ? 1173 ARG B CB    1 
ATOM   5365 C  CG    . ARG F 3 181 ? 64.736  90.331  52.048  1.00 17.21 ? 1173 ARG B CG    1 
ATOM   5366 C  CD    . ARG F 3 181 ? 65.631  91.359  52.719  1.00 17.90 ? 1173 ARG B CD    1 
ATOM   5367 N  NE    . ARG F 3 181 ? 64.903  92.581  53.060  1.00 19.00 ? 1173 ARG B NE    1 
ATOM   5368 C  CZ    . ARG F 3 181 ? 64.066  92.717  54.093  1.00 19.98 ? 1173 ARG B CZ    1 
ATOM   5369 N  NH1   . ARG F 3 181 ? 63.827  91.703  54.919  1.00 20.39 ? 1173 ARG B NH1   1 
ATOM   5370 N  NH2   . ARG F 3 181 ? 63.457  93.883  54.302  1.00 20.27 ? 1173 ARG B NH2   1 
ATOM   5371 N  N     . LEU F 3 182 ? 61.218  90.823  50.390  1.00 16.24 ? 1174 LEU B N     1 
ATOM   5372 C  CA    . LEU F 3 182 ? 59.924  91.018  51.054  1.00 15.98 ? 1174 LEU B CA    1 
ATOM   5373 C  C     . LEU F 3 182 ? 58.901  89.986  50.598  1.00 15.81 ? 1174 LEU B C     1 
ATOM   5374 O  O     . LEU F 3 182 ? 57.913  89.752  51.280  1.00 15.59 ? 1174 LEU B O     1 
ATOM   5375 C  CB    . LEU F 3 182 ? 59.370  92.421  50.779  1.00 15.91 ? 1174 LEU B CB    1 
ATOM   5376 C  CG    . LEU F 3 182 ? 60.106  93.602  51.409  1.00 15.73 ? 1174 LEU B CG    1 
ATOM   5377 C  CD1   . LEU F 3 182 ? 59.487  94.903  50.923  1.00 15.84 ? 1174 LEU B CD1   1 
ATOM   5378 C  CD2   . LEU F 3 182 ? 60.099  93.528  52.927  1.00 15.56 ? 1174 LEU B CD2   1 
ATOM   5379 N  N     . ILE F 3 183 ? 59.134  89.400  49.428  1.00 15.82 ? 1175 ILE B N     1 
ATOM   5380 C  CA    . ILE F 3 183 ? 58.335  88.285  48.943  1.00 15.93 ? 1175 ILE B CA    1 
ATOM   5381 C  C     . ILE F 3 183 ? 58.514  87.102  49.887  1.00 16.01 ? 1175 ILE B C     1 
ATOM   5382 O  O     . ILE F 3 183 ? 57.607  86.292  50.047  1.00 16.19 ? 1175 ILE B O     1 
ATOM   5383 C  CB    . ILE F 3 183 ? 58.745  87.925  47.492  1.00 15.94 ? 1175 ILE B CB    1 
ATOM   5384 C  CG1   . ILE F 3 183 ? 58.054  88.882  46.516  1.00 16.42 ? 1175 ILE B CG1   1 
ATOM   5385 C  CG2   . ILE F 3 183 ? 58.401  86.477  47.149  1.00 15.71 ? 1175 ILE B CG2   1 
ATOM   5386 C  CD1   . ILE F 3 183 ? 58.673  88.921  45.124  1.00 16.61 ? 1175 ILE B CD1   1 
ATOM   5387 N  N     . ARG F 3 184 ? 59.681  87.027  50.519  1.00 16.09 ? 1176 ARG B N     1 
ATOM   5388 C  CA    . ARG F 3 184 ? 60.001  85.966  51.473  1.00 16.21 ? 1176 ARG B CA    1 
ATOM   5389 C  C     . ARG F 3 184 ? 59.732  86.330  52.939  1.00 16.16 ? 1176 ARG B C     1 
ATOM   5390 O  O     . ARG F 3 184 ? 59.376  85.455  53.727  1.00 16.09 ? 1176 ARG B O     1 
ATOM   5391 C  CB    . ARG F 3 184 ? 61.474  85.553  51.318  1.00 16.25 ? 1176 ARG B CB    1 
ATOM   5392 C  CG    . ARG F 3 184 ? 61.681  84.118  50.860  1.00 16.90 ? 1176 ARG B CG    1 
ATOM   5393 C  CD    . ARG F 3 184 ? 63.154  83.702  50.726  1.00 18.17 ? 1176 ARG B CD    1 
ATOM   5394 N  NE    . ARG F 3 184 ? 63.828  84.382  49.612  1.00 18.61 ? 1176 ARG B NE    1 
ATOM   5395 C  CZ    . ARG F 3 184 ? 64.490  85.539  49.694  1.00 18.36 ? 1176 ARG B CZ    1 
ATOM   5396 N  NH1   . ARG F 3 184 ? 64.601  86.194  50.846  1.00 18.68 ? 1176 ARG B NH1   1 
ATOM   5397 N  NH2   . ARG F 3 184 ? 65.049  86.050  48.604  1.00 18.36 ? 1176 ARG B NH2   1 
ATOM   5398 N  N     . GLU F 3 185 ? 59.884  87.601  53.308  1.00 16.23 ? 1177 GLU B N     1 
ATOM   5399 C  CA    . GLU F 3 185 ? 59.979  87.967  54.726  1.00 16.51 ? 1177 GLU B CA    1 
ATOM   5400 C  C     . GLU F 3 185 ? 58.872  88.882  55.281  1.00 16.73 ? 1177 GLU B C     1 
ATOM   5401 O  O     . GLU F 3 185 ? 58.748  89.025  56.499  1.00 16.86 ? 1177 GLU B O     1 
ATOM   5402 C  CB    . GLU F 3 185 ? 61.373  88.542  55.017  1.00 16.52 ? 1177 GLU B CB    1 
ATOM   5403 C  CG    . GLU F 3 185 ? 62.500  87.578  54.613  1.00 17.04 ? 1177 GLU B CG    1 
ATOM   5404 C  CD    . GLU F 3 185 ? 63.811  87.764  55.378  1.00 17.73 ? 1177 GLU B CD    1 
ATOM   5405 O  OE1   . GLU F 3 185 ? 63.943  88.727  56.164  1.00 18.34 ? 1177 GLU B OE1   1 
ATOM   5406 O  OE2   . GLU F 3 185 ? 64.733  86.937  55.186  1.00 18.35 ? 1177 GLU B OE2   1 
ATOM   5407 N  N     . LEU F 3 186 ? 58.056  89.477  54.414  1.00 16.99 ? 1178 LEU B N     1 
ATOM   5408 C  CA    . LEU F 3 186 ? 56.978  90.374  54.857  1.00 17.06 ? 1178 LEU B CA    1 
ATOM   5409 C  C     . LEU F 3 186 ? 55.732  89.625  55.351  1.00 16.86 ? 1178 LEU B C     1 
ATOM   5410 O  O     . LEU F 3 186 ? 55.176  88.786  54.641  1.00 16.53 ? 1178 LEU B O     1 
ATOM   5411 C  CB    . LEU F 3 186 ? 56.578  91.336  53.731  1.00 17.09 ? 1178 LEU B CB    1 
ATOM   5412 C  CG    . LEU F 3 186 ? 55.692  92.519  54.147  1.00 17.90 ? 1178 LEU B CG    1 
ATOM   5413 C  CD1   . LEU F 3 186 ? 56.466  93.515  55.018  1.00 18.16 ? 1178 LEU B CD1   1 
ATOM   5414 C  CD2   . LEU F 3 186 ? 55.086  93.232  52.926  1.00 18.23 ? 1178 LEU B CD2   1 
ATOM   5415 N  N     . ASP F 3 187 ? 55.316  89.940  56.578  1.00 16.91 ? 1179 ASP B N     1 
ATOM   5416 C  CA    . ASP F 3 187 ? 54.007  89.543  57.113  1.00 17.04 ? 1179 ASP B CA    1 
ATOM   5417 C  C     . ASP F 3 187 ? 52.956  89.741  56.024  1.00 16.77 ? 1179 ASP B C     1 
ATOM   5418 O  O     . ASP F 3 187 ? 52.870  90.825  55.437  1.00 16.79 ? 1179 ASP B O     1 
ATOM   5419 C  CB    . ASP F 3 187 ? 53.638  90.426  58.330  1.00 17.45 ? 1179 ASP B CB    1 
ATOM   5420 C  CG    . ASP F 3 187 ? 53.033  89.640  59.493  1.00 18.00 ? 1179 ASP B CG    1 
ATOM   5421 O  OD1   . ASP F 3 187 ? 51.900  89.109  59.353  1.00 18.09 ? 1179 ASP B OD1   1 
ATOM   5422 O  OD2   . ASP F 3 187 ? 53.624  89.534  60.596  1.00 18.65 ? 1179 ASP B OD2   1 
ATOM   5423 N  N     . ILE F 3 188 ? 52.144  88.721  55.763  1.00 16.39 ? 1180 ILE B N     1 
ATOM   5424 C  CA    . ILE F 3 188 ? 51.190  88.791  54.657  1.00 16.12 ? 1180 ILE B CA    1 
ATOM   5425 C  C     . ILE F 3 188 ? 49.968  89.643  54.984  1.00 15.78 ? 1180 ILE B C     1 
ATOM   5426 O  O     . ILE F 3 188 ? 49.210  89.970  54.085  1.00 15.64 ? 1180 ILE B O     1 
ATOM   5427 C  CB    . ILE F 3 188 ? 50.768  87.386  54.182  1.00 16.21 ? 1180 ILE B CB    1 
ATOM   5428 C  CG1   . ILE F 3 188 ? 50.154  87.467  52.779  1.00 16.16 ? 1180 ILE B CG1   1 
ATOM   5429 C  CG2   . ILE F 3 188 ? 49.804  86.726  55.173  1.00 16.46 ? 1180 ILE B CG2   1 
ATOM   5430 C  CD1   . ILE F 3 188 ? 50.429  86.244  51.935  1.00 16.66 ? 1180 ILE B CD1   1 
ATOM   5431 N  N     . ALA F 3 189 ? 49.790  90.003  56.257  1.00 15.49 ? 1181 ALA B N     1 
ATOM   5432 C  CA    . ALA F 3 189 ? 48.762  90.970  56.662  1.00 15.30 ? 1181 ALA B CA    1 
ATOM   5433 C  C     . ALA F 3 189 ? 49.092  92.407  56.249  1.00 15.24 ? 1181 ALA B C     1 
ATOM   5434 O  O     . ALA F 3 189 ? 48.211  93.276  56.249  1.00 15.16 ? 1181 ALA B O     1 
ATOM   5435 C  CB    . ALA F 3 189 ? 48.551  90.910  58.152  1.00 15.22 ? 1181 ALA B CB    1 
ATOM   5436 N  N     . ASP F 3 190 ? 50.363  92.648  55.921  1.00 15.24 ? 1182 ASP B N     1 
ATOM   5437 C  CA    . ASP F 3 190 ? 50.850  93.972  55.527  1.00 15.16 ? 1182 ASP B CA    1 
ATOM   5438 C  C     . ASP F 3 190 ? 50.836  94.159  54.014  1.00 14.87 ? 1182 ASP B C     1 
ATOM   5439 O  O     . ASP F 3 190 ? 51.270  95.186  53.522  1.00 15.08 ? 1182 ASP B O     1 
ATOM   5440 C  CB    . ASP F 3 190 ? 52.272  94.204  56.058  1.00 15.32 ? 1182 ASP B CB    1 
ATOM   5441 C  CG    . ASP F 3 190 ? 52.348  94.171  57.585  1.00 16.19 ? 1182 ASP B CG    1 
ATOM   5442 O  OD1   . ASP F 3 190 ? 51.392  94.635  58.249  1.00 17.20 ? 1182 ASP B OD1   1 
ATOM   5443 O  OD2   . ASP F 3 190 ? 53.327  93.699  58.208  1.00 16.64 ? 1182 ASP B OD2   1 
ATOM   5444 N  N     . VAL F 3 191 ? 50.347  93.168  53.276  1.00 14.57 ? 1183 VAL B N     1 
ATOM   5445 C  CA    . VAL F 3 191 ? 50.107  93.327  51.853  1.00 14.28 ? 1183 VAL B CA    1 
ATOM   5446 C  C     . VAL F 3 191 ? 48.855  94.196  51.689  1.00 14.48 ? 1183 VAL B C     1 
ATOM   5447 O  O     . VAL F 3 191 ? 47.861  93.961  52.366  1.00 14.53 ? 1183 VAL B O     1 
ATOM   5448 C  CB    . VAL F 3 191 ? 49.889  91.969  51.180  1.00 14.18 ? 1183 VAL B CB    1 
ATOM   5449 C  CG1   . VAL F 3 191 ? 49.487  92.140  49.734  1.00 14.03 ? 1183 VAL B CG1   1 
ATOM   5450 C  CG2   . VAL F 3 191 ? 51.150  91.120  51.275  1.00 14.34 ? 1183 VAL B CG2   1 
ATOM   5451 N  N     . PRO F 3 192 ? 48.910  95.229  50.847  1.00 14.68 ? 1184 PRO B N     1 
ATOM   5452 C  CA    . PRO F 3 192 ? 47.711  95.994  50.488  1.00 14.80 ? 1184 PRO B CA    1 
ATOM   5453 C  C     . PRO F 3 192 ? 46.563  95.123  49.999  1.00 14.98 ? 1184 PRO B C     1 
ATOM   5454 O  O     . PRO F 3 192 ? 46.759  94.248  49.157  1.00 14.73 ? 1184 PRO B O     1 
ATOM   5455 C  CB    . PRO F 3 192 ? 48.206  96.910  49.368  1.00 14.92 ? 1184 PRO B CB    1 
ATOM   5456 C  CG    . PRO F 3 192 ? 49.666  97.079  49.632  1.00 14.65 ? 1184 PRO B CG    1 
ATOM   5457 C  CD    . PRO F 3 192 ? 50.122  95.797  50.229  1.00 14.69 ? 1184 PRO B CD    1 
ATOM   5458 N  N     . GLY F 3 193 ? 45.377  95.358  50.553  1.00 15.42 ? 1185 GLY B N     1 
ATOM   5459 C  CA    . GLY F 3 193 ? 44.179  94.622  50.176  1.00 15.74 ? 1185 GLY B CA    1 
ATOM   5460 C  C     . GLY F 3 193 ? 43.863  93.460  51.104  1.00 15.88 ? 1185 GLY B C     1 
ATOM   5461 O  O     . GLY F 3 193 ? 42.772  92.897  51.050  1.00 15.87 ? 1185 GLY B O     1 
ATOM   5462 N  N     . ILE F 3 194 ? 44.823  93.096  51.944  1.00 16.30 ? 1186 ILE B N     1 
ATOM   5463 C  CA    . ILE F 3 194 ? 44.619  92.099  52.986  1.00 16.66 ? 1186 ILE B CA    1 
ATOM   5464 C  C     . ILE F 3 194 ? 44.351  92.866  54.273  1.00 17.40 ? 1186 ILE B C     1 
ATOM   5465 O  O     . ILE F 3 194 ? 45.175  93.689  54.699  1.00 17.86 ? 1186 ILE B O     1 
ATOM   5466 C  CB    . ILE F 3 194 ? 45.867  91.212  53.171  1.00 16.44 ? 1186 ILE B CB    1 
ATOM   5467 C  CG1   . ILE F 3 194 ? 46.474  90.782  51.825  1.00 15.72 ? 1186 ILE B CG1   1 
ATOM   5468 C  CG2   . ILE F 3 194 ? 45.517  90.005  54.013  1.00 16.53 ? 1186 ILE B CG2   1 
ATOM   5469 C  CD1   . ILE F 3 194 ? 45.508  90.124  50.862  1.00 15.71 ? 1186 ILE B CD1   1 
ATOM   5470 N  N     . GLY F 3 195 ? 43.203  92.592  54.884  1.00 17.88 ? 1187 GLY B N     1 
ATOM   5471 C  CA    . GLY F 3 195 ? 42.789  93.252  56.105  1.00 18.34 ? 1187 GLY B CA    1 
ATOM   5472 C  C     . GLY F 3 195 ? 42.827  92.320  57.298  1.00 19.05 ? 1187 GLY B C     1 
ATOM   5473 O  O     . GLY F 3 195 ? 43.462  91.255  57.245  1.00 19.28 ? 1187 GLY B O     1 
ATOM   5474 N  N     . ASN F 3 196 ? 42.144  92.726  58.377  1.00 19.58 ? 1188 ASN B N     1 
ATOM   5475 C  CA    . ASN F 3 196 ? 42.088  91.947  59.615  1.00 19.62 ? 1188 ASN B CA    1 
ATOM   5476 C  C     . ASN F 3 196 ? 41.650  90.510  59.327  1.00 19.42 ? 1188 ASN B C     1 
ATOM   5477 O  O     . ASN F 3 196 ? 42.340  89.563  59.674  1.00 19.67 ? 1188 ASN B O     1 
ATOM   5478 C  CB    . ASN F 3 196 ? 41.100  92.563  60.620  1.00 20.03 ? 1188 ASN B CB    1 
ATOM   5479 C  CG    . ASN F 3 196 ? 41.475  93.988  61.053  1.00 21.31 ? 1188 ASN B CG    1 
ATOM   5480 O  OD1   . ASN F 3 196 ? 40.787  94.955  60.692  1.00 22.19 ? 1188 ASN B OD1   1 
ATOM   5481 N  ND2   . ASN F 3 196 ? 42.541  94.119  61.858  1.00 21.66 ? 1188 ASN B ND2   1 
ATOM   5482 N  N     . ILE F 3 197 ? 40.508  90.371  58.658  1.00 19.11 ? 1189 ILE B N     1 
ATOM   5483 C  CA    . ILE F 3 197 ? 39.821  89.081  58.517  1.00 18.78 ? 1189 ILE B CA    1 
ATOM   5484 C  C     . ILE F 3 197 ? 40.526  88.106  57.560  1.00 18.52 ? 1189 ILE B C     1 
ATOM   5485 O  O     . ILE F 3 197 ? 40.640  86.911  57.864  1.00 18.69 ? 1189 ILE B O     1 
ATOM   5486 C  CB    . ILE F 3 197 ? 38.332  89.315  58.085  1.00 18.79 ? 1189 ILE B CB    1 
ATOM   5487 C  CG1   . ILE F 3 197 ? 37.557  90.047  59.200  1.00 18.94 ? 1189 ILE B CG1   1 
ATOM   5488 C  CG2   . ILE F 3 197 ? 37.647  87.994  57.717  1.00 18.44 ? 1189 ILE B CG2   1 
ATOM   5489 C  CD1   . ILE F 3 197 ? 36.213  90.651  58.769  1.00 18.50 ? 1189 ILE B CD1   1 
ATOM   5490 N  N     . THR F 3 198 ? 40.987  88.613  56.415  1.00 18.13 ? 1190 THR B N     1 
ATOM   5491 C  CA    . THR F 3 198 ? 41.686  87.798  55.415  1.00 17.75 ? 1190 THR B CA    1 
ATOM   5492 C  C     . THR F 3 198 ? 43.028  87.313  55.953  1.00 17.79 ? 1190 THR B C     1 
ATOM   5493 O  O     . THR F 3 198 ? 43.501  86.236  55.584  1.00 17.53 ? 1190 THR B O     1 
ATOM   5494 C  CB    . THR F 3 198 ? 41.918  88.592  54.110  1.00 17.64 ? 1190 THR B CB    1 
ATOM   5495 O  OG1   . THR F 3 198 ? 40.668  89.045  53.572  1.00 17.28 ? 1190 THR B OG1   1 
ATOM   5496 C  CG2   . THR F 3 198 ? 42.492  87.696  53.010  1.00 17.45 ? 1190 THR B CG2   1 
ATOM   5497 N  N     . ALA F 3 199 ? 43.637  88.121  56.820  1.00 17.89 ? 1191 ALA B N     1 
ATOM   5498 C  CA    . ALA F 3 199 ? 44.894  87.762  57.470  1.00 17.90 ? 1191 ALA B CA    1 
ATOM   5499 C  C     . ALA F 3 199 ? 44.716  86.611  58.450  1.00 17.91 ? 1191 ALA B C     1 
ATOM   5500 O  O     . ALA F 3 199 ? 45.590  85.759  58.538  1.00 17.96 ? 1191 ALA B O     1 
ATOM   5501 C  CB    . ALA F 3 199 ? 45.485  88.963  58.173  1.00 18.06 ? 1191 ALA B CB    1 
ATOM   5502 N  N     . GLU F 3 200 ? 43.591  86.583  59.171  1.00 18.11 ? 1192 GLU B N     1 
ATOM   5503 C  CA    . GLU F 3 200 ? 43.275  85.480  60.103  1.00 18.43 ? 1192 GLU B CA    1 
ATOM   5504 C  C     . GLU F 3 200 ? 43.055  84.163  59.372  1.00 18.18 ? 1192 GLU B C     1 
ATOM   5505 O  O     . GLU F 3 200 ? 43.413  83.111  59.878  1.00 18.03 ? 1192 GLU B O     1 
ATOM   5506 C  CB    . GLU F 3 200 ? 42.009  85.765  60.932  1.00 18.66 ? 1192 GLU B CB    1 
ATOM   5507 C  CG    . GLU F 3 200 ? 42.012  87.053  61.748  1.00 19.72 ? 1192 GLU B CG    1 
ATOM   5508 C  CD    . GLU F 3 200 ? 43.223  87.184  62.653  1.00 21.25 ? 1192 GLU B CD    1 
ATOM   5509 O  OE1   . GLU F 3 200 ? 43.325  86.410  63.634  1.00 22.06 ? 1192 GLU B OE1   1 
ATOM   5510 O  OE2   . GLU F 3 200 ? 44.077  88.060  62.378  1.00 22.44 ? 1192 GLU B OE2   1 
ATOM   5511 N  N     . LYS F 3 201 ? 42.429  84.237  58.199  1.00 18.23 ? 1193 LYS B N     1 
ATOM   5512 C  CA    . LYS F 3 201 ? 42.168  83.062  57.370  1.00 18.24 ? 1193 LYS B CA    1 
ATOM   5513 C  C     . LYS F 3 201 ? 43.486  82.492  56.879  1.00 18.13 ? 1193 LYS B C     1 
ATOM   5514 O  O     . LYS F 3 201 ? 43.697  81.280  56.902  1.00 18.07 ? 1193 LYS B O     1 
ATOM   5515 C  CB    . LYS F 3 201 ? 41.288  83.429  56.161  1.00 18.32 ? 1193 LYS B CB    1 
ATOM   5516 C  CG    . LYS F 3 201 ? 39.830  83.761  56.491  1.00 18.38 ? 1193 LYS B CG    1 
ATOM   5517 C  CD    . LYS F 3 201 ? 39.090  84.244  55.247  1.00 19.01 ? 1193 LYS B CD    1 
ATOM   5518 C  CE    . LYS F 3 201 ? 37.575  84.136  55.386  1.00 19.49 ? 1193 LYS B CE    1 
ATOM   5519 N  NZ    . LYS F 3 201 ? 36.865  84.708  54.195  1.00 19.77 ? 1193 LYS B NZ    1 
ATOM   5520 N  N     . LEU F 3 202 ? 44.368  83.389  56.447  1.00 18.09 ? 1194 LEU B N     1 
ATOM   5521 C  CA    . LEU F 3 202 ? 45.686  83.026  55.948  1.00 18.10 ? 1194 LEU B CA    1 
ATOM   5522 C  C     . LEU F 3 202 ? 46.564  82.420  57.060  1.00 18.32 ? 1194 LEU B C     1 
ATOM   5523 O  O     . LEU F 3 202 ? 47.266  81.426  56.825  1.00 18.15 ? 1194 LEU B O     1 
ATOM   5524 C  CB    . LEU F 3 202 ? 46.364  84.247  55.312  1.00 18.07 ? 1194 LEU B CB    1 
ATOM   5525 C  CG    . LEU F 3 202 ? 45.809  84.646  53.932  1.00 17.95 ? 1194 LEU B CG    1 
ATOM   5526 C  CD1   . LEU F 3 202 ? 46.021  86.125  53.619  1.00 17.84 ? 1194 LEU B CD1   1 
ATOM   5527 C  CD2   . LEU F 3 202 ? 46.438  83.790  52.847  1.00 17.98 ? 1194 LEU B CD2   1 
ATOM   5528 N  N     . LYS F 3 203 ? 46.500  83.006  58.262  1.00 18.34 ? 1195 LYS B N     1 
ATOM   5529 C  CA    . LYS F 3 203 ? 47.238  82.505  59.434  1.00 18.40 ? 1195 LYS B CA    1 
ATOM   5530 C  C     . LYS F 3 203 ? 46.764  81.091  59.793  1.00 18.25 ? 1195 LYS B C     1 
ATOM   5531 O  O     . LYS F 3 203 ? 47.582  80.211  60.058  1.00 18.30 ? 1195 LYS B O     1 
ATOM   5532 C  CB    . LYS F 3 203 ? 47.096  83.472  60.638  1.00 18.51 ? 1195 LYS B CB    1 
ATOM   5533 C  CG    . LYS F 3 203 ? 47.481  82.899  62.038  1.00 18.67 ? 1195 LYS B CG    1 
ATOM   5534 C  CD    . LYS F 3 203 ? 48.623  83.668  62.729  1.00 19.31 ? 1195 LYS B CD    1 
ATOM   5535 C  CE    . LYS F 3 203 ? 48.116  84.767  63.678  1.00 20.01 ? 1195 LYS B CE    1 
ATOM   5536 N  NZ    . LYS F 3 203 ? 49.137  85.854  63.937  1.00 19.58 ? 1195 LYS B NZ    1 
ATOM   5537 N  N     . LYS F 3 204 ? 45.449  80.878  59.768  1.00 18.11 ? 1196 LYS B N     1 
ATOM   5538 C  CA    . LYS F 3 204 ? 44.868  79.559  60.029  1.00 18.10 ? 1196 LYS B CA    1 
ATOM   5539 C  C     . LYS F 3 204 ? 45.203  78.538  58.934  1.00 17.77 ? 1196 LYS B C     1 
ATOM   5540 O  O     . LYS F 3 204 ? 45.125  77.340  59.176  1.00 17.86 ? 1196 LYS B O     1 
ATOM   5541 C  CB    . LYS F 3 204 ? 43.336  79.647  60.221  1.00 18.18 ? 1196 LYS B CB    1 
ATOM   5542 C  CG    . LYS F 3 204 ? 42.874  80.204  61.594  1.00 18.74 ? 1196 LYS B CG    1 
ATOM   5543 C  CD    . LYS F 3 204 ? 43.426  79.374  62.795  1.00 19.45 ? 1196 LYS B CD    1 
ATOM   5544 C  CE    . LYS F 3 204 ? 42.334  78.871  63.750  1.00 18.80 ? 1196 LYS B CE    1 
ATOM   5545 N  NZ    . LYS F 3 204 ? 42.800  77.680  64.503  1.00 17.96 ? 1196 LYS B NZ    1 
ATOM   5546 N  N     . LEU F 3 205 ? 45.570  79.005  57.740  1.00 17.46 ? 1197 LEU B N     1 
ATOM   5547 C  CA    . LEU F 3 205 ? 45.970  78.108  56.647  1.00 17.20 ? 1197 LEU B CA    1 
ATOM   5548 C  C     . LEU F 3 205 ? 47.457  77.775  56.714  1.00 16.84 ? 1197 LEU B C     1 
ATOM   5549 O  O     . LEU F 3 205 ? 47.918  76.868  56.019  1.00 16.61 ? 1197 LEU B O     1 
ATOM   5550 C  CB    . LEU F 3 205 ? 45.644  78.720  55.270  1.00 17.26 ? 1197 LEU B CB    1 
ATOM   5551 C  CG    . LEU F 3 205 ? 44.243  78.516  54.665  1.00 17.37 ? 1197 LEU B CG    1 
ATOM   5552 C  CD1   . LEU F 3 205 ? 44.109  79.302  53.362  1.00 17.02 ? 1197 LEU B CD1   1 
ATOM   5553 C  CD2   . LEU F 3 205 ? 43.929  77.040  54.421  1.00 17.63 ? 1197 LEU B CD2   1 
ATOM   5554 N  N     . GLY F 3 206 ? 48.197  78.517  57.537  1.00 16.41 ? 1198 GLY B N     1 
ATOM   5555 C  CA    . GLY F 3 206 ? 49.629  78.321  57.694  1.00 16.40 ? 1198 GLY B CA    1 
ATOM   5556 C  C     . GLY F 3 206 ? 50.441  79.193  56.757  1.00 16.43 ? 1198 GLY B C     1 
ATOM   5557 O  O     . GLY F 3 206 ? 51.574  78.856  56.400  1.00 16.32 ? 1198 GLY B O     1 
ATOM   5558 N  N     . ILE F 3 207 ? 49.851  80.329  56.383  1.00 16.55 ? 1199 ILE B N     1 
ATOM   5559 C  CA    . ILE F 3 207 ? 50.410  81.257  55.404  1.00 16.34 ? 1199 ILE B CA    1 
ATOM   5560 C  C     . ILE F 3 207 ? 50.649  82.593  56.093  1.00 16.45 ? 1199 ILE B C     1 
ATOM   5561 O  O     . ILE F 3 207 ? 49.708  83.334  56.373  1.00 16.06 ? 1199 ILE B O     1 
ATOM   5562 C  CB    . ILE F 3 207 ? 49.443  81.415  54.213  1.00 16.31 ? 1199 ILE B CB    1 
ATOM   5563 C  CG1   . ILE F 3 207 ? 49.336  80.094  53.449  1.00 15.78 ? 1199 ILE B CG1   1 
ATOM   5564 C  CG2   . ILE F 3 207 ? 49.903  82.525  53.267  1.00 16.23 ? 1199 ILE B CG2   1 
ATOM   5565 C  CD1   . ILE F 3 207 ? 48.054  79.932  52.715  1.00 15.72 ? 1199 ILE B CD1   1 
ATOM   5566 N  N     . ASN F 3 208 ? 51.921  82.864  56.390  1.00 16.87 ? 1200 ASN B N     1 
ATOM   5567 C  CA    . ASN F 3 208 ? 52.344  84.100  57.060  1.00 16.95 ? 1200 ASN B CA    1 
ATOM   5568 C  C     . ASN F 3 208 ? 53.171  84.989  56.137  1.00 17.08 ? 1200 ASN B C     1 
ATOM   5569 O  O     . ASN F 3 208 ? 53.254  86.192  56.354  1.00 16.94 ? 1200 ASN B O     1 
ATOM   5570 C  CB    . ASN F 3 208 ? 53.162  83.794  58.326  1.00 17.06 ? 1200 ASN B CB    1 
ATOM   5571 C  CG    . ASN F 3 208 ? 52.769  82.485  58.985  1.00 16.66 ? 1200 ASN B CG    1 
ATOM   5572 O  OD1   . ASN F 3 208 ? 51.839  82.433  59.794  1.00 17.17 ? 1200 ASN B OD1   1 
ATOM   5573 N  ND2   . ASN F 3 208 ? 53.473  81.423  58.636  1.00 15.35 ? 1200 ASN B ND2   1 
ATOM   5574 N  N     . LYS F 3 209 ? 53.809  84.383  55.137  1.00 17.20 ? 1201 LYS B N     1 
ATOM   5575 C  CA    . LYS F 3 209 ? 54.565  85.121  54.129  1.00 17.32 ? 1201 LYS B CA    1 
ATOM   5576 C  C     . LYS F 3 209 ? 53.913  84.943  52.760  1.00 17.53 ? 1201 LYS B C     1 
ATOM   5577 O  O     . LYS F 3 209 ? 53.139  84.010  52.548  1.00 17.78 ? 1201 LYS B O     1 
ATOM   5578 C  CB    . LYS F 3 209 ? 56.022  84.631  54.079  1.00 17.22 ? 1201 LYS B CB    1 
ATOM   5579 C  CG    . LYS F 3 209 ? 56.659  84.335  55.443  1.00 16.73 ? 1201 LYS B CG    1 
ATOM   5580 C  CD    . LYS F 3 209 ? 56.498  85.488  56.427  1.00 16.27 ? 1201 LYS B CD    1 
ATOM   5581 C  CE    . LYS F 3 209 ? 57.665  85.586  57.396  1.00 15.99 ? 1201 LYS B CE    1 
ATOM   5582 N  NZ    . LYS F 3 209 ? 57.461  86.690  58.375  1.00 15.77 ? 1201 LYS B NZ    1 
ATOM   5583 N  N     . LEU F 3 210 ? 54.224  85.856  51.841  1.00 17.61 ? 1202 LEU B N     1 
ATOM   5584 C  CA    . LEU F 3 210 ? 53.761  85.777  50.452  1.00 17.44 ? 1202 LEU B CA    1 
ATOM   5585 C  C     . LEU F 3 210 ? 54.217  84.490  49.751  1.00 17.32 ? 1202 LEU B C     1 
ATOM   5586 O  O     . LEU F 3 210 ? 53.449  83.889  49.005  1.00 17.40 ? 1202 LEU B O     1 
ATOM   5587 C  CB    . LEU F 3 210 ? 54.244  86.997  49.651  1.00 17.49 ? 1202 LEU B CB    1 
ATOM   5588 C  CG    . LEU F 3 210 ? 53.404  88.279  49.694  1.00 17.23 ? 1202 LEU B CG    1 
ATOM   5589 C  CD1   . LEU F 3 210 ? 54.216  89.447  49.167  1.00 17.11 ? 1202 LEU B CD1   1 
ATOM   5590 C  CD2   . LEU F 3 210 ? 52.118  88.141  48.888  1.00 17.25 ? 1202 LEU B CD2   1 
ATOM   5591 N  N     . VAL F 3 211 ? 55.454  84.068  49.995  1.00 17.17 ? 1203 VAL B N     1 
ATOM   5592 C  CA    . VAL F 3 211 ? 56.022  82.899  49.315  1.00 17.19 ? 1203 VAL B CA    1 
ATOM   5593 C  C     . VAL F 3 211 ? 55.338  81.585  49.741  1.00 17.21 ? 1203 VAL B C     1 
ATOM   5594 O  O     . VAL F 3 211 ? 55.477  80.554  49.079  1.00 17.07 ? 1203 VAL B O     1 
ATOM   5595 C  CB    . VAL F 3 211 ? 57.569  82.815  49.530  1.00 17.21 ? 1203 VAL B CB    1 
ATOM   5596 C  CG1   . VAL F 3 211 ? 57.913  82.295  50.930  1.00 17.00 ? 1203 VAL B CG1   1 
ATOM   5597 C  CG2   . VAL F 3 211 ? 58.236  81.963  48.442  1.00 17.27 ? 1203 VAL B CG2   1 
ATOM   5598 N  N     . ASP F 3 212 ? 54.592  81.642  50.843  1.00 17.29 ? 1204 ASP B N     1 
ATOM   5599 C  CA    . ASP F 3 212 ? 53.804  80.515  51.326  1.00 17.24 ? 1204 ASP B CA    1 
ATOM   5600 C  C     . ASP F 3 212 ? 52.491  80.306  50.563  1.00 17.37 ? 1204 ASP B C     1 
ATOM   5601 O  O     . ASP F 3 212 ? 51.689  79.471  50.971  1.00 17.65 ? 1204 ASP B O     1 
ATOM   5602 C  CB    . ASP F 3 212 ? 53.488  80.691  52.820  1.00 17.24 ? 1204 ASP B CB    1 
ATOM   5603 C  CG    . ASP F 3 212 ? 54.731  80.677  53.696  1.00 17.17 ? 1204 ASP B CG    1 
ATOM   5604 O  OD1   . ASP F 3 212 ? 55.814  80.267  53.226  1.00 16.73 ? 1204 ASP B OD1   1 
ATOM   5605 O  OD2   . ASP F 3 212 ? 54.708  81.050  54.886  1.00 17.66 ? 1204 ASP B OD2   1 
ATOM   5606 N  N     . THR F 3 213 ? 52.259  81.047  49.476  1.00 17.40 ? 1205 THR B N     1 
ATOM   5607 C  CA    . THR F 3 213 ? 51.109  80.785  48.594  1.00 17.43 ? 1205 THR B CA    1 
ATOM   5608 C  C     . THR F 3 213 ? 51.489  79.859  47.440  1.00 17.46 ? 1205 THR B C     1 
ATOM   5609 O  O     . THR F 3 213 ? 50.667  79.578  46.569  1.00 17.27 ? 1205 THR B O     1 
ATOM   5610 C  CB    . THR F 3 213 ? 50.488  82.095  48.043  1.00 17.50 ? 1205 THR B CB    1 
ATOM   5611 O  OG1   . THR F 3 213 ? 51.474  82.863  47.342  1.00 17.75 ? 1205 THR B OG1   1 
ATOM   5612 C  CG2   . THR F 3 213 ? 50.026  83.006  49.177  1.00 17.45 ? 1205 THR B CG2   1 
ATOM   5613 N  N     . LEU F 3 214 ? 52.739  79.399  47.444  1.00 17.65 ? 1206 LEU B N     1 
ATOM   5614 C  CA    . LEU F 3 214 ? 53.220  78.387  46.508  1.00 17.83 ? 1206 LEU B CA    1 
ATOM   5615 C  C     . LEU F 3 214 ? 53.510  77.054  47.223  1.00 17.90 ? 1206 LEU B C     1 
ATOM   5616 O  O     . LEU F 3 214 ? 53.859  76.059  46.576  1.00 17.77 ? 1206 LEU B O     1 
ATOM   5617 C  CB    . LEU F 3 214 ? 54.472  78.889  45.778  1.00 17.94 ? 1206 LEU B CB    1 
ATOM   5618 C  CG    . LEU F 3 214 ? 54.541  80.394  45.483  1.00 18.33 ? 1206 LEU B CG    1 
ATOM   5619 C  CD1   . LEU F 3 214 ? 55.952  80.799  45.059  1.00 18.77 ? 1206 LEU B CD1   1 
ATOM   5620 C  CD2   . LEU F 3 214 ? 53.520  80.787  44.423  1.00 18.41 ? 1206 LEU B CD2   1 
ATOM   5621 N  N     . SER F 3 215 ? 53.378  77.042  48.553  1.00 17.92 ? 1207 SER B N     1 
ATOM   5622 C  CA    . SER F 3 215 ? 53.431  75.799  49.329  1.00 17.90 ? 1207 SER B CA    1 
ATOM   5623 C  C     . SER F 3 215 ? 52.061  75.125  49.316  1.00 17.79 ? 1207 SER B C     1 
ATOM   5624 O  O     . SER F 3 215 ? 51.955  73.919  49.521  1.00 17.94 ? 1207 SER B O     1 
ATOM   5625 C  CB    . SER F 3 215 ? 53.851  76.071  50.780  1.00 17.99 ? 1207 SER B CB    1 
ATOM   5626 O  OG    . SER F 3 215 ? 55.204  76.488  50.866  1.00 17.76 ? 1207 SER B OG    1 
ATOM   5627 N  N     . ILE F 3 216 ? 51.023  75.919  49.063  1.00 17.63 ? 1208 ILE B N     1 
ATOM   5628 C  CA    . ILE F 3 216 ? 49.633  75.468  49.108  1.00 17.49 ? 1208 ILE B CA    1 
ATOM   5629 C  C     . ILE F 3 216 ? 49.054  75.319  47.693  1.00 17.50 ? 1208 ILE B C     1 
ATOM   5630 O  O     . ILE F 3 216 ? 49.410  76.076  46.786  1.00 17.54 ? 1208 ILE B O     1 
ATOM   5631 C  CB    . ILE F 3 216 ? 48.793  76.470  49.960  1.00 17.44 ? 1208 ILE B CB    1 
ATOM   5632 C  CG1   . ILE F 3 216 ? 47.436  75.874  50.341  1.00 17.39 ? 1208 ILE B CG1   1 
ATOM   5633 C  CG2   . ILE F 3 216 ? 48.609  77.817  49.238  1.00 17.34 ? 1208 ILE B CG2   1 
ATOM   5634 C  CD1   . ILE F 3 216 ? 46.715  76.662  51.438  1.00 17.20 ? 1208 ILE B CD1   1 
ATOM   5635 N  N     . GLU F 3 217 ? 48.167  74.341  47.512  1.00 17.45 ? 1209 GLU B N     1 
ATOM   5636 C  CA    . GLU F 3 217 ? 47.524  74.104  46.216  1.00 17.35 ? 1209 GLU B CA    1 
ATOM   5637 C  C     . GLU F 3 217 ? 46.493  75.188  45.920  1.00 17.28 ? 1209 GLU B C     1 
ATOM   5638 O  O     . GLU F 3 217 ? 45.922  75.783  46.840  1.00 17.37 ? 1209 GLU B O     1 
ATOM   5639 C  CB    . GLU F 3 217 ? 46.878  72.717  46.173  1.00 17.41 ? 1209 GLU B CB    1 
ATOM   5640 C  CG    . GLU F 3 217 ? 47.848  71.614  45.771  1.00 17.53 ? 1209 GLU B CG    1 
ATOM   5641 C  CD    . GLU F 3 217 ? 47.317  70.227  46.063  1.00 18.11 ? 1209 GLU B CD    1 
ATOM   5642 O  OE1   . GLU F 3 217 ? 48.130  69.274  46.116  1.00 18.38 ? 1209 GLU B OE1   1 
ATOM   5643 O  OE2   . GLU F 3 217 ? 46.086  70.089  46.237  1.00 18.85 ? 1209 GLU B OE2   1 
ATOM   5644 N  N     . PHE F 3 218 ? 46.258  75.438  44.634  1.00 17.16 ? 1210 PHE B N     1 
ATOM   5645 C  CA    . PHE F 3 218 ? 45.526  76.633  44.204  1.00 17.01 ? 1210 PHE B CA    1 
ATOM   5646 C  C     . PHE F 3 218 ? 44.063  76.658  44.645  1.00 16.86 ? 1210 PHE B C     1 
ATOM   5647 O  O     . PHE F 3 218 ? 43.592  77.680  45.138  1.00 17.00 ? 1210 PHE B O     1 
ATOM   5648 C  CB    . PHE F 3 218 ? 45.607  76.821  42.682  1.00 17.02 ? 1210 PHE B CB    1 
ATOM   5649 C  CG    . PHE F 3 218 ? 44.940  78.080  42.195  1.00 17.28 ? 1210 PHE B CG    1 
ATOM   5650 C  CD1   . PHE F 3 218 ? 45.540  79.316  42.390  1.00 17.29 ? 1210 PHE B CD1   1 
ATOM   5651 C  CD2   . PHE F 3 218 ? 43.701  78.034  41.563  1.00 17.93 ? 1210 PHE B CD2   1 
ATOM   5652 C  CE1   . PHE F 3 218 ? 44.926  80.487  41.955  1.00 17.11 ? 1210 PHE B CE1   1 
ATOM   5653 C  CE2   . PHE F 3 218 ? 43.077  79.207  41.126  1.00 17.63 ? 1210 PHE B CE2   1 
ATOM   5654 C  CZ    . PHE F 3 218 ? 43.695  80.432  41.321  1.00 17.34 ? 1210 PHE B CZ    1 
ATOM   5655 N  N     . ASP F 3 219 ? 43.345  75.551  44.463  1.00 16.60 ? 1211 ASP B N     1 
ATOM   5656 C  CA    . ASP F 3 219 ? 41.908  75.517  44.759  1.00 16.43 ? 1211 ASP B CA    1 
ATOM   5657 C  C     . ASP F 3 219 ? 41.596  75.585  46.263  1.00 16.24 ? 1211 ASP B C     1 
ATOM   5658 O  O     . ASP F 3 219 ? 40.492  75.973  46.655  1.00 15.82 ? 1211 ASP B O     1 
ATOM   5659 C  CB    . ASP F 3 219 ? 41.254  74.280  44.126  1.00 16.51 ? 1211 ASP B CB    1 
ATOM   5660 C  CG    . ASP F 3 219 ? 41.144  74.380  42.604  1.00 16.63 ? 1211 ASP B CG    1 
ATOM   5661 O  OD1   . ASP F 3 219 ? 41.367  75.478  42.045  1.00 16.45 ? 1211 ASP B OD1   1 
ATOM   5662 O  OD2   . ASP F 3 219 ? 40.835  73.403  41.885  1.00 16.54 ? 1211 ASP B OD2   1 
ATOM   5663 N  N     . LYS F 3 220 ? 42.569  75.210  47.094  1.00 16.19 ? 1212 LYS B N     1 
ATOM   5664 C  CA    . LYS F 3 220 ? 42.456  75.354  48.551  1.00 16.19 ? 1212 LYS B CA    1 
ATOM   5665 C  C     . LYS F 3 220 ? 42.470  76.851  48.944  1.00 16.26 ? 1212 LYS B C     1 
ATOM   5666 O  O     . LYS F 3 220 ? 41.671  77.299  49.778  1.00 16.44 ? 1212 LYS B O     1 
ATOM   5667 C  CB    . LYS F 3 220 ? 43.593  74.591  49.252  1.00 16.06 ? 1212 LYS B CB    1 
ATOM   5668 C  CG    . LYS F 3 220 ? 43.213  73.882  50.559  1.00 15.79 ? 1212 LYS B CG    1 
ATOM   5669 C  CD    . LYS F 3 220 ? 44.112  72.649  50.817  1.00 15.97 ? 1212 LYS B CD    1 
ATOM   5670 C  CE    . LYS F 3 220 ? 44.576  72.551  52.270  1.00 15.83 ? 1212 LYS B CE    1 
ATOM   5671 N  NZ    . LYS F 3 220 ? 44.840  71.146  52.677  1.00 14.75 ? 1212 LYS B NZ    1 
ATOM   5672 N  N     . LEU F 3 221 ? 43.375  77.611  48.330  1.00 16.18 ? 1213 LEU B N     1 
ATOM   5673 C  CA    . LEU F 3 221 ? 43.471  79.057  48.545  1.00 16.04 ? 1213 LEU B CA    1 
ATOM   5674 C  C     . LEU F 3 221 ? 42.254  79.800  47.990  1.00 16.08 ? 1213 LEU B C     1 
ATOM   5675 O  O     . LEU F 3 221 ? 41.730  80.694  48.640  1.00 15.95 ? 1213 LEU B O     1 
ATOM   5676 C  CB    . LEU F 3 221 ? 44.753  79.588  47.898  1.00 15.92 ? 1213 LEU B CB    1 
ATOM   5677 C  CG    . LEU F 3 221 ? 45.165  81.032  48.180  1.00 15.66 ? 1213 LEU B CG    1 
ATOM   5678 C  CD1   . LEU F 3 221 ? 45.192  81.373  49.669  1.00 15.14 ? 1213 LEU B CD1   1 
ATOM   5679 C  CD2   . LEU F 3 221 ? 46.522  81.286  47.547  1.00 15.62 ? 1213 LEU B CD2   1 
ATOM   5680 N  N     . LYS F 3 222 ? 41.821  79.414  46.788  1.00 16.34 ? 1214 LYS B N     1 
ATOM   5681 C  CA    . LYS F 3 222 ? 40.601  79.934  46.142  1.00 16.48 ? 1214 LYS B CA    1 
ATOM   5682 C  C     . LYS F 3 222 ? 39.371  79.788  47.033  1.00 16.54 ? 1214 LYS B C     1 
ATOM   5683 O  O     . LYS F 3 222 ? 38.549  80.697  47.116  1.00 16.46 ? 1214 LYS B O     1 
ATOM   5684 C  CB    . LYS F 3 222 ? 40.343  79.187  44.818  1.00 16.56 ? 1214 LYS B CB    1 
ATOM   5685 C  CG    . LYS F 3 222 ? 39.195  79.743  43.949  1.00 16.60 ? 1214 LYS B CG    1 
ATOM   5686 C  CD    . LYS F 3 222 ? 38.275  78.632  43.399  1.00 16.55 ? 1214 LYS B CD    1 
ATOM   5687 C  CE    . LYS F 3 222 ? 37.570  79.034  42.088  1.00 16.54 ? 1214 LYS B CE    1 
ATOM   5688 N  NZ    . LYS F 3 222 ? 36.292  79.797  42.289  1.00 16.11 ? 1214 LYS B NZ    1 
ATOM   5689 N  N     . GLY F 3 223 ? 39.258  78.640  47.696  1.00 16.74 ? 1215 GLY B N     1 
ATOM   5690 C  CA    . GLY F 3 223 ? 38.104  78.328  48.520  1.00 16.86 ? 1215 GLY B CA    1 
ATOM   5691 C  C     . GLY F 3 223 ? 38.052  79.096  49.829  1.00 16.94 ? 1215 GLY B C     1 
ATOM   5692 O  O     . GLY F 3 223 ? 37.022  79.090  50.507  1.00 17.10 ? 1215 GLY B O     1 
ATOM   5693 N  N     . MET F 3 224 ? 39.149  79.761  50.183  1.00 16.91 ? 1216 MET B N     1 
ATOM   5694 C  CA    . MET F 3 224 ? 39.256  80.438  51.473  1.00 17.03 ? 1216 MET B CA    1 
ATOM   5695 C  C     . MET F 3 224 ? 39.187  81.973  51.399  1.00 16.54 ? 1216 MET B C     1 
ATOM   5696 O  O     . MET F 3 224 ? 38.497  82.591  52.216  1.00 16.50 ? 1216 MET B O     1 
ATOM   5697 C  CB    . MET F 3 224 ? 40.543  79.988  52.177  1.00 17.31 ? 1216 MET B CB    1 
ATOM   5698 C  CG    . MET F 3 224 ? 40.343  79.526  53.621  1.00 18.51 ? 1216 MET B CG    1 
ATOM   5699 S  SD    . MET F 3 224 ? 39.070  78.229  53.859  1.00 21.43 ? 1216 MET B SD    1 
ATOM   5700 C  CE    . MET F 3 224 ? 39.611  76.863  52.698  1.00 21.10 ? 1216 MET B CE    1 
ATOM   5701 N  N     . ILE F 3 225 ? 39.889  82.580  50.438  1.00 15.99 ? 1217 ILE B N     1 
ATOM   5702 C  CA    . ILE F 3 225 ? 39.964  84.052  50.323  1.00 15.66 ? 1217 ILE B CA    1 
ATOM   5703 C  C     . ILE F 3 225 ? 39.327  84.621  49.050  1.00 15.31 ? 1217 ILE B C     1 
ATOM   5704 O  O     . ILE F 3 225 ? 39.390  85.831  48.820  1.00 14.92 ? 1217 ILE B O     1 
ATOM   5705 C  CB    . ILE F 3 225 ? 41.441  84.536  50.413  1.00 15.69 ? 1217 ILE B CB    1 
ATOM   5706 C  CG1   . ILE F 3 225 ? 42.313  83.848  49.350  1.00 15.30 ? 1217 ILE B CG1   1 
ATOM   5707 C  CG2   . ILE F 3 225 ? 41.994  84.288  51.814  1.00 15.76 ? 1217 ILE B CG2   1 
ATOM   5708 C  CD1   . ILE F 3 225 ? 43.580  84.595  49.021  1.00 14.73 ? 1217 ILE B CD1   1 
ATOM   5709 N  N     . GLY F 3 226 ? 38.719  83.750  48.242  1.00 15.00 ? 1218 GLY B N     1 
ATOM   5710 C  CA    . GLY F 3 226 ? 38.173  84.122  46.951  1.00 14.84 ? 1218 GLY B CA    1 
ATOM   5711 C  C     . GLY F 3 226 ? 39.181  83.982  45.826  1.00 14.94 ? 1218 GLY B C     1 
ATOM   5712 O  O     . GLY F 3 226 ? 40.378  83.859  46.063  1.00 14.66 ? 1218 GLY B O     1 
ATOM   5713 N  N     . GLU F 3 227 ? 38.679  84.009  44.593  1.00 15.37 ? 1219 GLU B N     1 
ATOM   5714 C  CA    . GLU F 3 227 ? 39.503  83.889  43.385  1.00 15.64 ? 1219 GLU B CA    1 
ATOM   5715 C  C     . GLU F 3 227 ? 40.362  85.134  43.130  1.00 15.79 ? 1219 GLU B C     1 
ATOM   5716 O  O     . GLU F 3 227 ? 41.473  85.020  42.615  1.00 15.54 ? 1219 GLU B O     1 
ATOM   5717 C  CB    . GLU F 3 227 ? 38.605  83.619  42.162  1.00 15.69 ? 1219 GLU B CB    1 
ATOM   5718 C  CG    . GLU F 3 227 ? 39.349  83.179  40.903  1.00 16.41 ? 1219 GLU B CG    1 
ATOM   5719 C  CD    . GLU F 3 227 ? 38.436  83.007  39.687  1.00 17.25 ? 1219 GLU B CD    1 
ATOM   5720 O  OE1   . GLU F 3 227 ? 37.730  83.979  39.328  1.00 17.08 ? 1219 GLU B OE1   1 
ATOM   5721 O  OE2   . GLU F 3 227 ? 38.429  81.904  39.080  1.00 17.35 ? 1219 GLU B OE2   1 
ATOM   5722 N  N     . ALA F 3 228 ? 39.836  86.311  43.489  1.00 16.18 ? 1220 ALA B N     1 
ATOM   5723 C  CA    . ALA F 3 228 ? 40.477  87.605  43.192  1.00 16.21 ? 1220 ALA B CA    1 
ATOM   5724 C  C     . ALA F 3 228 ? 41.761  87.813  43.992  1.00 16.35 ? 1220 ALA B C     1 
ATOM   5725 O  O     . ALA F 3 228 ? 42.811  88.072  43.413  1.00 16.56 ? 1220 ALA B O     1 
ATOM   5726 C  CB    . ALA F 3 228 ? 39.503  88.762  43.439  1.00 16.06 ? 1220 ALA B CB    1 
ATOM   5727 N  N     . LYS F 3 229 ? 41.676  87.690  45.315  1.00 16.44 ? 1221 LYS B N     1 
ATOM   5728 C  CA    . LYS F 3 229 ? 42.863  87.766  46.173  1.00 16.53 ? 1221 LYS B CA    1 
ATOM   5729 C  C     . LYS F 3 229 ? 43.814  86.591  45.965  1.00 16.39 ? 1221 LYS B C     1 
ATOM   5730 O  O     . LYS F 3 229 ? 45.006  86.703  46.218  1.00 15.98 ? 1221 LYS B O     1 
ATOM   5731 C  CB    . LYS F 3 229 ? 42.463  87.817  47.641  1.00 16.67 ? 1221 LYS B CB    1 
ATOM   5732 C  CG    . LYS F 3 229 ? 41.729  89.074  48.025  1.00 17.47 ? 1221 LYS B CG    1 
ATOM   5733 C  CD    . LYS F 3 229 ? 41.100  88.926  49.395  1.00 18.21 ? 1221 LYS B CD    1 
ATOM   5734 C  CE    . LYS F 3 229 ? 40.555  90.251  49.878  1.00 19.13 ? 1221 LYS B CE    1 
ATOM   5735 N  NZ    . LYS F 3 229 ? 39.686  90.915  48.854  1.00 19.96 ? 1221 LYS B NZ    1 
ATOM   5736 N  N     . ALA F 3 230 ? 43.273  85.460  45.523  1.00 16.61 ? 1222 ALA B N     1 
ATOM   5737 C  CA    . ALA F 3 230 ? 44.073  84.262  45.292  1.00 16.62 ? 1222 ALA B CA    1 
ATOM   5738 C  C     . ALA F 3 230 ? 44.994  84.444  44.089  1.00 16.76 ? 1222 ALA B C     1 
ATOM   5739 O  O     . ALA F 3 230 ? 46.191  84.165  44.170  1.00 16.93 ? 1222 ALA B O     1 
ATOM   5740 C  CB    . ALA F 3 230 ? 43.176  83.062  45.090  1.00 16.56 ? 1222 ALA B CB    1 
ATOM   5741 N  N     . LYS F 3 231 ? 44.429  84.907  42.977  1.00 16.76 ? 1223 LYS B N     1 
ATOM   5742 C  CA    . LYS F 3 231 ? 45.197  85.147  41.751  1.00 16.76 ? 1223 LYS B CA    1 
ATOM   5743 C  C     . LYS F 3 231 ? 46.198  86.280  42.002  1.00 16.41 ? 1223 LYS B C     1 
ATOM   5744 O  O     . LYS F 3 231 ? 47.303  86.291  41.448  1.00 16.44 ? 1223 LYS B O     1 
ATOM   5745 C  CB    . LYS F 3 231 ? 44.264  85.526  40.583  1.00 16.95 ? 1223 LYS B CB    1 
ATOM   5746 C  CG    . LYS F 3 231 ? 44.037  84.426  39.532  1.00 17.33 ? 1223 LYS B CG    1 
ATOM   5747 C  CD    . LYS F 3 231 ? 43.424  85.001  38.229  1.00 17.77 ? 1223 LYS B CD    1 
ATOM   5748 C  CE    . LYS F 3 231 ? 42.187  84.232  37.758  1.00 17.78 ? 1223 LYS B CE    1 
ATOM   5749 N  NZ    . LYS F 3 231 ? 42.540  82.877  37.230  1.00 18.32 ? 1223 LYS B NZ    1 
ATOM   5750 N  N     . TYR F 3 232 ? 45.786  87.208  42.863  1.00 15.77 ? 1224 TYR B N     1 
ATOM   5751 C  CA    . TYR F 3 232 ? 46.524  88.428  43.174  1.00 15.21 ? 1224 TYR B CA    1 
ATOM   5752 C  C     . TYR F 3 232 ? 47.757  88.153  44.036  1.00 15.03 ? 1224 TYR B C     1 
ATOM   5753 O  O     . TYR F 3 232 ? 48.863  88.565  43.688  1.00 15.05 ? 1224 TYR B O     1 
ATOM   5754 C  CB    . TYR F 3 232 ? 45.563  89.373  43.887  1.00 14.89 ? 1224 TYR B CB    1 
ATOM   5755 C  CG    . TYR F 3 232 ? 46.158  90.598  44.525  1.00 14.60 ? 1224 TYR B CG    1 
ATOM   5756 C  CD1   . TYR F 3 232 ? 46.412  91.740  43.774  1.00 13.99 ? 1224 TYR B CD1   1 
ATOM   5757 C  CD2   . TYR F 3 232 ? 46.404  90.642  45.896  1.00 13.93 ? 1224 TYR B CD2   1 
ATOM   5758 C  CE1   . TYR F 3 232 ? 46.927  92.875  44.358  1.00 13.27 ? 1224 TYR B CE1   1 
ATOM   5759 C  CE2   . TYR F 3 232 ? 46.923  91.779  46.493  1.00 13.16 ? 1224 TYR B CE2   1 
ATOM   5760 C  CZ    . TYR F 3 232 ? 47.182  92.888  45.719  1.00 12.84 ? 1224 TYR B CZ    1 
ATOM   5761 O  OH    . TYR F 3 232 ? 47.691  94.016  46.305  1.00 11.18 ? 1224 TYR B OH    1 
ATOM   5762 N  N     . LEU F 3 233 ? 47.560  87.446  45.148  1.00 14.75 ? 1225 LEU B N     1 
ATOM   5763 C  CA    . LEU F 3 233 ? 48.635  87.171  46.104  1.00 14.57 ? 1225 LEU B CA    1 
ATOM   5764 C  C     . LEU F 3 233 ? 49.708  86.298  45.488  1.00 14.71 ? 1225 LEU B C     1 
ATOM   5765 O  O     . LEU F 3 233 ? 50.894  86.530  45.708  1.00 14.71 ? 1225 LEU B O     1 
ATOM   5766 C  CB    . LEU F 3 233 ? 48.099  86.492  47.366  1.00 14.29 ? 1225 LEU B CB    1 
ATOM   5767 C  CG    . LEU F 3 233 ? 47.445  87.413  48.394  1.00 13.98 ? 1225 LEU B CG    1 
ATOM   5768 C  CD1   . LEU F 3 233 ? 46.725  86.588  49.448  1.00 13.61 ? 1225 LEU B CD1   1 
ATOM   5769 C  CD2   . LEU F 3 233 ? 48.462  88.348  49.038  1.00 13.53 ? 1225 LEU B CD2   1 
ATOM   5770 N  N     . ILE F 3 234 ? 49.278  85.289  44.730  1.00 14.94 ? 1226 ILE B N     1 
ATOM   5771 C  CA    . ILE F 3 234 ? 50.184  84.413  43.996  1.00 15.14 ? 1226 ILE B CA    1 
ATOM   5772 C  C     . ILE F 3 234 ? 50.940  85.208  42.943  1.00 15.29 ? 1226 ILE B C     1 
ATOM   5773 O  O     . ILE F 3 234 ? 52.128  84.989  42.746  1.00 15.28 ? 1226 ILE B O     1 
ATOM   5774 C  CB    . ILE F 3 234 ? 49.414  83.226  43.340  1.00 15.31 ? 1226 ILE B CB    1 
ATOM   5775 C  CG1   . ILE F 3 234 ? 48.926  82.255  44.417  1.00 15.76 ? 1226 ILE B CG1   1 
ATOM   5776 C  CG2   . ILE F 3 234 ? 50.296  82.472  42.322  1.00 14.70 ? 1226 ILE B CG2   1 
ATOM   5777 C  CD1   . ILE F 3 234 ? 47.853  81.290  43.942  1.00 16.00 ? 1226 ILE B CD1   1 
ATOM   5778 N  N     . SER F 3 235 ? 50.255  86.129  42.271  1.00 15.49 ? 1227 SER B N     1 
ATOM   5779 C  CA    . SER F 3 235 ? 50.901  86.958  41.258  1.00 15.79 ? 1227 SER B CA    1 
ATOM   5780 C  C     . SER F 3 235 ? 52.056  87.767  41.847  1.00 15.81 ? 1227 SER B C     1 
ATOM   5781 O  O     . SER F 3 235 ? 53.057  87.978  41.183  1.00 15.61 ? 1227 SER B O     1 
ATOM   5782 C  CB    . SER F 3 235 ? 49.898  87.902  40.591  1.00 15.97 ? 1227 SER B CB    1 
ATOM   5783 O  OG    . SER F 3 235 ? 50.570  88.837  39.761  1.00 16.74 ? 1227 SER B OG    1 
ATOM   5784 N  N     . LEU F 3 236 ? 51.912  88.215  43.092  1.00 16.05 ? 1228 LEU B N     1 
ATOM   5785 C  CA    . LEU F 3 236 ? 52.963  88.989  43.760  1.00 16.06 ? 1228 LEU B CA    1 
ATOM   5786 C  C     . LEU F 3 236 ? 54.130  88.111  44.216  1.00 15.94 ? 1228 LEU B C     1 
ATOM   5787 O  O     . LEU F 3 236 ? 55.260  88.580  44.315  1.00 15.75 ? 1228 LEU B O     1 
ATOM   5788 C  CB    . LEU F 3 236 ? 52.385  89.764  44.945  1.00 15.99 ? 1228 LEU B CB    1 
ATOM   5789 C  CG    . LEU F 3 236 ? 51.503  90.947  44.521  1.00 16.36 ? 1228 LEU B CG    1 
ATOM   5790 C  CD1   . LEU F 3 236 ? 50.291  91.121  45.428  1.00 16.08 ? 1228 LEU B CD1   1 
ATOM   5791 C  CD2   . LEU F 3 236 ? 52.324  92.226  44.481  1.00 16.77 ? 1228 LEU B CD2   1 
ATOM   5792 N  N     . ALA F 3 237 ? 53.849  86.844  44.498  1.00 16.09 ? 1229 ALA B N     1 
ATOM   5793 C  CA    . ALA F 3 237 ? 54.879  85.896  44.921  1.00 16.24 ? 1229 ALA B CA    1 
ATOM   5794 C  C     . ALA F 3 237 ? 55.771  85.496  43.739  1.00 16.35 ? 1229 ALA B C     1 
ATOM   5795 O  O     . ALA F 3 237 ? 56.994  85.450  43.864  1.00 16.24 ? 1229 ALA B O     1 
ATOM   5796 C  CB    . ALA F 3 237 ? 54.237  84.675  45.549  1.00 16.21 ? 1229 ALA B CB    1 
ATOM   5797 N  N     . ARG F 3 238 ? 55.142  85.238  42.593  1.00 16.62 ? 1230 ARG B N     1 
ATOM   5798 C  CA    . ARG F 3 238 ? 55.837  84.943  41.335  1.00 16.85 ? 1230 ARG B CA    1 
ATOM   5799 C  C     . ARG F 3 238 ? 56.539  86.185  40.749  1.00 17.07 ? 1230 ARG B C     1 
ATOM   5800 O  O     . ARG F 3 238 ? 57.208  86.099  39.711  1.00 17.13 ? 1230 ARG B O     1 
ATOM   5801 C  CB    . ARG F 3 238 ? 54.838  84.365  40.307  1.00 16.81 ? 1230 ARG B CB    1 
ATOM   5802 C  CG    . ARG F 3 238 ? 54.485  82.886  40.537  1.00 16.88 ? 1230 ARG B CG    1 
ATOM   5803 C  CD    . ARG F 3 238 ? 53.156  82.417  39.907  1.00 16.45 ? 1230 ARG B CD    1 
ATOM   5804 N  NE    . ARG F 3 238 ? 53.094  80.956  39.766  1.00 16.09 ? 1230 ARG B NE    1 
ATOM   5805 C  CZ    . ARG F 3 238 ? 51.994  80.243  39.494  1.00 15.89 ? 1230 ARG B CZ    1 
ATOM   5806 N  NH1   . ARG F 3 238 ? 50.814  80.834  39.324  1.00 15.59 ? 1230 ARG B NH1   1 
ATOM   5807 N  NH2   . ARG F 3 238 ? 52.078  78.917  39.389  1.00 15.76 ? 1230 ARG B NH2   1 
ATOM   5808 N  N     . ASP F 3 239 ? 56.370  87.331  41.411  1.00 17.33 ? 1231 ASP B N     1 
ATOM   5809 C  CA    . ASP F 3 239 ? 56.931  88.611  40.975  1.00 17.49 ? 1231 ASP B CA    1 
ATOM   5810 C  C     . ASP F 3 239 ? 56.483  88.958  39.555  1.00 17.55 ? 1231 ASP B C     1 
ATOM   5811 O  O     . ASP F 3 239 ? 57.245  89.514  38.760  1.00 17.81 ? 1231 ASP B O     1 
ATOM   5812 C  CB    . ASP F 3 239 ? 58.460  88.601  41.090  1.00 17.57 ? 1231 ASP B CB    1 
ATOM   5813 C  CG    . ASP F 3 239 ? 59.050  89.997  41.184  1.00 17.82 ? 1231 ASP B CG    1 
ATOM   5814 O  OD1   . ASP F 3 239 ? 58.281  90.979  41.317  1.00 17.90 ? 1231 ASP B OD1   1 
ATOM   5815 O  OD2   . ASP F 3 239 ? 60.280  90.208  41.131  1.00 18.80 ? 1231 ASP B OD2   1 
ATOM   5816 N  N     . GLU F 3 240 ? 55.234  88.615  39.260  1.00 17.61 ? 1232 GLU B N     1 
ATOM   5817 C  CA    . GLU F 3 240 ? 54.629  88.830  37.955  1.00 17.78 ? 1232 GLU B CA    1 
ATOM   5818 C  C     . GLU F 3 240 ? 53.553  89.936  38.002  1.00 17.93 ? 1232 GLU B C     1 
ATOM   5819 O  O     . GLU F 3 240 ? 52.884  90.193  37.003  1.00 18.31 ? 1232 GLU B O     1 
ATOM   5820 C  CB    . GLU F 3 240 ? 54.043  87.501  37.430  1.00 17.67 ? 1232 GLU B CB    1 
ATOM   5821 C  CG    . GLU F 3 240 ? 54.841  86.861  36.294  1.00 17.71 ? 1232 GLU B CG    1 
ATOM   5822 C  CD    . GLU F 3 240 ? 54.866  85.331  36.334  1.00 17.86 ? 1232 GLU B CD    1 
ATOM   5823 O  OE1   . GLU F 3 240 ? 53.899  84.714  36.843  1.00 17.69 ? 1232 GLU B OE1   1 
ATOM   5824 O  OE2   . GLU F 3 240 ? 55.860  84.740  35.846  1.00 16.73 ? 1232 GLU B OE2   1 
ATOM   5825 N  N     . TYR F 3 241 ? 53.388  90.604  39.142  1.00 18.02 ? 1233 TYR B N     1 
ATOM   5826 C  CA    . TYR F 3 241 ? 52.405  91.681  39.236  1.00 18.00 ? 1233 TYR B CA    1 
ATOM   5827 C  C     . TYR F 3 241 ? 52.909  92.899  38.457  1.00 18.09 ? 1233 TYR B C     1 
ATOM   5828 O  O     . TYR F 3 241 ? 54.047  93.353  38.651  1.00 18.15 ? 1233 TYR B O     1 
ATOM   5829 C  CB    . TYR F 3 241 ? 52.111  92.049  40.695  1.00 17.94 ? 1233 TYR B CB    1 
ATOM   5830 C  CG    . TYR F 3 241 ? 50.980  93.056  40.852  1.00 18.05 ? 1233 TYR B CG    1 
ATOM   5831 C  CD1   . TYR F 3 241 ? 49.674  92.644  41.127  1.00 17.62 ? 1233 TYR B CD1   1 
ATOM   5832 C  CD2   . TYR F 3 241 ? 51.219  94.424  40.725  1.00 17.92 ? 1233 TYR B CD2   1 
ATOM   5833 C  CE1   . TYR F 3 241 ? 48.637  93.576  41.269  1.00 17.31 ? 1233 TYR B CE1   1 
ATOM   5834 C  CE2   . TYR F 3 241 ? 50.190  95.359  40.864  1.00 17.07 ? 1233 TYR B CE2   1 
ATOM   5835 C  CZ    . TYR F 3 241 ? 48.907  94.930  41.131  1.00 17.02 ? 1233 TYR B CZ    1 
ATOM   5836 O  OH    . TYR F 3 241 ? 47.903  95.861  41.260  1.00 16.13 ? 1233 TYR B OH    1 
ATOM   5837 N  N     . ASN F 3 242 ? 52.066  93.404  37.559  1.00 18.06 ? 1234 ASN B N     1 
ATOM   5838 C  CA    . ASN F 3 242 ? 52.386  94.601  36.789  1.00 18.02 ? 1234 ASN B CA    1 
ATOM   5839 C  C     . ASN F 3 242 ? 51.147  95.275  36.201  1.00 17.85 ? 1234 ASN B C     1 
ATOM   5840 O  O     . ASN F 3 242 ? 51.155  95.712  35.056  1.00 17.79 ? 1234 ASN B O     1 
ATOM   5841 C  CB    . ASN F 3 242 ? 53.388  94.259  35.672  1.00 18.20 ? 1234 ASN B CB    1 
ATOM   5842 C  CG    . ASN F 3 242 ? 54.206  95.461  35.232  1.00 18.52 ? 1234 ASN B CG    1 
ATOM   5843 O  OD1   . ASN F 3 242 ? 54.118  96.539  35.825  1.00 19.84 ? 1234 ASN B OD1   1 
ATOM   5844 N  ND2   . ASN F 3 242 ? 55.009  95.280  34.193  1.00 18.80 ? 1234 ASN B ND2   1 
ATOM   5845 N  N     . GLU F 3 243 ? 50.085  95.373  36.994  1.00 18.01 ? 1235 GLU B N     1 
ATOM   5846 C  CA    . GLU F 3 243 ? 48.854  96.036  36.550  1.00 18.14 ? 1235 GLU B CA    1 
ATOM   5847 C  C     . GLU F 3 243 ? 49.126  97.539  36.365  1.00 18.07 ? 1235 GLU B C     1 
ATOM   5848 O  O     . GLU F 3 243 ? 49.805  98.147  37.190  1.00 17.99 ? 1235 GLU B O     1 
ATOM   5849 C  CB    . GLU F 3 243 ? 47.702  95.824  37.545  1.00 18.10 ? 1235 GLU B CB    1 
ATOM   5850 C  CG    . GLU F 3 243 ? 47.348  94.369  37.833  1.00 18.63 ? 1235 GLU B CG    1 
ATOM   5851 C  CD    . GLU F 3 243 ? 46.614  93.677  36.693  1.00 19.62 ? 1235 GLU B CD    1 
ATOM   5852 O  OE1   . GLU F 3 243 ? 45.388  93.470  36.828  1.00 20.34 ? 1235 GLU B OE1   1 
ATOM   5853 O  OE2   . GLU F 3 243 ? 47.260  93.318  35.676  1.00 20.23 ? 1235 GLU B OE2   1 
ATOM   5854 N  N     . PRO F 3 244 ? 48.607  98.133  35.291  1.00 18.03 ? 1236 PRO B N     1 
ATOM   5855 C  CA    . PRO F 3 244 ? 48.944  99.515  34.952  1.00 17.85 ? 1236 PRO B CA    1 
ATOM   5856 C  C     . PRO F 3 244 ? 48.243  100.530 35.830  1.00 17.73 ? 1236 PRO B C     1 
ATOM   5857 O  O     . PRO F 3 244 ? 47.178  100.248 36.403  1.00 17.68 ? 1236 PRO B O     1 
ATOM   5858 C  CB    . PRO F 3 244 ? 48.433  99.647  33.516  1.00 17.84 ? 1236 PRO B CB    1 
ATOM   5859 C  CG    . PRO F 3 244 ? 47.249  98.746  33.480  1.00 17.94 ? 1236 PRO B CG    1 
ATOM   5860 C  CD    . PRO F 3 244 ? 47.653  97.560  34.319  1.00 18.19 ? 1236 PRO B CD    1 
ATOM   5861 N  N     . ILE F 3 245 ? 48.859  101.705 35.919  1.00 17.63 ? 1237 ILE B N     1 
ATOM   5862 C  CA    . ILE F 3 245 ? 48.211  102.893 36.447  1.00 17.72 ? 1237 ILE B CA    1 
ATOM   5863 C  C     . ILE F 3 245 ? 47.115  103.248 35.452  1.00 18.35 ? 1237 ILE B C     1 
ATOM   5864 O  O     . ILE F 3 245 ? 47.356  103.267 34.243  1.00 18.47 ? 1237 ILE B O     1 
ATOM   5865 C  CB    . ILE F 3 245 ? 49.228  104.048 36.590  1.00 17.45 ? 1237 ILE B CB    1 
ATOM   5866 C  CG1   . ILE F 3 245 ? 50.026  103.900 37.886  1.00 16.96 ? 1237 ILE B CG1   1 
ATOM   5867 C  CG2   . ILE F 3 245 ? 48.536  105.402 36.568  1.00 17.09 ? 1237 ILE B CG2   1 
ATOM   5868 C  CD1   . ILE F 3 245 ? 50.817  102.625 37.972  1.00 17.03 ? 1237 ILE B CD1   1 
ATOM   5869 N  N     . ARG F 3 246 ? 45.913  103.509 35.953  1.00 19.06 ? 1238 ARG B N     1 
ATOM   5870 C  CA    . ARG F 3 246 ? 44.759  103.741 35.087  1.00 19.81 ? 1238 ARG B CA    1 
ATOM   5871 C  C     . ARG F 3 246 ? 43.595  104.316 35.872  1.00 20.06 ? 1238 ARG B C     1 
ATOM   5872 O  O     . ARG F 3 246 ? 43.465  104.069 37.065  1.00 20.13 ? 1238 ARG B O     1 
ATOM   5873 C  CB    . ARG F 3 246 ? 44.325  102.440 34.385  1.00 20.12 ? 1238 ARG B CB    1 
ATOM   5874 C  CG    . ARG F 3 246 ? 43.775  101.330 35.320  1.00 21.44 ? 1238 ARG B CG    1 
ATOM   5875 C  CD    . ARG F 3 246 ? 42.224  101.243 35.376  1.00 22.63 ? 1238 ARG B CD    1 
ATOM   5876 N  NE    . ARG F 3 246 ? 41.678  99.910  35.079  1.00 22.88 ? 1238 ARG B NE    1 
ATOM   5877 C  CZ    . ARG F 3 246 ? 41.672  99.322  33.878  1.00 22.27 ? 1238 ARG B CZ    1 
ATOM   5878 N  NH1   . ARG F 3 246 ? 41.128  98.117  33.746  1.00 21.95 ? 1238 ARG B NH1   1 
ATOM   5879 N  NH2   . ARG F 3 246 ? 42.201  99.919  32.811  1.00 22.07 ? 1238 ARG B NH2   1 
ATOM   5880 N  N     . THR F 3 247 ? 42.736  105.067 35.190  1.00 20.56 ? 1239 THR B N     1 
ATOM   5881 C  CA    . THR F 3 247 ? 41.590  105.697 35.843  1.00 20.99 ? 1239 THR B CA    1 
ATOM   5882 C  C     . THR F 3 247 ? 40.606  104.647 36.362  1.00 21.18 ? 1239 THR B C     1 
ATOM   5883 O  O     . THR F 3 247 ? 39.915  103.998 35.578  1.00 21.33 ? 1239 THR B O     1 
ATOM   5884 C  CB    . THR F 3 247 ? 40.865  106.697 34.882  1.00 21.06 ? 1239 THR B CB    1 
ATOM   5885 O  OG1   . THR F 3 247 ? 41.778  107.711 34.439  1.00 20.52 ? 1239 THR B OG1   1 
ATOM   5886 C  CG2   . THR F 3 247 ? 39.767  107.492 35.628  1.00 21.18 ? 1239 THR B CG2   1 
ATOM   5887 N  N     . ARG F 3 248 ? 40.550  104.466 37.677  1.00 21.38 ? 1240 ARG B N     1 
ATOM   5888 C  CA    . ARG F 3 248 ? 39.553  103.562 38.244  1.00 21.82 ? 1240 ARG B CA    1 
ATOM   5889 C  C     . ARG F 3 248 ? 38.160  104.102 37.950  1.00 21.75 ? 1240 ARG B C     1 
ATOM   5890 O  O     . ARG F 3 248 ? 37.876  105.262 38.256  1.00 21.98 ? 1240 ARG B O     1 
ATOM   5891 C  CB    . ARG F 3 248 ? 39.715  103.456 39.754  1.00 22.09 ? 1240 ARG B CB    1 
ATOM   5892 C  CG    . ARG F 3 248 ? 40.831  102.542 40.206  1.00 22.98 ? 1240 ARG B CG    1 
ATOM   5893 C  CD    . ARG F 3 248 ? 41.078  102.658 41.695  1.00 24.04 ? 1240 ARG B CD    1 
ATOM   5894 N  NE    . ARG F 3 248 ? 42.275  101.939 42.114  1.00 24.63 ? 1240 ARG B NE    1 
ATOM   5895 C  CZ    . ARG F 3 248 ? 42.410  101.322 43.286  1.00 25.62 ? 1240 ARG B CZ    1 
ATOM   5896 N  NH1   . ARG F 3 248 ? 41.421  101.328 44.186  1.00 25.42 ? 1240 ARG B NH1   1 
ATOM   5897 N  NH2   . ARG F 3 248 ? 43.550  100.696 43.565  1.00 25.86 ? 1240 ARG B NH2   1 
ATOM   5898 N  N     . VAL F 3 249 ? 37.290  103.284 37.367  1.00 21.45 ? 1241 VAL B N     1 
ATOM   5899 C  CA    . VAL F 3 249 ? 35.921  103.733 37.140  1.00 21.49 ? 1241 VAL B CA    1 
ATOM   5900 C  C     . VAL F 3 249 ? 34.987  103.180 38.209  1.00 21.54 ? 1241 VAL B C     1 
ATOM   5901 O  O     . VAL F 3 249 ? 34.839  101.964 38.339  1.00 21.23 ? 1241 VAL B O     1 
ATOM   5902 C  CB    . VAL F 3 249 ? 35.378  103.336 35.749  1.00 21.61 ? 1241 VAL B CB    1 
ATOM   5903 C  CG1   . VAL F 3 249 ? 33.959  103.899 35.563  1.00 21.51 ? 1241 VAL B CG1   1 
ATOM   5904 C  CG2   . VAL F 3 249 ? 36.314  103.814 34.634  1.00 21.00 ? 1241 VAL B CG2   1 
ATOM   5905 N  N     . ARG F 3 250 ? 34.366  104.086 38.965  1.00 21.74 ? 1242 ARG B N     1 
ATOM   5906 C  CA    . ARG F 3 250 ? 33.284  103.744 39.890  1.00 21.94 ? 1242 ARG B CA    1 
ATOM   5907 C  C     . ARG F 3 250 ? 32.289  102.793 39.198  1.00 21.69 ? 1242 ARG B C     1 
ATOM   5908 O  O     . ARG F 3 250 ? 31.799  103.099 38.114  1.00 21.82 ? 1242 ARG B O     1 
ATOM   5909 C  CB    . ARG F 3 250 ? 32.559  105.025 40.347  1.00 22.31 ? 1242 ARG B CB    1 
ATOM   5910 C  CG    . ARG F 3 250 ? 32.906  105.583 41.756  1.00 23.55 ? 1242 ARG B CG    1 
ATOM   5911 C  CD    . ARG F 3 250 ? 34.245  105.159 42.339  1.00 25.42 ? 1242 ARG B CD    1 
ATOM   5912 N  NE    . ARG F 3 250 ? 34.697  106.046 43.419  1.00 27.10 ? 1242 ARG B NE    1 
ATOM   5913 C  CZ    . ARG F 3 250 ? 35.613  105.724 44.357  1.00 28.40 ? 1242 ARG B CZ    1 
ATOM   5914 N  NH1   . ARG F 3 250 ? 36.202  104.521 44.372  1.00 27.80 ? 1242 ARG B NH1   1 
ATOM   5915 N  NH2   . ARG F 3 250 ? 35.944  106.621 45.294  1.00 28.46 ? 1242 ARG B NH2   1 
ATOM   5916 N  N     . LYS F 3 251 ? 32.024  101.641 39.811  1.00 21.41 ? 1243 LYS B N     1 
ATOM   5917 C  CA    . LYS F 3 251 ? 31.025  100.694 39.308  1.00 21.31 ? 1243 LYS B CA    1 
ATOM   5918 C  C     . LYS F 3 251 ? 29.688  100.795 40.060  1.00 20.84 ? 1243 LYS B C     1 
ATOM   5919 O  O     . LYS F 3 251 ? 28.694  100.199 39.640  1.00 21.02 ? 1243 LYS B O     1 
ATOM   5920 C  CB    . LYS F 3 251 ? 31.569  99.259  39.360  1.00 21.65 ? 1243 LYS B CB    1 
ATOM   5921 C  CG    . LYS F 3 251 ? 32.530  98.928  38.201  1.00 23.14 ? 1243 LYS B CG    1 
ATOM   5922 C  CD    . LYS F 3 251 ? 31.971  97.833  37.261  1.00 25.47 ? 1243 LYS B CD    1 
ATOM   5923 C  CE    . LYS F 3 251 ? 32.839  97.596  35.994  1.00 26.28 ? 1243 LYS B CE    1 
ATOM   5924 N  NZ    . LYS F 3 251 ? 34.208  98.212  36.080  1.00 27.16 ? 1243 LYS B NZ    1 
ATOM   5925 N  N     . SER F 3 252 ? 29.667  101.530 41.174  1.00 20.07 ? 1244 SER B N     1 
ATOM   5926 C  CA    . SER F 3 252 ? 28.413  101.971 41.785  1.00 19.51 ? 1244 SER B CA    1 
ATOM   5927 C  C     . SER F 3 252 ? 28.594  103.287 42.540  1.00 19.16 ? 1244 SER B C     1 
ATOM   5928 O  O     . SER F 3 252 ? 29.700  103.641 42.911  1.00 19.66 ? 1244 SER B O     1 
ATOM   5929 C  CB    . SER F 3 252 ? 27.794  100.876 42.675  1.00 19.62 ? 1244 SER B CB    1 
ATOM   5930 O  OG    . SER F 3 252 ? 28.541  100.603 43.856  1.00 19.94 ? 1244 SER B OG    1 
ATOM   5931 N  N     . ILE F 3 253 ? 27.506  104.030 42.721  1.00 18.78 ? 1245 ILE B N     1 
ATOM   5932 C  CA    . ILE F 3 253 ? 27.498  105.275 43.508  1.00 18.32 ? 1245 ILE B CA    1 
ATOM   5933 C  C     . ILE F 3 253 ? 26.247  105.285 44.370  1.00 17.59 ? 1245 ILE B C     1 
ATOM   5934 O  O     . ILE F 3 253 ? 25.204  104.830 43.933  1.00 17.58 ? 1245 ILE B O     1 
ATOM   5935 C  CB    . ILE F 3 253 ? 27.484  106.513 42.586  1.00 18.48 ? 1245 ILE B CB    1 
ATOM   5936 C  CG1   . ILE F 3 253 ? 28.790  106.636 41.785  1.00 19.51 ? 1245 ILE B CG1   1 
ATOM   5937 C  CG2   . ILE F 3 253 ? 27.236  107.777 43.387  1.00 18.53 ? 1245 ILE B CG2   1 
ATOM   5938 C  CD1   . ILE F 3 253 ? 30.011  107.009 42.629  1.00 21.37 ? 1245 ILE B CD1   1 
ATOM   5939 N  N     . GLY F 3 254 ? 26.329  105.828 45.577  1.00 16.99 ? 1246 GLY B N     1 
ATOM   5940 C  CA    . GLY F 3 254 ? 25.198  105.744 46.480  1.00 16.79 ? 1246 GLY B CA    1 
ATOM   5941 C  C     . GLY F 3 254 ? 25.327  106.410 47.831  1.00 16.54 ? 1246 GLY B C     1 
ATOM   5942 O  O     . GLY F 3 254 ? 26.352  107.004 48.166  1.00 17.02 ? 1246 GLY B O     1 
ATOM   5943 N  N     . ARG F 3 255 ? 24.252  106.312 48.602  1.00 15.91 ? 1247 ARG B N     1 
ATOM   5944 C  CA    . ARG F 3 255 ? 24.195  106.877 49.933  1.00 15.82 ? 1247 ARG B CA    1 
ATOM   5945 C  C     . ARG F 3 255 ? 23.245  106.076 50.820  1.00 15.36 ? 1247 ARG B C     1 
ATOM   5946 O  O     . ARG F 3 255 ? 22.154  105.708 50.415  1.00 14.92 ? 1247 ARG B O     1 
ATOM   5947 C  CB    . ARG F 3 255 ? 23.738  108.335 49.860  1.00 16.10 ? 1247 ARG B CB    1 
ATOM   5948 C  CG    . ARG F 3 255 ? 23.833  109.113 51.180  1.00 17.30 ? 1247 ARG B CG    1 
ATOM   5949 C  CD    . ARG F 3 255 ? 24.930  110.190 51.192  1.00 18.63 ? 1247 ARG B CD    1 
ATOM   5950 N  NE    . ARG F 3 255 ? 25.071  110.860 52.492  1.00 19.52 ? 1247 ARG B NE    1 
ATOM   5951 C  CZ    . ARG F 3 255 ? 25.575  110.301 53.588  1.00 19.49 ? 1247 ARG B CZ    1 
ATOM   5952 N  NH1   . ARG F 3 255 ? 25.974  109.035 53.588  1.00 19.82 ? 1247 ARG B NH1   1 
ATOM   5953 N  NH2   . ARG F 3 255 ? 25.664  111.016 54.704  1.00 20.22 ? 1247 ARG B NH2   1 
ATOM   5954 N  N     . ILE F 3 256 ? 23.676  105.793 52.036  1.00 15.05 ? 1248 ILE B N     1 
ATOM   5955 C  CA    . ILE F 3 256 ? 22.777  105.198 53.005  1.00 14.84 ? 1248 ILE B CA    1 
ATOM   5956 C  C     . ILE F 3 256 ? 23.043  105.872 54.337  1.00 14.43 ? 1248 ILE B C     1 
ATOM   5957 O  O     . ILE F 3 256 ? 24.187  105.978 54.768  1.00 14.64 ? 1248 ILE B O     1 
ATOM   5958 C  CB    . ILE F 3 256 ? 22.849  103.616 53.003  1.00 14.92 ? 1248 ILE B CB    1 
ATOM   5959 C  CG1   . ILE F 3 256 ? 22.837  103.036 54.404  1.00 15.13 ? 1248 ILE B CG1   1 
ATOM   5960 C  CG2   . ILE F 3 256 ? 24.039  103.072 52.193  1.00 14.87 ? 1248 ILE B CG2   1 
ATOM   5961 C  CD1   . ILE F 3 256 ? 22.655  101.549 54.395  1.00 16.01 ? 1248 ILE B CD1   1 
ATOM   5962 N  N     . VAL F 3 257 ? 21.966  106.382 54.931  1.00 13.94 ? 1249 VAL B N     1 
ATOM   5963 C  CA    . VAL F 3 257 ? 22.017  107.269 56.083  1.00 13.76 ? 1249 VAL B CA    1 
ATOM   5964 C  C     . VAL F 3 257 ? 21.333  106.602 57.266  1.00 13.86 ? 1249 VAL B C     1 
ATOM   5965 O  O     . VAL F 3 257 ? 20.441  105.774 57.087  1.00 13.70 ? 1249 VAL B O     1 
ATOM   5966 C  CB    . VAL F 3 257 ? 21.295  108.623 55.794  1.00 13.59 ? 1249 VAL B CB    1 
ATOM   5967 C  CG1   . VAL F 3 257 ? 21.825  109.286 54.538  1.00 13.03 ? 1249 VAL B CG1   1 
ATOM   5968 C  CG2   . VAL F 3 257 ? 19.799  108.436 55.677  1.00 13.95 ? 1249 VAL B CG2   1 
ATOM   5969 N  N     . THR F 3 258 ? 21.740  106.971 58.476  1.00 13.99 ? 1250 THR B N     1 
ATOM   5970 C  CA    . THR F 3 258 ? 21.082  106.465 59.675  1.00 14.12 ? 1250 THR B CA    1 
ATOM   5971 C  C     . THR F 3 258 ? 19.877  107.340 59.976  1.00 14.26 ? 1250 THR B C     1 
ATOM   5972 O  O     . THR F 3 258 ? 19.955  108.564 59.916  1.00 14.04 ? 1250 THR B O     1 
ATOM   5973 C  CB    . THR F 3 258 ? 22.043  106.433 60.891  1.00 14.20 ? 1250 THR B CB    1 
ATOM   5974 O  OG1   . THR F 3 258 ? 22.978  105.359 60.755  1.00 13.81 ? 1250 THR B OG1   1 
ATOM   5975 C  CG2   . THR F 3 258 ? 21.293  106.074 62.183  1.00 14.24 ? 1250 THR B CG2   1 
ATOM   5976 N  N     . MET F 3 259 ? 18.761  106.704 60.293  1.00 14.56 ? 1251 MET B N     1 
ATOM   5977 C  CA    . MET F 3 259 ? 17.553  107.426 60.641  1.00 15.04 ? 1251 MET B CA    1 
ATOM   5978 C  C     . MET F 3 259 ? 17.597  107.798 62.112  1.00 15.66 ? 1251 MET B C     1 
ATOM   5979 O  O     . MET F 3 259 ? 18.217  107.104 62.926  1.00 15.76 ? 1251 MET B O     1 
ATOM   5980 C  CB    . MET F 3 259 ? 16.326  106.578 60.351  1.00 14.83 ? 1251 MET B CB    1 
ATOM   5981 C  CG    . MET F 3 259 ? 16.232  106.158 58.917  1.00 14.96 ? 1251 MET B CG    1 
ATOM   5982 S  SD    . MET F 3 259 ? 14.597  105.621 58.490  1.00 14.96 ? 1251 MET B SD    1 
ATOM   5983 C  CE    . MET F 3 259 ? 14.564  104.061 59.260  1.00 15.82 ? 1251 MET B CE    1 
ATOM   5984 N  N     . LYS F 3 260 ? 16.930  108.897 62.450  1.00 16.28 ? 1252 LYS B N     1 
ATOM   5985 C  CA    . LYS F 3 260 ? 16.914  109.386 63.818  1.00 16.81 ? 1252 LYS B CA    1 
ATOM   5986 C  C     . LYS F 3 260 ? 16.497  108.253 64.746  1.00 16.99 ? 1252 LYS B C     1 
ATOM   5987 O  O     . LYS F 3 260 ? 17.150  108.016 65.763  1.00 17.52 ? 1252 LYS B O     1 
ATOM   5988 C  CB    . LYS F 3 260 ? 15.982  110.589 63.971  1.00 17.02 ? 1252 LYS B CB    1 
ATOM   5989 C  CG    . LYS F 3 260 ? 16.291  111.433 65.195  1.00 17.83 ? 1252 LYS B CG    1 
ATOM   5990 C  CD    . LYS F 3 260 ? 17.629  112.178 65.062  1.00 18.63 ? 1252 LYS B CD    1 
ATOM   5991 C  CE    . LYS F 3 260 ? 18.583  111.886 66.249  1.00 19.46 ? 1252 LYS B CE    1 
ATOM   5992 N  NZ    . LYS F 3 260 ? 18.001  112.203 67.606  1.00 18.98 ? 1252 LYS B NZ    1 
ATOM   5993 N  N     . ARG F 3 261 ? 15.433  107.540 64.378  1.00 16.73 ? 1253 ARG B N     1 
ATOM   5994 C  CA    . ARG F 3 261 ? 15.072  106.311 65.075  1.00 16.44 ? 1253 ARG B CA    1 
ATOM   5995 C  C     . ARG F 3 261 ? 14.580  105.202 64.140  1.00 16.05 ? 1253 ARG B C     1 
ATOM   5996 O  O     . ARG F 3 261 ? 14.209  105.448 62.989  1.00 15.86 ? 1253 ARG B O     1 
ATOM   5997 C  CB    . ARG F 3 261 ? 14.029  106.601 66.154  1.00 16.65 ? 1253 ARG B CB    1 
ATOM   5998 C  CG    . ARG F 3 261 ? 12.656  106.982 65.621  1.00 16.84 ? 1253 ARG B CG    1 
ATOM   5999 C  CD    . ARG F 3 261 ? 11.791  107.716 66.635  1.00 17.31 ? 1253 ARG B CD    1 
ATOM   6000 N  NE    . ARG F 3 261 ? 10.569  108.195 65.996  1.00 17.75 ? 1253 ARG B NE    1 
ATOM   6001 C  CZ    . ARG F 3 261 ? 9.380   108.298 66.581  1.00 17.51 ? 1253 ARG B CZ    1 
ATOM   6002 N  NH1   . ARG F 3 261 ? 9.217   107.979 67.864  1.00 18.28 ? 1253 ARG B NH1   1 
ATOM   6003 N  NH2   . ARG F 3 261 ? 8.342   108.738 65.874  1.00 17.02 ? 1253 ARG B NH2   1 
ATOM   6004 N  N     . ASN F 3 262 ? 14.580  103.979 64.668  1.00 15.59 ? 1254 ASN B N     1 
ATOM   6005 C  CA    . ASN F 3 262 ? 14.120  102.800 63.947  1.00 15.21 ? 1254 ASN B CA    1 
ATOM   6006 C  C     . ASN F 3 262 ? 12.651  102.941 63.633  1.00 15.09 ? 1254 ASN B C     1 
ATOM   6007 O  O     . ASN F 3 262 ? 11.929  103.639 64.341  1.00 15.25 ? 1254 ASN B O     1 
ATOM   6008 C  CB    . ASN F 3 262 ? 14.314  101.531 64.776  1.00 15.25 ? 1254 ASN B CB    1 
ATOM   6009 C  CG    . ASN F 3 262 ? 15.733  101.365 65.277  1.00 14.97 ? 1254 ASN B CG    1 
ATOM   6010 O  OD1   . ASN F 3 262 ? 16.691  101.704 64.583  1.00 14.78 ? 1254 ASN B OD1   1 
ATOM   6011 N  ND2   . ASN F 3 262 ? 15.873  100.841 66.489  1.00 13.84 ? 1254 ASN B ND2   1 
ATOM   6012 N  N     . SER F 3 263 ? 12.206  102.261 62.584  1.00 14.73 ? 1255 SER B N     1 
ATOM   6013 C  CA    . SER F 3 263 ? 10.866  102.465 62.068  1.00 14.49 ? 1255 SER B CA    1 
ATOM   6014 C  C     . SER F 3 263 ? 10.472  101.368 61.085  1.00 14.30 ? 1255 SER B C     1 
ATOM   6015 O  O     . SER F 3 263 ? 11.311  100.613 60.612  1.00 14.34 ? 1255 SER B O     1 
ATOM   6016 C  CB    . SER F 3 263 ? 10.775  103.841 61.394  1.00 14.54 ? 1255 SER B CB    1 
ATOM   6017 O  OG    . SER F 3 263 ? 9.443   104.158 61.009  1.00 15.06 ? 1255 SER B OG    1 
ATOM   6018 N  N     . ARG F 3 264 ? 9.172   101.267 60.827  1.00 14.15 ? 1256 ARG B N     1 
ATOM   6019 C  CA    . ARG F 3 264 ? 8.626   100.404 59.787  1.00 14.02 ? 1256 ARG B CA    1 
ATOM   6020 C  C     . ARG F 3 264 ? 7.480   101.107 59.069  1.00 13.93 ? 1256 ARG B C     1 
ATOM   6021 O  O     . ARG F 3 264 ? 6.686   100.472 58.381  1.00 13.55 ? 1256 ARG B O     1 
ATOM   6022 C  CB    . ARG F 3 264 ? 8.113   99.098  60.395  1.00 14.04 ? 1256 ARG B CB    1 
ATOM   6023 C  CG    . ARG F 3 264 ? 9.186   98.248  61.043  1.00 14.01 ? 1256 ARG B CG    1 
ATOM   6024 C  CD    . ARG F 3 264 ? 8.704   96.876  61.504  1.00 13.49 ? 1256 ARG B CD    1 
ATOM   6025 N  NE    . ARG F 3 264 ? 7.881   96.200  60.500  1.00 13.25 ? 1256 ARG B NE    1 
ATOM   6026 C  CZ    . ARG F 3 264 ? 8.335   95.665  59.367  1.00 12.85 ? 1256 ARG B CZ    1 
ATOM   6027 N  NH1   . ARG F 3 264 ? 9.625   95.714  59.058  1.00 12.63 ? 1256 ARG B NH1   1 
ATOM   6028 N  NH2   . ARG F 3 264 ? 7.489   95.074  58.531  1.00 12.76 ? 1256 ARG B NH2   1 
ATOM   6029 N  N     . ASN F 3 265 ? 7.413   102.425 59.222  1.00 14.12 ? 1257 ASN B N     1 
ATOM   6030 C  CA    . ASN F 3 265 ? 6.308   103.216 58.701  1.00 14.35 ? 1257 ASN B CA    1 
ATOM   6031 C  C     . ASN F 3 265 ? 6.777   103.887 57.418  1.00 14.64 ? 1257 ASN B C     1 
ATOM   6032 O  O     . ASN F 3 265 ? 7.655   104.755 57.443  1.00 14.48 ? 1257 ASN B O     1 
ATOM   6033 C  CB    . ASN F 3 265 ? 5.858   104.247 59.748  1.00 14.24 ? 1257 ASN B CB    1 
ATOM   6034 C  CG    . ASN F 3 265 ? 4.703   105.108 59.271  1.00 14.13 ? 1257 ASN B CG    1 
ATOM   6035 O  OD1   . ASN F 3 265 ? 4.881   106.289 58.975  1.00 13.22 ? 1257 ASN B OD1   1 
ATOM   6036 N  ND2   . ASN F 3 265 ? 3.507   104.520 59.197  1.00 15.04 ? 1257 ASN B ND2   1 
ATOM   6037 N  N     . LEU F 3 266 ? 6.203   103.459 56.296  1.00 15.06 ? 1258 LEU B N     1 
ATOM   6038 C  CA    . LEU F 3 266 ? 6.628   103.925 54.976  1.00 15.26 ? 1258 LEU B CA    1 
ATOM   6039 C  C     . LEU F 3 266 ? 6.910   105.429 54.954  1.00 15.43 ? 1258 LEU B C     1 
ATOM   6040 O  O     . LEU F 3 266 ? 8.005   105.842 54.587  1.00 15.55 ? 1258 LEU B O     1 
ATOM   6041 C  CB    . LEU F 3 266 ? 5.585   103.569 53.902  1.00 15.21 ? 1258 LEU B CB    1 
ATOM   6042 C  CG    . LEU F 3 266 ? 6.029   103.801 52.446  1.00 15.40 ? 1258 LEU B CG    1 
ATOM   6043 C  CD1   . LEU F 3 266 ? 6.925   102.667 51.957  1.00 15.40 ? 1258 LEU B CD1   1 
ATOM   6044 C  CD2   . LEU F 3 266 ? 4.839   104.005 51.506  1.00 15.28 ? 1258 LEU B CD2   1 
ATOM   6045 N  N     . GLU F 3 267 ? 5.933   106.236 55.364  1.00 15.58 ? 1259 GLU B N     1 
ATOM   6046 C  CA    . GLU F 3 267 ? 6.023   107.697 55.225  1.00 15.62 ? 1259 GLU B CA    1 
ATOM   6047 C  C     . GLU F 3 267 ? 7.124   108.312 56.092  1.00 15.30 ? 1259 GLU B C     1 
ATOM   6048 O  O     . GLU F 3 267 ? 7.662   109.366 55.761  1.00 15.05 ? 1259 GLU B O     1 
ATOM   6049 C  CB    . GLU F 3 267 ? 4.676   108.362 55.548  1.00 15.89 ? 1259 GLU B CB    1 
ATOM   6050 C  CG    . GLU F 3 267 ? 3.482   107.852 54.734  1.00 16.60 ? 1259 GLU B CG    1 
ATOM   6051 C  CD    . GLU F 3 267 ? 3.674   107.977 53.230  1.00 17.37 ? 1259 GLU B CD    1 
ATOM   6052 O  OE1   . GLU F 3 267 ? 4.294   108.969 52.790  1.00 18.05 ? 1259 GLU B OE1   1 
ATOM   6053 O  OE2   . GLU F 3 267 ? 3.199   107.085 52.490  1.00 17.45 ? 1259 GLU B OE2   1 
ATOM   6054 N  N     . GLU F 3 268 ? 7.443   107.657 57.204  1.00 15.17 ? 1260 GLU B N     1 
ATOM   6055 C  CA    . GLU F 3 268 ? 8.520   108.102 58.090  1.00 15.04 ? 1260 GLU B CA    1 
ATOM   6056 C  C     . GLU F 3 268 ? 9.922   107.761 57.541  1.00 14.75 ? 1260 GLU B C     1 
ATOM   6057 O  O     . GLU F 3 268 ? 10.910  108.402 57.912  1.00 14.58 ? 1260 GLU B O     1 
ATOM   6058 C  CB    . GLU F 3 268 ? 8.328   107.505 59.489  1.00 14.98 ? 1260 GLU B CB    1 
ATOM   6059 C  CG    . GLU F 3 268 ? 9.512   107.735 60.422  1.00 16.05 ? 1260 GLU B CG    1 
ATOM   6060 C  CD    . GLU F 3 268 ? 9.182   107.525 61.888  1.00 16.79 ? 1260 GLU B CD    1 
ATOM   6061 O  OE1   . GLU F 3 268 ? 8.148   106.883 62.194  1.00 18.05 ? 1260 GLU B OE1   1 
ATOM   6062 O  OE2   . GLU F 3 268 ? 9.969   108.004 62.732  1.00 16.00 ? 1260 GLU B OE2   1 
ATOM   6063 N  N     . ILE F 3 269 ? 10.001  106.756 56.671  1.00 14.48 ? 1261 ILE B N     1 
ATOM   6064 C  CA    . ILE F 3 269 ? 11.266  106.342 56.059  1.00 14.43 ? 1261 ILE B CA    1 
ATOM   6065 C  C     . ILE F 3 269 ? 11.550  107.098 54.750  1.00 14.61 ? 1261 ILE B C     1 
ATOM   6066 O  O     . ILE F 3 269 ? 12.694  107.478 54.483  1.00 14.31 ? 1261 ILE B O     1 
ATOM   6067 C  CB    . ILE F 3 269 ? 11.263  104.809 55.825  1.00 14.25 ? 1261 ILE B CB    1 
ATOM   6068 C  CG1   . ILE F 3 269 ? 11.080  104.082 57.163  1.00 14.31 ? 1261 ILE B CG1   1 
ATOM   6069 C  CG2   . ILE F 3 269 ? 12.550  104.358 55.157  1.00 13.84 ? 1261 ILE B CG2   1 
ATOM   6070 C  CD1   . ILE F 3 269 ? 10.960  102.568 57.058  1.00 14.28 ? 1261 ILE B CD1   1 
ATOM   6071 N  N     . LYS F 3 270 ? 10.503  107.318 53.952  1.00 14.83 ? 1262 LYS B N     1 
ATOM   6072 C  CA    . LYS F 3 270 ? 10.619  107.938 52.621  1.00 14.95 ? 1262 LYS B CA    1 
ATOM   6073 C  C     . LYS F 3 270 ? 11.525  109.178 52.596  1.00 14.87 ? 1262 LYS B C     1 
ATOM   6074 O  O     . LYS F 3 270 ? 12.439  109.228 51.783  1.00 14.65 ? 1262 LYS B O     1 
ATOM   6075 C  CB    . LYS F 3 270 ? 9.228   108.284 52.041  1.00 15.10 ? 1262 LYS B CB    1 
ATOM   6076 C  CG    . LYS F 3 270 ? 8.623   107.211 51.136  1.00 15.27 ? 1262 LYS B CG    1 
ATOM   6077 C  CD    . LYS F 3 270 ? 7.098   107.262 51.122  1.00 15.48 ? 1262 LYS B CD    1 
ATOM   6078 C  CE    . LYS F 3 270 ? 6.567   108.496 50.391  1.00 16.36 ? 1262 LYS B CE    1 
ATOM   6079 N  NZ    . LYS F 3 270 ? 5.472   108.156 49.417  1.00 15.43 ? 1262 LYS B NZ    1 
ATOM   6080 N  N     . PRO F 3 271 ? 11.281  110.169 53.467  1.00 14.89 ? 1263 PRO B N     1 
ATOM   6081 C  CA    . PRO F 3 271 ? 12.118  111.378 53.514  1.00 14.77 ? 1263 PRO B CA    1 
ATOM   6082 C  C     . PRO F 3 271 ? 13.611  111.083 53.492  1.00 14.61 ? 1263 PRO B C     1 
ATOM   6083 O  O     . PRO F 3 271 ? 14.325  111.737 52.751  1.00 14.33 ? 1263 PRO B O     1 
ATOM   6084 C  CB    . PRO F 3 271 ? 11.733  112.023 54.851  1.00 14.65 ? 1263 PRO B CB    1 
ATOM   6085 C  CG    . PRO F 3 271 ? 10.361  111.578 55.106  1.00 14.73 ? 1263 PRO B CG    1 
ATOM   6086 C  CD    . PRO F 3 271 ? 10.196  110.236 54.464  1.00 14.68 ? 1263 PRO B CD    1 
ATOM   6087 N  N     . TYR F 3 272 ? 14.053  110.119 54.299  1.00 14.73 ? 1264 TYR B N     1 
ATOM   6088 C  CA    . TYR F 3 272 ? 15.462  109.722 54.368  1.00 14.70 ? 1264 TYR B CA    1 
ATOM   6089 C  C     . TYR F 3 272 ? 15.940  109.074 53.074  1.00 14.59 ? 1264 TYR B C     1 
ATOM   6090 O  O     . TYR F 3 272 ? 17.065  109.329 52.646  1.00 14.66 ? 1264 TYR B O     1 
ATOM   6091 C  CB    . TYR F 3 272 ? 15.709  108.732 55.517  1.00 14.67 ? 1264 TYR B CB    1 
ATOM   6092 C  CG    . TYR F 3 272 ? 15.544  109.299 56.910  1.00 14.77 ? 1264 TYR B CG    1 
ATOM   6093 C  CD1   . TYR F 3 272 ? 16.620  109.871 57.588  1.00 15.16 ? 1264 TYR B CD1   1 
ATOM   6094 C  CD2   . TYR F 3 272 ? 14.313  109.239 57.562  1.00 14.46 ? 1264 TYR B CD2   1 
ATOM   6095 C  CE1   . TYR F 3 272 ? 16.463  110.388 58.874  1.00 15.01 ? 1264 TYR B CE1   1 
ATOM   6096 C  CE2   . TYR F 3 272 ? 14.150  109.748 58.834  1.00 14.17 ? 1264 TYR B CE2   1 
ATOM   6097 C  CZ    . TYR F 3 272 ? 15.220  110.319 59.485  1.00 14.62 ? 1264 TYR B CZ    1 
ATOM   6098 O  OH    . TYR F 3 272 ? 15.039  110.816 60.750  1.00 15.20 ? 1264 TYR B OH    1 
ATOM   6099 N  N     . LEU F 3 273 ? 15.102  108.211 52.490  1.00 14.29 ? 1265 LEU B N     1 
ATOM   6100 C  CA    . LEU F 3 273 ? 15.429  107.501 51.246  1.00 14.02 ? 1265 LEU B CA    1 
ATOM   6101 C  C     . LEU F 3 273 ? 15.521  108.457 50.062  1.00 14.03 ? 1265 LEU B C     1 
ATOM   6102 O  O     . LEU F 3 273 ? 16.354  108.296 49.175  1.00 13.58 ? 1265 LEU B O     1 
ATOM   6103 C  CB    . LEU F 3 273 ? 14.373  106.430 50.952  1.00 13.93 ? 1265 LEU B CB    1 
ATOM   6104 C  CG    . LEU F 3 273 ? 14.442  105.618 49.648  1.00 13.28 ? 1265 LEU B CG    1 
ATOM   6105 C  CD1   . LEU F 3 273 ? 15.768  104.900 49.459  1.00 13.16 ? 1265 LEU B CD1   1 
ATOM   6106 C  CD2   . LEU F 3 273 ? 13.332  104.606 49.652  1.00 13.30 ? 1265 LEU B CD2   1 
ATOM   6107 N  N     . PHE F 3 274 ? 14.640  109.445 50.061  1.00 14.28 ? 1266 PHE B N     1 
ATOM   6108 C  CA    . PHE F 3 274 ? 14.599  110.442 49.012  1.00 14.54 ? 1266 PHE B CA    1 
ATOM   6109 C  C     . PHE F 3 274 ? 15.816  111.353 49.121  1.00 14.78 ? 1266 PHE B C     1 
ATOM   6110 O  O     . PHE F 3 274 ? 16.387  111.745 48.109  1.00 15.27 ? 1266 PHE B O     1 
ATOM   6111 C  CB    . PHE F 3 274 ? 13.301  111.254 49.103  1.00 14.51 ? 1266 PHE B CB    1 
ATOM   6112 C  CG    . PHE F 3 274 ? 12.043  110.464 48.797  1.00 14.32 ? 1266 PHE B CG    1 
ATOM   6113 C  CD1   . PHE F 3 274 ? 12.078  109.277 48.062  1.00 14.80 ? 1266 PHE B CD1   1 
ATOM   6114 C  CD2   . PHE F 3 274 ? 10.809  110.930 49.235  1.00 14.35 ? 1266 PHE B CD2   1 
ATOM   6115 C  CE1   . PHE F 3 274 ? 10.903  108.578 47.774  1.00 14.97 ? 1266 PHE B CE1   1 
ATOM   6116 C  CE2   . PHE F 3 274 ? 9.634   110.231 48.953  1.00 14.39 ? 1266 PHE B CE2   1 
ATOM   6117 C  CZ    . PHE F 3 274 ? 9.683   109.057 48.222  1.00 14.42 ? 1266 PHE B CZ    1 
ATOM   6118 N  N     . ARG F 3 275 ? 16.215  111.668 50.349  1.00 14.83 ? 1267 ARG B N     1 
ATOM   6119 C  CA    . ARG F 3 275 ? 17.411  112.462 50.612  1.00 14.87 ? 1267 ARG B CA    1 
ATOM   6120 C  C     . ARG F 3 275 ? 18.635  111.701 50.111  1.00 14.60 ? 1267 ARG B C     1 
ATOM   6121 O  O     . ARG F 3 275 ? 19.536  112.291 49.528  1.00 14.53 ? 1267 ARG B O     1 
ATOM   6122 C  CB    . ARG F 3 275 ? 17.533  112.739 52.115  1.00 15.14 ? 1267 ARG B CB    1 
ATOM   6123 C  CG    . ARG F 3 275 ? 18.298  114.005 52.490  1.00 16.66 ? 1267 ARG B CG    1 
ATOM   6124 C  CD    . ARG F 3 275 ? 18.341  114.279 54.022  1.00 18.64 ? 1267 ARG B CD    1 
ATOM   6125 N  NE    . ARG F 3 275 ? 16.999  114.283 54.638  1.00 19.40 ? 1267 ARG B NE    1 
ATOM   6126 C  CZ    . ARG F 3 275 ? 16.706  113.867 55.875  1.00 19.60 ? 1267 ARG B CZ    1 
ATOM   6127 N  NH1   . ARG F 3 275 ? 17.650  113.399 56.694  1.00 20.10 ? 1267 ARG B NH1   1 
ATOM   6128 N  NH2   . ARG F 3 275 ? 15.446  113.915 56.298  1.00 19.35 ? 1267 ARG B NH2   1 
ATOM   6129 N  N     . ALA F 3 276 ? 18.637  110.385 50.328  1.00 14.34 ? 1268 ALA B N     1 
ATOM   6130 C  CA    . ALA F 3 276 ? 19.704  109.497 49.877  1.00 14.10 ? 1268 ALA B CA    1 
ATOM   6131 C  C     . ALA F 3 276 ? 19.836  109.495 48.363  1.00 14.32 ? 1268 ALA B C     1 
ATOM   6132 O  O     . ALA F 3 276 ? 20.943  109.462 47.842  1.00 14.01 ? 1268 ALA B O     1 
ATOM   6133 C  CB    . ALA F 3 276 ? 19.453  108.093 50.365  1.00 13.90 ? 1268 ALA B CB    1 
ATOM   6134 N  N     . ILE F 3 277 ? 18.701  109.530 47.669  1.00 14.79 ? 1269 ILE B N     1 
ATOM   6135 C  CA    . ILE F 3 277 ? 18.668  109.561 46.213  1.00 15.15 ? 1269 ILE B CA    1 
ATOM   6136 C  C     . ILE F 3 277 ? 19.175  110.900 45.685  1.00 15.81 ? 1269 ILE B C     1 
ATOM   6137 O  O     . ILE F 3 277 ? 19.915  110.930 44.713  1.00 15.46 ? 1269 ILE B O     1 
ATOM   6138 C  CB    . ILE F 3 277 ? 17.229  109.275 45.696  1.00 15.21 ? 1269 ILE B CB    1 
ATOM   6139 C  CG1   . ILE F 3 277 ? 16.869  107.803 45.934  1.00 15.51 ? 1269 ILE B CG1   1 
ATOM   6140 C  CG2   . ILE F 3 277 ? 17.086  109.600 44.204  1.00 14.81 ? 1269 ILE B CG2   1 
ATOM   6141 C  CD1   . ILE F 3 277 ? 15.391  107.518 45.964  1.00 15.09 ? 1269 ILE B CD1   1 
ATOM   6142 N  N     . GLU F 3 278 ? 18.789  112.003 46.324  1.00 16.85 ? 1270 GLU B N     1 
ATOM   6143 C  CA    . GLU F 3 278 ? 19.190  113.327 45.846  1.00 17.76 ? 1270 GLU B CA    1 
ATOM   6144 C  C     . GLU F 3 278 ? 20.706  113.452 45.922  1.00 18.28 ? 1270 GLU B C     1 
ATOM   6145 O  O     . GLU F 3 278 ? 21.349  113.798 44.923  1.00 18.48 ? 1270 GLU B O     1 
ATOM   6146 C  CB    . GLU F 3 278 ? 18.517  114.459 46.636  1.00 17.78 ? 1270 GLU B CB    1 
ATOM   6147 C  CG    . GLU F 3 278 ? 17.042  114.674 46.308  1.00 19.30 ? 1270 GLU B CG    1 
ATOM   6148 C  CD    . GLU F 3 278 ? 16.779  115.148 44.874  1.00 22.35 ? 1270 GLU B CD    1 
ATOM   6149 O  OE1   . GLU F 3 278 ? 17.675  115.785 44.262  1.00 23.93 ? 1270 GLU B OE1   1 
ATOM   6150 O  OE2   . GLU F 3 278 ? 15.659  114.890 44.343  1.00 23.72 ? 1270 GLU B OE2   1 
ATOM   6151 N  N     . GLU F 3 279 ? 21.264  113.148 47.098  1.00 18.57 ? 1271 GLU B N     1 
ATOM   6152 C  CA    . GLU F 3 279 ? 22.712  113.157 47.314  1.00 18.93 ? 1271 GLU B CA    1 
ATOM   6153 C  C     . GLU F 3 279 ? 23.422  112.149 46.410  1.00 18.89 ? 1271 GLU B C     1 
ATOM   6154 O  O     . GLU F 3 279 ? 24.548  112.397 45.960  1.00 18.84 ? 1271 GLU B O     1 
ATOM   6155 C  CB    . GLU F 3 279 ? 23.050  112.861 48.780  1.00 19.16 ? 1271 GLU B CB    1 
ATOM   6156 C  CG    . GLU F 3 279 ? 22.690  113.984 49.749  1.00 20.94 ? 1271 GLU B CG    1 
ATOM   6157 C  CD    . GLU F 3 279 ? 22.838  113.577 51.210  1.00 23.31 ? 1271 GLU B CD    1 
ATOM   6158 O  OE1   . GLU F 3 279 ? 23.945  113.134 51.579  1.00 24.97 ? 1271 GLU B OE1   1 
ATOM   6159 O  OE2   . GLU F 3 279 ? 21.859  113.702 51.991  1.00 24.42 ? 1271 GLU B OE2   1 
ATOM   6160 N  N     . SER F 3 280 ? 22.766  111.021 46.148  1.00 18.73 ? 1272 SER B N     1 
ATOM   6161 C  CA    . SER F 3 280 ? 23.310  110.011 45.247  1.00 18.65 ? 1272 SER B CA    1 
ATOM   6162 C  C     . SER F 3 280 ? 23.400  110.593 43.856  1.00 18.62 ? 1272 SER B C     1 
ATOM   6163 O  O     . SER F 3 280 ? 24.410  110.458 43.178  1.00 18.37 ? 1272 SER B O     1 
ATOM   6164 C  CB    . SER F 3 280 ? 22.421  108.764 45.204  1.00 18.69 ? 1272 SER B CB    1 
ATOM   6165 O  OG    . SER F 3 280 ? 22.565  107.976 46.369  1.00 18.87 ? 1272 SER B OG    1 
ATOM   6166 N  N     . TYR F 3 281 ? 22.329  111.261 43.454  1.00 19.01 ? 1273 TYR B N     1 
ATOM   6167 C  CA    . TYR F 3 281 ? 22.164  111.706 42.077  1.00 19.33 ? 1273 TYR B CA    1 
ATOM   6168 C  C     . TYR F 3 281 ? 22.992  112.952 41.747  1.00 20.12 ? 1273 TYR B C     1 
ATOM   6169 O  O     . TYR F 3 281 ? 23.190  113.253 40.571  1.00 19.99 ? 1273 TYR B O     1 
ATOM   6170 C  CB    . TYR F 3 281 ? 20.678  111.927 41.757  1.00 19.02 ? 1273 TYR B CB    1 
ATOM   6171 C  CG    . TYR F 3 281 ? 20.243  111.181 40.535  1.00 18.25 ? 1273 TYR B CG    1 
ATOM   6172 C  CD1   . TYR F 3 281 ? 20.319  111.781 39.288  1.00 17.71 ? 1273 TYR B CD1   1 
ATOM   6173 C  CD2   . TYR F 3 281 ? 19.789  109.867 40.610  1.00 18.01 ? 1273 TYR B CD2   1 
ATOM   6174 C  CE1   . TYR F 3 281 ? 19.949  111.125 38.160  1.00 17.18 ? 1273 TYR B CE1   1 
ATOM   6175 C  CE2   . TYR F 3 281 ? 19.408  109.188 39.456  1.00 17.51 ? 1273 TYR B CE2   1 
ATOM   6176 C  CZ    . TYR F 3 281 ? 19.498  109.837 38.240  1.00 17.62 ? 1273 TYR B CZ    1 
ATOM   6177 O  OH    . TYR F 3 281 ? 19.140  109.234 37.061  1.00 20.72 ? 1273 TYR B OH    1 
ATOM   6178 N  N     . TYR F 3 282 ? 23.483  113.661 42.772  1.00 21.15 ? 1274 TYR B N     1 
ATOM   6179 C  CA    . TYR F 3 282 ? 24.422  114.765 42.555  1.00 21.89 ? 1274 TYR B CA    1 
ATOM   6180 C  C     . TYR F 3 282 ? 25.822  114.207 42.365  1.00 21.87 ? 1274 TYR B C     1 
ATOM   6181 O  O     . TYR F 3 282 ? 26.527  114.610 41.437  1.00 22.31 ? 1274 TYR B O     1 
ATOM   6182 C  CB    . TYR F 3 282 ? 24.410  115.810 43.691  1.00 22.31 ? 1274 TYR B CB    1 
ATOM   6183 C  CG    . TYR F 3 282 ? 25.090  117.128 43.287  1.00 24.54 ? 1274 TYR B CG    1 
ATOM   6184 C  CD1   . TYR F 3 282 ? 24.787  117.741 42.050  1.00 26.55 ? 1274 TYR B CD1   1 
ATOM   6185 C  CD2   . TYR F 3 282 ? 26.049  117.745 44.110  1.00 25.30 ? 1274 TYR B CD2   1 
ATOM   6186 C  CE1   . TYR F 3 282 ? 25.403  118.926 41.649  1.00 26.93 ? 1274 TYR B CE1   1 
ATOM   6187 C  CE2   . TYR F 3 282 ? 26.675  118.943 43.717  1.00 26.19 ? 1274 TYR B CE2   1 
ATOM   6188 C  CZ    . TYR F 3 282 ? 26.345  119.525 42.476  1.00 27.53 ? 1274 TYR B CZ    1 
ATOM   6189 O  OH    . TYR F 3 282 ? 26.935  120.703 42.035  1.00 28.55 ? 1274 TYR B OH    1 
ATOM   6190 N  N     . LYS F 3 283 ? 26.212  113.266 43.227  1.00 21.77 ? 1275 LYS B N     1 
ATOM   6191 C  CA    . LYS F 3 283 ? 27.478  112.549 43.066  1.00 21.78 ? 1275 LYS B CA    1 
ATOM   6192 C  C     . LYS F 3 283 ? 27.588  111.912 41.677  1.00 21.87 ? 1275 LYS B C     1 
ATOM   6193 O  O     . LYS F 3 283 ? 28.694  111.752 41.167  1.00 22.19 ? 1275 LYS B O     1 
ATOM   6194 C  CB    . LYS F 3 283 ? 27.647  111.450 44.129  1.00 21.83 ? 1275 LYS B CB    1 
ATOM   6195 C  CG    . LYS F 3 283 ? 28.085  111.924 45.536  1.00 22.15 ? 1275 LYS B CG    1 
ATOM   6196 C  CD    . LYS F 3 283 ? 28.264  110.717 46.502  1.00 22.05 ? 1275 LYS B CD    1 
ATOM   6197 C  CE    . LYS F 3 283 ? 28.269  111.141 47.983  1.00 22.53 ? 1275 LYS B CE    1 
ATOM   6198 N  NZ    . LYS F 3 283 ? 28.027  109.990 48.936  1.00 22.14 ? 1275 LYS B NZ    1 
ATOM   6199 N  N     . LEU F 3 284 ? 26.448  111.554 41.072  1.00 21.81 ? 1276 LEU B N     1 
ATOM   6200 C  CA    . LEU F 3 284 ? 26.428  110.832 39.793  1.00 21.54 ? 1276 LEU B CA    1 
ATOM   6201 C  C     . LEU F 3 284 ? 27.078  111.633 38.686  1.00 21.82 ? 1276 LEU B C     1 
ATOM   6202 O  O     . LEU F 3 284 ? 27.752  111.067 37.816  1.00 21.90 ? 1276 LEU B O     1 
ATOM   6203 C  CB    . LEU F 3 284 ? 25.002  110.468 39.366  1.00 21.28 ? 1276 LEU B CB    1 
ATOM   6204 C  CG    . LEU F 3 284 ? 24.406  109.143 39.852  1.00 20.98 ? 1276 LEU B CG    1 
ATOM   6205 C  CD1   . LEU F 3 284 ? 23.057  108.920 39.167  1.00 21.28 ? 1276 LEU B CD1   1 
ATOM   6206 C  CD2   . LEU F 3 284 ? 25.320  107.952 39.605  1.00 20.28 ? 1276 LEU B CD2   1 
ATOM   6207 N  N     . ASP F 3 285 ? 26.847  112.945 38.698  1.00 21.91 ? 1277 ASP B N     1 
ATOM   6208 C  CA    . ASP F 3 285 ? 27.519  113.850 37.768  1.00 21.92 ? 1277 ASP B CA    1 
ATOM   6209 C  C     . ASP F 3 285 ? 27.447  113.317 36.326  1.00 21.46 ? 1277 ASP B C     1 
ATOM   6210 O  O     . ASP F 3 285 ? 28.409  112.727 35.815  1.00 21.91 ? 1277 ASP B O     1 
ATOM   6211 C  CB    . ASP F 3 285 ? 28.978  114.040 38.228  1.00 22.22 ? 1277 ASP B CB    1 
ATOM   6212 C  CG    . ASP F 3 285 ? 29.738  115.055 37.392  1.00 23.11 ? 1277 ASP B CG    1 
ATOM   6213 O  OD1   . ASP F 3 285 ? 30.849  114.711 36.918  1.00 24.90 ? 1277 ASP B OD1   1 
ATOM   6214 O  OD2   . ASP F 3 285 ? 29.302  116.207 37.159  1.00 23.46 ? 1277 ASP B OD2   1 
ATOM   6215 N  N     . LYS F 3 286 ? 26.290  113.486 35.693  1.00 20.75 ? 1278 LYS B N     1 
ATOM   6216 C  CA    . LYS F 3 286 ? 26.122  113.170 34.264  1.00 20.35 ? 1278 LYS B CA    1 
ATOM   6217 C  C     . LYS F 3 286 ? 26.341  111.686 33.891  1.00 19.94 ? 1278 LYS B C     1 
ATOM   6218 O  O     . LYS F 3 286 ? 26.463  111.355 32.714  1.00 20.09 ? 1278 LYS B O     1 
ATOM   6219 C  CB    . LYS F 3 286 ? 27.026  114.073 33.392  1.00 20.36 ? 1278 LYS B CB    1 
ATOM   6220 C  CG    . LYS F 3 286 ? 27.074  115.560 33.817  1.00 20.22 ? 1278 LYS B CG    1 
ATOM   6221 C  CD    . LYS F 3 286 ? 26.601  116.525 32.728  1.00 20.16 ? 1278 LYS B CD    1 
ATOM   6222 C  CE    . LYS F 3 286 ? 26.473  117.958 33.277  1.00 20.30 ? 1278 LYS B CE    1 
ATOM   6223 N  NZ    . LYS F 3 286 ? 25.620  118.863 32.430  1.00 19.34 ? 1278 LYS B NZ    1 
ATOM   6224 N  N     . ARG F 3 287 ? 26.378  110.802 34.885  1.00 19.47 ? 1279 ARG B N     1 
ATOM   6225 C  CA    . ARG F 3 287 ? 26.450  109.365 34.647  1.00 19.04 ? 1279 ARG B CA    1 
ATOM   6226 C  C     . ARG F 3 287 ? 25.060  108.773 34.859  1.00 18.22 ? 1279 ARG B C     1 
ATOM   6227 O  O     . ARG F 3 287 ? 24.411  109.059 35.864  1.00 18.35 ? 1279 ARG B O     1 
ATOM   6228 C  CB    . ARG F 3 287 ? 27.429  108.706 35.619  1.00 19.40 ? 1279 ARG B CB    1 
ATOM   6229 C  CG    . ARG F 3 287 ? 28.882  109.104 35.437  1.00 19.92 ? 1279 ARG B CG    1 
ATOM   6230 C  CD    . ARG F 3 287 ? 29.790  108.572 36.537  1.00 20.55 ? 1279 ARG B CD    1 
ATOM   6231 N  NE    . ARG F 3 287 ? 29.887  109.516 37.659  1.00 21.26 ? 1279 ARG B NE    1 
ATOM   6232 C  CZ    . ARG F 3 287 ? 31.018  109.872 38.287  1.00 20.81 ? 1279 ARG B CZ    1 
ATOM   6233 N  NH1   . ARG F 3 287 ? 32.204  109.354 37.966  1.00 20.44 ? 1279 ARG B NH1   1 
ATOM   6234 N  NH2   . ARG F 3 287 ? 30.949  110.750 39.277  1.00 20.91 ? 1279 ARG B NH2   1 
ATOM   6235 N  N     . ILE F 3 288 ? 24.611  107.944 33.924  1.00 17.17 ? 1280 ILE B N     1 
ATOM   6236 C  CA    . ILE F 3 288 ? 23.275  107.369 33.981  1.00 16.39 ? 1280 ILE B CA    1 
ATOM   6237 C  C     . ILE F 3 288 ? 23.332  105.894 34.392  1.00 15.54 ? 1280 ILE B C     1 
ATOM   6238 O  O     . ILE F 3 288 ? 23.881  105.070 33.664  1.00 15.05 ? 1280 ILE B O     1 
ATOM   6239 C  CB    . ILE F 3 288 ? 22.580  107.482 32.607  1.00 16.49 ? 1280 ILE B CB    1 
ATOM   6240 C  CG1   . ILE F 3 288 ? 22.708  108.900 32.029  1.00 16.90 ? 1280 ILE B CG1   1 
ATOM   6241 C  CG2   . ILE F 3 288 ? 21.116  107.053 32.719  1.00 16.35 ? 1280 ILE B CG2   1 
ATOM   6242 C  CD1   . ILE F 3 288 ? 22.182  110.010 32.931  1.00 17.73 ? 1280 ILE B CD1   1 
ATOM   6243 N  N     . PRO F 3 289 ? 22.748  105.555 35.537  1.00 14.54 ? 1281 PRO B N     1 
ATOM   6244 C  CA    . PRO F 3 289 ? 22.653  104.156 35.956  1.00 13.93 ? 1281 PRO B CA    1 
ATOM   6245 C  C     . PRO F 3 289 ? 21.470  103.442 35.305  1.00 13.26 ? 1281 PRO B C     1 
ATOM   6246 O  O     . PRO F 3 289 ? 20.418  104.047 35.097  1.00 12.84 ? 1281 PRO B O     1 
ATOM   6247 C  CB    . PRO F 3 289 ? 22.447  104.263 37.465  1.00 14.03 ? 1281 PRO B CB    1 
ATOM   6248 C  CG    . PRO F 3 289 ? 21.732  105.557 37.660  1.00 14.32 ? 1281 PRO B CG    1 
ATOM   6249 C  CD    . PRO F 3 289 ? 22.139  106.461 36.526  1.00 14.52 ? 1281 PRO B CD    1 
ATOM   6250 N  N     . LYS F 3 290 ? 21.662  102.167 34.987  1.00 12.45 ? 1282 LYS B N     1 
ATOM   6251 C  CA    . LYS F 3 290 ? 20.592  101.309 34.503  1.00 11.93 ? 1282 LYS B CA    1 
ATOM   6252 C  C     . LYS F 3 290 ? 20.015  100.493 35.657  1.00 11.25 ? 1282 LYS B C     1 
ATOM   6253 O  O     . LYS F 3 290 ? 18.930  99.945  35.536  1.00 11.02 ? 1282 LYS B O     1 
ATOM   6254 C  CB    . LYS F 3 290 ? 21.107  100.370 33.403  1.00 12.11 ? 1282 LYS B CB    1 
ATOM   6255 C  CG    . LYS F 3 290 ? 21.384  101.058 32.057  1.00 12.69 ? 1282 LYS B CG    1 
ATOM   6256 C  CD    . LYS F 3 290 ? 21.793  100.064 30.950  1.00 13.15 ? 1282 LYS B CD    1 
ATOM   6257 C  CE    . LYS F 3 290 ? 23.317  99.991  30.738  1.00 13.96 ? 1282 LYS B CE    1 
ATOM   6258 N  NZ    . LYS F 3 290 ? 23.695  99.956  29.278  1.00 14.34 ? 1282 LYS B NZ    1 
ATOM   6259 N  N     . ALA F 3 291 ? 20.744  100.417 36.772  1.00 10.70 ? 1283 ALA B N     1 
ATOM   6260 C  CA    . ALA F 3 291 ? 20.332  99.626  37.937  1.00 10.18 ? 1283 ALA B CA    1 
ATOM   6261 C  C     . ALA F 3 291 ? 20.236  100.475 39.199  1.00 9.35  ? 1283 ALA B C     1 
ATOM   6262 O  O     . ALA F 3 291 ? 21.019  101.386 39.395  1.00 8.96  ? 1283 ALA B O     1 
ATOM   6263 C  CB    . ALA F 3 291 ? 21.299  98.475  38.150  1.00 10.07 ? 1283 ALA B CB    1 
ATOM   6264 N  N     . ILE F 3 292 ? 19.256  100.166 40.037  1.00 9.08  ? 1284 ILE B N     1 
ATOM   6265 C  CA    . ILE F 3 292 ? 19.062  100.829 41.330  1.00 9.10  ? 1284 ILE B CA    1 
ATOM   6266 C  C     . ILE F 3 292 ? 18.809  99.772  42.404  1.00 9.00  ? 1284 ILE B C     1 
ATOM   6267 O  O     . ILE F 3 292 ? 18.160  98.771  42.154  1.00 8.75  ? 1284 ILE B O     1 
ATOM   6268 C  CB    . ILE F 3 292 ? 17.884  101.848 41.284  1.00 9.04  ? 1284 ILE B CB    1 
ATOM   6269 C  CG1   . ILE F 3 292 ? 17.605  102.416 42.686  1.00 9.18  ? 1284 ILE B CG1   1 
ATOM   6270 C  CG2   . ILE F 3 292 ? 16.627  101.203 40.710  1.00 8.98  ? 1284 ILE B CG2   1 
ATOM   6271 C  CD1   . ILE F 3 292 ? 16.643  103.586 42.725  1.00 9.53  ? 1284 ILE B CD1   1 
ATOM   6272 N  N     . HIS F 3 293 ? 19.296  100.021 43.611  1.00 9.28  ? 1285 HIS B N     1 
ATOM   6273 C  CA    . HIS F 3 293 ? 19.183  99.059  44.704  1.00 9.27  ? 1285 HIS B CA    1 
ATOM   6274 C  C     . HIS F 3 293 ? 18.891  99.787  45.998  1.00 8.89  ? 1285 HIS B C     1 
ATOM   6275 O  O     . HIS F 3 293 ? 19.734  100.505 46.468  1.00 9.05  ? 1285 HIS B O     1 
ATOM   6276 C  CB    . HIS F 3 293 ? 20.504  98.299  44.852  1.00 9.39  ? 1285 HIS B CB    1 
ATOM   6277 C  CG    . HIS F 3 293 ? 20.625  97.100  43.965  1.00 9.09  ? 1285 HIS B CG    1 
ATOM   6278 N  ND1   . HIS F 3 293 ? 20.172  95.855  44.339  1.00 9.22  ? 1285 HIS B ND1   1 
ATOM   6279 C  CD2   . HIS F 3 293 ? 21.175  96.948  42.739  1.00 8.84  ? 1285 HIS B CD2   1 
ATOM   6280 C  CE1   . HIS F 3 293 ? 20.420  94.991  43.372  1.00 9.53  ? 1285 HIS B CE1   1 
ATOM   6281 N  NE2   . HIS F 3 293 ? 21.027  95.630  42.390  1.00 9.29  ? 1285 HIS B NE2   1 
ATOM   6282 N  N     . VAL F 3 294 ? 17.710  99.601  46.568  1.00 8.99  ? 1286 VAL B N     1 
ATOM   6283 C  CA    . VAL F 3 294 ? 17.411  100.107 47.903  1.00 9.48  ? 1286 VAL B CA    1 
ATOM   6284 C  C     . VAL F 3 294 ? 17.998  99.185  48.968  1.00 9.66  ? 1286 VAL B C     1 
ATOM   6285 O  O     . VAL F 3 294 ? 17.631  98.026  49.033  1.00 9.64  ? 1286 VAL B O     1 
ATOM   6286 C  CB    . VAL F 3 294 ? 15.902  100.201 48.131  1.00 9.70  ? 1286 VAL B CB    1 
ATOM   6287 C  CG1   . VAL F 3 294 ? 15.592  100.559 49.576  1.00 10.08 ? 1286 VAL B CG1   1 
ATOM   6288 C  CG2   . VAL F 3 294 ? 15.285  101.224 47.191  1.00 10.37 ? 1286 VAL B CG2   1 
ATOM   6289 N  N     . VAL F 3 295 ? 18.893  99.709  49.803  1.00 10.15 ? 1287 VAL B N     1 
ATOM   6290 C  CA    . VAL F 3 295 ? 19.545  98.938  50.866  1.00 10.55 ? 1287 VAL B CA    1 
ATOM   6291 C  C     . VAL F 3 295 ? 19.085  99.355  52.259  1.00 11.05 ? 1287 VAL B C     1 
ATOM   6292 O  O     . VAL F 3 295 ? 19.394  100.450 52.707  1.00 11.23 ? 1287 VAL B O     1 
ATOM   6293 C  CB    . VAL F 3 295 ? 21.077  99.125  50.828  1.00 10.46 ? 1287 VAL B CB    1 
ATOM   6294 C  CG1   . VAL F 3 295 ? 21.743  98.230  51.872  1.00 10.62 ? 1287 VAL B CG1   1 
ATOM   6295 C  CG2   . VAL F 3 295 ? 21.632  98.837  49.439  1.00 10.39 ? 1287 VAL B CG2   1 
ATOM   6296 N  N     . ALA F 3 296 ? 18.369  98.475  52.950  1.00 11.90 ? 1288 ALA B N     1 
ATOM   6297 C  CA    . ALA F 3 296 ? 17.983  98.703  54.348  1.00 12.62 ? 1288 ALA B CA    1 
ATOM   6298 C  C     . ALA F 3 296 ? 18.920  97.964  55.300  1.00 13.28 ? 1288 ALA B C     1 
ATOM   6299 O  O     . ALA F 3 296 ? 19.271  96.809  55.058  1.00 13.56 ? 1288 ALA B O     1 
ATOM   6300 C  CB    . ALA F 3 296 ? 16.544  98.258  54.583  1.00 12.56 ? 1288 ALA B CB    1 
ATOM   6301 N  N     . VAL F 3 297 ? 19.344  98.642  56.366  1.00 13.88 ? 1289 VAL B N     1 
ATOM   6302 C  CA    . VAL F 3 297 ? 20.108  98.015  57.439  1.00 14.31 ? 1289 VAL B CA    1 
ATOM   6303 C  C     . VAL F 3 297 ? 19.200  97.957  58.649  1.00 14.92 ? 1289 VAL B C     1 
ATOM   6304 O  O     . VAL F 3 297 ? 18.772  98.988  59.149  1.00 15.04 ? 1289 VAL B O     1 
ATOM   6305 C  CB    . VAL F 3 297 ? 21.375  98.811  57.803  1.00 14.39 ? 1289 VAL B CB    1 
ATOM   6306 C  CG1   . VAL F 3 297 ? 22.046  98.227  59.059  1.00 14.29 ? 1289 VAL B CG1   1 
ATOM   6307 C  CG2   . VAL F 3 297 ? 22.353  98.835  56.629  1.00 14.01 ? 1289 VAL B CG2   1 
ATOM   6308 N  N     . THR F 3 298 ? 18.927  96.746  59.118  1.00 15.40 ? 1290 THR B N     1 
ATOM   6309 C  CA    . THR F 3 298 ? 17.975  96.505  60.194  1.00 15.70 ? 1290 THR B CA    1 
ATOM   6310 C  C     . THR F 3 298 ? 18.489  96.916  61.590  1.00 16.21 ? 1290 THR B C     1 
ATOM   6311 O  O     . THR F 3 298 ? 19.618  97.400  61.741  1.00 15.71 ? 1290 THR B O     1 
ATOM   6312 C  CB    . THR F 3 298 ? 17.590  95.003  60.208  1.00 15.82 ? 1290 THR B CB    1 
ATOM   6313 O  OG1   . THR F 3 298 ? 18.763  94.190  60.370  1.00 15.79 ? 1290 THR B OG1   1 
ATOM   6314 C  CG2   . THR F 3 298 ? 17.003  94.566  58.866  1.00 15.76 ? 1290 THR B CG2   1 
ATOM   6315 N  N     . GLU F 3 299 ? 17.622  96.722  62.589  1.00 16.81 ? 1291 GLU B N     1 
ATOM   6316 C  CA    . GLU F 3 299 ? 17.921  96.898  64.014  1.00 17.40 ? 1291 GLU B CA    1 
ATOM   6317 C  C     . GLU F 3 299 ? 19.297  96.393  64.407  1.00 17.64 ? 1291 GLU B C     1 
ATOM   6318 O  O     . GLU F 3 299 ? 20.060  97.087  65.088  1.00 17.55 ? 1291 GLU B O     1 
ATOM   6319 C  CB    . GLU F 3 299 ? 16.938  96.059  64.836  1.00 17.71 ? 1291 GLU B CB    1 
ATOM   6320 C  CG    . GLU F 3 299 ? 15.546  96.633  65.008  1.00 18.59 ? 1291 GLU B CG    1 
ATOM   6321 C  CD    . GLU F 3 299 ? 14.956  96.281  66.362  1.00 20.14 ? 1291 GLU B CD    1 
ATOM   6322 O  OE1   . GLU F 3 299 ? 13.815  95.741  66.396  1.00 21.02 ? 1291 GLU B OE1   1 
ATOM   6323 O  OE2   . GLU F 3 299 ? 15.644  96.538  67.389  1.00 19.68 ? 1291 GLU B OE2   1 
ATOM   6324 N  N     . ASP F 3 300 ? 19.572  95.160  63.976  1.00 17.86 ? 1292 ASP B N     1 
ATOM   6325 C  CA    . ASP F 3 300 ? 20.709  94.359  64.435  1.00 18.16 ? 1292 ASP B CA    1 
ATOM   6326 C  C     . ASP F 3 300 ? 21.889  94.364  63.444  1.00 18.28 ? 1292 ASP B C     1 
ATOM   6327 O  O     . ASP F 3 300 ? 22.723  93.455  63.439  1.00 18.46 ? 1292 ASP B O     1 
ATOM   6328 C  CB    . ASP F 3 300 ? 20.255  92.915  64.741  1.00 18.28 ? 1292 ASP B CB    1 
ATOM   6329 C  CG    . ASP F 3 300 ? 19.164  92.405  63.788  1.00 19.36 ? 1292 ASP B CG    1 
ATOM   6330 O  OD1   . ASP F 3 300 ? 18.222  91.740  64.284  1.00 20.09 ? 1292 ASP B OD1   1 
ATOM   6331 O  OD2   . ASP F 3 300 ? 19.165  92.609  62.544  1.00 20.14 ? 1292 ASP B OD2   1 
ATOM   6332 N  N     . LEU F 3 301 ? 21.951  95.401  62.614  1.00 18.27 ? 1293 LEU B N     1 
ATOM   6333 C  CA    . LEU F 3 301 ? 23.012  95.584  61.624  1.00 18.31 ? 1293 LEU B CA    1 
ATOM   6334 C  C     . LEU F 3 301 ? 23.092  94.525  60.521  1.00 18.08 ? 1293 LEU B C     1 
ATOM   6335 O  O     . LEU F 3 301 ? 24.061  94.513  59.762  1.00 18.20 ? 1293 LEU B O     1 
ATOM   6336 C  CB    . LEU F 3 301 ? 24.369  95.745  62.308  1.00 18.23 ? 1293 LEU B CB    1 
ATOM   6337 C  CG    . LEU F 3 301 ? 24.465  96.856  63.356  1.00 19.24 ? 1293 LEU B CG    1 
ATOM   6338 C  CD1   . LEU F 3 301 ? 25.942  97.277  63.531  1.00 20.59 ? 1293 LEU B CD1   1 
ATOM   6339 C  CD2   . LEU F 3 301 ? 23.619  98.079  63.011  1.00 19.45 ? 1293 LEU B CD2   1 
ATOM   6340 N  N     . ASP F 3 302 ? 22.080  93.663  60.416  1.00 17.75 ? 1294 ASP B N     1 
ATOM   6341 C  CA    . ASP F 3 302 ? 21.962  92.749  59.275  1.00 17.84 ? 1294 ASP B CA    1 
ATOM   6342 C  C     . ASP F 3 302 ? 21.449  93.573  58.066  1.00 17.26 ? 1294 ASP B C     1 
ATOM   6343 O  O     . ASP F 3 302 ? 20.932  94.678  58.242  1.00 17.03 ? 1294 ASP B O     1 
ATOM   6344 C  CB    . ASP F 3 302 ? 21.054  91.536  59.618  1.00 17.99 ? 1294 ASP B CB    1 
ATOM   6345 C  CG    . ASP F 3 302 ? 21.711  90.544  60.645  1.00 19.18 ? 1294 ASP B CG    1 
ATOM   6346 O  OD1   . ASP F 3 302 ? 22.507  90.977  61.520  1.00 20.39 ? 1294 ASP B OD1   1 
ATOM   6347 O  OD2   . ASP F 3 302 ? 21.486  89.307  60.664  1.00 19.69 ? 1294 ASP B OD2   1 
ATOM   6348 N  N     . ILE F 3 303 ? 21.624  93.065  56.847  1.00 16.61 ? 1295 ILE B N     1 
ATOM   6349 C  CA    . ILE F 3 303 ? 21.332  93.854  55.644  1.00 16.17 ? 1295 ILE B CA    1 
ATOM   6350 C  C     . ILE F 3 303 ? 20.374  93.165  54.667  1.00 15.93 ? 1295 ILE B C     1 
ATOM   6351 O  O     . ILE F 3 303 ? 20.628  92.061  54.206  1.00 16.21 ? 1295 ILE B O     1 
ATOM   6352 C  CB    . ILE F 3 303 ? 22.644  94.211  54.929  1.00 16.03 ? 1295 ILE B CB    1 
ATOM   6353 C  CG1   . ILE F 3 303 ? 23.583  94.936  55.905  1.00 15.93 ? 1295 ILE B CG1   1 
ATOM   6354 C  CG2   . ILE F 3 303 ? 22.352  95.033  53.678  1.00 16.43 ? 1295 ILE B CG2   1 
ATOM   6355 C  CD1   . ILE F 3 303 ? 24.505  95.977  55.292  1.00 15.48 ? 1295 ILE B CD1   1 
ATOM   6356 N  N     . VAL F 3 304 ? 19.272  93.837  54.361  1.00 15.67 ? 1296 VAL B N     1 
ATOM   6357 C  CA    . VAL F 3 304 ? 18.312  93.387  53.365  1.00 15.40 ? 1296 VAL B CA    1 
ATOM   6358 C  C     . VAL F 3 304 ? 18.381  94.356  52.202  1.00 15.22 ? 1296 VAL B C     1 
ATOM   6359 O  O     . VAL F 3 304 ? 18.338  95.564  52.404  1.00 14.97 ? 1296 VAL B O     1 
ATOM   6360 C  CB    . VAL F 3 304 ? 16.882  93.401  53.940  1.00 15.59 ? 1296 VAL B CB    1 
ATOM   6361 C  CG1   . VAL F 3 304 ? 15.830  93.309  52.829  1.00 15.83 ? 1296 VAL B CG1   1 
ATOM   6362 C  CG2   . VAL F 3 304 ? 16.698  92.272  54.946  1.00 15.62 ? 1296 VAL B CG2   1 
ATOM   6363 N  N     . SER F 3 305 ? 18.475  93.825  50.986  1.00 15.15 ? 1297 SER B N     1 
ATOM   6364 C  CA    . SER F 3 305 ? 18.516  94.655  49.780  1.00 15.09 ? 1297 SER B CA    1 
ATOM   6365 C  C     . SER F 3 305 ? 17.551  94.174  48.685  1.00 14.66 ? 1297 SER B C     1 
ATOM   6366 O  O     . SER F 3 305 ? 17.573  93.007  48.303  1.00 14.55 ? 1297 SER B O     1 
ATOM   6367 C  CB    . SER F 3 305 ? 19.936  94.694  49.210  1.00 15.22 ? 1297 SER B CB    1 
ATOM   6368 O  OG    . SER F 3 305 ? 19.899  94.843  47.794  1.00 15.88 ? 1297 SER B OG    1 
ATOM   6369 N  N     . ARG F 3 306 ? 16.720  95.089  48.185  1.00 14.33 ? 1298 ARG B N     1 
ATOM   6370 C  CA    . ARG F 3 306 ? 15.883  94.855  47.004  1.00 13.99 ? 1298 ARG B CA    1 
ATOM   6371 C  C     . ARG F 3 306 ? 16.277  95.836  45.900  1.00 13.61 ? 1298 ARG B C     1 
ATOM   6372 O  O     . ARG F 3 306 ? 16.409  97.028  46.151  1.00 13.83 ? 1298 ARG B O     1 
ATOM   6373 C  CB    . ARG F 3 306 ? 14.406  95.046  47.351  1.00 13.90 ? 1298 ARG B CB    1 
ATOM   6374 C  CG    . ARG F 3 306 ? 13.858  94.019  48.316  1.00 14.41 ? 1298 ARG B CG    1 
ATOM   6375 C  CD    . ARG F 3 306 ? 13.777  92.614  47.736  1.00 15.79 ? 1298 ARG B CD    1 
ATOM   6376 N  NE    . ARG F 3 306 ? 13.276  91.625  48.694  1.00 15.75 ? 1298 ARG B NE    1 
ATOM   6377 C  CZ    . ARG F 3 306 ? 13.990  91.097  49.684  1.00 15.64 ? 1298 ARG B CZ    1 
ATOM   6378 N  NH1   . ARG F 3 306 ? 15.252  91.454  49.881  1.00 15.91 ? 1298 ARG B NH1   1 
ATOM   6379 N  NH2   . ARG F 3 306 ? 13.439  90.202  50.492  1.00 16.05 ? 1298 ARG B NH2   1 
ATOM   6380 N  N     . GLY F 3 307 ? 16.462  95.330  44.685  1.00 13.20 ? 1299 GLY B N     1 
ATOM   6381 C  CA    . GLY F 3 307 ? 16.778  96.159  43.534  1.00 12.94 ? 1299 GLY B CA    1 
ATOM   6382 C  C     . GLY F 3 307 ? 16.095  95.723  42.246  1.00 12.79 ? 1299 GLY B C     1 
ATOM   6383 O  O     . GLY F 3 307 ? 15.252  94.813  42.233  1.00 12.66 ? 1299 GLY B O     1 
ATOM   6384 N  N     . ARG F 3 308 ? 16.478  96.385  41.156  1.00 12.72 ? 1300 ARG B N     1 
ATOM   6385 C  CA    . ARG F 3 308 ? 15.927  96.116  39.823  1.00 12.90 ? 1300 ARG B CA    1 
ATOM   6386 C  C     . ARG F 3 308 ? 16.795  96.753  38.732  1.00 12.68 ? 1300 ARG B C     1 
ATOM   6387 O  O     . ARG F 3 308 ? 17.303  97.863  38.883  1.00 12.26 ? 1300 ARG B O     1 
ATOM   6388 C  CB    . ARG F 3 308 ? 14.477  96.629  39.726  1.00 13.01 ? 1300 ARG B CB    1 
ATOM   6389 C  CG    . ARG F 3 308 ? 13.879  96.681  38.321  1.00 13.26 ? 1300 ARG B CG    1 
ATOM   6390 C  CD    . ARG F 3 308 ? 12.386  97.013  38.279  1.00 14.24 ? 1300 ARG B CD    1 
ATOM   6391 N  NE    . ARG F 3 308 ? 11.847  96.851  36.922  1.00 16.08 ? 1300 ARG B NE    1 
ATOM   6392 C  CZ    . ARG F 3 308 ? 10.744  97.445  36.439  1.00 16.73 ? 1300 ARG B CZ    1 
ATOM   6393 N  NH1   . ARG F 3 308 ? 10.004  98.265  37.192  1.00 17.07 ? 1300 ARG B NH1   1 
ATOM   6394 N  NH2   . ARG F 3 308 ? 10.376  97.214  35.183  1.00 16.08 ? 1300 ARG B NH2   1 
ATOM   6395 N  N     . THR F 3 309 ? 16.951  96.038  37.629  1.00 12.85 ? 1301 THR B N     1 
ATOM   6396 C  CA    . THR F 3 309 ? 17.665  96.551  36.467  1.00 13.11 ? 1301 THR B CA    1 
ATOM   6397 C  C     . THR F 3 309 ? 16.653  96.901  35.374  1.00 13.13 ? 1301 THR B C     1 
ATOM   6398 O  O     . THR F 3 309 ? 15.729  96.132  35.083  1.00 13.24 ? 1301 THR B O     1 
ATOM   6399 C  CB    . THR F 3 309 ? 18.719  95.527  35.963  1.00 13.24 ? 1301 THR B CB    1 
ATOM   6400 O  OG1   . THR F 3 309 ? 19.712  95.302  36.984  1.00 12.95 ? 1301 THR B OG1   1 
ATOM   6401 C  CG2   . THR F 3 309 ? 19.521  96.090  34.789  1.00 12.84 ? 1301 THR B CG2   1 
ATOM   6402 N  N     . PHE F 3 310 ? 16.830  98.087  34.803  1.00 13.09 ? 1302 PHE B N     1 
ATOM   6403 C  CA    . PHE F 3 310 ? 15.996  98.592  33.723  1.00 13.09 ? 1302 PHE B CA    1 
ATOM   6404 C  C     . PHE F 3 310 ? 16.740  98.461  32.390  1.00 13.00 ? 1302 PHE B C     1 
ATOM   6405 O  O     . PHE F 3 310 ? 17.966  98.545  32.366  1.00 13.26 ? 1302 PHE B O     1 
ATOM   6406 C  CB    . PHE F 3 310 ? 15.669  100.065 33.979  1.00 13.03 ? 1302 PHE B CB    1 
ATOM   6407 C  CG    . PHE F 3 310 ? 14.620  100.279 35.019  1.00 12.26 ? 1302 PHE B CG    1 
ATOM   6408 C  CD1   . PHE F 3 310 ? 14.957  100.321 36.356  1.00 11.48 ? 1302 PHE B CD1   1 
ATOM   6409 C  CD2   . PHE F 3 310 ? 13.291  100.446 34.655  1.00 11.75 ? 1302 PHE B CD2   1 
ATOM   6410 C  CE1   . PHE F 3 310 ? 13.986  100.528 37.320  1.00 11.55 ? 1302 PHE B CE1   1 
ATOM   6411 C  CE2   . PHE F 3 310 ? 12.316  100.654 35.613  1.00 11.60 ? 1302 PHE B CE2   1 
ATOM   6412 C  CZ    . PHE F 3 310 ? 12.663  100.697 36.947  1.00 11.50 ? 1302 PHE B CZ    1 
ATOM   6413 N  N     . PRO F 3 311 ? 16.027  98.276  31.282  1.00 12.86 ? 1303 PRO B N     1 
ATOM   6414 C  CA    . PRO F 3 311 ? 16.694  98.186  29.972  1.00 12.94 ? 1303 PRO B CA    1 
ATOM   6415 C  C     . PRO F 3 311 ? 17.167  99.539  29.413  1.00 13.03 ? 1303 PRO B C     1 
ATOM   6416 O  O     . PRO F 3 311 ? 17.862  99.557  28.398  1.00 12.87 ? 1303 PRO B O     1 
ATOM   6417 C  CB    . PRO F 3 311 ? 15.625  97.557  29.065  1.00 12.71 ? 1303 PRO B CB    1 
ATOM   6418 C  CG    . PRO F 3 311 ? 14.442  97.271  29.947  1.00 12.68 ? 1303 PRO B CG    1 
ATOM   6419 C  CD    . PRO F 3 311 ? 14.567  98.134  31.160  1.00 12.80 ? 1303 PRO B CD    1 
ATOM   6420 N  N     . HIS F 3 312 ? 16.775  100.643 30.049  1.00 13.25 ? 1304 HIS B N     1 
ATOM   6421 C  CA    . HIS F 3 312 ? 17.269  101.971 29.695  1.00 13.60 ? 1304 HIS B CA    1 
ATOM   6422 C  C     . HIS F 3 312 ? 17.759  102.709 30.968  1.00 13.22 ? 1304 HIS B C     1 
ATOM   6423 O  O     . HIS F 3 312 ? 17.833  102.120 32.055  1.00 13.22 ? 1304 HIS B O     1 
ATOM   6424 C  CB    . HIS F 3 312 ? 16.187  102.741 28.920  1.00 13.86 ? 1304 HIS B CB    1 
ATOM   6425 C  CG    . HIS F 3 312 ? 15.803  102.101 27.604  1.00 16.66 ? 1304 HIS B CG    1 
ATOM   6426 N  ND1   . HIS F 3 312 ? 16.732  101.613 26.703  1.00 18.99 ? 1304 HIS B ND1   1 
ATOM   6427 C  CD2   . HIS F 3 312 ? 14.588  101.876 27.039  1.00 18.41 ? 1304 HIS B CD2   1 
ATOM   6428 C  CE1   . HIS F 3 312 ? 16.108  101.118 25.645  1.00 19.39 ? 1304 HIS B CE1   1 
ATOM   6429 N  NE2   . HIS F 3 312 ? 14.806  101.266 25.823  1.00 19.14 ? 1304 HIS B NE2   1 
ATOM   6430 N  N     . GLY F 3 313 ? 18.138  103.975 30.831  1.00 12.74 ? 1305 GLY B N     1 
ATOM   6431 C  CA    . GLY F 3 313 ? 18.614  104.763 31.958  1.00 12.18 ? 1305 GLY B CA    1 
ATOM   6432 C  C     . GLY F 3 313 ? 17.523  105.166 32.934  1.00 11.75 ? 1305 GLY B C     1 
ATOM   6433 O  O     . GLY F 3 313 ? 16.337  105.172 32.585  1.00 11.54 ? 1305 GLY B O     1 
ATOM   6434 N  N     . ILE F 3 314 ? 17.938  105.509 34.155  1.00 11.32 ? 1306 ILE B N     1 
ATOM   6435 C  CA    . ILE F 3 314 ? 17.023  105.845 35.250  1.00 11.03 ? 1306 ILE B CA    1 
ATOM   6436 C  C     . ILE F 3 314 ? 17.105  107.332 35.537  1.00 10.71 ? 1306 ILE B C     1 
ATOM   6437 O  O     . ILE F 3 314 ? 18.156  107.825 35.915  1.00 10.19 ? 1306 ILE B O     1 
ATOM   6438 C  CB    . ILE F 3 314 ? 17.391  105.087 36.544  1.00 11.10 ? 1306 ILE B CB    1 
ATOM   6439 C  CG1   . ILE F 3 314 ? 17.302  103.575 36.349  1.00 10.94 ? 1306 ILE B CG1   1 
ATOM   6440 C  CG2   . ILE F 3 314 ? 16.467  105.512 37.695  1.00 11.40 ? 1306 ILE B CG2   1 
ATOM   6441 C  CD1   . ILE F 3 314 ? 17.851  102.777 37.532  1.00 10.59 ? 1306 ILE B CD1   1 
ATOM   6442 N  N     . SER F 3 315 ? 15.999  108.041 35.360  1.00 10.69 ? 1307 SER B N     1 
ATOM   6443 C  CA    . SER F 3 315 ? 15.928  109.453 35.700  1.00 10.82 ? 1307 SER B CA    1 
ATOM   6444 C  C     . SER F 3 315 ? 15.651  109.567 37.181  1.00 11.05 ? 1307 SER B C     1 
ATOM   6445 O  O     . SER F 3 315 ? 15.121  108.641 37.771  1.00 11.12 ? 1307 SER B O     1 
ATOM   6446 C  CB    . SER F 3 315 ? 14.805  110.130 34.924  1.00 10.86 ? 1307 SER B CB    1 
ATOM   6447 O  OG    . SER F 3 315 ? 13.542  109.708 35.402  1.00 10.52 ? 1307 SER B OG    1 
ATOM   6448 N  N     . LYS F 3 316 ? 16.000  110.703 37.773  1.00 11.40 ? 1308 LYS B N     1 
ATOM   6449 C  CA    . LYS F 3 316 ? 15.749  110.959 39.193  1.00 11.81 ? 1308 LYS B CA    1 
ATOM   6450 C  C     . LYS F 3 316 ? 14.305  110.631 39.597  1.00 11.89 ? 1308 LYS B C     1 
ATOM   6451 O  O     . LYS F 3 316 ? 14.053  110.105 40.669  1.00 11.83 ? 1308 LYS B O     1 
ATOM   6452 C  CB    . LYS F 3 316 ? 16.054  112.425 39.526  1.00 11.94 ? 1308 LYS B CB    1 
ATOM   6453 C  CG    . LYS F 3 316 ? 16.118  112.736 41.014  1.00 12.71 ? 1308 LYS B CG    1 
ATOM   6454 C  CD    . LYS F 3 316 ? 17.115  113.868 41.334  1.00 14.21 ? 1308 LYS B CD    1 
ATOM   6455 C  CE    . LYS F 3 316 ? 16.607  115.242 40.863  1.00 14.86 ? 1308 LYS B CE    1 
ATOM   6456 N  NZ    . LYS F 3 316 ? 16.194  116.140 42.000  1.00 15.05 ? 1308 LYS B NZ    1 
ATOM   6457 N  N     . GLU F 3 317 ? 13.365  110.931 38.715  1.00 12.11 ? 1309 GLU B N     1 
ATOM   6458 C  CA    . GLU F 3 317 ? 11.948  110.777 39.009  1.00 12.35 ? 1309 GLU B CA    1 
ATOM   6459 C  C     . GLU F 3 317 ? 11.511  109.307 38.988  1.00 11.91 ? 1309 GLU B C     1 
ATOM   6460 O  O     . GLU F 3 317 ? 10.633  108.907 39.740  1.00 11.34 ? 1309 GLU B O     1 
ATOM   6461 C  CB    . GLU F 3 317 ? 11.146  111.632 38.032  1.00 12.69 ? 1309 GLU B CB    1 
ATOM   6462 C  CG    . GLU F 3 317 ? 11.480  113.134 38.134  1.00 14.52 ? 1309 GLU B CG    1 
ATOM   6463 C  CD    . GLU F 3 317 ? 12.538  113.650 37.136  1.00 16.34 ? 1309 GLU B CD    1 
ATOM   6464 O  OE1   . GLU F 3 317 ? 12.969  112.909 36.217  1.00 16.79 ? 1309 GLU B OE1   1 
ATOM   6465 O  OE2   . GLU F 3 317 ? 12.949  114.832 37.267  1.00 17.75 ? 1309 GLU B OE2   1 
ATOM   6466 N  N     . THR F 3 318 ? 12.139  108.510 38.132  1.00 11.97 ? 1310 THR B N     1 
ATOM   6467 C  CA    . THR F 3 318 ? 11.971  107.057 38.149  1.00 11.97 ? 1310 THR B CA    1 
ATOM   6468 C  C     . THR F 3 318 ? 12.674  106.429 39.356  1.00 11.99 ? 1310 THR B C     1 
ATOM   6469 O  O     . THR F 3 318 ? 12.254  105.383 39.833  1.00 12.10 ? 1310 THR B O     1 
ATOM   6470 C  CB    . THR F 3 318 ? 12.508  106.430 36.837  1.00 11.76 ? 1310 THR B CB    1 
ATOM   6471 O  OG1   . THR F 3 318 ? 11.684  106.825 35.737  1.00 12.18 ? 1310 THR B OG1   1 
ATOM   6472 C  CG2   . THR F 3 318 ? 12.376  104.905 36.840  1.00 11.75 ? 1310 THR B CG2   1 
ATOM   6473 N  N     . ALA F 3 319 ? 13.745  107.060 39.831  1.00 11.92 ? 1311 ALA B N     1 
ATOM   6474 C  CA    . ALA F 3 319 ? 14.498  106.563 40.979  1.00 11.92 ? 1311 ALA B CA    1 
ATOM   6475 C  C     . ALA F 3 319 ? 13.659  106.728 42.241  1.00 12.12 ? 1311 ALA B C     1 
ATOM   6476 O  O     . ALA F 3 319 ? 13.479  105.783 42.996  1.00 12.18 ? 1311 ALA B O     1 
ATOM   6477 C  CB    . ALA F 3 319 ? 15.817  107.297 41.108  1.00 11.63 ? 1311 ALA B CB    1 
ATOM   6478 N  N     . TYR F 3 320 ? 13.163  107.943 42.458  1.00 12.34 ? 1312 TYR B N     1 
ATOM   6479 C  CA    . TYR F 3 320 ? 12.147  108.225 43.468  1.00 12.56 ? 1312 TYR B CA    1 
ATOM   6480 C  C     . TYR F 3 320 ? 11.053  107.153 43.440  1.00 12.13 ? 1312 TYR B C     1 
ATOM   6481 O  O     . TYR F 3 320 ? 10.847  106.434 44.416  1.00 12.06 ? 1312 TYR B O     1 
ATOM   6482 C  CB    . TYR F 3 320 ? 11.524  109.607 43.208  1.00 12.74 ? 1312 TYR B CB    1 
ATOM   6483 C  CG    . TYR F 3 320 ? 12.179  110.744 43.957  1.00 15.01 ? 1312 TYR B CG    1 
ATOM   6484 C  CD1   . TYR F 3 320 ? 11.468  111.474 44.907  1.00 17.50 ? 1312 TYR B CD1   1 
ATOM   6485 C  CD2   . TYR F 3 320 ? 13.511  111.088 43.732  1.00 17.07 ? 1312 TYR B CD2   1 
ATOM   6486 C  CE1   . TYR F 3 320 ? 12.059  112.525 45.604  1.00 18.44 ? 1312 TYR B CE1   1 
ATOM   6487 C  CE2   . TYR F 3 320 ? 14.117  112.138 44.430  1.00 17.84 ? 1312 TYR B CE2   1 
ATOM   6488 C  CZ    . TYR F 3 320 ? 13.384  112.853 45.363  1.00 18.68 ? 1312 TYR B CZ    1 
ATOM   6489 O  OH    . TYR F 3 320 ? 13.952  113.899 46.067  1.00 19.73 ? 1312 TYR B OH    1 
ATOM   6490 N  N     . SER F 3 321 ? 10.390  107.048 42.293  1.00 11.84 ? 1313 SER B N     1 
ATOM   6491 C  CA    . SER F 3 321 ? 9.223   106.193 42.093  1.00 11.70 ? 1313 SER B CA    1 
ATOM   6492 C  C     . SER F 3 321 ? 9.467   104.715 42.402  1.00 11.64 ? 1313 SER B C     1 
ATOM   6493 O  O     . SER F 3 321 ? 8.643   104.065 43.042  1.00 11.78 ? 1313 SER B O     1 
ATOM   6494 C  CB    . SER F 3 321 ? 8.758   106.318 40.644  1.00 11.73 ? 1313 SER B CB    1 
ATOM   6495 O  OG    . SER F 3 321 ? 7.435   105.847 40.490  1.00 12.07 ? 1313 SER B OG    1 
ATOM   6496 N  N     . GLU F 3 322 ? 10.598  104.193 41.945  1.00 11.47 ? 1314 GLU B N     1 
ATOM   6497 C  CA    . GLU F 3 322 ? 10.899  102.771 42.052  1.00 11.37 ? 1314 GLU B CA    1 
ATOM   6498 C  C     . GLU F 3 322 ? 11.527  102.427 43.399  1.00 11.18 ? 1314 GLU B C     1 
ATOM   6499 O  O     . GLU F 3 322 ? 11.475  101.289 43.820  1.00 11.03 ? 1314 GLU B O     1 
ATOM   6500 C  CB    . GLU F 3 322 ? 11.817  102.346 40.901  1.00 11.49 ? 1314 GLU B CB    1 
ATOM   6501 C  CG    . GLU F 3 322 ? 12.184  100.860 40.836  1.00 11.78 ? 1314 GLU B CG    1 
ATOM   6502 C  CD    . GLU F 3 322 ? 11.036  99.956  40.425  1.00 12.20 ? 1314 GLU B CD    1 
ATOM   6503 O  OE1   . GLU F 3 322 ? 11.053  98.769  40.833  1.00 12.38 ? 1314 GLU B OE1   1 
ATOM   6504 O  OE2   . GLU F 3 322 ? 10.130  100.417 39.688  1.00 12.21 ? 1314 GLU B OE2   1 
ATOM   6505 N  N     . SER F 3 323 ? 12.115  103.399 44.082  1.00 11.26 ? 1315 SER B N     1 
ATOM   6506 C  CA    . SER F 3 323 ? 12.723  103.135 45.391  1.00 11.58 ? 1315 SER B CA    1 
ATOM   6507 C  C     . SER F 3 323 ? 11.676  103.011 46.497  1.00 11.66 ? 1315 SER B C     1 
ATOM   6508 O  O     . SER F 3 323 ? 11.930  102.385 47.515  1.00 11.81 ? 1315 SER B O     1 
ATOM   6509 C  CB    . SER F 3 323 ? 13.741  104.212 45.759  1.00 11.44 ? 1315 SER B CB    1 
ATOM   6510 O  OG    . SER F 3 323 ? 13.090  105.434 46.038  1.00 11.93 ? 1315 SER B OG    1 
ATOM   6511 N  N     . VAL F 3 324 ? 10.516  103.627 46.298  1.00 11.97 ? 1316 VAL B N     1 
ATOM   6512 C  CA    . VAL F 3 324 ? 9.384   103.465 47.199  1.00 12.17 ? 1316 VAL B CA    1 
ATOM   6513 C  C     . VAL F 3 324 ? 8.899   102.030 47.066  1.00 12.50 ? 1316 VAL B C     1 
ATOM   6514 O  O     . VAL F 3 324 ? 8.668   101.349 48.056  1.00 12.41 ? 1316 VAL B O     1 
ATOM   6515 C  CB    . VAL F 3 324 ? 8.219   104.430 46.839  1.00 12.12 ? 1316 VAL B CB    1 
ATOM   6516 C  CG1   . VAL F 3 324 ? 6.980   104.123 47.662  1.00 11.38 ? 1316 VAL B CG1   1 
ATOM   6517 C  CG2   . VAL F 3 324 ? 8.637   105.881 47.037  1.00 12.46 ? 1316 VAL B CG2   1 
ATOM   6518 N  N     . LYS F 3 325 ? 8.743   101.592 45.820  1.00 12.97 ? 1317 LYS B N     1 
ATOM   6519 C  CA    . LYS F 3 325 ? 8.321   100.233 45.509  1.00 13.24 ? 1317 LYS B CA    1 
ATOM   6520 C  C     . LYS F 3 325 ? 9.233   99.186  46.162  1.00 13.28 ? 1317 LYS B C     1 
ATOM   6521 O  O     . LYS F 3 325 ? 8.744   98.283  46.825  1.00 13.51 ? 1317 LYS B O     1 
ATOM   6522 C  CB    . LYS F 3 325 ? 8.272   100.027 43.988  1.00 13.36 ? 1317 LYS B CB    1 
ATOM   6523 C  CG    . LYS F 3 325 ? 7.125   100.755 43.283  1.00 13.93 ? 1317 LYS B CG    1 
ATOM   6524 C  CD    . LYS F 3 325 ? 6.973   100.286 41.824  1.00 14.60 ? 1317 LYS B CD    1 
ATOM   6525 C  CE    . LYS F 3 325 ? 5.677   100.773 41.182  1.00 14.94 ? 1317 LYS B CE    1 
ATOM   6526 N  NZ    . LYS F 3 325 ? 5.258   99.911  40.024  1.00 15.72 ? 1317 LYS B NZ    1 
ATOM   6527 N  N     . LEU F 3 326 ? 10.545  99.318  45.990  1.00 13.33 ? 1318 LEU B N     1 
ATOM   6528 C  CA    . LEU F 3 326 ? 11.502  98.360  46.548  1.00 13.56 ? 1318 LEU B CA    1 
ATOM   6529 C  C     . LEU F 3 326 ? 11.564  98.408  48.086  1.00 13.79 ? 1318 LEU B C     1 
ATOM   6530 O  O     . LEU F 3 326 ? 11.877  97.410  48.728  1.00 13.61 ? 1318 LEU B O     1 
ATOM   6531 C  CB    . LEU F 3 326 ? 12.906  98.605  45.984  1.00 13.66 ? 1318 LEU B CB    1 
ATOM   6532 C  CG    . LEU F 3 326 ? 13.140  98.528  44.468  1.00 13.41 ? 1318 LEU B CG    1 
ATOM   6533 C  CD1   . LEU F 3 326 ? 14.376  99.355  44.088  1.00 12.96 ? 1318 LEU B CD1   1 
ATOM   6534 C  CD2   . LEU F 3 326 ? 13.282  97.089  43.975  1.00 12.19 ? 1318 LEU B CD2   1 
ATOM   6535 N  N     . LEU F 3 327 ? 11.287  99.572  48.670  1.00 14.13 ? 1319 LEU B N     1 
ATOM   6536 C  CA    . LEU F 3 327 ? 11.208  99.705  50.124  1.00 14.46 ? 1319 LEU B CA    1 
ATOM   6537 C  C     . LEU F 3 327 ? 9.949   99.002  50.624  1.00 14.68 ? 1319 LEU B C     1 
ATOM   6538 O  O     . LEU F 3 327 ? 10.009  98.237  51.577  1.00 14.75 ? 1319 LEU B O     1 
ATOM   6539 C  CB    . LEU F 3 327 ? 11.207  101.179 50.552  1.00 14.46 ? 1319 LEU B CB    1 
ATOM   6540 C  CG    . LEU F 3 327 ? 10.952  101.498 52.032  1.00 14.86 ? 1319 LEU B CG    1 
ATOM   6541 C  CD1   . LEU F 3 327 ? 11.886  100.736 52.945  1.00 15.12 ? 1319 LEU B CD1   1 
ATOM   6542 C  CD2   . LEU F 3 327 ? 11.095  102.985 52.290  1.00 15.67 ? 1319 LEU B CD2   1 
ATOM   6543 N  N     . GLN F 3 328 ? 8.817   99.268  49.972  1.00 14.89 ? 1320 GLN B N     1 
ATOM   6544 C  CA    . GLN F 3 328 ? 7.557   98.572  50.256  1.00 15.03 ? 1320 GLN B CA    1 
ATOM   6545 C  C     . GLN F 3 328 ? 7.785   97.058  50.262  1.00 15.03 ? 1320 GLN B C     1 
ATOM   6546 O  O     . GLN F 3 328 ? 7.323   96.363  51.162  1.00 15.05 ? 1320 GLN B O     1 
ATOM   6547 C  CB    . GLN F 3 328 ? 6.455   98.961  49.241  1.00 15.12 ? 1320 GLN B CB    1 
ATOM   6548 C  CG    . GLN F 3 328 ? 5.449   100.009 49.773  1.00 15.51 ? 1320 GLN B CG    1 
ATOM   6549 C  CD    . GLN F 3 328 ? 4.540   100.628 48.694  1.00 16.18 ? 1320 GLN B CD    1 
ATOM   6550 O  OE1   . GLN F 3 328 ? 4.879   100.643 47.509  1.00 16.45 ? 1320 GLN B OE1   1 
ATOM   6551 N  NE2   . GLN F 3 328 ? 3.390   101.156 49.118  1.00 15.61 ? 1320 GLN B NE2   1 
ATOM   6552 N  N     . LYS F 3 329 ? 8.530   96.568  49.273  1.00 15.14 ? 1321 LYS B N     1 
ATOM   6553 C  CA    . LYS F 3 329 ? 8.855   95.144  49.150  1.00 15.16 ? 1321 LYS B CA    1 
ATOM   6554 C  C     . LYS F 3 329 ? 9.731   94.633  50.307  1.00 15.10 ? 1321 LYS B C     1 
ATOM   6555 O  O     . LYS F 3 329 ? 9.571   93.490  50.745  1.00 15.10 ? 1321 LYS B O     1 
ATOM   6556 C  CB    . LYS F 3 329 ? 9.544   94.873  47.800  1.00 15.14 ? 1321 LYS B CB    1 
ATOM   6557 C  CG    . LYS F 3 329 ? 9.993   93.422  47.581  1.00 15.29 ? 1321 LYS B CG    1 
ATOM   6558 C  CD    . LYS F 3 329 ? 9.943   93.020  46.103  1.00 15.46 ? 1321 LYS B CD    1 
ATOM   6559 C  CE    . LYS F 3 329 ? 10.525  91.619  45.863  1.00 15.59 ? 1321 LYS B CE    1 
ATOM   6560 N  NZ    . LYS F 3 329 ? 9.485   90.554  45.835  1.00 14.53 ? 1321 LYS B NZ    1 
ATOM   6561 N  N     . ILE F 3 330 ? 10.653  95.469  50.785  1.00 14.92 ? 1322 ILE B N     1 
ATOM   6562 C  CA    . ILE F 3 330 ? 11.511  95.112  51.917  1.00 14.94 ? 1322 ILE B CA    1 
ATOM   6563 C  C     . ILE F 3 330 ? 10.694  94.906  53.195  1.00 14.94 ? 1322 ILE B C     1 
ATOM   6564 O  O     . ILE F 3 330 ? 10.871  93.903  53.882  1.00 14.99 ? 1322 ILE B O     1 
ATOM   6565 C  CB    . ILE F 3 330 ? 12.622  96.177  52.143  1.00 14.93 ? 1322 ILE B CB    1 
ATOM   6566 C  CG1   . ILE F 3 330 ? 13.666  96.091  51.027  1.00 14.80 ? 1322 ILE B CG1   1 
ATOM   6567 C  CG2   . ILE F 3 330 ? 13.293  95.997  53.514  1.00 14.73 ? 1322 ILE B CG2   1 
ATOM   6568 C  CD1   . ILE F 3 330 ? 14.492  97.334  50.848  1.00 15.05 ? 1322 ILE B CD1   1 
ATOM   6569 N  N     . LEU F 3 331 ? 9.817   95.858  53.504  1.00 14.89 ? 1323 LEU B N     1 
ATOM   6570 C  CA    . LEU F 3 331 ? 8.921   95.759  54.655  1.00 14.84 ? 1323 LEU B CA    1 
ATOM   6571 C  C     . LEU F 3 331 ? 8.035   94.507  54.570  1.00 15.04 ? 1323 LEU B C     1 
ATOM   6572 O  O     . LEU F 3 331 ? 7.814   93.825  55.572  1.00 14.99 ? 1323 LEU B O     1 
ATOM   6573 C  CB    . LEU F 3 331 ? 8.027   97.006  54.746  1.00 14.90 ? 1323 LEU B CB    1 
ATOM   6574 C  CG    . LEU F 3 331 ? 8.497   98.330  55.384  1.00 14.64 ? 1323 LEU B CG    1 
ATOM   6575 C  CD1   . LEU F 3 331 ? 9.364   98.128  56.624  1.00 14.27 ? 1323 LEU B CD1   1 
ATOM   6576 C  CD2   . LEU F 3 331 ? 9.199   99.221  54.380  1.00 14.29 ? 1323 LEU B CD2   1 
ATOM   6577 N  N     . GLU F 3 332 ? 7.540   94.214  53.366  1.00 15.29 ? 1324 GLU B N     1 
ATOM   6578 C  CA    . GLU F 3 332 ? 6.623   93.088  53.128  1.00 15.48 ? 1324 GLU B CA    1 
ATOM   6579 C  C     . GLU F 3 332 ? 7.247   91.731  53.437  1.00 15.50 ? 1324 GLU B C     1 
ATOM   6580 O  O     . GLU F 3 332 ? 6.542   90.793  53.804  1.00 15.59 ? 1324 GLU B O     1 
ATOM   6581 C  CB    . GLU F 3 332 ? 6.160   93.058  51.664  1.00 15.48 ? 1324 GLU B CB    1 
ATOM   6582 C  CG    . GLU F 3 332 ? 4.949   93.915  51.339  1.00 15.94 ? 1324 GLU B CG    1 
ATOM   6583 C  CD    . GLU F 3 332 ? 4.537   93.808  49.879  1.00 16.68 ? 1324 GLU B CD    1 
ATOM   6584 O  OE1   . GLU F 3 332 ? 3.436   94.291  49.534  1.00 17.33 ? 1324 GLU B OE1   1 
ATOM   6585 O  OE2   . GLU F 3 332 ? 5.308   93.237  49.072  1.00 17.24 ? 1324 GLU B OE2   1 
ATOM   6586 N  N     . GLU F 3 333 ? 8.560   91.625  53.260  1.00 15.49 ? 1325 GLU B N     1 
ATOM   6587 C  CA    . GLU F 3 333 ? 9.245   90.339  53.313  1.00 15.49 ? 1325 GLU B CA    1 
ATOM   6588 C  C     . GLU F 3 333 ? 10.290  90.264  54.429  1.00 15.49 ? 1325 GLU B C     1 
ATOM   6589 O  O     . GLU F 3 333 ? 11.066  89.309  54.479  1.00 15.67 ? 1325 GLU B O     1 
ATOM   6590 C  CB    . GLU F 3 333 ? 9.886   90.046  51.946  1.00 15.56 ? 1325 GLU B CB    1 
ATOM   6591 C  CG    . GLU F 3 333 ? 8.908   90.146  50.777  1.00 15.33 ? 1325 GLU B CG    1 
ATOM   6592 C  CD    . GLU F 3 333 ? 9.545   89.909  49.415  1.00 15.11 ? 1325 GLU B CD    1 
ATOM   6593 O  OE1   . GLU F 3 333 ? 10.747  89.568  49.356  1.00 13.24 ? 1325 GLU B OE1   1 
ATOM   6594 O  OE2   . GLU F 3 333 ? 8.823   90.058  48.393  1.00 15.49 ? 1325 GLU B OE2   1 
ATOM   6595 N  N     . ASP F 3 334 ? 10.301  91.255  55.322  1.00 15.43 ? 1326 ASP B N     1 
ATOM   6596 C  CA    . ASP F 3 334 ? 11.191  91.245  56.484  1.00 15.35 ? 1326 ASP B CA    1 
ATOM   6597 C  C     . ASP F 3 334 ? 10.525  91.902  57.691  1.00 15.58 ? 1326 ASP B C     1 
ATOM   6598 O  O     . ASP F 3 334 ? 10.006  93.013  57.598  1.00 15.44 ? 1326 ASP B O     1 
ATOM   6599 C  CB    . ASP F 3 334 ? 12.507  91.945  56.164  1.00 15.25 ? 1326 ASP B CB    1 
ATOM   6600 C  CG    . ASP F 3 334 ? 13.672  91.376  56.947  1.00 15.41 ? 1326 ASP B CG    1 
ATOM   6601 O  OD1   . ASP F 3 334 ? 13.967  91.892  58.052  1.00 14.39 ? 1326 ASP B OD1   1 
ATOM   6602 O  OD2   . ASP F 3 334 ? 14.347  90.411  56.530  1.00 15.44 ? 1326 ASP B OD2   1 
ATOM   6603 N  N     . GLU F 3 335 ? 10.563  91.207  58.826  1.00 16.02 ? 1327 GLU B N     1 
ATOM   6604 C  CA    . GLU F 3 335 ? 9.805   91.599  60.019  1.00 16.26 ? 1327 GLU B CA    1 
ATOM   6605 C  C     . GLU F 3 335 ? 10.509  92.673  60.847  1.00 16.22 ? 1327 GLU B C     1 
ATOM   6606 O  O     . GLU F 3 335 ? 9.873   93.339  61.666  1.00 16.23 ? 1327 GLU B O     1 
ATOM   6607 C  CB    . GLU F 3 335 ? 9.534   90.373  60.906  1.00 16.33 ? 1327 GLU B CB    1 
ATOM   6608 C  CG    . GLU F 3 335 ? 8.922   89.184  60.172  1.00 16.76 ? 1327 GLU B CG    1 
ATOM   6609 C  CD    . GLU F 3 335 ? 8.192   88.220  61.100  1.00 17.23 ? 1327 GLU B CD    1 
ATOM   6610 O  OE1   . GLU F 3 335 ? 6.994   87.952  60.851  1.00 17.57 ? 1327 GLU B OE1   1 
ATOM   6611 O  OE2   . GLU F 3 335 ? 8.811   87.728  62.072  1.00 16.61 ? 1327 GLU B OE2   1 
ATOM   6612 N  N     . ARG F 3 336 ? 11.812  92.840  60.629  1.00 16.24 ? 1328 ARG B N     1 
ATOM   6613 C  CA    . ARG F 3 336 ? 12.637  93.695  61.486  1.00 16.27 ? 1328 ARG B CA    1 
ATOM   6614 C  C     . ARG F 3 336 ? 12.462  95.184  61.204  1.00 16.08 ? 1328 ARG B C     1 
ATOM   6615 O  O     . ARG F 3 336 ? 12.041  95.573  60.125  1.00 15.91 ? 1328 ARG B O     1 
ATOM   6616 C  CB    . ARG F 3 336 ? 14.115  93.322  61.343  1.00 16.39 ? 1328 ARG B CB    1 
ATOM   6617 C  CG    . ARG F 3 336 ? 14.504  92.085  62.141  1.00 16.75 ? 1328 ARG B CG    1 
ATOM   6618 C  CD    . ARG F 3 336 ? 15.857  91.511  61.760  1.00 16.80 ? 1328 ARG B CD    1 
ATOM   6619 N  NE    . ARG F 3 336 ? 15.890  91.117  60.353  1.00 16.83 ? 1328 ARG B NE    1 
ATOM   6620 C  CZ    . ARG F 3 336 ? 16.927  90.527  59.765  1.00 17.16 ? 1328 ARG B CZ    1 
ATOM   6621 N  NH1   . ARG F 3 336 ? 18.027  90.245  60.459  1.00 16.95 ? 1328 ARG B NH1   1 
ATOM   6622 N  NH2   . ARG F 3 336 ? 16.865  90.214  58.473  1.00 17.27 ? 1328 ARG B NH2   1 
ATOM   6623 N  N     . LYS F 3 337 ? 12.802  96.007  62.194  1.00 16.03 ? 1329 LYS B N     1 
ATOM   6624 C  CA    . LYS F 3 337 ? 12.738  97.462  62.061  1.00 15.85 ? 1329 LYS B CA    1 
ATOM   6625 C  C     . LYS F 3 337 ? 13.944  97.960  61.260  1.00 15.54 ? 1329 LYS B C     1 
ATOM   6626 O  O     . LYS F 3 337 ? 15.050  97.436  61.399  1.00 15.31 ? 1329 LYS B O     1 
ATOM   6627 C  CB    . LYS F 3 337 ? 12.719  98.149  63.439  1.00 15.97 ? 1329 LYS B CB    1 
ATOM   6628 C  CG    . LYS F 3 337 ? 11.662  97.638  64.429  1.00 16.34 ? 1329 LYS B CG    1 
ATOM   6629 C  CD    . LYS F 3 337 ? 11.723  98.405  65.751  1.00 16.53 ? 1329 LYS B CD    1 
ATOM   6630 C  CE    . LYS F 3 337 ? 10.425  98.299  66.525  1.00 17.19 ? 1329 LYS B CE    1 
ATOM   6631 N  NZ    . LYS F 3 337 ? 9.282   98.811  65.718  1.00 17.51 ? 1329 LYS B NZ    1 
ATOM   6632 N  N     . ILE F 3 338 ? 13.728  98.972  60.428  1.00 15.05 ? 1330 ILE B N     1 
ATOM   6633 C  CA    . ILE F 3 338 ? 14.804  99.539  59.635  1.00 14.86 ? 1330 ILE B CA    1 
ATOM   6634 C  C     . ILE F 3 338 ? 15.499  100.674 60.392  1.00 14.74 ? 1330 ILE B C     1 
ATOM   6635 O  O     . ILE F 3 338 ? 14.845  101.560 60.935  1.00 14.54 ? 1330 ILE B O     1 
ATOM   6636 C  CB    . ILE F 3 338 ? 14.272  99.994  58.266  1.00 14.85 ? 1330 ILE B CB    1 
ATOM   6637 C  CG1   . ILE F 3 338 ? 13.766  98.770  57.482  1.00 14.33 ? 1330 ILE B CG1   1 
ATOM   6638 C  CG2   . ILE F 3 338 ? 15.370  100.723 57.480  1.00 14.57 ? 1330 ILE B CG2   1 
ATOM   6639 C  CD1   . ILE F 3 338 ? 12.845  99.099  56.322  1.00 13.98 ? 1330 ILE B CD1   1 
ATOM   6640 N  N     . ARG F 3 339 ? 16.833  100.621 60.405  1.00 14.55 ? 1331 ARG B N     1 
ATOM   6641 C  CA    . ARG F 3 339 ? 17.690  101.530 61.179  1.00 14.51 ? 1331 ARG B CA    1 
ATOM   6642 C  C     . ARG F 3 339 ? 18.457  102.500 60.270  1.00 14.31 ? 1331 ARG B C     1 
ATOM   6643 O  O     . ARG F 3 339 ? 18.626  103.669 60.606  1.00 14.28 ? 1331 ARG B O     1 
ATOM   6644 C  CB    . ARG F 3 339 ? 18.669  100.712 62.039  1.00 14.44 ? 1331 ARG B CB    1 
ATOM   6645 C  CG    . ARG F 3 339 ? 19.782  101.498 62.722  1.00 14.80 ? 1331 ARG B CG    1 
ATOM   6646 C  CD    . ARG F 3 339 ? 20.321  100.816 63.991  1.00 15.98 ? 1331 ARG B CD    1 
ATOM   6647 N  NE    . ARG F 3 339 ? 21.767  100.972 64.198  1.00 16.57 ? 1331 ARG B NE    1 
ATOM   6648 C  CZ    . ARG F 3 339 ? 22.398  100.795 65.364  1.00 16.94 ? 1331 ARG B CZ    1 
ATOM   6649 N  NH1   . ARG F 3 339 ? 21.737  100.460 66.464  1.00 17.34 ? 1331 ARG B NH1   1 
ATOM   6650 N  NH2   . ARG F 3 339 ? 23.711  100.961 65.435  1.00 17.81 ? 1331 ARG B NH2   1 
ATOM   6651 N  N     . ARG F 3 340 ? 18.954  101.992 59.145  1.00 14.05 ? 1332 ARG B N     1 
ATOM   6652 C  CA    . ARG F 3 340 ? 19.506  102.825 58.080  1.00 13.81 ? 1332 ARG B CA    1 
ATOM   6653 C  C     . ARG F 3 340 ? 18.796  102.503 56.776  1.00 13.27 ? 1332 ARG B C     1 
ATOM   6654 O  O     . ARG F 3 340 ? 18.325  101.389 56.558  1.00 13.30 ? 1332 ARG B O     1 
ATOM   6655 C  CB    . ARG F 3 340 ? 21.009  102.601 57.904  1.00 13.91 ? 1332 ARG B CB    1 
ATOM   6656 C  CG    . ARG F 3 340 ? 21.801  102.483 59.195  1.00 14.26 ? 1332 ARG B CG    1 
ATOM   6657 C  CD    . ARG F 3 340 ? 23.227  101.980 58.984  1.00 14.88 ? 1332 ARG B CD    1 
ATOM   6658 N  NE    . ARG F 3 340 ? 23.929  101.792 60.250  1.00 15.40 ? 1332 ARG B NE    1 
ATOM   6659 C  CZ    . ARG F 3 340 ? 25.157  101.287 60.384  1.00 15.50 ? 1332 ARG B CZ    1 
ATOM   6660 N  NH1   . ARG F 3 340 ? 25.678  101.161 61.600  1.00 15.67 ? 1332 ARG B NH1   1 
ATOM   6661 N  NH2   . ARG F 3 340 ? 25.867  100.912 59.323  1.00 14.86 ? 1332 ARG B NH2   1 
ATOM   6662 N  N     . ILE F 3 341 ? 18.701  103.493 55.910  1.00 12.69 ? 1333 ILE B N     1 
ATOM   6663 C  CA    . ILE F 3 341 ? 18.104  103.278 54.614  1.00 12.33 ? 1333 ILE B CA    1 
ATOM   6664 C  C     . ILE F 3 341 ? 18.863  104.065 53.572  1.00 12.05 ? 1333 ILE B C     1 
ATOM   6665 O  O     . ILE F 3 341 ? 19.366  105.150 53.833  1.00 12.09 ? 1333 ILE B O     1 
ATOM   6666 C  CB    . ILE F 3 341 ? 16.610  103.655 54.646  1.00 12.29 ? 1333 ILE B CB    1 
ATOM   6667 C  CG1   . ILE F 3 341 ? 15.920  103.246 53.336  1.00 12.62 ? 1333 ILE B CG1   1 
ATOM   6668 C  CG2   . ILE F 3 341 ? 16.429  105.142 54.947  1.00 11.94 ? 1333 ILE B CG2   1 
ATOM   6669 C  CD1   . ILE F 3 341 ? 15.989  101.740 53.037  1.00 12.60 ? 1333 ILE B CD1   1 
ATOM   6670 N  N     . GLY F 3 342 ? 18.952  103.512 52.379  1.00 11.89 ? 1334 GLY B N     1 
ATOM   6671 C  CA    . GLY F 3 342 ? 19.664  104.186 51.322  1.00 11.88 ? 1334 GLY B CA    1 
ATOM   6672 C  C     . GLY F 3 342 ? 19.510  103.515 49.999  1.00 11.72 ? 1334 GLY B C     1 
ATOM   6673 O  O     . GLY F 3 342 ? 18.642  102.684 49.813  1.00 11.86 ? 1334 GLY B O     1 
ATOM   6674 N  N     . VAL F 3 343 ? 20.372  103.882 49.072  1.00 11.91 ? 1335 VAL B N     1 
ATOM   6675 C  CA    . VAL F 3 343 ? 20.217  103.453 47.702  1.00 11.95 ? 1335 VAL B CA    1 
ATOM   6676 C  C     . VAL F 3 343 ? 21.570  103.346 47.029  1.00 12.17 ? 1335 VAL B C     1 
ATOM   6677 O  O     . VAL F 3 343 ? 22.489  104.096 47.323  1.00 12.12 ? 1335 VAL B O     1 
ATOM   6678 C  CB    . VAL F 3 343 ? 19.285  104.430 46.941  1.00 11.87 ? 1335 VAL B CB    1 
ATOM   6679 C  CG1   . VAL F 3 343 ? 19.938  105.797 46.781  1.00 12.09 ? 1335 VAL B CG1   1 
ATOM   6680 C  CG2   . VAL F 3 343 ? 18.886  103.869 45.604  1.00 11.99 ? 1335 VAL B CG2   1 
ATOM   6681 N  N     . ARG F 3 344 ? 21.669  102.421 46.093  1.00 12.80 ? 1336 ARG B N     1 
ATOM   6682 C  CA    . ARG F 3 344 ? 22.904  102.156 45.386  1.00 13.23 ? 1336 ARG B CA    1 
ATOM   6683 C  C     . ARG F 3 344 ? 22.598  102.071 43.885  1.00 12.71 ? 1336 ARG B C     1 
ATOM   6684 O  O     . ARG F 3 344 ? 21.754  101.289 43.463  1.00 12.48 ? 1336 ARG B O     1 
ATOM   6685 C  CB    . ARG F 3 344 ? 23.495  100.850 45.917  1.00 13.81 ? 1336 ARG B CB    1 
ATOM   6686 C  CG    . ARG F 3 344 ? 24.846  100.477 45.322  1.00 16.60 ? 1336 ARG B CG    1 
ATOM   6687 C  CD    . ARG F 3 344 ? 25.924  100.108 46.354  1.00 19.71 ? 1336 ARG B CD    1 
ATOM   6688 N  NE    . ARG F 3 344 ? 26.942  101.155 46.462  1.00 20.78 ? 1336 ARG B NE    1 
ATOM   6689 C  CZ    . ARG F 3 344 ? 26.818  102.248 47.198  1.00 21.72 ? 1336 ARG B CZ    1 
ATOM   6690 N  NH1   . ARG F 3 344 ? 25.720  102.456 47.931  1.00 22.62 ? 1336 ARG B NH1   1 
ATOM   6691 N  NH2   . ARG F 3 344 ? 27.803  103.140 47.209  1.00 21.16 ? 1336 ARG B NH2   1 
ATOM   6692 N  N     . PHE F 3 345 ? 23.277  102.897 43.097  1.00 12.43 ? 1337 PHE B N     1 
ATOM   6693 C  CA    . PHE F 3 345 ? 23.104  102.946 41.651  1.00 12.31 ? 1337 PHE B CA    1 
ATOM   6694 C  C     . PHE F 3 345 ? 24.304  102.337 40.960  1.00 11.96 ? 1337 PHE B C     1 
ATOM   6695 O  O     . PHE F 3 345 ? 25.422  102.675 41.287  1.00 11.88 ? 1337 PHE B O     1 
ATOM   6696 C  CB    . PHE F 3 345 ? 22.986  104.390 41.193  1.00 12.50 ? 1337 PHE B CB    1 
ATOM   6697 C  CG    . PHE F 3 345 ? 21.721  105.053 41.619  1.00 13.21 ? 1337 PHE B CG    1 
ATOM   6698 C  CD1   . PHE F 3 345 ? 20.555  104.857 40.906  1.00 13.13 ? 1337 PHE B CD1   1 
ATOM   6699 C  CD2   . PHE F 3 345 ? 21.694  105.871 42.732  1.00 14.16 ? 1337 PHE B CD2   1 
ATOM   6700 C  CE1   . PHE F 3 345 ? 19.388  105.466 41.290  1.00 13.20 ? 1337 PHE B CE1   1 
ATOM   6701 C  CE2   . PHE F 3 345 ? 20.520  106.481 43.124  1.00 14.53 ? 1337 PHE B CE2   1 
ATOM   6702 C  CZ    . PHE F 3 345 ? 19.366  106.277 42.400  1.00 13.76 ? 1337 PHE B CZ    1 
ATOM   6703 N  N     . SER F 3 346 ? 24.071  101.450 39.998  1.00 11.68 ? 1338 SER B N     1 
ATOM   6704 C  CA    . SER F 3 346 ? 25.154  100.774 39.285  1.00 11.37 ? 1338 SER B CA    1 
ATOM   6705 C  C     . SER F 3 346 ? 24.835  100.626 37.784  1.00 11.70 ? 1338 SER B C     1 
ATOM   6706 O  O     . SER F 3 346 ? 23.832  101.157 37.308  1.00 11.62 ? 1338 SER B O     1 
ATOM   6707 C  CB    . SER F 3 346 ? 25.423  99.411  39.937  1.00 11.10 ? 1338 SER B CB    1 
ATOM   6708 O  OG    . SER F 3 346 ? 24.237  98.660  40.094  1.00 9.10  ? 1338 SER B OG    1 
ATOM   6709 N  N     . LYS F 3 347 ? 25.714  99.937  37.052  1.00 11.97 ? 1339 LYS B N     1 
ATOM   6710 C  CA    . LYS F 3 347 ? 25.554  99.677  35.618  1.00 12.24 ? 1339 LYS B CA    1 
ATOM   6711 C  C     . LYS F 3 347 ? 25.371  100.956 34.802  1.00 12.89 ? 1339 LYS B C     1 
ATOM   6712 O  O     . LYS F 3 347 ? 24.344  101.147 34.155  1.00 13.05 ? 1339 LYS B O     1 
ATOM   6713 C  CB    . LYS F 3 347 ? 24.392  98.715  35.369  1.00 12.12 ? 1339 LYS B CB    1 
ATOM   6714 C  CG    . LYS F 3 347 ? 24.495  97.393  36.113  1.00 12.05 ? 1339 LYS B CG    1 
ATOM   6715 C  CD    . LYS F 3 347 ? 23.443  96.412  35.604  1.00 12.27 ? 1339 LYS B CD    1 
ATOM   6716 C  CE    . LYS F 3 347 ? 23.432  95.099  36.381  1.00 11.68 ? 1339 LYS B CE    1 
ATOM   6717 N  NZ    . LYS F 3 347 ? 22.504  94.136  35.728  1.00 10.92 ? 1339 LYS B NZ    1 
ATOM   6718 N  N     . PHE F 3 348 ? 26.386  101.816 34.817  1.00 13.67 ? 1340 PHE B N     1 
ATOM   6719 C  CA    . PHE F 3 348 ? 26.308  103.127 34.177  1.00 14.28 ? 1340 PHE B CA    1 
ATOM   6720 C  C     . PHE F 3 348 ? 26.351  103.028 32.650  1.00 15.16 ? 1340 PHE B C     1 
ATOM   6721 O  O     . PHE F 3 348 ? 26.606  101.961 32.103  1.00 15.07 ? 1340 PHE B O     1 
ATOM   6722 C  CB    . PHE F 3 348 ? 27.426  104.039 34.685  1.00 14.19 ? 1340 PHE B CB    1 
ATOM   6723 C  CG    . PHE F 3 348 ? 27.475  104.151 36.189  1.00 14.56 ? 1340 PHE B CG    1 
ATOM   6724 C  CD1   . PHE F 3 348 ? 26.434  104.755 36.888  1.00 14.22 ? 1340 PHE B CD1   1 
ATOM   6725 C  CD2   . PHE F 3 348 ? 28.548  103.638 36.909  1.00 14.98 ? 1340 PHE B CD2   1 
ATOM   6726 C  CE1   . PHE F 3 348 ? 26.462  104.853 38.269  1.00 13.91 ? 1340 PHE B CE1   1 
ATOM   6727 C  CE2   . PHE F 3 348 ? 28.575  103.725 38.306  1.00 14.90 ? 1340 PHE B CE2   1 
ATOM   6728 C  CZ    . PHE F 3 348 ? 27.530  104.340 38.979  1.00 14.21 ? 1340 PHE B CZ    1 
ATOM   6729 N  N     . ILE F 3 349 ? 26.072  104.142 31.974  1.00 16.25 ? 1341 ILE B N     1 
ATOM   6730 C  CA    . ILE F 3 349 ? 26.137  104.199 30.529  1.00 17.13 ? 1341 ILE B CA    1 
ATOM   6731 C  C     . ILE F 3 349 ? 27.513  104.732 30.154  1.00 17.96 ? 1341 ILE B C     1 
ATOM   6732 O  O     . ILE F 3 349 ? 28.184  104.152 29.295  1.00 19.09 ? 1341 ILE B O     1 
ATOM   6733 C  CB    . ILE F 3 349 ? 24.983  105.068 29.919  1.00 17.16 ? 1341 ILE B CB    1 
ATOM   6734 C  CG1   . ILE F 3 349 ? 23.656  104.299 29.963  1.00 16.58 ? 1341 ILE B CG1   1 
ATOM   6735 C  CG2   . ILE F 3 349 ? 25.305  105.465 28.460  1.00 16.52 ? 1341 ILE B CG2   1 
ATOM   6736 C  CD1   . ILE F 3 349 ? 22.442  105.089 29.499  1.00 15.81 ? 1341 ILE B CD1   1 
HETATM 6737 CA CA    . CA  G 4 .   ? -16.784 -17.142 5.653   1.00 36.46 ? 416  CA  D CA    1 
HETATM 6738 CA CA    . CA  H 4 .   ? 15.594  84.314  44.206  1.00 30.82 ? 1416 CA  J CA    1 
HETATM 6739 CA CA    . CA  I 4 .   ? 13.986  4.909   10.925  1.00 25.04 ? 415  CA  A CA    1 
HETATM 6740 CA CA    . CA  J 4 .   ? 45.358  105.862 52.668  1.00 14.01 ? 1415 CA  B CA    1 
HETATM 6741 O  O     . HOH K 5 .   ? -8.590  -8.332  12.023  1.00 24.01 ? 39   HOH D O     1 
HETATM 6742 O  O     . HOH K 5 .   ? -13.387 -9.207  12.000  1.00 26.74 ? 50   HOH D O     1 
HETATM 6743 O  O     . HOH K 5 .   ? -19.646 -6.986  5.289   1.00 28.09 ? 54   HOH D O     1 
HETATM 6744 O  O     . HOH K 5 .   ? -4.101  -25.622 -10.606 1.00 39.73 ? 62   HOH D O     1 
HETATM 6745 O  O     . HOH K 5 .   ? -7.244  -20.347 -10.963 1.00 32.94 ? 67   HOH D O     1 
HETATM 6746 O  O     . HOH K 5 .   ? -7.231  -6.129  10.361  1.00 24.40 ? 73   HOH D O     1 
HETATM 6747 O  O     . HOH K 5 .   ? -10.051 -8.140  0.384   1.00 15.17 ? 82   HOH D O     1 
HETATM 6748 O  O     . HOH K 5 .   ? 1.167   -14.036 12.846  1.00 48.23 ? 109  HOH D O     1 
HETATM 6749 O  O     . HOH K 5 .   ? -4.787  -4.292  13.699  1.00 45.87 ? 150  HOH D O     1 
HETATM 6750 O  O     . HOH K 5 .   ? -6.398  -6.224  12.907  1.00 29.28 ? 151  HOH D O     1 
HETATM 6751 O  O     . HOH K 5 .   ? -12.292 -8.593  1.556   1.00 22.36 ? 167  HOH D O     1 
HETATM 6752 O  O     . HOH K 5 .   ? -18.607 -15.394 7.037   1.00 34.21 ? 505  HOH D O     1 
HETATM 6753 O  O     . HOH K 5 .   ? -15.486 -15.546 6.830   1.00 30.36 ? 506  HOH D O     1 
HETATM 6754 O  O     . HOH K 5 .   ? -15.919 -15.571 4.243   1.00 43.49 ? 509  HOH D O     1 
HETATM 6755 O  O     . HOH L 5 .   ? -6.075  -0.708  27.640  1.00 52.73 ? 30   HOH E O     1 
HETATM 6756 O  O     . HOH L 5 .   ? -5.138  2.393   9.722   1.00 14.29 ? 53   HOH E O     1 
HETATM 6757 O  O     . HOH L 5 .   ? -18.117 -24.295 -1.790  1.00 29.09 ? 60   HOH E O     1 
HETATM 6758 O  O     . HOH L 5 .   ? -16.992 -17.198 -0.864  1.00 34.20 ? 63   HOH E O     1 
HETATM 6759 O  O     . HOH L 5 .   ? -5.013  -2.095  12.020  1.00 3.77  ? 71   HOH E O     1 
HETATM 6760 O  O     . HOH L 5 .   ? 3.458   -2.735  7.704   1.00 26.30 ? 72   HOH E O     1 
HETATM 6761 O  O     . HOH L 5 .   ? 2.000   -6.519  33.980  1.00 39.64 ? 76   HOH E O     1 
HETATM 6762 O  O     . HOH L 5 .   ? -4.921  -17.957 2.435   1.00 14.33 ? 120  HOH E O     1 
HETATM 6763 O  O     . HOH L 5 .   ? -6.578  5.169   15.797  1.00 42.03 ? 148  HOH E O     1 
HETATM 6764 O  O     . HOH L 5 .   ? -5.362  -13.372 3.073   1.00 31.96 ? 155  HOH E O     1 
HETATM 6765 O  O     . HOH L 5 .   ? -2.696  0.860   20.833  1.00 31.15 ? 170  HOH E O     1 
HETATM 6766 O  O     . HOH L 5 .   ? -1.388  -0.943  19.355  1.00 32.47 ? 171  HOH E O     1 
HETATM 6767 O  O     . HOH L 5 .   ? -15.031 -18.991 5.884   1.00 40.42 ? 504  HOH E O     1 
HETATM 6768 O  O     . HOH L 5 .   ? -18.484 -19.153 6.260   1.00 27.23 ? 507  HOH E O     1 
HETATM 6769 O  O     . HOH L 5 .   ? -17.087 -18.359 8.089   1.00 45.74 ? 508  HOH E O     1 
HETATM 6770 O  O     . HOH M 5 .   ? 21.096  89.350  57.212  1.00 32.28 ? 15   HOH H O     1 
HETATM 6771 O  O     . HOH M 5 .   ? 33.292  90.559  57.414  1.00 37.22 ? 17   HOH H O     1 
HETATM 6772 O  O     . HOH M 5 .   ? 34.018  86.458  52.935  1.00 43.52 ? 24   HOH H O     1 
HETATM 6773 O  O     . HOH M 5 .   ? 32.889  76.532  29.294  1.00 41.16 ? 80   HOH H O     1 
HETATM 6774 O  O     . HOH M 5 .   ? 21.667  92.057  43.808  1.00 36.15 ? 81   HOH H O     1 
HETATM 6775 O  O     . HOH M 5 .   ? 24.352  94.877  49.928  1.00 26.33 ? 140  HOH H O     1 
HETATM 6776 O  O     . HOH M 5 .   ? 14.813  86.534  55.059  1.00 29.74 ? 174  HOH H O     1 
HETATM 6777 O  O     . HOH M 5 .   ? 14.722  82.760  53.289  1.00 35.38 ? 175  HOH H O     1 
HETATM 6778 O  O     . HOH M 5 .   ? 17.663  84.393  45.279  1.00 50.82 ? 1504 HOH H O     1 
HETATM 6779 O  O     . HOH M 5 .   ? 15.342  86.979  42.410  1.00 43.10 ? 1506 HOH H O     1 
HETATM 6780 O  O     . HOH M 5 .   ? 14.289  86.313  45.096  1.00 29.77 ? 1508 HOH H O     1 
HETATM 6781 O  O     . HOH M 5 .   ? 17.200  83.978  42.542  1.00 48.54 ? 1509 HOH H O     1 
HETATM 6782 O  O     . HOH N 5 .   ? 29.898  105.252 69.898  1.00 13.65 ? 2    HOH J O     1 
HETATM 6783 O  O     . HOH N 5 .   ? 23.168  109.673 59.191  1.00 29.72 ? 66   HOH J O     1 
HETATM 6784 O  O     . HOH N 5 .   ? 26.681  102.852 50.572  1.00 22.79 ? 87   HOH J O     1 
HETATM 6785 O  O     . HOH N 5 .   ? 36.140  99.111  48.406  1.00 31.95 ? 97   HOH J O     1 
HETATM 6786 O  O     . HOH N 5 .   ? 26.854  98.133  52.104  1.00 25.42 ? 103  HOH J O     1 
HETATM 6787 O  O     . HOH N 5 .   ? 33.274  96.434  39.453  1.00 30.92 ? 111  HOH J O     1 
HETATM 6788 O  O     . HOH N 5 .   ? 21.840  78.951  48.407  1.00 32.05 ? 118  HOH J O     1 
HETATM 6789 O  O     . HOH N 5 .   ? 41.937  95.405  41.141  1.00 44.12 ? 130  HOH J O     1 
HETATM 6790 O  O     . HOH N 5 .   ? 29.362  98.117  56.063  1.00 29.16 ? 139  HOH J O     1 
HETATM 6791 O  O     . HOH N 5 .   ? 31.750  100.478 65.173  1.00 31.71 ? 158  HOH J O     1 
HETATM 6792 O  O     . HOH N 5 .   ? 25.659  100.000 68.647  1.00 48.02 ? 159  HOH J O     1 
HETATM 6793 O  O     . HOH N 5 .   ? 28.426  99.703  61.541  1.00 28.61 ? 172  HOH J O     1 
HETATM 6794 O  O     . HOH N 5 .   ? 12.889  83.900  40.466  1.00 46.33 ? 1505 HOH J O     1 
HETATM 6795 O  O     . HOH N 5 .   ? 14.154  81.751  44.861  1.00 36.44 ? 1507 HOH J O     1 
HETATM 6796 O  O     . HOH O 5 .   ? 15.380  2.811   11.803  1.00 23.47 ? 501  HOH A O     1 
HETATM 6797 O  O     . HOH O 5 .   ? 12.559  4.909   9.994   1.00 48.64 ? 502  HOH A O     1 
HETATM 6798 O  O     . HOH O 5 .   ? 14.233  3.371   9.859   1.00 18.08 ? 503  HOH A O     1 
HETATM 6799 O  O     . HOH O 5 .   ? -19.710 -0.364  -8.225  1.00 12.95 ? 504  HOH A O     1 
HETATM 6800 O  O     . HOH O 5 .   ? -1.103  7.473   28.283  1.00 16.57 ? 505  HOH A O     1 
HETATM 6801 O  O     . HOH O 5 .   ? -6.056  2.101   15.537  1.00 20.04 ? 506  HOH A O     1 
HETATM 6802 O  O     . HOH O 5 .   ? 11.907  6.220   19.692  1.00 18.67 ? 507  HOH A O     1 
HETATM 6803 O  O     . HOH O 5 .   ? 7.518   19.973  0.913   1.00 40.86 ? 508  HOH A O     1 
HETATM 6804 O  O     . HOH O 5 .   ? 15.079  -5.092  14.328  1.00 31.83 ? 509  HOH A O     1 
HETATM 6805 O  O     . HOH O 5 .   ? -15.612 10.623  -5.694  1.00 23.55 ? 510  HOH A O     1 
HETATM 6806 O  O     . HOH O 5 .   ? 8.555   4.602   -3.181  1.00 29.30 ? 511  HOH A O     1 
HETATM 6807 O  O     . HOH O 5 .   ? 18.670  20.216  14.209  1.00 22.94 ? 512  HOH A O     1 
HETATM 6808 O  O     . HOH O 5 .   ? 13.629  0.312   5.098   1.00 28.01 ? 513  HOH A O     1 
HETATM 6809 O  O     . HOH O 5 .   ? -3.611  0.386   -13.099 1.00 40.15 ? 514  HOH A O     1 
HETATM 6810 O  O     . HOH O 5 .   ? -9.748  -2.462  2.309   1.00 22.80 ? 515  HOH A O     1 
HETATM 6811 O  O     . HOH O 5 .   ? 14.763  -6.130  16.545  1.00 18.53 ? 516  HOH A O     1 
HETATM 6812 O  O     . HOH O 5 .   ? 21.616  9.027   22.997  1.00 35.33 ? 517  HOH A O     1 
HETATM 6813 O  O     . HOH O 5 .   ? 35.573  -7.723  1.729   1.00 48.47 ? 518  HOH A O     1 
HETATM 6814 O  O     . HOH O 5 .   ? 14.231  24.105  3.519   1.00 36.38 ? 519  HOH A O     1 
HETATM 6815 O  O     . HOH O 5 .   ? 10.637  9.647   13.689  1.00 36.55 ? 520  HOH A O     1 
HETATM 6816 O  O     . HOH O 5 .   ? -1.709  14.470  18.801  1.00 24.67 ? 521  HOH A O     1 
HETATM 6817 O  O     . HOH O 5 .   ? -20.592 -9.801  21.099  1.00 43.04 ? 522  HOH A O     1 
HETATM 6818 O  O     . HOH O 5 .   ? -8.630  -5.820  0.274   1.00 17.91 ? 523  HOH A O     1 
HETATM 6819 O  O     . HOH O 5 .   ? 1.415   7.109   11.808  1.00 12.37 ? 524  HOH A O     1 
HETATM 6820 O  O     . HOH O 5 .   ? 21.601  13.809  15.929  1.00 33.26 ? 525  HOH A O     1 
HETATM 6821 O  O     . HOH O 5 .   ? -14.255 -1.277  -13.216 1.00 25.41 ? 526  HOH A O     1 
HETATM 6822 O  O     . HOH O 5 .   ? 30.229  6.799   11.722  1.00 35.51 ? 527  HOH A O     1 
HETATM 6823 O  O     . HOH O 5 .   ? -11.578 12.473  13.537  1.00 45.46 ? 528  HOH A O     1 
HETATM 6824 O  O     . HOH O 5 .   ? 6.878   -0.679  31.410  1.00 35.77 ? 529  HOH A O     1 
HETATM 6825 O  O     . HOH O 5 .   ? 22.926  15.000  7.357   1.00 31.16 ? 530  HOH A O     1 
HETATM 6826 O  O     . HOH O 5 .   ? 9.655   -3.457  -8.641  1.00 35.37 ? 531  HOH A O     1 
HETATM 6827 O  O     . HOH O 5 .   ? -4.714  -4.085  -2.774  1.00 31.18 ? 532  HOH A O     1 
HETATM 6828 O  O     . HOH O 5 .   ? -29.402 5.593   13.918  1.00 45.53 ? 533  HOH A O     1 
HETATM 6829 O  O     . HOH O 5 .   ? 12.854  8.152   13.639  1.00 31.62 ? 534  HOH A O     1 
HETATM 6830 O  O     . HOH O 5 .   ? 5.235   -2.618  -4.917  1.00 26.61 ? 535  HOH A O     1 
HETATM 6831 O  O     . HOH O 5 .   ? 15.932  21.260  0.744   1.00 20.16 ? 536  HOH A O     1 
HETATM 6832 O  O     . HOH O 5 .   ? 15.304  4.927   12.945  1.00 32.24 ? 537  HOH A O     1 
HETATM 6833 O  O     . HOH O 5 .   ? 19.300  -5.290  -2.689  1.00 27.80 ? 538  HOH A O     1 
HETATM 6834 O  O     . HOH O 5 .   ? 0.428   5.975   0.318   1.00 41.26 ? 539  HOH A O     1 
HETATM 6835 O  O     . HOH O 5 .   ? 2.283   12.175  5.589   1.00 43.40 ? 540  HOH A O     1 
HETATM 6836 O  O     . HOH O 5 .   ? 12.344  22.341  29.316  1.00 35.66 ? 541  HOH A O     1 
HETATM 6837 O  O     . HOH O 5 .   ? 9.124   27.443  13.589  1.00 16.59 ? 542  HOH A O     1 
HETATM 6838 O  O     . HOH O 5 .   ? -13.182 -9.969  16.789  1.00 36.09 ? 543  HOH A O     1 
HETATM 6839 O  O     . HOH O 5 .   ? 6.356   -22.711 0.372   1.00 42.27 ? 544  HOH A O     1 
HETATM 6840 O  O     . HOH O 5 .   ? -9.252  -4.580  7.164   1.00 16.35 ? 545  HOH A O     1 
HETATM 6841 O  O     . HOH O 5 .   ? -3.019  2.542   -8.424  1.00 36.21 ? 546  HOH A O     1 
HETATM 6842 O  O     . HOH O 5 .   ? 14.952  7.390   11.970  1.00 12.36 ? 547  HOH A O     1 
HETATM 6843 O  O     . HOH O 5 .   ? -3.919  7.925   7.200   1.00 34.11 ? 548  HOH A O     1 
HETATM 6844 O  O     . HOH O 5 .   ? -0.400  -7.248  -0.552  1.00 35.89 ? 549  HOH A O     1 
HETATM 6845 O  O     . HOH O 5 .   ? -11.053 -9.206  13.536  1.00 19.43 ? 550  HOH A O     1 
HETATM 6846 O  O     . HOH O 5 .   ? -13.382 -7.996  6.914   1.00 36.47 ? 551  HOH A O     1 
HETATM 6847 O  O     . HOH O 5 .   ? 7.626   -19.854 23.280  1.00 36.69 ? 552  HOH A O     1 
HETATM 6848 O  O     . HOH O 5 .   ? 17.294  9.393   17.878  1.00 30.73 ? 553  HOH A O     1 
HETATM 6849 O  O     . HOH O 5 .   ? 22.046  12.706  26.297  1.00 43.16 ? 554  HOH A O     1 
HETATM 6850 O  O     . HOH O 5 .   ? 23.359  11.212  28.727  1.00 38.05 ? 555  HOH A O     1 
HETATM 6851 O  O     . HOH O 5 .   ? 6.279   6.313   6.941   1.00 25.76 ? 556  HOH A O     1 
HETATM 6852 O  O     . HOH O 5 .   ? -5.897  0.220   16.304  1.00 30.03 ? 557  HOH A O     1 
HETATM 6853 O  O     . HOH O 5 .   ? -5.453  -0.981  10.135  1.00 14.82 ? 558  HOH A O     1 
HETATM 6854 O  O     . HOH O 5 .   ? -7.556  0.710   8.175   1.00 37.34 ? 559  HOH A O     1 
HETATM 6855 O  O     . HOH O 5 .   ? 8.030   29.396  18.180  1.00 30.25 ? 560  HOH A O     1 
HETATM 6856 O  O     . HOH O 5 .   ? 13.104  -5.608  4.871   1.00 35.93 ? 561  HOH A O     1 
HETATM 6857 O  O     . HOH O 5 .   ? 10.979  -7.971  5.884   1.00 47.22 ? 562  HOH A O     1 
HETATM 6858 O  O     . HOH O 5 .   ? -0.292  -4.952  -5.146  1.00 50.14 ? 563  HOH A O     1 
HETATM 6859 O  O     . HOH O 5 .   ? 1.191   4.767   -2.898  1.00 51.09 ? 564  HOH A O     1 
HETATM 6860 O  O     . HOH O 5 .   ? -3.706  0.930   5.051   1.00 14.46 ? 565  HOH A O     1 
HETATM 6861 O  O     . HOH O 5 .   ? 3.048   -17.307 12.236  1.00 33.27 ? 566  HOH A O     1 
HETATM 6862 O  O     . HOH P 5 .   ? 43.105  106.058 61.845  1.00 4.26  ? 3    HOH B O     1 
HETATM 6863 O  O     . HOH P 5 .   ? 14.258  102.821 31.363  1.00 20.59 ? 4    HOH B O     1 
HETATM 6864 O  O     . HOH P 5 .   ? 42.553  111.398 77.350  1.00 14.76 ? 7    HOH B O     1 
HETATM 6865 O  O     . HOH P 5 .   ? 41.814  110.423 56.368  1.00 22.35 ? 10   HOH B O     1 
HETATM 6866 O  O     . HOH P 5 .   ? 65.611  99.254  48.252  1.00 34.96 ? 14   HOH B O     1 
HETATM 6867 O  O     . HOH P 5 .   ? 49.364  119.389 59.524  1.00 40.60 ? 16   HOH B O     1 
HETATM 6868 O  O     . HOH P 5 .   ? 13.798  106.482 33.848  1.00 17.37 ? 21   HOH B O     1 
HETATM 6869 O  O     . HOH P 5 .   ? 31.276  106.034 37.385  1.00 46.90 ? 26   HOH B O     1 
HETATM 6870 O  O     . HOH P 5 .   ? 43.998  105.063 77.983  1.00 7.25  ? 27   HOH B O     1 
HETATM 6871 O  O     . HOH P 5 .   ? 44.048  107.565 57.805  1.00 20.63 ? 28   HOH B O     1 
HETATM 6872 O  O     . HOH P 5 .   ? 53.802  107.139 30.908  1.00 55.59 ? 32   HOH B O     1 
HETATM 6873 O  O     . HOH P 5 .   ? 38.014  107.710 49.616  1.00 30.90 ? 43   HOH B O     1 
HETATM 6874 O  O     . HOH P 5 .   ? 45.842  101.695 46.881  1.00 29.15 ? 45   HOH B O     1 
HETATM 6875 O  O     . HOH P 5 .   ? 24.682  104.673 56.835  1.00 26.79 ? 47   HOH B O     1 
HETATM 6876 O  O     . HOH P 5 .   ? 26.510  107.503 31.085  1.00 40.39 ? 48   HOH B O     1 
HETATM 6877 O  O     . HOH P 5 .   ? 39.970  114.208 42.432  1.00 29.70 ? 49   HOH B O     1 
HETATM 6878 O  O     . HOH P 5 .   ? 24.497  96.124  39.819  1.00 41.29 ? 52   HOH B O     1 
HETATM 6879 O  O     . HOH P 5 .   ? 18.074  104.671 65.194  1.00 33.08 ? 55   HOH B O     1 
HETATM 6880 O  O     . HOH P 5 .   ? 25.227  101.669 56.427  1.00 17.90 ? 57   HOH B O     1 
HETATM 6881 O  O     . HOH P 5 .   ? 72.035  92.862  43.774  1.00 55.01 ? 59   HOH B O     1 
HETATM 6882 O  O     . HOH P 5 .   ? 14.624  103.880 24.834  1.00 49.15 ? 61   HOH B O     1 
HETATM 6883 O  O     . HOH P 5 .   ? 22.278  91.199  52.365  1.00 25.76 ? 68   HOH B O     1 
HETATM 6884 O  O     . HOH P 5 .   ? 29.578  113.618 61.463  1.00 37.18 ? 69   HOH B O     1 
HETATM 6885 O  O     . HOH P 5 .   ? 42.138  107.180 38.312  1.00 41.55 ? 70   HOH B O     1 
HETATM 6886 O  O     . HOH P 5 .   ? 35.616  107.335 78.912  1.00 34.07 ? 74   HOH B O     1 
HETATM 6887 O  O     . HOH P 5 .   ? 54.588  116.621 52.035  1.00 27.92 ? 75   HOH B O     1 
HETATM 6888 O  O     . HOH P 5 .   ? 22.923  99.216  42.229  1.00 34.72 ? 78   HOH B O     1 
HETATM 6889 O  O     . HOH P 5 .   ? 48.159  109.359 60.765  1.00 21.90 ? 79   HOH B O     1 
HETATM 6890 O  O     . HOH P 5 .   ? 25.697  110.486 67.155  1.00 25.60 ? 83   HOH B O     1 
HETATM 6891 O  O     . HOH P 5 .   ? 28.413  103.869 27.077  1.00 35.34 ? 85   HOH B O     1 
HETATM 6892 O  O     . HOH P 5 .   ? 52.360  118.709 66.964  1.00 48.63 ? 90   HOH B O     1 
HETATM 6893 O  O     . HOH P 5 .   ? 13.671  93.052  40.193  1.00 38.09 ? 91   HOH B O     1 
HETATM 6894 O  O     . HOH P 5 .   ? 67.653  97.369  49.571  1.00 33.51 ? 93   HOH B O     1 
HETATM 6895 O  O     . HOH P 5 .   ? 39.509  122.186 62.576  1.00 25.64 ? 94   HOH B O     1 
HETATM 6896 O  O     . HOH P 5 .   ? 45.575  95.756  56.406  1.00 41.14 ? 95   HOH B O     1 
HETATM 6897 O  O     . HOH P 5 .   ? 38.495  122.531 65.124  1.00 30.82 ? 96   HOH B O     1 
HETATM 6898 O  O     . HOH P 5 .   ? 47.590  95.685  54.830  1.00 36.10 ? 98   HOH B O     1 
HETATM 6899 O  O     . HOH P 5 .   ? 38.425  104.067 42.541  1.00 44.89 ? 100  HOH B O     1 
HETATM 6900 O  O     . HOH P 5 .   ? 22.705  113.300 33.319  1.00 39.48 ? 101  HOH B O     1 
HETATM 6901 O  O     . HOH P 5 .   ? 15.429  103.672 67.862  1.00 35.55 ? 105  HOH B O     1 
HETATM 6902 O  O     . HOH P 5 .   ? 53.395  109.991 65.152  1.00 45.76 ? 114  HOH B O     1 
HETATM 6903 O  O     . HOH P 5 .   ? 56.096  88.211  52.377  1.00 38.17 ? 121  HOH B O     1 
HETATM 6904 O  O     . HOH P 5 .   ? 33.780  113.049 48.712  1.00 42.92 ? 124  HOH B O     1 
HETATM 6905 O  O     . HOH P 5 .   ? 48.705  94.241  47.698  1.00 53.11 ? 128  HOH B O     1 
HETATM 6906 O  O     . HOH P 5 .   ? 45.958  93.512  57.733  1.00 40.32 ? 129  HOH B O     1 
HETATM 6907 O  O     . HOH P 5 .   ? 49.980  104.654 52.871  1.00 38.90 ? 131  HOH B O     1 
HETATM 6908 O  O     . HOH P 5 .   ? 50.160  104.678 62.613  1.00 41.39 ? 132  HOH B O     1 
HETATM 6909 O  O     . HOH P 5 .   ? 44.182  104.156 62.061  1.00 37.72 ? 133  HOH B O     1 
HETATM 6910 O  O     . HOH P 5 .   ? 49.579  113.845 64.340  1.00 43.73 ? 134  HOH B O     1 
HETATM 6911 O  O     . HOH P 5 .   ? 51.604  112.780 70.128  1.00 24.98 ? 135  HOH B O     1 
HETATM 6912 O  O     . HOH P 5 .   ? 22.754  114.247 73.151  1.00 49.05 ? 136  HOH B O     1 
HETATM 6913 O  O     . HOH P 5 .   ? 42.906  92.203  45.487  1.00 31.43 ? 137  HOH B O     1 
HETATM 6914 O  O     . HOH P 5 .   ? 26.311  99.760  56.281  1.00 20.02 ? 138  HOH B O     1 
HETATM 6915 O  O     . HOH P 5 .   ? 9.457   92.217  38.243  1.00 43.05 ? 156  HOH B O     1 
HETATM 6916 O  O     . HOH P 5 .   ? 43.074  94.139  46.920  1.00 40.42 ? 160  HOH B O     1 
HETATM 6917 O  O     . HOH P 5 .   ? 38.095  87.558  50.066  1.00 34.93 ? 161  HOH B O     1 
HETATM 6918 O  O     . HOH P 5 .   ? 26.410  95.987  59.306  1.00 32.93 ? 173  HOH B O     1 
HETATM 6919 O  O     . HOH P 5 .   ? 46.994  105.766 54.716  1.00 20.43 ? 1501 HOH B O     1 
HETATM 6920 O  O     . HOH P 5 .   ? 46.800  108.323 55.769  1.00 35.92 ? 1502 HOH B O     1 
HETATM 6921 O  O     . HOH P 5 .   ? 46.486  108.194 54.044  1.00 12.75 ? 1503 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   801  801  DG  G   D . n 
A 1 2   DG  2   802  802  DG  G   D . n 
A 1 3   DT  3   803  803  DT  T   D . n 
A 1 4   DT  4   804  804  DT  T   D . n 
A 1 5   DG  5   805  805  DG  G   D . n 
A 1 6   DG  6   806  806  DG  G   D . n 
A 1 7   DA  7   807  807  DA  A   D . n 
A 1 8   DT  8   808  808  DT  T   D . n 
A 1 9   DG  9   809  809  DG  G   D . n 
A 1 10  DG  10  810  810  DG  G   D . n 
A 1 11  DT  11  811  811  DT  T   D . n 
A 1 12  DA  12  812  812  DA  A   D . n 
A 1 13  DG  13  813  813  DG  G   D . n 
A 1 14  DOC 14  814  814  DOC DOC D . n 
B 2 1   DC  1   901  ?    ?   ?   E . n 
B 2 2   DT  2   902  ?    ?   ?   E . n 
B 2 3   DA  3   903  903  DA  A   E . n 
B 2 4   DA  4   904  904  DA  A   E . n 
B 2 5   DC  5   905  905  DC  C   E . n 
B 2 6   8OG 6   906  906  8OG 8OG E . n 
B 2 7   DC  7   907  907  DC  C   E . n 
B 2 8   DT  8   908  908  DT  T   E . n 
B 2 9   DA  9   909  909  DA  A   E . n 
B 2 10  DC  10  910  910  DC  C   E . n 
B 2 11  DC  11  911  911  DC  C   E . n 
B 2 12  DA  12  912  912  DA  A   E . n 
B 2 13  DT  13  913  913  DT  T   E . n 
B 2 14  DC  14  914  914  DC  C   E . n 
B 2 15  DC  15  915  915  DC  C   E . n 
B 2 16  DA  16  916  916  DA  A   E . n 
B 2 17  DA  17  917  917  DA  A   E . n 
B 2 18  DC  18  918  918  DC  C   E . n 
B 2 19  DC  19  919  919  DC  C   E . n 
C 1 1   DG  1   1801 1801 DG  G   H . n 
C 1 2   DG  2   1802 1802 DG  G   H . n 
C 1 3   DT  3   1803 1803 DT  T   H . n 
C 1 4   DT  4   1804 1804 DT  T   H . n 
C 1 5   DG  5   1805 1805 DG  G   H . n 
C 1 6   DG  6   1806 1806 DG  G   H . n 
C 1 7   DA  7   1807 1807 DA  A   H . n 
C 1 8   DT  8   1808 1808 DT  T   H . n 
C 1 9   DG  9   1809 1809 DG  G   H . n 
C 1 10  DG  10  1810 1810 DG  G   H . n 
C 1 11  DT  11  1811 1811 DT  T   H . n 
C 1 12  DA  12  1812 1812 DA  A   H . n 
C 1 13  DG  13  1813 1813 DG  G   H . n 
C 1 14  DOC 14  1814 1814 DOC DOC H . n 
D 2 1   DC  1   1901 ?    ?   ?   J . n 
D 2 2   DT  2   1902 ?    ?   ?   J . n 
D 2 3   DA  3   1903 1903 DA  A   J . n 
D 2 4   DA  4   1904 1904 DA  A   J . n 
D 2 5   DC  5   1905 1905 DC  C   J . n 
D 2 6   8OG 6   1906 1906 8OG 8OG J . n 
D 2 7   DC  7   1907 1907 DC  C   J . n 
D 2 8   DT  8   1908 1908 DT  T   J . n 
D 2 9   DA  9   1909 1909 DA  A   J . n 
D 2 10  DC  10  1910 1910 DC  C   J . n 
D 2 11  DC  11  1911 1911 DC  C   J . n 
D 2 12  DA  12  1912 1912 DA  A   J . n 
D 2 13  DT  13  1913 1913 DT  T   J . n 
D 2 14  DC  14  1914 1914 DC  C   J . n 
D 2 15  DC  15  1915 1915 DC  C   J . n 
D 2 16  DA  16  1916 1916 DA  A   J . n 
D 2 17  DA  17  1917 1917 DA  A   J . n 
D 2 18  DC  18  1918 1918 DC  C   J . n 
D 2 19  DC  19  1919 1919 DC  C   J . n 
E 3 1   GLY 1   -7   ?    ?   ?   A . n 
E 3 2   SER 2   -6   ?    ?   ?   A . n 
E 3 3   HIS 3   -5   ?    ?   ?   A . n 
E 3 4   MET 4   -4   ?    ?   ?   A . n 
E 3 5   GLY 5   -3   ?    ?   ?   A . n 
E 3 6   GLY 6   -2   ?    ?   ?   A . n 
E 3 7   GLY 7   -1   ?    ?   ?   A . n 
E 3 8   GLY 8   0    ?    ?   ?   A . n 
E 3 9   GLY 9   1    1    GLY GLY A . n 
E 3 10  ILE 10  2    2    ILE ILE A . n 
E 3 11  VAL 11  3    3    VAL VAL A . n 
E 3 12  LEU 12  4    4    LEU LEU A . n 
E 3 13  PHE 13  5    5    PHE PHE A . n 
E 3 14  VAL 14  6    6    VAL VAL A . n 
E 3 15  ASP 15  7    7    ASP ASP A . n 
E 3 16  PHE 16  8    8    PHE PHE A . n 
E 3 17  ASP 17  9    9    ASP ASP A . n 
E 3 18  TYR 18  10   10   TYR TYR A . n 
E 3 19  PHE 19  11   11   PHE PHE A . n 
E 3 20  TYR 20  12   12   TYR TYR A . n 
E 3 21  ALA 21  13   13   ALA ALA A . n 
E 3 22  GLN 22  14   14   GLN GLN A . n 
E 3 23  VAL 23  15   15   VAL VAL A . n 
E 3 24  GLU 24  16   16   GLU GLU A . n 
E 3 25  GLU 25  17   17   GLU GLU A . n 
E 3 26  VAL 26  18   18   VAL VAL A . n 
E 3 27  LEU 27  19   19   LEU LEU A . n 
E 3 28  ASN 28  20   20   ASN ASN A . n 
E 3 29  PRO 29  21   21   PRO PRO A . n 
E 3 30  SER 30  22   22   SER SER A . n 
E 3 31  LEU 31  23   23   LEU LEU A . n 
E 3 32  LYS 32  24   24   LYS LYS A . n 
E 3 33  GLY 33  25   25   GLY GLY A . n 
E 3 34  LYS 34  26   26   LYS LYS A . n 
E 3 35  PRO 35  27   27   PRO PRO A . n 
E 3 36  VAL 36  28   28   VAL VAL A . n 
E 3 37  VAL 37  29   29   VAL VAL A . n 
E 3 38  VAL 38  30   30   VAL VAL A . n 
E 3 39  CYS 39  31   31   CYS CYS A . n 
E 3 40  VAL 40  32   32   VAL VAL A . n 
E 3 41  PHE 41  33   33   PHE PHE A . n 
E 3 42  SER 42  34   34   SER SER A . n 
E 3 43  GLY 43  35   35   GLY GLY A . n 
E 3 44  ARG 44  36   36   ARG ARG A . n 
E 3 45  PHE 45  37   37   PHE PHE A . n 
E 3 46  GLU 46  38   38   GLU GLU A . n 
E 3 47  ASP 47  39   39   ASP ASP A . n 
E 3 48  SER 48  40   40   SER SER A . n 
E 3 49  GLY 49  41   41   GLY GLY A . n 
E 3 50  ALA 50  42   42   ALA ALA A . n 
E 3 51  VAL 51  43   43   VAL VAL A . n 
E 3 52  ALA 52  44   44   ALA ALA A . n 
E 3 53  THR 53  45   45   THR THR A . n 
E 3 54  ALA 54  46   46   ALA ALA A . n 
E 3 55  ASN 55  47   47   ASN ASN A . n 
E 3 56  TYR 56  48   48   TYR TYR A . n 
E 3 57  GLU 57  49   49   GLU GLU A . n 
E 3 58  ALA 58  50   50   ALA ALA A . n 
E 3 59  ARG 59  51   51   ARG ARG A . n 
E 3 60  LYS 60  52   52   LYS LYS A . n 
E 3 61  PHE 61  53   53   PHE PHE A . n 
E 3 62  GLY 62  54   54   GLY GLY A . n 
E 3 63  VAL 63  55   55   VAL VAL A . n 
E 3 64  LYS 64  56   56   LYS LYS A . n 
E 3 65  ALA 65  57   57   ALA ALA A . n 
E 3 66  GLY 66  58   58   GLY GLY A . n 
E 3 67  ILE 67  59   59   ILE ILE A . n 
E 3 68  PRO 68  60   60   PRO PRO A . n 
E 3 69  ILE 69  61   61   ILE ILE A . n 
E 3 70  VAL 70  62   62   VAL VAL A . n 
E 3 71  GLU 71  63   63   GLU GLU A . n 
E 3 72  ALA 72  64   64   ALA ALA A . n 
E 3 73  LYS 73  65   65   LYS LYS A . n 
E 3 74  LYS 74  66   66   LYS LYS A . n 
E 3 75  ILE 75  67   67   ILE ILE A . n 
E 3 76  LEU 76  68   68   LEU LEU A . n 
E 3 77  PRO 77  69   69   PRO PRO A . n 
E 3 78  ASN 78  70   70   ASN ASN A . n 
E 3 79  ALA 79  71   71   ALA ALA A . n 
E 3 80  VAL 80  72   72   VAL VAL A . n 
E 3 81  TYR 81  73   73   TYR TYR A . n 
E 3 82  LEU 82  74   74   LEU LEU A . n 
E 3 83  PRO 83  75   75   PRO PRO A . n 
E 3 84  MET 84  76   76   MET MET A . n 
E 3 85  ARG 85  77   77   ARG ARG A . n 
E 3 86  LYS 86  78   78   LYS LYS A . n 
E 3 87  GLU 87  79   79   GLU GLU A . n 
E 3 88  VAL 88  80   80   VAL VAL A . n 
E 3 89  TYR 89  81   81   TYR TYR A . n 
E 3 90  GLN 90  82   82   GLN GLN A . n 
E 3 91  GLN 91  83   83   GLN GLN A . n 
E 3 92  VAL 92  84   84   VAL VAL A . n 
E 3 93  SER 93  85   85   SER SER A . n 
E 3 94  SER 94  86   86   SER SER A . n 
E 3 95  ARG 95  87   87   ARG ARG A . n 
E 3 96  ILE 96  88   88   ILE ILE A . n 
E 3 97  MET 97  89   89   MET MET A . n 
E 3 98  ASN 98  90   90   ASN ASN A . n 
E 3 99  LEU 99  91   91   LEU LEU A . n 
E 3 100 LEU 100 92   92   LEU LEU A . n 
E 3 101 ARG 101 93   93   ARG ARG A . n 
E 3 102 GLU 102 94   94   GLU GLU A . n 
E 3 103 TYR 103 95   95   TYR TYR A . n 
E 3 104 SER 104 96   96   SER SER A . n 
E 3 105 GLU 105 97   97   GLU GLU A . n 
E 3 106 LYS 106 98   98   LYS LYS A . n 
E 3 107 ILE 107 99   99   ILE ILE A . n 
E 3 108 GLU 108 100  100  GLU GLU A . n 
E 3 109 ILE 109 101  101  ILE ILE A . n 
E 3 110 ALA 110 102  102  ALA ALA A . n 
E 3 111 SER 111 103  103  SER SER A . n 
E 3 112 ILE 112 104  104  ILE ILE A . n 
E 3 113 ASP 113 105  105  ASP ASP A . n 
E 3 114 GLU 114 106  106  GLU GLU A . n 
E 3 115 ALA 115 107  107  ALA ALA A . n 
E 3 116 TYR 116 108  108  TYR TYR A . n 
E 3 117 LEU 117 109  109  LEU LEU A . n 
E 3 118 ASP 118 110  110  ASP ASP A . n 
E 3 119 ILE 119 111  111  ILE ILE A . n 
E 3 120 SER 120 112  112  SER SER A . n 
E 3 121 ASP 121 113  113  ASP ASP A . n 
E 3 122 LYS 122 114  114  LYS LYS A . n 
E 3 123 VAL 123 115  115  VAL VAL A . n 
E 3 124 ARG 124 116  116  ARG ARG A . n 
E 3 125 ASP 125 117  117  ASP ASP A . n 
E 3 126 TYR 126 118  118  TYR TYR A . n 
E 3 127 ARG 127 119  119  ARG ARG A . n 
E 3 128 GLU 128 120  120  GLU GLU A . n 
E 3 129 ALA 129 121  121  ALA ALA A . n 
E 3 130 TYR 130 122  122  TYR TYR A . n 
E 3 131 ASN 131 123  123  ASN ASN A . n 
E 3 132 LEU 132 124  124  LEU LEU A . n 
E 3 133 GLY 133 125  125  GLY GLY A . n 
E 3 134 LEU 134 126  126  LEU LEU A . n 
E 3 135 GLU 135 127  127  GLU GLU A . n 
E 3 136 ILE 136 128  128  ILE ILE A . n 
E 3 137 LYS 137 129  129  LYS LYS A . n 
E 3 138 ASN 138 130  130  ASN ASN A . n 
E 3 139 LYS 139 131  131  LYS LYS A . n 
E 3 140 ILE 140 132  132  ILE ILE A . n 
E 3 141 LEU 141 133  133  LEU LEU A . n 
E 3 142 GLU 142 134  134  GLU GLU A . n 
E 3 143 LYS 143 135  135  LYS LYS A . n 
E 3 144 GLU 144 136  136  GLU GLU A . n 
E 3 145 LYS 145 137  137  LYS LYS A . n 
E 3 146 ILE 146 138  138  ILE ILE A . n 
E 3 147 THR 147 139  139  THR THR A . n 
E 3 148 VAL 148 140  140  VAL VAL A . n 
E 3 149 THR 149 141  141  THR THR A . n 
E 3 150 VAL 150 142  142  VAL VAL A . n 
E 3 151 GLY 151 143  143  GLY GLY A . n 
E 3 152 ILE 152 144  144  ILE ILE A . n 
E 3 153 SER 153 145  145  SER SER A . n 
E 3 154 LYS 154 146  146  LYS LYS A . n 
E 3 155 ASN 155 147  147  ASN ASN A . n 
E 3 156 LYS 156 148  148  LYS LYS A . n 
E 3 157 VAL 157 149  149  VAL VAL A . n 
E 3 158 PHE 158 150  150  PHE PHE A . n 
E 3 159 ALA 159 151  151  ALA ALA A . n 
E 3 160 LYS 160 152  152  LYS LYS A . n 
E 3 161 ILE 161 153  153  ILE ILE A . n 
E 3 162 ALA 162 154  154  ALA ALA A . n 
E 3 163 ALA 163 155  155  ALA ALA A . n 
E 3 164 ASP 164 156  156  ASP ASP A . n 
E 3 165 MET 165 157  157  MET MET A . n 
E 3 166 ALA 166 158  158  ALA ALA A . n 
E 3 167 LYS 167 159  159  LYS LYS A . n 
E 3 168 PRO 168 160  160  PRO PRO A . n 
E 3 169 ASN 169 161  161  ASN ASN A . n 
E 3 170 GLY 170 162  162  GLY GLY A . n 
E 3 171 ILE 171 163  163  ILE ILE A . n 
E 3 172 LYS 172 164  164  LYS LYS A . n 
E 3 173 VAL 173 165  165  VAL VAL A . n 
E 3 174 ILE 174 166  166  ILE ILE A . n 
E 3 175 ASP 175 167  167  ASP ASP A . n 
E 3 176 ASP 176 168  168  ASP ASP A . n 
E 3 177 GLU 177 169  169  GLU GLU A . n 
E 3 178 GLU 178 170  170  GLU GLU A . n 
E 3 179 VAL 179 171  171  VAL VAL A . n 
E 3 180 LYS 180 172  172  LYS LYS A . n 
E 3 181 ARG 181 173  173  ARG ARG A . n 
E 3 182 LEU 182 174  174  LEU LEU A . n 
E 3 183 ILE 183 175  175  ILE ILE A . n 
E 3 184 ARG 184 176  176  ARG ARG A . n 
E 3 185 GLU 185 177  177  GLU GLU A . n 
E 3 186 LEU 186 178  178  LEU LEU A . n 
E 3 187 ASP 187 179  179  ASP ASP A . n 
E 3 188 ILE 188 180  180  ILE ILE A . n 
E 3 189 ALA 189 181  181  ALA ALA A . n 
E 3 190 ASP 190 182  182  ASP ASP A . n 
E 3 191 VAL 191 183  183  VAL VAL A . n 
E 3 192 PRO 192 184  184  PRO PRO A . n 
E 3 193 GLY 193 185  185  GLY GLY A . n 
E 3 194 ILE 194 186  186  ILE ILE A . n 
E 3 195 GLY 195 187  187  GLY GLY A . n 
E 3 196 ASN 196 188  188  ASN ASN A . n 
E 3 197 ILE 197 189  189  ILE ILE A . n 
E 3 198 THR 198 190  190  THR THR A . n 
E 3 199 ALA 199 191  191  ALA ALA A . n 
E 3 200 GLU 200 192  192  GLU GLU A . n 
E 3 201 LYS 201 193  193  LYS LYS A . n 
E 3 202 LEU 202 194  194  LEU LEU A . n 
E 3 203 LYS 203 195  195  LYS LYS A . n 
E 3 204 LYS 204 196  196  LYS LYS A . n 
E 3 205 LEU 205 197  197  LEU LEU A . n 
E 3 206 GLY 206 198  198  GLY GLY A . n 
E 3 207 ILE 207 199  199  ILE ILE A . n 
E 3 208 ASN 208 200  200  ASN ASN A . n 
E 3 209 LYS 209 201  201  LYS LYS A . n 
E 3 210 LEU 210 202  202  LEU LEU A . n 
E 3 211 VAL 211 203  203  VAL VAL A . n 
E 3 212 ASP 212 204  204  ASP ASP A . n 
E 3 213 THR 213 205  205  THR THR A . n 
E 3 214 LEU 214 206  206  LEU LEU A . n 
E 3 215 SER 215 207  207  SER SER A . n 
E 3 216 ILE 216 208  208  ILE ILE A . n 
E 3 217 GLU 217 209  209  GLU GLU A . n 
E 3 218 PHE 218 210  210  PHE PHE A . n 
E 3 219 ASP 219 211  211  ASP ASP A . n 
E 3 220 LYS 220 212  212  LYS LYS A . n 
E 3 221 LEU 221 213  213  LEU LEU A . n 
E 3 222 LYS 222 214  214  LYS LYS A . n 
E 3 223 GLY 223 215  215  GLY GLY A . n 
E 3 224 MET 224 216  216  MET MET A . n 
E 3 225 ILE 225 217  217  ILE ILE A . n 
E 3 226 GLY 226 218  218  GLY GLY A . n 
E 3 227 GLU 227 219  219  GLU GLU A . n 
E 3 228 ALA 228 220  220  ALA ALA A . n 
E 3 229 LYS 229 221  221  LYS LYS A . n 
E 3 230 ALA 230 222  222  ALA ALA A . n 
E 3 231 LYS 231 223  223  LYS LYS A . n 
E 3 232 TYR 232 224  224  TYR TYR A . n 
E 3 233 LEU 233 225  225  LEU LEU A . n 
E 3 234 ILE 234 226  226  ILE ILE A . n 
E 3 235 SER 235 227  227  SER SER A . n 
E 3 236 LEU 236 228  228  LEU LEU A . n 
E 3 237 ALA 237 229  229  ALA ALA A . n 
E 3 238 ARG 238 230  230  ARG ARG A . n 
E 3 239 ASP 239 231  231  ASP ASP A . n 
E 3 240 GLU 240 232  232  GLU GLU A . n 
E 3 241 TYR 241 233  233  TYR TYR A . n 
E 3 242 ASN 242 234  234  ASN ASN A . n 
E 3 243 GLU 243 235  235  GLU GLU A . n 
E 3 244 PRO 244 236  236  PRO PRO A . n 
E 3 245 ILE 245 237  237  ILE ILE A . n 
E 3 246 ARG 246 238  238  ARG ARG A . n 
E 3 247 THR 247 239  239  THR THR A . n 
E 3 248 ARG 248 240  240  ARG ARG A . n 
E 3 249 VAL 249 241  241  VAL VAL A . n 
E 3 250 ARG 250 242  242  ARG ARG A . n 
E 3 251 LYS 251 243  243  LYS LYS A . n 
E 3 252 SER 252 244  244  SER SER A . n 
E 3 253 ILE 253 245  245  ILE ILE A . n 
E 3 254 GLY 254 246  246  GLY GLY A . n 
E 3 255 ARG 255 247  247  ARG ARG A . n 
E 3 256 ILE 256 248  248  ILE ILE A . n 
E 3 257 VAL 257 249  249  VAL VAL A . n 
E 3 258 THR 258 250  250  THR THR A . n 
E 3 259 MET 259 251  251  MET MET A . n 
E 3 260 LYS 260 252  252  LYS LYS A . n 
E 3 261 ARG 261 253  253  ARG ARG A . n 
E 3 262 ASN 262 254  254  ASN ASN A . n 
E 3 263 SER 263 255  255  SER SER A . n 
E 3 264 ARG 264 256  256  ARG ARG A . n 
E 3 265 ASN 265 257  257  ASN ASN A . n 
E 3 266 LEU 266 258  258  LEU LEU A . n 
E 3 267 GLU 267 259  259  GLU GLU A . n 
E 3 268 GLU 268 260  260  GLU GLU A . n 
E 3 269 ILE 269 261  261  ILE ILE A . n 
E 3 270 LYS 270 262  262  LYS LYS A . n 
E 3 271 PRO 271 263  263  PRO PRO A . n 
E 3 272 TYR 272 264  264  TYR TYR A . n 
E 3 273 LEU 273 265  265  LEU LEU A . n 
E 3 274 PHE 274 266  266  PHE PHE A . n 
E 3 275 ARG 275 267  267  ARG ARG A . n 
E 3 276 ALA 276 268  268  ALA ALA A . n 
E 3 277 ILE 277 269  269  ILE ILE A . n 
E 3 278 GLU 278 270  270  GLU GLU A . n 
E 3 279 GLU 279 271  271  GLU GLU A . n 
E 3 280 SER 280 272  272  SER SER A . n 
E 3 281 TYR 281 273  273  TYR TYR A . n 
E 3 282 TYR 282 274  274  TYR TYR A . n 
E 3 283 LYS 283 275  275  LYS LYS A . n 
E 3 284 LEU 284 276  276  LEU LEU A . n 
E 3 285 ASP 285 277  277  ASP ASP A . n 
E 3 286 LYS 286 278  278  LYS LYS A . n 
E 3 287 ARG 287 279  279  ARG ARG A . n 
E 3 288 ILE 288 280  280  ILE ILE A . n 
E 3 289 PRO 289 281  281  PRO PRO A . n 
E 3 290 LYS 290 282  282  LYS LYS A . n 
E 3 291 ALA 291 283  283  ALA ALA A . n 
E 3 292 ILE 292 284  284  ILE ILE A . n 
E 3 293 HIS 293 285  285  HIS HIS A . n 
E 3 294 VAL 294 286  286  VAL VAL A . n 
E 3 295 VAL 295 287  287  VAL VAL A . n 
E 3 296 ALA 296 288  288  ALA ALA A . n 
E 3 297 VAL 297 289  289  VAL VAL A . n 
E 3 298 THR 298 290  290  THR THR A . n 
E 3 299 GLU 299 291  291  GLU GLU A . n 
E 3 300 ASP 300 292  292  ASP ASP A . n 
E 3 301 LEU 301 293  293  LEU LEU A . n 
E 3 302 ASP 302 294  294  ASP ASP A . n 
E 3 303 ILE 303 295  295  ILE ILE A . n 
E 3 304 VAL 304 296  296  VAL VAL A . n 
E 3 305 SER 305 297  297  SER SER A . n 
E 3 306 ARG 306 298  298  ARG ARG A . n 
E 3 307 GLY 307 299  299  GLY GLY A . n 
E 3 308 ARG 308 300  300  ARG ARG A . n 
E 3 309 THR 309 301  301  THR THR A . n 
E 3 310 PHE 310 302  302  PHE PHE A . n 
E 3 311 PRO 311 303  303  PRO PRO A . n 
E 3 312 HIS 312 304  304  HIS HIS A . n 
E 3 313 GLY 313 305  305  GLY GLY A . n 
E 3 314 ILE 314 306  306  ILE ILE A . n 
E 3 315 SER 315 307  307  SER SER A . n 
E 3 316 LYS 316 308  308  LYS LYS A . n 
E 3 317 GLU 317 309  309  GLU GLU A . n 
E 3 318 THR 318 310  310  THR THR A . n 
E 3 319 ALA 319 311  311  ALA ALA A . n 
E 3 320 TYR 320 312  312  TYR TYR A . n 
E 3 321 SER 321 313  313  SER SER A . n 
E 3 322 GLU 322 314  314  GLU GLU A . n 
E 3 323 SER 323 315  315  SER SER A . n 
E 3 324 VAL 324 316  316  VAL VAL A . n 
E 3 325 LYS 325 317  317  LYS LYS A . n 
E 3 326 LEU 326 318  318  LEU LEU A . n 
E 3 327 LEU 327 319  319  LEU LEU A . n 
E 3 328 GLN 328 320  320  GLN GLN A . n 
E 3 329 LYS 329 321  321  LYS LYS A . n 
E 3 330 ILE 330 322  322  ILE ILE A . n 
E 3 331 LEU 331 323  323  LEU LEU A . n 
E 3 332 GLU 332 324  324  GLU GLU A . n 
E 3 333 GLU 333 325  325  GLU GLU A . n 
E 3 334 ASP 334 326  326  ASP ASP A . n 
E 3 335 GLU 335 327  327  GLU GLU A . n 
E 3 336 ARG 336 328  328  ARG ARG A . n 
E 3 337 LYS 337 329  329  LYS LYS A . n 
E 3 338 ILE 338 330  330  ILE ILE A . n 
E 3 339 ARG 339 331  331  ARG ARG A . n 
E 3 340 ARG 340 332  332  ARG ARG A . n 
E 3 341 ILE 341 333  333  ILE ILE A . n 
E 3 342 GLY 342 334  334  GLY GLY A . n 
E 3 343 VAL 343 335  335  VAL VAL A . n 
E 3 344 ARG 344 336  336  ARG ARG A . n 
E 3 345 PHE 345 337  337  PHE PHE A . n 
E 3 346 SER 346 338  338  SER SER A . n 
E 3 347 LYS 347 339  339  LYS LYS A . n 
E 3 348 PHE 348 340  340  PHE PHE A . n 
E 3 349 ILE 349 341  341  ILE ILE A . n 
E 3 350 GLU 350 342  ?    ?   ?   A . n 
E 3 351 ALA 351 343  ?    ?   ?   A . n 
E 3 352 ILE 352 344  ?    ?   ?   A . n 
E 3 353 GLY 353 345  ?    ?   ?   A . n 
E 3 354 LEU 354 346  ?    ?   ?   A . n 
E 3 355 ASP 355 347  ?    ?   ?   A . n 
E 3 356 LYS 356 348  ?    ?   ?   A . n 
E 3 357 PHE 357 349  ?    ?   ?   A . n 
E 3 358 PHE 358 350  ?    ?   ?   A . n 
E 3 359 ASP 359 351  ?    ?   ?   A . n 
E 3 360 THR 360 352  ?    ?   ?   A . n 
F 3 1   GLY 1   -7   ?    ?   ?   B . n 
F 3 2   SER 2   -6   ?    ?   ?   B . n 
F 3 3   HIS 3   -5   ?    ?   ?   B . n 
F 3 4   MET 4   -4   ?    ?   ?   B . n 
F 3 5   GLY 5   -3   ?    ?   ?   B . n 
F 3 6   GLY 6   -2   ?    ?   ?   B . n 
F 3 7   GLY 7   -1   ?    ?   ?   B . n 
F 3 8   GLY 8   0    ?    ?   ?   B . n 
F 3 9   GLY 9   1001 1001 GLY GLY B . n 
F 3 10  ILE 10  1002 1002 ILE ILE B . n 
F 3 11  VAL 11  1003 1003 VAL VAL B . n 
F 3 12  LEU 12  1004 1004 LEU LEU B . n 
F 3 13  PHE 13  1005 1005 PHE PHE B . n 
F 3 14  VAL 14  1006 1006 VAL VAL B . n 
F 3 15  ASP 15  1007 1007 ASP ASP B . n 
F 3 16  PHE 16  1008 1008 PHE PHE B . n 
F 3 17  ASP 17  1009 1009 ASP ASP B . n 
F 3 18  TYR 18  1010 1010 TYR TYR B . n 
F 3 19  PHE 19  1011 1011 PHE PHE B . n 
F 3 20  TYR 20  1012 1012 TYR TYR B . n 
F 3 21  ALA 21  1013 1013 ALA ALA B . n 
F 3 22  GLN 22  1014 1014 GLN GLN B . n 
F 3 23  VAL 23  1015 1015 VAL VAL B . n 
F 3 24  GLU 24  1016 1016 GLU GLU B . n 
F 3 25  GLU 25  1017 1017 GLU GLU B . n 
F 3 26  VAL 26  1018 1018 VAL VAL B . n 
F 3 27  LEU 27  1019 1019 LEU LEU B . n 
F 3 28  ASN 28  1020 1020 ASN ASN B . n 
F 3 29  PRO 29  1021 1021 PRO PRO B . n 
F 3 30  SER 30  1022 1022 SER SER B . n 
F 3 31  LEU 31  1023 1023 LEU LEU B . n 
F 3 32  LYS 32  1024 1024 LYS LYS B . n 
F 3 33  GLY 33  1025 1025 GLY GLY B . n 
F 3 34  LYS 34  1026 1026 LYS LYS B . n 
F 3 35  PRO 35  1027 1027 PRO PRO B . n 
F 3 36  VAL 36  1028 1028 VAL VAL B . n 
F 3 37  VAL 37  1029 1029 VAL VAL B . n 
F 3 38  VAL 38  1030 1030 VAL VAL B . n 
F 3 39  CYS 39  1031 1031 CYS CYS B . n 
F 3 40  VAL 40  1032 1032 VAL VAL B . n 
F 3 41  PHE 41  1033 1033 PHE PHE B . n 
F 3 42  SER 42  1034 1034 SER SER B . n 
F 3 43  GLY 43  1035 1035 GLY GLY B . n 
F 3 44  ARG 44  1036 1036 ARG ARG B . n 
F 3 45  PHE 45  1037 1037 PHE PHE B . n 
F 3 46  GLU 46  1038 1038 GLU GLU B . n 
F 3 47  ASP 47  1039 1039 ASP ASP B . n 
F 3 48  SER 48  1040 1040 SER SER B . n 
F 3 49  GLY 49  1041 1041 GLY GLY B . n 
F 3 50  ALA 50  1042 1042 ALA ALA B . n 
F 3 51  VAL 51  1043 1043 VAL VAL B . n 
F 3 52  ALA 52  1044 1044 ALA ALA B . n 
F 3 53  THR 53  1045 1045 THR THR B . n 
F 3 54  ALA 54  1046 1046 ALA ALA B . n 
F 3 55  ASN 55  1047 1047 ASN ASN B . n 
F 3 56  TYR 56  1048 1048 TYR TYR B . n 
F 3 57  GLU 57  1049 1049 GLU GLU B . n 
F 3 58  ALA 58  1050 1050 ALA ALA B . n 
F 3 59  ARG 59  1051 1051 ARG ARG B . n 
F 3 60  LYS 60  1052 1052 LYS LYS B . n 
F 3 61  PHE 61  1053 1053 PHE PHE B . n 
F 3 62  GLY 62  1054 1054 GLY GLY B . n 
F 3 63  VAL 63  1055 1055 VAL VAL B . n 
F 3 64  LYS 64  1056 1056 LYS LYS B . n 
F 3 65  ALA 65  1057 1057 ALA ALA B . n 
F 3 66  GLY 66  1058 1058 GLY GLY B . n 
F 3 67  ILE 67  1059 1059 ILE ILE B . n 
F 3 68  PRO 68  1060 1060 PRO PRO B . n 
F 3 69  ILE 69  1061 1061 ILE ILE B . n 
F 3 70  VAL 70  1062 1062 VAL VAL B . n 
F 3 71  GLU 71  1063 1063 GLU GLU B . n 
F 3 72  ALA 72  1064 1064 ALA ALA B . n 
F 3 73  LYS 73  1065 1065 LYS LYS B . n 
F 3 74  LYS 74  1066 1066 LYS LYS B . n 
F 3 75  ILE 75  1067 1067 ILE ILE B . n 
F 3 76  LEU 76  1068 1068 LEU LEU B . n 
F 3 77  PRO 77  1069 1069 PRO PRO B . n 
F 3 78  ASN 78  1070 1070 ASN ASN B . n 
F 3 79  ALA 79  1071 1071 ALA ALA B . n 
F 3 80  VAL 80  1072 1072 VAL VAL B . n 
F 3 81  TYR 81  1073 1073 TYR TYR B . n 
F 3 82  LEU 82  1074 1074 LEU LEU B . n 
F 3 83  PRO 83  1075 1075 PRO PRO B . n 
F 3 84  MET 84  1076 1076 MET MET B . n 
F 3 85  ARG 85  1077 1077 ARG ARG B . n 
F 3 86  LYS 86  1078 1078 LYS LYS B . n 
F 3 87  GLU 87  1079 1079 GLU GLU B . n 
F 3 88  VAL 88  1080 1080 VAL VAL B . n 
F 3 89  TYR 89  1081 1081 TYR TYR B . n 
F 3 90  GLN 90  1082 1082 GLN GLN B . n 
F 3 91  GLN 91  1083 1083 GLN GLN B . n 
F 3 92  VAL 92  1084 1084 VAL VAL B . n 
F 3 93  SER 93  1085 1085 SER SER B . n 
F 3 94  SER 94  1086 1086 SER SER B . n 
F 3 95  ARG 95  1087 1087 ARG ARG B . n 
F 3 96  ILE 96  1088 1088 ILE ILE B . n 
F 3 97  MET 97  1089 1089 MET MET B . n 
F 3 98  ASN 98  1090 1090 ASN ASN B . n 
F 3 99  LEU 99  1091 1091 LEU LEU B . n 
F 3 100 LEU 100 1092 1092 LEU LEU B . n 
F 3 101 ARG 101 1093 1093 ARG ARG B . n 
F 3 102 GLU 102 1094 1094 GLU GLU B . n 
F 3 103 TYR 103 1095 1095 TYR TYR B . n 
F 3 104 SER 104 1096 1096 SER SER B . n 
F 3 105 GLU 105 1097 1097 GLU GLU B . n 
F 3 106 LYS 106 1098 1098 LYS LYS B . n 
F 3 107 ILE 107 1099 1099 ILE ILE B . n 
F 3 108 GLU 108 1100 1100 GLU GLU B . n 
F 3 109 ILE 109 1101 1101 ILE ILE B . n 
F 3 110 ALA 110 1102 1102 ALA ALA B . n 
F 3 111 SER 111 1103 1103 SER SER B . n 
F 3 112 ILE 112 1104 1104 ILE ILE B . n 
F 3 113 ASP 113 1105 1105 ASP ASP B . n 
F 3 114 GLU 114 1106 1106 GLU GLU B . n 
F 3 115 ALA 115 1107 1107 ALA ALA B . n 
F 3 116 TYR 116 1108 1108 TYR TYR B . n 
F 3 117 LEU 117 1109 1109 LEU LEU B . n 
F 3 118 ASP 118 1110 1110 ASP ASP B . n 
F 3 119 ILE 119 1111 1111 ILE ILE B . n 
F 3 120 SER 120 1112 1112 SER SER B . n 
F 3 121 ASP 121 1113 1113 ASP ASP B . n 
F 3 122 LYS 122 1114 1114 LYS LYS B . n 
F 3 123 VAL 123 1115 1115 VAL VAL B . n 
F 3 124 ARG 124 1116 1116 ARG ARG B . n 
F 3 125 ASP 125 1117 1117 ASP ASP B . n 
F 3 126 TYR 126 1118 1118 TYR TYR B . n 
F 3 127 ARG 127 1119 1119 ARG ARG B . n 
F 3 128 GLU 128 1120 1120 GLU GLU B . n 
F 3 129 ALA 129 1121 1121 ALA ALA B . n 
F 3 130 TYR 130 1122 1122 TYR TYR B . n 
F 3 131 ASN 131 1123 1123 ASN ASN B . n 
F 3 132 LEU 132 1124 1124 LEU LEU B . n 
F 3 133 GLY 133 1125 1125 GLY GLY B . n 
F 3 134 LEU 134 1126 1126 LEU LEU B . n 
F 3 135 GLU 135 1127 1127 GLU GLU B . n 
F 3 136 ILE 136 1128 1128 ILE ILE B . n 
F 3 137 LYS 137 1129 1129 LYS LYS B . n 
F 3 138 ASN 138 1130 1130 ASN ASN B . n 
F 3 139 LYS 139 1131 1131 LYS LYS B . n 
F 3 140 ILE 140 1132 1132 ILE ILE B . n 
F 3 141 LEU 141 1133 1133 LEU LEU B . n 
F 3 142 GLU 142 1134 1134 GLU GLU B . n 
F 3 143 LYS 143 1135 1135 LYS LYS B . n 
F 3 144 GLU 144 1136 1136 GLU GLU B . n 
F 3 145 LYS 145 1137 1137 LYS LYS B . n 
F 3 146 ILE 146 1138 1138 ILE ILE B . n 
F 3 147 THR 147 1139 1139 THR THR B . n 
F 3 148 VAL 148 1140 1140 VAL VAL B . n 
F 3 149 THR 149 1141 1141 THR THR B . n 
F 3 150 VAL 150 1142 1142 VAL VAL B . n 
F 3 151 GLY 151 1143 1143 GLY GLY B . n 
F 3 152 ILE 152 1144 1144 ILE ILE B . n 
F 3 153 SER 153 1145 1145 SER SER B . n 
F 3 154 LYS 154 1146 1146 LYS LYS B . n 
F 3 155 ASN 155 1147 1147 ASN ASN B . n 
F 3 156 LYS 156 1148 1148 LYS LYS B . n 
F 3 157 VAL 157 1149 1149 VAL VAL B . n 
F 3 158 PHE 158 1150 1150 PHE PHE B . n 
F 3 159 ALA 159 1151 1151 ALA ALA B . n 
F 3 160 LYS 160 1152 1152 LYS LYS B . n 
F 3 161 ILE 161 1153 1153 ILE ILE B . n 
F 3 162 ALA 162 1154 1154 ALA ALA B . n 
F 3 163 ALA 163 1155 1155 ALA ALA B . n 
F 3 164 ASP 164 1156 1156 ASP ASP B . n 
F 3 165 MET 165 1157 1157 MET MET B . n 
F 3 166 ALA 166 1158 1158 ALA ALA B . n 
F 3 167 LYS 167 1159 1159 LYS LYS B . n 
F 3 168 PRO 168 1160 1160 PRO PRO B . n 
F 3 169 ASN 169 1161 1161 ASN ASN B . n 
F 3 170 GLY 170 1162 1162 GLY GLY B . n 
F 3 171 ILE 171 1163 1163 ILE ILE B . n 
F 3 172 LYS 172 1164 1164 LYS LYS B . n 
F 3 173 VAL 173 1165 1165 VAL VAL B . n 
F 3 174 ILE 174 1166 1166 ILE ILE B . n 
F 3 175 ASP 175 1167 1167 ASP ASP B . n 
F 3 176 ASP 176 1168 1168 ASP ASP B . n 
F 3 177 GLU 177 1169 1169 GLU GLU B . n 
F 3 178 GLU 178 1170 1170 GLU GLU B . n 
F 3 179 VAL 179 1171 1171 VAL VAL B . n 
F 3 180 LYS 180 1172 1172 LYS LYS B . n 
F 3 181 ARG 181 1173 1173 ARG ARG B . n 
F 3 182 LEU 182 1174 1174 LEU LEU B . n 
F 3 183 ILE 183 1175 1175 ILE ILE B . n 
F 3 184 ARG 184 1176 1176 ARG ARG B . n 
F 3 185 GLU 185 1177 1177 GLU GLU B . n 
F 3 186 LEU 186 1178 1178 LEU LEU B . n 
F 3 187 ASP 187 1179 1179 ASP ASP B . n 
F 3 188 ILE 188 1180 1180 ILE ILE B . n 
F 3 189 ALA 189 1181 1181 ALA ALA B . n 
F 3 190 ASP 190 1182 1182 ASP ASP B . n 
F 3 191 VAL 191 1183 1183 VAL VAL B . n 
F 3 192 PRO 192 1184 1184 PRO PRO B . n 
F 3 193 GLY 193 1185 1185 GLY GLY B . n 
F 3 194 ILE 194 1186 1186 ILE ILE B . n 
F 3 195 GLY 195 1187 1187 GLY GLY B . n 
F 3 196 ASN 196 1188 1188 ASN ASN B . n 
F 3 197 ILE 197 1189 1189 ILE ILE B . n 
F 3 198 THR 198 1190 1190 THR THR B . n 
F 3 199 ALA 199 1191 1191 ALA ALA B . n 
F 3 200 GLU 200 1192 1192 GLU GLU B . n 
F 3 201 LYS 201 1193 1193 LYS LYS B . n 
F 3 202 LEU 202 1194 1194 LEU LEU B . n 
F 3 203 LYS 203 1195 1195 LYS LYS B . n 
F 3 204 LYS 204 1196 1196 LYS LYS B . n 
F 3 205 LEU 205 1197 1197 LEU LEU B . n 
F 3 206 GLY 206 1198 1198 GLY GLY B . n 
F 3 207 ILE 207 1199 1199 ILE ILE B . n 
F 3 208 ASN 208 1200 1200 ASN ASN B . n 
F 3 209 LYS 209 1201 1201 LYS LYS B . n 
F 3 210 LEU 210 1202 1202 LEU LEU B . n 
F 3 211 VAL 211 1203 1203 VAL VAL B . n 
F 3 212 ASP 212 1204 1204 ASP ASP B . n 
F 3 213 THR 213 1205 1205 THR THR B . n 
F 3 214 LEU 214 1206 1206 LEU LEU B . n 
F 3 215 SER 215 1207 1207 SER SER B . n 
F 3 216 ILE 216 1208 1208 ILE ILE B . n 
F 3 217 GLU 217 1209 1209 GLU GLU B . n 
F 3 218 PHE 218 1210 1210 PHE PHE B . n 
F 3 219 ASP 219 1211 1211 ASP ASP B . n 
F 3 220 LYS 220 1212 1212 LYS LYS B . n 
F 3 221 LEU 221 1213 1213 LEU LEU B . n 
F 3 222 LYS 222 1214 1214 LYS LYS B . n 
F 3 223 GLY 223 1215 1215 GLY GLY B . n 
F 3 224 MET 224 1216 1216 MET MET B . n 
F 3 225 ILE 225 1217 1217 ILE ILE B . n 
F 3 226 GLY 226 1218 1218 GLY GLY B . n 
F 3 227 GLU 227 1219 1219 GLU GLU B . n 
F 3 228 ALA 228 1220 1220 ALA ALA B . n 
F 3 229 LYS 229 1221 1221 LYS LYS B . n 
F 3 230 ALA 230 1222 1222 ALA ALA B . n 
F 3 231 LYS 231 1223 1223 LYS LYS B . n 
F 3 232 TYR 232 1224 1224 TYR TYR B . n 
F 3 233 LEU 233 1225 1225 LEU LEU B . n 
F 3 234 ILE 234 1226 1226 ILE ILE B . n 
F 3 235 SER 235 1227 1227 SER SER B . n 
F 3 236 LEU 236 1228 1228 LEU LEU B . n 
F 3 237 ALA 237 1229 1229 ALA ALA B . n 
F 3 238 ARG 238 1230 1230 ARG ARG B . n 
F 3 239 ASP 239 1231 1231 ASP ASP B . n 
F 3 240 GLU 240 1232 1232 GLU GLU B . n 
F 3 241 TYR 241 1233 1233 TYR TYR B . n 
F 3 242 ASN 242 1234 1234 ASN ASN B . n 
F 3 243 GLU 243 1235 1235 GLU GLU B . n 
F 3 244 PRO 244 1236 1236 PRO PRO B . n 
F 3 245 ILE 245 1237 1237 ILE ILE B . n 
F 3 246 ARG 246 1238 1238 ARG ARG B . n 
F 3 247 THR 247 1239 1239 THR THR B . n 
F 3 248 ARG 248 1240 1240 ARG ARG B . n 
F 3 249 VAL 249 1241 1241 VAL VAL B . n 
F 3 250 ARG 250 1242 1242 ARG ARG B . n 
F 3 251 LYS 251 1243 1243 LYS LYS B . n 
F 3 252 SER 252 1244 1244 SER SER B . n 
F 3 253 ILE 253 1245 1245 ILE ILE B . n 
F 3 254 GLY 254 1246 1246 GLY GLY B . n 
F 3 255 ARG 255 1247 1247 ARG ARG B . n 
F 3 256 ILE 256 1248 1248 ILE ILE B . n 
F 3 257 VAL 257 1249 1249 VAL VAL B . n 
F 3 258 THR 258 1250 1250 THR THR B . n 
F 3 259 MET 259 1251 1251 MET MET B . n 
F 3 260 LYS 260 1252 1252 LYS LYS B . n 
F 3 261 ARG 261 1253 1253 ARG ARG B . n 
F 3 262 ASN 262 1254 1254 ASN ASN B . n 
F 3 263 SER 263 1255 1255 SER SER B . n 
F 3 264 ARG 264 1256 1256 ARG ARG B . n 
F 3 265 ASN 265 1257 1257 ASN ASN B . n 
F 3 266 LEU 266 1258 1258 LEU LEU B . n 
F 3 267 GLU 267 1259 1259 GLU GLU B . n 
F 3 268 GLU 268 1260 1260 GLU GLU B . n 
F 3 269 ILE 269 1261 1261 ILE ILE B . n 
F 3 270 LYS 270 1262 1262 LYS LYS B . n 
F 3 271 PRO 271 1263 1263 PRO PRO B . n 
F 3 272 TYR 272 1264 1264 TYR TYR B . n 
F 3 273 LEU 273 1265 1265 LEU LEU B . n 
F 3 274 PHE 274 1266 1266 PHE PHE B . n 
F 3 275 ARG 275 1267 1267 ARG ARG B . n 
F 3 276 ALA 276 1268 1268 ALA ALA B . n 
F 3 277 ILE 277 1269 1269 ILE ILE B . n 
F 3 278 GLU 278 1270 1270 GLU GLU B . n 
F 3 279 GLU 279 1271 1271 GLU GLU B . n 
F 3 280 SER 280 1272 1272 SER SER B . n 
F 3 281 TYR 281 1273 1273 TYR TYR B . n 
F 3 282 TYR 282 1274 1274 TYR TYR B . n 
F 3 283 LYS 283 1275 1275 LYS LYS B . n 
F 3 284 LEU 284 1276 1276 LEU LEU B . n 
F 3 285 ASP 285 1277 1277 ASP ASP B . n 
F 3 286 LYS 286 1278 1278 LYS LYS B . n 
F 3 287 ARG 287 1279 1279 ARG ARG B . n 
F 3 288 ILE 288 1280 1280 ILE ILE B . n 
F 3 289 PRO 289 1281 1281 PRO PRO B . n 
F 3 290 LYS 290 1282 1282 LYS LYS B . n 
F 3 291 ALA 291 1283 1283 ALA ALA B . n 
F 3 292 ILE 292 1284 1284 ILE ILE B . n 
F 3 293 HIS 293 1285 1285 HIS HIS B . n 
F 3 294 VAL 294 1286 1286 VAL VAL B . n 
F 3 295 VAL 295 1287 1287 VAL VAL B . n 
F 3 296 ALA 296 1288 1288 ALA ALA B . n 
F 3 297 VAL 297 1289 1289 VAL VAL B . n 
F 3 298 THR 298 1290 1290 THR THR B . n 
F 3 299 GLU 299 1291 1291 GLU GLU B . n 
F 3 300 ASP 300 1292 1292 ASP ASP B . n 
F 3 301 LEU 301 1293 1293 LEU LEU B . n 
F 3 302 ASP 302 1294 1294 ASP ASP B . n 
F 3 303 ILE 303 1295 1295 ILE ILE B . n 
F 3 304 VAL 304 1296 1296 VAL VAL B . n 
F 3 305 SER 305 1297 1297 SER SER B . n 
F 3 306 ARG 306 1298 1298 ARG ARG B . n 
F 3 307 GLY 307 1299 1299 GLY GLY B . n 
F 3 308 ARG 308 1300 1300 ARG ARG B . n 
F 3 309 THR 309 1301 1301 THR THR B . n 
F 3 310 PHE 310 1302 1302 PHE PHE B . n 
F 3 311 PRO 311 1303 1303 PRO PRO B . n 
F 3 312 HIS 312 1304 1304 HIS HIS B . n 
F 3 313 GLY 313 1305 1305 GLY GLY B . n 
F 3 314 ILE 314 1306 1306 ILE ILE B . n 
F 3 315 SER 315 1307 1307 SER SER B . n 
F 3 316 LYS 316 1308 1308 LYS LYS B . n 
F 3 317 GLU 317 1309 1309 GLU GLU B . n 
F 3 318 THR 318 1310 1310 THR THR B . n 
F 3 319 ALA 319 1311 1311 ALA ALA B . n 
F 3 320 TYR 320 1312 1312 TYR TYR B . n 
F 3 321 SER 321 1313 1313 SER SER B . n 
F 3 322 GLU 322 1314 1314 GLU GLU B . n 
F 3 323 SER 323 1315 1315 SER SER B . n 
F 3 324 VAL 324 1316 1316 VAL VAL B . n 
F 3 325 LYS 325 1317 1317 LYS LYS B . n 
F 3 326 LEU 326 1318 1318 LEU LEU B . n 
F 3 327 LEU 327 1319 1319 LEU LEU B . n 
F 3 328 GLN 328 1320 1320 GLN GLN B . n 
F 3 329 LYS 329 1321 1321 LYS LYS B . n 
F 3 330 ILE 330 1322 1322 ILE ILE B . n 
F 3 331 LEU 331 1323 1323 LEU LEU B . n 
F 3 332 GLU 332 1324 1324 GLU GLU B . n 
F 3 333 GLU 333 1325 1325 GLU GLU B . n 
F 3 334 ASP 334 1326 1326 ASP ASP B . n 
F 3 335 GLU 335 1327 1327 GLU GLU B . n 
F 3 336 ARG 336 1328 1328 ARG ARG B . n 
F 3 337 LYS 337 1329 1329 LYS LYS B . n 
F 3 338 ILE 338 1330 1330 ILE ILE B . n 
F 3 339 ARG 339 1331 1331 ARG ARG B . n 
F 3 340 ARG 340 1332 1332 ARG ARG B . n 
F 3 341 ILE 341 1333 1333 ILE ILE B . n 
F 3 342 GLY 342 1334 1334 GLY GLY B . n 
F 3 343 VAL 343 1335 1335 VAL VAL B . n 
F 3 344 ARG 344 1336 1336 ARG ARG B . n 
F 3 345 PHE 345 1337 1337 PHE PHE B . n 
F 3 346 SER 346 1338 1338 SER SER B . n 
F 3 347 LYS 347 1339 1339 LYS LYS B . n 
F 3 348 PHE 348 1340 1340 PHE PHE B . n 
F 3 349 ILE 349 1341 1341 ILE ILE B . n 
F 3 350 GLU 350 1342 ?    ?   ?   B . n 
F 3 351 ALA 351 1343 ?    ?   ?   B . n 
F 3 352 ILE 352 1344 ?    ?   ?   B . n 
F 3 353 GLY 353 1345 ?    ?   ?   B . n 
F 3 354 LEU 354 1346 ?    ?   ?   B . n 
F 3 355 ASP 355 1347 ?    ?   ?   B . n 
F 3 356 LYS 356 1348 ?    ?   ?   B . n 
F 3 357 PHE 357 1349 ?    ?   ?   B . n 
F 3 358 PHE 358 1350 ?    ?   ?   B . n 
F 3 359 ASP 359 1351 ?    ?   ?   B . n 
F 3 360 THR 360 1352 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CA  1  416  416  CA  CA  D . 
H 4 CA  1  1416 1416 CA  CA  J . 
I 4 CA  1  415  415  CA  CA  A . 
J 4 CA  1  1415 1415 CA  CA  B . 
K 5 HOH 1  39   39   HOH HOH D . 
K 5 HOH 2  50   50   HOH HOH D . 
K 5 HOH 3  54   54   HOH HOH D . 
K 5 HOH 4  62   62   HOH HOH D . 
K 5 HOH 5  67   67   HOH HOH D . 
K 5 HOH 6  73   73   HOH HOH D . 
K 5 HOH 7  82   82   HOH HOH D . 
K 5 HOH 8  109  109  HOH HOH D . 
K 5 HOH 9  150  150  HOH HOH D . 
K 5 HOH 10 151  151  HOH HOH D . 
K 5 HOH 11 167  167  HOH HOH D . 
K 5 HOH 12 505  505  HOH HOH D . 
K 5 HOH 13 506  506  HOH HOH D . 
K 5 HOH 14 509  509  HOH HOH D . 
L 5 HOH 1  30   30   HOH HOH E . 
L 5 HOH 2  53   53   HOH HOH E . 
L 5 HOH 3  60   60   HOH HOH E . 
L 5 HOH 4  63   63   HOH HOH E . 
L 5 HOH 5  71   71   HOH HOH E . 
L 5 HOH 6  72   72   HOH HOH E . 
L 5 HOH 7  76   76   HOH HOH E . 
L 5 HOH 8  120  120  HOH HOH E . 
L 5 HOH 9  148  148  HOH HOH E . 
L 5 HOH 10 155  155  HOH HOH E . 
L 5 HOH 11 170  170  HOH HOH E . 
L 5 HOH 12 171  171  HOH HOH E . 
L 5 HOH 13 504  504  HOH HOH E . 
L 5 HOH 14 507  507  HOH HOH E . 
L 5 HOH 15 508  508  HOH HOH E . 
M 5 HOH 1  15   15   HOH HOH H . 
M 5 HOH 2  17   17   HOH HOH H . 
M 5 HOH 3  24   24   HOH HOH H . 
M 5 HOH 4  80   80   HOH HOH H . 
M 5 HOH 5  81   81   HOH HOH H . 
M 5 HOH 6  140  140  HOH HOH H . 
M 5 HOH 7  174  174  HOH HOH H . 
M 5 HOH 8  175  175  HOH HOH H . 
M 5 HOH 9  1504 1504 HOH HOH H . 
M 5 HOH 10 1506 1506 HOH HOH H . 
M 5 HOH 11 1508 1508 HOH HOH H . 
M 5 HOH 12 1509 1509 HOH HOH H . 
N 5 HOH 1  2    2    HOH HOH J . 
N 5 HOH 2  66   66   HOH HOH J . 
N 5 HOH 3  87   87   HOH HOH J . 
N 5 HOH 4  97   97   HOH HOH J . 
N 5 HOH 5  103  103  HOH HOH J . 
N 5 HOH 6  111  111  HOH HOH J . 
N 5 HOH 7  118  118  HOH HOH J . 
N 5 HOH 8  130  130  HOH HOH J . 
N 5 HOH 9  139  139  HOH HOH J . 
N 5 HOH 10 158  158  HOH HOH J . 
N 5 HOH 11 159  159  HOH HOH J . 
N 5 HOH 12 172  172  HOH HOH J . 
N 5 HOH 13 1505 1505 HOH HOH J . 
N 5 HOH 14 1507 1507 HOH HOH J . 
O 5 HOH 1  501  501  HOH HOH A . 
O 5 HOH 2  502  502  HOH HOH A . 
O 5 HOH 3  503  503  HOH HOH A . 
O 5 HOH 4  504  1    HOH HOH A . 
O 5 HOH 5  505  5    HOH HOH A . 
O 5 HOH 6  506  6    HOH HOH A . 
O 5 HOH 7  507  8    HOH HOH A . 
O 5 HOH 8  508  9    HOH HOH A . 
O 5 HOH 9  509  11   HOH HOH A . 
O 5 HOH 10 510  12   HOH HOH A . 
O 5 HOH 11 511  13   HOH HOH A . 
O 5 HOH 12 512  18   HOH HOH A . 
O 5 HOH 13 513  19   HOH HOH A . 
O 5 HOH 14 514  20   HOH HOH A . 
O 5 HOH 15 515  22   HOH HOH A . 
O 5 HOH 16 516  25   HOH HOH A . 
O 5 HOH 17 517  29   HOH HOH A . 
O 5 HOH 18 518  31   HOH HOH A . 
O 5 HOH 19 519  33   HOH HOH A . 
O 5 HOH 20 520  34   HOH HOH A . 
O 5 HOH 21 521  35   HOH HOH A . 
O 5 HOH 22 522  36   HOH HOH A . 
O 5 HOH 23 523  37   HOH HOH A . 
O 5 HOH 24 524  38   HOH HOH A . 
O 5 HOH 25 525  40   HOH HOH A . 
O 5 HOH 26 526  41   HOH HOH A . 
O 5 HOH 27 527  42   HOH HOH A . 
O 5 HOH 28 528  44   HOH HOH A . 
O 5 HOH 29 529  46   HOH HOH A . 
O 5 HOH 30 530  51   HOH HOH A . 
O 5 HOH 31 531  56   HOH HOH A . 
O 5 HOH 32 532  58   HOH HOH A . 
O 5 HOH 33 533  64   HOH HOH A . 
O 5 HOH 34 534  65   HOH HOH A . 
O 5 HOH 35 535  77   HOH HOH A . 
O 5 HOH 36 536  84   HOH HOH A . 
O 5 HOH 37 537  86   HOH HOH A . 
O 5 HOH 38 538  88   HOH HOH A . 
O 5 HOH 39 539  89   HOH HOH A . 
O 5 HOH 40 540  92   HOH HOH A . 
O 5 HOH 41 541  99   HOH HOH A . 
O 5 HOH 42 542  102  HOH HOH A . 
O 5 HOH 43 543  106  HOH HOH A . 
O 5 HOH 44 544  107  HOH HOH A . 
O 5 HOH 45 545  108  HOH HOH A . 
O 5 HOH 46 546  112  HOH HOH A . 
O 5 HOH 47 547  113  HOH HOH A . 
O 5 HOH 48 548  115  HOH HOH A . 
O 5 HOH 49 549  116  HOH HOH A . 
O 5 HOH 50 550  126  HOH HOH A . 
O 5 HOH 51 551  127  HOH HOH A . 
O 5 HOH 52 552  143  HOH HOH A . 
O 5 HOH 53 553  144  HOH HOH A . 
O 5 HOH 54 554  145  HOH HOH A . 
O 5 HOH 55 555  146  HOH HOH A . 
O 5 HOH 56 556  147  HOH HOH A . 
O 5 HOH 57 557  149  HOH HOH A . 
O 5 HOH 58 558  152  HOH HOH A . 
O 5 HOH 59 559  153  HOH HOH A . 
O 5 HOH 60 560  157  HOH HOH A . 
O 5 HOH 61 561  162  HOH HOH A . 
O 5 HOH 62 562  163  HOH HOH A . 
O 5 HOH 63 563  164  HOH HOH A . 
O 5 HOH 64 564  165  HOH HOH A . 
O 5 HOH 65 565  166  HOH HOH A . 
O 5 HOH 66 566  169  HOH HOH A . 
P 5 HOH 1  3    3    HOH HOH B . 
P 5 HOH 2  4    4    HOH HOH B . 
P 5 HOH 3  7    7    HOH HOH B . 
P 5 HOH 4  10   10   HOH HOH B . 
P 5 HOH 5  14   14   HOH HOH B . 
P 5 HOH 6  16   16   HOH HOH B . 
P 5 HOH 7  21   21   HOH HOH B . 
P 5 HOH 8  26   26   HOH HOH B . 
P 5 HOH 9  27   27   HOH HOH B . 
P 5 HOH 10 28   28   HOH HOH B . 
P 5 HOH 11 32   32   HOH HOH B . 
P 5 HOH 12 43   43   HOH HOH B . 
P 5 HOH 13 45   45   HOH HOH B . 
P 5 HOH 14 47   47   HOH HOH B . 
P 5 HOH 15 48   48   HOH HOH B . 
P 5 HOH 16 49   49   HOH HOH B . 
P 5 HOH 17 52   52   HOH HOH B . 
P 5 HOH 18 55   55   HOH HOH B . 
P 5 HOH 19 57   57   HOH HOH B . 
P 5 HOH 20 59   59   HOH HOH B . 
P 5 HOH 21 61   61   HOH HOH B . 
P 5 HOH 22 68   68   HOH HOH B . 
P 5 HOH 23 69   69   HOH HOH B . 
P 5 HOH 24 70   70   HOH HOH B . 
P 5 HOH 25 74   74   HOH HOH B . 
P 5 HOH 26 75   75   HOH HOH B . 
P 5 HOH 27 78   78   HOH HOH B . 
P 5 HOH 28 79   79   HOH HOH B . 
P 5 HOH 29 83   83   HOH HOH B . 
P 5 HOH 30 85   85   HOH HOH B . 
P 5 HOH 31 90   90   HOH HOH B . 
P 5 HOH 32 91   91   HOH HOH B . 
P 5 HOH 33 93   93   HOH HOH B . 
P 5 HOH 34 94   94   HOH HOH B . 
P 5 HOH 35 95   95   HOH HOH B . 
P 5 HOH 36 96   96   HOH HOH B . 
P 5 HOH 37 98   98   HOH HOH B . 
P 5 HOH 38 100  100  HOH HOH B . 
P 5 HOH 39 101  101  HOH HOH B . 
P 5 HOH 40 105  105  HOH HOH B . 
P 5 HOH 41 114  114  HOH HOH B . 
P 5 HOH 42 121  121  HOH HOH B . 
P 5 HOH 43 124  124  HOH HOH B . 
P 5 HOH 44 128  128  HOH HOH B . 
P 5 HOH 45 129  129  HOH HOH B . 
P 5 HOH 46 131  131  HOH HOH B . 
P 5 HOH 47 132  132  HOH HOH B . 
P 5 HOH 48 133  133  HOH HOH B . 
P 5 HOH 49 134  134  HOH HOH B . 
P 5 HOH 50 135  135  HOH HOH B . 
P 5 HOH 51 136  136  HOH HOH B . 
P 5 HOH 52 137  137  HOH HOH B . 
P 5 HOH 53 138  138  HOH HOH B . 
P 5 HOH 54 156  156  HOH HOH B . 
P 5 HOH 55 160  160  HOH HOH B . 
P 5 HOH 56 161  161  HOH HOH B . 
P 5 HOH 57 173  173  HOH HOH B . 
P 5 HOH 58 1501 1501 HOH HOH B . 
P 5 HOH 59 1502 1502 HOH HOH B . 
P 5 HOH 60 1503 1503 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A DOC 14 D DOC 814  ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
2 B 8OG 6  E 8OG 906  ? DG ?                                        
3 C DOC 14 H DOC 1814 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
4 D 8OG 6  J 8OG 1906 ? DG ?                                        
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,I,K,L,O 
2 1 C,D,F,H,J,M,N,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 503  ? 1_555 78.5  ? 
2  O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 72.9  ? 
3  O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 67.9  ? 
4  O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 128.1 ? 
5  O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 58.4  ? 
6  OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 65.3  ? 
7  O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 537  ? 1_555 156.2 ? 
8  O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 537  ? 1_555 114.1 ? 
9  OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 537  ? 1_555 92.6  ? 
10 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 537  ? 1_555 56.3  ? 
11 O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 70.3  ? 
12 O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 134.3 ? 
13 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 128.9 ? 
14 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 161.5 ? 
15 O   ? O HOH .   ? A HOH 537  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 107.6 ? 
16 O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 118.8 ? 
17 O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 150.3 ? 
18 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 137.7 ? 
19 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 112.7 ? 
20 O   ? O HOH .   ? A HOH 537  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 60.2  ? 
21 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 547  ? 1_555 49.1  ? 
22 O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 123.9 ? 
23 O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 68.2  ? 
24 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 127.3 ? 
25 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 67.6  ? 
26 O   ? O HOH .   ? A HOH 537  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 79.9  ? 
27 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 102.6 ? 
28 O   ? O HOH .   ? A HOH 547  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 82.2  ? 
29 O   ? O HOH .   ? A HOH 502  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 129.5 ? 
30 O   ? O HOH .   ? A HOH 503  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 107.0 ? 
31 OP1 ? A DOC 14  ? D DOC 814  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 156.8 ? 
32 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 92.4  ? 
33 O   ? O HOH .   ? A HOH 537  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 68.2  ? 
34 OD2 ? E ASP 113 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 71.7  ? 
35 O   ? O HOH .   ? A HOH 547  ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 43.4  ? 
36 OD2 ? E ASP 15  ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 415  ? 1_555 OD1 ? E ASP 15  ? A ASP 7    ? 1_555 39.2  ? 
37 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 114.4 ? 
38 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 90.8  ? 
39 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 118.2 ? 
40 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1501 ? 1_555 62.0  ? 
41 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1501 ? 1_555 146.4 ? 
42 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1501 ? 1_555 95.3  ? 
43 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 106.3 ? 
44 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 72.3  ? 
45 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 46.2  ? 
46 O   ? P HOH .   ? B HOH 1501 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 141.2 ? 
47 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 147.0 ? 
48 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 69.3  ? 
49 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 117.1 ? 
50 O   ? P HOH .   ? B HOH 1501 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 96.2  ? 
51 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 105.8 ? 
52 OD2 ? F ASP 15  ? B ASP 1007 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 55.0  ? 
53 OE1 ? F GLU 114 ? B GLU 1106 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 154.0 ? 
54 OD2 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 45.9  ? 
55 O   ? P HOH .   ? B HOH 1501 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 54.8  ? 
56 OD1 ? F ASP 113 ? B ASP 1105 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 87.6  ? 
57 OP1 ? C DOC 14  ? H DOC 1814 ? 1_555 CA ? J CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 1503 ? 1_555 133.8 ? 
58 O   ? L HOH .   ? E HOH 508  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? L HOH .   ? E HOH 504  ? 1_555 71.0  ? 
59 O   ? L HOH .   ? E HOH 508  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? L HOH .   ? E HOH 507  ? 1_555 53.1  ? 
60 O   ? L HOH .   ? E HOH 504  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? L HOH .   ? E HOH 507  ? 1_555 82.7  ? 
61 O   ? L HOH .   ? E HOH 508  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 505  ? 1_555 76.8  ? 
62 O   ? L HOH .   ? E HOH 504  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 505  ? 1_555 146.0 ? 
63 O   ? L HOH .   ? E HOH 507  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 505  ? 1_555 86.9  ? 
64 O   ? L HOH .   ? E HOH 508  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 509  ? 1_555 153.8 ? 
65 O   ? L HOH .   ? E HOH 504  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 509  ? 1_555 107.1 ? 
66 O   ? L HOH .   ? E HOH 507  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 509  ? 1_555 152.9 ? 
67 O   ? K HOH .   ? D HOH 505  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 509  ? 1_555 96.8  ? 
68 O   ? L HOH .   ? E HOH 508  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 506  ? 1_555 85.3  ? 
69 O   ? L HOH .   ? E HOH 504  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 506  ? 1_555 93.8  ? 
70 O   ? L HOH .   ? E HOH 507  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 506  ? 1_555 137.2 ? 
71 O   ? K HOH .   ? D HOH 505  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 506  ? 1_555 72.5  ? 
72 O   ? K HOH .   ? D HOH 509  ? 1_555 CA ? G CA . ? D CA 416  ? 1_555 O   ? K HOH .   ? D HOH 506  ? 1_555 68.6  ? 
73 O   ? M HOH .   ? H HOH 1509 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1504 ? 1_555 73.9  ? 
74 O   ? M HOH .   ? H HOH 1509 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1508 ? 1_555 135.5 ? 
75 O   ? M HOH .   ? H HOH 1504 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1508 ? 1_555 105.5 ? 
76 O   ? M HOH .   ? H HOH 1509 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1506 ? 1_555 77.0  ? 
77 O   ? M HOH .   ? H HOH 1504 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1506 ? 1_555 107.3 ? 
78 O   ? M HOH .   ? H HOH 1508 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? M HOH .   ? H HOH 1506 ? 1_555 60.4  ? 
79 O   ? M HOH .   ? H HOH 1509 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? N HOH .   ? J HOH 1507 ? 1_555 111.2 ? 
80 O   ? M HOH .   ? H HOH 1504 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? N HOH .   ? J HOH 1507 ? 1_555 110.7 ? 
81 O   ? M HOH .   ? H HOH 1508 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? N HOH .   ? J HOH 1507 ? 1_555 110.3 ? 
82 O   ? M HOH .   ? H HOH 1506 ? 1_555 CA ? H CA . ? J CA 1416 ? 1_555 O   ? N HOH .   ? J HOH 1507 ? 1_555 141.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-10 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 6.8000  2.4270   9.3340  0.1380 0.0963 0.0331 0.0402  0.0517  0.0491  2.6153 1.2433 0.9923 0.3583 0.4300 0.3683 
-0.0215 -0.0390 -0.0948 -0.0954 -0.0625 -0.0790 0.0951 0.0794  0.0840  'X-RAY DIFFRACTION' 
2 ? refined 38.7000 103.5430 50.9500 0.2201 0.1399 0.0568 0.0243  0.0552  0.0512  2.7672 1.6996 1.7555 0.1223 0.9353 0.2231 0.1072 
0.0636  -0.2760 -0.3465 -0.1212 -0.1303 0.1199 0.0149  0.0140  'X-RAY DIFFRACTION' 
3 ? refined -5.6070 -11.0280 7.4610  0.2700 0.1153 0.1824 -0.0381 -0.0247 -0.0001 2.6828 3.8442 1.1995 1.2776 0.9715 1.8183 0.1975 
-0.3000 -0.4515 0.3379  -0.0853 -0.3203 0.3917 0.0043  -0.1122 'X-RAY DIFFRACTION' 
4 ? refined 26.8880 89.6930  46.8870 0.4010 0.2750 0.2575 -0.0297 -0.1407 0.0256  3.5374 4.6949 2.1771 0.9402 1.1844 3.0396 0.2536 
-0.1854 -0.7638 0.1586  -0.1186 -0.1042 0.4584 -0.1369 -0.1351 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1 A 1    E 9 A 341  E 349 ? 'X-RAY DIFFRACTION' ? 
2  2 B 1001 F 9 B 1341 F 349 ? 'X-RAY DIFFRACTION' ? 
3  3 D 801  A 1 D 813  A 13  ? 'X-RAY DIFFRACTION' ? 
4  3 E 903  B 3 E 919  B 19  ? 'X-RAY DIFFRACTION' ? 
5  3 A 415  G 1 A 415  G 1   ? 'X-RAY DIFFRACTION' ? 
6  3 D 416  H 1 D 416  H 1   ? 'X-RAY DIFFRACTION' ? 
7  4 H 1801 C 1 H 1813 C 13  ? 'X-RAY DIFFRACTION' ? 
8  4 J 1903 D 3 J 1919 D 19  ? 'X-RAY DIFFRACTION' ? 
9  4 B 1415 I 1 B 1415 I 1   ? 'X-RAY DIFFRACTION' ? 
10 4 J 1416 J 1 J 1416 J 1   ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH  B TYR 1224 ? ? O B HOH 128  ? ? 1.74 
2 1 O   B HOH 1502 ? ? O B HOH 1503 ? ? 1.76 
3 1 O   A HOH 506  ? ? O A HOH 557  ? ? 2.04 
4 1 OH  B TYR 1273 ? ? O B ILE 1306 ? ? 2.07 
5 1 OD2 B ASP 1105 ? ? O B HOH 1503 ? ? 2.13 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" D DT  803  ? ? "C1'" D DT  803  ? ? N1    D DT  803  ? ? 111.51 108.30 3.21  0.30 N 
2  1 "O4'" D DG  809  ? ? "C1'" D DG  809  ? ? N9    D DG  809  ? ? 114.71 108.30 6.41  0.30 N 
3  1 "O4'" D DG  810  ? ? "C1'" D DG  810  ? ? N9    D DG  810  ? ? 111.70 108.30 3.40  0.30 N 
4  1 "O4'" D DT  811  ? ? "C1'" D DT  811  ? ? N1    D DT  811  ? ? 112.16 108.30 3.86  0.30 N 
5  1 "O4'" D DG  813  ? ? "C1'" D DG  813  ? ? N9    D DG  813  ? ? 111.94 108.30 3.64  0.30 N 
6  1 "O4'" E DA  903  ? ? "C1'" E DA  903  ? ? N9    E DA  903  ? ? 110.48 108.30 2.18  0.30 N 
7  1 "O4'" E DC  905  ? ? "C1'" E DC  905  ? ? N1    E DC  905  ? ? 111.38 108.30 3.08  0.30 N 
8  1 "C3'" E 8OG 906  ? ? "O3'" E 8OG 906  ? ? P     E DC  907  ? ? 132.61 119.70 12.91 1.20 Y 
9  1 "O4'" E DC  910  ? ? "C1'" E DC  910  ? ? N1    E DC  910  ? ? 112.22 108.30 3.92  0.30 N 
10 1 "O4'" E DC  918  ? ? "C4'" E DC  918  ? ? "C3'" E DC  918  ? ? 102.08 104.50 -2.42 0.40 N 
11 1 "O4'" E DC  918  ? ? "C1'" E DC  918  ? ? N1    E DC  918  ? ? 112.14 108.30 3.84  0.30 N 
12 1 "O4'" E DC  919  ? ? "C1'" E DC  919  ? ? N1    E DC  919  ? ? 113.62 108.30 5.32  0.30 N 
13 1 "O4'" H DG  1802 ? ? "C1'" H DG  1802 ? ? N9    H DG  1802 ? ? 111.52 108.30 3.22  0.30 N 
14 1 "O4'" H DT  1803 ? ? "C1'" H DT  1803 ? ? N1    H DT  1803 ? ? 113.64 108.30 5.34  0.30 N 
15 1 "O4'" H DG  1806 ? ? "C1'" H DG  1806 ? ? N9    H DG  1806 ? ? 110.25 108.30 1.95  0.30 N 
16 1 "C3'" H DT  1808 ? ? "O3'" H DT  1808 ? ? P     H DG  1809 ? ? 126.98 119.70 7.28  1.20 Y 
17 1 "O4'" H DG  1809 ? ? "C1'" H DG  1809 ? ? N9    H DG  1809 ? ? 112.74 108.30 4.44  0.30 N 
18 1 "O4'" H DT  1811 ? ? "C1'" H DT  1811 ? ? N1    H DT  1811 ? ? 110.71 108.30 2.41  0.30 N 
19 1 "O4'" H DG  1813 ? ? "C1'" H DG  1813 ? ? N9    H DG  1813 ? ? 110.73 108.30 2.43  0.30 N 
20 1 "O4'" J DA  1904 ? ? "C1'" J DA  1904 ? ? N9    J DA  1904 ? ? 111.73 108.30 3.43  0.30 N 
21 1 "C1'" J DC  1905 ? ? "O4'" J DC  1905 ? ? "C4'" J DC  1905 ? ? 102.38 110.10 -7.72 1.00 N 
22 1 "O4'" J DC  1905 ? ? "C1'" J DC  1905 ? ? N1    J DC  1905 ? ? 114.20 108.30 5.90  0.30 N 
23 1 "C3'" J 8OG 1906 ? ? "O3'" J 8OG 1906 ? ? P     J DC  1907 ? ? 127.12 119.70 7.42  1.20 Y 
24 1 "O4'" J DC  1907 ? ? "C1'" J DC  1907 ? ? N1    J DC  1907 ? ? 110.50 108.30 2.20  0.30 N 
25 1 "O4'" J DC  1910 ? ? "C1'" J DC  1910 ? ? N1    J DC  1910 ? ? 110.49 108.30 2.19  0.30 N 
26 1 "O4'" J DC  1918 ? ? "C1'" J DC  1918 ? ? N1    J DC  1918 ? ? 112.26 108.30 3.96  0.30 N 
27 1 CB    A ASP 294  ? ? CG    A ASP 294  ? ? OD2   A ASP 294  ? ? 124.05 118.30 5.75  0.90 N 
28 1 CB    B ASP 1007 ? ? CG    B ASP 1007 ? ? OD2   B ASP 1007 ? ? 124.46 118.30 6.16  0.90 N 
29 1 CB    B ASP 1105 ? ? CG    B ASP 1105 ? ? OD2   B ASP 1105 ? ? 124.23 118.30 5.93  0.90 N 
30 1 CB    B ASP 1292 ? ? CG    B ASP 1292 ? ? OD2   B ASP 1292 ? ? 123.92 118.30 5.62  0.90 N 
31 1 CB    B ASP 1294 ? ? CG    B ASP 1294 ? ? OD2   B ASP 1294 ? ? 123.78 118.30 5.48  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10   ? ? 26.84   57.28   
2  1 ASN A 20   ? ? -151.00 84.30   
3  1 PRO A 21   ? ? -59.03  -6.77   
4  1 LYS A 159  ? ? -41.05  -177.68 
5  1 PRO A 160  ? ? -8.01   140.52  
6  1 ASP A 231  ? ? 71.89   31.46   
7  1 ASN A 234  ? ? -159.79 43.56   
8  1 ASP A 277  ? ? 47.24   75.32   
9  1 LYS A 278  ? ? 82.52   -16.58  
10 1 TYR B 1010 ? ? 21.23   59.14   
11 1 ASP B 1039 ? ? 85.13   -20.04  
12 1 SER B 1145 ? ? -173.39 -176.30 
13 1 LYS B 1159 ? ? -42.85  176.52  
14 1 PRO B 1160 ? ? 0.11    127.15  
15 1 ASN B 1234 ? ? -160.04 42.76   
16 1 ARG B 1256 ? ? -140.18 17.64   
17 1 ASP B 1277 ? ? 48.11   77.71   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS A 159  ? ? PRO A 160  ? ? -116.01 
2 1 LYS B 1159 ? ? PRO B 1160 ? ? -115.44 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    "C1'" 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    E 
_pdbx_validate_chiral.auth_comp_id    8OG 
_pdbx_validate_chiral.auth_seq_id     906 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 E DA 903  ? P   ? B DA 3 P   
2 1 Y 1 E DA 903  ? OP1 ? B DA 3 OP1 
3 1 Y 1 E DA 903  ? OP2 ? B DA 3 OP2 
4 1 Y 1 J DA 1903 ? P   ? D DA 3 P   
5 1 Y 1 J DA 1903 ? OP1 ? D DA 3 OP1 
6 1 Y 1 J DA 1903 ? OP2 ? D DA 3 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 E DC  901  ? B DC  1   
2  1 Y 1 E DT  902  ? B DT  2   
3  1 Y 1 J DC  1901 ? D DC  1   
4  1 Y 1 J DT  1902 ? D DT  2   
5  1 Y 1 A GLY -7   ? E GLY 1   
6  1 Y 1 A SER -6   ? E SER 2   
7  1 Y 1 A HIS -5   ? E HIS 3   
8  1 Y 1 A MET -4   ? E MET 4   
9  1 Y 1 A GLY -3   ? E GLY 5   
10 1 Y 1 A GLY -2   ? E GLY 6   
11 1 Y 1 A GLY -1   ? E GLY 7   
12 1 Y 1 A GLY 0    ? E GLY 8   
13 1 Y 1 A GLU 342  ? E GLU 350 
14 1 Y 1 A ALA 343  ? E ALA 351 
15 1 Y 1 A ILE 344  ? E ILE 352 
16 1 Y 1 A GLY 345  ? E GLY 353 
17 1 Y 1 A LEU 346  ? E LEU 354 
18 1 Y 1 A ASP 347  ? E ASP 355 
19 1 Y 1 A LYS 348  ? E LYS 356 
20 1 Y 1 A PHE 349  ? E PHE 357 
21 1 Y 1 A PHE 350  ? E PHE 358 
22 1 Y 1 A ASP 351  ? E ASP 359 
23 1 Y 1 A THR 352  ? E THR 360 
24 1 Y 1 B GLY -7   ? F GLY 1   
25 1 Y 1 B SER -6   ? F SER 2   
26 1 Y 1 B HIS -5   ? F HIS 3   
27 1 Y 1 B MET -4   ? F MET 4   
28 1 Y 1 B GLY -3   ? F GLY 5   
29 1 Y 1 B GLY -2   ? F GLY 6   
30 1 Y 1 B GLY -1   ? F GLY 7   
31 1 Y 1 B GLY 0    ? F GLY 8   
32 1 Y 1 B GLU 1342 ? F GLU 350 
33 1 Y 1 B ALA 1343 ? F ALA 351 
34 1 Y 1 B ILE 1344 ? F ILE 352 
35 1 Y 1 B GLY 1345 ? F GLY 353 
36 1 Y 1 B LEU 1346 ? F LEU 354 
37 1 Y 1 B ASP 1347 ? F ASP 355 
38 1 Y 1 B LYS 1348 ? F LYS 356 
39 1 Y 1 B PHE 1349 ? F PHE 357 
40 1 Y 1 B PHE 1350 ? F PHE 358 
41 1 Y 1 B ASP 1351 ? F ASP 359 
42 1 Y 1 B THR 1352 ? F THR 360 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ASL 'double helix'        
2ASL 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG  1  1_555 B DC  19 1_555 -0.417 -0.219 -0.202 -6.131  -3.392  -0.831 1  D_DG801:DC919_E     D 801  ? E 919  ? 19 1 
1 A DG  2  1_555 B DC  18 1_555 -0.576 -0.057 0.342  8.687   -14.223 3.169  2  D_DG802:DC918_E     D 802  ? E 918  ? 19 1 
1 A DT  3  1_555 B DA  17 1_555 0.125  -0.184 0.229  1.133   -11.934 -2.733 3  D_DT803:DA917_E     D 803  ? E 917  ? 20 1 
1 A DT  4  1_555 B DA  16 1_555 -0.016 -0.048 -0.396 3.653   -15.658 -4.055 4  D_DT804:DA916_E     D 804  ? E 916  ? 20 1 
1 A DG  5  1_555 B DC  15 1_555 -0.292 -0.209 0.020  -5.570  -9.840  1.107  5  D_DG805:DC915_E     D 805  ? E 915  ? 19 1 
1 A DG  6  1_555 B DC  14 1_555 -0.310 -0.132 -0.101 -0.894  -10.719 0.087  6  D_DG806:DC914_E     D 806  ? E 914  ? 19 1 
1 A DA  7  1_555 B DT  13 1_555 0.828  -0.108 -0.137 -0.111  -7.537  3.701  7  D_DA807:DT913_E     D 807  ? E 913  ? 20 1 
1 A DT  8  1_555 B DA  12 1_555 0.232  0.090  -0.304 8.664   -7.610  9.806  8  D_DT808:DA912_E     D 808  ? E 912  ? 20 1 
1 A DG  9  1_555 B DC  11 1_555 -0.389 -0.056 -0.163 -7.250  -8.107  5.441  9  D_DG809:DC911_E     D 809  ? E 911  ? 19 1 
1 A DG  10 1_555 B DC  10 1_555 -0.061 -0.118 -0.327 -18.019 -20.588 3.943  10 D_DG810:DC910_E     D 810  ? E 910  ? 19 1 
1 A DT  11 1_555 B DA  9  1_555 -0.300 -0.047 0.067  -16.045 -7.050  5.171  11 D_DT811:DA909_E     D 811  ? E 909  ? 20 1 
1 A DA  12 1_555 B DT  8  1_555 -0.004 0.088  -0.013 -2.566  -3.806  -2.949 12 D_DA812:DT908_E     D 812  ? E 908  ? 20 1 
1 A DG  13 1_555 B DC  7  1_555 -0.213 -0.083 0.051  5.034   -1.745  -0.342 13 D_DG813:DC907_E     D 813  ? E 907  ? 19 1 
1 A DOC 14 1_555 B 8OG 6  1_555 -0.214 -0.049 0.067  2.932   -1.917  -2.331 14 D_DOC814:8OG906_E   D 814  ? E 906  ? 19 1 
1 C DG  1  1_555 D DC  19 1_555 -0.876 0.008  -0.133 -0.148  -4.312  3.541  15 H_DG1801:DC1919_J   H 1801 ? J 1919 ? 19 1 
1 C DG  2  1_555 D DC  18 1_555 -0.535 -0.068 0.530  5.045   -17.385 9.811  16 H_DG1802:DC1918_J   H 1802 ? J 1918 ? 19 1 
1 C DT  3  1_555 D DA  17 1_555 0.177  0.105  -0.048 3.385   -14.084 1.326  17 H_DT1803:DA1917_J   H 1803 ? J 1917 ? 20 1 
1 C DT  4  1_555 D DA  16 1_555 -0.477 0.137  -0.207 7.703   -14.512 5.406  18 H_DT1804:DA1916_J   H 1804 ? J 1916 ? 20 1 
1 C DG  5  1_555 D DC  15 1_555 -0.599 0.104  -0.259 -10.657 -12.619 1.858  19 H_DG1805:DC1915_J   H 1805 ? J 1915 ? 19 1 
1 C DG  6  1_555 D DC  14 1_555 -0.339 -0.044 0.115  -1.126  -13.092 -2.144 20 H_DG1806:DC1914_J   H 1806 ? J 1914 ? 19 1 
1 C DA  7  1_555 D DT  13 1_555 -0.212 -0.079 -0.106 -6.328  -6.921  0.676  21 H_DA1807:DT1913_J   H 1807 ? J 1913 ? 20 1 
1 C DT  8  1_555 D DA  12 1_555 -0.016 -0.034 -0.060 1.238   -9.463  7.662  22 H_DT1808:DA1912_J   H 1808 ? J 1912 ? 20 1 
1 C DG  9  1_555 D DC  11 1_555 0.323  -0.139 -0.367 -2.710  -1.056  -1.981 23 H_DG1809:DC1911_J   H 1809 ? J 1911 ? 19 1 
1 C DG  10 1_555 D DC  10 1_555 -0.185 0.059  0.265  -10.462 -15.728 9.930  24 H_DG1810:DC1910_J   H 1810 ? J 1910 ? 19 1 
1 C DT  11 1_555 D DA  9  1_555 -0.626 -0.030 0.290  -14.512 -8.006  -0.533 25 H_DT1811:DA1909_J   H 1811 ? J 1909 ? 20 1 
1 C DA  12 1_555 D DT  8  1_555 -0.480 -0.052 -0.204 -4.610  -3.176  -4.180 26 H_DA1812:DT1908_J   H 1812 ? J 1908 ? 20 1 
1 C DG  13 1_555 D DC  7  1_555 -0.088 -0.074 0.243  5.376   0.337   -0.839 27 H_DG1813:DC1907_J   H 1813 ? J 1907 ? 19 1 
1 C DOC 14 1_555 D 8OG 6  1_555 -0.212 0.110  0.163  -2.595  -2.467  1.697  28 H_DOC1814:8OG1906_J H 1814 ? J 1906 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 19 1_555 A DG  2  1_555 B DC  18 1_555 0.072  -0.195 3.043 -6.526 1.974  36.525 -0.550 -0.921 2.973 3.116  
10.302 37.135 1  DD_DG801DG802:DC918DC919_EE       D 801  ? E 919  ? D 802  ? E 918  ? 
1 A DG 2  1_555 B DC 18 1_555 A DT  3  1_555 B DA  17 1_555 -0.763 -0.934 3.410 -0.480 0.254  32.053 -1.738 1.291  3.413 0.460  
0.870  32.057 2  DD_DG802DT803:DA917DC918_EE       D 802  ? E 918  ? D 803  ? E 917  ? 
1 A DT 3  1_555 B DA 17 1_555 A DT  4  1_555 B DA  16 1_555 -0.410 -0.325 3.165 2.652  5.091  32.534 -1.397 1.150  3.038 9.000  
-4.687 33.023 3  DD_DT803DT804:DA916DA917_EE       D 803  ? E 917  ? D 804  ? E 916  ? 
1 A DT 4  1_555 B DA 16 1_555 A DG  5  1_555 B DC  15 1_555 0.601  -0.712 3.465 -2.937 11.531 30.884 -3.234 -1.562 2.950 20.713 
5.275  33.045 4  DD_DT804DG805:DC915DA916_EE       D 804  ? E 916  ? D 805  ? E 915  ? 
1 A DG 5  1_555 B DC 15 1_555 A DG  6  1_555 B DC  14 1_555 -0.172 0.011  3.214 1.690  8.678  28.525 -1.755 0.679  3.069 17.100 
-3.329 29.836 5  DD_DG805DG806:DC914DC915_EE       D 805  ? E 915  ? D 806  ? E 914  ? 
1 A DG 6  1_555 B DC 14 1_555 A DA  7  1_555 B DT  13 1_555 0.000  -0.055 3.268 -1.341 6.381  40.728 -0.765 -0.145 3.223 9.098  
1.911  41.225 6  DD_DG806DA807:DT913DC914_EE       D 806  ? E 914  ? D 807  ? E 913  ? 
1 A DA 7  1_555 B DT 13 1_555 A DT  8  1_555 B DA  12 1_555 0.513  -0.634 3.057 1.659  1.377  28.502 -1.576 -0.686 3.048 2.791  
-3.363 28.582 7  DD_DA807DT808:DA912DT913_EE       D 807  ? E 913  ? D 808  ? E 912  ? 
1 A DT 8  1_555 B DA 12 1_555 A DG  9  1_555 B DC  11 1_555 0.293  -0.996 3.678 0.861  5.825  29.886 -3.174 -0.368 3.434 11.159 
-1.650 30.448 8  DD_DT808DG809:DC911DA912_EE       D 808  ? E 912  ? D 809  ? E 911  ? 
1 A DG 9  1_555 B DC 11 1_555 A DG  10 1_555 B DC  10 1_555 0.480  -1.231 3.654 1.974  8.977  30.225 -4.048 -0.489 3.191 16.735 
-3.680 31.560 9  DD_DG809DG810:DC910DC911_EE       D 809  ? E 911  ? D 810  ? E 910  ? 
1 A DG 10 1_555 B DC 10 1_555 A DT  11 1_555 B DA  9  1_555 -0.458 -0.787 3.360 -1.524 -3.888 33.750 -0.697 0.529  3.443 -6.664 
2.612  33.999 10 DD_DG810DT811:DA909DC910_EE       D 810  ? E 910  ? D 811  ? E 909  ? 
1 A DT 11 1_555 B DA 9  1_555 A DA  12 1_555 B DT  8  1_555 -1.317 -0.041 3.062 -1.296 5.123  31.533 -0.949 2.170  3.067 9.345  
2.365  31.962 11 DD_DT811DA812:DT908DA909_EE       D 811  ? E 909  ? D 812  ? E 908  ? 
1 A DA 12 1_555 B DT 8  1_555 A DG  13 1_555 B DC  7  1_555 0.941  -0.282 3.342 -2.278 5.796  27.968 -1.885 -2.418 3.136 11.808 
4.641  28.639 12 DD_DA812DG813:DC907DT908_EE       D 812  ? E 908  ? D 813  ? E 907  ? 
1 A DG 13 1_555 B DC 7  1_555 A DOC 14 1_555 B 8OG 6  1_555 -1.172 -0.386 3.380 -2.471 4.200  34.792 -1.292 1.558  3.385 6.982  
4.108  35.121 13 DD_DG813DOC814:8OG906DC907_EE     D 813  ? E 907  ? D 814  ? E 906  ? 
1 C DG 1  1_555 D DC 19 1_555 C DG  2  1_555 D DC  18 1_555 0.075  0.165  3.184 -8.922 8.333  40.639 -0.605 -0.995 3.077 11.684 
12.510 42.358 14 HH_DG1801DG1802:DC1918DC1919_JJ   H 1801 ? J 1919 ? H 1802 ? J 1918 ? 
1 C DG 2  1_555 D DC 18 1_555 C DT  3  1_555 D DA  17 1_555 -1.248 -0.324 3.201 1.712  2.470  34.377 -0.917 2.360  3.107 4.169  
-2.889 34.504 15 HH_DG1802DT1803:DA1917DC1918_JJ   H 1802 ? J 1918 ? H 1803 ? J 1917 ? 
1 C DT 3  1_555 D DA 17 1_555 C DT  4  1_555 D DA  16 1_555 0.132  0.177  3.130 2.103  8.250  27.980 -1.382 0.179  3.058 16.583 
-4.227 29.222 16 HH_DT1803DT1804:DA1916DA1917_JJ   H 1803 ? J 1917 ? H 1804 ? J 1916 ? 
1 C DT 4  1_555 D DA 16 1_555 C DG  5  1_555 D DC  15 1_555 -0.051 -0.441 3.640 -0.135 12.129 30.625 -3.041 0.065  3.237 21.916 
0.243  32.886 17 HH_DT1804DG1805:DC1915DA1916_JJ   H 1804 ? J 1916 ? H 1805 ? J 1915 ? 
1 C DG 5  1_555 D DC 15 1_555 C DG  6  1_555 D DC  14 1_555 0.103  0.164  3.067 -3.993 7.576  33.958 -0.804 -0.739 3.002 12.722 
6.705  34.990 18 HH_DG1805DG1806:DC1914DC1915_JJ   H 1805 ? J 1915 ? H 1806 ? J 1914 ? 
1 C DG 6  1_555 D DC 14 1_555 C DA  7  1_555 D DT  13 1_555 -0.151 -0.406 3.342 0.651  3.581  35.042 -1.211 0.348  3.283 5.927  
-1.078 35.225 19 HH_DG1806DA1807:DT1913DC1914_JJ   H 1806 ? J 1914 ? H 1807 ? J 1913 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT  8  1_555 D DA  12 1_555 0.462  -0.583 3.115 -0.443 0.876  32.714 -1.178 -0.893 3.093 1.555  
0.787  32.728 20 HH_DA1807DT1808:DA1912DT1913_JJ   H 1807 ? J 1913 ? H 1808 ? J 1912 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG  9  1_555 D DC  11 1_555 -0.052 -0.607 3.420 1.292  4.316  35.240 -1.648 0.280  3.321 7.094  
-2.123 35.518 21 HH_DT1808DG1809:DC1911DA1912_JJ   H 1808 ? J 1912 ? H 1809 ? J 1911 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG  10 1_555 D DC  10 1_555 1.054  -1.523 3.533 -1.769 2.422  26.992 -3.884 -2.712 3.311 5.169  
3.776  27.155 22 HH_DG1809DG1810:DC1910DC1911_JJ   H 1809 ? J 1911 ? H 1810 ? J 1910 ? 
1 C DG 10 1_555 D DC 10 1_555 C DT  11 1_555 D DA  9  1_555 -0.711 -1.142 3.455 1.660  -2.174 32.180 -1.644 1.592  3.483 -3.913 
-2.988 32.293 23 HH_DG1810DT1811:DA1909DC1910_JJ   H 1810 ? J 1910 ? H 1811 ? J 1909 ? 
1 C DT 11 1_555 D DA 9  1_555 C DA  12 1_555 D DT  8  1_555 -0.898 -0.050 3.177 2.484  4.953  31.640 -0.943 2.051  3.057 8.998  
-4.513 32.110 24 HH_DT1811DA1812:DT1908DA1909_JJ   H 1811 ? J 1909 ? H 1812 ? J 1908 ? 
1 C DA 12 1_555 D DT 8  1_555 C DG  13 1_555 D DC  7  1_555 0.962  -0.290 3.174 -5.037 7.880  29.637 -1.961 -2.703 2.808 14.944 
9.551  31.046 25 HH_DA1812DG1813:DC1907DT1908_JJ   H 1812 ? J 1908 ? H 1813 ? J 1907 ? 
1 C DG 13 1_555 D DC 7  1_555 C DOC 14 1_555 D 8OG 6  1_555 -1.226 -0.138 3.513 -0.920 1.930  38.969 -0.457 1.716  3.530 2.890  
1.378  39.025 26 HH_DG1813DOC1814:8OG1906DC1907_JJ H 1813 ? J 1907 ? H 1814 ? J 1906 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
#