data_2AWH
# 
_entry.id   2AWH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AWH         
RCSB  RCSB034395   
WWPDB D_1000034395 
# 
_pdbx_database_status.entry_id                        2AWH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fyffe, S.A.'      1 
'Alphey, M.S.'     2 
'Buetow, L.'       3 
'Smith, T.K.'      4 
'Ferguson, M.A.J.' 5 
'Sorensen, M.D.'   6 
'Bjorkling, F.'    7 
'Hunter, W.N.'     8 
# 
_citation.id                        primary 
_citation.title                     
'Recombinant Human PPAR-beta/delta Ligand-binding Domain is Locked in an Activated Conformation by Endogenous Fatty Acids' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            356 
_citation.page_first                1005 
_citation.page_last                 1013 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16405912 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.047 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fyffe, S.A.'      1 
primary 'Alphey, M.S.'     2 
primary 'Buetow, L.'       3 
primary 'Smith, T.K.'      4 
primary 'Ferguson, M.A.J.' 5 
primary 'Sorensen, M.D.'   6 
primary 'Bjorkling, F.'    7 
primary 'Hunter, W.N.'     8 
# 
_cell.length_a           37.220 
_cell.length_b           96.717 
_cell.length_c           92.304 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.96 
_cell.angle_gamma        90.00 
_cell.entry_id           2AWH 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         2AWH 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peroxisome proliferator activated receptor delta' 30683.676 2   ? ? 'residues 210-477' ? 
2 non-polymer syn HEPTYL-BETA-D-GLUCOPYRANOSIDE                      278.342   2   ? ? ?                  ? 
3 non-polymer syn 'VACCENIC ACID'                                    282.461   2   ? ? ?                  ? 
4 water       nat water                                              18.015    265 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPAR-delta, PPAR- beta, Nuclear hormone receptor 1, NUC1, NUCI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTT
VETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFE
FAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEH
AQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTT
VETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFE
FAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEH
AQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   LEU n 
1 3   LYS n 
1 4   ALA n 
1 5   PHE n 
1 6   SER n 
1 7   LYS n 
1 8   HIS n 
1 9   ILE n 
1 10  TYR n 
1 11  ASN n 
1 12  ALA n 
1 13  TYR n 
1 14  LEU n 
1 15  LYS n 
1 16  ASN n 
1 17  PHE n 
1 18  ASN n 
1 19  MET n 
1 20  THR n 
1 21  LYS n 
1 22  LYS n 
1 23  LYS n 
1 24  ALA n 
1 25  ARG n 
1 26  SER n 
1 27  ILE n 
1 28  LEU n 
1 29  THR n 
1 30  GLY n 
1 31  LYS n 
1 32  ALA n 
1 33  SER n 
1 34  HIS n 
1 35  THR n 
1 36  ALA n 
1 37  PRO n 
1 38  PHE n 
1 39  VAL n 
1 40  ILE n 
1 41  HIS n 
1 42  ASP n 
1 43  ILE n 
1 44  GLU n 
1 45  THR n 
1 46  LEU n 
1 47  TRP n 
1 48  GLN n 
1 49  ALA n 
1 50  GLU n 
1 51  LYS n 
1 52  GLY n 
1 53  LEU n 
1 54  VAL n 
1 55  TRP n 
1 56  LYS n 
1 57  GLN n 
1 58  LEU n 
1 59  VAL n 
1 60  ASN n 
1 61  GLY n 
1 62  LEU n 
1 63  PRO n 
1 64  PRO n 
1 65  TYR n 
1 66  LYS n 
1 67  GLU n 
1 68  ILE n 
1 69  SER n 
1 70  VAL n 
1 71  HIS n 
1 72  VAL n 
1 73  PHE n 
1 74  TYR n 
1 75  ARG n 
1 76  CYS n 
1 77  GLN n 
1 78  CYS n 
1 79  THR n 
1 80  THR n 
1 81  VAL n 
1 82  GLU n 
1 83  THR n 
1 84  VAL n 
1 85  ARG n 
1 86  GLU n 
1 87  LEU n 
1 88  THR n 
1 89  GLU n 
1 90  PHE n 
1 91  ALA n 
1 92  LYS n 
1 93  SER n 
1 94  ILE n 
1 95  PRO n 
1 96  SER n 
1 97  PHE n 
1 98  SER n 
1 99  SER n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 ASN n 
1 104 ASP n 
1 105 GLN n 
1 106 VAL n 
1 107 THR n 
1 108 LEU n 
1 109 LEU n 
1 110 LYS n 
1 111 TYR n 
1 112 GLY n 
1 113 VAL n 
1 114 HIS n 
1 115 GLU n 
1 116 ALA n 
1 117 ILE n 
1 118 PHE n 
1 119 ALA n 
1 120 MET n 
1 121 LEU n 
1 122 ALA n 
1 123 SER n 
1 124 ILE n 
1 125 VAL n 
1 126 ASN n 
1 127 LYS n 
1 128 ASP n 
1 129 GLY n 
1 130 LEU n 
1 131 LEU n 
1 132 VAL n 
1 133 ALA n 
1 134 ASN n 
1 135 GLY n 
1 136 SER n 
1 137 GLY n 
1 138 PHE n 
1 139 VAL n 
1 140 THR n 
1 141 ARG n 
1 142 GLU n 
1 143 PHE n 
1 144 LEU n 
1 145 ARG n 
1 146 SER n 
1 147 LEU n 
1 148 ARG n 
1 149 LYS n 
1 150 PRO n 
1 151 PHE n 
1 152 SER n 
1 153 ASP n 
1 154 ILE n 
1 155 ILE n 
1 156 GLU n 
1 157 PRO n 
1 158 LYS n 
1 159 PHE n 
1 160 GLU n 
1 161 PHE n 
1 162 ALA n 
1 163 VAL n 
1 164 LYS n 
1 165 PHE n 
1 166 ASN n 
1 167 ALA n 
1 168 LEU n 
1 169 GLU n 
1 170 LEU n 
1 171 ASP n 
1 172 ASP n 
1 173 SER n 
1 174 ASP n 
1 175 LEU n 
1 176 ALA n 
1 177 LEU n 
1 178 PHE n 
1 179 ILE n 
1 180 ALA n 
1 181 ALA n 
1 182 ILE n 
1 183 ILE n 
1 184 LEU n 
1 185 CYS n 
1 186 GLY n 
1 187 ASP n 
1 188 ARG n 
1 189 PRO n 
1 190 GLY n 
1 191 LEU n 
1 192 MET n 
1 193 ASN n 
1 194 VAL n 
1 195 PRO n 
1 196 ARG n 
1 197 VAL n 
1 198 GLU n 
1 199 ALA n 
1 200 ILE n 
1 201 GLN n 
1 202 ASP n 
1 203 THR n 
1 204 ILE n 
1 205 LEU n 
1 206 ARG n 
1 207 ALA n 
1 208 LEU n 
1 209 GLU n 
1 210 PHE n 
1 211 HIS n 
1 212 LEU n 
1 213 GLN n 
1 214 ALA n 
1 215 ASN n 
1 216 HIS n 
1 217 PRO n 
1 218 ASP n 
1 219 ALA n 
1 220 GLN n 
1 221 GLN n 
1 222 LEU n 
1 223 PHE n 
1 224 PRO n 
1 225 LYS n 
1 226 LEU n 
1 227 LEU n 
1 228 GLN n 
1 229 LYS n 
1 230 MET n 
1 231 ALA n 
1 232 ASP n 
1 233 LEU n 
1 234 ARG n 
1 235 GLN n 
1 236 LEU n 
1 237 VAL n 
1 238 THR n 
1 239 GLU n 
1 240 HIS n 
1 241 ALA n 
1 242 GLN n 
1 243 MET n 
1 244 MET n 
1 245 GLN n 
1 246 ARG n 
1 247 ILE n 
1 248 LYS n 
1 249 LYS n 
1 250 THR n 
1 251 GLU n 
1 252 THR n 
1 253 GLU n 
1 254 THR n 
1 255 SER n 
1 256 LEU n 
1 257 HIS n 
1 258 PRO n 
1 259 LEU n 
1 260 LEU n 
1 261 GLN n 
1 262 GLU n 
1 263 ILE n 
1 264 TYR n 
1 265 LYS n 
1 266 ASP n 
1 267 MET n 
1 268 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 GOLD (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPAS_HUMAN 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTT
VETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFE
FAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEH
AQMMQRIKKTETETSLHPLLQEIYKDMY
;
_struct_ref.pdbx_align_begin           174 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AWH A 1 ? 268 ? Q03181 174 ? 441 ? 210 477 
2 1 2AWH B 1 ? 268 ? Q03181 174 ? 441 ? 210 477 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2AWH GLN A 221 ? UNP Q03181 TYR 394 CONFLICT 430 1 
2 2AWH GLN B 221 ? UNP Q03181 TYR 394 CONFLICT 430 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                             'C4 H7 N O4'     133.103 
B7G non-polymer         . HEPTYL-BETA-D-GLUCOPYRANOSIDE ?                             'C13 H26 O6'     278.342 
CYS 'L-peptide linking' y CYSTEINE                      ?                             'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ?                             'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                    ?                             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ?                             'C5 H11 N O2'    117.146 
VCA non-polymer         . 'VACCENIC ACID'               '(11E)-OCTADEC-11-ENOIC ACID' 'C18 H34 O2'     282.461 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2AWH 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   50.8 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;5% PEG 8000, 200mM KCl, 40mM bis-tris-propane pH 8.5, 2.5% 1,2-propanediol, 0.5% n-heptyl-B-D-glucopyranoside, 1mM EDTA, 10mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           65 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.939261 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_wavelength_list        0.939261 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
# 
_reflns_shell.d_res_low              2.11 
_reflns_shell.d_res_high             2.00 
_reflns_shell.number_measured_all    25088 
_reflns_shell.number_unique_all      6119 
_reflns_shell.percent_possible_all   96.22 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             43.030 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.110 
_refine.ls_number_reflns_obs                     42892 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.215 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2163 
_refine.B_iso_mean                               34.880 
_refine.aniso_B[1][1]                            0.020 
_refine.aniso_B[2][2]                            -0.120 
_refine.aniso_B[3][3]                            0.100 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.120 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.pdbx_overall_ESU_R                       0.190 
_refine.pdbx_overall_ESU_R_Free                  0.175 
_refine.overall_SU_ML                            0.127 
_refine.overall_SU_B                             4.530 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2AWH 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     44172 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4050 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             265 
_refine_hist.number_atoms_total               4393 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        43.030 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4208 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5666 1.481  1.978  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   498  5.268  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   184  32.199 24.022 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   757  16.857 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22   18.330 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           657  0.109  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3046 0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2010 0.218  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2912 0.306  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    236  0.175  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   45   0.169  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 13   0.190  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2607 0.988  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4071 1.613  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1799 2.312  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1595 3.556  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.040 
_refine_ls_shell.number_reflns_R_work             2957 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.R_factor_R_free                  0.331 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             173 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3130 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2AWH 
_struct.title                     'Human Nuclear Receptor-Ligand Complex 1' 
_struct.pdbx_descriptor           'Human Nuclear Receptor-Ligand Complex 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            'Nuclear Receptor, Protein-ligand complex, PPAR, GENE REGULATION' 
_struct_keywords.entry_id        2AWH 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The biological unit is a monomer.  There are 2 biological units the aymmetric unit (chains A and B)' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 1   ? PHE A 17  ? ASP A 210 PHE A 226 1 ? 17 
HELX_P HELX_P2  2  THR A 20  ? LEU A 28  ? THR A 229 LEU A 237 1 ? 9  
HELX_P HELX_P3  3  ASP A 42  ? LYS A 51  ? ASP A 251 LYS A 260 1 ? 10 
HELX_P HELX_P4  4  GLU A 67  ? LYS A 92  ? GLU A 276 LYS A 301 1 ? 26 
HELX_P HELX_P5  5  PHE A 101 ? ALA A 122 ? PHE A 310 ALA A 331 1 ? 22 
HELX_P HELX_P6  6  ALA A 133 ? GLY A 135 ? ALA A 342 GLY A 344 5 ? 3  
HELX_P HELX_P7  7  ARG A 141 ? SER A 146 ? ARG A 350 SER A 355 1 ? 6  
HELX_P HELX_P8  8  ARG A 148 ? ALA A 167 ? ARG A 357 ALA A 376 1 ? 20 
HELX_P HELX_P9  9  ASP A 171 ? LEU A 184 ? ASP A 380 LEU A 393 1 ? 14 
HELX_P HELX_P10 10 ASN A 193 ? HIS A 216 ? ASN A 402 HIS A 425 1 ? 24 
HELX_P HELX_P11 11 GLN A 221 ? GLU A 251 ? GLN A 430 GLU A 460 1 ? 31 
HELX_P HELX_P12 12 HIS A 257 ? LYS A 265 ? HIS A 466 LYS A 474 1 ? 9  
HELX_P HELX_P13 13 ASP B 1   ? PHE B 17  ? ASP B 210 PHE B 226 1 ? 17 
HELX_P HELX_P14 14 THR B 20  ? LEU B 28  ? THR B 229 LEU B 237 1 ? 9  
HELX_P HELX_P15 15 ASP B 42  ? LYS B 51  ? ASP B 251 LYS B 260 1 ? 10 
HELX_P HELX_P16 16 GLU B 67  ? LYS B 92  ? GLU B 276 LYS B 301 1 ? 26 
HELX_P HELX_P17 17 PHE B 101 ? ALA B 122 ? PHE B 310 ALA B 331 1 ? 22 
HELX_P HELX_P18 18 ALA B 133 ? GLY B 135 ? ALA B 342 GLY B 344 5 ? 3  
HELX_P HELX_P19 19 ARG B 141 ? SER B 146 ? ARG B 350 SER B 355 1 ? 6  
HELX_P HELX_P20 20 ARG B 148 ? ALA B 167 ? ARG B 357 ALA B 376 1 ? 20 
HELX_P HELX_P21 21 ASP B 171 ? LEU B 184 ? ASP B 380 LEU B 393 1 ? 14 
HELX_P HELX_P22 22 ASN B 193 ? HIS B 216 ? ASN B 402 HIS B 425 1 ? 24 
HELX_P HELX_P23 23 GLN B 221 ? GLU B 251 ? GLN B 430 GLU B 460 1 ? 31 
HELX_P HELX_P24 24 HIS B 257 ? LYS B 265 ? HIS B 466 LYS B 474 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 38  ? ILE A 40  ? PHE A 247 ILE A 249 
A 2 GLY A 137 ? THR A 140 ? GLY A 346 THR A 349 
A 3 GLY A 129 ? VAL A 132 ? GLY A 338 VAL A 341 
A 4 VAL A 125 ? ASN A 126 ? VAL A 334 ASN A 335 
B 1 PHE B 38  ? ILE B 40  ? PHE B 247 ILE B 249 
B 2 GLY B 137 ? THR B 140 ? GLY B 346 THR B 349 
B 3 GLY B 129 ? VAL B 132 ? GLY B 338 VAL B 341 
B 4 VAL B 125 ? ASN B 126 ? VAL B 334 ASN B 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 40  ? N ILE A 249 O PHE A 138 ? O PHE A 347 
A 2 3 O GLY A 137 ? O GLY A 346 N VAL A 132 ? N VAL A 341 
A 3 4 O GLY A 129 ? O GLY A 338 N ASN A 126 ? N ASN A 335 
B 1 2 N ILE B 40  ? N ILE B 249 O PHE B 138 ? O PHE B 347 
B 2 3 O VAL B 139 ? O VAL B 348 N LEU B 130 ? N LEU B 339 
B 3 4 O GLY B 129 ? O GLY B 338 N ASN B 126 ? N ASN B 335 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE B7G B 920'  
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE B7G A 1920' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE VCA A 1001' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE VCA B 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  LYS A 110 ? LYS A 319  . ? 1_555 ? 
2  AC1 9  GLU A 262 ? GLU A 471  . ? 1_555 ? 
3  AC1 9  LYS A 265 ? LYS A 474  . ? 1_555 ? 
4  AC1 9  B7G C .   ? B7G A 1920 . ? 1_555 ? 
5  AC1 9  LEU B 102 ? LEU B 311  . ? 1_555 ? 
6  AC1 9  ASN B 103 ? ASN B 312  . ? 1_555 ? 
7  AC1 9  VAL B 106 ? VAL B 315  . ? 1_555 ? 
8  AC1 9  THR B 107 ? THR B 316  . ? 1_555 ? 
9  AC1 9  HOH H .   ? HOH B 2061 . ? 1_555 ? 
10 AC2 10 ASN A 103 ? ASN A 312  . ? 1_555 ? 
11 AC2 10 VAL A 106 ? VAL A 315  . ? 1_555 ? 
12 AC2 10 THR A 107 ? THR A 316  . ? 1_555 ? 
13 AC2 10 HOH G .   ? HOH A 2005 . ? 1_555 ? 
14 AC2 10 LYS B 110 ? LYS B 319  . ? 1_555 ? 
15 AC2 10 GLU B 262 ? GLU B 471  . ? 1_555 ? 
16 AC2 10 ILE B 263 ? ILE B 472  . ? 1_555 ? 
17 AC2 10 LYS B 265 ? LYS B 474  . ? 1_555 ? 
18 AC2 10 B7G E .   ? B7G B 920  . ? 1_555 ? 
19 AC2 10 HOH H .   ? HOH B 2094 . ? 1_555 ? 
20 AC3 8  THR A 79  ? THR A 288  . ? 1_555 ? 
21 AC3 8  THR A 80  ? THR A 289  . ? 1_555 ? 
22 AC3 8  HIS A 114 ? HIS A 323  . ? 1_555 ? 
23 AC3 8  LEU A 130 ? LEU A 339  . ? 1_555 ? 
24 AC3 8  HIS A 240 ? HIS A 449  . ? 1_555 ? 
25 AC3 8  MET A 244 ? MET A 453  . ? 1_555 ? 
26 AC3 8  LEU A 260 ? LEU A 469  . ? 1_555 ? 
27 AC3 8  TYR A 264 ? TYR A 473  . ? 1_555 ? 
28 AC4 12 CYS B 76  ? CYS B 285  . ? 1_555 ? 
29 AC4 12 THR B 80  ? THR B 289  . ? 1_555 ? 
30 AC4 12 HIS B 114 ? HIS B 323  . ? 1_555 ? 
31 AC4 12 PHE B 118 ? PHE B 327  . ? 1_555 ? 
32 AC4 12 LEU B 130 ? LEU B 339  . ? 1_555 ? 
33 AC4 12 VAL B 132 ? VAL B 341  . ? 1_555 ? 
34 AC4 12 ILE B 154 ? ILE B 363  . ? 1_555 ? 
35 AC4 12 LYS B 158 ? LYS B 367  . ? 1_555 ? 
36 AC4 12 HIS B 240 ? HIS B 449  . ? 1_555 ? 
37 AC4 12 MET B 244 ? MET B 453  . ? 1_555 ? 
38 AC4 12 LEU B 260 ? LEU B 469  . ? 1_555 ? 
39 AC4 12 TYR B 264 ? TYR B 473  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2AWH 
_atom_sites.fract_transf_matrix[1][1]   0.02687 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   -0.00002 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01034 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01083 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 19.517  -22.627 41.103  1.00 46.23 ? 210  ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 20.002  -21.881 42.291  1.00 46.53 ? 210  ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 19.030  -20.740 42.653  1.00 45.73 ? 210  ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 19.046  -19.653 42.051  1.00 46.00 ? 210  ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 21.418  -21.354 42.030  1.00 46.93 ? 210  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 22.002  -20.621 43.218  1.00 48.44 ? 210  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 23.126  -20.082 43.074  1.00 50.56 ? 210  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 21.347  -20.575 44.286  1.00 49.05 ? 210  ASP A OD2 1 
ATOM   9    N N   . LEU A 1 2   ? 18.183  -21.011 43.639  1.00 44.68 ? 211  LEU A N   1 
ATOM   10   C CA  . LEU A 1 2   ? 17.121  -20.103 44.047  1.00 42.93 ? 211  LEU A CA  1 
ATOM   11   C C   . LEU A 1 2   ? 17.695  -18.830 44.658  1.00 42.05 ? 211  LEU A C   1 
ATOM   12   O O   . LEU A 1 2   ? 17.021  -17.807 44.725  1.00 41.74 ? 211  LEU A O   1 
ATOM   13   C CB  . LEU A 1 2   ? 16.219  -20.815 45.046  1.00 43.18 ? 211  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 2   ? 14.876  -21.429 44.619  1.00 43.39 ? 211  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 2   ? 14.737  -21.784 43.110  1.00 42.62 ? 211  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 2   ? 14.562  -22.613 45.515  1.00 42.95 ? 211  LEU A CD2 1 
ATOM   17   N N   . LYS A 1 3   ? 18.951  -18.898 45.096  1.00 40.71 ? 212  LYS A N   1 
ATOM   18   C CA  . LYS A 1 3   ? 19.598  -17.768 45.766  1.00 40.18 ? 212  LYS A CA  1 
ATOM   19   C C   . LYS A 1 3   ? 20.184  -16.802 44.721  1.00 38.47 ? 212  LYS A C   1 
ATOM   20   O O   . LYS A 1 3   ? 20.111  -15.576 44.873  1.00 38.15 ? 212  LYS A O   1 
ATOM   21   C CB  . LYS A 1 3   ? 20.645  -18.291 46.767  1.00 39.80 ? 212  LYS A CB  1 
ATOM   22   C CG  . LYS A 1 3   ? 21.422  -17.239 47.537  1.00 41.95 ? 212  LYS A CG  1 
ATOM   23   C CD  . LYS A 1 3   ? 22.502  -17.891 48.407  1.00 42.39 ? 212  LYS A CD  1 
ATOM   24   C CE  . LYS A 1 3   ? 23.277  -16.857 49.208  1.00 46.53 ? 212  LYS A CE  1 
ATOM   25   N NZ  . LYS A 1 3   ? 23.603  -17.337 50.610  1.00 48.80 ? 212  LYS A NZ  1 
ATOM   26   N N   . ALA A 1 4   ? 20.752  -17.374 43.657  1.00 36.73 ? 213  ALA A N   1 
ATOM   27   C CA  . ALA A 1 4   ? 21.241  -16.625 42.499  1.00 34.74 ? 213  ALA A CA  1 
ATOM   28   C C   . ALA A 1 4   ? 20.105  -15.950 41.714  1.00 33.04 ? 213  ALA A C   1 
ATOM   29   O O   . ALA A 1 4   ? 20.227  -14.812 41.255  1.00 31.56 ? 213  ALA A O   1 
ATOM   30   C CB  . ALA A 1 4   ? 22.007  -17.553 41.572  1.00 34.74 ? 213  ALA A CB  1 
ATOM   31   N N   . PHE A 1 5   ? 19.024  -16.688 41.514  1.00 31.98 ? 214  PHE A N   1 
ATOM   32   C CA  . PHE A 1 5   ? 17.865  -16.142 40.848  1.00 31.11 ? 214  PHE A CA  1 
ATOM   33   C C   . PHE A 1 5   ? 17.371  -14.925 41.639  1.00 30.08 ? 214  PHE A C   1 
ATOM   34   O O   . PHE A 1 5   ? 17.167  -13.874 41.077  1.00 30.50 ? 214  PHE A O   1 
ATOM   35   C CB  . PHE A 1 5   ? 16.797  -17.224 40.726  1.00 31.62 ? 214  PHE A CB  1 
ATOM   36   C CG  . PHE A 1 5   ? 15.573  -16.797 39.973  1.00 32.06 ? 214  PHE A CG  1 
ATOM   37   C CD1 . PHE A 1 5   ? 14.519  -16.177 40.632  1.00 32.25 ? 214  PHE A CD1 1 
ATOM   38   C CD2 . PHE A 1 5   ? 15.465  -17.031 38.619  1.00 34.68 ? 214  PHE A CD2 1 
ATOM   39   C CE1 . PHE A 1 5   ? 13.380  -15.790 39.950  1.00 32.84 ? 214  PHE A CE1 1 
ATOM   40   C CE2 . PHE A 1 5   ? 14.302  -16.640 37.918  1.00 34.41 ? 214  PHE A CE2 1 
ATOM   41   C CZ  . PHE A 1 5   ? 13.274  -16.027 38.586  1.00 32.40 ? 214  PHE A CZ  1 
ATOM   42   N N   . SER A 1 6   ? 17.195  -15.082 42.946  1.00 29.80 ? 215  SER A N   1 
ATOM   43   C CA  . SER A 1 6   ? 16.788  -13.998 43.829  1.00 28.76 ? 215  SER A CA  1 
ATOM   44   C C   . SER A 1 6   ? 17.661  -12.766 43.741  1.00 28.62 ? 215  SER A C   1 
ATOM   45   O O   . SER A 1 6   ? 17.154  -11.634 43.780  1.00 27.06 ? 215  SER A O   1 
ATOM   46   C CB  . SER A 1 6   ? 16.768  -14.458 45.288  1.00 28.95 ? 215  SER A CB  1 
ATOM   47   O OG  . SER A 1 6   ? 15.786  -15.451 45.502  1.00 30.47 ? 215  SER A OG  1 
ATOM   48   N N   . LYS A 1 7   ? 18.987  -12.975 43.682  1.00 28.47 ? 216  LYS A N   1 
ATOM   49   C CA  . LYS A 1 7   ? 19.929  -11.878 43.615  1.00 28.70 ? 216  LYS A CA  1 
ATOM   50   C C   . LYS A 1 7   ? 19.817  -11.108 42.316  1.00 28.10 ? 216  LYS A C   1 
ATOM   51   O O   . LYS A 1 7   ? 19.887  -9.873  42.312  1.00 28.63 ? 216  LYS A O   1 
ATOM   52   C CB  . LYS A 1 7   ? 21.386  -12.385 43.796  1.00 29.37 ? 216  LYS A CB  1 
ATOM   53   C CG  . LYS A 1 7   ? 22.383  -11.251 44.064  1.00 32.28 ? 216  LYS A CG  1 
ATOM   54   C CD  . LYS A 1 7   ? 22.062  -10.602 45.410  1.00 36.89 ? 216  LYS A CD  1 
ATOM   55   C CE  . LYS A 1 7   ? 22.920  -9.394  45.734  1.00 36.40 ? 216  LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 7   ? 22.811  -9.112  47.212  1.00 39.81 ? 216  LYS A NZ  1 
ATOM   57   N N   . HIS A 1 8   ? 19.660  -11.840 41.222  1.00 28.05 ? 217  HIS A N   1 
ATOM   58   C CA  . HIS A 1 8   ? 19.489  -11.246 39.912  1.00 29.36 ? 217  HIS A CA  1 
ATOM   59   C C   . HIS A 1 8   ? 18.209  -10.381 39.890  1.00 28.38 ? 217  HIS A C   1 
ATOM   60   O O   . HIS A 1 8   ? 18.243  -9.267  39.417  1.00 27.92 ? 217  HIS A O   1 
ATOM   61   C CB  . HIS A 1 8   ? 19.442  -12.360 38.858  1.00 30.60 ? 217  HIS A CB  1 
ATOM   62   C CG  . HIS A 1 8   ? 18.985  -11.917 37.499  1.00 34.77 ? 217  HIS A CG  1 
ATOM   63   N ND1 . HIS A 1 8   ? 19.862  -11.606 36.481  1.00 38.40 ? 217  HIS A ND1 1 
ATOM   64   C CD2 . HIS A 1 8   ? 17.735  -11.765 36.979  1.00 39.37 ? 217  HIS A CD2 1 
ATOM   65   C CE1 . HIS A 1 8   ? 19.177  -11.264 35.399  1.00 41.00 ? 217  HIS A CE1 1 
ATOM   66   N NE2 . HIS A 1 8   ? 17.883  -11.352 35.674  1.00 39.34 ? 217  HIS A NE2 1 
ATOM   67   N N   . ILE A 1 9   ? 17.091  -10.904 40.395  1.00 28.33 ? 218  ILE A N   1 
ATOM   68   C CA  . ILE A 1 9   ? 15.856  -10.091 40.469  1.00 27.39 ? 218  ILE A CA  1 
ATOM   69   C C   . ILE A 1 9   ? 16.060  -8.873  41.383  1.00 27.18 ? 218  ILE A C   1 
ATOM   70   O O   . ILE A 1 9   ? 15.691  -7.767  41.039  1.00 25.99 ? 218  ILE A O   1 
ATOM   71   C CB  . ILE A 1 9   ? 14.618  -10.939 40.889  1.00 28.27 ? 218  ILE A CB  1 
ATOM   72   C CG1 . ILE A 1 9   ? 14.350  -11.992 39.802  1.00 29.81 ? 218  ILE A CG1 1 
ATOM   73   C CG2 . ILE A 1 9   ? 13.383  -10.027 41.137  1.00 26.53 ? 218  ILE A CG2 1 
ATOM   74   C CD1 . ILE A 1 9   ? 12.906  -12.483 39.689  1.00 35.01 ? 218  ILE A CD1 1 
ATOM   75   N N   . TYR A 1 10  ? 16.717  -9.059  42.523  1.00 27.99 ? 219  TYR A N   1 
ATOM   76   C CA  . TYR A 1 10  ? 17.014  -7.929  43.405  1.00 28.90 ? 219  TYR A CA  1 
ATOM   77   C C   . TYR A 1 10  ? 17.787  -6.826  42.685  1.00 27.52 ? 219  TYR A C   1 
ATOM   78   O O   . TYR A 1 10  ? 17.462  -5.634  42.802  1.00 26.85 ? 219  TYR A O   1 
ATOM   79   C CB  . TYR A 1 10  ? 17.741  -8.410  44.682  1.00 30.10 ? 219  TYR A CB  1 
ATOM   80   C CG  . TYR A 1 10  ? 18.125  -7.327  45.651  1.00 33.39 ? 219  TYR A CG  1 
ATOM   81   C CD1 . TYR A 1 10  ? 17.177  -6.405  46.122  1.00 34.55 ? 219  TYR A CD1 1 
ATOM   82   C CD2 . TYR A 1 10  ? 19.436  -7.241  46.144  1.00 35.33 ? 219  TYR A CD2 1 
ATOM   83   C CE1 . TYR A 1 10  ? 17.521  -5.415  47.022  1.00 35.71 ? 219  TYR A CE1 1 
ATOM   84   C CE2 . TYR A 1 10  ? 19.788  -6.248  47.063  1.00 37.32 ? 219  TYR A CE2 1 
ATOM   85   C CZ  . TYR A 1 10  ? 18.826  -5.348  47.497  1.00 36.28 ? 219  TYR A CZ  1 
ATOM   86   O OH  . TYR A 1 10  ? 19.182  -4.366  48.397  1.00 37.67 ? 219  TYR A OH  1 
ATOM   87   N N   . ASN A 1 11  ? 18.797  -7.219  41.923  1.00 27.31 ? 220  ASN A N   1 
ATOM   88   C CA  . ASN A 1 11  ? 19.609  -6.244  41.202  1.00 26.98 ? 220  ASN A CA  1 
ATOM   89   C C   . ASN A 1 11  ? 18.871  -5.565  40.061  1.00 26.42 ? 220  ASN A C   1 
ATOM   90   O O   . ASN A 1 11  ? 19.098  -4.384  39.806  1.00 26.70 ? 220  ASN A O   1 
ATOM   91   C CB  . ASN A 1 11  ? 20.922  -6.846  40.706  1.00 27.33 ? 220  ASN A CB  1 
ATOM   92   C CG  . ASN A 1 11  ? 22.002  -6.836  41.783  1.00 27.13 ? 220  ASN A CG  1 
ATOM   93   O OD1 . ASN A 1 11  ? 22.125  -5.882  42.550  1.00 30.56 ? 220  ASN A OD1 1 
ATOM   94   N ND2 . ASN A 1 11  ? 22.749  -7.909  41.866  1.00 28.40 ? 220  ASN A ND2 1 
ATOM   95   N N   . ALA A 1 12  ? 17.977  -6.301  39.396  1.00 25.78 ? 221  ALA A N   1 
ATOM   96   C CA  . ALA A 1 12  ? 17.151  -5.691  38.333  1.00 25.74 ? 221  ALA A CA  1 
ATOM   97   C C   . ALA A 1 12  ? 16.274  -4.609  38.948  1.00 25.16 ? 221  ALA A C   1 
ATOM   98   O O   . ALA A 1 12  ? 16.032  -3.580  38.335  1.00 25.29 ? 221  ALA A O   1 
ATOM   99   C CB  . ALA A 1 12  ? 16.296  -6.744  37.630  1.00 24.94 ? 221  ALA A CB  1 
ATOM   100  N N   . TYR A 1 13  ? 15.818  -4.851  40.173  1.00 25.16 ? 222  TYR A N   1 
ATOM   101  C CA  . TYR A 1 13  ? 14.997  -3.890  40.898  1.00 25.73 ? 222  TYR A CA  1 
ATOM   102  C C   . TYR A 1 13  ? 15.773  -2.637  41.372  1.00 25.79 ? 222  TYR A C   1 
ATOM   103  O O   . TYR A 1 13  ? 15.317  -1.483  41.195  1.00 25.35 ? 222  TYR A O   1 
ATOM   104  C CB  . TYR A 1 13  ? 14.327  -4.632  42.035  1.00 26.47 ? 222  TYR A CB  1 
ATOM   105  C CG  . TYR A 1 13  ? 13.682  -3.820  43.121  1.00 27.54 ? 222  TYR A CG  1 
ATOM   106  C CD1 . TYR A 1 13  ? 14.466  -3.172  44.083  1.00 27.88 ? 222  TYR A CD1 1 
ATOM   107  C CD2 . TYR A 1 13  ? 12.284  -3.774  43.245  1.00 27.47 ? 222  TYR A CD2 1 
ATOM   108  C CE1 . TYR A 1 13  ? 13.893  -2.453  45.099  1.00 29.55 ? 222  TYR A CE1 1 
ATOM   109  C CE2 . TYR A 1 13  ? 11.688  -3.070  44.276  1.00 29.99 ? 222  TYR A CE2 1 
ATOM   110  C CZ  . TYR A 1 13  ? 12.504  -2.409  45.201  1.00 30.54 ? 222  TYR A CZ  1 
ATOM   111  O OH  . TYR A 1 13  ? 11.945  -1.705  46.234  1.00 32.69 ? 222  TYR A OH  1 
ATOM   112  N N   . LEU A 1 14  ? 16.940  -2.857  41.974  1.00 25.35 ? 223  LEU A N   1 
ATOM   113  C CA  . LEU A 1 14  ? 17.867  -1.749  42.299  1.00 25.81 ? 223  LEU A CA  1 
ATOM   114  C C   . LEU A 1 14  ? 18.178  -0.878  41.086  1.00 25.56 ? 223  LEU A C   1 
ATOM   115  O O   . LEU A 1 14  ? 18.200  0.355   41.175  1.00 25.52 ? 223  LEU A O   1 
ATOM   116  C CB  . LEU A 1 14  ? 19.173  -2.325  42.872  1.00 25.93 ? 223  LEU A CB  1 
ATOM   117  C CG  . LEU A 1 14  ? 19.354  -2.308  44.393  1.00 28.34 ? 223  LEU A CG  1 
ATOM   118  C CD1 . LEU A 1 14  ? 18.056  -2.342  45.225  1.00 29.34 ? 223  LEU A CD1 1 
ATOM   119  C CD2 . LEU A 1 14  ? 20.338  -3.418  44.782  1.00 28.38 ? 223  LEU A CD2 1 
ATOM   120  N N   . LYS A 1 15  ? 18.429  -1.517  39.949  1.00 26.37 ? 224  LYS A N   1 
ATOM   121  C CA  . LYS A 1 15  ? 18.702  -0.785  38.716  1.00 27.68 ? 224  LYS A CA  1 
ATOM   122  C C   . LYS A 1 15  ? 17.543  0.104   38.230  1.00 28.34 ? 224  LYS A C   1 
ATOM   123  O O   . LYS A 1 15  ? 17.756  1.222   37.731  1.00 28.52 ? 224  LYS A O   1 
ATOM   124  C CB  . LYS A 1 15  ? 19.053  -1.794  37.619  1.00 28.66 ? 224  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 15  ? 19.127  -1.217  36.200  1.00 30.94 ? 224  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 15  ? 20.004  -2.017  35.276  1.00 36.85 ? 224  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 15  ? 19.638  -3.489  35.223  1.00 40.89 ? 224  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 15  ? 20.085  -4.092  33.910  1.00 44.10 ? 224  LYS A NZ  1 
ATOM   129  N N   . ASN A 1 16  ? 16.315  -0.392  38.364  1.00 27.83 ? 225  ASN A N   1 
ATOM   130  C CA  . ASN A 1 16  ? 15.179  0.234   37.666  1.00 27.61 ? 225  ASN A CA  1 
ATOM   131  C C   . ASN A 1 16  ? 14.361  1.207   38.523  1.00 28.39 ? 225  ASN A C   1 
ATOM   132  O O   . ASN A 1 16  ? 13.665  2.077   37.988  1.00 28.06 ? 225  ASN A O   1 
ATOM   133  C CB  . ASN A 1 16  ? 14.325  -0.864  37.003  1.00 26.64 ? 225  ASN A CB  1 
ATOM   134  C CG  . ASN A 1 16  ? 14.958  -1.404  35.741  1.00 25.82 ? 225  ASN A CG  1 
ATOM   135  O OD1 . ASN A 1 16  ? 15.026  -0.700  34.741  1.00 22.90 ? 225  ASN A OD1 1 
ATOM   136  N ND2 . ASN A 1 16  ? 15.419  -2.669  35.771  1.00 27.00 ? 225  ASN A ND2 1 
ATOM   137  N N   . PHE A 1 17  ? 14.496  1.093   39.851  1.00 29.25 ? 226  PHE A N   1 
ATOM   138  C CA  . PHE A 1 17  ? 13.799  1.946   40.821  1.00 30.03 ? 226  PHE A CA  1 
ATOM   139  C C   . PHE A 1 17  ? 14.775  2.740   41.721  1.00 31.98 ? 226  PHE A C   1 
ATOM   140  O O   . PHE A 1 17  ? 15.512  2.147   42.535  1.00 32.27 ? 226  PHE A O   1 
ATOM   141  C CB  . PHE A 1 17  ? 12.833  1.087   41.666  1.00 29.16 ? 226  PHE A CB  1 
ATOM   142  C CG  . PHE A 1 17  ? 11.894  0.237   40.827  1.00 26.67 ? 226  PHE A CG  1 
ATOM   143  C CD1 . PHE A 1 17  ? 10.891  0.831   40.072  1.00 27.38 ? 226  PHE A CD1 1 
ATOM   144  C CD2 . PHE A 1 17  ? 12.050  -1.119  40.755  1.00 23.73 ? 226  PHE A CD2 1 
ATOM   145  C CE1 . PHE A 1 17  ? 10.049  0.070   39.272  1.00 23.92 ? 226  PHE A CE1 1 
ATOM   146  C CE2 . PHE A 1 17  ? 11.194  -1.898  39.959  1.00 25.21 ? 226  PHE A CE2 1 
ATOM   147  C CZ  . PHE A 1 17  ? 10.187  -1.275  39.218  1.00 23.40 ? 226  PHE A CZ  1 
ATOM   148  N N   . ASN A 1 18  ? 14.774  4.067   41.584  1.00 33.29 ? 227  ASN A N   1 
ATOM   149  C CA  . ASN A 1 18  ? 15.725  4.907   42.340  1.00 34.87 ? 227  ASN A CA  1 
ATOM   150  C C   . ASN A 1 18  ? 15.411  4.939   43.832  1.00 34.97 ? 227  ASN A C   1 
ATOM   151  O O   . ASN A 1 18  ? 16.291  4.734   44.681  1.00 35.17 ? 227  ASN A O   1 
ATOM   152  C CB  . ASN A 1 18  ? 15.806  6.343   41.799  1.00 35.46 ? 227  ASN A CB  1 
ATOM   153  C CG  . ASN A 1 18  ? 16.978  7.151   42.446  1.00 38.89 ? 227  ASN A CG  1 
ATOM   154  O OD1 . ASN A 1 18  ? 16.806  8.294   42.847  1.00 43.61 ? 227  ASN A OD1 1 
ATOM   155  N ND2 . ASN A 1 18  ? 18.148  6.533   42.561  1.00 40.06 ? 227  ASN A ND2 1 
ATOM   156  N N   . MET A 1 19  ? 14.148  5.187   44.145  1.00 34.63 ? 228  MET A N   1 
ATOM   157  C CA  . MET A 1 19  ? 13.702  5.205   45.514  1.00 35.03 ? 228  MET A CA  1 
ATOM   158  C C   . MET A 1 19  ? 13.448  3.784   45.938  1.00 34.20 ? 228  MET A C   1 
ATOM   159  O O   . MET A 1 19  ? 12.615  3.100   45.360  1.00 35.07 ? 228  MET A O   1 
ATOM   160  C CB  . MET A 1 19  ? 12.424  6.040   45.655  1.00 36.09 ? 228  MET A CB  1 
ATOM   161  C CG  . MET A 1 19  ? 12.058  6.359   47.077  1.00 37.54 ? 228  MET A CG  1 
ATOM   162  S SD  . MET A 1 19  ? 13.474  7.119   47.880  1.00 42.85 ? 228  MET A SD  1 
ATOM   163  C CE  . MET A 1 19  ? 12.621  8.049   49.122  1.00 40.53 ? 228  MET A CE  1 
ATOM   164  N N   . THR A 1 20  ? 14.206  3.331   46.926  1.00 33.41 ? 229  THR A N   1 
ATOM   165  C CA  . THR A 1 20  ? 14.037  2.004   47.500  1.00 32.73 ? 229  THR A CA  1 
ATOM   166  C C   . THR A 1 20  ? 13.409  2.184   48.873  1.00 31.61 ? 229  THR A C   1 
ATOM   167  O O   . THR A 1 20  ? 13.420  3.283   49.428  1.00 31.06 ? 229  THR A O   1 
ATOM   168  C CB  . THR A 1 20  ? 15.387  1.302   47.696  1.00 32.92 ? 229  THR A CB  1 
ATOM   169  O OG1 . THR A 1 20  ? 16.246  2.134   48.499  1.00 33.46 ? 229  THR A OG1 1 
ATOM   170  C CG2 . THR A 1 20  ? 16.046  0.984   46.345  1.00 33.72 ? 229  THR A CG2 1 
ATOM   171  N N   . LYS A 1 21  ? 12.878  1.105   49.421  1.00 30.90 ? 230  LYS A N   1 
ATOM   172  C CA  . LYS A 1 21  ? 12.328  1.143   50.763  1.00 30.98 ? 230  LYS A CA  1 
ATOM   173  C C   . LYS A 1 21  ? 13.435  1.532   51.743  1.00 31.65 ? 230  LYS A C   1 
ATOM   174  O O   . LYS A 1 21  ? 13.189  2.243   52.728  1.00 30.72 ? 230  LYS A O   1 
ATOM   175  C CB  . LYS A 1 21  ? 11.749  -0.209  51.167  1.00 30.38 ? 230  LYS A CB  1 
ATOM   176  C CG  . LYS A 1 21  ? 10.985  -0.164  52.493  1.00 29.56 ? 230  LYS A CG  1 
ATOM   177  C CD  . LYS A 1 21  ? 10.232  -1.466  52.749  1.00 28.14 ? 230  LYS A CD  1 
ATOM   178  C CE  . LYS A 1 21  ? 9.418   -1.350  54.042  1.00 26.22 ? 230  LYS A CE  1 
ATOM   179  N NZ  . LYS A 1 21  ? 8.650   -2.580  54.239  1.00 28.25 ? 230  LYS A NZ  1 
ATOM   180  N N   . LYS A 1 22  ? 14.640  1.039   51.471  1.00 32.43 ? 231  LYS A N   1 
ATOM   181  C CA  . LYS A 1 22  ? 15.786  1.340   52.325  1.00 34.67 ? 231  LYS A CA  1 
ATOM   182  C C   . LYS A 1 22  ? 15.993  2.843   52.383  1.00 34.37 ? 231  LYS A C   1 
ATOM   183  O O   . LYS A 1 22  ? 16.044  3.418   53.462  1.00 34.64 ? 231  LYS A O   1 
ATOM   184  C CB  . LYS A 1 22  ? 17.048  0.630   51.831  1.00 34.62 ? 231  LYS A CB  1 
ATOM   185  C CG  . LYS A 1 22  ? 18.284  0.830   52.757  1.00 36.57 ? 231  LYS A CG  1 
ATOM   186  C CD  . LYS A 1 22  ? 19.364  -0.239  52.489  1.00 36.31 ? 231  LYS A CD  1 
ATOM   187  C CE  . LYS A 1 22  ? 20.667  0.063   53.247  1.00 39.55 ? 231  LYS A CE  1 
ATOM   188  N NZ  . LYS A 1 22  ? 21.522  -1.174  53.402  1.00 43.00 ? 231  LYS A NZ  1 
ATOM   189  N N   . LYS A 1 23  ? 16.065  3.472   51.217  1.00 35.44 ? 232  LYS A N   1 
ATOM   190  C CA  . LYS A 1 23  ? 16.316  4.902   51.134  1.00 36.60 ? 232  LYS A CA  1 
ATOM   191  C C   . LYS A 1 23  ? 15.149  5.714   51.676  1.00 37.44 ? 232  LYS A C   1 
ATOM   192  O O   . LYS A 1 23  ? 15.368  6.704   52.369  1.00 37.60 ? 232  LYS A O   1 
ATOM   193  C CB  . LYS A 1 23  ? 16.672  5.316   49.704  1.00 36.75 ? 232  LYS A CB  1 
ATOM   194  C CG  . LYS A 1 23  ? 17.961  4.678   49.204  1.00 38.02 ? 232  LYS A CG  1 
ATOM   195  C CD  . LYS A 1 23  ? 18.640  5.573   48.193  1.00 41.16 ? 232  LYS A CD  1 
ATOM   196  C CE  . LYS A 1 23  ? 18.590  4.994   46.799  1.00 40.54 ? 232  LYS A CE  1 
ATOM   197  N NZ  . LYS A 1 23  ? 18.658  6.077   45.784  1.00 43.25 ? 232  LYS A NZ  1 
ATOM   198  N N   . ALA A 1 24  ? 13.926  5.272   51.381  1.00 37.99 ? 233  ALA A N   1 
ATOM   199  C CA  . ALA A 1 24  ? 12.708  5.902   51.893  1.00 39.31 ? 233  ALA A CA  1 
ATOM   200  C C   . ALA A 1 24  ? 12.654  5.908   53.417  1.00 40.65 ? 233  ALA A C   1 
ATOM   201  O O   . ALA A 1 24  ? 12.391  6.947   54.031  1.00 40.97 ? 233  ALA A O   1 
ATOM   202  C CB  . ALA A 1 24  ? 11.476  5.206   51.335  1.00 38.49 ? 233  ALA A CB  1 
ATOM   203  N N   . ARG A 1 25  ? 12.891  4.745   54.022  1.00 42.46 ? 234  ARG A N   1 
ATOM   204  C CA  . ARG A 1 25  ? 12.828  4.597   55.478  1.00 44.84 ? 234  ARG A CA  1 
ATOM   205  C C   . ARG A 1 25  ? 13.862  5.443   56.247  1.00 45.94 ? 234  ARG A C   1 
ATOM   206  O O   . ARG A 1 25  ? 13.564  5.941   57.340  1.00 46.76 ? 234  ARG A O   1 
ATOM   207  C CB  . ARG A 1 25  ? 12.918  3.118   55.878  1.00 45.02 ? 234  ARG A CB  1 
ATOM   208  C CG  . ARG A 1 25  ? 11.659  2.544   56.524  1.00 46.93 ? 234  ARG A CG  1 
ATOM   209  C CD  . ARG A 1 25  ? 10.429  2.660   55.639  1.00 48.96 ? 234  ARG A CD  1 
ATOM   210  N NE  . ARG A 1 25  ? 9.210   2.678   56.446  1.00 52.74 ? 234  ARG A NE  1 
ATOM   211  C CZ  . ARG A 1 25  ? 7.989   2.973   55.983  1.00 53.54 ? 234  ARG A CZ  1 
ATOM   212  N NH1 . ARG A 1 25  ? 7.801   3.276   54.693  1.00 51.06 ? 234  ARG A NH1 1 
ATOM   213  N NH2 . ARG A 1 25  ? 6.949   2.969   56.823  1.00 52.94 ? 234  ARG A NH2 1 
ATOM   214  N N   . SER A 1 26  ? 15.057  5.614   55.685  1.00 47.01 ? 235  SER A N   1 
ATOM   215  C CA  . SER A 1 26  ? 16.063  6.454   56.328  1.00 48.53 ? 235  SER A CA  1 
ATOM   216  C C   . SER A 1 26  ? 15.715  7.942   56.193  1.00 49.31 ? 235  SER A C   1 
ATOM   217  O O   . SER A 1 26  ? 15.989  8.729   57.107  1.00 49.56 ? 235  SER A O   1 
ATOM   218  C CB  . SER A 1 26  ? 17.486  6.134   55.836  1.00 48.37 ? 235  SER A CB  1 
ATOM   219  O OG  . SER A 1 26  ? 17.850  6.878   54.686  1.00 50.22 ? 235  SER A OG  1 
ATOM   220  N N   . ILE A 1 27  ? 15.099  8.325   55.072  1.00 50.19 ? 236  ILE A N   1 
ATOM   221  C CA  . ILE A 1 27  ? 14.514  9.673   54.949  1.00 50.67 ? 236  ILE A CA  1 
ATOM   222  C C   . ILE A 1 27  ? 13.358  9.884   55.928  1.00 51.55 ? 236  ILE A C   1 
ATOM   223  O O   . ILE A 1 27  ? 13.335  10.888  56.650  1.00 52.03 ? 236  ILE A O   1 
ATOM   224  C CB  . ILE A 1 27  ? 14.058  10.021  53.518  1.00 50.41 ? 236  ILE A CB  1 
ATOM   225  C CG1 . ILE A 1 27  ? 15.271  10.235  52.618  1.00 49.65 ? 236  ILE A CG1 1 
ATOM   226  C CG2 . ILE A 1 27  ? 13.189  11.281  53.537  1.00 50.39 ? 236  ILE A CG2 1 
ATOM   227  C CD1 . ILE A 1 27  ? 14.951  10.334  51.131  1.00 49.53 ? 236  ILE A CD1 1 
ATOM   228  N N   . LEU A 1 28  ? 12.415  8.943   55.977  1.00 52.30 ? 237  LEU A N   1 
ATOM   229  C CA  . LEU A 1 28  ? 11.257  9.084   56.872  1.00 53.20 ? 237  LEU A CA  1 
ATOM   230  C C   . LEU A 1 28  ? 11.609  9.174   58.376  1.00 54.46 ? 237  LEU A C   1 
ATOM   231  O O   . LEU A 1 28  ? 10.709  9.341   59.219  1.00 54.61 ? 237  LEU A O   1 
ATOM   232  C CB  . LEU A 1 28  ? 10.202  7.997   56.607  1.00 52.44 ? 237  LEU A CB  1 
ATOM   233  C CG  . LEU A 1 28  ? 9.378   8.114   55.322  1.00 51.31 ? 237  LEU A CG  1 
ATOM   234  C CD1 . LEU A 1 28  ? 8.542   6.876   55.133  1.00 48.63 ? 237  LEU A CD1 1 
ATOM   235  C CD2 . LEU A 1 28  ? 8.490   9.353   55.340  1.00 50.49 ? 237  LEU A CD2 1 
ATOM   236  N N   . THR A 1 29  ? 12.902  9.065   58.704  1.00 55.78 ? 238  THR A N   1 
ATOM   237  C CA  . THR A 1 29  ? 13.404  9.319   60.074  1.00 56.90 ? 238  THR A CA  1 
ATOM   238  C C   . THR A 1 29  ? 14.849  9.854   60.084  1.00 57.22 ? 238  THR A C   1 
ATOM   239  O O   . THR A 1 29  ? 15.098  11.061  59.952  1.00 57.41 ? 238  THR A O   1 
ATOM   240  C CB  . THR A 1 29  ? 13.339  8.049   60.957  1.00 57.17 ? 238  THR A CB  1 
ATOM   241  O OG1 . THR A 1 29  ? 12.303  7.175   60.486  1.00 57.37 ? 238  THR A OG1 1 
ATOM   242  C CG2 . THR A 1 29  ? 13.085  8.419   62.440  1.00 57.80 ? 238  THR A CG2 1 
ATOM   243  N N   . HIS A 1 34  ? 21.501  13.902  55.796  1.00 62.81 ? 243  HIS A N   1 
ATOM   244  C CA  . HIS A 1 34  ? 20.899  14.709  54.730  1.00 62.67 ? 243  HIS A CA  1 
ATOM   245  C C   . HIS A 1 34  ? 19.651  15.484  55.197  1.00 62.01 ? 243  HIS A C   1 
ATOM   246  O O   . HIS A 1 34  ? 19.060  15.184  56.248  1.00 62.10 ? 243  HIS A O   1 
ATOM   247  C CB  . HIS A 1 34  ? 20.566  13.844  53.504  1.00 63.02 ? 243  HIS A CB  1 
ATOM   248  C CG  . HIS A 1 34  ? 20.470  14.623  52.223  1.00 64.81 ? 243  HIS A CG  1 
ATOM   249  N ND1 . HIS A 1 34  ? 19.305  15.235  51.805  1.00 66.28 ? 243  HIS A ND1 1 
ATOM   250  C CD2 . HIS A 1 34  ? 21.400  14.900  51.277  1.00 65.99 ? 243  HIS A CD2 1 
ATOM   251  C CE1 . HIS A 1 34  ? 19.522  15.853  50.657  1.00 67.19 ? 243  HIS A CE1 1 
ATOM   252  N NE2 . HIS A 1 34  ? 20.786  15.667  50.314  1.00 67.20 ? 243  HIS A NE2 1 
ATOM   253  N N   . THR A 1 35  ? 19.260  16.469  54.388  1.00 60.76 ? 244  THR A N   1 
ATOM   254  C CA  . THR A 1 35  ? 18.217  17.432  54.734  1.00 59.58 ? 244  THR A CA  1 
ATOM   255  C C   . THR A 1 35  ? 16.808  16.864  54.559  1.00 57.90 ? 244  THR A C   1 
ATOM   256  O O   . THR A 1 35  ? 16.548  16.097  53.628  1.00 58.03 ? 244  THR A O   1 
ATOM   257  C CB  . THR A 1 35  ? 18.372  18.748  53.913  1.00 60.09 ? 244  THR A CB  1 
ATOM   258  O OG1 . THR A 1 35  ? 18.155  18.478  52.519  1.00 60.86 ? 244  THR A OG1 1 
ATOM   259  C CG2 . THR A 1 35  ? 19.779  19.360  54.110  1.00 60.01 ? 244  THR A CG2 1 
ATOM   260  N N   . ALA A 1 36  ? 15.916  17.257  55.471  1.00 55.68 ? 245  ALA A N   1 
ATOM   261  C CA  . ALA A 1 36  ? 14.523  16.792  55.517  1.00 53.20 ? 245  ALA A CA  1 
ATOM   262  C C   . ALA A 1 36  ? 13.692  17.173  54.272  1.00 51.23 ? 245  ALA A C   1 
ATOM   263  O O   . ALA A 1 36  ? 14.017  18.143  53.572  1.00 51.16 ? 245  ALA A O   1 
ATOM   264  C CB  . ALA A 1 36  ? 13.845  17.299  56.798  1.00 53.30 ? 245  ALA A CB  1 
ATOM   265  N N   . PRO A 1 37  ? 12.633  16.389  53.976  1.00 49.05 ? 246  PRO A N   1 
ATOM   266  C CA  . PRO A 1 37  ? 11.756  16.723  52.852  1.00 47.13 ? 246  PRO A CA  1 
ATOM   267  C C   . PRO A 1 37  ? 10.851  17.910  53.166  1.00 45.03 ? 246  PRO A C   1 
ATOM   268  O O   . PRO A 1 37  ? 10.446  18.095  54.311  1.00 44.97 ? 246  PRO A O   1 
ATOM   269  C CB  . PRO A 1 37  ? 10.910  15.455  52.680  1.00 47.08 ? 246  PRO A CB  1 
ATOM   270  C CG  . PRO A 1 37  ? 10.889  14.823  54.007  1.00 48.09 ? 246  PRO A CG  1 
ATOM   271  C CD  . PRO A 1 37  ? 12.213  15.143  54.649  1.00 48.97 ? 246  PRO A CD  1 
ATOM   272  N N   . PHE A 1 38  ? 10.541  18.698  52.147  1.00 42.92 ? 247  PHE A N   1 
ATOM   273  C CA  . PHE A 1 38  ? 9.608   19.809  52.280  1.00 40.92 ? 247  PHE A CA  1 
ATOM   274  C C   . PHE A 1 38  ? 8.173   19.284  52.450  1.00 39.84 ? 247  PHE A C   1 
ATOM   275  O O   . PHE A 1 38  ? 7.726   18.454  51.659  1.00 39.29 ? 247  PHE A O   1 
ATOM   276  C CB  . PHE A 1 38  ? 9.727   20.712  51.054  1.00 40.59 ? 247  PHE A CB  1 
ATOM   277  C CG  . PHE A 1 38  ? 8.777   21.855  51.058  1.00 40.55 ? 247  PHE A CG  1 
ATOM   278  C CD1 . PHE A 1 38  ? 9.054   23.005  51.811  1.00 40.73 ? 247  PHE A CD1 1 
ATOM   279  C CD2 . PHE A 1 38  ? 7.589   21.791  50.334  1.00 38.94 ? 247  PHE A CD2 1 
ATOM   280  C CE1 . PHE A 1 38  ? 8.152   24.081  51.828  1.00 39.45 ? 247  PHE A CE1 1 
ATOM   281  C CE2 . PHE A 1 38  ? 6.696   22.856  50.340  1.00 39.30 ? 247  PHE A CE2 1 
ATOM   282  C CZ  . PHE A 1 38  ? 6.977   24.006  51.091  1.00 39.44 ? 247  PHE A CZ  1 
ATOM   283  N N   . VAL A 1 39  ? 7.458   19.748  53.476  1.00 37.97 ? 248  VAL A N   1 
ATOM   284  C CA  . VAL A 1 39  ? 6.106   19.243  53.732  1.00 36.58 ? 248  VAL A CA  1 
ATOM   285  C C   . VAL A 1 39  ? 5.005   19.969  52.919  1.00 36.37 ? 248  VAL A C   1 
ATOM   286  O O   . VAL A 1 39  ? 4.809   21.181  53.044  1.00 36.38 ? 248  VAL A O   1 
ATOM   287  C CB  . VAL A 1 39  ? 5.774   19.204  55.239  1.00 36.74 ? 248  VAL A CB  1 
ATOM   288  C CG1 . VAL A 1 39  ? 4.343   18.677  55.475  1.00 35.50 ? 248  VAL A CG1 1 
ATOM   289  C CG2 . VAL A 1 39  ? 6.775   18.350  55.984  1.00 34.54 ? 248  VAL A CG2 1 
ATOM   290  N N   . ILE A 1 40  ? 4.317   19.210  52.066  1.00 35.59 ? 249  ILE A N   1 
ATOM   291  C CA  . ILE A 1 40  ? 3.203   19.722  51.250  1.00 34.46 ? 249  ILE A CA  1 
ATOM   292  C C   . ILE A 1 40  ? 1.886   19.323  51.909  1.00 34.90 ? 249  ILE A C   1 
ATOM   293  O O   . ILE A 1 40  ? 1.557   18.134  51.993  1.00 34.42 ? 249  ILE A O   1 
ATOM   294  C CB  . ILE A 1 40  ? 3.248   19.154  49.804  1.00 34.65 ? 249  ILE A CB  1 
ATOM   295  C CG1 . ILE A 1 40  ? 4.521   19.612  49.088  1.00 33.49 ? 249  ILE A CG1 1 
ATOM   296  C CG2 . ILE A 1 40  ? 1.988   19.538  48.992  1.00 32.88 ? 249  ILE A CG2 1 
ATOM   297  C CD1 . ILE A 1 40  ? 4.962   18.655  48.010  1.00 33.42 ? 249  ILE A CD1 1 
ATOM   298  N N   . HIS A 1 41  ? 1.124   20.312  52.367  1.00 35.38 ? 250  HIS A N   1 
ATOM   299  C CA  . HIS A 1 41  ? -0.069  20.029  53.160  1.00 35.68 ? 250  HIS A CA  1 
ATOM   300  C C   . HIS A 1 41  ? -1.254  20.961  52.865  1.00 36.38 ? 250  HIS A C   1 
ATOM   301  O O   . HIS A 1 41  ? -2.287  20.908  53.564  1.00 36.90 ? 250  HIS A O   1 
ATOM   302  C CB  . HIS A 1 41  ? 0.282   20.050  54.666  1.00 35.95 ? 250  HIS A CB  1 
ATOM   303  C CG  . HIS A 1 41  ? 0.583   21.419  55.197  1.00 37.09 ? 250  HIS A CG  1 
ATOM   304  N ND1 . HIS A 1 41  ? 1.834   21.994  55.114  1.00 38.51 ? 250  HIS A ND1 1 
ATOM   305  C CD2 . HIS A 1 41  ? -0.214  22.336  55.793  1.00 37.22 ? 250  HIS A CD2 1 
ATOM   306  C CE1 . HIS A 1 41  ? 1.794   23.210  55.631  1.00 36.55 ? 250  HIS A CE1 1 
ATOM   307  N NE2 . HIS A 1 41  ? 0.563   23.441  56.050  1.00 38.98 ? 250  HIS A NE2 1 
ATOM   308  N N   . ASP A 1 42  ? -1.100  21.809  51.847  1.00 36.02 ? 251  ASP A N   1 
ATOM   309  C CA  . ASP A 1 42  ? -2.122  22.787  51.459  1.00 36.41 ? 251  ASP A CA  1 
ATOM   310  C C   . ASP A 1 42  ? -1.757  23.423  50.113  1.00 36.49 ? 251  ASP A C   1 
ATOM   311  O O   . ASP A 1 42  ? -0.704  23.114  49.527  1.00 36.37 ? 251  ASP A O   1 
ATOM   312  C CB  . ASP A 1 42  ? -2.344  23.863  52.556  1.00 36.36 ? 251  ASP A CB  1 
ATOM   313  C CG  . ASP A 1 42  ? -1.045  24.588  52.983  1.00 36.90 ? 251  ASP A CG  1 
ATOM   314  O OD1 . ASP A 1 42  ? -0.064  24.661  52.213  1.00 38.10 ? 251  ASP A OD1 1 
ATOM   315  O OD2 . ASP A 1 42  ? -1.009  25.118  54.121  1.00 37.89 ? 251  ASP A OD2 1 
ATOM   316  N N   . ILE A 1 43  ? -2.620  24.305  49.621  1.00 36.25 ? 252  ILE A N   1 
ATOM   317  C CA  . ILE A 1 43  ? -2.400  24.953  48.318  1.00 36.42 ? 252  ILE A CA  1 
ATOM   318  C C   . ILE A 1 43  ? -1.099  25.745  48.293  1.00 35.95 ? 252  ILE A C   1 
ATOM   319  O O   . ILE A 1 43  ? -0.375  25.719  47.322  1.00 35.83 ? 252  ILE A O   1 
ATOM   320  C CB  . ILE A 1 43  ? -3.513  25.921  47.998  1.00 36.29 ? 252  ILE A CB  1 
ATOM   321  C CG1 . ILE A 1 43  ? -4.806  25.172  47.721  1.00 36.99 ? 252  ILE A CG1 1 
ATOM   322  C CG2 . ILE A 1 43  ? -3.149  26.796  46.796  1.00 38.05 ? 252  ILE A CG2 1 
ATOM   323  C CD1 . ILE A 1 43  ? -5.944  26.123  47.465  1.00 38.94 ? 252  ILE A CD1 1 
ATOM   324  N N   . GLU A 1 44  ? -0.823  26.461  49.370  1.00 35.79 ? 253  GLU A N   1 
ATOM   325  C CA  . GLU A 1 44  ? 0.324   27.336  49.401  1.00 36.12 ? 253  GLU A CA  1 
ATOM   326  C C   . GLU A 1 44  ? 1.621   26.549  49.300  1.00 35.38 ? 253  GLU A C   1 
ATOM   327  O O   . GLU A 1 44  ? 2.460   26.865  48.472  1.00 35.04 ? 253  GLU A O   1 
ATOM   328  C CB  . GLU A 1 44  ? 0.287   28.211  50.653  1.00 36.48 ? 253  GLU A CB  1 
ATOM   329  C CG  . GLU A 1 44  ? 1.011   29.506  50.493  1.00 39.46 ? 253  GLU A CG  1 
ATOM   330  C CD  . GLU A 1 44  ? 2.475   29.373  50.851  1.00 45.04 ? 253  GLU A CD  1 
ATOM   331  O OE1 . GLU A 1 44  ? 2.813   28.473  51.665  1.00 45.51 ? 253  GLU A OE1 1 
ATOM   332  O OE2 . GLU A 1 44  ? 3.287   30.165  50.307  1.00 48.38 ? 253  GLU A OE2 1 
ATOM   333  N N   . THR A 1 45  ? 1.770   25.531  50.147  1.00 35.09 ? 254  THR A N   1 
ATOM   334  C CA  . THR A 1 45  ? 2.985   24.706  50.165  1.00 34.92 ? 254  THR A CA  1 
ATOM   335  C C   . THR A 1 45  ? 3.181   23.891  48.883  1.00 34.83 ? 254  THR A C   1 
ATOM   336  O O   . THR A 1 45  ? 4.325   23.651  48.471  1.00 34.74 ? 254  THR A O   1 
ATOM   337  C CB  . THR A 1 45  ? 3.049   23.771  51.380  1.00 34.88 ? 254  THR A CB  1 
ATOM   338  O OG1 . THR A 1 45  ? 1.829   23.039  51.497  1.00 35.37 ? 254  THR A OG1 1 
ATOM   339  C CG2 . THR A 1 45  ? 3.317   24.560  52.653  1.00 34.96 ? 254  THR A CG2 1 
ATOM   340  N N   . LEU A 1 46  ? 2.080   23.474  48.258  1.00 34.55 ? 255  LEU A N   1 
ATOM   341  C CA  . LEU A 1 46  ? 2.159   22.831  46.940  1.00 34.78 ? 255  LEU A CA  1 
ATOM   342  C C   . LEU A 1 46  ? 2.735   23.796  45.914  1.00 35.18 ? 255  LEU A C   1 
ATOM   343  O O   . LEU A 1 46  ? 3.613   23.418  45.145  1.00 34.63 ? 255  LEU A O   1 
ATOM   344  C CB  . LEU A 1 46  ? 0.820   22.258  46.455  1.00 34.41 ? 255  LEU A CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 0.808   21.545  45.072  1.00 34.75 ? 255  LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 1.791   20.380  45.018  1.00 33.85 ? 255  LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? -0.583  21.060  44.660  1.00 34.46 ? 255  LEU A CD2 1 
ATOM   348  N N   . TRP A 1 47  ? 2.234   25.031  45.913  1.00 35.73 ? 256  TRP A N   1 
ATOM   349  C CA  . TRP A 1 47  ? 2.743   26.069  45.025  1.00 37.02 ? 256  TRP A CA  1 
ATOM   350  C C   . TRP A 1 47  ? 4.256   26.274  45.217  1.00 37.56 ? 256  TRP A C   1 
ATOM   351  O O   . TRP A 1 47  ? 5.007   26.280  44.250  1.00 37.20 ? 256  TRP A O   1 
ATOM   352  C CB  . TRP A 1 47  ? 1.970   27.377  45.233  1.00 36.98 ? 256  TRP A CB  1 
ATOM   353  C CG  . TRP A 1 47  ? 2.436   28.503  44.351  1.00 37.91 ? 256  TRP A CG  1 
ATOM   354  C CD1 . TRP A 1 47  ? 2.248   28.630  42.988  1.00 38.77 ? 256  TRP A CD1 1 
ATOM   355  C CD2 . TRP A 1 47  ? 3.185   29.653  44.759  1.00 37.65 ? 256  TRP A CD2 1 
ATOM   356  N NE1 . TRP A 1 47  ? 2.824   29.799  42.541  1.00 38.01 ? 256  TRP A NE1 1 
ATOM   357  C CE2 . TRP A 1 47  ? 3.404   30.443  43.606  1.00 38.30 ? 256  TRP A CE2 1 
ATOM   358  C CE3 . TRP A 1 47  ? 3.680   30.101  45.990  1.00 38.50 ? 256  TRP A CE3 1 
ATOM   359  C CZ2 . TRP A 1 47  ? 4.101   31.655  43.649  1.00 37.37 ? 256  TRP A CZ2 1 
ATOM   360  C CZ3 . TRP A 1 47  ? 4.372   31.303  46.028  1.00 39.04 ? 256  TRP A CZ3 1 
ATOM   361  C CH2 . TRP A 1 47  ? 4.579   32.064  44.855  1.00 37.60 ? 256  TRP A CH2 1 
ATOM   362  N N   . GLN A 1 48  ? 4.695   26.418  46.467  1.00 38.54 ? 257  GLN A N   1 
ATOM   363  C CA  . GLN A 1 48  ? 6.121   26.501  46.763  1.00 39.68 ? 257  GLN A CA  1 
ATOM   364  C C   . GLN A 1 48  ? 6.881   25.263  46.266  1.00 40.28 ? 257  GLN A C   1 
ATOM   365  O O   . GLN A 1 48  ? 7.970   25.377  45.701  1.00 39.91 ? 257  GLN A O   1 
ATOM   366  C CB  . GLN A 1 48  ? 6.346   26.640  48.262  1.00 39.85 ? 257  GLN A CB  1 
ATOM   367  C CG  . GLN A 1 48  ? 5.985   27.984  48.852  1.00 42.94 ? 257  GLN A CG  1 
ATOM   368  C CD  . GLN A 1 48  ? 6.270   28.018  50.333  1.00 47.76 ? 257  GLN A CD  1 
ATOM   369  O OE1 . GLN A 1 48  ? 7.435   28.105  50.764  1.00 52.28 ? 257  GLN A OE1 1 
ATOM   370  N NE2 . GLN A 1 48  ? 5.223   27.931  51.130  1.00 48.00 ? 257  GLN A NE2 1 
ATOM   371  N N   . ALA A 1 49  ? 6.308   24.080  46.489  1.00 40.56 ? 258  ALA A N   1 
ATOM   372  C CA  . ALA A 1 49  ? 6.951   22.827  46.086  1.00 40.79 ? 258  ALA A CA  1 
ATOM   373  C C   . ALA A 1 49  ? 7.225   22.813  44.589  1.00 41.35 ? 258  ALA A C   1 
ATOM   374  O O   . ALA A 1 49  ? 8.303   22.423  44.147  1.00 40.22 ? 258  ALA A O   1 
ATOM   375  C CB  . ALA A 1 49  ? 6.101   21.653  46.476  1.00 40.54 ? 258  ALA A CB  1 
ATOM   376  N N   . GLU A 1 50  ? 6.249   23.260  43.811  1.00 42.41 ? 259  GLU A N   1 
ATOM   377  C CA  . GLU A 1 50  ? 6.411   23.318  42.364  1.00 44.05 ? 259  GLU A CA  1 
ATOM   378  C C   . GLU A 1 50  ? 7.243   24.516  41.904  1.00 45.30 ? 259  GLU A C   1 
ATOM   379  O O   . GLU A 1 50  ? 7.597   24.607  40.730  1.00 45.71 ? 259  GLU A O   1 
ATOM   380  C CB  . GLU A 1 50  ? 5.053   23.270  41.660  1.00 44.06 ? 259  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 50  ? 4.489   21.856  41.587  1.00 44.47 ? 259  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 50  ? 3.055   21.811  41.142  1.00 46.27 ? 259  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 50  ? 2.435   22.883  41.003  1.00 48.85 ? 259  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 50  ? 2.537   20.697  40.936  1.00 45.79 ? 259  GLU A OE2 1 
ATOM   385  N N   . LYS A 1 51  ? 7.574   25.417  42.829  1.00 47.00 ? 260  LYS A N   1 
ATOM   386  C CA  . LYS A 1 51  ? 8.443   26.561  42.514  1.00 48.32 ? 260  LYS A CA  1 
ATOM   387  C C   . LYS A 1 51  ? 9.921   26.178  42.575  1.00 49.17 ? 260  LYS A C   1 
ATOM   388  O O   . LYS A 1 51  ? 10.792  27.049  42.612  1.00 49.17 ? 260  LYS A O   1 
ATOM   389  C CB  . LYS A 1 51  ? 8.180   27.741  43.449  1.00 48.07 ? 260  LYS A CB  1 
ATOM   390  C CG  . LYS A 1 51  ? 6.929   28.512  43.159  1.00 48.99 ? 260  LYS A CG  1 
ATOM   391  C CD  . LYS A 1 51  ? 6.982   29.858  43.832  1.00 50.89 ? 260  LYS A CD  1 
ATOM   392  C CE  . LYS A 1 51  ? 7.606   30.887  42.896  1.00 53.42 ? 260  LYS A CE  1 
ATOM   393  N NZ  . LYS A 1 51  ? 7.116   30.698  41.480  1.00 54.07 ? 260  LYS A NZ  1 
ATOM   394  N N   . GLY A 1 52  ? 10.200  24.879  42.576  1.00 50.14 ? 261  GLY A N   1 
ATOM   395  C CA  . GLY A 1 52  ? 11.575  24.408  42.543  1.00 51.57 ? 261  GLY A CA  1 
ATOM   396  C C   . GLY A 1 52  ? 12.077  23.857  43.862  1.00 52.60 ? 261  GLY A C   1 
ATOM   397  O O   . GLY A 1 52  ? 13.205  23.359  43.932  1.00 53.06 ? 261  GLY A O   1 
ATOM   398  N N   . LEU A 1 53  ? 11.254  23.946  44.906  1.00 53.06 ? 262  LEU A N   1 
ATOM   399  C CA  . LEU A 1 53  ? 11.585  23.328  46.191  1.00 53.70 ? 262  LEU A CA  1 
ATOM   400  C C   . LEU A 1 53  ? 11.552  21.803  46.117  1.00 54.05 ? 262  LEU A C   1 
ATOM   401  O O   . LEU A 1 53  ? 12.400  21.137  46.709  1.00 54.26 ? 262  LEU A O   1 
ATOM   402  C CB  . LEU A 1 53  ? 10.641  23.814  47.303  1.00 54.18 ? 262  LEU A CB  1 
ATOM   403  C CG  . LEU A 1 53  ? 10.986  25.056  48.129  1.00 54.54 ? 262  LEU A CG  1 
ATOM   404  C CD1 . LEU A 1 53  ? 9.818   25.373  49.034  1.00 56.12 ? 262  LEU A CD1 1 
ATOM   405  C CD2 . LEU A 1 53  ? 12.267  24.879  48.957  1.00 55.38 ? 262  LEU A CD2 1 
ATOM   406  N N   . VAL A 1 54  ? 10.574  21.260  45.391  1.00 54.15 ? 263  VAL A N   1 
ATOM   407  C CA  . VAL A 1 54  ? 10.372  19.813  45.302  1.00 54.40 ? 263  VAL A CA  1 
ATOM   408  C C   . VAL A 1 54  ? 10.488  19.351  43.848  1.00 55.13 ? 263  VAL A C   1 
ATOM   409  O O   . VAL A 1 54  ? 11.232  18.413  43.549  1.00 55.36 ? 263  VAL A O   1 
ATOM   410  C CB  . VAL A 1 54  ? 9.019   19.378  45.953  1.00 54.24 ? 263  VAL A CB  1 
ATOM   411  C CG1 . VAL A 1 54  ? 8.654   17.931  45.617  1.00 52.97 ? 263  VAL A CG1 1 
ATOM   412  C CG2 . VAL A 1 54  ? 9.079   19.569  47.457  1.00 53.18 ? 263  VAL A CG2 1 
ATOM   413  N N   . TRP A 1 55  ? 9.759   20.024  42.957  1.00 55.72 ? 264  TRP A N   1 
ATOM   414  C CA  . TRP A 1 55  ? 9.806   19.754  41.518  1.00 56.34 ? 264  TRP A CA  1 
ATOM   415  C C   . TRP A 1 55  ? 10.500  20.906  40.784  1.00 57.49 ? 264  TRP A C   1 
ATOM   416  O O   . TRP A 1 55  ? 10.584  22.017  41.308  1.00 57.66 ? 264  TRP A O   1 
ATOM   417  C CB  . TRP A 1 55  ? 8.389   19.546  40.965  1.00 55.21 ? 264  TRP A CB  1 
ATOM   418  C CG  . TRP A 1 55  ? 7.744   18.298  41.464  1.00 54.23 ? 264  TRP A CG  1 
ATOM   419  C CD1 . TRP A 1 55  ? 7.981   17.033  41.026  1.00 53.92 ? 264  TRP A CD1 1 
ATOM   420  C CD2 . TRP A 1 55  ? 6.757   18.185  42.503  1.00 53.59 ? 264  TRP A CD2 1 
ATOM   421  N NE1 . TRP A 1 55  ? 7.209   16.133  41.725  1.00 53.60 ? 264  TRP A NE1 1 
ATOM   422  C CE2 . TRP A 1 55  ? 6.448   16.812  42.639  1.00 52.68 ? 264  TRP A CE2 1 
ATOM   423  C CE3 . TRP A 1 55  ? 6.105   19.108  43.330  1.00 53.42 ? 264  TRP A CE3 1 
ATOM   424  C CZ2 . TRP A 1 55  ? 5.512   16.337  43.559  1.00 52.38 ? 264  TRP A CZ2 1 
ATOM   425  C CZ3 . TRP A 1 55  ? 5.169   18.629  44.255  1.00 53.81 ? 264  TRP A CZ3 1 
ATOM   426  C CH2 . TRP A 1 55  ? 4.887   17.255  44.359  1.00 53.30 ? 264  TRP A CH2 1 
ATOM   427  N N   . LYS A 1 56  ? 11.004  20.632  39.577  1.00 58.84 ? 265  LYS A N   1 
ATOM   428  C CA  . LYS A 1 56  ? 11.653  21.656  38.744  1.00 59.66 ? 265  LYS A CA  1 
ATOM   429  C C   . LYS A 1 56  ? 11.027  21.748  37.356  1.00 59.89 ? 265  LYS A C   1 
ATOM   430  O O   . LYS A 1 56  ? 9.804   21.640  37.210  1.00 60.22 ? 265  LYS A O   1 
ATOM   431  C CB  . LYS A 1 56  ? 13.163  21.410  38.651  1.00 59.95 ? 265  LYS A CB  1 
ATOM   432  C CG  . LYS A 1 56  ? 13.895  21.789  39.937  1.00 61.59 ? 265  LYS A CG  1 
ATOM   433  C CD  . LYS A 1 56  ? 15.332  21.302  39.983  1.00 63.30 ? 265  LYS A CD  1 
ATOM   434  C CE  . LYS A 1 56  ? 15.887  21.454  41.403  1.00 64.76 ? 265  LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 56  ? 17.349  21.169  41.480  1.00 65.52 ? 265  LYS A NZ  1 
ATOM   436  N N   . GLU A 1 67  ? -8.618  23.542  39.730  1.00 39.01 ? 276  GLU A N   1 
ATOM   437  C CA  . GLU A 1 67  ? -8.793  23.351  41.157  1.00 39.50 ? 276  GLU A CA  1 
ATOM   438  C C   . GLU A 1 67  ? -7.727  22.431  41.738  1.00 39.68 ? 276  GLU A C   1 
ATOM   439  O O   . GLU A 1 67  ? -7.195  21.561  41.045  1.00 40.30 ? 276  GLU A O   1 
ATOM   440  C CB  . GLU A 1 67  ? -10.174 22.791  41.463  1.00 39.43 ? 276  GLU A CB  1 
ATOM   441  C CG  . GLU A 1 67  ? -10.395 21.426  40.882  1.00 41.42 ? 276  GLU A CG  1 
ATOM   442  C CD  . GLU A 1 67  ? -11.784 20.913  41.081  1.00 43.87 ? 276  GLU A CD  1 
ATOM   443  O OE1 . GLU A 1 67  ? -12.218 20.799  42.247  1.00 45.91 ? 276  GLU A OE1 1 
ATOM   444  O OE2 . GLU A 1 67  ? -12.441 20.596  40.071  1.00 46.16 ? 276  GLU A OE2 1 
ATOM   445  N N   . ILE A 1 68  ? -7.434  22.634  43.020  1.00 39.00 ? 277  ILE A N   1 
ATOM   446  C CA  . ILE A 1 68  ? -6.432  21.867  43.746  1.00 37.89 ? 277  ILE A CA  1 
ATOM   447  C C   . ILE A 1 68  ? -6.565  20.340  43.574  1.00 36.74 ? 277  ILE A C   1 
ATOM   448  O O   . ILE A 1 68  ? -5.565  19.668  43.393  1.00 36.40 ? 277  ILE A O   1 
ATOM   449  C CB  . ILE A 1 68  ? -6.383  22.285  45.260  1.00 38.20 ? 277  ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 68  ? -5.188  21.663  45.978  1.00 37.35 ? 277  ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 68  ? -7.697  21.939  45.989  1.00 38.65 ? 277  ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 68  ? -3.834  22.067  45.399  1.00 39.42 ? 277  ILE A CD1 1 
ATOM   453  N N   . SER A 1 69  ? -7.793  19.815  43.632  1.00 36.03 ? 278  SER A N   1 
ATOM   454  C CA  . SER A 1 69  ? -8.045  18.370  43.580  1.00 35.56 ? 278  SER A CA  1 
ATOM   455  C C   . SER A 1 69  ? -7.553  17.745  42.258  1.00 35.10 ? 278  SER A C   1 
ATOM   456  O O   . SER A 1 69  ? -6.953  16.653  42.250  1.00 35.17 ? 278  SER A O   1 
ATOM   457  C CB  . SER A 1 69  ? -9.542  18.078  43.789  1.00 35.89 ? 278  SER A CB  1 
ATOM   458  O OG  . SER A 1 69  ? -9.972  18.419  45.100  1.00 36.38 ? 278  SER A OG  1 
ATOM   459  N N   . VAL A 1 70  ? -7.809  18.449  41.153  1.00 33.80 ? 279  VAL A N   1 
ATOM   460  C CA  . VAL A 1 70  ? -7.426  17.996  39.819  1.00 33.44 ? 279  VAL A CA  1 
ATOM   461  C C   . VAL A 1 70  ? -5.917  18.157  39.626  1.00 33.26 ? 279  VAL A C   1 
ATOM   462  O O   . VAL A 1 70  ? -5.238  17.252  39.151  1.00 32.30 ? 279  VAL A O   1 
ATOM   463  C CB  . VAL A 1 70  ? -8.217  18.756  38.741  1.00 33.81 ? 279  VAL A CB  1 
ATOM   464  C CG1 . VAL A 1 70  ? -7.841  18.277  37.345  1.00 33.98 ? 279  VAL A CG1 1 
ATOM   465  C CG2 . VAL A 1 70  ? -9.728  18.578  38.981  1.00 32.36 ? 279  VAL A CG2 1 
ATOM   466  N N   . HIS A 1 71  ? -5.374  19.294  40.031  1.00 33.24 ? 280  HIS A N   1 
ATOM   467  C CA  . HIS A 1 71  ? -3.931  19.453  39.940  1.00 33.52 ? 280  HIS A CA  1 
ATOM   468  C C   . HIS A 1 71  ? -3.138  18.334  40.675  1.00 32.74 ? 280  HIS A C   1 
ATOM   469  O O   . HIS A 1 71  ? -2.163  17.811  40.132  1.00 33.06 ? 280  HIS A O   1 
ATOM   470  C CB  . HIS A 1 71  ? -3.477  20.849  40.377  1.00 34.51 ? 280  HIS A CB  1 
ATOM   471  C CG  . HIS A 1 71  ? -1.992  21.009  40.349  1.00 35.16 ? 280  HIS A CG  1 
ATOM   472  N ND1 . HIS A 1 71  ? -1.285  21.185  39.180  1.00 39.13 ? 280  HIS A ND1 1 
ATOM   473  C CD2 . HIS A 1 71  ? -1.073  20.979  41.341  1.00 38.23 ? 280  HIS A CD2 1 
ATOM   474  C CE1 . HIS A 1 71  ? 0.005   21.274  39.455  1.00 37.44 ? 280  HIS A CE1 1 
ATOM   475  N NE2 . HIS A 1 71  ? 0.161   21.144  40.758  1.00 36.30 ? 280  HIS A NE2 1 
ATOM   476  N N   . VAL A 1 72  ? -3.568  17.968  41.883  1.00 31.99 ? 281  VAL A N   1 
ATOM   477  C CA  . VAL A 1 72  ? -2.996  16.830  42.620  1.00 31.61 ? 281  VAL A CA  1 
ATOM   478  C C   . VAL A 1 72  ? -3.172  15.526  41.815  1.00 31.39 ? 281  VAL A C   1 
ATOM   479  O O   . VAL A 1 72  ? -2.243  14.712  41.699  1.00 30.69 ? 281  VAL A O   1 
ATOM   480  C CB  . VAL A 1 72  ? -3.637  16.696  44.040  1.00 30.99 ? 281  VAL A CB  1 
ATOM   481  C CG1 . VAL A 1 72  ? -3.288  15.352  44.713  1.00 31.52 ? 281  VAL A CG1 1 
ATOM   482  C CG2 . VAL A 1 72  ? -3.238  17.884  44.927  1.00 32.73 ? 281  VAL A CG2 1 
ATOM   483  N N   . PHE A 1 73  ? -4.360  15.349  41.247  1.00 30.89 ? 282  PHE A N   1 
ATOM   484  C CA  . PHE A 1 73  ? -4.672  14.147  40.467  1.00 31.03 ? 282  PHE A CA  1 
ATOM   485  C C   . PHE A 1 73  ? -3.704  14.031  39.288  1.00 30.66 ? 282  PHE A C   1 
ATOM   486  O O   . PHE A 1 73  ? -3.239  12.938  38.986  1.00 30.19 ? 282  PHE A O   1 
ATOM   487  C CB  . PHE A 1 73  ? -6.144  14.205  40.026  1.00 31.44 ? 282  PHE A CB  1 
ATOM   488  C CG  . PHE A 1 73  ? -6.619  13.025  39.197  1.00 32.27 ? 282  PHE A CG  1 
ATOM   489  C CD1 . PHE A 1 73  ? -6.711  11.755  39.742  1.00 33.03 ? 282  PHE A CD1 1 
ATOM   490  C CD2 . PHE A 1 73  ? -7.027  13.213  37.880  1.00 32.06 ? 282  PHE A CD2 1 
ATOM   491  C CE1 . PHE A 1 73  ? -7.183  10.668  38.971  1.00 32.51 ? 282  PHE A CE1 1 
ATOM   492  C CE2 . PHE A 1 73  ? -7.492  12.138  37.114  1.00 32.80 ? 282  PHE A CE2 1 
ATOM   493  C CZ  . PHE A 1 73  ? -7.581  10.871  37.676  1.00 31.43 ? 282  PHE A CZ  1 
ATOM   494  N N   . TYR A 1 74  ? -3.372  15.169  38.668  1.00 30.59 ? 283  TYR A N   1 
ATOM   495  C CA  . TYR A 1 74  ? -2.448  15.210  37.526  1.00 31.03 ? 283  TYR A CA  1 
ATOM   496  C C   . TYR A 1 74  ? -1.031  14.871  37.935  1.00 30.77 ? 283  TYR A C   1 
ATOM   497  O O   . TYR A 1 74  ? -0.308  14.218  37.176  1.00 29.61 ? 283  TYR A O   1 
ATOM   498  C CB  . TYR A 1 74  ? -2.437  16.568  36.822  1.00 32.14 ? 283  TYR A CB  1 
ATOM   499  C CG  . TYR A 1 74  ? -3.671  16.859  35.990  1.00 33.55 ? 283  TYR A CG  1 
ATOM   500  C CD1 . TYR A 1 74  ? -4.555  15.847  35.630  1.00 34.47 ? 283  TYR A CD1 1 
ATOM   501  C CD2 . TYR A 1 74  ? -3.943  18.148  35.560  1.00 34.79 ? 283  TYR A CD2 1 
ATOM   502  C CE1 . TYR A 1 74  ? -5.695  16.115  34.863  1.00 35.94 ? 283  TYR A CE1 1 
ATOM   503  C CE2 . TYR A 1 74  ? -5.082  18.434  34.795  1.00 37.55 ? 283  TYR A CE2 1 
ATOM   504  C CZ  . TYR A 1 74  ? -5.947  17.410  34.445  1.00 36.58 ? 283  TYR A CZ  1 
ATOM   505  O OH  . TYR A 1 74  ? -7.076  17.698  33.694  1.00 37.44 ? 283  TYR A OH  1 
ATOM   506  N N   . ARG A 1 75  ? -0.631  15.330  39.124  1.00 30.48 ? 284  ARG A N   1 
ATOM   507  C CA  . ARG A 1 75  ? 0.663   14.938  39.705  1.00 30.90 ? 284  ARG A CA  1 
ATOM   508  C C   . ARG A 1 75  ? 0.714   13.439  40.010  1.00 29.41 ? 284  ARG A C   1 
ATOM   509  O O   . ARG A 1 75  ? 1.738   12.800  39.772  1.00 29.76 ? 284  ARG A O   1 
ATOM   510  C CB  . ARG A 1 75  ? 0.958   15.734  40.964  1.00 31.15 ? 284  ARG A CB  1 
ATOM   511  C CG  . ARG A 1 75  ? 1.781   16.982  40.721  1.00 36.63 ? 284  ARG A CG  1 
ATOM   512  C CD  . ARG A 1 75  ? 3.203   16.629  40.311  1.00 40.40 ? 284  ARG A CD  1 
ATOM   513  N NE  . ARG A 1 75  ? 3.914   17.812  39.854  1.00 45.81 ? 284  ARG A NE  1 
ATOM   514  C CZ  . ARG A 1 75  ? 5.046   17.782  39.163  1.00 49.24 ? 284  ARG A CZ  1 
ATOM   515  N NH1 . ARG A 1 75  ? 5.598   16.621  38.832  1.00 50.39 ? 284  ARG A NH1 1 
ATOM   516  N NH2 . ARG A 1 75  ? 5.624   18.918  38.801  1.00 51.46 ? 284  ARG A NH2 1 
ATOM   517  N N   . CYS A 1 76  ? -0.387  12.889  40.515  1.00 28.64 ? 285  CYS A N   1 
ATOM   518  C CA  . CYS A 1 76  ? -0.551  11.437  40.682  1.00 28.69 ? 285  CYS A CA  1 
ATOM   519  C C   . CYS A 1 76  ? -0.353  10.663  39.367  1.00 28.06 ? 285  CYS A C   1 
ATOM   520  O O   . CYS A 1 76  ? 0.425   9.693   39.331  1.00 27.29 ? 285  CYS A O   1 
ATOM   521  C CB  . CYS A 1 76  ? -1.928  11.114  41.256  1.00 29.21 ? 285  CYS A CB  1 
ATOM   522  S SG  . CYS A 1 76  ? -2.148  11.552  43.014  1.00 32.67 ? 285  CYS A SG  1 
ATOM   523  N N   . GLN A 1 77  ? -1.043  11.097  38.296  1.00 26.27 ? 286  GLN A N   1 
ATOM   524  C CA  . GLN A 1 77  ? -0.873  10.517  36.952  1.00 26.61 ? 286  GLN A CA  1 
ATOM   525  C C   . GLN A 1 77  ? 0.571   10.547  36.455  1.00 28.22 ? 286  GLN A C   1 
ATOM   526  O O   . GLN A 1 77  ? 1.053   9.598   35.851  1.00 28.55 ? 286  GLN A O   1 
ATOM   527  C CB  . GLN A 1 77  ? -1.749  11.240  35.933  1.00 25.54 ? 286  GLN A CB  1 
ATOM   528  C CG  . GLN A 1 77  ? -3.234  10.921  36.148  1.00 24.23 ? 286  GLN A CG  1 
ATOM   529  C CD  . GLN A 1 77  ? -4.104  11.481  35.064  1.00 26.54 ? 286  GLN A CD  1 
ATOM   530  O OE1 . GLN A 1 77  ? -3.813  11.337  33.885  1.00 28.15 ? 286  GLN A OE1 1 
ATOM   531  N NE2 . GLN A 1 77  ? -5.186  12.135  35.458  1.00 27.61 ? 286  GLN A NE2 1 
ATOM   532  N N   . CYS A 1 78  ? 1.236   11.663  36.678  1.00 30.20 ? 287  CYS A N   1 
ATOM   533  C CA  . CYS A 1 78  ? 2.602   11.845  36.223  1.00 30.15 ? 287  CYS A CA  1 
ATOM   534  C C   . CYS A 1 78  ? 3.563   10.855  36.922  1.00 28.85 ? 287  CYS A C   1 
ATOM   535  O O   . CYS A 1 78  ? 4.423   10.225  36.294  1.00 28.68 ? 287  CYS A O   1 
ATOM   536  C CB  . CYS A 1 78  ? 2.981   13.309  36.444  1.00 30.99 ? 287  CYS A CB  1 
ATOM   537  S SG  . CYS A 1 78  ? 4.748   13.536  36.700  1.00 39.06 ? 287  CYS A SG  1 
ATOM   538  N N   . THR A 1 79  ? 3.366   10.677  38.218  1.00 27.82 ? 288  THR A N   1 
ATOM   539  C CA  . THR A 1 79  ? 4.155   9.759   39.018  1.00 27.29 ? 288  THR A CA  1 
ATOM   540  C C   . THR A 1 79  ? 3.901   8.299   38.631  1.00 26.04 ? 288  THR A C   1 
ATOM   541  O O   . THR A 1 79  ? 4.844   7.507   38.502  1.00 24.37 ? 288  THR A O   1 
ATOM   542  C CB  . THR A 1 79  ? 3.846   9.990   40.517  1.00 27.23 ? 288  THR A CB  1 
ATOM   543  O OG1 . THR A 1 79  ? 4.060   11.377  40.815  1.00 30.11 ? 288  THR A OG1 1 
ATOM   544  C CG2 . THR A 1 79  ? 4.737   9.130   41.389  1.00 29.47 ? 288  THR A CG2 1 
ATOM   545  N N   . THR A 1 80  ? 2.625   7.922   38.418  1.00 24.47 ? 289  THR A N   1 
ATOM   546  C CA  . THR A 1 80  ? 2.357   6.512   38.167  1.00 23.10 ? 289  THR A CA  1 
ATOM   547  C C   . THR A 1 80  ? 2.829   6.109   36.785  1.00 22.88 ? 289  THR A C   1 
ATOM   548  O O   . THR A 1 80  ? 3.371   5.009   36.616  1.00 23.61 ? 289  THR A O   1 
ATOM   549  C CB  . THR A 1 80  ? 0.858   6.102   38.336  1.00 23.17 ? 289  THR A CB  1 
ATOM   550  O OG1 . THR A 1 80  ? 0.084   6.875   37.437  1.00 21.06 ? 289  THR A OG1 1 
ATOM   551  C CG2 . THR A 1 80  ? 0.366   6.330   39.766  1.00 23.05 ? 289  THR A CG2 1 
ATOM   552  N N   . VAL A 1 81  ? 2.641   6.985   35.798  1.00 22.80 ? 290  VAL A N   1 
ATOM   553  C CA  . VAL A 1 81  ? 3.142   6.723   34.433  1.00 24.16 ? 290  VAL A CA  1 
ATOM   554  C C   . VAL A 1 81  ? 4.690   6.605   34.408  1.00 24.33 ? 290  VAL A C   1 
ATOM   555  O O   . VAL A 1 81  ? 5.246   5.773   33.691  1.00 23.42 ? 290  VAL A O   1 
ATOM   556  C CB  . VAL A 1 81  ? 2.599   7.734   33.404  1.00 24.35 ? 290  VAL A CB  1 
ATOM   557  C CG1 . VAL A 1 81  ? 3.413   7.726   32.097  1.00 26.06 ? 290  VAL A CG1 1 
ATOM   558  C CG2 . VAL A 1 81  ? 1.118   7.422   33.084  1.00 24.18 ? 290  VAL A CG2 1 
ATOM   559  N N   . GLU A 1 82  ? 5.368   7.383   35.235  1.00 24.90 ? 291  GLU A N   1 
ATOM   560  C CA  . GLU A 1 82  ? 6.838   7.191   35.378  1.00 24.57 ? 291  GLU A CA  1 
ATOM   561  C C   . GLU A 1 82  ? 7.145   5.802   35.965  1.00 23.65 ? 291  GLU A C   1 
ATOM   562  O O   . GLU A 1 82  ? 8.058   5.134   35.493  1.00 24.09 ? 291  GLU A O   1 
ATOM   563  C CB  . GLU A 1 82  ? 7.480   8.313   36.198  1.00 24.88 ? 291  GLU A CB  1 
ATOM   564  C CG  . GLU A 1 82  ? 9.001   8.064   36.572  1.00 28.22 ? 291  GLU A CG  1 
ATOM   565  C CD  . GLU A 1 82  ? 9.963   7.855   35.362  1.00 37.20 ? 291  GLU A CD  1 
ATOM   566  O OE1 . GLU A 1 82  ? 9.551   8.019   34.173  1.00 36.78 ? 291  GLU A OE1 1 
ATOM   567  O OE2 . GLU A 1 82  ? 11.177  7.551   35.621  1.00 42.22 ? 291  GLU A OE2 1 
ATOM   568  N N   . THR A 1 83  ? 6.342   5.343   36.936  1.00 22.47 ? 292  THR A N   1 
ATOM   569  C CA  . THR A 1 83  ? 6.537   4.043   37.544  1.00 22.34 ? 292  THR A CA  1 
ATOM   570  C C   . THR A 1 83  ? 6.204   2.920   36.547  1.00 22.09 ? 292  THR A C   1 
ATOM   571  O O   . THR A 1 83  ? 6.927   1.922   36.469  1.00 22.32 ? 292  THR A O   1 
ATOM   572  C CB  . THR A 1 83  ? 5.814   3.919   38.907  1.00 22.30 ? 292  THR A CB  1 
ATOM   573  O OG1 . THR A 1 83  ? 6.161   5.042   39.707  1.00 23.99 ? 292  THR A OG1 1 
ATOM   574  C CG2 . THR A 1 83  ? 6.237   2.673   39.649  1.00 22.34 ? 292  THR A CG2 1 
ATOM   575  N N   . VAL A 1 84  ? 5.159   3.116   35.730  1.00 22.17 ? 293  VAL A N   1 
ATOM   576  C CA  . VAL A 1 84  ? 4.880   2.191   34.634  1.00 21.54 ? 293  VAL A CA  1 
ATOM   577  C C   . VAL A 1 84  ? 6.134   2.001   33.761  1.00 22.58 ? 293  VAL A C   1 
ATOM   578  O O   . VAL A 1 84  ? 6.502   0.889   33.478  1.00 21.78 ? 293  VAL A O   1 
ATOM   579  C CB  . VAL A 1 84  ? 3.668   2.627   33.797  1.00 21.44 ? 293  VAL A CB  1 
ATOM   580  C CG1 . VAL A 1 84  ? 3.506   1.715   32.582  1.00 21.75 ? 293  VAL A CG1 1 
ATOM   581  C CG2 . VAL A 1 84  ? 2.380   2.572   34.662  1.00 17.22 ? 293  VAL A CG2 1 
ATOM   582  N N   . ARG A 1 85  ? 6.749   3.100   33.328  1.00 23.86 ? 294  ARG A N   1 
ATOM   583  C CA  . ARG A 1 85  ? 7.991   3.047   32.555  1.00 25.33 ? 294  ARG A CA  1 
ATOM   584  C C   . ARG A 1 85  ? 9.083   2.248   33.253  1.00 23.81 ? 294  ARG A C   1 
ATOM   585  O O   . ARG A 1 85  ? 9.711   1.425   32.611  1.00 24.49 ? 294  ARG A O   1 
ATOM   586  C CB  . ARG A 1 85  ? 8.521   4.447   32.241  1.00 26.53 ? 294  ARG A CB  1 
ATOM   587  C CG  . ARG A 1 85  ? 7.873   5.124   31.015  1.00 32.97 ? 294  ARG A CG  1 
ATOM   588  C CD  . ARG A 1 85  ? 8.326   6.580   30.945  1.00 41.12 ? 294  ARG A CD  1 
ATOM   589  N NE  . ARG A 1 85  ? 7.979   7.246   29.682  1.00 48.42 ? 294  ARG A NE  1 
ATOM   590  C CZ  . ARG A 1 85  ? 8.633   7.088   28.523  1.00 49.97 ? 294  ARG A CZ  1 
ATOM   591  N NH1 . ARG A 1 85  ? 9.661   6.252   28.422  1.00 52.17 ? 294  ARG A NH1 1 
ATOM   592  N NH2 . ARG A 1 85  ? 8.239   7.754   27.448  1.00 52.85 ? 294  ARG A NH2 1 
ATOM   593  N N   . GLU A 1 86  ? 9.318   2.496   34.545  1.00 23.29 ? 295  GLU A N   1 
ATOM   594  C CA  . GLU A 1 86  ? 10.325  1.728   35.290  1.00 23.16 ? 295  GLU A CA  1 
ATOM   595  C C   . GLU A 1 86  ? 9.948   0.252   35.363  1.00 21.82 ? 295  GLU A C   1 
ATOM   596  O O   . GLU A 1 86  ? 10.786  -0.597  35.179  1.00 20.66 ? 295  GLU A O   1 
ATOM   597  C CB  . GLU A 1 86  ? 10.548  2.294   36.695  1.00 22.75 ? 295  GLU A CB  1 
ATOM   598  C CG  . GLU A 1 86  ? 11.045  3.726   36.707  1.00 24.68 ? 295  GLU A CG  1 
ATOM   599  C CD  . GLU A 1 86  ? 10.955  4.396   38.070  1.00 26.97 ? 295  GLU A CD  1 
ATOM   600  O OE1 . GLU A 1 86  ? 10.161  3.976   38.941  1.00 33.68 ? 295  GLU A OE1 1 
ATOM   601  O OE2 . GLU A 1 86  ? 11.675  5.382   38.273  1.00 34.76 ? 295  GLU A OE2 1 
ATOM   602  N N   . LEU A 1 87  ? 8.661   -0.067  35.574  1.00 20.58 ? 296  LEU A N   1 
ATOM   603  C CA  . LEU A 1 87  ? 8.220   -1.465  35.634  1.00 18.83 ? 296  LEU A CA  1 
ATOM   604  C C   . LEU A 1 87  ? 8.404   -2.220  34.311  1.00 19.52 ? 296  LEU A C   1 
ATOM   605  O O   . LEU A 1 87  ? 8.726   -3.424  34.315  1.00 18.87 ? 296  LEU A O   1 
ATOM   606  C CB  . LEU A 1 87  ? 6.715   -1.552  36.101  1.00 18.87 ? 296  LEU A CB  1 
ATOM   607  C CG  . LEU A 1 87  ? 6.494   -1.351  37.599  1.00 16.62 ? 296  LEU A CG  1 
ATOM   608  C CD1 . LEU A 1 87  ? 5.034   -0.915  37.928  1.00 19.39 ? 296  LEU A CD1 1 
ATOM   609  C CD2 . LEU A 1 87  ? 6.833   -2.589  38.316  1.00 17.19 ? 296  LEU A CD2 1 
ATOM   610  N N   . THR A 1 88  ? 8.168   -1.536  33.190  1.00 19.49 ? 297  THR A N   1 
ATOM   611  C CA  . THR A 1 88  ? 8.358   -2.128  31.850  1.00 22.09 ? 297  THR A CA  1 
ATOM   612  C C   . THR A 1 88  ? 9.851   -2.516  31.607  1.00 22.51 ? 297  THR A C   1 
ATOM   613  O O   . THR A 1 88  ? 10.150  -3.596  31.092  1.00 21.78 ? 297  THR A O   1 
ATOM   614  C CB  . THR A 1 88  ? 7.868   -1.146  30.752  1.00 22.30 ? 297  THR A CB  1 
ATOM   615  O OG1 . THR A 1 88  ? 6.475   -0.856  30.969  1.00 25.60 ? 297  THR A OG1 1 
ATOM   616  C CG2 . THR A 1 88  ? 8.004   -1.730  29.353  1.00 23.17 ? 297  THR A CG2 1 
ATOM   617  N N   . GLU A 1 89  ? 10.753  -1.647  32.041  1.00 23.45 ? 298  GLU A N   1 
ATOM   618  C CA  . GLU A 1 89  ? 12.198  -1.950  31.975  1.00 25.83 ? 298  GLU A CA  1 
ATOM   619  C C   . GLU A 1 89  ? 12.601  -3.053  32.925  1.00 25.32 ? 298  GLU A C   1 
ATOM   620  O O   . GLU A 1 89  ? 13.360  -3.943  32.553  1.00 26.69 ? 298  GLU A O   1 
ATOM   621  C CB  . GLU A 1 89  ? 13.007  -0.684  32.236  1.00 26.40 ? 298  GLU A CB  1 
ATOM   622  C CG  . GLU A 1 89  ? 13.019  0.196   31.002  1.00 33.76 ? 298  GLU A CG  1 
ATOM   623  C CD  . GLU A 1 89  ? 13.679  -0.509  29.806  1.00 39.89 ? 298  GLU A CD  1 
ATOM   624  O OE1 . GLU A 1 89  ? 14.800  -1.041  29.953  1.00 43.33 ? 298  GLU A OE1 1 
ATOM   625  O OE2 . GLU A 1 89  ? 13.060  -0.558  28.731  1.00 43.51 ? 298  GLU A OE2 1 
ATOM   626  N N   . PHE A 1 90  ? 12.096  -2.995  34.155  1.00 25.65 ? 299  PHE A N   1 
ATOM   627  C CA  . PHE A 1 90  ? 12.281  -4.050  35.147  1.00 25.18 ? 299  PHE A CA  1 
ATOM   628  C C   . PHE A 1 90  ? 11.883  -5.425  34.631  1.00 25.05 ? 299  PHE A C   1 
ATOM   629  O O   . PHE A 1 90  ? 12.618  -6.391  34.802  1.00 22.85 ? 299  PHE A O   1 
ATOM   630  C CB  . PHE A 1 90  ? 11.501  -3.720  36.437  1.00 24.28 ? 299  PHE A CB  1 
ATOM   631  C CG  . PHE A 1 90  ? 11.467  -4.865  37.452  1.00 24.92 ? 299  PHE A CG  1 
ATOM   632  C CD1 . PHE A 1 90  ? 12.609  -5.200  38.190  1.00 22.45 ? 299  PHE A CD1 1 
ATOM   633  C CD2 . PHE A 1 90  ? 10.284  -5.606  37.654  1.00 20.93 ? 299  PHE A CD2 1 
ATOM   634  C CE1 . PHE A 1 90  ? 12.595  -6.240  39.111  1.00 24.78 ? 299  PHE A CE1 1 
ATOM   635  C CE2 . PHE A 1 90  ? 10.252  -6.652  38.564  1.00 21.92 ? 299  PHE A CE2 1 
ATOM   636  C CZ  . PHE A 1 90  ? 11.403  -6.976  39.315  1.00 23.95 ? 299  PHE A CZ  1 
ATOM   637  N N   . ALA A 1 91  ? 10.704  -5.508  34.007  1.00 25.70 ? 300  ALA A N   1 
ATOM   638  C CA  . ALA A 1 91  ? 10.183  -6.760  33.451  1.00 26.45 ? 300  ALA A CA  1 
ATOM   639  C C   . ALA A 1 91  ? 11.141  -7.451  32.458  1.00 26.82 ? 300  ALA A C   1 
ATOM   640  O O   . ALA A 1 91  ? 11.340  -8.654  32.503  1.00 26.26 ? 300  ALA A O   1 
ATOM   641  C CB  . ALA A 1 91  ? 8.768   -6.542  32.820  1.00 25.44 ? 300  ALA A CB  1 
ATOM   642  N N   . LYS A 1 92  ? 11.743  -6.681  31.573  1.00 29.76 ? 301  LYS A N   1 
ATOM   643  C CA  . LYS A 1 92  ? 12.776  -7.208  30.687  1.00 32.38 ? 301  LYS A CA  1 
ATOM   644  C C   . LYS A 1 92  ? 13.845  -8.063  31.391  1.00 33.76 ? 301  LYS A C   1 
ATOM   645  O O   . LYS A 1 92  ? 14.436  -8.939  30.756  1.00 34.45 ? 301  LYS A O   1 
ATOM   646  C CB  . LYS A 1 92  ? 13.452  -6.073  29.939  1.00 32.96 ? 301  LYS A CB  1 
ATOM   647  C CG  . LYS A 1 92  ? 12.552  -5.358  28.954  1.00 34.71 ? 301  LYS A CG  1 
ATOM   648  C CD  . LYS A 1 92  ? 13.194  -4.032  28.548  1.00 39.88 ? 301  LYS A CD  1 
ATOM   649  C CE  . LYS A 1 92  ? 12.586  -3.478  27.256  1.00 42.76 ? 301  LYS A CE  1 
ATOM   650  N NZ  . LYS A 1 92  ? 11.079  -3.472  27.285  1.00 44.68 ? 301  LYS A NZ  1 
ATOM   651  N N   . SER A 1 93  ? 14.084  -7.839  32.686  1.00 34.26 ? 302  SER A N   1 
ATOM   652  C CA  . SER A 1 93  ? 15.159  -8.565  33.380  1.00 35.42 ? 302  SER A CA  1 
ATOM   653  C C   . SER A 1 93  ? 14.695  -9.797  34.145  1.00 36.03 ? 302  SER A C   1 
ATOM   654  O O   . SER A 1 93  ? 15.533  -10.544 34.702  1.00 36.63 ? 302  SER A O   1 
ATOM   655  C CB  . SER A 1 93  ? 15.928  -7.645  34.318  1.00 35.55 ? 302  SER A CB  1 
ATOM   656  O OG  . SER A 1 93  ? 16.325  -6.470  33.646  1.00 36.40 ? 302  SER A OG  1 
ATOM   657  N N   . ILE A 1 94  ? 13.378  -10.000 34.205  1.00 35.49 ? 303  ILE A N   1 
ATOM   658  C CA  . ILE A 1 94  ? 12.815  -11.205 34.785  1.00 35.48 ? 303  ILE A CA  1 
ATOM   659  C C   . ILE A 1 94  ? 13.080  -12.284 33.741  1.00 36.02 ? 303  ILE A C   1 
ATOM   660  O O   . ILE A 1 94  ? 12.716  -12.111 32.572  1.00 36.36 ? 303  ILE A O   1 
ATOM   661  C CB  . ILE A 1 94  ? 11.286  -11.056 35.070  1.00 35.37 ? 303  ILE A CB  1 
ATOM   662  C CG1 . ILE A 1 94  ? 11.014  -9.893  36.020  1.00 34.83 ? 303  ILE A CG1 1 
ATOM   663  C CG2 . ILE A 1 94  ? 10.719  -12.303 35.716  1.00 35.34 ? 303  ILE A CG2 1 
ATOM   664  C CD1 . ILE A 1 94  ? 9.543   -9.467  36.029  1.00 35.29 ? 303  ILE A CD1 1 
ATOM   665  N N   . PRO A 1 95  ? 13.797  -13.363 34.125  1.00 37.03 ? 304  PRO A N   1 
ATOM   666  C CA  . PRO A 1 95  ? 14.070  -14.443 33.172  1.00 36.26 ? 304  PRO A CA  1 
ATOM   667  C C   . PRO A 1 95  ? 12.817  -14.948 32.455  1.00 36.25 ? 304  PRO A C   1 
ATOM   668  O O   . PRO A 1 95  ? 11.778  -15.239 33.088  1.00 35.62 ? 304  PRO A O   1 
ATOM   669  C CB  . PRO A 1 95  ? 14.691  -15.533 34.047  1.00 35.91 ? 304  PRO A CB  1 
ATOM   670  C CG  . PRO A 1 95  ? 15.394  -14.757 35.117  1.00 36.99 ? 304  PRO A CG  1 
ATOM   671  C CD  . PRO A 1 95  ? 14.453  -13.618 35.431  1.00 37.09 ? 304  PRO A CD  1 
ATOM   672  N N   . SER A 1 96  ? 12.928  -14.982 31.124  1.00 35.64 ? 305  SER A N   1 
ATOM   673  C CA  . SER A 1 96  ? 11.929  -15.536 30.239  1.00 34.75 ? 305  SER A CA  1 
ATOM   674  C C   . SER A 1 96  ? 10.792  -14.565 29.889  1.00 33.55 ? 305  SER A C   1 
ATOM   675  O O   . SER A 1 96  ? 10.043  -14.848 28.967  1.00 33.54 ? 305  SER A O   1 
ATOM   676  C CB  . SER A 1 96  ? 11.392  -16.877 30.769  1.00 35.49 ? 305  SER A CB  1 
ATOM   677  O OG  . SER A 1 96  ? 12.433  -17.819 30.960  1.00 38.06 ? 305  SER A OG  1 
ATOM   678  N N   . PHE A 1 97  ? 10.671  -13.434 30.596  1.00 32.55 ? 306  PHE A N   1 
ATOM   679  C CA  . PHE A 1 97  ? 9.676   -12.406 30.232  1.00 31.06 ? 306  PHE A CA  1 
ATOM   680  C C   . PHE A 1 97  ? 9.825   -11.951 28.762  1.00 31.09 ? 306  PHE A C   1 
ATOM   681  O O   . PHE A 1 97  ? 8.840   -11.888 28.017  1.00 30.36 ? 306  PHE A O   1 
ATOM   682  C CB  . PHE A 1 97  ? 9.711   -11.193 31.181  1.00 29.45 ? 306  PHE A CB  1 
ATOM   683  C CG  . PHE A 1 97  ? 8.661   -10.147 30.859  1.00 28.98 ? 306  PHE A CG  1 
ATOM   684  C CD1 . PHE A 1 97  ? 8.969   -9.054  30.050  1.00 25.93 ? 306  PHE A CD1 1 
ATOM   685  C CD2 . PHE A 1 97  ? 7.337   -10.283 31.338  1.00 25.30 ? 306  PHE A CD2 1 
ATOM   686  C CE1 . PHE A 1 97  ? 7.996   -8.092  29.721  1.00 26.33 ? 306  PHE A CE1 1 
ATOM   687  C CE2 . PHE A 1 97  ? 6.372   -9.337  31.034  1.00 23.41 ? 306  PHE A CE2 1 
ATOM   688  C CZ  . PHE A 1 97  ? 6.683   -8.235  30.233  1.00 24.84 ? 306  PHE A CZ  1 
ATOM   689  N N   . SER A 1 98  ? 11.055  -11.618 28.371  1.00 30.96 ? 307  SER A N   1 
ATOM   690  C CA  . SER A 1 98  ? 11.370  -11.115 27.026  1.00 31.43 ? 307  SER A CA  1 
ATOM   691  C C   . SER A 1 98  ? 11.186  -12.140 25.916  1.00 32.14 ? 307  SER A C   1 
ATOM   692  O O   . SER A 1 98  ? 11.073  -11.771 24.747  1.00 32.33 ? 307  SER A O   1 
ATOM   693  C CB  . SER A 1 98  ? 12.809  -10.607 26.980  1.00 31.10 ? 307  SER A CB  1 
ATOM   694  O OG  . SER A 1 98  ? 12.939  -9.440  27.752  1.00 32.73 ? 307  SER A OG  1 
ATOM   695  N N   . SER A 1 99  ? 11.162  -13.421 26.264  1.00 32.51 ? 308  SER A N   1 
ATOM   696  C CA  . SER A 1 99  ? 10.944  -14.452 25.259  1.00 33.59 ? 308  SER A CA  1 
ATOM   697  C C   . SER A 1 99  ? 9.454   -14.692 25.023  1.00 33.43 ? 308  SER A C   1 
ATOM   698  O O   . SER A 1 99  ? 9.093   -15.490 24.160  1.00 33.95 ? 308  SER A O   1 
ATOM   699  C CB  . SER A 1 99  ? 11.629  -15.757 25.659  1.00 34.51 ? 308  SER A CB  1 
ATOM   700  O OG  . SER A 1 99  ? 10.930  -16.398 26.733  1.00 37.66 ? 308  SER A OG  1 
ATOM   701  N N   . LEU A 1 100 ? 8.589   -14.025 25.793  1.00 31.65 ? 309  LEU A N   1 
ATOM   702  C CA  . LEU A 1 100 ? 7.153   -14.133 25.547  1.00 31.21 ? 309  LEU A CA  1 
ATOM   703  C C   . LEU A 1 100 ? 6.839   -13.299 24.315  1.00 30.18 ? 309  LEU A C   1 
ATOM   704  O O   . LEU A 1 100 ? 7.564   -12.355 23.993  1.00 30.58 ? 309  LEU A O   1 
ATOM   705  C CB  . LEU A 1 100 ? 6.337   -13.653 26.759  1.00 30.65 ? 309  LEU A CB  1 
ATOM   706  C CG  . LEU A 1 100 ? 6.436   -14.395 28.107  1.00 31.50 ? 309  LEU A CG  1 
ATOM   707  C CD1 . LEU A 1 100 ? 5.841   -13.545 29.217  1.00 27.76 ? 309  LEU A CD1 1 
ATOM   708  C CD2 . LEU A 1 100 ? 5.740   -15.754 28.085  1.00 33.33 ? 309  LEU A CD2 1 
ATOM   709  N N   . PHE A 1 101 ? 5.796   -13.661 23.597  1.00 29.47 ? 310  PHE A N   1 
ATOM   710  C CA  . PHE A 1 101 ? 5.380   -12.839 22.482  1.00 28.83 ? 310  PHE A CA  1 
ATOM   711  C C   . PHE A 1 101 ? 5.041   -11.454 23.049  1.00 27.92 ? 310  PHE A C   1 
ATOM   712  O O   . PHE A 1 101 ? 4.557   -11.333 24.185  1.00 27.04 ? 310  PHE A O   1 
ATOM   713  C CB  . PHE A 1 101 ? 4.176   -13.448 21.757  1.00 29.23 ? 310  PHE A CB  1 
ATOM   714  C CG  . PHE A 1 101 ? 4.540   -14.495 20.731  1.00 30.50 ? 310  PHE A CG  1 
ATOM   715  C CD1 . PHE A 1 101 ? 4.944   -14.129 19.456  1.00 32.88 ? 310  PHE A CD1 1 
ATOM   716  C CD2 . PHE A 1 101 ? 4.481   -15.845 21.043  1.00 34.52 ? 310  PHE A CD2 1 
ATOM   717  C CE1 . PHE A 1 101 ? 5.286   -15.088 18.515  1.00 34.10 ? 310  PHE A CE1 1 
ATOM   718  C CE2 . PHE A 1 101 ? 4.824   -16.817 20.098  1.00 35.86 ? 310  PHE A CE2 1 
ATOM   719  C CZ  . PHE A 1 101 ? 5.234   -16.419 18.831  1.00 32.52 ? 310  PHE A CZ  1 
ATOM   720  N N   . LEU A 1 102 ? 5.305   -10.429 22.246  1.00 26.91 ? 311  LEU A N   1 
ATOM   721  C CA  . LEU A 1 102 ? 5.128   -9.046  22.633  1.00 26.99 ? 311  LEU A CA  1 
ATOM   722  C C   . LEU A 1 102 ? 3.693   -8.766  23.082  1.00 26.00 ? 311  LEU A C   1 
ATOM   723  O O   . LEU A 1 102 ? 3.477   -7.949  23.974  1.00 25.45 ? 311  LEU A O   1 
ATOM   724  C CB  . LEU A 1 102 ? 5.483   -8.175  21.436  1.00 27.85 ? 311  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 102 ? 6.144   -6.815  21.574  1.00 30.61 ? 311  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 102 ? 7.509   -6.911  22.263  1.00 33.32 ? 311  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 102 ? 6.288   -6.212  20.163  1.00 29.30 ? 311  LEU A CD2 1 
ATOM   728  N N   . ASN A 1 103 ? 2.711   -9.438  22.478  1.00 24.63 ? 312  ASN A N   1 
ATOM   729  C CA  . ASN A 1 103 ? 1.322   -9.241  22.910  1.00 24.75 ? 312  ASN A CA  1 
ATOM   730  C C   . ASN A 1 103 ? 1.086   -9.765  24.327  1.00 24.51 ? 312  ASN A C   1 
ATOM   731  O O   . ASN A 1 103 ? 0.328   -9.162  25.091  1.00 24.22 ? 312  ASN A O   1 
ATOM   732  C CB  . ASN A 1 103 ? 0.305   -9.841  21.916  1.00 24.77 ? 312  ASN A CB  1 
ATOM   733  C CG  . ASN A 1 103 ? 0.544   -11.313 21.649  1.00 26.86 ? 312  ASN A CG  1 
ATOM   734  O OD1 . ASN A 1 103 ? 1.630   -11.709 21.214  1.00 29.27 ? 312  ASN A OD1 1 
ATOM   735  N ND2 . ASN A 1 103 ? -0.479  -12.133 21.873  1.00 28.53 ? 312  ASN A ND2 1 
ATOM   736  N N   . ASP A 1 104 ? 1.717   -10.885 24.679  1.00 23.79 ? 313  ASP A N   1 
ATOM   737  C CA  . ASP A 1 104 ? 1.630   -11.362 26.075  1.00 23.96 ? 313  ASP A CA  1 
ATOM   738  C C   . ASP A 1 104 ? 2.326   -10.446 27.068  1.00 22.99 ? 313  ASP A C   1 
ATOM   739  O O   . ASP A 1 104 ? 1.816   -10.255 28.171  1.00 22.93 ? 313  ASP A O   1 
ATOM   740  C CB  . ASP A 1 104 ? 2.131   -12.812 26.240  1.00 23.87 ? 313  ASP A CB  1 
ATOM   741  C CG  . ASP A 1 104 ? 1.075   -13.858 25.895  1.00 27.47 ? 313  ASP A CG  1 
ATOM   742  O OD1 . ASP A 1 104 ? -0.131  -13.526 25.751  1.00 28.47 ? 313  ASP A OD1 1 
ATOM   743  O OD2 . ASP A 1 104 ? 1.453   -15.038 25.802  1.00 30.74 ? 313  ASP A OD2 1 
ATOM   744  N N   . GLN A 1 105 ? 3.500   -9.888  26.703  1.00 23.00 ? 314  GLN A N   1 
ATOM   745  C CA  . GLN A 1 105 ? 4.196   -8.922  27.539  1.00 21.17 ? 314  GLN A CA  1 
ATOM   746  C C   . GLN A 1 105 ? 3.305   -7.724  27.851  1.00 21.42 ? 314  GLN A C   1 
ATOM   747  O O   . GLN A 1 105 ? 3.253   -7.272  29.013  1.00 20.11 ? 314  GLN A O   1 
ATOM   748  C CB  . GLN A 1 105 ? 5.486   -8.403  26.875  1.00 21.97 ? 314  GLN A CB  1 
ATOM   749  C CG  . GLN A 1 105 ? 6.553   -9.480  26.595  1.00 21.36 ? 314  GLN A CG  1 
ATOM   750  C CD  . GLN A 1 105 ? 7.775   -8.871  25.899  1.00 21.59 ? 314  GLN A CD  1 
ATOM   751  O OE1 . GLN A 1 105 ? 8.034   -7.676  26.031  1.00 22.82 ? 314  GLN A OE1 1 
ATOM   752  N NE2 . GLN A 1 105 ? 8.458   -9.667  25.088  1.00 25.55 ? 314  GLN A NE2 1 
ATOM   753  N N   . VAL A 1 106 ? 2.600   -7.227  26.831  1.00 20.83 ? 315  VAL A N   1 
ATOM   754  C CA  . VAL A 1 106 ? 1.654   -6.090  26.975  1.00 21.36 ? 315  VAL A CA  1 
ATOM   755  C C   . VAL A 1 106 ? 0.439   -6.371  27.893  1.00 21.25 ? 315  VAL A C   1 
ATOM   756  O O   . VAL A 1 106 ? 0.040   -5.516  28.705  1.00 20.68 ? 315  VAL A O   1 
ATOM   757  C CB  . VAL A 1 106 ? 1.188   -5.574  25.552  1.00 21.75 ? 315  VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 106 ? 0.046   -4.581  25.653  1.00 21.71 ? 315  VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 106 ? 2.359   -4.931  24.849  1.00 20.74 ? 315  VAL A CG2 1 
ATOM   760  N N   . THR A 1 107 ? -0.151  -7.558  27.752  1.00 21.44 ? 316  THR A N   1 
ATOM   761  C CA  . THR A 1 107 ? -1.203  -8.015  28.668  1.00 21.39 ? 316  THR A CA  1 
ATOM   762  C C   . THR A 1 107 ? -0.696  -8.102  30.122  1.00 21.15 ? 316  THR A C   1 
ATOM   763  O O   . THR A 1 107 ? -1.381  -7.687  31.039  1.00 19.82 ? 316  THR A O   1 
ATOM   764  C CB  . THR A 1 107 ? -1.746  -9.395  28.205  1.00 22.09 ? 316  THR A CB  1 
ATOM   765  O OG1 . THR A 1 107 ? -2.359  -9.231  26.910  1.00 23.96 ? 316  THR A OG1 1 
ATOM   766  C CG2 . THR A 1 107 ? -2.761  -9.952  29.169  1.00 18.95 ? 316  THR A CG2 1 
ATOM   767  N N   . LEU A 1 108 ? 0.506   -8.641  30.321  1.00 20.28 ? 317  LEU A N   1 
ATOM   768  C CA  . LEU A 1 108 ? 1.085   -8.752  31.670  1.00 20.67 ? 317  LEU A CA  1 
ATOM   769  C C   . LEU A 1 108 ? 1.308   -7.392  32.312  1.00 19.68 ? 317  LEU A C   1 
ATOM   770  O O   . LEU A 1 108 ? 1.025   -7.194  33.498  1.00 22.29 ? 317  LEU A O   1 
ATOM   771  C CB  . LEU A 1 108 ? 2.403   -9.559  31.618  1.00 20.33 ? 317  LEU A CB  1 
ATOM   772  C CG  . LEU A 1 108 ? 2.448   -11.080 31.867  1.00 22.39 ? 317  LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 108 ? 1.108   -11.847 31.870  1.00 23.09 ? 317  LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 108 ? 3.517   -11.762 31.058  1.00 20.62 ? 317  LEU A CD2 1 
ATOM   775  N N   . LEU A 1 109 ? 1.834   -6.443  31.557  1.00 19.06 ? 318  LEU A N   1 
ATOM   776  C CA  . LEU A 1 109 ? 2.039   -5.078  32.083  1.00 17.29 ? 318  LEU A CA  1 
ATOM   777  C C   . LEU A 1 109 ? 0.686   -4.385  32.288  1.00 17.66 ? 318  LEU A C   1 
ATOM   778  O O   . LEU A 1 109 ? 0.413   -3.812  33.343  1.00 17.90 ? 318  LEU A O   1 
ATOM   779  C CB  . LEU A 1 109 ? 2.946   -4.300  31.129  1.00 17.29 ? 318  LEU A CB  1 
ATOM   780  C CG  . LEU A 1 109 ? 4.366   -4.911  31.017  1.00 18.28 ? 318  LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 109 ? 5.099   -4.358  29.829  1.00 17.68 ? 318  LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 109 ? 5.130   -4.635  32.301  1.00 17.75 ? 318  LEU A CD2 1 
ATOM   783  N N   . LYS A 1 110 ? -0.193  -4.494  31.300  1.00 16.86 ? 319  LYS A N   1 
ATOM   784  C CA  . LYS A 1 110 ? -1.531  -3.884  31.425  1.00 17.71 ? 319  LYS A CA  1 
ATOM   785  C C   . LYS A 1 110 ? -2.166  -4.240  32.753  1.00 16.47 ? 319  LYS A C   1 
ATOM   786  O O   . LYS A 1 110 ? -2.526  -3.355  33.507  1.00 17.83 ? 319  LYS A O   1 
ATOM   787  C CB  . LYS A 1 110 ? -2.448  -4.300  30.247  1.00 16.66 ? 319  LYS A CB  1 
ATOM   788  C CG  . LYS A 1 110 ? -3.906  -3.790  30.416  1.00 18.55 ? 319  LYS A CG  1 
ATOM   789  C CD  . LYS A 1 110 ? -4.814  -4.312  29.277  1.00 19.45 ? 319  LYS A CD  1 
ATOM   790  C CE  . LYS A 1 110 ? -6.305  -3.858  29.475  1.00 21.76 ? 319  LYS A CE  1 
ATOM   791  N NZ  . LYS A 1 110 ? -6.506  -2.533  28.790  1.00 28.26 ? 319  LYS A NZ  1 
ATOM   792  N N   . TYR A 1 111 ? -2.284  -5.527  33.054  1.00 18.48 ? 320  TYR A N   1 
ATOM   793  C CA  . TYR A 1 111 ? -2.974  -5.983  34.275  1.00 20.34 ? 320  TYR A CA  1 
ATOM   794  C C   . TYR A 1 111 ? -2.147  -6.064  35.547  1.00 20.32 ? 320  TYR A C   1 
ATOM   795  O O   . TYR A 1 111 ? -2.710  -6.145  36.650  1.00 20.27 ? 320  TYR A O   1 
ATOM   796  C CB  . TYR A 1 111 ? -3.596  -7.329  34.009  1.00 22.11 ? 320  TYR A CB  1 
ATOM   797  C CG  . TYR A 1 111 ? -4.841  -7.191  33.189  1.00 24.32 ? 320  TYR A CG  1 
ATOM   798  C CD1 . TYR A 1 111 ? -6.075  -6.966  33.807  1.00 25.76 ? 320  TYR A CD1 1 
ATOM   799  C CD2 . TYR A 1 111 ? -4.794  -7.292  31.802  1.00 24.17 ? 320  TYR A CD2 1 
ATOM   800  C CE1 . TYR A 1 111 ? -7.242  -6.830  33.056  1.00 28.24 ? 320  TYR A CE1 1 
ATOM   801  C CE2 . TYR A 1 111 ? -5.972  -7.172  31.034  1.00 26.17 ? 320  TYR A CE2 1 
ATOM   802  C CZ  . TYR A 1 111 ? -7.179  -6.937  31.679  1.00 27.09 ? 320  TYR A CZ  1 
ATOM   803  O OH  . TYR A 1 111 ? -8.338  -6.824  30.933  1.00 30.09 ? 320  TYR A OH  1 
ATOM   804  N N   . GLY A 1 112 ? -0.813  -6.001  35.409  1.00 20.32 ? 321  GLY A N   1 
ATOM   805  C CA  . GLY A 1 112 ? 0.075   -6.051  36.572  1.00 19.08 ? 321  GLY A CA  1 
ATOM   806  C C   . GLY A 1 112 ? 0.717   -4.759  37.076  1.00 19.52 ? 321  GLY A C   1 
ATOM   807  O O   . GLY A 1 112 ? 1.064   -4.687  38.265  1.00 19.27 ? 321  GLY A O   1 
ATOM   808  N N   . VAL A 1 113 ? 0.875   -3.733  36.226  1.00 19.33 ? 322  VAL A N   1 
ATOM   809  C CA  . VAL A 1 113 ? 1.654   -2.537  36.644  1.00 19.32 ? 322  VAL A CA  1 
ATOM   810  C C   . VAL A 1 113 ? 1.106   -1.816  37.851  1.00 19.25 ? 322  VAL A C   1 
ATOM   811  O O   . VAL A 1 113 ? 1.875   -1.475  38.739  1.00 17.75 ? 322  VAL A O   1 
ATOM   812  C CB  . VAL A 1 113 ? 2.056   -1.527  35.506  1.00 18.48 ? 322  VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 113 ? 3.116   -2.172  34.582  1.00 20.08 ? 322  VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 113 ? 0.847   -0.979  34.737  1.00 20.35 ? 322  VAL A CG2 1 
ATOM   815  N N   . HIS A 1 114 ? -0.228  -1.606  37.904  1.00 19.16 ? 323  HIS A N   1 
ATOM   816  C CA  . HIS A 1 114 ? -0.833  -0.997  39.093  1.00 18.34 ? 323  HIS A CA  1 
ATOM   817  C C   . HIS A 1 114 ? -0.813  -1.834  40.374  1.00 17.99 ? 323  HIS A C   1 
ATOM   818  O O   . HIS A 1 114 ? -0.699  -1.264  41.448  1.00 19.77 ? 323  HIS A O   1 
ATOM   819  C CB  . HIS A 1 114 ? -2.262  -0.432  38.793  1.00 17.51 ? 323  HIS A CB  1 
ATOM   820  C CG  . HIS A 1 114 ? -2.233  0.820   37.965  1.00 17.87 ? 323  HIS A CG  1 
ATOM   821  N ND1 . HIS A 1 114 ? -2.193  0.808   36.581  1.00 18.66 ? 323  HIS A ND1 1 
ATOM   822  C CD2 . HIS A 1 114 ? -2.163  2.121   38.332  1.00 17.47 ? 323  HIS A CD2 1 
ATOM   823  C CE1 . HIS A 1 114 ? -2.138  2.050   36.135  1.00 18.22 ? 323  HIS A CE1 1 
ATOM   824  N NE2 . HIS A 1 114 ? -2.128  2.869   37.181  1.00 19.10 ? 323  HIS A NE2 1 
ATOM   825  N N   . GLU A 1 115 ? -0.969  -3.153  40.305  1.00 18.12 ? 324  GLU A N   1 
ATOM   826  C CA  . GLU A 1 115 ? -0.765  -3.973  41.488  1.00 19.42 ? 324  GLU A CA  1 
ATOM   827  C C   . GLU A 1 115 ? 0.679   -3.744  41.991  1.00 19.67 ? 324  GLU A C   1 
ATOM   828  O O   . GLU A 1 115 ? 0.921   -3.594  43.194  1.00 18.89 ? 324  GLU A O   1 
ATOM   829  C CB  . GLU A 1 115 ? -0.974  -5.459  41.161  1.00 19.33 ? 324  GLU A CB  1 
ATOM   830  C CG  . GLU A 1 115 ? -2.507  -5.829  40.972  1.00 20.99 ? 324  GLU A CG  1 
ATOM   831  C CD  . GLU A 1 115 ? -2.715  -7.262  40.502  1.00 23.15 ? 324  GLU A CD  1 
ATOM   832  O OE1 . GLU A 1 115 ? -1.750  -8.077  40.610  1.00 27.14 ? 324  GLU A OE1 1 
ATOM   833  O OE2 . GLU A 1 115 ? -3.823  -7.576  39.986  1.00 24.33 ? 324  GLU A OE2 1 
ATOM   834  N N   . ALA A 1 116 ? 1.629   -3.740  41.064  1.00 19.52 ? 325  ALA A N   1 
ATOM   835  C CA  . ALA A 1 116 ? 3.049   -3.567  41.471  1.00 20.89 ? 325  ALA A CA  1 
ATOM   836  C C   . ALA A 1 116 ? 3.245   -2.160  42.048  1.00 21.25 ? 325  ALA A C   1 
ATOM   837  O O   . ALA A 1 116 ? 3.916   -1.973  43.073  1.00 22.02 ? 325  ALA A O   1 
ATOM   838  C CB  . ALA A 1 116 ? 3.951   -3.803  40.277  1.00 19.84 ? 325  ALA A CB  1 
ATOM   839  N N   . ILE A 1 117 ? 2.613   -1.173  41.410  1.00 20.87 ? 326  ILE A N   1 
ATOM   840  C CA  . ILE A 1 117 ? 2.715   0.214   41.845  1.00 20.95 ? 326  ILE A CA  1 
ATOM   841  C C   . ILE A 1 117 ? 2.221   0.400   43.281  1.00 21.51 ? 326  ILE A C   1 
ATOM   842  O O   . ILE A 1 117 ? 2.875   1.050   44.091  1.00 21.10 ? 326  ILE A O   1 
ATOM   843  C CB  . ILE A 1 117 ? 1.912   1.142   40.942  1.00 20.67 ? 326  ILE A CB  1 
ATOM   844  C CG1 . ILE A 1 117 ? 2.569   1.267   39.551  1.00 21.15 ? 326  ILE A CG1 1 
ATOM   845  C CG2 . ILE A 1 117 ? 1.750   2.540   41.623  1.00 22.69 ? 326  ILE A CG2 1 
ATOM   846  C CD1 . ILE A 1 117 ? 1.814   2.198   38.584  1.00 20.50 ? 326  ILE A CD1 1 
ATOM   847  N N   . PHE A 1 118 ? 1.040   -0.151  43.574  1.00 20.99 ? 327  PHE A N   1 
ATOM   848  C CA  . PHE A 1 118 ? 0.437   0.037   44.878  1.00 21.13 ? 327  PHE A CA  1 
ATOM   849  C C   . PHE A 1 118 ? 1.142   -0.766  45.960  1.00 21.36 ? 327  PHE A C   1 
ATOM   850  O O   . PHE A 1 118 ? 1.152   -0.351  47.088  1.00 22.53 ? 327  PHE A O   1 
ATOM   851  C CB  . PHE A 1 118 ? -1.074  -0.294  44.817  1.00 21.09 ? 327  PHE A CB  1 
ATOM   852  C CG  . PHE A 1 118 ? -1.844  0.616   43.896  1.00 22.28 ? 327  PHE A CG  1 
ATOM   853  C CD1 . PHE A 1 118 ? -1.447  1.927   43.695  1.00 24.01 ? 327  PHE A CD1 1 
ATOM   854  C CD2 . PHE A 1 118 ? -2.995  0.168   43.262  1.00 26.87 ? 327  PHE A CD2 1 
ATOM   855  C CE1 . PHE A 1 118 ? -2.172  2.788   42.861  1.00 27.04 ? 327  PHE A CE1 1 
ATOM   856  C CE2 . PHE A 1 118 ? -3.708  1.017   42.422  1.00 26.37 ? 327  PHE A CE2 1 
ATOM   857  C CZ  . PHE A 1 118 ? -3.284  2.317   42.222  1.00 25.09 ? 327  PHE A CZ  1 
ATOM   858  N N   . ALA A 1 119 ? 1.734   -1.906  45.622  1.00 22.47 ? 328  ALA A N   1 
ATOM   859  C CA  . ALA A 1 119 ? 2.649   -2.625  46.562  1.00 22.96 ? 328  ALA A CA  1 
ATOM   860  C C   . ALA A 1 119 ? 3.910   -1.808  46.935  1.00 23.92 ? 328  ALA A C   1 
ATOM   861  O O   . ALA A 1 119 ? 4.297   -1.756  48.133  1.00 24.49 ? 328  ALA A O   1 
ATOM   862  C CB  . ALA A 1 119 ? 3.054   -3.990  45.965  1.00 22.67 ? 328  ALA A CB  1 
ATOM   863  N N   . MET A 1 120 ? 4.551   -1.193  45.938  1.00 24.41 ? 329  MET A N   1 
ATOM   864  C CA  . MET A 1 120 ? 5.767   -0.350  46.151  1.00 26.23 ? 329  MET A CA  1 
ATOM   865  C C   . MET A 1 120 ? 5.478   1.000   46.797  1.00 26.34 ? 329  MET A C   1 
ATOM   866  O O   . MET A 1 120 ? 6.336   1.572   47.492  1.00 25.91 ? 329  MET A O   1 
ATOM   867  C CB  . MET A 1 120 ? 6.521   -0.113  44.848  1.00 25.77 ? 329  MET A CB  1 
ATOM   868  C CG  . MET A 1 120 ? 7.115   -1.361  44.211  1.00 25.56 ? 329  MET A CG  1 
ATOM   869  S SD  . MET A 1 120 ? 8.052   -0.955  42.712  1.00 29.93 ? 329  MET A SD  1 
ATOM   870  C CE  . MET A 1 120 ? 6.740   -0.498  41.605  1.00 24.04 ? 329  MET A CE  1 
ATOM   871  N N   . LEU A 1 121 ? 4.262   1.507   46.582  1.00 26.69 ? 330  LEU A N   1 
ATOM   872  C CA  . LEU A 1 121 ? 3.760   2.670   47.314  1.00 26.97 ? 330  LEU A CA  1 
ATOM   873  C C   . LEU A 1 121 ? 3.983   2.555   48.833  1.00 26.37 ? 330  LEU A C   1 
ATOM   874  O O   . LEU A 1 121 ? 4.393   3.520   49.485  1.00 25.74 ? 330  LEU A O   1 
ATOM   875  C CB  . LEU A 1 121 ? 2.253   2.833   47.056  1.00 27.60 ? 330  LEU A CB  1 
ATOM   876  C CG  . LEU A 1 121 ? 1.629   4.210   46.905  1.00 31.31 ? 330  LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 121 ? 0.222   4.289   47.561  1.00 32.78 ? 330  LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 121 ? 2.495   5.309   47.428  1.00 33.92 ? 330  LEU A CD2 1 
ATOM   879  N N   . ALA A 1 122 ? 3.706   1.383   49.389  1.00 25.82 ? 331  ALA A N   1 
ATOM   880  C CA  . ALA A 1 122 ? 3.870   1.142   50.819  1.00 25.73 ? 331  ALA A CA  1 
ATOM   881  C C   . ALA A 1 122 ? 5.264   1.532   51.314  1.00 26.68 ? 331  ALA A C   1 
ATOM   882  O O   . ALA A 1 122 ? 5.406   2.009   52.425  1.00 27.32 ? 331  ALA A O   1 
ATOM   883  C CB  . ALA A 1 122 ? 3.609   -0.298  51.126  1.00 26.34 ? 331  ALA A CB  1 
ATOM   884  N N   . SER A 1 123 ? 6.276   1.333   50.472  1.00 26.74 ? 332  SER A N   1 
ATOM   885  C CA  . SER A 1 123 ? 7.671   1.679   50.771  1.00 27.30 ? 332  SER A CA  1 
ATOM   886  C C   . SER A 1 123 ? 7.900   3.143   51.118  1.00 28.19 ? 332  SER A C   1 
ATOM   887  O O   . SER A 1 123 ? 8.835   3.459   51.856  1.00 27.63 ? 332  SER A O   1 
ATOM   888  C CB  . SER A 1 123 ? 8.563   1.346   49.578  1.00 26.17 ? 332  SER A CB  1 
ATOM   889  O OG  . SER A 1 123 ? 8.474   -0.029  49.253  1.00 27.14 ? 332  SER A OG  1 
ATOM   890  N N   . ILE A 1 124 ? 7.071   4.034   50.560  1.00 28.36 ? 333  ILE A N   1 
ATOM   891  C CA  . ILE A 1 124 ? 7.278   5.481   50.714  1.00 29.15 ? 333  ILE A CA  1 
ATOM   892  C C   . ILE A 1 124 ? 6.183   6.144   51.549  1.00 29.76 ? 333  ILE A C   1 
ATOM   893  O O   . ILE A 1 124 ? 6.084   7.372   51.611  1.00 30.06 ? 333  ILE A O   1 
ATOM   894  C CB  . ILE A 1 124 ? 7.417   6.212   49.333  1.00 28.90 ? 333  ILE A CB  1 
ATOM   895  C CG1 . ILE A 1 124 ? 6.257   5.834   48.395  1.00 27.95 ? 333  ILE A CG1 1 
ATOM   896  C CG2 . ILE A 1 124 ? 8.757   5.910   48.708  1.00 28.05 ? 333  ILE A CG2 1 
ATOM   897  C CD1 . ILE A 1 124 ? 5.941   6.877   47.320  1.00 29.51 ? 333  ILE A CD1 1 
ATOM   898  N N   . VAL A 1 125 ? 5.374   5.310   52.178  1.00 31.57 ? 334  VAL A N   1 
ATOM   899  C CA  . VAL A 1 125 ? 4.213   5.728   52.957  1.00 33.64 ? 334  VAL A CA  1 
ATOM   900  C C   . VAL A 1 125 ? 4.451   5.480   54.460  1.00 34.36 ? 334  VAL A C   1 
ATOM   901  O O   . VAL A 1 125 ? 5.171   4.547   54.846  1.00 35.10 ? 334  VAL A O   1 
ATOM   902  C CB  . VAL A 1 125 ? 2.945   4.987   52.435  1.00 33.16 ? 334  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 125 ? 1.794   5.023   53.399  1.00 35.36 ? 334  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 125 ? 2.502   5.578   51.114  1.00 34.63 ? 334  VAL A CG2 1 
ATOM   905  N N   . ASN A 1 126 ? 3.920   6.373   55.290  1.00 34.56 ? 335  ASN A N   1 
ATOM   906  C CA  . ASN A 1 126 ? 3.602   6.042   56.673  1.00 35.16 ? 335  ASN A CA  1 
ATOM   907  C C   . ASN A 1 126 ? 2.148   6.503   56.939  1.00 35.67 ? 335  ASN A C   1 
ATOM   908  O O   . ASN A 1 126 ? 1.494   7.056   56.027  1.00 35.64 ? 335  ASN A O   1 
ATOM   909  C CB  . ASN A 1 126 ? 4.660   6.588   57.666  1.00 34.83 ? 335  ASN A CB  1 
ATOM   910  C CG  . ASN A 1 126 ? 4.669   8.109   57.756  1.00 34.46 ? 335  ASN A CG  1 
ATOM   911  O OD1 . ASN A 1 126 ? 3.649   8.756   57.537  1.00 34.71 ? 335  ASN A OD1 1 
ATOM   912  N ND2 . ASN A 1 126 ? 5.821   8.683   58.083  1.00 31.47 ? 335  ASN A ND2 1 
ATOM   913  N N   . LYS A 1 127 ? 1.634   6.264   58.151  1.00 35.98 ? 336  LYS A N   1 
ATOM   914  C CA  . LYS A 1 127 ? 0.258   6.638   58.517  1.00 36.54 ? 336  LYS A CA  1 
ATOM   915  C C   . LYS A 1 127 ? -0.046  8.121   58.265  1.00 35.87 ? 336  LYS A C   1 
ATOM   916  O O   . LYS A 1 127 ? -1.208  8.507   58.161  1.00 35.25 ? 336  LYS A O   1 
ATOM   917  C CB  . LYS A 1 127 ? -0.009  6.307   59.998  1.00 37.08 ? 336  LYS A CB  1 
ATOM   918  C CG  . LYS A 1 127 ? 0.807   7.155   60.977  1.00 37.96 ? 336  LYS A CG  1 
ATOM   919  C CD  . LYS A 1 127 ? 0.430   6.846   62.448  1.00 38.90 ? 336  LYS A CD  1 
ATOM   920  C CE  . LYS A 1 127 ? 0.643   8.081   63.339  1.00 42.57 ? 336  LYS A CE  1 
ATOM   921  N NZ  . LYS A 1 127 ? 2.081   8.498   63.384  1.00 44.90 ? 336  LYS A NZ  1 
ATOM   922  N N   . ASP A 1 128 ? 1.016   8.928   58.168  1.00 35.71 ? 337  ASP A N   1 
ATOM   923  C CA  . ASP A 1 128 ? 0.938   10.396  58.069  1.00 35.75 ? 337  ASP A CA  1 
ATOM   924  C C   . ASP A 1 128 ? 0.967   10.964  56.639  1.00 35.06 ? 337  ASP A C   1 
ATOM   925  O O   . ASP A 1 128 ? 0.633   12.132  56.421  1.00 35.00 ? 337  ASP A O   1 
ATOM   926  C CB  . ASP A 1 128 ? 2.128   11.017  58.806  1.00 36.15 ? 337  ASP A CB  1 
ATOM   927  C CG  . ASP A 1 128 ? 1.980   10.988  60.326  1.00 39.08 ? 337  ASP A CG  1 
ATOM   928  O OD1 . ASP A 1 128 ? 0.835   10.873  60.827  1.00 38.33 ? 337  ASP A OD1 1 
ATOM   929  O OD2 . ASP A 1 128 ? 3.040   11.098  61.005  1.00 41.16 ? 337  ASP A OD2 1 
ATOM   930  N N   . GLY A 1 129 ? 1.420   10.174  55.670  1.00 34.31 ? 338  GLY A N   1 
ATOM   931  C CA  . GLY A 1 129 ? 1.657   10.740  54.331  1.00 33.53 ? 338  GLY A CA  1 
ATOM   932  C C   . GLY A 1 129 ? 2.665   9.979   53.505  1.00 32.71 ? 338  GLY A C   1 
ATOM   933  O O   . GLY A 1 129 ? 2.999   8.848   53.827  1.00 31.92 ? 338  GLY A O   1 
ATOM   934  N N   . LEU A 1 130 ? 3.132   10.586  52.418  1.00 32.43 ? 339  LEU A N   1 
ATOM   935  C CA  . LEU A 1 130 ? 4.003   9.862   51.494  1.00 32.91 ? 339  LEU A CA  1 
ATOM   936  C C   . LEU A 1 130 ? 5.111   10.723  50.923  1.00 32.25 ? 339  LEU A C   1 
ATOM   937  O O   . LEU A 1 130 ? 4.899   11.903  50.654  1.00 32.35 ? 339  LEU A O   1 
ATOM   938  C CB  . LEU A 1 130 ? 3.171   9.213   50.375  1.00 32.83 ? 339  LEU A CB  1 
ATOM   939  C CG  . LEU A 1 130 ? 3.014   9.764   48.952  1.00 35.83 ? 339  LEU A CG  1 
ATOM   940  C CD1 . LEU A 1 130 ? 2.342   8.701   48.109  1.00 38.15 ? 339  LEU A CD1 1 
ATOM   941  C CD2 . LEU A 1 130 ? 2.214   11.017  48.882  1.00 37.56 ? 339  LEU A CD2 1 
ATOM   942  N N   . LEU A 1 131 ? 6.288   10.130  50.744  1.00 32.10 ? 340  LEU A N   1 
ATOM   943  C CA  . LEU A 1 131 ? 7.391   10.805  50.044  1.00 31.88 ? 340  LEU A CA  1 
ATOM   944  C C   . LEU A 1 131 ? 7.114   11.010  48.561  1.00 32.50 ? 340  LEU A C   1 
ATOM   945  O O   . LEU A 1 131 ? 6.661   10.086  47.885  1.00 32.05 ? 340  LEU A O   1 
ATOM   946  C CB  . LEU A 1 131 ? 8.709   10.026  50.203  1.00 31.65 ? 340  LEU A CB  1 
ATOM   947  C CG  . LEU A 1 131 ? 9.317   9.975   51.604  1.00 32.16 ? 340  LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 131 ? 10.528  9.046   51.609  1.00 34.86 ? 340  LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 131 ? 9.731   11.378  52.054  1.00 30.83 ? 340  LEU A CD2 1 
ATOM   950  N N   . VAL A 1 132 ? 7.419   12.204  48.054  1.00 32.62 ? 341  VAL A N   1 
ATOM   951  C CA  . VAL A 1 132 ? 7.319   12.498  46.630  1.00 33.90 ? 341  VAL A CA  1 
ATOM   952  C C   . VAL A 1 132 ? 8.657   13.019  46.084  1.00 35.07 ? 341  VAL A C   1 
ATOM   953  O O   . VAL A 1 132 ? 9.573   13.353  46.863  1.00 34.61 ? 341  VAL A O   1 
ATOM   954  C CB  . VAL A 1 132 ? 6.115   13.420  46.285  1.00 33.44 ? 341  VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 132 ? 4.799   12.724  46.622  1.00 33.32 ? 341  VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 132 ? 6.204   14.767  47.020  1.00 35.57 ? 341  VAL A CG2 1 
ATOM   957  N N   . ALA A 1 133 ? 8.771   13.051  44.758  1.00 36.06 ? 342  ALA A N   1 
ATOM   958  C CA  . ALA A 1 133 ? 9.968   13.547  44.059  1.00 37.42 ? 342  ALA A CA  1 
ATOM   959  C C   . ALA A 1 133 ? 11.299  13.099  44.660  1.00 38.35 ? 342  ALA A C   1 
ATOM   960  O O   . ALA A 1 133 ? 12.109  13.915  45.101  1.00 38.76 ? 342  ALA A O   1 
ATOM   961  C CB  . ALA A 1 133 ? 9.913   15.068  43.930  1.00 37.49 ? 342  ALA A CB  1 
ATOM   962  N N   . ASN A 1 134 ? 11.514  11.792  44.688  1.00 39.69 ? 343  ASN A N   1 
ATOM   963  C CA  . ASN A 1 134 ? 12.788  11.210  45.123  1.00 40.91 ? 343  ASN A CA  1 
ATOM   964  C C   . ASN A 1 134 ? 13.152  11.538  46.574  1.00 40.61 ? 343  ASN A C   1 
ATOM   965  O O   . ASN A 1 134 ? 14.336  11.672  46.925  1.00 40.99 ? 343  ASN A O   1 
ATOM   966  C CB  . ASN A 1 134 ? 13.907  11.654  44.173  1.00 41.80 ? 343  ASN A CB  1 
ATOM   967  C CG  . ASN A 1 134 ? 14.709  10.493  43.629  1.00 44.43 ? 343  ASN A CG  1 
ATOM   968  O OD1 . ASN A 1 134 ? 14.245  9.344   43.620  1.00 46.33 ? 343  ASN A OD1 1 
ATOM   969  N ND2 . ASN A 1 134 ? 15.927  10.787  43.154  1.00 46.29 ? 343  ASN A ND2 1 
ATOM   970  N N   . GLY A 1 135 ? 12.126  11.664  47.412  1.00 40.02 ? 344  GLY A N   1 
ATOM   971  C CA  . GLY A 1 135 ? 12.296  12.010  48.813  1.00 39.55 ? 344  GLY A CA  1 
ATOM   972  C C   . GLY A 1 135 ? 12.403  13.494  49.112  1.00 39.16 ? 344  GLY A C   1 
ATOM   973  O O   . GLY A 1 135 ? 12.557  13.864  50.269  1.00 40.02 ? 344  GLY A O   1 
ATOM   974  N N   . SER A 1 136 ? 12.310  14.351  48.097  1.00 38.67 ? 345  SER A N   1 
ATOM   975  C CA  . SER A 1 136 ? 12.396  15.818  48.303  1.00 38.23 ? 345  SER A CA  1 
ATOM   976  C C   . SER A 1 136 ? 11.187  16.416  49.022  1.00 37.35 ? 345  SER A C   1 
ATOM   977  O O   . SER A 1 136 ? 11.260  17.534  49.559  1.00 37.29 ? 345  SER A O   1 
ATOM   978  C CB  . SER A 1 136 ? 12.523  16.538  46.966  1.00 38.14 ? 345  SER A CB  1 
ATOM   979  O OG  . SER A 1 136 ? 13.601  16.024  46.227  1.00 41.93 ? 345  SER A OG  1 
ATOM   980  N N   . GLY A 1 137 ? 10.064  15.698  48.990  1.00 35.61 ? 346  GLY A N   1 
ATOM   981  C CA  . GLY A 1 137 ? 8.789   16.225  49.481  1.00 33.35 ? 346  GLY A CA  1 
ATOM   982  C C   . GLY A 1 137 ? 8.033   15.168  50.239  1.00 32.34 ? 346  GLY A C   1 
ATOM   983  O O   . GLY A 1 137 ? 8.197   13.973  49.987  1.00 32.19 ? 346  GLY A O   1 
ATOM   984  N N   . PHE A 1 138 ? 7.214   15.606  51.181  1.00 31.59 ? 347  PHE A N   1 
ATOM   985  C CA  . PHE A 1 138 ? 6.338   14.722  51.921  1.00 31.71 ? 347  PHE A CA  1 
ATOM   986  C C   . PHE A 1 138 ? 4.919   15.296  51.855  1.00 31.42 ? 347  PHE A C   1 
ATOM   987  O O   . PHE A 1 138 ? 4.681   16.416  52.298  1.00 31.94 ? 347  PHE A O   1 
ATOM   988  C CB  . PHE A 1 138 ? 6.851   14.577  53.365  1.00 32.03 ? 347  PHE A CB  1 
ATOM   989  C CG  . PHE A 1 138 ? 6.036   13.648  54.224  1.00 33.58 ? 347  PHE A CG  1 
ATOM   990  C CD1 . PHE A 1 138 ? 6.327   12.286  54.280  1.00 34.27 ? 347  PHE A CD1 1 
ATOM   991  C CD2 . PHE A 1 138 ? 4.980   14.134  54.987  1.00 34.39 ? 347  PHE A CD2 1 
ATOM   992  C CE1 . PHE A 1 138 ? 5.586   11.438  55.068  1.00 33.22 ? 347  PHE A CE1 1 
ATOM   993  C CE2 . PHE A 1 138 ? 4.231   13.281  55.784  1.00 34.50 ? 347  PHE A CE2 1 
ATOM   994  C CZ  . PHE A 1 138 ? 4.539   11.928  55.824  1.00 33.68 ? 347  PHE A CZ  1 
ATOM   995  N N   . VAL A 1 139 ? 3.988   14.542  51.278  1.00 30.29 ? 348  VAL A N   1 
ATOM   996  C CA  . VAL A 1 139 ? 2.623   15.015  51.118  1.00 30.23 ? 348  VAL A CA  1 
ATOM   997  C C   . VAL A 1 139 ? 1.794   14.363  52.190  1.00 30.73 ? 348  VAL A C   1 
ATOM   998  O O   . VAL A 1 139 ? 1.763   13.145  52.304  1.00 30.24 ? 348  VAL A O   1 
ATOM   999  C CB  . VAL A 1 139 ? 2.069   14.680  49.691  1.00 30.06 ? 348  VAL A CB  1 
ATOM   1000 C CG1 . VAL A 1 139 ? 0.687   15.249  49.469  1.00 28.72 ? 348  VAL A CG1 1 
ATOM   1001 C CG2 . VAL A 1 139 ? 3.007   15.235  48.642  1.00 29.90 ? 348  VAL A CG2 1 
ATOM   1002 N N   . THR A 1 140 ? 1.117   15.179  52.999  1.00 31.78 ? 349  THR A N   1 
ATOM   1003 C CA  . THR A 1 140 ? 0.410   14.647  54.143  1.00 32.41 ? 349  THR A CA  1 
ATOM   1004 C C   . THR A 1 140 ? -0.874  13.963  53.708  1.00 33.31 ? 349  THR A C   1 
ATOM   1005 O O   . THR A 1 140 ? -1.489  14.358  52.727  1.00 33.98 ? 349  THR A O   1 
ATOM   1006 C CB  . THR A 1 140 ? 0.091   15.742  55.190  1.00 32.97 ? 349  THR A CB  1 
ATOM   1007 O OG1 . THR A 1 140 ? -0.918  16.622  54.680  1.00 31.42 ? 349  THR A OG1 1 
ATOM   1008 C CG2 . THR A 1 140 ? 1.361   16.522  55.559  1.00 31.02 ? 349  THR A CG2 1 
ATOM   1009 N N   . ARG A 1 141 ? -1.270  12.949  54.465  1.00 33.89 ? 350  ARG A N   1 
ATOM   1010 C CA  . ARG A 1 141 ? -2.495  12.203  54.210  1.00 34.59 ? 350  ARG A CA  1 
ATOM   1011 C C   . ARG A 1 141 ? -3.733  13.043  54.497  1.00 35.21 ? 350  ARG A C   1 
ATOM   1012 O O   . ARG A 1 141 ? -4.756  12.897  53.810  1.00 35.14 ? 350  ARG A O   1 
ATOM   1013 C CB  . ARG A 1 141 ? -2.514  10.948  55.078  1.00 34.30 ? 350  ARG A CB  1 
ATOM   1014 C CG  . ARG A 1 141 ? -3.572  9.917   54.718  1.00 34.20 ? 350  ARG A CG  1 
ATOM   1015 C CD  . ARG A 1 141 ? -3.401  8.733   55.660  1.00 36.00 ? 350  ARG A CD  1 
ATOM   1016 N NE  . ARG A 1 141 ? -4.360  7.663   55.429  1.00 35.43 ? 350  ARG A NE  1 
ATOM   1017 C CZ  . ARG A 1 141 ? -4.410  6.550   56.152  1.00 37.03 ? 350  ARG A CZ  1 
ATOM   1018 N NH1 . ARG A 1 141 ? -3.526  6.342   57.133  1.00 37.29 ? 350  ARG A NH1 1 
ATOM   1019 N NH2 . ARG A 1 141 ? -5.336  5.638   55.886  1.00 36.98 ? 350  ARG A NH2 1 
ATOM   1020 N N   . GLU A 1 142 ? -3.652  13.905  55.518  1.00 35.69 ? 351  GLU A N   1 
ATOM   1021 C CA  . GLU A 1 142 ? -4.757  14.813  55.804  1.00 36.85 ? 351  GLU A CA  1 
ATOM   1022 C C   . GLU A 1 142 ? -5.076  15.731  54.632  1.00 36.16 ? 351  GLU A C   1 
ATOM   1023 O O   . GLU A 1 142 ? -6.240  15.891  54.279  1.00 36.75 ? 351  GLU A O   1 
ATOM   1024 C CB  . GLU A 1 142 ? -4.552  15.603  57.111  1.00 37.75 ? 351  GLU A CB  1 
ATOM   1025 C CG  . GLU A 1 142 ? -4.907  14.802  58.402  1.00 41.39 ? 351  GLU A CG  1 
ATOM   1026 C CD  . GLU A 1 142 ? -6.045  13.749  58.235  1.00 46.27 ? 351  GLU A CD  1 
ATOM   1027 O OE1 . GLU A 1 142 ? -7.255  14.126  58.142  1.00 46.42 ? 351  GLU A OE1 1 
ATOM   1028 O OE2 . GLU A 1 142 ? -5.716  12.531  58.225  1.00 47.56 ? 351  GLU A OE2 1 
ATOM   1029 N N   . PHE A 1 143 ? -4.055  16.312  54.012  1.00 35.40 ? 352  PHE A N   1 
ATOM   1030 C CA  . PHE A 1 143 ? -4.265  17.152  52.817  1.00 34.96 ? 352  PHE A CA  1 
ATOM   1031 C C   . PHE A 1 143 ? -5.003  16.374  51.688  1.00 35.27 ? 352  PHE A C   1 
ATOM   1032 O O   . PHE A 1 143 ? -5.998  16.847  51.122  1.00 34.56 ? 352  PHE A O   1 
ATOM   1033 C CB  . PHE A 1 143 ? -2.911  17.702  52.350  1.00 34.59 ? 352  PHE A CB  1 
ATOM   1034 C CG  . PHE A 1 143 ? -2.934  18.405  51.013  1.00 34.36 ? 352  PHE A CG  1 
ATOM   1035 C CD1 . PHE A 1 143 ? -3.846  19.440  50.745  1.00 33.49 ? 352  PHE A CD1 1 
ATOM   1036 C CD2 . PHE A 1 143 ? -2.010  18.057  50.034  1.00 33.73 ? 352  PHE A CD2 1 
ATOM   1037 C CE1 . PHE A 1 143 ? -3.842  20.098  49.501  1.00 34.56 ? 352  PHE A CE1 1 
ATOM   1038 C CE2 . PHE A 1 143 ? -1.996  18.705  48.778  1.00 33.04 ? 352  PHE A CE2 1 
ATOM   1039 C CZ  . PHE A 1 143 ? -2.911  19.724  48.513  1.00 34.45 ? 352  PHE A CZ  1 
ATOM   1040 N N   . LEU A 1 144 ? -4.531  15.164  51.395  1.00 35.88 ? 353  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 144 ? -5.131  14.339  50.362  1.00 36.79 ? 353  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 144 ? -6.596  13.972  50.688  1.00 37.77 ? 353  LEU A C   1 
ATOM   1043 O O   . LEU A 1 144 ? -7.422  13.889  49.787  1.00 37.98 ? 353  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 144 ? -4.262  13.105  50.108  1.00 37.29 ? 353  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 144 ? -3.059  13.139  49.135  1.00 37.85 ? 353  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 144 ? -2.687  14.511  48.577  1.00 36.52 ? 353  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 144 ? -1.840  12.414  49.723  1.00 37.01 ? 353  LEU A CD2 1 
ATOM   1048 N N   . ARG A 1 145 ? -6.908  13.767  51.968  1.00 38.47 ? 354  ARG A N   1 
ATOM   1049 C CA  . ARG A 1 145 ? -8.298  13.548  52.427  1.00 39.93 ? 354  ARG A CA  1 
ATOM   1050 C C   . ARG A 1 145 ? -9.189  14.783  52.213  1.00 40.07 ? 354  ARG A C   1 
ATOM   1051 O O   . ARG A 1 145 ? -10.428 14.671  52.134  1.00 40.11 ? 354  ARG A O   1 
ATOM   1052 C CB  . ARG A 1 145 ? -8.321  13.141  53.910  1.00 40.18 ? 354  ARG A CB  1 
ATOM   1053 C CG  . ARG A 1 145 ? -8.074  11.667  54.158  1.00 41.93 ? 354  ARG A CG  1 
ATOM   1054 C CD  . ARG A 1 145 ? -7.632  11.410  55.596  1.00 44.27 ? 354  ARG A CD  1 
ATOM   1055 N NE  . ARG A 1 145 ? -7.788  10.008  56.002  1.00 45.34 ? 354  ARG A NE  1 
ATOM   1056 C CZ  . ARG A 1 145 ? -7.065  9.422   56.951  1.00 46.07 ? 354  ARG A CZ  1 
ATOM   1057 N NH1 . ARG A 1 145 ? -6.118  10.106  57.578  1.00 48.10 ? 354  ARG A NH1 1 
ATOM   1058 N NH2 . ARG A 1 145 ? -7.271  8.153   57.269  1.00 45.35 ? 354  ARG A NH2 1 
ATOM   1059 N N   . SER A 1 146 ? -8.540  15.943  52.077  1.00 39.88 ? 355  SER A N   1 
ATOM   1060 C CA  . SER A 1 146 ? -9.223  17.217  51.953  1.00 40.01 ? 355  SER A CA  1 
ATOM   1061 C C   . SER A 1 146 ? -9.619  17.596  50.516  1.00 40.51 ? 355  SER A C   1 
ATOM   1062 O O   . SER A 1 146 ? -10.306 18.596  50.318  1.00 40.43 ? 355  SER A O   1 
ATOM   1063 C CB  . SER A 1 146 ? -8.369  18.330  52.568  1.00 40.12 ? 355  SER A CB  1 
ATOM   1064 O OG  . SER A 1 146 ? -7.400  18.792  51.654  1.00 38.46 ? 355  SER A OG  1 
ATOM   1065 N N   . LEU A 1 147 ? -9.197  16.812  49.521  1.00 40.51 ? 356  LEU A N   1 
ATOM   1066 C CA  . LEU A 1 147 ? -9.562  17.098  48.138  1.00 40.95 ? 356  LEU A CA  1 
ATOM   1067 C C   . LEU A 1 147 ? -11.009 16.668  47.859  1.00 42.17 ? 356  LEU A C   1 
ATOM   1068 O O   . LEU A 1 147 ? -11.585 15.881  48.625  1.00 42.49 ? 356  LEU A O   1 
ATOM   1069 C CB  . LEU A 1 147 ? -8.583  16.413  47.171  1.00 40.65 ? 356  LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 147 ? -7.070  16.537  47.431  1.00 38.93 ? 356  LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 147 ? -6.299  15.605  46.513  1.00 38.26 ? 356  LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 147 ? -6.568  17.984  47.320  1.00 35.39 ? 356  LEU A CD2 1 
ATOM   1073 N N   . ARG A 1 148 ? -11.583 17.174  46.765  1.00 43.52 ? 357  ARG A N   1 
ATOM   1074 C CA  . ARG A 1 148 ? -12.938 16.811  46.301  1.00 44.93 ? 357  ARG A CA  1 
ATOM   1075 C C   . ARG A 1 148 ? -13.201 15.312  46.257  1.00 45.66 ? 357  ARG A C   1 
ATOM   1076 O O   . ARG A 1 148 ? -12.315 14.534  45.895  1.00 45.62 ? 357  ARG A O   1 
ATOM   1077 C CB  . ARG A 1 148 ? -13.166 17.310  44.872  1.00 45.16 ? 357  ARG A CB  1 
ATOM   1078 C CG  . ARG A 1 148 ? -13.317 18.769  44.726  1.00 46.70 ? 357  ARG A CG  1 
ATOM   1079 C CD  . ARG A 1 148 ? -14.475 19.064  43.800  1.00 47.03 ? 357  ARG A CD  1 
ATOM   1080 N NE  . ARG A 1 148 ? -14.103 18.998  42.391  1.00 47.05 ? 357  ARG A NE  1 
ATOM   1081 C CZ  . ARG A 1 148 ? -14.333 17.960  41.594  1.00 47.17 ? 357  ARG A CZ  1 
ATOM   1082 N NH1 . ARG A 1 148 ? -14.917 16.858  42.057  1.00 46.97 ? 357  ARG A NH1 1 
ATOM   1083 N NH2 . ARG A 1 148 ? -13.970 18.025  40.323  1.00 48.88 ? 357  ARG A NH2 1 
ATOM   1084 N N   . LYS A 1 149 ? -14.455 14.937  46.514  1.00 46.47 ? 358  LYS A N   1 
ATOM   1085 C CA  . LYS A 1 149 ? -14.857 13.546  46.751  1.00 47.56 ? 358  LYS A CA  1 
ATOM   1086 C C   . LYS A 1 149 ? -14.254 12.472  45.853  1.00 47.49 ? 358  LYS A C   1 
ATOM   1087 O O   . LYS A 1 149 ? -13.709 11.482  46.391  1.00 48.71 ? 358  LYS A O   1 
ATOM   1088 C CB  . LYS A 1 149 ? -16.385 13.373  46.781  1.00 48.12 ? 358  LYS A CB  1 
ATOM   1089 C CG  . LYS A 1 149 ? -16.837 12.118  47.548  1.00 49.63 ? 358  LYS A CG  1 
ATOM   1090 C CD  . LYS A 1 149 ? -16.560 12.280  49.040  1.00 53.81 ? 358  LYS A CD  1 
ATOM   1091 C CE  . LYS A 1 149 ? -16.708 10.970  49.807  1.00 55.48 ? 358  LYS A CE  1 
ATOM   1092 N NZ  . LYS A 1 149 ? -15.735 10.889  50.946  1.00 57.04 ? 358  LYS A NZ  1 
ATOM   1093 N N   . PRO A 1 150 ? -14.329 12.637  44.504  1.00 46.66 ? 359  PRO A N   1 
ATOM   1094 C CA  . PRO A 1 150 ? -13.844 11.480  43.743  1.00 45.44 ? 359  PRO A CA  1 
ATOM   1095 C C   . PRO A 1 150 ? -12.368 11.206  44.032  1.00 44.58 ? 359  PRO A C   1 
ATOM   1096 O O   . PRO A 1 150 ? -11.981 10.048  44.154  1.00 44.08 ? 359  PRO A O   1 
ATOM   1097 C CB  . PRO A 1 150 ? -14.056 11.890  42.278  1.00 45.28 ? 359  PRO A CB  1 
ATOM   1098 C CG  . PRO A 1 150 ? -14.145 13.364  42.300  1.00 45.79 ? 359  PRO A CG  1 
ATOM   1099 C CD  . PRO A 1 150 ? -14.760 13.739  43.621  1.00 46.24 ? 359  PRO A CD  1 
ATOM   1100 N N   . PHE A 1 151 ? -11.588 12.276  44.184  1.00 43.81 ? 360  PHE A N   1 
ATOM   1101 C CA  . PHE A 1 151 ? -10.126 12.206  44.274  1.00 43.52 ? 360  PHE A CA  1 
ATOM   1102 C C   . PHE A 1 151 ? -9.658  11.691  45.630  1.00 43.85 ? 360  PHE A C   1 
ATOM   1103 O O   . PHE A 1 151 ? -8.886  10.735  45.703  1.00 44.38 ? 360  PHE A O   1 
ATOM   1104 C CB  . PHE A 1 151 ? -9.507  13.562  43.909  1.00 42.82 ? 360  PHE A CB  1 
ATOM   1105 C CG  . PHE A 1 151 ? -9.902  14.050  42.533  1.00 42.53 ? 360  PHE A CG  1 
ATOM   1106 C CD1 . PHE A 1 151 ? -9.473  13.378  41.394  1.00 41.71 ? 360  PHE A CD1 1 
ATOM   1107 C CD2 . PHE A 1 151 ? -10.723 15.159  42.376  1.00 42.06 ? 360  PHE A CD2 1 
ATOM   1108 C CE1 . PHE A 1 151 ? -9.859  13.801  40.121  1.00 41.16 ? 360  PHE A CE1 1 
ATOM   1109 C CE2 . PHE A 1 151 ? -11.107 15.603  41.100  1.00 43.08 ? 360  PHE A CE2 1 
ATOM   1110 C CZ  . PHE A 1 151 ? -10.673 14.912  39.968  1.00 42.65 ? 360  PHE A CZ  1 
ATOM   1111 N N   . SER A 1 152 ? -10.167 12.287  46.703  1.00 43.87 ? 361  SER A N   1 
ATOM   1112 C CA  . SER A 1 152 ? -9.918  11.799  48.051  1.00 43.93 ? 361  SER A CA  1 
ATOM   1113 C C   . SER A 1 152 ? -10.252 10.310  48.157  1.00 43.75 ? 361  SER A C   1 
ATOM   1114 O O   . SER A 1 152 ? -9.528  9.541   48.802  1.00 43.73 ? 361  SER A O   1 
ATOM   1115 C CB  . SER A 1 152 ? -10.725 12.620  49.062  1.00 44.49 ? 361  SER A CB  1 
ATOM   1116 O OG  . SER A 1 152 ? -12.095 12.727  48.657  1.00 45.12 ? 361  SER A OG  1 
ATOM   1117 N N   . ASP A 1 153 ? -11.336 9.903   47.503  1.00 43.40 ? 362  ASP A N   1 
ATOM   1118 C CA  . ASP A 1 153 ? -11.772 8.523   47.553  1.00 43.71 ? 362  ASP A CA  1 
ATOM   1119 C C   . ASP A 1 153 ? -10.882 7.535   46.766  1.00 42.89 ? 362  ASP A C   1 
ATOM   1120 O O   . ASP A 1 153 ? -10.876 6.342   47.069  1.00 42.76 ? 362  ASP A O   1 
ATOM   1121 C CB  . ASP A 1 153 ? -13.241 8.402   47.129  1.00 44.26 ? 362  ASP A CB  1 
ATOM   1122 C CG  . ASP A 1 153 ? -14.223 8.567   48.315  1.00 47.59 ? 362  ASP A CG  1 
ATOM   1123 O OD1 . ASP A 1 153 ? -13.871 9.191   49.352  1.00 49.31 ? 362  ASP A OD1 1 
ATOM   1124 O OD2 . ASP A 1 153 ? -15.367 8.063   48.205  1.00 51.12 ? 362  ASP A OD2 1 
ATOM   1125 N N   . ILE A 1 154 ? -10.130 8.004   45.772  1.00 42.21 ? 363  ILE A N   1 
ATOM   1126 C CA  . ILE A 1 154 ? -9.202  7.080   45.073  1.00 41.83 ? 363  ILE A CA  1 
ATOM   1127 C C   . ILE A 1 154 ? -7.913  6.873   45.866  1.00 40.41 ? 363  ILE A C   1 
ATOM   1128 O O   . ILE A 1 154 ? -7.347  5.786   45.863  1.00 40.11 ? 363  ILE A O   1 
ATOM   1129 C CB  . ILE A 1 154 ? -8.887  7.485   43.590  1.00 41.65 ? 363  ILE A CB  1 
ATOM   1130 C CG1 . ILE A 1 154 ? -7.904  8.655   43.553  1.00 42.36 ? 363  ILE A CG1 1 
ATOM   1131 C CG2 . ILE A 1 154 ? -10.191 7.754   42.802  1.00 41.93 ? 363  ILE A CG2 1 
ATOM   1132 C CD1 . ILE A 1 154 ? -7.849  9.399   42.242  1.00 43.12 ? 363  ILE A CD1 1 
ATOM   1133 N N   . ILE A 1 155 ? -7.480  7.913   46.568  1.00 39.36 ? 364  ILE A N   1 
ATOM   1134 C CA  . ILE A 1 155 ? -6.175  7.911   47.233  1.00 38.55 ? 364  ILE A CA  1 
ATOM   1135 C C   . ILE A 1 155 ? -6.186  7.155   48.552  1.00 37.83 ? 364  ILE A C   1 
ATOM   1136 O O   . ILE A 1 155 ? -5.262  6.377   48.828  1.00 37.72 ? 364  ILE A O   1 
ATOM   1137 C CB  . ILE A 1 155 ? -5.652  9.348   47.442  1.00 38.76 ? 364  ILE A CB  1 
ATOM   1138 C CG1 . ILE A 1 155 ? -5.574  10.066  46.092  1.00 38.97 ? 364  ILE A CG1 1 
ATOM   1139 C CG2 . ILE A 1 155 ? -4.274  9.332   48.147  1.00 38.20 ? 364  ILE A CG2 1 
ATOM   1140 C CD1 . ILE A 1 155 ? -5.383  11.561  46.189  1.00 40.61 ? 364  ILE A CD1 1 
ATOM   1141 N N   . GLU A 1 156 ? -7.232  7.373   49.350  1.00 37.44 ? 365  GLU A N   1 
ATOM   1142 C CA  . GLU A 1 156 ? -7.307  6.813   50.713  1.00 37.17 ? 365  GLU A CA  1 
ATOM   1143 C C   . GLU A 1 156 ? -7.203  5.278   50.853  1.00 36.26 ? 365  GLU A C   1 
ATOM   1144 O O   . GLU A 1 156 ? -6.463  4.804   51.722  1.00 36.11 ? 365  GLU A O   1 
ATOM   1145 C CB  . GLU A 1 156 ? -8.505  7.375   51.498  1.00 37.55 ? 365  GLU A CB  1 
ATOM   1146 C CG  . GLU A 1 156 ? -8.698  6.806   52.923  1.00 38.20 ? 365  GLU A CG  1 
ATOM   1147 C CD  . GLU A 1 156 ? -7.548  7.101   53.926  1.00 41.38 ? 365  GLU A CD  1 
ATOM   1148 O OE1 . GLU A 1 156 ? -6.691  8.003   53.710  1.00 40.31 ? 365  GLU A OE1 1 
ATOM   1149 O OE2 . GLU A 1 156 ? -7.526  6.409   54.972  1.00 41.95 ? 365  GLU A OE2 1 
ATOM   1150 N N   . PRO A 1 157 ? -7.915  4.501   50.011  1.00 35.17 ? 366  PRO A N   1 
ATOM   1151 C CA  . PRO A 1 157 ? -7.735  3.034   50.096  1.00 34.78 ? 366  PRO A CA  1 
ATOM   1152 C C   . PRO A 1 157 ? -6.295  2.535   49.861  1.00 33.83 ? 366  PRO A C   1 
ATOM   1153 O O   . PRO A 1 157 ? -5.929  1.463   50.373  1.00 33.19 ? 366  PRO A O   1 
ATOM   1154 C CB  . PRO A 1 157 ? -8.650  2.489   48.999  1.00 34.88 ? 366  PRO A CB  1 
ATOM   1155 C CG  . PRO A 1 157 ? -9.598  3.610   48.674  1.00 35.87 ? 366  PRO A CG  1 
ATOM   1156 C CD  . PRO A 1 157 ? -8.885  4.882   48.968  1.00 35.42 ? 366  PRO A CD  1 
ATOM   1157 N N   . LYS A 1 158 ? -5.496  3.287   49.101  1.00 32.63 ? 367  LYS A N   1 
ATOM   1158 C CA  . LYS A 1 158 ? -4.085  2.899   48.848  1.00 32.11 ? 367  LYS A CA  1 
ATOM   1159 C C   . LYS A 1 158 ? -3.275  3.033   50.117  1.00 32.36 ? 367  LYS A C   1 
ATOM   1160 O O   . LYS A 1 158 ? -2.471  2.167   50.439  1.00 32.28 ? 367  LYS A O   1 
ATOM   1161 C CB  . LYS A 1 158 ? -3.450  3.732   47.737  1.00 32.29 ? 367  LYS A CB  1 
ATOM   1162 C CG  . LYS A 1 158 ? -3.825  3.301   46.320  1.00 31.67 ? 367  LYS A CG  1 
ATOM   1163 C CD  . LYS A 1 158 ? -5.306  3.508   46.072  1.00 32.92 ? 367  LYS A CD  1 
ATOM   1164 C CE  . LYS A 1 158 ? -5.703  3.328   44.638  1.00 32.28 ? 367  LYS A CE  1 
ATOM   1165 N NZ  . LYS A 1 158 ? -7.180  3.564   44.492  1.00 34.90 ? 367  LYS A NZ  1 
ATOM   1166 N N   . PHE A 1 159 ? -3.504  4.125   50.841  1.00 32.74 ? 368  PHE A N   1 
ATOM   1167 C CA  . PHE A 1 159 ? -2.994  4.288   52.217  1.00 32.84 ? 368  PHE A CA  1 
ATOM   1168 C C   . PHE A 1 159 ? -3.371  3.159   53.162  1.00 33.05 ? 368  PHE A C   1 
ATOM   1169 O O   . PHE A 1 159 ? -2.501  2.629   53.862  1.00 33.53 ? 368  PHE A O   1 
ATOM   1170 C CB  . PHE A 1 159 ? -3.456  5.624   52.812  1.00 32.38 ? 368  PHE A CB  1 
ATOM   1171 C CG  . PHE A 1 159 ? -2.537  6.762   52.503  1.00 33.83 ? 368  PHE A CG  1 
ATOM   1172 C CD1 . PHE A 1 159 ? -1.403  6.982   53.278  1.00 32.83 ? 368  PHE A CD1 1 
ATOM   1173 C CD2 . PHE A 1 159 ? -2.790  7.610   51.420  1.00 35.51 ? 368  PHE A CD2 1 
ATOM   1174 C CE1 . PHE A 1 159 ? -0.539  8.044   52.983  1.00 34.05 ? 368  PHE A CE1 1 
ATOM   1175 C CE2 . PHE A 1 159 ? -1.925  8.664   51.114  1.00 34.77 ? 368  PHE A CE2 1 
ATOM   1176 C CZ  . PHE A 1 159 ? -0.800  8.889   51.906  1.00 32.62 ? 368  PHE A CZ  1 
ATOM   1177 N N   . GLU A 1 160 ? -4.663  2.812   53.205  1.00 33.35 ? 369  GLU A N   1 
ATOM   1178 C CA  . GLU A 1 160 ? -5.142  1.708   54.036  1.00 34.78 ? 369  GLU A CA  1 
ATOM   1179 C C   . GLU A 1 160 ? -4.408  0.405   53.703  1.00 33.16 ? 369  GLU A C   1 
ATOM   1180 O O   . GLU A 1 160 ? -3.956  -0.309  54.610  1.00 32.64 ? 369  GLU A O   1 
ATOM   1181 C CB  . GLU A 1 160 ? -6.676  1.529   53.916  1.00 34.57 ? 369  GLU A CB  1 
ATOM   1182 C CG  . GLU A 1 160 ? -7.481  2.628   54.601  1.00 37.31 ? 369  GLU A CG  1 
ATOM   1183 C CD  . GLU A 1 160 ? -8.956  2.703   54.163  1.00 39.79 ? 369  GLU A CD  1 
ATOM   1184 O OE1 . GLU A 1 160 ? -9.457  1.772   53.466  1.00 45.62 ? 369  GLU A OE1 1 
ATOM   1185 O OE2 . GLU A 1 160 ? -9.616  3.715   54.533  1.00 45.57 ? 369  GLU A OE2 1 
ATOM   1186 N N   . PHE A 1 161 ? -4.289  0.100   52.409  1.00 31.96 ? 370  PHE A N   1 
ATOM   1187 C CA  . PHE A 1 161 ? -3.521  -1.070  51.988  1.00 30.90 ? 370  PHE A CA  1 
ATOM   1188 C C   . PHE A 1 161 ? -2.056  -0.978  52.477  1.00 30.76 ? 370  PHE A C   1 
ATOM   1189 O O   . PHE A 1 161 ? -1.535  -1.928  53.059  1.00 30.64 ? 370  PHE A O   1 
ATOM   1190 C CB  . PHE A 1 161 ? -3.552  -1.284  50.459  1.00 30.55 ? 370  PHE A CB  1 
ATOM   1191 C CG  . PHE A 1 161 ? -2.742  -2.483  50.028  1.00 29.31 ? 370  PHE A CG  1 
ATOM   1192 C CD1 . PHE A 1 161 ? -1.365  -2.368  49.788  1.00 29.16 ? 370  PHE A CD1 1 
ATOM   1193 C CD2 . PHE A 1 161 ? -3.336  -3.743  49.955  1.00 28.31 ? 370  PHE A CD2 1 
ATOM   1194 C CE1 . PHE A 1 161 ? -0.594  -3.495  49.442  1.00 29.16 ? 370  PHE A CE1 1 
ATOM   1195 C CE2 . PHE A 1 161 ? -2.576  -4.864  49.614  1.00 27.54 ? 370  PHE A CE2 1 
ATOM   1196 C CZ  . PHE A 1 161 ? -1.205  -4.738  49.375  1.00 28.56 ? 370  PHE A CZ  1 
ATOM   1197 N N   . ALA A 1 162 ? -1.421  0.169   52.252  1.00 31.12 ? 371  ALA A N   1 
ATOM   1198 C CA  . ALA A 1 162 ? 0.030   0.309   52.439  1.00 32.97 ? 371  ALA A CA  1 
ATOM   1199 C C   . ALA A 1 162 ? 0.459   0.146   53.901  1.00 33.86 ? 371  ALA A C   1 
ATOM   1200 O O   . ALA A 1 162 ? 1.465   -0.505  54.192  1.00 34.60 ? 371  ALA A O   1 
ATOM   1201 C CB  . ALA A 1 162 ? 0.508   1.656   51.889  1.00 32.50 ? 371  ALA A CB  1 
ATOM   1202 N N   . VAL A 1 163 ? -0.302  0.747   54.817  1.00 34.84 ? 372  VAL A N   1 
ATOM   1203 C CA  . VAL A 1 163 ? 0.011   0.660   56.252  1.00 35.34 ? 372  VAL A CA  1 
ATOM   1204 C C   . VAL A 1 163 ? -0.120  -0.764  56.790  1.00 35.47 ? 372  VAL A C   1 
ATOM   1205 O O   . VAL A 1 163 ? 0.709   -1.190  57.584  1.00 36.22 ? 372  VAL A O   1 
ATOM   1206 C CB  . VAL A 1 163 ? -0.793  1.686   57.105  1.00 35.97 ? 372  VAL A CB  1 
ATOM   1207 C CG1 . VAL A 1 163 ? -0.463  3.105   56.665  1.00 35.19 ? 372  VAL A CG1 1 
ATOM   1208 C CG2 . VAL A 1 163 ? -2.291  1.443   56.971  1.00 35.79 ? 372  VAL A CG2 1 
ATOM   1209 N N   . LYS A 1 164 ? -1.126  -1.507  56.323  1.00 35.29 ? 373  LYS A N   1 
ATOM   1210 C CA  . LYS A 1 164 ? -1.230  -2.926  56.636  1.00 35.50 ? 373  LYS A CA  1 
ATOM   1211 C C   . LYS A 1 164 ? -0.053  -3.694  56.031  1.00 35.21 ? 373  LYS A C   1 
ATOM   1212 O O   . LYS A 1 164 ? 0.558   -4.525  56.698  1.00 34.89 ? 373  LYS A O   1 
ATOM   1213 C CB  . LYS A 1 164 ? -2.540  -3.519  56.112  1.00 35.77 ? 373  LYS A CB  1 
ATOM   1214 C CG  . LYS A 1 164 ? -3.769  -3.095  56.896  1.00 37.05 ? 373  LYS A CG  1 
ATOM   1215 C CD  . LYS A 1 164 ? -4.991  -3.895  56.517  1.00 39.91 ? 373  LYS A CD  1 
ATOM   1216 C CE  . LYS A 1 164 ? -5.652  -3.331  55.280  1.00 40.55 ? 373  LYS A CE  1 
ATOM   1217 N NZ  . LYS A 1 164 ? -7.061  -3.787  55.176  1.00 41.82 ? 373  LYS A NZ  1 
ATOM   1218 N N   . PHE A 1 165 ? 0.237   -3.416  54.759  1.00 33.90 ? 374  PHE A N   1 
ATOM   1219 C CA  . PHE A 1 165 ? 1.300   -4.093  54.045  1.00 33.09 ? 374  PHE A CA  1 
ATOM   1220 C C   . PHE A 1 165 ? 2.632   -3.909  54.775  1.00 33.23 ? 374  PHE A C   1 
ATOM   1221 O O   . PHE A 1 165 ? 3.415   -4.863  54.895  1.00 33.29 ? 374  PHE A O   1 
ATOM   1222 C CB  . PHE A 1 165 ? 1.401   -3.591  52.592  1.00 32.20 ? 374  PHE A CB  1 
ATOM   1223 C CG  . PHE A 1 165 ? 2.278   -4.451  51.720  1.00 29.60 ? 374  PHE A CG  1 
ATOM   1224 C CD1 . PHE A 1 165 ? 1.890   -5.751  51.390  1.00 28.11 ? 374  PHE A CD1 1 
ATOM   1225 C CD2 . PHE A 1 165 ? 3.502   -3.979  51.253  1.00 29.15 ? 374  PHE A CD2 1 
ATOM   1226 C CE1 . PHE A 1 165 ? 2.713   -6.574  50.591  1.00 28.03 ? 374  PHE A CE1 1 
ATOM   1227 C CE2 . PHE A 1 165 ? 4.338   -4.786  50.446  1.00 28.29 ? 374  PHE A CE2 1 
ATOM   1228 C CZ  . PHE A 1 165 ? 3.935   -6.093  50.115  1.00 28.96 ? 374  PHE A CZ  1 
ATOM   1229 N N   . ASN A 1 166 ? 2.875   -2.698  55.274  1.00 32.78 ? 375  ASN A N   1 
ATOM   1230 C CA  . ASN A 1 166 ? 4.130   -2.392  55.978  1.00 33.79 ? 375  ASN A CA  1 
ATOM   1231 C C   . ASN A 1 166 ? 4.353   -3.190  57.260  1.00 34.31 ? 375  ASN A C   1 
ATOM   1232 O O   . ASN A 1 166 ? 5.508   -3.336  57.701  1.00 33.89 ? 375  ASN A O   1 
ATOM   1233 C CB  . ASN A 1 166 ? 4.302   -0.883  56.242  1.00 33.12 ? 375  ASN A CB  1 
ATOM   1234 C CG  . ASN A 1 166 ? 4.716   -0.113  54.993  1.00 33.38 ? 375  ASN A CG  1 
ATOM   1235 O OD1 . ASN A 1 166 ? 5.144   -0.704  54.009  1.00 38.03 ? 375  ASN A OD1 1 
ATOM   1236 N ND2 . ASN A 1 166 ? 4.616   1.205   55.037  1.00 32.28 ? 375  ASN A ND2 1 
ATOM   1237 N N   . ALA A 1 167 ? 3.267   -3.731  57.823  1.00 34.96 ? 376  ALA A N   1 
ATOM   1238 C CA  . ALA A 1 167 ? 3.351   -4.554  59.046  1.00 35.77 ? 376  ALA A CA  1 
ATOM   1239 C C   . ALA A 1 167 ? 4.024   -5.909  58.789  1.00 35.92 ? 376  ALA A C   1 
ATOM   1240 O O   . ALA A 1 167 ? 4.453   -6.579  59.732  1.00 36.20 ? 376  ALA A O   1 
ATOM   1241 C CB  . ALA A 1 167 ? 1.955   -4.749  59.684  1.00 35.61 ? 376  ALA A CB  1 
ATOM   1242 N N   . LEU A 1 168 ? 4.112   -6.310  57.513  1.00 35.46 ? 377  LEU A N   1 
ATOM   1243 C CA  . LEU A 1 168 ? 4.839   -7.526  57.121  1.00 34.91 ? 377  LEU A CA  1 
ATOM   1244 C C   . LEU A 1 168 ? 6.357   -7.329  57.124  1.00 34.42 ? 377  LEU A C   1 
ATOM   1245 O O   . LEU A 1 168 ? 7.102   -8.288  57.139  1.00 34.01 ? 377  LEU A O   1 
ATOM   1246 C CB  . LEU A 1 168 ? 4.351   -8.044  55.760  1.00 35.05 ? 377  LEU A CB  1 
ATOM   1247 C CG  . LEU A 1 168 ? 2.857   -8.372  55.644  1.00 35.62 ? 377  LEU A CG  1 
ATOM   1248 C CD1 . LEU A 1 168 ? 2.547   -8.844  54.248  1.00 34.69 ? 377  LEU A CD1 1 
ATOM   1249 C CD2 . LEU A 1 168 ? 2.466   -9.450  56.649  1.00 37.19 ? 377  LEU A CD2 1 
ATOM   1250 N N   . GLU A 1 169 ? 6.796   -6.078  57.120  1.00 34.95 ? 378  GLU A N   1 
ATOM   1251 C CA  . GLU A 1 169 ? 8.215   -5.708  57.295  1.00 35.80 ? 378  GLU A CA  1 
ATOM   1252 C C   . GLU A 1 169 ? 9.151   -6.292  56.229  1.00 34.82 ? 378  GLU A C   1 
ATOM   1253 O O   . GLU A 1 169 ? 10.278  -6.728  56.529  1.00 34.37 ? 378  GLU A O   1 
ATOM   1254 C CB  . GLU A 1 169 ? 8.727   -6.039  58.711  1.00 36.31 ? 378  GLU A CB  1 
ATOM   1255 C CG  . GLU A 1 169 ? 8.065   -5.271  59.852  1.00 37.96 ? 378  GLU A CG  1 
ATOM   1256 C CD  . GLU A 1 169 ? 8.659   -5.651  61.214  1.00 39.40 ? 378  GLU A CD  1 
ATOM   1257 O OE1 . GLU A 1 169 ? 9.142   -4.734  61.919  1.00 45.61 ? 378  GLU A OE1 1 
ATOM   1258 O OE2 . GLU A 1 169 ? 8.672   -6.862  61.571  1.00 44.20 ? 378  GLU A OE2 1 
ATOM   1259 N N   . LEU A 1 170 ? 8.690   -6.251  54.977  1.00 32.80 ? 379  LEU A N   1 
ATOM   1260 C CA  . LEU A 1 170 ? 9.491   -6.722  53.834  1.00 31.82 ? 379  LEU A CA  1 
ATOM   1261 C C   . LEU A 1 170 ? 10.652  -5.791  53.570  1.00 31.00 ? 379  LEU A C   1 
ATOM   1262 O O   . LEU A 1 170 ? 10.592  -4.615  53.894  1.00 31.38 ? 379  LEU A O   1 
ATOM   1263 C CB  . LEU A 1 170 ? 8.631   -6.821  52.563  1.00 31.20 ? 379  LEU A CB  1 
ATOM   1264 C CG  . LEU A 1 170 ? 7.434   -7.773  52.558  1.00 31.36 ? 379  LEU A CG  1 
ATOM   1265 C CD1 . LEU A 1 170 ? 6.950   -8.001  51.147  1.00 33.35 ? 379  LEU A CD1 1 
ATOM   1266 C CD2 . LEU A 1 170 ? 7.774   -9.102  53.193  1.00 32.24 ? 379  LEU A CD2 1 
ATOM   1267 N N   . ASP A 1 171 ? 11.713  -6.301  52.974  1.00 30.50 ? 380  ASP A N   1 
ATOM   1268 C CA  . ASP A 1 171 ? 12.766  -5.403  52.544  1.00 30.11 ? 380  ASP A CA  1 
ATOM   1269 C C   . ASP A 1 171 ? 12.821  -5.381  51.020  1.00 29.53 ? 380  ASP A C   1 
ATOM   1270 O O   . ASP A 1 171 ? 11.949  -5.962  50.356  1.00 28.22 ? 380  ASP A O   1 
ATOM   1271 C CB  . ASP A 1 171 ? 14.120  -5.741  53.179  1.00 31.36 ? 380  ASP A CB  1 
ATOM   1272 C CG  . ASP A 1 171 ? 14.586  -7.130  52.860  1.00 34.50 ? 380  ASP A CG  1 
ATOM   1273 O OD1 . ASP A 1 171 ? 14.460  -7.569  51.701  1.00 38.38 ? 380  ASP A OD1 1 
ATOM   1274 O OD2 . ASP A 1 171 ? 15.101  -7.799  53.784  1.00 40.16 ? 380  ASP A OD2 1 
ATOM   1275 N N   . ASP A 1 172 ? 13.838  -4.734  50.455  1.00 27.80 ? 381  ASP A N   1 
ATOM   1276 C CA  . ASP A 1 172 ? 13.800  -4.470  49.023  1.00 27.54 ? 381  ASP A CA  1 
ATOM   1277 C C   . ASP A 1 172 ? 14.030  -5.749  48.266  1.00 27.07 ? 381  ASP A C   1 
ATOM   1278 O O   . ASP A 1 172 ? 13.523  -5.913  47.164  1.00 27.00 ? 381  ASP A O   1 
ATOM   1279 C CB  . ASP A 1 172 ? 14.798  -3.384  48.607  1.00 27.72 ? 381  ASP A CB  1 
ATOM   1280 C CG  . ASP A 1 172 ? 14.366  -2.002  49.042  1.00 28.18 ? 381  ASP A CG  1 
ATOM   1281 O OD1 . ASP A 1 172 ? 13.328  -1.504  48.520  1.00 31.29 ? 381  ASP A OD1 1 
ATOM   1282 O OD2 . ASP A 1 172 ? 15.053  -1.411  49.909  1.00 28.50 ? 381  ASP A OD2 1 
ATOM   1283 N N   . SER A 1 173 ? 14.780  -6.666  48.881  1.00 26.84 ? 382  SER A N   1 
ATOM   1284 C CA  . SER A 1 173 ? 15.084  -7.952  48.266  1.00 26.48 ? 382  SER A CA  1 
ATOM   1285 C C   . SER A 1 173 ? 13.824  -8.816  48.220  1.00 26.21 ? 382  SER A C   1 
ATOM   1286 O O   . SER A 1 173 ? 13.631  -9.580  47.277  1.00 26.68 ? 382  SER A O   1 
ATOM   1287 C CB  . SER A 1 173 ? 16.226  -8.670  49.008  1.00 25.71 ? 382  SER A CB  1 
ATOM   1288 O OG  . SER A 1 173 ? 15.809  -9.064  50.299  1.00 25.33 ? 382  SER A OG  1 
ATOM   1289 N N   . ASP A 1 174 ? 12.980  -8.688  49.239  1.00 25.43 ? 383  ASP A N   1 
ATOM   1290 C CA  . ASP A 1 174 ? 11.683  -9.383  49.258  1.00 25.94 ? 383  ASP A CA  1 
ATOM   1291 C C   . ASP A 1 174 ? 10.725  -8.811  48.234  1.00 25.09 ? 383  ASP A C   1 
ATOM   1292 O O   . ASP A 1 174 ? 10.048  -9.556  47.539  1.00 25.80 ? 383  ASP A O   1 
ATOM   1293 C CB  . ASP A 1 174 ? 11.002  -9.272  50.620  1.00 25.82 ? 383  ASP A CB  1 
ATOM   1294 C CG  . ASP A 1 174 ? 11.880  -9.752  51.752  1.00 26.80 ? 383  ASP A CG  1 
ATOM   1295 O OD1 . ASP A 1 174 ? 12.578  -10.790 51.583  1.00 27.89 ? 383  ASP A OD1 1 
ATOM   1296 O OD2 . ASP A 1 174 ? 11.833  -9.071  52.797  1.00 27.21 ? 383  ASP A OD2 1 
ATOM   1297 N N   . LEU A 1 175 ? 10.678  -7.488  48.174  1.00 24.70 ? 384  LEU A N   1 
ATOM   1298 C CA  . LEU A 1 175 ? 9.762   -6.747  47.276  1.00 23.78 ? 384  LEU A CA  1 
ATOM   1299 C C   . LEU A 1 175 ? 10.040  -6.966  45.816  1.00 22.65 ? 384  LEU A C   1 
ATOM   1300 O O   . LEU A 1 175 ? 9.119   -6.986  44.979  1.00 21.30 ? 384  LEU A O   1 
ATOM   1301 C CB  . LEU A 1 175 ? 9.843   -5.247  47.591  1.00 24.24 ? 384  LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 175 ? 9.078   -4.860  48.849  1.00 27.11 ? 384  LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 175 ? 9.423   -3.421  49.230  1.00 28.36 ? 384  LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 175 ? 7.516   -5.069  48.651  1.00 28.16 ? 384  LEU A CD2 1 
ATOM   1305 N N   . ALA A 1 176 ? 11.328  -7.121  45.488  1.00 20.71 ? 385  ALA A N   1 
ATOM   1306 C CA  . ALA A 1 176 ? 11.746  -7.432  44.128  1.00 19.73 ? 385  ALA A CA  1 
ATOM   1307 C C   . ALA A 1 176 ? 11.150  -8.729  43.563  1.00 18.99 ? 385  ALA A C   1 
ATOM   1308 O O   . ALA A 1 176 ? 10.752  -8.778  42.417  1.00 18.32 ? 385  ALA A O   1 
ATOM   1309 C CB  . ALA A 1 176 ? 13.309  -7.498  44.067  1.00 18.83 ? 385  ALA A CB  1 
ATOM   1310 N N   . LEU A 1 177 ? 11.177  -9.806  44.340  1.00 19.03 ? 386  LEU A N   1 
ATOM   1311 C CA  . LEU A 1 177 ? 10.584  -11.037 43.909  1.00 19.82 ? 386  LEU A CA  1 
ATOM   1312 C C   . LEU A 1 177 ? 9.047   -10.933 43.920  1.00 20.88 ? 386  LEU A C   1 
ATOM   1313 O O   . LEU A 1 177 ? 8.360   -11.518 43.049  1.00 21.06 ? 386  LEU A O   1 
ATOM   1314 C CB  . LEU A 1 177 ? 11.055  -12.190 44.802  1.00 21.12 ? 386  LEU A CB  1 
ATOM   1315 C CG  . LEU A 1 177 ? 12.525  -12.612 44.611  1.00 19.81 ? 386  LEU A CG  1 
ATOM   1316 C CD1 . LEU A 1 177 ? 13.060  -13.323 45.887  1.00 19.71 ? 386  LEU A CD1 1 
ATOM   1317 C CD2 . LEU A 1 177 ? 12.641  -13.518 43.414  1.00 21.61 ? 386  LEU A CD2 1 
ATOM   1318 N N   . PHE A 1 178 ? 8.535   -10.183 44.887  1.00 21.05 ? 387  PHE A N   1 
ATOM   1319 C CA  . PHE A 1 178 ? 7.064   -9.993  45.024  1.00 21.48 ? 387  PHE A CA  1 
ATOM   1320 C C   . PHE A 1 178 ? 6.478   -9.336  43.759  1.00 22.08 ? 387  PHE A C   1 
ATOM   1321 O O   . PHE A 1 178 ? 5.542   -9.858  43.161  1.00 22.85 ? 387  PHE A O   1 
ATOM   1322 C CB  . PHE A 1 178 ? 6.756   -9.179  46.278  1.00 20.97 ? 387  PHE A CB  1 
ATOM   1323 C CG  . PHE A 1 178 ? 5.250   -9.073  46.590  1.00 21.07 ? 387  PHE A CG  1 
ATOM   1324 C CD1 . PHE A 1 178 ? 4.537   -10.188 46.971  1.00 20.76 ? 387  PHE A CD1 1 
ATOM   1325 C CD2 . PHE A 1 178 ? 4.603   -7.853  46.511  1.00 21.05 ? 387  PHE A CD2 1 
ATOM   1326 C CE1 . PHE A 1 178 ? 3.147   -10.106 47.233  1.00 24.88 ? 387  PHE A CE1 1 
ATOM   1327 C CE2 . PHE A 1 178 ? 3.207   -7.743  46.793  1.00 23.96 ? 387  PHE A CE2 1 
ATOM   1328 C CZ  . PHE A 1 178 ? 2.499   -8.870  47.158  1.00 21.80 ? 387  PHE A CZ  1 
ATOM   1329 N N   . ILE A 1 179 ? 7.066   -8.214  43.350  1.00 21.50 ? 388  ILE A N   1 
ATOM   1330 C CA  . ILE A 1 179 ? 6.681   -7.476  42.149  1.00 22.10 ? 388  ILE A CA  1 
ATOM   1331 C C   . ILE A 1 179 ? 6.848   -8.322  40.875  1.00 20.90 ? 388  ILE A C   1 
ATOM   1332 O O   . ILE A 1 179 ? 5.974   -8.315  39.994  1.00 21.62 ? 388  ILE A O   1 
ATOM   1333 C CB  . ILE A 1 179 ? 7.464   -6.116  42.072  1.00 22.65 ? 388  ILE A CB  1 
ATOM   1334 C CG1 . ILE A 1 179 ? 6.796   -5.059  42.939  1.00 26.25 ? 388  ILE A CG1 1 
ATOM   1335 C CG2 . ILE A 1 179 ? 7.515   -5.570  40.668  1.00 23.23 ? 388  ILE A CG2 1 
ATOM   1336 C CD1 . ILE A 1 179 ? 7.133   -5.159  44.369  1.00 30.15 ? 388  ILE A CD1 1 
ATOM   1337 N N   . ALA A 1 180 ? 7.955   -9.066  40.780  1.00 20.63 ? 389  ALA A N   1 
ATOM   1338 C CA  . ALA A 1 180 ? 8.141   -10.021 39.676  1.00 19.94 ? 389  ALA A CA  1 
ATOM   1339 C C   . ALA A 1 180 ? 7.001   -11.025 39.590  1.00 20.29 ? 389  ALA A C   1 
ATOM   1340 O O   . ALA A 1 180 ? 6.478   -11.274 38.503  1.00 19.15 ? 389  ALA A O   1 
ATOM   1341 C CB  . ALA A 1 180 ? 9.467   -10.742 39.783  1.00 19.40 ? 389  ALA A CB  1 
ATOM   1342 N N   . ALA A 1 181 ? 6.624   -11.585 40.747  1.00 20.68 ? 390  ALA A N   1 
ATOM   1343 C CA  . ALA A 1 181 ? 5.554   -12.570 40.837  1.00 21.52 ? 390  ALA A CA  1 
ATOM   1344 C C   . ALA A 1 181 ? 4.250   -11.924 40.402  1.00 22.42 ? 390  ALA A C   1 
ATOM   1345 O O   . ALA A 1 181 ? 3.468   -12.551 39.688  1.00 24.01 ? 390  ALA A O   1 
ATOM   1346 C CB  . ALA A 1 181 ? 5.424   -13.105 42.254  1.00 21.62 ? 390  ALA A CB  1 
ATOM   1347 N N   . ILE A 1 182 ? 4.028   -10.677 40.811  1.00 22.31 ? 391  ILE A N   1 
ATOM   1348 C CA  . ILE A 1 182 ? 2.827   -9.927  40.413  1.00 22.79 ? 391  ILE A CA  1 
ATOM   1349 C C   . ILE A 1 182 ? 2.676   -9.783  38.878  1.00 24.10 ? 391  ILE A C   1 
ATOM   1350 O O   . ILE A 1 182 ? 1.581   -10.004 38.323  1.00 24.28 ? 391  ILE A O   1 
ATOM   1351 C CB  . ILE A 1 182 ? 2.817   -8.534  41.067  1.00 22.44 ? 391  ILE A CB  1 
ATOM   1352 C CG1 . ILE A 1 182 ? 2.403   -8.643  42.547  1.00 21.25 ? 391  ILE A CG1 1 
ATOM   1353 C CG2 . ILE A 1 182 ? 1.903   -7.554  40.286  1.00 23.21 ? 391  ILE A CG2 1 
ATOM   1354 C CD1 . ILE A 1 182 ? 2.561   -7.311  43.249  1.00 21.07 ? 391  ILE A CD1 1 
ATOM   1355 N N   . ILE A 1 183 ? 3.769   -9.416  38.209  1.00 23.82 ? 392  ILE A N   1 
ATOM   1356 C CA  . ILE A 1 183 ? 3.790   -9.177  36.762  1.00 25.63 ? 392  ILE A CA  1 
ATOM   1357 C C   . ILE A 1 183 ? 3.588   -10.476 35.978  1.00 26.54 ? 392  ILE A C   1 
ATOM   1358 O O   . ILE A 1 183 ? 2.898   -10.495 34.957  1.00 26.02 ? 392  ILE A O   1 
ATOM   1359 C CB  . ILE A 1 183 ? 5.082   -8.396  36.312  1.00 25.76 ? 392  ILE A CB  1 
ATOM   1360 C CG1 . ILE A 1 183 ? 5.078   -6.999  36.935  1.00 26.52 ? 392  ILE A CG1 1 
ATOM   1361 C CG2 . ILE A 1 183 ? 5.150   -8.263  34.763  1.00 23.67 ? 392  ILE A CG2 1 
ATOM   1362 C CD1 . ILE A 1 183 ? 6.453   -6.276  36.931  1.00 27.46 ? 392  ILE A CD1 1 
ATOM   1363 N N   . LEU A 1 184 ? 4.134   -11.579 36.482  1.00 27.90 ? 393  LEU A N   1 
ATOM   1364 C CA  . LEU A 1 184 ? 3.994   -12.846 35.787  1.00 29.82 ? 393  LEU A CA  1 
ATOM   1365 C C   . LEU A 1 184 ? 2.767   -13.657 36.198  1.00 31.98 ? 393  LEU A C   1 
ATOM   1366 O O   . LEU A 1 184 ? 2.806   -14.876 36.327  1.00 33.67 ? 393  LEU A O   1 
ATOM   1367 C CB  . LEU A 1 184 ? 5.319   -13.615 35.824  1.00 30.24 ? 393  LEU A CB  1 
ATOM   1368 C CG  . LEU A 1 184 ? 5.998   -12.955 34.612  1.00 30.42 ? 393  LEU A CG  1 
ATOM   1369 C CD1 . LEU A 1 184 ? 7.184   -12.044 34.930  1.00 29.41 ? 393  LEU A CD1 1 
ATOM   1370 C CD2 . LEU A 1 184 ? 6.254   -13.954 33.481  1.00 25.78 ? 393  LEU A CD2 1 
ATOM   1371 N N   . CYS A 1 185 ? 1.659   -12.967 36.374  1.00 33.37 ? 394  CYS A N   1 
ATOM   1372 C CA  . CYS A 1 185 ? 0.417   -13.617 36.698  1.00 33.55 ? 394  CYS A CA  1 
ATOM   1373 C C   . CYS A 1 185 ? -0.235  -14.310 35.487  1.00 32.95 ? 394  CYS A C   1 
ATOM   1374 O O   . CYS A 1 185 ? -0.603  -13.667 34.519  1.00 32.73 ? 394  CYS A O   1 
ATOM   1375 C CB  . CYS A 1 185 ? -0.505  -12.601 37.327  1.00 33.43 ? 394  CYS A CB  1 
ATOM   1376 S SG  . CYS A 1 185 ? -2.117  -13.233 37.591  1.00 38.25 ? 394  CYS A SG  1 
ATOM   1377 N N   . GLY A 1 186 ? -0.363  -15.635 35.555  1.00 32.61 ? 395  GLY A N   1 
ATOM   1378 C CA  . GLY A 1 186 ? -0.863  -16.432 34.433  1.00 32.93 ? 395  GLY A CA  1 
ATOM   1379 C C   . GLY A 1 186 ? -2.356  -16.323 34.166  1.00 33.06 ? 395  GLY A C   1 
ATOM   1380 O O   . GLY A 1 186 ? -2.838  -16.767 33.118  1.00 34.12 ? 395  GLY A O   1 
ATOM   1381 N N   . ASP A 1 187 ? -3.092  -15.708 35.081  1.00 33.08 ? 396  ASP A N   1 
ATOM   1382 C CA  . ASP A 1 187 ? -4.550  -15.623 34.940  1.00 33.71 ? 396  ASP A CA  1 
ATOM   1383 C C   . ASP A 1 187 ? -5.096  -14.286 34.441  1.00 32.94 ? 396  ASP A C   1 
ATOM   1384 O O   . ASP A 1 187 ? -6.291  -14.025 34.574  1.00 33.08 ? 396  ASP A O   1 
ATOM   1385 C CB  . ASP A 1 187 ? -5.248  -16.048 36.256  1.00 35.11 ? 396  ASP A CB  1 
ATOM   1386 C CG  . ASP A 1 187 ? -4.808  -15.223 37.447  1.00 38.90 ? 396  ASP A CG  1 
ATOM   1387 O OD1 . ASP A 1 187 ? -4.556  -14.014 37.261  1.00 43.50 ? 396  ASP A OD1 1 
ATOM   1388 O OD2 . ASP A 1 187 ? -4.726  -15.761 38.572  1.00 42.58 ? 396  ASP A OD2 1 
ATOM   1389 N N   . ARG A 1 188 ? -4.244  -13.453 33.839  1.00 31.68 ? 397  ARG A N   1 
ATOM   1390 C CA  . ARG A 1 188 ? -4.692  -12.172 33.301  1.00 30.50 ? 397  ARG A CA  1 
ATOM   1391 C C   . ARG A 1 188 ? -5.608  -12.405 32.111  1.00 31.23 ? 397  ARG A C   1 
ATOM   1392 O O   . ARG A 1 188 ? -5.332  -13.285 31.304  1.00 31.34 ? 397  ARG A O   1 
ATOM   1393 C CB  . ARG A 1 188 ? -3.508  -11.314 32.850  1.00 29.94 ? 397  ARG A CB  1 
ATOM   1394 C CG  . ARG A 1 188 ? -2.410  -11.091 33.883  1.00 28.14 ? 397  ARG A CG  1 
ATOM   1395 C CD  . ARG A 1 188 ? -2.972  -10.479 35.119  1.00 24.55 ? 397  ARG A CD  1 
ATOM   1396 N NE  . ARG A 1 188 ? -1.934  -9.949  35.993  1.00 25.26 ? 397  ARG A NE  1 
ATOM   1397 C CZ  . ARG A 1 188 ? -2.169  -9.519  37.217  1.00 25.90 ? 397  ARG A CZ  1 
ATOM   1398 N NH1 . ARG A 1 188 ? -3.430  -9.538  37.683  1.00 20.94 ? 397  ARG A NH1 1 
ATOM   1399 N NH2 . ARG A 1 188 ? -1.147  -9.103  37.975  1.00 24.84 ? 397  ARG A NH2 1 
ATOM   1400 N N   . PRO A 1 189 ? -6.683  -11.604 31.981  1.00 31.55 ? 398  PRO A N   1 
ATOM   1401 C CA  . PRO A 1 189 ? -7.638  -11.801 30.886  1.00 32.30 ? 398  PRO A CA  1 
ATOM   1402 C C   . PRO A 1 189 ? -6.964  -11.659 29.528  1.00 32.64 ? 398  PRO A C   1 
ATOM   1403 O O   . PRO A 1 189 ? -6.197  -10.701 29.306  1.00 32.33 ? 398  PRO A O   1 
ATOM   1404 C CB  . PRO A 1 189 ? -8.630  -10.651 31.064  1.00 31.72 ? 398  PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 189 ? -8.494  -10.236 32.477  1.00 33.08 ? 398  PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 189 ? -7.052  -10.461 32.830  1.00 31.71 ? 398  PRO A CD  1 
ATOM   1407 N N   . GLY A 1 190 ? -7.256  -12.607 28.637  1.00 32.58 ? 399  GLY A N   1 
ATOM   1408 C CA  . GLY A 1 190 ? -6.785  -12.552 27.266  1.00 32.40 ? 399  GLY A CA  1 
ATOM   1409 C C   . GLY A 1 190 ? -5.342  -12.958 27.036  1.00 32.87 ? 399  GLY A C   1 
ATOM   1410 O O   . GLY A 1 190 ? -4.783  -12.691 25.963  1.00 32.10 ? 399  GLY A O   1 
ATOM   1411 N N   . LEU A 1 191 ? -4.736  -13.598 28.030  1.00 33.28 ? 400  LEU A N   1 
ATOM   1412 C CA  . LEU A 1 191 ? -3.374  -14.111 27.886  1.00 34.12 ? 400  LEU A CA  1 
ATOM   1413 C C   . LEU A 1 191 ? -3.317  -15.265 26.882  1.00 34.40 ? 400  LEU A C   1 
ATOM   1414 O O   . LEU A 1 191 ? -4.127  -16.190 26.950  1.00 33.94 ? 400  LEU A O   1 
ATOM   1415 C CB  . LEU A 1 191 ? -2.839  -14.611 29.220  1.00 33.53 ? 400  LEU A CB  1 
ATOM   1416 C CG  . LEU A 1 191 ? -1.698  -13.943 29.961  1.00 35.67 ? 400  LEU A CG  1 
ATOM   1417 C CD1 . LEU A 1 191 ? -1.160  -14.952 30.967  1.00 34.94 ? 400  LEU A CD1 1 
ATOM   1418 C CD2 . LEU A 1 191 ? -0.578  -13.462 29.075  1.00 34.96 ? 400  LEU A CD2 1 
ATOM   1419 N N   . MET A 1 192 ? -2.330  -15.221 25.995  1.00 34.90 ? 401  MET A N   1 
ATOM   1420 C CA  . MET A 1 192 ? -2.175  -16.229 24.954  1.00 35.77 ? 401  MET A CA  1 
ATOM   1421 C C   . MET A 1 192 ? -1.513  -17.529 25.428  1.00 35.94 ? 401  MET A C   1 
ATOM   1422 O O   . MET A 1 192 ? -2.106  -18.605 25.312  1.00 36.83 ? 401  MET A O   1 
ATOM   1423 C CB  . MET A 1 192 ? -1.417  -15.631 23.768  1.00 35.74 ? 401  MET A CB  1 
ATOM   1424 C CG  . MET A 1 192 ? -1.453  -16.455 22.496  1.00 35.46 ? 401  MET A CG  1 
ATOM   1425 S SD  . MET A 1 192 ? -0.416  -15.673 21.233  1.00 36.81 ? 401  MET A SD  1 
ATOM   1426 C CE  . MET A 1 192 ? 1.233   -15.942 21.883  1.00 38.29 ? 401  MET A CE  1 
ATOM   1427 N N   . ASN A 1 193 ? -0.287  -17.445 25.944  1.00 35.36 ? 402  ASN A N   1 
ATOM   1428 C CA  . ASN A 1 193 ? 0.404   -18.635 26.400  1.00 34.61 ? 402  ASN A CA  1 
ATOM   1429 C C   . ASN A 1 193 ? 0.321   -18.736 27.922  1.00 34.26 ? 402  ASN A C   1 
ATOM   1430 O O   . ASN A 1 193 ? 1.267   -18.420 28.630  1.00 33.09 ? 402  ASN A O   1 
ATOM   1431 C CB  . ASN A 1 193 ? 1.859   -18.627 25.932  1.00 35.00 ? 402  ASN A CB  1 
ATOM   1432 C CG  . ASN A 1 193 ? 2.518   -20.000 26.036  1.00 36.47 ? 402  ASN A CG  1 
ATOM   1433 O OD1 . ASN A 1 193 ? 1.941   -20.949 26.558  1.00 36.08 ? 402  ASN A OD1 1 
ATOM   1434 N ND2 . ASN A 1 193 ? 3.742   -20.103 25.528  1.00 39.00 ? 402  ASN A ND2 1 
ATOM   1435 N N   . VAL A 1 194 ? -0.838  -19.167 28.413  1.00 33.52 ? 403  VAL A N   1 
ATOM   1436 C CA  . VAL A 1 194 ? -1.076  -19.287 29.838  1.00 33.72 ? 403  VAL A CA  1 
ATOM   1437 C C   . VAL A 1 194 ? -0.108  -20.227 30.557  1.00 33.58 ? 403  VAL A C   1 
ATOM   1438 O O   . VAL A 1 194 ? 0.490   -19.825 31.539  1.00 34.49 ? 403  VAL A O   1 
ATOM   1439 C CB  . VAL A 1 194 ? -2.534  -19.676 30.150  1.00 33.69 ? 403  VAL A CB  1 
ATOM   1440 C CG1 . VAL A 1 194 ? -2.694  -19.954 31.644  1.00 33.02 ? 403  VAL A CG1 1 
ATOM   1441 C CG2 . VAL A 1 194 ? -3.463  -18.563 29.692  1.00 32.64 ? 403  VAL A CG2 1 
ATOM   1442 N N   . PRO A 1 195 ? 0.068   -21.461 30.062  1.00 33.96 ? 404  PRO A N   1 
ATOM   1443 C CA  . PRO A 1 195 ? 0.955   -22.438 30.709  1.00 33.83 ? 404  PRO A CA  1 
ATOM   1444 C C   . PRO A 1 195 ? 2.402   -21.980 30.890  1.00 33.69 ? 404  PRO A C   1 
ATOM   1445 O O   . PRO A 1 195 ? 3.070   -22.353 31.855  1.00 33.92 ? 404  PRO A O   1 
ATOM   1446 C CB  . PRO A 1 195 ? 0.885   -23.634 29.749  1.00 34.19 ? 404  PRO A CB  1 
ATOM   1447 C CG  . PRO A 1 195 ? -0.509  -23.521 29.142  1.00 35.02 ? 404  PRO A CG  1 
ATOM   1448 C CD  . PRO A 1 195 ? -0.590  -22.046 28.870  1.00 34.16 ? 404  PRO A CD  1 
ATOM   1449 N N   . ARG A 1 196 ? 2.883   -21.159 29.978  1.00 33.60 ? 405  ARG A N   1 
ATOM   1450 C CA  . ARG A 1 196 ? 4.261   -20.705 30.033  1.00 33.21 ? 405  ARG A CA  1 
ATOM   1451 C C   . ARG A 1 196 ? 4.458   -19.566 31.033  1.00 32.53 ? 405  ARG A C   1 
ATOM   1452 O O   . ARG A 1 196 ? 5.488   -19.504 31.702  1.00 32.91 ? 405  ARG A O   1 
ATOM   1453 C CB  . ARG A 1 196 ? 4.656   -20.212 28.675  1.00 33.61 ? 405  ARG A CB  1 
ATOM   1454 C CG  . ARG A 1 196 ? 6.109   -19.906 28.504  1.00 36.07 ? 405  ARG A CG  1 
ATOM   1455 C CD  . ARG A 1 196 ? 6.262   -19.560 27.044  1.00 42.05 ? 405  ARG A CD  1 
ATOM   1456 N NE  . ARG A 1 196 ? 7.556   -18.997 26.694  1.00 45.96 ? 405  ARG A NE  1 
ATOM   1457 C CZ  . ARG A 1 196 ? 7.761   -18.226 25.630  1.00 47.79 ? 405  ARG A CZ  1 
ATOM   1458 N NH1 . ARG A 1 196 ? 6.749   -17.888 24.817  1.00 47.88 ? 405  ARG A NH1 1 
ATOM   1459 N NH2 . ARG A 1 196 ? 8.982   -17.778 25.388  1.00 49.74 ? 405  ARG A NH2 1 
ATOM   1460 N N   . VAL A 1 197 ? 3.503   -18.641 31.074  1.00 31.22 ? 406  VAL A N   1 
ATOM   1461 C CA  . VAL A 1 197 ? 3.495   -17.577 32.081  1.00 30.59 ? 406  VAL A CA  1 
ATOM   1462 C C   . VAL A 1 197 ? 3.393   -18.209 33.479  1.00 30.26 ? 406  VAL A C   1 
ATOM   1463 O O   . VAL A 1 197 ? 4.100   -17.824 34.400  1.00 29.61 ? 406  VAL A O   1 
ATOM   1464 C CB  . VAL A 1 197 ? 2.348   -16.544 31.838  1.00 30.35 ? 406  VAL A CB  1 
ATOM   1465 C CG1 . VAL A 1 197 ? 2.249   -15.545 33.023  1.00 28.62 ? 406  VAL A CG1 1 
ATOM   1466 C CG2 . VAL A 1 197 ? 2.564   -15.782 30.522  1.00 29.81 ? 406  VAL A CG2 1 
ATOM   1467 N N   . GLU A 1 198 ? 2.517   -19.194 33.632  1.00 30.47 ? 407  GLU A N   1 
ATOM   1468 C CA  . GLU A 1 198 ? 2.414   -19.915 34.907  1.00 30.71 ? 407  GLU A CA  1 
ATOM   1469 C C   . GLU A 1 198 ? 3.699   -20.602 35.325  1.00 30.59 ? 407  GLU A C   1 
ATOM   1470 O O   . GLU A 1 198 ? 4.061   -20.591 36.510  1.00 30.87 ? 407  GLU A O   1 
ATOM   1471 C CB  . GLU A 1 198 ? 1.282   -20.920 34.873  1.00 30.63 ? 407  GLU A CB  1 
ATOM   1472 C CG  . GLU A 1 198 ? -0.048  -20.272 34.631  1.00 32.00 ? 407  GLU A CG  1 
ATOM   1473 C CD  . GLU A 1 198 ? -1.169  -21.271 34.640  1.00 35.65 ? 407  GLU A CD  1 
ATOM   1474 O OE1 . GLU A 1 198 ? -0.930  -22.444 34.250  1.00 36.45 ? 407  GLU A OE1 1 
ATOM   1475 O OE2 . GLU A 1 198 ? -2.287  -20.871 35.045  1.00 38.54 ? 407  GLU A OE2 1 
ATOM   1476 N N   . ALA A 1 199 ? 4.399   -21.179 34.361  1.00 31.07 ? 408  ALA A N   1 
ATOM   1477 C CA  . ALA A 1 199 ? 5.685   -21.823 34.636  1.00 30.77 ? 408  ALA A CA  1 
ATOM   1478 C C   . ALA A 1 199 ? 6.727   -20.813 35.110  1.00 30.82 ? 408  ALA A C   1 
ATOM   1479 O O   . ALA A 1 199 ? 7.496   -21.099 36.031  1.00 31.76 ? 408  ALA A O   1 
ATOM   1480 C CB  . ALA A 1 199 ? 6.180   -22.601 33.401  1.00 31.50 ? 408  ALA A CB  1 
ATOM   1481 N N   . ILE A 1 200 ? 6.762   -19.622 34.508  1.00 30.52 ? 409  ILE A N   1 
ATOM   1482 C CA  . ILE A 1 200 ? 7.760   -18.616 34.903  1.00 29.92 ? 409  ILE A CA  1 
ATOM   1483 C C   . ILE A 1 200 ? 7.417   -18.064 36.282  1.00 29.22 ? 409  ILE A C   1 
ATOM   1484 O O   . ILE A 1 200 ? 8.288   -17.824 37.099  1.00 27.64 ? 409  ILE A O   1 
ATOM   1485 C CB  . ILE A 1 200 ? 7.833   -17.419 33.896  1.00 30.69 ? 409  ILE A CB  1 
ATOM   1486 C CG1 . ILE A 1 200 ? 8.222   -17.924 32.487  1.00 31.40 ? 409  ILE A CG1 1 
ATOM   1487 C CG2 . ILE A 1 200 ? 8.747   -16.311 34.449  1.00 29.25 ? 409  ILE A CG2 1 
ATOM   1488 C CD1 . ILE A 1 200 ? 7.854   -16.993 31.301  1.00 30.84 ? 409  ILE A CD1 1 
ATOM   1489 N N   . GLN A 1 201 ? 6.132   -17.862 36.545  1.00 28.48 ? 410  GLN A N   1 
ATOM   1490 C CA  . GLN A 1 201 ? 5.721   -17.391 37.863  1.00 28.00 ? 410  GLN A CA  1 
ATOM   1491 C C   . GLN A 1 201 ? 6.106   -18.385 38.976  1.00 28.27 ? 410  GLN A C   1 
ATOM   1492 O O   . GLN A 1 201 ? 6.522   -17.994 40.057  1.00 27.89 ? 410  GLN A O   1 
ATOM   1493 C CB  . GLN A 1 201 ? 4.203   -17.173 37.918  1.00 27.97 ? 410  GLN A CB  1 
ATOM   1494 C CG  . GLN A 1 201 ? 3.800   -16.266 39.086  1.00 28.42 ? 410  GLN A CG  1 
ATOM   1495 C CD  . GLN A 1 201 ? 2.338   -16.319 39.369  1.00 29.14 ? 410  GLN A CD  1 
ATOM   1496 O OE1 . GLN A 1 201 ? 1.714   -17.335 39.135  1.00 31.21 ? 410  GLN A OE1 1 
ATOM   1497 N NE2 . GLN A 1 201 ? 1.771   -15.217 39.863  1.00 28.41 ? 410  GLN A NE2 1 
ATOM   1498 N N   . ASP A 1 202 ? 5.911   -19.671 38.706  1.00 28.51 ? 411  ASP A N   1 
ATOM   1499 C CA  . ASP A 1 202 ? 6.193   -20.706 39.694  1.00 29.63 ? 411  ASP A CA  1 
ATOM   1500 C C   . ASP A 1 202 ? 7.668   -20.667 40.075  1.00 28.74 ? 411  ASP A C   1 
ATOM   1501 O O   . ASP A 1 202 ? 8.000   -20.801 41.252  1.00 28.30 ? 411  ASP A O   1 
ATOM   1502 C CB  . ASP A 1 202 ? 5.819   -22.089 39.178  1.00 30.62 ? 411  ASP A CB  1 
ATOM   1503 C CG  . ASP A 1 202 ? 5.784   -23.129 40.289  1.00 34.64 ? 411  ASP A CG  1 
ATOM   1504 O OD1 . ASP A 1 202 ? 4.855   -23.080 41.127  1.00 37.73 ? 411  ASP A OD1 1 
ATOM   1505 O OD2 . ASP A 1 202 ? 6.701   -23.988 40.320  1.00 39.55 ? 411  ASP A OD2 1 
ATOM   1506 N N   . THR A 1 203 ? 8.530   -20.438 39.090  1.00 28.08 ? 412  THR A N   1 
ATOM   1507 C CA  . THR A 1 203 ? 9.967   -20.281 39.346  1.00 28.13 ? 412  THR A CA  1 
ATOM   1508 C C   . THR A 1 203 ? 10.218  -19.091 40.282  1.00 27.35 ? 412  THR A C   1 
ATOM   1509 O O   . THR A 1 203 ? 11.043  -19.171 41.193  1.00 26.95 ? 412  THR A O   1 
ATOM   1510 C CB  . THR A 1 203 ? 10.724  -20.110 38.028  1.00 28.14 ? 412  THR A CB  1 
ATOM   1511 O OG1 . THR A 1 203 ? 10.592  -21.320 37.272  1.00 30.55 ? 412  THR A OG1 1 
ATOM   1512 C CG2 . THR A 1 203 ? 12.232  -19.830 38.271  1.00 30.53 ? 412  THR A CG2 1 
ATOM   1513 N N   . ILE A 1 204 ? 9.495   -17.985 40.062  1.00 25.96 ? 413  ILE A N   1 
ATOM   1514 C CA  . ILE A 1 204 ? 9.685   -16.802 40.894  1.00 24.44 ? 413  ILE A CA  1 
ATOM   1515 C C   . ILE A 1 204 ? 9.221   -17.072 42.321  1.00 24.48 ? 413  ILE A C   1 
ATOM   1516 O O   . ILE A 1 204 ? 9.873   -16.667 43.273  1.00 24.79 ? 413  ILE A O   1 
ATOM   1517 C CB  . ILE A 1 204 ? 8.956   -15.544 40.317  1.00 24.66 ? 413  ILE A CB  1 
ATOM   1518 C CG1 . ILE A 1 204 ? 9.569   -15.103 38.977  1.00 23.78 ? 413  ILE A CG1 1 
ATOM   1519 C CG2 . ILE A 1 204 ? 8.961   -14.376 41.343  1.00 21.27 ? 413  ILE A CG2 1 
ATOM   1520 C CD1 . ILE A 1 204 ? 8.534   -14.368 38.061  1.00 23.99 ? 413  ILE A CD1 1 
ATOM   1521 N N   . LEU A 1 205 ? 8.069   -17.725 42.455  1.00 24.03 ? 414  LEU A N   1 
ATOM   1522 C CA  . LEU A 1 205 ? 7.478   -17.999 43.750  1.00 24.70 ? 414  LEU A CA  1 
ATOM   1523 C C   . LEU A 1 205 ? 8.289   -18.992 44.575  1.00 25.24 ? 414  LEU A C   1 
ATOM   1524 O O   . LEU A 1 205 ? 8.379   -18.865 45.775  1.00 25.54 ? 414  LEU A O   1 
ATOM   1525 C CB  . LEU A 1 205 ? 6.081   -18.576 43.578  1.00 24.26 ? 414  LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 205 ? 5.061   -17.564 43.075  1.00 24.08 ? 414  LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 205 ? 3.700   -18.267 42.931  1.00 23.90 ? 414  LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 205 ? 4.993   -16.357 44.040  1.00 23.93 ? 414  LEU A CD2 1 
ATOM   1529 N N   . ARG A 1 206 ? 8.843   -19.992 43.919  1.00 26.26 ? 415  ARG A N   1 
ATOM   1530 C CA  . ARG A 1 206 ? 9.752   -20.917 44.584  1.00 28.35 ? 415  ARG A CA  1 
ATOM   1531 C C   . ARG A 1 206 ? 10.938  -20.142 45.150  1.00 28.05 ? 415  ARG A C   1 
ATOM   1532 O O   . ARG A 1 206 ? 11.282  -20.310 46.308  1.00 27.92 ? 415  ARG A O   1 
ATOM   1533 C CB  . ARG A 1 206 ? 10.178  -22.041 43.628  1.00 27.99 ? 415  ARG A CB  1 
ATOM   1534 C CG  . ARG A 1 206 ? 8.980   -22.930 43.297  1.00 30.94 ? 415  ARG A CG  1 
ATOM   1535 C CD  . ARG A 1 206 ? 9.341   -24.377 43.017  1.00 34.31 ? 415  ARG A CD  1 
ATOM   1536 N NE  . ARG A 1 206 ? 8.195   -25.092 42.441  1.00 37.29 ? 415  ARG A NE  1 
ATOM   1537 C CZ  . ARG A 1 206 ? 8.137   -26.405 42.224  1.00 40.26 ? 415  ARG A CZ  1 
ATOM   1538 N NH1 . ARG A 1 206 ? 9.157   -27.198 42.541  1.00 41.19 ? 415  ARG A NH1 1 
ATOM   1539 N NH2 . ARG A 1 206 ? 7.052   -26.933 41.671  1.00 43.16 ? 415  ARG A NH2 1 
ATOM   1540 N N   . ALA A 1 207 ? 11.520  -19.269 44.337  1.00 28.34 ? 416  ALA A N   1 
ATOM   1541 C CA  . ALA A 1 207 ? 12.604  -18.380 44.775  1.00 28.49 ? 416  ALA A CA  1 
ATOM   1542 C C   . ALA A 1 207 ? 12.173  -17.513 45.947  1.00 29.58 ? 416  ALA A C   1 
ATOM   1543 O O   . ALA A 1 207 ? 12.909  -17.350 46.941  1.00 28.13 ? 416  ALA A O   1 
ATOM   1544 C CB  . ALA A 1 207 ? 13.042  -17.520 43.644  1.00 28.95 ? 416  ALA A CB  1 
ATOM   1545 N N   . LEU A 1 208 ? 10.962  -16.953 45.834  1.00 29.71 ? 417  LEU A N   1 
ATOM   1546 C CA  . LEU A 1 208 ? 10.443  -16.089 46.871  1.00 30.50 ? 417  LEU A CA  1 
ATOM   1547 C C   . LEU A 1 208 ? 10.281  -16.859 48.186  1.00 31.65 ? 417  LEU A C   1 
ATOM   1548 O O   . LEU A 1 208 ? 10.652  -16.367 49.260  1.00 30.90 ? 417  LEU A O   1 
ATOM   1549 C CB  . LEU A 1 208 ? 9.117   -15.463 46.437  1.00 30.25 ? 417  LEU A CB  1 
ATOM   1550 C CG  . LEU A 1 208 ? 8.416   -14.569 47.460  1.00 31.58 ? 417  LEU A CG  1 
ATOM   1551 C CD1 . LEU A 1 208 ? 9.312   -13.433 48.001  1.00 31.43 ? 417  LEU A CD1 1 
ATOM   1552 C CD2 . LEU A 1 208 ? 7.088   -14.047 46.899  1.00 29.92 ? 417  LEU A CD2 1 
ATOM   1553 N N   . GLU A 1 209 ? 9.726   -18.061 48.090  1.00 32.70 ? 418  GLU A N   1 
ATOM   1554 C CA  . GLU A 1 209 ? 9.534   -18.903 49.265  1.00 34.99 ? 418  GLU A CA  1 
ATOM   1555 C C   . GLU A 1 209 ? 10.877  -19.193 49.923  1.00 34.12 ? 418  GLU A C   1 
ATOM   1556 O O   . GLU A 1 209 ? 11.042  -19.059 51.146  1.00 33.81 ? 418  GLU A O   1 
ATOM   1557 C CB  . GLU A 1 209 ? 8.852   -20.211 48.878  1.00 35.18 ? 418  GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 209 ? 8.293   -20.955 50.073  1.00 40.67 ? 418  GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 209 ? 7.522   -22.203 49.659  1.00 47.21 ? 418  GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 209 ? 7.845   -22.780 48.578  1.00 49.24 ? 418  GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 209 ? 6.601   -22.604 50.420  1.00 50.26 ? 418  GLU A OE2 1 
ATOM   1562 N N   . PHE A 1 210 ? 11.841  -19.561 49.099  1.00 34.22 ? 419  PHE A N   1 
ATOM   1563 C CA  . PHE A 1 210 ? 13.185  -19.783 49.585  1.00 34.98 ? 419  PHE A CA  1 
ATOM   1564 C C   . PHE A 1 210 ? 13.739  -18.536 50.248  1.00 35.19 ? 419  PHE A C   1 
ATOM   1565 O O   . PHE A 1 210 ? 14.305  -18.618 51.336  1.00 35.23 ? 419  PHE A O   1 
ATOM   1566 C CB  . PHE A 1 210 ? 14.098  -20.261 48.454  1.00 36.03 ? 419  PHE A CB  1 
ATOM   1567 C CG  . PHE A 1 210 ? 15.550  -20.336 48.837  1.00 38.08 ? 419  PHE A CG  1 
ATOM   1568 C CD1 . PHE A 1 210 ? 16.120  -21.555 49.198  1.00 40.45 ? 419  PHE A CD1 1 
ATOM   1569 C CD2 . PHE A 1 210 ? 16.353  -19.184 48.831  1.00 39.73 ? 419  PHE A CD2 1 
ATOM   1570 C CE1 . PHE A 1 210 ? 17.494  -21.629 49.548  1.00 42.02 ? 419  PHE A CE1 1 
ATOM   1571 C CE2 . PHE A 1 210 ? 17.706  -19.241 49.187  1.00 40.42 ? 419  PHE A CE2 1 
ATOM   1572 C CZ  . PHE A 1 210 ? 18.278  -20.468 49.545  1.00 39.70 ? 419  PHE A CZ  1 
ATOM   1573 N N   . HIS A 1 211 ? 13.568  -17.379 49.599  1.00 34.89 ? 420  HIS A N   1 
ATOM   1574 C CA  . HIS A 1 211 ? 14.118  -16.114 50.098  1.00 34.09 ? 420  HIS A CA  1 
ATOM   1575 C C   . HIS A 1 211 ? 13.529  -15.670 51.438  1.00 34.25 ? 420  HIS A C   1 
ATOM   1576 O O   . HIS A 1 211 ? 14.266  -15.228 52.294  1.00 33.40 ? 420  HIS A O   1 
ATOM   1577 C CB  . HIS A 1 211 ? 13.974  -15.002 49.050  1.00 33.98 ? 420  HIS A CB  1 
ATOM   1578 C CG  . HIS A 1 211 ? 14.716  -13.748 49.398  1.00 32.97 ? 420  HIS A CG  1 
ATOM   1579 N ND1 . HIS A 1 211 ? 16.093  -13.647 49.337  1.00 31.94 ? 420  HIS A ND1 1 
ATOM   1580 C CD2 . HIS A 1 211 ? 14.271  -12.553 49.841  1.00 32.05 ? 420  HIS A CD2 1 
ATOM   1581 C CE1 . HIS A 1 211 ? 16.459  -12.432 49.708  1.00 31.43 ? 420  HIS A CE1 1 
ATOM   1582 N NE2 . HIS A 1 211 ? 15.371  -11.752 50.030  1.00 33.42 ? 420  HIS A NE2 1 
ATOM   1583 N N   . LEU A 1 212 ? 12.210  -15.784 51.609  1.00 34.76 ? 421  LEU A N   1 
ATOM   1584 C CA  . LEU A 1 212 ? 11.550  -15.443 52.883  1.00 35.93 ? 421  LEU A CA  1 
ATOM   1585 C C   . LEU A 1 212 ? 12.042  -16.272 54.075  1.00 38.06 ? 421  LEU A C   1 
ATOM   1586 O O   . LEU A 1 212 ? 12.195  -15.750 55.176  1.00 39.02 ? 421  LEU A O   1 
ATOM   1587 C CB  . LEU A 1 212 ? 10.015  -15.566 52.769  1.00 35.12 ? 421  LEU A CB  1 
ATOM   1588 C CG  . LEU A 1 212 ? 9.415   -14.649 51.692  1.00 31.77 ? 421  LEU A CG  1 
ATOM   1589 C CD1 . LEU A 1 212 ? 7.968   -14.958 51.425  1.00 27.41 ? 421  LEU A CD1 1 
ATOM   1590 C CD2 . LEU A 1 212 ? 9.644   -13.168 52.045  1.00 31.82 ? 421  LEU A CD2 1 
ATOM   1591 N N   . GLN A 1 213 ? 12.273  -17.561 53.849  1.00 40.02 ? 422  GLN A N   1 
ATOM   1592 C CA  . GLN A 1 213 ? 12.808  -18.466 54.879  1.00 42.15 ? 422  GLN A CA  1 
ATOM   1593 C C   . GLN A 1 213 ? 14.246  -18.144 55.312  1.00 42.52 ? 422  GLN A C   1 
ATOM   1594 O O   . GLN A 1 213 ? 14.573  -18.202 56.491  1.00 43.04 ? 422  GLN A O   1 
ATOM   1595 C CB  . GLN A 1 213 ? 12.671  -19.922 54.421  1.00 42.20 ? 422  GLN A CB  1 
ATOM   1596 C CG  . GLN A 1 213 ? 11.266  -20.472 54.702  1.00 44.39 ? 422  GLN A CG  1 
ATOM   1597 C CD  . GLN A 1 213 ? 11.065  -20.821 56.168  1.00 46.71 ? 422  GLN A CD  1 
ATOM   1598 O OE1 . GLN A 1 213 ? 10.301  -20.165 56.895  1.00 45.43 ? 422  GLN A OE1 1 
ATOM   1599 N NE2 . GLN A 1 213 ? 11.774  -21.851 56.619  1.00 48.22 ? 422  GLN A NE2 1 
ATOM   1600 N N   . ALA A 1 214 ? 15.086  -17.785 54.353  1.00 43.12 ? 423  ALA A N   1 
ATOM   1601 C CA  . ALA A 1 214 ? 16.427  -17.301 54.634  1.00 43.41 ? 423  ALA A CA  1 
ATOM   1602 C C   . ALA A 1 214 ? 16.412  -15.912 55.323  1.00 44.03 ? 423  ALA A C   1 
ATOM   1603 O O   . ALA A 1 214 ? 17.027  -15.717 56.375  1.00 43.63 ? 423  ALA A O   1 
ATOM   1604 C CB  . ALA A 1 214 ? 17.238  -17.256 53.329  1.00 43.20 ? 423  ALA A CB  1 
ATOM   1605 N N   . ASN A 1 215 ? 15.688  -14.968 54.715  1.00 44.35 ? 424  ASN A N   1 
ATOM   1606 C CA  . ASN A 1 215 ? 15.661  -13.558 55.107  1.00 44.73 ? 424  ASN A CA  1 
ATOM   1607 C C   . ASN A 1 215 ? 14.828  -13.295 56.380  1.00 44.67 ? 424  ASN A C   1 
ATOM   1608 O O   . ASN A 1 215 ? 15.177  -12.440 57.197  1.00 44.55 ? 424  ASN A O   1 
ATOM   1609 C CB  . ASN A 1 215 ? 15.112  -12.747 53.907  1.00 44.56 ? 424  ASN A CB  1 
ATOM   1610 C CG  . ASN A 1 215 ? 15.532  -11.284 53.912  1.00 45.44 ? 424  ASN A CG  1 
ATOM   1611 O OD1 . ASN A 1 215 ? 16.571  -10.913 54.468  1.00 47.24 ? 424  ASN A OD1 1 
ATOM   1612 N ND2 . ASN A 1 215 ? 14.724  -10.440 53.264  1.00 42.16 ? 424  ASN A ND2 1 
ATOM   1613 N N   . HIS A 1 216 ? 13.733  -14.036 56.532  1.00 44.79 ? 425  HIS A N   1 
ATOM   1614 C CA  . HIS A 1 216 ? 12.785  -13.862 57.643  1.00 45.61 ? 425  HIS A CA  1 
ATOM   1615 C C   . HIS A 1 216 ? 12.532  -15.232 58.309  1.00 46.58 ? 425  HIS A C   1 
ATOM   1616 O O   . HIS A 1 216 ? 11.416  -15.764 58.222  1.00 45.82 ? 425  HIS A O   1 
ATOM   1617 C CB  . HIS A 1 216 ? 11.442  -13.309 57.136  1.00 45.16 ? 425  HIS A CB  1 
ATOM   1618 C CG  . HIS A 1 216 ? 11.552  -12.010 56.397  1.00 44.18 ? 425  HIS A CG  1 
ATOM   1619 N ND1 . HIS A 1 216 ? 11.351  -10.791 57.002  1.00 43.68 ? 425  HIS A ND1 1 
ATOM   1620 C CD2 . HIS A 1 216 ? 11.819  -11.744 55.099  1.00 42.91 ? 425  HIS A CD2 1 
ATOM   1621 C CE1 . HIS A 1 216 ? 11.522  -9.826  56.115  1.00 44.01 ? 425  HIS A CE1 1 
ATOM   1622 N NE2 . HIS A 1 216 ? 11.803  -10.378 54.951  1.00 41.65 ? 425  HIS A NE2 1 
ATOM   1623 N N   . PRO A 1 217 ? 13.552  -15.787 58.999  1.00 47.67 ? 426  PRO A N   1 
ATOM   1624 C CA  . PRO A 1 217 ? 13.432  -17.163 59.495  1.00 48.78 ? 426  PRO A CA  1 
ATOM   1625 C C   . PRO A 1 217 ? 12.305  -17.296 60.525  1.00 49.70 ? 426  PRO A C   1 
ATOM   1626 O O   . PRO A 1 217 ? 11.600  -18.312 60.535  1.00 50.12 ? 426  PRO A O   1 
ATOM   1627 C CB  . PRO A 1 217 ? 14.801  -17.438 60.136  1.00 48.86 ? 426  PRO A CB  1 
ATOM   1628 C CG  . PRO A 1 217 ? 15.708  -16.359 59.661  1.00 48.41 ? 426  PRO A CG  1 
ATOM   1629 C CD  . PRO A 1 217 ? 14.825  -15.172 59.410  1.00 48.10 ? 426  PRO A CD  1 
ATOM   1630 N N   . ASP A 1 218 ? 12.108  -16.246 61.327  1.00 50.46 ? 427  ASP A N   1 
ATOM   1631 C CA  . ASP A 1 218 ? 11.119  -16.235 62.403  1.00 51.57 ? 427  ASP A CA  1 
ATOM   1632 C C   . ASP A 1 218 ? 9.697   -15.988 61.900  1.00 51.85 ? 427  ASP A C   1 
ATOM   1633 O O   . ASP A 1 218 ? 8.722   -16.264 62.611  1.00 52.35 ? 427  ASP A O   1 
ATOM   1634 C CB  . ASP A 1 218 ? 11.474  -15.160 63.443  1.00 52.15 ? 427  ASP A CB  1 
ATOM   1635 C CG  . ASP A 1 218 ? 12.725  -15.498 64.269  1.00 54.17 ? 427  ASP A CG  1 
ATOM   1636 O OD1 . ASP A 1 218 ? 13.273  -16.627 64.154  1.00 55.04 ? 427  ASP A OD1 1 
ATOM   1637 O OD2 . ASP A 1 218 ? 13.159  -14.607 65.046  1.00 56.96 ? 427  ASP A OD2 1 
ATOM   1638 N N   . ALA A 1 219 ? 9.573   -15.446 60.692  1.00 51.72 ? 428  ALA A N   1 
ATOM   1639 C CA  . ALA A 1 219 ? 8.264   -15.096 60.156  1.00 51.38 ? 428  ALA A CA  1 
ATOM   1640 C C   . ALA A 1 219 ? 7.643   -16.297 59.451  1.00 51.35 ? 428  ALA A C   1 
ATOM   1641 O O   . ALA A 1 219 ? 7.614   -16.399 58.211  1.00 51.58 ? 428  ALA A O   1 
ATOM   1642 C CB  . ALA A 1 219 ? 8.355   -13.886 59.232  1.00 51.43 ? 428  ALA A CB  1 
ATOM   1643 N N   . GLN A 1 220 ? 7.160   -17.224 60.264  1.00 50.71 ? 429  GLN A N   1 
ATOM   1644 C CA  . GLN A 1 220 ? 6.354   -18.304 59.759  1.00 50.19 ? 429  GLN A CA  1 
ATOM   1645 C C   . GLN A 1 220 ? 5.089   -17.680 59.152  1.00 49.57 ? 429  GLN A C   1 
ATOM   1646 O O   . GLN A 1 220 ? 4.632   -16.610 59.589  1.00 50.21 ? 429  GLN A O   1 
ATOM   1647 C CB  . GLN A 1 220 ? 6.016   -19.288 60.892  1.00 50.58 ? 429  GLN A CB  1 
ATOM   1648 N N   . GLN A 1 221 ? 4.552   -18.336 58.127  1.00 47.92 ? 430  GLN A N   1 
ATOM   1649 C CA  . GLN A 1 221 ? 3.305   -17.928 57.464  1.00 46.17 ? 430  GLN A CA  1 
ATOM   1650 C C   . GLN A 1 221 ? 3.432   -16.655 56.607  1.00 44.03 ? 430  GLN A C   1 
ATOM   1651 O O   . GLN A 1 221 ? 2.435   -16.181 56.073  1.00 43.06 ? 430  GLN A O   1 
ATOM   1652 C CB  . GLN A 1 221 ? 2.120   -17.806 58.453  1.00 46.81 ? 430  GLN A CB  1 
ATOM   1653 C CG  . GLN A 1 221 ? 2.123   -18.804 59.645  1.00 49.93 ? 430  GLN A CG  1 
ATOM   1654 C CD  . GLN A 1 221 ? 1.547   -20.172 59.309  1.00 53.97 ? 430  GLN A CD  1 
ATOM   1655 O OE1 . GLN A 1 221 ? 1.169   -20.439 58.167  1.00 55.72 ? 430  GLN A OE1 1 
ATOM   1656 N NE2 . GLN A 1 221 ? 1.474   -21.052 60.317  1.00 55.01 ? 430  GLN A NE2 1 
ATOM   1657 N N   . LEU A 1 222 ? 4.645   -16.126 56.454  1.00 41.29 ? 431  LEU A N   1 
ATOM   1658 C CA  . LEU A 1 222 ? 4.852   -14.937 55.621  1.00 39.79 ? 431  LEU A CA  1 
ATOM   1659 C C   . LEU A 1 222 ? 4.488   -15.188 54.153  1.00 38.46 ? 431  LEU A C   1 
ATOM   1660 O O   . LEU A 1 222 ? 3.809   -14.367 53.542  1.00 39.08 ? 431  LEU A O   1 
ATOM   1661 C CB  . LEU A 1 222 ? 6.288   -14.392 55.752  1.00 39.89 ? 431  LEU A CB  1 
ATOM   1662 C CG  . LEU A 1 222 ? 6.638   -13.032 55.120  1.00 40.23 ? 431  LEU A CG  1 
ATOM   1663 C CD1 . LEU A 1 222 ? 5.650   -11.905 55.470  1.00 39.26 ? 431  LEU A CD1 1 
ATOM   1664 C CD2 . LEU A 1 222 ? 8.051   -12.629 55.510  1.00 39.44 ? 431  LEU A CD2 1 
ATOM   1665 N N   . PHE A 1 223 ? 4.899   -16.337 53.615  1.00 36.35 ? 432  PHE A N   1 
ATOM   1666 C CA  . PHE A 1 223 ? 4.659   -16.669 52.206  1.00 35.15 ? 432  PHE A CA  1 
ATOM   1667 C C   . PHE A 1 223 ? 3.157   -16.796 51.834  1.00 34.47 ? 432  PHE A C   1 
ATOM   1668 O O   . PHE A 1 223 ? 2.726   -16.191 50.857  1.00 34.84 ? 432  PHE A O   1 
ATOM   1669 C CB  . PHE A 1 223 ? 5.482   -17.875 51.771  1.00 34.10 ? 432  PHE A CB  1 
ATOM   1670 C CG  . PHE A 1 223 ? 5.358   -18.197 50.308  1.00 34.36 ? 432  PHE A CG  1 
ATOM   1671 C CD1 . PHE A 1 223 ? 5.894   -17.356 49.341  1.00 32.81 ? 432  PHE A CD1 1 
ATOM   1672 C CD2 . PHE A 1 223 ? 4.705   -19.339 49.897  1.00 34.82 ? 432  PHE A CD2 1 
ATOM   1673 C CE1 . PHE A 1 223 ? 5.776   -17.656 47.990  1.00 31.08 ? 432  PHE A CE1 1 
ATOM   1674 C CE2 . PHE A 1 223 ? 4.582   -19.642 48.541  1.00 35.42 ? 432  PHE A CE2 1 
ATOM   1675 C CZ  . PHE A 1 223 ? 5.123   -18.789 47.595  1.00 33.19 ? 432  PHE A CZ  1 
ATOM   1676 N N   . PRO A 1 224 ? 2.367   -17.578 52.604  1.00 33.82 ? 433  PRO A N   1 
ATOM   1677 C CA  . PRO A 1 224 ? 0.907   -17.537 52.415  1.00 33.28 ? 433  PRO A CA  1 
ATOM   1678 C C   . PRO A 1 224 ? 0.329   -16.128 52.584  1.00 32.31 ? 433  PRO A C   1 
ATOM   1679 O O   . PRO A 1 224 ? -0.566  -15.750 51.852  1.00 32.06 ? 433  PRO A O   1 
ATOM   1680 C CB  . PRO A 1 224 ? 0.374   -18.454 53.525  1.00 34.01 ? 433  PRO A CB  1 
ATOM   1681 C CG  . PRO A 1 224 ? 1.521   -19.352 53.897  1.00 33.79 ? 433  PRO A CG  1 
ATOM   1682 C CD  . PRO A 1 224 ? 2.759   -18.530 53.666  1.00 33.97 ? 433  PRO A CD  1 
ATOM   1683 N N   . LYS A 1 225 ? 0.833   -15.359 53.543  1.00 32.33 ? 434  LYS A N   1 
ATOM   1684 C CA  . LYS A 1 225 ? 0.391   -13.973 53.726  1.00 31.84 ? 434  LYS A CA  1 
ATOM   1685 C C   . LYS A 1 225 ? 0.589   -13.136 52.471  1.00 31.29 ? 434  LYS A C   1 
ATOM   1686 O O   . LYS A 1 225 ? -0.313  -12.390 52.064  1.00 31.11 ? 434  LYS A O   1 
ATOM   1687 C CB  . LYS A 1 225 ? 1.129   -13.316 54.887  1.00 32.59 ? 434  LYS A CB  1 
ATOM   1688 C CG  . LYS A 1 225 ? 0.648   -13.797 56.254  1.00 32.82 ? 434  LYS A CG  1 
ATOM   1689 C CD  . LYS A 1 225 ? 1.432   -13.104 57.346  1.00 35.26 ? 434  LYS A CD  1 
ATOM   1690 C CE  . LYS A 1 225 ? 1.190   -13.758 58.703  1.00 38.76 ? 434  LYS A CE  1 
ATOM   1691 N NZ  . LYS A 1 225 ? 1.185   -12.703 59.756  1.00 39.82 ? 434  LYS A NZ  1 
ATOM   1692 N N   . LEU A 1 226 ? 1.768   -13.275 51.868  1.00 29.59 ? 435  LEU A N   1 
ATOM   1693 C CA  . LEU A 1 226 ? 2.100   -12.618 50.583  1.00 28.86 ? 435  LEU A CA  1 
ATOM   1694 C C   . LEU A 1 226 ? 1.247   -13.050 49.403  1.00 28.51 ? 435  LEU A C   1 
ATOM   1695 O O   . LEU A 1 226 ? 0.801   -12.203 48.632  1.00 27.73 ? 435  LEU A O   1 
ATOM   1696 C CB  . LEU A 1 226 ? 3.584   -12.783 50.261  1.00 28.35 ? 435  LEU A CB  1 
ATOM   1697 C CG  . LEU A 1 226 ? 4.462   -11.984 51.221  1.00 27.98 ? 435  LEU A CG  1 
ATOM   1698 C CD1 . LEU A 1 226 ? 5.955   -12.105 50.855  1.00 31.74 ? 435  LEU A CD1 1 
ATOM   1699 C CD2 . LEU A 1 226 ? 4.060   -10.504 51.221  1.00 27.10 ? 435  LEU A CD2 1 
ATOM   1700 N N   . LEU A 1 227 ? 1.008   -14.359 49.272  1.00 28.27 ? 436  LEU A N   1 
ATOM   1701 C CA  . LEU A 1 227 ? 0.092   -14.848 48.258  1.00 28.40 ? 436  LEU A CA  1 
ATOM   1702 C C   . LEU A 1 227 ? -1.290  -14.187 48.387  1.00 28.50 ? 436  LEU A C   1 
ATOM   1703 O O   . LEU A 1 227 ? -1.869  -13.804 47.387  1.00 28.13 ? 436  LEU A O   1 
ATOM   1704 C CB  . LEU A 1 227 ? -0.009  -16.380 48.286  1.00 29.11 ? 436  LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 227 ? 1.226   -17.189 47.837  1.00 30.42 ? 436  LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 227 ? 1.003   -18.705 47.942  1.00 31.39 ? 436  LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 227 ? 1.633   -16.828 46.410  1.00 32.61 ? 436  LEU A CD2 1 
ATOM   1708 N N   . GLN A 1 228 ? -1.777  -14.029 49.623  1.00 28.16 ? 437  GLN A N   1 
ATOM   1709 C CA  . GLN A 1 228 ? -3.064  -13.360 49.900  1.00 27.90 ? 437  GLN A CA  1 
ATOM   1710 C C   . GLN A 1 228 ? -3.016  -11.847 49.606  1.00 27.02 ? 437  GLN A C   1 
ATOM   1711 O O   . GLN A 1 228 ? -4.009  -11.279 49.141  1.00 27.42 ? 437  GLN A O   1 
ATOM   1712 C CB  . GLN A 1 228 ? -3.514  -13.601 51.357  1.00 27.91 ? 437  GLN A CB  1 
ATOM   1713 C CG  . GLN A 1 228 ? -4.900  -12.942 51.710  1.00 28.71 ? 437  GLN A CG  1 
ATOM   1714 C CD  . GLN A 1 228 ? -6.018  -13.417 50.797  1.00 31.54 ? 437  GLN A CD  1 
ATOM   1715 O OE1 . GLN A 1 228 ? -6.789  -12.614 50.274  1.00 35.69 ? 437  GLN A OE1 1 
ATOM   1716 N NE2 . GLN A 1 228 ? -6.101  -14.724 50.583  1.00 30.48 ? 437  GLN A NE2 1 
ATOM   1717 N N   . LYS A 1 229 ? -1.868  -11.209 49.851  1.00 25.52 ? 438  LYS A N   1 
ATOM   1718 C CA  . LYS A 1 229 ? -1.667  -9.794  49.473  1.00 24.68 ? 438  LYS A CA  1 
ATOM   1719 C C   . LYS A 1 229 ? -1.800  -9.555  47.953  1.00 24.42 ? 438  LYS A C   1 
ATOM   1720 O O   . LYS A 1 229 ? -2.246  -8.480  47.538  1.00 22.48 ? 438  LYS A O   1 
ATOM   1721 C CB  . LYS A 1 229 ? -0.300  -9.252  49.940  1.00 25.09 ? 438  LYS A CB  1 
ATOM   1722 C CG  . LYS A 1 229 ? -0.151  -9.032  51.457  1.00 25.61 ? 438  LYS A CG  1 
ATOM   1723 C CD  . LYS A 1 229 ? -1.235  -8.108  52.050  1.00 25.59 ? 438  LYS A CD  1 
ATOM   1724 C CE  . LYS A 1 229 ? -1.044  -7.984  53.593  1.00 28.40 ? 438  LYS A CE  1 
ATOM   1725 N NZ  . LYS A 1 229 ? -2.261  -7.362  54.226  1.00 27.71 ? 438  LYS A NZ  1 
ATOM   1726 N N   . MET A 1 230 ? -1.367  -10.530 47.145  1.00 24.94 ? 439  MET A N   1 
ATOM   1727 C CA  . MET A 1 230 ? -1.480  -10.440 45.681  1.00 26.60 ? 439  MET A CA  1 
ATOM   1728 C C   . MET A 1 230 ? -2.967  -10.449 45.256  1.00 25.66 ? 439  MET A C   1 
ATOM   1729 O O   . MET A 1 230 ? -3.367  -9.740  44.336  1.00 26.74 ? 439  MET A O   1 
ATOM   1730 C CB  . MET A 1 230 ? -0.720  -11.594 45.006  1.00 26.68 ? 439  MET A CB  1 
ATOM   1731 C CG  . MET A 1 230 ? 0.841   -11.595 45.225  1.00 27.65 ? 439  MET A CG  1 
ATOM   1732 S SD  . MET A 1 230 ? 1.641   -13.122 44.616  1.00 31.97 ? 439  MET A SD  1 
ATOM   1733 C CE  . MET A 1 230 ? 1.432   -12.901 42.855  1.00 31.59 ? 439  MET A CE  1 
ATOM   1734 N N   . ALA A 1 231 ? -3.767  -11.281 45.894  1.00 25.70 ? 440  ALA A N   1 
ATOM   1735 C CA  . ALA A 1 231 ? -5.225  -11.276 45.624  1.00 26.59 ? 440  ALA A CA  1 
ATOM   1736 C C   . ALA A 1 231 ? -5.869  -10.004 46.173  1.00 26.32 ? 440  ALA A C   1 
ATOM   1737 O O   . ALA A 1 231 ? -6.772  -9.444  45.567  1.00 27.22 ? 440  ALA A O   1 
ATOM   1738 C CB  . ALA A 1 231 ? -5.883  -12.538 46.183  1.00 26.59 ? 440  ALA A CB  1 
ATOM   1739 N N   . ASP A 1 232 ? -5.382  -9.524  47.316  1.00 26.66 ? 441  ASP A N   1 
ATOM   1740 C CA  . ASP A 1 232 ? -5.789  -8.235  47.842  1.00 26.82 ? 441  ASP A CA  1 
ATOM   1741 C C   . ASP A 1 232 ? -5.529  -7.091  46.869  1.00 26.24 ? 441  ASP A C   1 
ATOM   1742 O O   . ASP A 1 232 ? -6.388  -6.200  46.697  1.00 25.37 ? 441  ASP A O   1 
ATOM   1743 C CB  . ASP A 1 232 ? -5.108  -7.961  49.194  1.00 27.67 ? 441  ASP A CB  1 
ATOM   1744 C CG  . ASP A 1 232 ? -5.592  -8.885  50.277  1.00 31.48 ? 441  ASP A CG  1 
ATOM   1745 O OD1 . ASP A 1 232 ? -6.586  -9.630  50.037  1.00 34.20 ? 441  ASP A OD1 1 
ATOM   1746 O OD2 . ASP A 1 232 ? -4.983  -8.886  51.367  1.00 34.86 ? 441  ASP A OD2 1 
ATOM   1747 N N   . LEU A 1 233 ? -4.355  -7.118  46.227  1.00 24.65 ? 442  LEU A N   1 
ATOM   1748 C CA  . LEU A 1 233 ? -3.969  -6.084  45.258  1.00 23.86 ? 442  LEU A CA  1 
ATOM   1749 C C   . LEU A 1 233 ? -4.806  -6.156  43.969  1.00 24.05 ? 442  LEU A C   1 
ATOM   1750 O O   . LEU A 1 233 ? -5.103  -5.155  43.362  1.00 23.65 ? 442  LEU A O   1 
ATOM   1751 C CB  . LEU A 1 233 ? -2.487  -6.255  44.891  1.00 22.35 ? 442  LEU A CB  1 
ATOM   1752 C CG  . LEU A 1 233 ? -1.469  -5.737  45.903  1.00 20.17 ? 442  LEU A CG  1 
ATOM   1753 C CD1 . LEU A 1 233 ? -0.072  -6.294  45.599  1.00 17.74 ? 442  LEU A CD1 1 
ATOM   1754 C CD2 . LEU A 1 233 ? -1.449  -4.210  45.859  1.00 17.59 ? 442  LEU A CD2 1 
ATOM   1755 N N   . ARG A 1 234 ? -5.092  -7.361  43.510  1.00 24.88 ? 443  ARG A N   1 
ATOM   1756 C CA  . ARG A 1 234 ? -5.957  -7.539  42.362  1.00 25.85 ? 443  ARG A CA  1 
ATOM   1757 C C   . ARG A 1 234 ? -7.314  -6.856  42.617  1.00 25.10 ? 443  ARG A C   1 
ATOM   1758 O O   . ARG A 1 234 ? -7.825  -6.139  41.767  1.00 24.30 ? 443  ARG A O   1 
ATOM   1759 C CB  . ARG A 1 234 ? -6.143  -9.039  42.114  1.00 26.72 ? 443  ARG A CB  1 
ATOM   1760 C CG  . ARG A 1 234 ? -7.095  -9.383  40.971  1.00 31.03 ? 443  ARG A CG  1 
ATOM   1761 C CD  . ARG A 1 234 ? -6.336  -9.806  39.757  1.00 37.84 ? 443  ARG A CD  1 
ATOM   1762 N NE  . ARG A 1 234 ? -5.547  -11.019 39.967  1.00 44.16 ? 443  ARG A NE  1 
ATOM   1763 C CZ  . ARG A 1 234 ? -5.873  -12.235 39.529  1.00 47.32 ? 443  ARG A CZ  1 
ATOM   1764 N NH1 . ARG A 1 234 ? -6.999  -12.457 38.845  1.00 47.30 ? 443  ARG A NH1 1 
ATOM   1765 N NH2 . ARG A 1 234 ? -5.056  -13.243 39.784  1.00 48.49 ? 443  ARG A NH2 1 
ATOM   1766 N N   . GLN A 1 235 ? -7.851  -7.033  43.819  1.00 25.91 ? 444  GLN A N   1 
ATOM   1767 C CA  . GLN A 1 235 ? -9.120  -6.336  44.197  1.00 25.99 ? 444  GLN A CA  1 
ATOM   1768 C C   . GLN A 1 235 ? -8.938  -4.816  44.385  1.00 25.77 ? 444  GLN A C   1 
ATOM   1769 O O   . GLN A 1 235 ? -9.803  -4.028  43.965  1.00 25.15 ? 444  GLN A O   1 
ATOM   1770 C CB  . GLN A 1 235 ? -9.795  -6.996  45.419  1.00 25.13 ? 444  GLN A CB  1 
ATOM   1771 C CG  . GLN A 1 235 ? -11.135 -6.321  45.848  1.00 26.07 ? 444  GLN A CG  1 
ATOM   1772 C CD  . GLN A 1 235 ? -12.274 -6.473  44.811  1.00 25.84 ? 444  GLN A CD  1 
ATOM   1773 O OE1 . GLN A 1 235 ? -13.225 -5.689  44.800  1.00 28.77 ? 444  GLN A OE1 1 
ATOM   1774 N NE2 . GLN A 1 235 ? -12.181 -7.470  43.968  1.00 22.32 ? 444  GLN A NE2 1 
ATOM   1775 N N   . LEU A 1 236 ? -7.815  -4.397  44.982  1.00 24.85 ? 445  LEU A N   1 
ATOM   1776 C CA  . LEU A 1 236 ? -7.505  -2.948  45.101  1.00 24.10 ? 445  LEU A CA  1 
ATOM   1777 C C   . LEU A 1 236 ? -7.558  -2.295  43.726  1.00 24.08 ? 445  LEU A C   1 
ATOM   1778 O O   . LEU A 1 236 ? -8.113  -1.201  43.543  1.00 24.37 ? 445  LEU A O   1 
ATOM   1779 C CB  . LEU A 1 236 ? -6.124  -2.721  45.770  1.00 24.06 ? 445  LEU A CB  1 
ATOM   1780 C CG  . LEU A 1 236 ? -5.660  -1.318  46.180  1.00 25.30 ? 445  LEU A CG  1 
ATOM   1781 C CD1 . LEU A 1 236 ? -6.610  -0.685  47.221  1.00 26.18 ? 445  LEU A CD1 1 
ATOM   1782 C CD2 . LEU A 1 236 ? -4.218  -1.314  46.732  1.00 24.25 ? 445  LEU A CD2 1 
ATOM   1783 N N   . VAL A 1 237 ? -6.994  -2.989  42.741  1.00 24.34 ? 446  VAL A N   1 
ATOM   1784 C CA  . VAL A 1 237 ? -6.839  -2.422  41.410  1.00 23.50 ? 446  VAL A CA  1 
ATOM   1785 C C   . VAL A 1 237 ? -8.166  -2.484  40.625  1.00 24.18 ? 446  VAL A C   1 
ATOM   1786 O O   . VAL A 1 237 ? -8.491  -1.567  39.882  1.00 24.31 ? 446  VAL A O   1 
ATOM   1787 C CB  . VAL A 1 237 ? -5.696  -3.112  40.635  1.00 23.76 ? 446  VAL A CB  1 
ATOM   1788 C CG1 . VAL A 1 237 ? -5.736  -2.707  39.173  1.00 21.97 ? 446  VAL A CG1 1 
ATOM   1789 C CG2 . VAL A 1 237 ? -4.289  -2.767  41.271  1.00 20.60 ? 446  VAL A CG2 1 
ATOM   1790 N N   . THR A 1 238 ? -8.878  -3.589  40.756  1.00 25.25 ? 447  THR A N   1 
ATOM   1791 C CA  . THR A 1 238 ? -10.231 -3.719  40.175  1.00 25.93 ? 447  THR A CA  1 
ATOM   1792 C C   . THR A 1 238 ? -11.036 -2.510  40.603  1.00 25.95 ? 447  THR A C   1 
ATOM   1793 O O   . THR A 1 238 ? -11.572 -1.805  39.764  1.00 26.43 ? 447  THR A O   1 
ATOM   1794 C CB  . THR A 1 238 ? -10.874 -5.027  40.624  1.00 26.17 ? 447  THR A CB  1 
ATOM   1795 O OG1 . THR A 1 238 ? -10.019 -6.107  40.233  1.00 25.27 ? 447  THR A OG1 1 
ATOM   1796 C CG2 . THR A 1 238 ? -12.313 -5.229  39.992  1.00 27.10 ? 447  THR A CG2 1 
ATOM   1797 N N   . GLU A 1 239 ? -11.069 -2.250  41.910  1.00 26.18 ? 448  GLU A N   1 
ATOM   1798 C CA  . GLU A 1 239 ? -11.781 -1.109  42.457  1.00 27.79 ? 448  GLU A CA  1 
ATOM   1799 C C   . GLU A 1 239 ? -11.239 0.260   42.014  1.00 27.56 ? 448  GLU A C   1 
ATOM   1800 O O   . GLU A 1 239 ? -12.014 1.191   41.775  1.00 26.53 ? 448  GLU A O   1 
ATOM   1801 C CB  . GLU A 1 239 ? -11.887 -1.223  43.982  1.00 28.21 ? 448  GLU A CB  1 
ATOM   1802 C CG  . GLU A 1 239 ? -12.822 -2.367  44.440  1.00 30.46 ? 448  GLU A CG  1 
ATOM   1803 C CD  . GLU A 1 239 ? -13.017 -2.415  45.953  1.00 31.46 ? 448  GLU A CD  1 
ATOM   1804 O OE1 . GLU A 1 239 ? -13.269 -1.338  46.541  1.00 38.16 ? 448  GLU A OE1 1 
ATOM   1805 O OE2 . GLU A 1 239 ? -12.945 -3.518  46.557  1.00 34.43 ? 448  GLU A OE2 1 
ATOM   1806 N N   . HIS A 1 240 ? -9.911  0.377   41.889  1.00 25.95 ? 449  HIS A N   1 
ATOM   1807 C CA  . HIS A 1 240 ? -9.291  1.586   41.350  1.00 25.04 ? 449  HIS A CA  1 
ATOM   1808 C C   . HIS A 1 240 ? -9.701  1.870   39.913  1.00 24.71 ? 449  HIS A C   1 
ATOM   1809 O O   . HIS A 1 240 ? -10.059 3.010   39.595  1.00 24.96 ? 449  HIS A O   1 
ATOM   1810 C CB  . HIS A 1 240 ? -7.746  1.490   41.447  1.00 24.75 ? 449  HIS A CB  1 
ATOM   1811 C CG  . HIS A 1 240 ? -7.041  2.719   40.968  1.00 24.36 ? 449  HIS A CG  1 
ATOM   1812 N ND1 . HIS A 1 240 ? -7.067  3.904   41.660  1.00 25.77 ? 449  HIS A ND1 1 
ATOM   1813 C CD2 . HIS A 1 240 ? -6.279  2.942   39.876  1.00 23.18 ? 449  HIS A CD2 1 
ATOM   1814 C CE1 . HIS A 1 240 ? -6.359  4.809   41.015  1.00 25.25 ? 449  HIS A CE1 1 
ATOM   1815 N NE2 . HIS A 1 240 ? -5.890  4.255   39.915  1.00 25.57 ? 449  HIS A NE2 1 
ATOM   1816 N N   . ALA A 1 241 ? -9.634  0.839   39.055  1.00 25.63 ? 450  ALA A N   1 
ATOM   1817 C CA  . ALA A 1 241 ? -10.022 0.909   37.653  1.00 26.36 ? 450  ALA A CA  1 
ATOM   1818 C C   . ALA A 1 241 ? -11.477 1.386   37.519  1.00 27.92 ? 450  ALA A C   1 
ATOM   1819 O O   . ALA A 1 241 ? -11.779 2.270   36.719  1.00 29.01 ? 450  ALA A O   1 
ATOM   1820 C CB  . ALA A 1 241 ? -9.876  -0.470  37.004  1.00 26.76 ? 450  ALA A CB  1 
ATOM   1821 N N   . GLN A 1 242 ? -12.362 0.795   38.310  1.00 28.89 ? 451  GLN A N   1 
ATOM   1822 C CA  . GLN A 1 242 ? -13.799 1.208   38.331  1.00 30.84 ? 451  GLN A CA  1 
ATOM   1823 C C   . GLN A 1 242 ? -13.921 2.709   38.605  1.00 31.35 ? 451  GLN A C   1 
ATOM   1824 O O   . GLN A 1 242 ? -14.672 3.395   37.918  1.00 31.80 ? 451  GLN A O   1 
ATOM   1825 C CB  . GLN A 1 242 ? -14.590 0.406   39.377  1.00 30.13 ? 451  GLN A CB  1 
ATOM   1826 C CG  . GLN A 1 242 ? -14.750 -1.097  39.042  1.00 31.15 ? 451  GLN A CG  1 
ATOM   1827 C CD  . GLN A 1 242 ? -15.171 -1.942  40.239  1.00 31.87 ? 451  GLN A CD  1 
ATOM   1828 O OE1 . GLN A 1 242 ? -15.345 -1.423  41.342  1.00 36.17 ? 451  GLN A OE1 1 
ATOM   1829 N NE2 . GLN A 1 242 ? -15.295 -3.267  40.038  1.00 30.01 ? 451  GLN A NE2 1 
ATOM   1830 N N   . MET A 1 243 ? -13.162 3.222   39.578  1.00 31.90 ? 452  MET A N   1 
ATOM   1831 C CA  . MET A 1 243 ? -13.163 4.661   39.890  1.00 33.58 ? 452  MET A CA  1 
ATOM   1832 C C   . MET A 1 243 ? -12.527 5.540   38.813  1.00 32.96 ? 452  MET A C   1 
ATOM   1833 O O   . MET A 1 243 ? -12.976 6.669   38.572  1.00 32.18 ? 452  MET A O   1 
ATOM   1834 C CB  . MET A 1 243 ? -12.467 4.930   41.224  1.00 33.75 ? 452  MET A CB  1 
ATOM   1835 C CG  . MET A 1 243 ? -13.145 4.262   42.446  1.00 35.30 ? 452  MET A CG  1 
ATOM   1836 S SD  . MET A 1 243 ? -12.395 4.722   44.023  1.00 39.58 ? 452  MET A SD  1 
ATOM   1837 C CE  . MET A 1 243 ? -10.835 3.867   43.909  1.00 36.13 ? 452  MET A CE  1 
ATOM   1838 N N   . MET A 1 244 ? -11.453 5.053   38.202  1.00 32.10 ? 453  MET A N   1 
ATOM   1839 C CA  . MET A 1 244 ? -10.801 5.780   37.112  1.00 32.30 ? 453  MET A CA  1 
ATOM   1840 C C   . MET A 1 244 ? -11.714 5.831   35.882  1.00 33.67 ? 453  MET A C   1 
ATOM   1841 O O   . MET A 1 244 ? -11.866 6.883   35.265  1.00 32.89 ? 453  MET A O   1 
ATOM   1842 C CB  . MET A 1 244 ? -9.447  5.153   36.753  1.00 30.90 ? 453  MET A CB  1 
ATOM   1843 C CG  . MET A 1 244 ? -8.390  5.271   37.850  1.00 29.08 ? 453  MET A CG  1 
ATOM   1844 S SD  . MET A 1 244 ? -7.962  6.973   38.224  1.00 26.72 ? 453  MET A SD  1 
ATOM   1845 C CE  . MET A 1 244 ? -6.984  7.386   36.789  1.00 30.20 ? 453  MET A CE  1 
ATOM   1846 N N   . GLN A 1 245 ? -12.312 4.692   35.543  1.00 35.51 ? 454  GLN A N   1 
ATOM   1847 C CA  . GLN A 1 245 ? -13.266 4.608   34.418  1.00 38.00 ? 454  GLN A CA  1 
ATOM   1848 C C   . GLN A 1 245 ? -14.447 5.571   34.570  1.00 39.28 ? 454  GLN A C   1 
ATOM   1849 O O   . GLN A 1 245 ? -14.968 6.069   33.582  1.00 40.22 ? 454  GLN A O   1 
ATOM   1850 C CB  . GLN A 1 245 ? -13.750 3.165   34.230  1.00 37.33 ? 454  GLN A CB  1 
ATOM   1851 C CG  . GLN A 1 245 ? -12.690 2.265   33.609  1.00 38.51 ? 454  GLN A CG  1 
ATOM   1852 C CD  . GLN A 1 245 ? -12.878 0.765   33.886  1.00 40.06 ? 454  GLN A CD  1 
ATOM   1853 O OE1 . GLN A 1 245 ? -13.791 0.336   34.626  1.00 40.14 ? 454  GLN A OE1 1 
ATOM   1854 N NE2 . GLN A 1 245 ? -11.989 -0.042  33.308  1.00 37.48 ? 454  GLN A NE2 1 
ATOM   1855 N N   . ARG A 1 246 ? -14.831 5.844   35.814  1.00 41.48 ? 455  ARG A N   1 
ATOM   1856 C CA  . ARG A 1 246 ? -15.953 6.715   36.156  1.00 43.23 ? 455  ARG A CA  1 
ATOM   1857 C C   . ARG A 1 246 ? -15.575 8.198   36.114  1.00 44.66 ? 455  ARG A C   1 
ATOM   1858 O O   . ARG A 1 246 ? -16.412 9.052   35.790  1.00 44.61 ? 455  ARG A O   1 
ATOM   1859 C CB  . ARG A 1 246 ? -16.475 6.364   37.558  1.00 42.93 ? 455  ARG A CB  1 
ATOM   1860 C CG  . ARG A 1 246 ? -17.931 6.788   37.829  1.00 44.22 ? 455  ARG A CG  1 
ATOM   1861 C CD  . ARG A 1 246 ? -18.442 6.370   39.218  1.00 43.80 ? 455  ARG A CD  1 
ATOM   1862 N NE  . ARG A 1 246 ? -18.708 4.931   39.305  1.00 46.02 ? 455  ARG A NE  1 
ATOM   1863 C CZ  . ARG A 1 246 ? -18.002 4.071   40.050  1.00 48.07 ? 455  ARG A CZ  1 
ATOM   1864 N NH1 . ARG A 1 246 ? -16.980 4.486   40.805  1.00 50.68 ? 455  ARG A NH1 1 
ATOM   1865 N NH2 . ARG A 1 246 ? -18.311 2.785   40.045  1.00 47.18 ? 455  ARG A NH2 1 
ATOM   1866 N N   . ILE A 1 247 ? -14.340 8.516   36.497  1.00 45.90 ? 456  ILE A N   1 
ATOM   1867 C CA  . ILE A 1 247 ? -13.837 9.892   36.410  1.00 47.67 ? 456  ILE A CA  1 
ATOM   1868 C C   . ILE A 1 247 ? -13.831 10.317  34.938  1.00 48.98 ? 456  ILE A C   1 
ATOM   1869 O O   . ILE A 1 247 ? -14.138 11.462  34.609  1.00 48.78 ? 456  ILE A O   1 
ATOM   1870 C CB  . ILE A 1 247 ? -12.406 10.038  37.037  1.00 47.81 ? 456  ILE A CB  1 
ATOM   1871 C CG1 . ILE A 1 247 ? -12.457 9.922   38.565  1.00 47.59 ? 456  ILE A CG1 1 
ATOM   1872 C CG2 . ILE A 1 247 ? -11.737 11.362  36.630  1.00 47.04 ? 456  ILE A CG2 1 
ATOM   1873 C CD1 . ILE A 1 247 ? -11.080 9.868   39.232  1.00 47.57 ? 456  ILE A CD1 1 
ATOM   1874 N N   . LYS A 1 248 ? -13.495 9.373   34.062  1.00 51.00 ? 457  LYS A N   1 
ATOM   1875 C CA  . LYS A 1 248 ? -13.511 9.591   32.617  1.00 53.39 ? 457  LYS A CA  1 
ATOM   1876 C C   . LYS A 1 248 ? -14.898 10.020  32.123  1.00 54.69 ? 457  LYS A C   1 
ATOM   1877 O O   . LYS A 1 248 ? -15.009 10.901  31.267  1.00 54.84 ? 457  LYS A O   1 
ATOM   1878 C CB  . LYS A 1 248 ? -13.027 8.336   31.880  1.00 53.02 ? 457  LYS A CB  1 
ATOM   1879 C CG  . LYS A 1 248 ? -12.930 8.486   30.352  1.00 54.35 ? 457  LYS A CG  1 
ATOM   1880 C CD  . LYS A 1 248 ? -12.506 7.183   29.669  1.00 54.60 ? 457  LYS A CD  1 
ATOM   1881 C CE  . LYS A 1 248 ? -10.984 6.942   29.752  1.00 56.53 ? 457  LYS A CE  1 
ATOM   1882 N NZ  . LYS A 1 248 ? -10.243 7.342   28.508  1.00 57.56 ? 457  LYS A NZ  1 
ATOM   1883 N N   . LYS A 1 249 ? -15.952 9.418   32.671  1.00 56.47 ? 458  LYS A N   1 
ATOM   1884 C CA  . LYS A 1 249 ? -17.309 9.765   32.242  1.00 58.21 ? 458  LYS A CA  1 
ATOM   1885 C C   . LYS A 1 249 ? -17.834 11.053  32.889  1.00 58.95 ? 458  LYS A C   1 
ATOM   1886 O O   . LYS A 1 249 ? -18.211 11.986  32.176  1.00 59.67 ? 458  LYS A O   1 
ATOM   1887 C CB  . LYS A 1 249 ? -18.289 8.592   32.418  1.00 58.56 ? 458  LYS A CB  1 
ATOM   1888 C CG  . LYS A 1 249 ? -18.950 8.476   33.799  1.00 59.99 ? 458  LYS A CG  1 
ATOM   1889 C CD  . LYS A 1 249 ? -20.411 8.031   33.683  1.00 62.42 ? 458  LYS A CD  1 
ATOM   1890 C CE  . LYS A 1 249 ? -21.330 9.176   33.223  1.00 63.58 ? 458  LYS A CE  1 
ATOM   1891 N NZ  . LYS A 1 249 ? -22.560 8.672   32.523  1.00 63.41 ? 458  LYS A NZ  1 
ATOM   1892 N N   . THR A 1 250 ? -17.827 11.104  34.225  1.00 59.47 ? 459  THR A N   1 
ATOM   1893 C CA  . THR A 1 250 ? -18.440 12.195  34.999  1.00 59.87 ? 459  THR A CA  1 
ATOM   1894 C C   . THR A 1 250 ? -17.622 13.495  35.039  1.00 59.87 ? 459  THR A C   1 
ATOM   1895 O O   . THR A 1 250 ? -18.184 14.592  34.952  1.00 59.97 ? 459  THR A O   1 
ATOM   1896 C CB  . THR A 1 250 ? -18.759 11.757  36.456  1.00 60.01 ? 459  THR A CB  1 
ATOM   1897 O OG1 . THR A 1 250 ? -17.625 11.086  37.026  1.00 61.19 ? 459  THR A OG1 1 
ATOM   1898 C CG2 . THR A 1 250 ? -19.966 10.824  36.498  1.00 60.56 ? 459  THR A CG2 1 
ATOM   1899 N N   . GLU A 1 251 ? -16.303 13.372  35.175  1.00 59.84 ? 460  GLU A N   1 
ATOM   1900 C CA  . GLU A 1 251 ? -15.414 14.534  35.284  1.00 59.43 ? 460  GLU A CA  1 
ATOM   1901 C C   . GLU A 1 251 ? -14.798 14.838  33.933  1.00 59.07 ? 460  GLU A C   1 
ATOM   1902 O O   . GLU A 1 251 ? -13.576 14.755  33.765  1.00 58.97 ? 460  GLU A O   1 
ATOM   1903 C CB  . GLU A 1 251 ? -14.298 14.256  36.298  1.00 59.77 ? 460  GLU A CB  1 
ATOM   1904 C CG  . GLU A 1 251 ? -14.734 14.222  37.744  1.00 60.65 ? 460  GLU A CG  1 
ATOM   1905 C CD  . GLU A 1 251 ? -14.735 15.594  38.382  1.00 62.96 ? 460  GLU A CD  1 
ATOM   1906 O OE1 . GLU A 1 251 ? -14.154 16.538  37.794  1.00 63.07 ? 460  GLU A OE1 1 
ATOM   1907 O OE2 . GLU A 1 251 ? -15.310 15.727  39.486  1.00 64.53 ? 460  GLU A OE2 1 
ATOM   1908 N N   . THR A 1 252 ? -15.638 15.202  32.971  1.00 58.49 ? 461  THR A N   1 
ATOM   1909 C CA  . THR A 1 252 ? -15.203 15.314  31.569  1.00 58.13 ? 461  THR A CA  1 
ATOM   1910 C C   . THR A 1 252 ? -14.104 16.366  31.292  1.00 57.28 ? 461  THR A C   1 
ATOM   1911 O O   . THR A 1 252 ? -13.338 16.237  30.327  1.00 57.62 ? 461  THR A O   1 
ATOM   1912 C CB  . THR A 1 252 ? -16.405 15.491  30.612  1.00 58.31 ? 461  THR A CB  1 
ATOM   1913 O OG1 . THR A 1 252 ? -15.930 15.578  29.259  1.00 58.93 ? 461  THR A OG1 1 
ATOM   1914 C CG2 . THR A 1 252 ? -17.225 16.741  30.978  1.00 58.43 ? 461  THR A CG2 1 
ATOM   1915 N N   . GLU A 1 253 ? -14.026 17.378  32.153  1.00 55.97 ? 462  GLU A N   1 
ATOM   1916 C CA  . GLU A 1 253 ? -13.030 18.443  32.042  1.00 54.80 ? 462  GLU A CA  1 
ATOM   1917 C C   . GLU A 1 253 ? -11.616 18.012  32.452  1.00 53.96 ? 462  GLU A C   1 
ATOM   1918 O O   . GLU A 1 253 ? -10.635 18.688  32.125  1.00 54.04 ? 462  GLU A O   1 
ATOM   1919 C CB  . GLU A 1 253 ? -13.469 19.647  32.872  1.00 55.13 ? 462  GLU A CB  1 
ATOM   1920 N N   . THR A 1 254 ? -11.506 16.902  33.181  1.00 52.40 ? 463  THR A N   1 
ATOM   1921 C CA  . THR A 1 254 ? -10.206 16.482  33.715  1.00 50.52 ? 463  THR A CA  1 
ATOM   1922 C C   . THR A 1 254 ? -9.604  15.378  32.850  1.00 48.95 ? 463  THR A C   1 
ATOM   1923 O O   . THR A 1 254 ? -10.220 14.336  32.632  1.00 48.94 ? 463  THR A O   1 
ATOM   1924 C CB  . THR A 1 254 ? -10.289 16.061  35.202  1.00 50.66 ? 463  THR A CB  1 
ATOM   1925 O OG1 . THR A 1 254 ? -10.717 14.705  35.297  1.00 51.93 ? 463  THR A OG1 1 
ATOM   1926 C CG2 . THR A 1 254 ? -11.264 16.943  35.971  1.00 50.25 ? 463  THR A CG2 1 
ATOM   1927 N N   . SER A 1 255 ? -8.404  15.632  32.342  1.00 46.98 ? 464  SER A N   1 
ATOM   1928 C CA  . SER A 1 255 ? -7.786  14.750  31.377  1.00 45.14 ? 464  SER A CA  1 
ATOM   1929 C C   . SER A 1 255 ? -7.182  13.500  32.022  1.00 43.81 ? 464  SER A C   1 
ATOM   1930 O O   . SER A 1 255 ? -6.888  13.491  33.225  1.00 43.66 ? 464  SER A O   1 
ATOM   1931 C CB  . SER A 1 255 ? -6.736  15.514  30.587  1.00 45.64 ? 464  SER A CB  1 
ATOM   1932 O OG  . SER A 1 255 ? -5.664  15.885  31.414  1.00 46.02 ? 464  SER A OG  1 
ATOM   1933 N N   . LEU A 1 256 ? -7.053  12.438  31.223  1.00 41.40 ? 465  LEU A N   1 
ATOM   1934 C CA  . LEU A 1 256 ? -6.395  11.203  31.639  1.00 39.55 ? 465  LEU A CA  1 
ATOM   1935 C C   . LEU A 1 256 ? -5.214  10.983  30.695  1.00 37.21 ? 465  LEU A C   1 
ATOM   1936 O O   . LEU A 1 256 ? -5.384  11.049  29.478  1.00 36.33 ? 465  LEU A O   1 
ATOM   1937 C CB  . LEU A 1 256 ? -7.388  10.021  31.595  1.00 39.78 ? 465  LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 256 ? -7.020  8.665   32.230  1.00 41.49 ? 465  LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 256 ? -6.390  8.817   33.616  1.00 42.31 ? 465  LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 256 ? -8.218  7.701   32.304  1.00 40.48 ? 465  LEU A CD2 1 
ATOM   1941 N N   . HIS A 1 257 ? -4.021  10.758  31.244  1.00 33.93 ? 466  HIS A N   1 
ATOM   1942 C CA  . HIS A 1 257 ? -2.840  10.485  30.416  1.00 32.58 ? 466  HIS A CA  1 
ATOM   1943 C C   . HIS A 1 257 ? -3.154  9.378   29.376  1.00 30.90 ? 466  HIS A C   1 
ATOM   1944 O O   . HIS A 1 257 ? -3.822  8.417   29.712  1.00 30.15 ? 466  HIS A O   1 
ATOM   1945 C CB  . HIS A 1 257 ? -1.630  10.080  31.294  1.00 32.50 ? 466  HIS A CB  1 
ATOM   1946 C CG  . HIS A 1 257 ? -0.389  9.832   30.504  1.00 32.83 ? 466  HIS A CG  1 
ATOM   1947 N ND1 . HIS A 1 257 ? 0.709   10.669  30.547  1.00 35.79 ? 466  HIS A ND1 1 
ATOM   1948 C CD2 . HIS A 1 257 ? -0.090  8.865   29.611  1.00 30.59 ? 466  HIS A CD2 1 
ATOM   1949 C CE1 . HIS A 1 257 ? 1.640   10.207  29.730  1.00 33.05 ? 466  HIS A CE1 1 
ATOM   1950 N NE2 . HIS A 1 257 ? 1.177   9.115   29.147  1.00 34.05 ? 466  HIS A NE2 1 
ATOM   1951 N N   . PRO A 1 258 ? -2.684  9.520   28.107  1.00 30.36 ? 467  PRO A N   1 
ATOM   1952 C CA  . PRO A 1 258 ? -3.078  8.500   27.117  1.00 29.49 ? 467  PRO A CA  1 
ATOM   1953 C C   . PRO A 1 258 ? -2.622  7.083   27.432  1.00 28.36 ? 467  PRO A C   1 
ATOM   1954 O O   . PRO A 1 258 ? -3.234  6.140   26.965  1.00 28.45 ? 467  PRO A O   1 
ATOM   1955 C CB  . PRO A 1 258 ? -2.446  8.983   25.808  1.00 29.57 ? 467  PRO A CB  1 
ATOM   1956 C CG  . PRO A 1 258 ? -2.042  10.419  26.048  1.00 30.89 ? 467  PRO A CG  1 
ATOM   1957 C CD  . PRO A 1 258 ? -1.809  10.550  27.524  1.00 29.99 ? 467  PRO A CD  1 
ATOM   1958 N N   . LEU A 1 259 ? -1.575  6.901   28.227  1.00 27.12 ? 468  LEU A N   1 
ATOM   1959 C CA  . LEU A 1 259 ? -1.180  5.525   28.541  1.00 25.98 ? 468  LEU A CA  1 
ATOM   1960 C C   . LEU A 1 259 ? -2.076  4.886   29.595  1.00 25.71 ? 468  LEU A C   1 
ATOM   1961 O O   . LEU A 1 259 ? -2.393  3.693   29.524  1.00 24.57 ? 468  LEU A O   1 
ATOM   1962 C CB  . LEU A 1 259 ? 0.293   5.461   28.925  1.00 25.77 ? 468  LEU A CB  1 
ATOM   1963 C CG  . LEU A 1 259 ? 0.860   4.121   29.399  1.00 27.53 ? 468  LEU A CG  1 
ATOM   1964 C CD1 . LEU A 1 259 ? 0.995   3.171   28.231  1.00 25.56 ? 468  LEU A CD1 1 
ATOM   1965 C CD2 . LEU A 1 259 ? 2.223   4.378   30.092  1.00 26.81 ? 468  LEU A CD2 1 
ATOM   1966 N N   . LEU A 1 260 ? -2.484  5.692   30.573  1.00 25.71 ? 469  LEU A N   1 
ATOM   1967 C CA  . LEU A 1 260 ? -3.445  5.260   31.589  1.00 26.52 ? 469  LEU A CA  1 
ATOM   1968 C C   . LEU A 1 260 ? -4.804  4.957   30.951  1.00 26.24 ? 469  LEU A C   1 
ATOM   1969 O O   . LEU A 1 260 ? -5.458  4.001   31.325  1.00 26.92 ? 469  LEU A O   1 
ATOM   1970 C CB  . LEU A 1 260 ? -3.610  6.345   32.655  1.00 25.76 ? 469  LEU A CB  1 
ATOM   1971 C CG  . LEU A 1 260 ? -2.822  6.308   33.983  1.00 29.34 ? 469  LEU A CG  1 
ATOM   1972 C CD1 . LEU A 1 260 ? -1.608  5.340   34.039  1.00 24.27 ? 469  LEU A CD1 1 
ATOM   1973 C CD2 . LEU A 1 260 ? -2.523  7.667   34.572  1.00 25.74 ? 469  LEU A CD2 1 
ATOM   1974 N N   . GLN A 1 261 ? -5.226  5.790   30.009  1.00 26.91 ? 470  GLN A N   1 
ATOM   1975 C CA  . GLN A 1 261 ? -6.440  5.500   29.215  1.00 26.94 ? 470  GLN A CA  1 
ATOM   1976 C C   . GLN A 1 261 ? -6.311  4.148   28.513  1.00 27.11 ? 470  GLN A C   1 
ATOM   1977 O O   . GLN A 1 261 ? -7.261  3.387   28.494  1.00 26.85 ? 470  GLN A O   1 
ATOM   1978 C CB  . GLN A 1 261 ? -6.728  6.622   28.208  1.00 27.08 ? 470  GLN A CB  1 
ATOM   1979 N N   . GLU A 1 262 ? -5.129  3.828   27.973  1.00 26.63 ? 471  GLU A N   1 
ATOM   1980 C CA  . GLU A 1 262 ? -4.916  2.499   27.354  1.00 27.07 ? 471  GLU A CA  1 
ATOM   1981 C C   . GLU A 1 262 ? -4.945  1.389   28.399  1.00 26.96 ? 471  GLU A C   1 
ATOM   1982 O O   . GLU A 1 262 ? -5.504  0.300   28.181  1.00 27.16 ? 471  GLU A O   1 
ATOM   1983 C CB  . GLU A 1 262 ? -3.593  2.454   26.564  1.00 26.86 ? 471  GLU A CB  1 
ATOM   1984 C CG  . GLU A 1 262 ? -3.631  3.225   25.271  1.00 30.13 ? 471  GLU A CG  1 
ATOM   1985 C CD  . GLU A 1 262 ? -4.905  2.952   24.437  1.00 34.91 ? 471  GLU A CD  1 
ATOM   1986 O OE1 . GLU A 1 262 ? -5.667  3.929   24.216  1.00 37.94 ? 471  GLU A OE1 1 
ATOM   1987 O OE2 . GLU A 1 262 ? -5.148  1.778   24.029  1.00 35.42 ? 471  GLU A OE2 1 
ATOM   1988 N N   . ILE A 1 263 ? -4.336  1.659   29.550  1.00 26.57 ? 472  ILE A N   1 
ATOM   1989 C CA  . ILE A 1 263 ? -4.334  0.664   30.634  1.00 25.77 ? 472  ILE A CA  1 
ATOM   1990 C C   . ILE A 1 263 ? -5.751  0.347   31.129  1.00 26.07 ? 472  ILE A C   1 
ATOM   1991 O O   . ILE A 1 263 ? -6.078  -0.818  31.303  1.00 24.59 ? 472  ILE A O   1 
ATOM   1992 C CB  . ILE A 1 263 ? -3.395  1.042   31.784  1.00 25.59 ? 472  ILE A CB  1 
ATOM   1993 C CG1 . ILE A 1 263 ? -1.928  0.904   31.324  1.00 24.94 ? 472  ILE A CG1 1 
ATOM   1994 C CG2 . ILE A 1 263 ? -3.627  0.135   33.011  1.00 23.99 ? 472  ILE A CG2 1 
ATOM   1995 C CD1 . ILE A 1 263 ? -0.938  1.455   32.328  1.00 25.27 ? 472  ILE A CD1 1 
ATOM   1996 N N   . TYR A 1 264 ? -6.565  1.373   31.351  1.00 27.63 ? 473  TYR A N   1 
ATOM   1997 C CA  . TYR A 1 264 ? -7.935  1.167   31.882  1.00 30.48 ? 473  TYR A CA  1 
ATOM   1998 C C   . TYR A 1 264 ? -8.957  0.762   30.801  1.00 32.23 ? 473  TYR A C   1 
ATOM   1999 O O   . TYR A 1 264 ? -10.066 0.288   31.114  1.00 32.81 ? 473  TYR A O   1 
ATOM   2000 C CB  . TYR A 1 264 ? -8.401  2.385   32.709  1.00 31.00 ? 473  TYR A CB  1 
ATOM   2001 C CG  . TYR A 1 264 ? -7.498  2.615   33.922  1.00 31.24 ? 473  TYR A CG  1 
ATOM   2002 C CD1 . TYR A 1 264 ? -7.267  1.588   34.831  1.00 31.03 ? 473  TYR A CD1 1 
ATOM   2003 C CD2 . TYR A 1 264 ? -6.836  3.832   34.121  1.00 32.39 ? 473  TYR A CD2 1 
ATOM   2004 C CE1 . TYR A 1 264 ? -6.424  1.758   35.916  1.00 31.84 ? 473  TYR A CE1 1 
ATOM   2005 C CE2 . TYR A 1 264 ? -5.972  4.015   35.225  1.00 31.36 ? 473  TYR A CE2 1 
ATOM   2006 C CZ  . TYR A 1 264 ? -5.782  2.976   36.106  1.00 32.37 ? 473  TYR A CZ  1 
ATOM   2007 O OH  . TYR A 1 264 ? -4.945  3.118   37.195  1.00 34.08 ? 473  TYR A OH  1 
ATOM   2008 N N   . LYS A 1 265 ? -8.588  0.932   29.536  1.00 34.33 ? 474  LYS A N   1 
ATOM   2009 C CA  . LYS A 1 265 ? -9.473  0.523   28.441  1.00 36.29 ? 474  LYS A CA  1 
ATOM   2010 C C   . LYS A 1 265 ? -9.834  -0.966  28.520  1.00 37.88 ? 474  LYS A C   1 
ATOM   2011 O O   . LYS A 1 265 ? -8.965  -1.857  28.419  1.00 37.75 ? 474  LYS A O   1 
ATOM   2012 C CB  . LYS A 1 265 ? -8.864  0.871   27.079  1.00 36.43 ? 474  LYS A CB  1 
ATOM   2013 C CG  . LYS A 1 265 ? -9.840  0.644   25.911  1.00 37.52 ? 474  LYS A CG  1 
ATOM   2014 C CD  . LYS A 1 265 ? -9.410  1.369   24.645  1.00 40.36 ? 474  LYS A CD  1 
ATOM   2015 C CE  . LYS A 1 265 ? -8.218  0.712   23.973  1.00 41.89 ? 474  LYS A CE  1 
ATOM   2016 N NZ  . LYS A 1 265 ? -7.921  1.404   22.672  1.00 46.15 ? 474  LYS A NZ  1 
ATOM   2017 N N   . ASP A 1 266 ? -11.117 -1.235  28.726  1.00 39.49 ? 475  ASP A N   1 
ATOM   2018 C CA  . ASP A 1 266 ? -11.624 -2.607  28.765  1.00 41.92 ? 475  ASP A CA  1 
ATOM   2019 C C   . ASP A 1 266 ? -11.046 -3.426  29.938  1.00 42.61 ? 475  ASP A C   1 
ATOM   2020 O O   . ASP A 1 266 ? -10.993 -4.654  29.869  1.00 43.51 ? 475  ASP A O   1 
ATOM   2021 C CB  . ASP A 1 266 ? -11.339 -3.330  27.435  1.00 42.02 ? 475  ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 266 ? -12.075 -2.718  26.248  1.00 44.53 ? 475  ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 266 ? -13.314 -2.489  26.334  1.00 46.33 ? 475  ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 266 ? -11.417 -2.498  25.205  1.00 46.14 ? 475  ASP A OD2 1 
ATOM   2025 N N   . MET A 1 267 ? -10.623 -2.769  31.012  1.00 43.38 ? 476  MET A N   1 
ATOM   2026 C CA  . MET A 1 267 ? -9.960  -3.503  32.102  1.00 44.29 ? 476  MET A CA  1 
ATOM   2027 C C   . MET A 1 267 ? -10.889 -4.378  32.958  1.00 46.32 ? 476  MET A C   1 
ATOM   2028 O O   . MET A 1 267 ? -11.084 -5.546  32.642  1.00 47.49 ? 476  MET A O   1 
ATOM   2029 C CB  . MET A 1 267 ? -9.105  -2.577  32.979  1.00 43.85 ? 476  MET A CB  1 
ATOM   2030 C CG  . MET A 1 267 ? -8.113  -3.333  33.846  1.00 43.00 ? 476  MET A CG  1 
ATOM   2031 S SD  . MET A 1 267 ? -7.165  -2.245  34.919  1.00 40.49 ? 476  MET A SD  1 
ATOM   2032 C CE  . MET A 1 267 ? -5.878  -3.370  35.476  1.00 43.09 ? 476  MET A CE  1 
ATOM   2033 N N   . TYR A 1 268 ? -11.439 -3.822  34.039  1.00 48.66 ? 477  TYR A N   1 
ATOM   2034 C CA  . TYR A 1 268 ? -12.213 -4.593  35.065  1.00 50.48 ? 477  TYR A CA  1 
ATOM   2035 C C   . TYR A 1 268 ? -11.434 -5.758  35.712  1.00 50.77 ? 477  TYR A C   1 
ATOM   2036 O O   . TYR A 1 268 ? -10.379 -5.555  36.339  1.00 50.17 ? 477  TYR A O   1 
ATOM   2037 C CB  . TYR A 1 268 ? -13.579 -5.048  34.494  1.00 51.89 ? 477  TYR A CB  1 
ATOM   2038 C CG  . TYR A 1 268 ? -13.953 -4.206  33.310  1.00 53.28 ? 477  TYR A CG  1 
ATOM   2039 C CD1 . TYR A 1 268 ? -14.037 -4.758  32.032  1.00 55.46 ? 477  TYR A CD1 1 
ATOM   2040 C CD2 . TYR A 1 268 ? -14.129 -2.824  33.450  1.00 55.23 ? 477  TYR A CD2 1 
ATOM   2041 C CE1 . TYR A 1 268 ? -14.332 -3.952  30.917  1.00 56.65 ? 477  TYR A CE1 1 
ATOM   2042 C CE2 . TYR A 1 268 ? -14.422 -2.013  32.348  1.00 55.81 ? 477  TYR A CE2 1 
ATOM   2043 C CZ  . TYR A 1 268 ? -14.518 -2.579  31.091  1.00 55.84 ? 477  TYR A CZ  1 
ATOM   2044 O OH  . TYR A 1 268 ? -14.813 -1.766  30.019  1.00 56.01 ? 477  TYR A OH  1 
ATOM   2045 N N   . ASP B 1 1   ? 19.392  12.075  5.138   1.00 45.94 ? 210  ASP B N   1 
ATOM   2046 C CA  . ASP B 1 1   ? 19.887  11.377  3.919   1.00 45.76 ? 210  ASP B CA  1 
ATOM   2047 C C   . ASP B 1 1   ? 18.975  10.206  3.533   1.00 44.94 ? 210  ASP B C   1 
ATOM   2048 O O   . ASP B 1 1   ? 19.022  9.123   4.133   1.00 44.56 ? 210  ASP B O   1 
ATOM   2049 C CB  . ASP B 1 1   ? 21.332  10.900  4.118   1.00 46.29 ? 210  ASP B CB  1 
ATOM   2050 C CG  . ASP B 1 1   ? 21.904  10.225  2.878   1.00 47.82 ? 210  ASP B CG  1 
ATOM   2051 O OD1 . ASP B 1 1   ? 22.961  9.563   2.992   1.00 50.40 ? 210  ASP B OD1 1 
ATOM   2052 O OD2 . ASP B 1 1   ? 21.316  10.366  1.785   1.00 50.22 ? 210  ASP B OD2 1 
ATOM   2053 N N   . LEU B 1 2   ? 18.158  10.441  2.514   1.00 44.41 ? 211  LEU B N   1 
ATOM   2054 C CA  . LEU B 1 2   ? 17.125  9.505   2.105   1.00 43.28 ? 211  LEU B CA  1 
ATOM   2055 C C   . LEU B 1 2   ? 17.720  8.229   1.522   1.00 42.62 ? 211  LEU B C   1 
ATOM   2056 O O   . LEU B 1 2   ? 17.136  7.157   1.664   1.00 42.66 ? 211  LEU B O   1 
ATOM   2057 C CB  . LEU B 1 2   ? 16.195  10.181  1.106   1.00 43.61 ? 211  LEU B CB  1 
ATOM   2058 C CG  . LEU B 1 2   ? 14.867  10.852  1.518   1.00 43.79 ? 211  LEU B CG  1 
ATOM   2059 C CD1 . LEU B 1 2   ? 14.741  11.366  2.973   1.00 44.50 ? 211  LEU B CD1 1 
ATOM   2060 C CD2 . LEU B 1 2   ? 14.536  11.946  0.513   1.00 44.26 ? 211  LEU B CD2 1 
ATOM   2061 N N   . LYS B 1 3   ? 18.892  8.346   0.889   1.00 41.46 ? 212  LYS B N   1 
ATOM   2062 C CA  . LYS B 1 3   ? 19.581  7.187   0.303   1.00 40.83 ? 212  LYS B CA  1 
ATOM   2063 C C   . LYS B 1 3   ? 20.125  6.257   1.395   1.00 39.23 ? 212  LYS B C   1 
ATOM   2064 O O   . LYS B 1 3   ? 20.063  5.031   1.260   1.00 38.82 ? 212  LYS B O   1 
ATOM   2065 C CB  . LYS B 1 3   ? 20.696  7.619   -0.674  1.00 40.72 ? 212  LYS B CB  1 
ATOM   2066 C CG  . LYS B 1 3   ? 21.279  6.460   -1.527  1.00 42.72 ? 212  LYS B CG  1 
ATOM   2067 C CD  . LYS B 1 3   ? 22.635  6.805   -2.196  1.00 42.66 ? 212  LYS B CD  1 
ATOM   2068 C CE  . LYS B 1 3   ? 23.838  6.441   -1.282  1.00 46.13 ? 212  LYS B CE  1 
ATOM   2069 N NZ  . LYS B 1 3   ? 24.225  4.972   -1.286  1.00 45.31 ? 212  LYS B NZ  1 
ATOM   2070 N N   . ALA B 1 4   ? 20.629  6.851   2.480   1.00 37.80 ? 213  ALA B N   1 
ATOM   2071 C CA  . ALA B 1 4   ? 21.175  6.106   3.613   1.00 36.19 ? 213  ALA B CA  1 
ATOM   2072 C C   . ALA B 1 4   ? 20.063  5.413   4.409   1.00 35.25 ? 213  ALA B C   1 
ATOM   2073 O O   . ALA B 1 4   ? 20.209  4.262   4.856   1.00 33.76 ? 213  ALA B O   1 
ATOM   2074 C CB  . ALA B 1 4   ? 21.963  7.036   4.526   1.00 36.13 ? 213  ALA B CB  1 
ATOM   2075 N N   . PHE B 1 5   ? 18.965  6.142   4.595   1.00 33.77 ? 214  PHE B N   1 
ATOM   2076 C CA  . PHE B 1 5   ? 17.785  5.591   5.222   1.00 33.38 ? 214  PHE B CA  1 
ATOM   2077 C C   . PHE B 1 5   ? 17.279  4.378   4.427   1.00 32.14 ? 214  PHE B C   1 
ATOM   2078 O O   . PHE B 1 5   ? 17.019  3.333   4.992   1.00 32.44 ? 214  PHE B O   1 
ATOM   2079 C CB  . PHE B 1 5   ? 16.711  6.672   5.325   1.00 33.43 ? 214  PHE B CB  1 
ATOM   2080 C CG  . PHE B 1 5   ? 15.486  6.250   6.088   1.00 34.14 ? 214  PHE B CG  1 
ATOM   2081 C CD1 . PHE B 1 5   ? 14.452  5.557   5.452   1.00 32.83 ? 214  PHE B CD1 1 
ATOM   2082 C CD2 . PHE B 1 5   ? 15.351  6.565   7.424   1.00 35.90 ? 214  PHE B CD2 1 
ATOM   2083 C CE1 . PHE B 1 5   ? 13.323  5.175   6.141   1.00 33.41 ? 214  PHE B CE1 1 
ATOM   2084 C CE2 . PHE B 1 5   ? 14.203  6.191   8.133   1.00 35.07 ? 214  PHE B CE2 1 
ATOM   2085 C CZ  . PHE B 1 5   ? 13.193  5.496   7.494   1.00 34.25 ? 214  PHE B CZ  1 
ATOM   2086 N N   . SER B 1 6   ? 17.139  4.542   3.115   1.00 31.44 ? 215  SER B N   1 
ATOM   2087 C CA  . SER B 1 6   ? 16.760  3.469   2.228   1.00 29.79 ? 215  SER B CA  1 
ATOM   2088 C C   . SER B 1 6   ? 17.614  2.218   2.335   1.00 29.59 ? 215  SER B C   1 
ATOM   2089 O O   . SER B 1 6   ? 17.090  1.099   2.311   1.00 28.35 ? 215  SER B O   1 
ATOM   2090 C CB  . SER B 1 6   ? 16.749  3.967   0.789   1.00 29.85 ? 215  SER B CB  1 
ATOM   2091 O OG  . SER B 1 6   ? 15.638  4.820   0.604   1.00 31.51 ? 215  SER B OG  1 
ATOM   2092 N N   . LYS B 1 7   ? 18.936  2.399   2.431   1.00 28.94 ? 216  LYS B N   1 
ATOM   2093 C CA  . LYS B 1 7   ? 19.856  1.281   2.448   1.00 29.02 ? 216  LYS B CA  1 
ATOM   2094 C C   . LYS B 1 7   ? 19.805  0.520   3.773   1.00 27.45 ? 216  LYS B C   1 
ATOM   2095 O O   . LYS B 1 7   ? 19.878  -0.695  3.777   1.00 27.83 ? 216  LYS B O   1 
ATOM   2096 C CB  . LYS B 1 7   ? 21.302  1.747   2.102   1.00 29.08 ? 216  LYS B CB  1 
ATOM   2097 C CG  . LYS B 1 7   ? 22.258  0.589   1.840   1.00 30.65 ? 216  LYS B CG  1 
ATOM   2098 C CD  . LYS B 1 7   ? 23.743  1.032   1.768   1.00 32.83 ? 216  LYS B CD  1 
ATOM   2099 C CE  . LYS B 1 7   ? 24.195  1.760   3.031   1.00 38.39 ? 216  LYS B CE  1 
ATOM   2100 N NZ  . LYS B 1 7   ? 24.668  0.867   4.134   1.00 40.08 ? 216  LYS B NZ  1 
ATOM   2101 N N   . HIS B 1 8   ? 19.666  1.226   4.885   1.00 27.30 ? 217  HIS B N   1 
ATOM   2102 C CA  . HIS B 1 8   ? 19.506  0.581   6.185   1.00 28.38 ? 217  HIS B CA  1 
ATOM   2103 C C   . HIS B 1 8   ? 18.185  -0.243  6.263   1.00 27.09 ? 217  HIS B C   1 
ATOM   2104 O O   . HIS B 1 8   ? 18.192  -1.365  6.740   1.00 26.73 ? 217  HIS B O   1 
ATOM   2105 C CB  . HIS B 1 8   ? 19.613  1.623   7.309   1.00 29.22 ? 217  HIS B CB  1 
ATOM   2106 C CG  . HIS B 1 8   ? 19.068  1.174   8.635   1.00 34.75 ? 217  HIS B CG  1 
ATOM   2107 N ND1 . HIS B 1 8   ? 19.877  0.815   9.696   1.00 38.85 ? 217  HIS B ND1 1 
ATOM   2108 C CD2 . HIS B 1 8   ? 17.787  1.065   9.087   1.00 38.98 ? 217  HIS B CD2 1 
ATOM   2109 C CE1 . HIS B 1 8   ? 19.122  0.482   10.732  1.00 40.25 ? 217  HIS B CE1 1 
ATOM   2110 N NE2 . HIS B 1 8   ? 17.849  0.627   10.389  1.00 38.31 ? 217  HIS B NE2 1 
ATOM   2111 N N   . ILE B 1 9   ? 17.072  0.313   5.791   1.00 26.60 ? 218  ILE B N   1 
ATOM   2112 C CA  . ILE B 1 9   ? 15.815  -0.469  5.715   1.00 26.47 ? 218  ILE B CA  1 
ATOM   2113 C C   . ILE B 1 9   ? 15.997  -1.733  4.869   1.00 26.84 ? 218  ILE B C   1 
ATOM   2114 O O   . ILE B 1 9   ? 15.624  -2.824  5.275   1.00 26.36 ? 218  ILE B O   1 
ATOM   2115 C CB  . ILE B 1 9   ? 14.628  0.385   5.141   1.00 26.54 ? 218  ILE B CB  1 
ATOM   2116 C CG1 . ILE B 1 9   ? 14.315  1.561   6.061   1.00 27.40 ? 218  ILE B CG1 1 
ATOM   2117 C CG2 . ILE B 1 9   ? 13.363  -0.479  4.969   1.00 25.05 ? 218  ILE B CG2 1 
ATOM   2118 C CD1 . ILE B 1 9   ? 13.984  1.136   7.502   1.00 30.41 ? 218  ILE B CD1 1 
ATOM   2119 N N   . TYR B 1 10  ? 16.599  -1.585  3.694   1.00 28.52 ? 219  TYR B N   1 
ATOM   2120 C CA  . TYR B 1 10  ? 16.905  -2.712  2.814   1.00 29.54 ? 219  TYR B CA  1 
ATOM   2121 C C   . TYR B 1 10  ? 17.747  -3.813  3.488   1.00 28.71 ? 219  TYR B C   1 
ATOM   2122 O O   . TYR B 1 10  ? 17.419  -5.000  3.373   1.00 27.36 ? 219  TYR B O   1 
ATOM   2123 C CB  . TYR B 1 10  ? 17.540  -2.172  1.519   1.00 31.52 ? 219  TYR B CB  1 
ATOM   2124 C CG  . TYR B 1 10  ? 18.128  -3.171  0.571   1.00 34.50 ? 219  TYR B CG  1 
ATOM   2125 C CD1 . TYR B 1 10  ? 17.328  -4.090  -0.128  1.00 35.40 ? 219  TYR B CD1 1 
ATOM   2126 C CD2 . TYR B 1 10  ? 19.508  -3.165  0.326   1.00 35.68 ? 219  TYR B CD2 1 
ATOM   2127 C CE1 . TYR B 1 10  ? 17.906  -5.003  -1.031  1.00 37.48 ? 219  TYR B CE1 1 
ATOM   2128 C CE2 . TYR B 1 10  ? 20.087  -4.063  -0.550  1.00 38.53 ? 219  TYR B CE2 1 
ATOM   2129 C CZ  . TYR B 1 10  ? 19.295  -4.973  -1.234  1.00 38.20 ? 219  TYR B CZ  1 
ATOM   2130 O OH  . TYR B 1 10  ? 19.942  -5.848  -2.100  1.00 39.36 ? 219  TYR B OH  1 
ATOM   2131 N N   . ASN B 1 11  ? 18.794  -3.419  4.221   1.00 28.18 ? 220  ASN B N   1 
ATOM   2132 C CA  . ASN B 1 11  ? 19.649  -4.379  4.922   1.00 27.27 ? 220  ASN B CA  1 
ATOM   2133 C C   . ASN B 1 11  ? 18.921  -5.018  6.079   1.00 26.75 ? 220  ASN B C   1 
ATOM   2134 O O   . ASN B 1 11  ? 19.218  -6.149  6.415   1.00 27.30 ? 220  ASN B O   1 
ATOM   2135 C CB  . ASN B 1 11  ? 20.954  -3.749  5.434   1.00 27.70 ? 220  ASN B CB  1 
ATOM   2136 C CG  . ASN B 1 11  ? 22.036  -3.675  4.352   1.00 26.90 ? 220  ASN B CG  1 
ATOM   2137 O OD1 . ASN B 1 11  ? 22.263  -4.631  3.623   1.00 29.29 ? 220  ASN B OD1 1 
ATOM   2138 N ND2 . ASN B 1 11  ? 22.660  -2.528  4.226   1.00 22.85 ? 220  ASN B ND2 1 
ATOM   2139 N N   . ALA B 1 12  ? 17.980  -4.289  6.686   1.00 26.33 ? 221  ALA B N   1 
ATOM   2140 C CA  . ALA B 1 12  ? 17.106  -4.861  7.736   1.00 25.90 ? 221  ALA B CA  1 
ATOM   2141 C C   . ALA B 1 12  ? 16.201  -5.936  7.140   1.00 24.82 ? 221  ALA B C   1 
ATOM   2142 O O   . ALA B 1 12  ? 15.960  -6.970  7.742   1.00 24.45 ? 221  ALA B O   1 
ATOM   2143 C CB  . ALA B 1 12  ? 16.264  -3.769  8.382   1.00 25.37 ? 221  ALA B CB  1 
ATOM   2144 N N   . TYR B 1 13  ? 15.717  -5.679  5.928   1.00 24.77 ? 222  TYR B N   1 
ATOM   2145 C CA  . TYR B 1 13  ? 14.939  -6.648  5.197   1.00 25.02 ? 222  TYR B CA  1 
ATOM   2146 C C   . TYR B 1 13  ? 15.756  -7.899  4.809   1.00 25.06 ? 222  TYR B C   1 
ATOM   2147 O O   . TYR B 1 13  ? 15.313  -9.035  5.015   1.00 24.93 ? 222  TYR B O   1 
ATOM   2148 C CB  . TYR B 1 13  ? 14.376  -5.933  3.999   1.00 25.94 ? 222  TYR B CB  1 
ATOM   2149 C CG  . TYR B 1 13  ? 13.678  -6.748  2.952   1.00 27.59 ? 222  TYR B CG  1 
ATOM   2150 C CD1 . TYR B 1 13  ? 14.410  -7.428  1.994   1.00 28.79 ? 222  TYR B CD1 1 
ATOM   2151 C CD2 . TYR B 1 13  ? 12.281  -6.763  2.869   1.00 27.41 ? 222  TYR B CD2 1 
ATOM   2152 C CE1 . TYR B 1 13  ? 13.794  -8.145  1.000   1.00 30.38 ? 222  TYR B CE1 1 
ATOM   2153 C CE2 . TYR B 1 13  ? 11.636  -7.470  1.867   1.00 29.47 ? 222  TYR B CE2 1 
ATOM   2154 C CZ  . TYR B 1 13  ? 12.410  -8.159  0.937   1.00 30.02 ? 222  TYR B CZ  1 
ATOM   2155 O OH  . TYR B 1 13  ? 11.831  -8.854  -0.083  1.00 32.14 ? 222  TYR B OH  1 
ATOM   2156 N N   . LEU B 1 14  ? 16.949  -7.701  4.248   1.00 24.79 ? 223  LEU B N   1 
ATOM   2157 C CA  . LEU B 1 14  ? 17.823  -8.836  3.905   1.00 25.00 ? 223  LEU B CA  1 
ATOM   2158 C C   . LEU B 1 14  ? 18.137  -9.680  5.125   1.00 24.75 ? 223  LEU B C   1 
ATOM   2159 O O   . LEU B 1 14  ? 18.162  -10.921 5.054   1.00 24.94 ? 223  LEU B O   1 
ATOM   2160 C CB  . LEU B 1 14  ? 19.129  -8.318  3.274   1.00 24.98 ? 223  LEU B CB  1 
ATOM   2161 C CG  . LEU B 1 14  ? 19.223  -8.191  1.752   1.00 27.73 ? 223  LEU B CG  1 
ATOM   2162 C CD1 . LEU B 1 14  ? 17.891  -8.053  0.981   1.00 31.14 ? 223  LEU B CD1 1 
ATOM   2163 C CD2 . LEU B 1 14  ? 20.264  -7.113  1.349   1.00 26.06 ? 223  LEU B CD2 1 
ATOM   2164 N N   . LYS B 1 15  ? 18.373  -9.014  6.248   1.00 25.00 ? 224  LYS B N   1 
ATOM   2165 C CA  . LYS B 1 15  ? 18.689  -9.723  7.493   1.00 26.18 ? 224  LYS B CA  1 
ATOM   2166 C C   . LYS B 1 15  ? 17.566  -10.656 7.955   1.00 26.95 ? 224  LYS B C   1 
ATOM   2167 O O   . LYS B 1 15  ? 17.818  -11.779 8.401   1.00 27.57 ? 224  LYS B O   1 
ATOM   2168 C CB  . LYS B 1 15  ? 18.951  -8.699  8.584   1.00 25.92 ? 224  LYS B CB  1 
ATOM   2169 C CG  . LYS B 1 15  ? 19.392  -9.287  9.936   1.00 26.91 ? 224  LYS B CG  1 
ATOM   2170 C CD  . LYS B 1 15  ? 19.590  -8.156  10.883  1.00 32.29 ? 224  LYS B CD  1 
ATOM   2171 C CE  . LYS B 1 15  ? 20.159  -8.632  12.220  1.00 35.78 ? 224  LYS B CE  1 
ATOM   2172 N NZ  . LYS B 1 15  ? 20.457  -7.403  13.005  1.00 38.06 ? 224  LYS B NZ  1 
ATOM   2173 N N   . ASN B 1 16  ? 16.320  -10.191 7.829   1.00 27.17 ? 225  ASN B N   1 
ATOM   2174 C CA  . ASN B 1 16  ? 15.177  -10.854 8.475   1.00 26.13 ? 225  ASN B CA  1 
ATOM   2175 C C   . ASN B 1 16  ? 14.342  -11.784 7.603   1.00 27.28 ? 225  ASN B C   1 
ATOM   2176 O O   . ASN B 1 16  ? 13.637  -12.637 8.138   1.00 26.55 ? 225  ASN B O   1 
ATOM   2177 C CB  . ASN B 1 16  ? 14.313  -9.797  9.183   1.00 25.27 ? 225  ASN B CB  1 
ATOM   2178 C CG  . ASN B 1 16  ? 14.947  -9.311  10.443  1.00 23.62 ? 225  ASN B CG  1 
ATOM   2179 O OD1 . ASN B 1 16  ? 15.039  -10.063 11.400  1.00 25.54 ? 225  ASN B OD1 1 
ATOM   2180 N ND2 . ASN B 1 16  ? 15.402  -8.047  10.465  1.00 23.94 ? 225  ASN B ND2 1 
ATOM   2181 N N   . PHE B 1 17  ? 14.437  -11.630 6.274   1.00 28.41 ? 226  PHE B N   1 
ATOM   2182 C CA  . PHE B 1 17  ? 13.768  -12.499 5.315   1.00 29.40 ? 226  PHE B CA  1 
ATOM   2183 C C   . PHE B 1 17  ? 14.774  -13.289 4.418   1.00 30.96 ? 226  PHE B C   1 
ATOM   2184 O O   . PHE B 1 17  ? 15.466  -12.698 3.568   1.00 31.30 ? 226  PHE B O   1 
ATOM   2185 C CB  . PHE B 1 17  ? 12.776  -11.655 4.472   1.00 28.71 ? 226  PHE B CB  1 
ATOM   2186 C CG  . PHE B 1 17  ? 11.845  -10.803 5.314   1.00 26.91 ? 226  PHE B CG  1 
ATOM   2187 C CD1 . PHE B 1 17  ? 10.781  -11.383 6.002   1.00 28.29 ? 226  PHE B CD1 1 
ATOM   2188 C CD2 . PHE B 1 17  ? 12.049  -9.447  5.440   1.00 24.76 ? 226  PHE B CD2 1 
ATOM   2189 C CE1 . PHE B 1 17  ? 9.927   -10.614 6.803   1.00 24.63 ? 226  PHE B CE1 1 
ATOM   2190 C CE2 . PHE B 1 17  ? 11.200  -8.663  6.243   1.00 26.13 ? 226  PHE B CE2 1 
ATOM   2191 C CZ  . PHE B 1 17  ? 10.132  -9.266  6.923   1.00 24.50 ? 226  PHE B CZ  1 
ATOM   2192 N N   . ASN B 1 18  ? 14.825  -14.612 4.593   1.00 32.28 ? 227  ASN B N   1 
ATOM   2193 C CA  . ASN B 1 18  ? 15.762  -15.492 3.850   1.00 34.26 ? 227  ASN B CA  1 
ATOM   2194 C C   . ASN B 1 18  ? 15.439  -15.553 2.357   1.00 35.03 ? 227  ASN B C   1 
ATOM   2195 O O   . ASN B 1 18  ? 16.320  -15.398 1.507   1.00 35.41 ? 227  ASN B O   1 
ATOM   2196 C CB  . ASN B 1 18  ? 15.771  -16.903 4.439   1.00 34.78 ? 227  ASN B CB  1 
ATOM   2197 C CG  . ASN B 1 18  ? 16.828  -17.820 3.793   1.00 37.78 ? 227  ASN B CG  1 
ATOM   2198 O OD1 . ASN B 1 18  ? 17.841  -17.368 3.254   1.00 41.71 ? 227  ASN B OD1 1 
ATOM   2199 N ND2 . ASN B 1 18  ? 16.598  -19.119 3.882   1.00 40.50 ? 227  ASN B ND2 1 
ATOM   2200 N N   . MET B 1 19  ? 14.165  -15.757 2.041   1.00 34.89 ? 228  MET B N   1 
ATOM   2201 C CA  . MET B 1 19  ? 13.727  -15.796 0.660   1.00 35.13 ? 228  MET B CA  1 
ATOM   2202 C C   . MET B 1 19  ? 13.444  -14.384 0.187   1.00 34.64 ? 228  MET B C   1 
ATOM   2203 O O   . MET B 1 19  ? 12.588  -13.698 0.738   1.00 35.53 ? 228  MET B O   1 
ATOM   2204 C CB  . MET B 1 19  ? 12.492  -16.692 0.524   1.00 35.83 ? 228  MET B CB  1 
ATOM   2205 C CG  . MET B 1 19  ? 11.996  -16.891 -0.895  1.00 37.58 ? 228  MET B CG  1 
ATOM   2206 S SD  . MET B 1 19  ? 13.329  -17.396 -1.986  1.00 40.99 ? 228  MET B SD  1 
ATOM   2207 C CE  . MET B 1 19  ? 13.519  -19.088 -1.522  1.00 39.74 ? 228  MET B CE  1 
ATOM   2208 N N   . THR B 1 20  ? 14.197  -13.935 -0.809  1.00 33.64 ? 229  THR B N   1 
ATOM   2209 C CA  . THR B 1 20  ? 14.010  -12.606 -1.385  1.00 33.00 ? 229  THR B CA  1 
ATOM   2210 C C   . THR B 1 20  ? 13.374  -12.764 -2.767  1.00 32.13 ? 229  THR B C   1 
ATOM   2211 O O   . THR B 1 20  ? 13.335  -13.864 -3.310  1.00 31.18 ? 229  THR B O   1 
ATOM   2212 C CB  . THR B 1 20  ? 15.360  -11.880 -1.526  1.00 33.32 ? 229  THR B CB  1 
ATOM   2213 O OG1 . THR B 1 20  ? 16.202  -12.642 -2.389  1.00 33.80 ? 229  THR B OG1 1 
ATOM   2214 C CG2 . THR B 1 20  ? 16.051  -11.740 -0.159  1.00 34.21 ? 229  THR B CG2 1 
ATOM   2215 N N   . LYS B 1 21  ? 12.880  -11.672 -3.327  1.00 31.75 ? 230  LYS B N   1 
ATOM   2216 C CA  . LYS B 1 21  ? 12.352  -11.692 -4.673  1.00 32.68 ? 230  LYS B CA  1 
ATOM   2217 C C   . LYS B 1 21  ? 13.448  -12.077 -5.665  1.00 33.74 ? 230  LYS B C   1 
ATOM   2218 O O   . LYS B 1 21  ? 13.181  -12.762 -6.661  1.00 33.56 ? 230  LYS B O   1 
ATOM   2219 C CB  . LYS B 1 21  ? 11.772  -10.330 -5.048  1.00 32.28 ? 230  LYS B CB  1 
ATOM   2220 C CG  . LYS B 1 21  ? 11.086  -10.320 -6.395  1.00 29.96 ? 230  LYS B CG  1 
ATOM   2221 C CD  . LYS B 1 21  ? 10.127  -9.134  -6.541  1.00 29.66 ? 230  LYS B CD  1 
ATOM   2222 C CE  . LYS B 1 21  ? 9.380   -9.248  -7.868  1.00 27.63 ? 230  LYS B CE  1 
ATOM   2223 N NZ  . LYS B 1 21  ? 8.494   -8.103  -8.135  1.00 28.01 ? 230  LYS B NZ  1 
ATOM   2224 N N   . LYS B 1 22  ? 14.671  -11.627 -5.395  1.00 34.84 ? 231  LYS B N   1 
ATOM   2225 C CA  . LYS B 1 22  ? 15.815  -11.988 -6.236  1.00 37.23 ? 231  LYS B CA  1 
ATOM   2226 C C   . LYS B 1 22  ? 16.006  -13.508 -6.281  1.00 37.56 ? 231  LYS B C   1 
ATOM   2227 O O   . LYS B 1 22  ? 16.064  -14.092 -7.362  1.00 37.99 ? 231  LYS B O   1 
ATOM   2228 C CB  . LYS B 1 22  ? 17.096  -11.266 -5.777  1.00 37.02 ? 231  LYS B CB  1 
ATOM   2229 C CG  . LYS B 1 22  ? 18.299  -11.380 -6.740  1.00 38.44 ? 231  LYS B CG  1 
ATOM   2230 C CD  . LYS B 1 22  ? 19.464  -10.479 -6.261  1.00 38.70 ? 231  LYS B CD  1 
ATOM   2231 C CE  . LYS B 1 22  ? 20.813  -11.145 -6.485  1.00 42.22 ? 231  LYS B CE  1 
ATOM   2232 N NZ  . LYS B 1 22  ? 21.980  -10.212 -6.272  1.00 44.46 ? 231  LYS B NZ  1 
ATOM   2233 N N   . LYS B 1 23  ? 16.064  -14.146 -5.118  1.00 38.89 ? 232  LYS B N   1 
ATOM   2234 C CA  . LYS B 1 23  ? 16.252  -15.602 -5.059  1.00 40.05 ? 232  LYS B CA  1 
ATOM   2235 C C   . LYS B 1 23  ? 15.052  -16.334 -5.643  1.00 40.82 ? 232  LYS B C   1 
ATOM   2236 O O   . LYS B 1 23  ? 15.221  -17.225 -6.485  1.00 41.54 ? 232  LYS B O   1 
ATOM   2237 C CB  . LYS B 1 23  ? 16.555  -16.066 -3.639  1.00 40.19 ? 232  LYS B CB  1 
ATOM   2238 C CG  . LYS B 1 23  ? 17.969  -15.714 -3.198  1.00 42.16 ? 232  LYS B CG  1 
ATOM   2239 C CD  . LYS B 1 23  ? 18.088  -15.494 -1.694  1.00 45.84 ? 232  LYS B CD  1 
ATOM   2240 C CE  . LYS B 1 23  ? 18.142  -16.790 -0.919  1.00 46.95 ? 232  LYS B CE  1 
ATOM   2241 N NZ  . LYS B 1 23  ? 18.618  -16.523 0.469   1.00 48.15 ? 232  LYS B NZ  1 
ATOM   2242 N N   . ALA B 1 24  ? 13.850  -15.928 -5.239  1.00 40.96 ? 233  ALA B N   1 
ATOM   2243 C CA  . ALA B 1 24  ? 12.619  -16.507 -5.776  1.00 41.90 ? 233  ALA B CA  1 
ATOM   2244 C C   . ALA B 1 24  ? 12.583  -16.454 -7.300  1.00 42.81 ? 233  ALA B C   1 
ATOM   2245 O O   . ALA B 1 24  ? 12.377  -17.476 -7.950  1.00 42.88 ? 233  ALA B O   1 
ATOM   2246 C CB  . ALA B 1 24  ? 11.398  -15.811 -5.196  1.00 41.05 ? 233  ALA B CB  1 
ATOM   2247 N N   . ARG B 1 25  ? 12.783  -15.265 -7.866  1.00 44.24 ? 234  ARG B N   1 
ATOM   2248 C CA  . ARG B 1 25  ? 12.742  -15.102 -9.317  1.00 46.31 ? 234  ARG B CA  1 
ATOM   2249 C C   . ARG B 1 25  ? 13.762  -15.984 -10.058 1.00 47.12 ? 234  ARG B C   1 
ATOM   2250 O O   . ARG B 1 25  ? 13.447  -16.527 -11.127 1.00 47.68 ? 234  ARG B O   1 
ATOM   2251 C CB  . ARG B 1 25  ? 12.885  -13.631 -9.724  1.00 46.55 ? 234  ARG B CB  1 
ATOM   2252 C CG  . ARG B 1 25  ? 11.629  -13.033 -10.359 1.00 48.04 ? 234  ARG B CG  1 
ATOM   2253 C CD  . ARG B 1 25  ? 10.420  -13.116 -9.451  1.00 50.38 ? 234  ARG B CD  1 
ATOM   2254 N NE  . ARG B 1 25  ? 9.202   -13.243 -10.249 1.00 53.74 ? 234  ARG B NE  1 
ATOM   2255 C CZ  . ARG B 1 25  ? 8.007   -13.598 -9.771  1.00 54.20 ? 234  ARG B CZ  1 
ATOM   2256 N NH1 . ARG B 1 25  ? 7.845   -13.866 -8.471  1.00 51.80 ? 234  ARG B NH1 1 
ATOM   2257 N NH2 . ARG B 1 25  ? 6.969   -13.694 -10.603 1.00 53.75 ? 234  ARG B NH2 1 
ATOM   2258 N N   . SER B 1 26  ? 14.961  -16.127 -9.495  1.00 47.56 ? 235  SER B N   1 
ATOM   2259 C CA  . SER B 1 26  ? 15.978  -16.958 -10.126 1.00 48.63 ? 235  SER B CA  1 
ATOM   2260 C C   . SER B 1 26  ? 15.573  -18.438 -10.123 1.00 49.26 ? 235  SER B C   1 
ATOM   2261 O O   . SER B 1 26  ? 15.816  -19.151 -11.110 1.00 49.06 ? 235  SER B O   1 
ATOM   2262 C CB  . SER B 1 26  ? 17.369  -16.724 -9.520  1.00 48.47 ? 235  SER B CB  1 
ATOM   2263 O OG  . SER B 1 26  ? 17.506  -17.286 -8.229  1.00 49.43 ? 235  SER B OG  1 
ATOM   2264 N N   . ILE B 1 27  ? 14.936  -18.885 -9.037  1.00 49.74 ? 236  ILE B N   1 
ATOM   2265 C CA  . ILE B 1 27  ? 14.383  -20.247 -8.958  1.00 50.17 ? 236  ILE B CA  1 
ATOM   2266 C C   . ILE B 1 27  ? 13.204  -20.435 -9.912  1.00 51.01 ? 236  ILE B C   1 
ATOM   2267 O O   . ILE B 1 27  ? 13.117  -21.452 -10.603 1.00 51.27 ? 236  ILE B O   1 
ATOM   2268 C CB  . ILE B 1 27  ? 13.943  -20.627 -7.527  1.00 50.12 ? 236  ILE B CB  1 
ATOM   2269 C CG1 . ILE B 1 27  ? 15.152  -20.684 -6.596  1.00 48.81 ? 236  ILE B CG1 1 
ATOM   2270 C CG2 . ILE B 1 27  ? 13.183  -21.970 -7.526  1.00 49.84 ? 236  ILE B CG2 1 
ATOM   2271 C CD1 . ILE B 1 27  ? 14.804  -20.607 -5.147  1.00 47.09 ? 236  ILE B CD1 1 
ATOM   2272 N N   . LEU B 1 28  ? 12.307  -19.456 -9.967  1.00 51.75 ? 237  LEU B N   1 
ATOM   2273 C CA  . LEU B 1 28  ? 11.124  -19.549 -10.843 1.00 52.49 ? 237  LEU B CA  1 
ATOM   2274 C C   . LEU B 1 28  ? 11.415  -19.628 -12.371 1.00 53.90 ? 237  LEU B C   1 
ATOM   2275 O O   . LEU B 1 28  ? 10.477  -19.649 -13.188 1.00 53.83 ? 237  LEU B O   1 
ATOM   2276 C CB  . LEU B 1 28  ? 10.108  -18.439 -10.518 1.00 51.92 ? 237  LEU B CB  1 
ATOM   2277 C CG  . LEU B 1 28  ? 9.333   -18.538 -9.195  1.00 49.93 ? 237  LEU B CG  1 
ATOM   2278 C CD1 . LEU B 1 28  ? 8.600   -17.252 -8.927  1.00 47.20 ? 237  LEU B CD1 1 
ATOM   2279 C CD2 . LEU B 1 28  ? 8.347   -19.705 -9.212  1.00 49.05 ? 237  LEU B CD2 1 
ATOM   2280 N N   . THR B 1 29  ? 12.697  -19.684 -12.746 1.00 55.07 ? 238  THR B N   1 
ATOM   2281 C CA  . THR B 1 29  ? 13.089  -19.859 -14.160 1.00 56.12 ? 238  THR B CA  1 
ATOM   2282 C C   . THR B 1 29  ? 14.153  -20.959 -14.380 1.00 56.30 ? 238  THR B C   1 
ATOM   2283 O O   . THR B 1 29  ? 15.233  -20.968 -13.771 1.00 56.50 ? 238  THR B O   1 
ATOM   2284 C CB  . THR B 1 29  ? 13.535  -18.520 -14.814 1.00 56.66 ? 238  THR B CB  1 
ATOM   2285 O OG1 . THR B 1 29  ? 12.612  -17.475 -14.462 1.00 57.61 ? 238  THR B OG1 1 
ATOM   2286 C CG2 . THR B 1 29  ? 13.605  -18.651 -16.355 1.00 56.79 ? 238  THR B CG2 1 
ATOM   2287 N N   . ALA B 1 36  ? 13.945  -27.184 -10.558 1.00 45.74 ? 245  ALA B N   1 
ATOM   2288 C CA  . ALA B 1 36  ? 14.576  -27.749 -9.363  1.00 45.76 ? 245  ALA B CA  1 
ATOM   2289 C C   . ALA B 1 36  ? 13.666  -27.927 -8.121  1.00 44.93 ? 245  ALA B C   1 
ATOM   2290 O O   . ALA B 1 36  ? 13.884  -28.867 -7.343  1.00 45.71 ? 245  ALA B O   1 
ATOM   2291 C CB  . ALA B 1 36  ? 15.843  -26.957 -8.992  1.00 45.83 ? 245  ALA B CB  1 
ATOM   2292 N N   . PRO B 1 37  ? 12.684  -27.019 -7.896  1.00 44.21 ? 246  PRO B N   1 
ATOM   2293 C CA  . PRO B 1 37  ? 11.790  -27.276 -6.756  1.00 43.03 ? 246  PRO B CA  1 
ATOM   2294 C C   . PRO B 1 37  ? 10.865  -28.460 -7.019  1.00 41.68 ? 246  PRO B C   1 
ATOM   2295 O O   . PRO B 1 37  ? 10.449  -28.674 -8.154  1.00 41.43 ? 246  PRO B O   1 
ATOM   2296 C CB  . PRO B 1 37  ? 10.972  -25.984 -6.647  1.00 43.07 ? 246  PRO B CB  1 
ATOM   2297 C CG  . PRO B 1 37  ? 11.001  -25.400 -7.996  1.00 44.09 ? 246  PRO B CG  1 
ATOM   2298 C CD  . PRO B 1 37  ? 12.337  -25.758 -8.579  1.00 44.09 ? 246  PRO B CD  1 
ATOM   2299 N N   . PHE B 1 38  ? 10.554  -29.218 -5.975  1.00 40.70 ? 247  PHE B N   1 
ATOM   2300 C CA  . PHE B 1 38  ? 9.622   -30.340 -6.097  1.00 39.75 ? 247  PHE B CA  1 
ATOM   2301 C C   . PHE B 1 38  ? 8.191   -29.829 -6.269  1.00 38.89 ? 247  PHE B C   1 
ATOM   2302 O O   . PHE B 1 38  ? 7.744   -28.958 -5.511  1.00 38.87 ? 247  PHE B O   1 
ATOM   2303 C CB  . PHE B 1 38  ? 9.749   -31.277 -4.892  1.00 39.63 ? 247  PHE B CB  1 
ATOM   2304 C CG  . PHE B 1 38  ? 8.836   -32.461 -4.956  1.00 40.20 ? 247  PHE B CG  1 
ATOM   2305 C CD1 . PHE B 1 38  ? 9.050   -33.479 -5.899  1.00 39.87 ? 247  PHE B CD1 1 
ATOM   2306 C CD2 . PHE B 1 38  ? 7.747   -32.558 -4.100  1.00 39.79 ? 247  PHE B CD2 1 
ATOM   2307 C CE1 . PHE B 1 38  ? 8.196   -34.583 -5.967  1.00 38.81 ? 247  PHE B CE1 1 
ATOM   2308 C CE2 . PHE B 1 38  ? 6.887   -33.663 -4.157  1.00 40.08 ? 247  PHE B CE2 1 
ATOM   2309 C CZ  . PHE B 1 38  ? 7.115   -34.675 -5.096  1.00 38.95 ? 247  PHE B CZ  1 
ATOM   2310 N N   . VAL B 1 39  ? 7.478   -30.330 -7.279  1.00 37.51 ? 248  VAL B N   1 
ATOM   2311 C CA  . VAL B 1 39  ? 6.126   -29.833 -7.544  1.00 35.78 ? 248  VAL B CA  1 
ATOM   2312 C C   . VAL B 1 39  ? 5.028   -30.549 -6.731  1.00 35.49 ? 248  VAL B C   1 
ATOM   2313 O O   . VAL B 1 39  ? 4.909   -31.769 -6.772  1.00 35.66 ? 248  VAL B O   1 
ATOM   2314 C CB  . VAL B 1 39  ? 5.784   -29.825 -9.041  1.00 36.11 ? 248  VAL B CB  1 
ATOM   2315 C CG1 . VAL B 1 39  ? 4.348   -29.334 -9.261  1.00 34.24 ? 248  VAL B CG1 1 
ATOM   2316 C CG2 . VAL B 1 39  ? 6.741   -28.945 -9.791  1.00 33.99 ? 248  VAL B CG2 1 
ATOM   2317 N N   . ILE B 1 40  ? 4.232   -29.773 -5.992  1.00 34.75 ? 249  ILE B N   1 
ATOM   2318 C CA  . ILE B 1 40  ? 3.120   -30.304 -5.195  1.00 33.95 ? 249  ILE B CA  1 
ATOM   2319 C C   . ILE B 1 40  ? 1.799   -29.925 -5.855  1.00 34.43 ? 249  ILE B C   1 
ATOM   2320 O O   . ILE B 1 40  ? 1.492   -28.742 -5.998  1.00 34.38 ? 249  ILE B O   1 
ATOM   2321 C CB  . ILE B 1 40  ? 3.196   -29.759 -3.744  1.00 34.32 ? 249  ILE B CB  1 
ATOM   2322 C CG1 . ILE B 1 40  ? 4.537   -30.154 -3.109  1.00 33.89 ? 249  ILE B CG1 1 
ATOM   2323 C CG2 . ILE B 1 40  ? 2.008   -30.236 -2.887  1.00 32.94 ? 249  ILE B CG2 1 
ATOM   2324 C CD1 . ILE B 1 40  ? 5.000   -29.225 -2.000  1.00 33.19 ? 249  ILE B CD1 1 
ATOM   2325 N N   . HIS B 1 41  ? 1.006   -30.918 -6.251  1.00 34.74 ? 250  HIS B N   1 
ATOM   2326 C CA  . HIS B 1 41  ? -0.215  -30.643 -7.009  1.00 34.93 ? 250  HIS B CA  1 
ATOM   2327 C C   . HIS B 1 41  ? -1.396  -31.573 -6.691  1.00 35.55 ? 250  HIS B C   1 
ATOM   2328 O O   . HIS B 1 41  ? -2.458  -31.513 -7.356  1.00 36.16 ? 250  HIS B O   1 
ATOM   2329 C CB  . HIS B 1 41  ? 0.095   -30.671 -8.512  1.00 35.30 ? 250  HIS B CB  1 
ATOM   2330 C CG  . HIS B 1 41  ? 0.539   -32.013 -9.019  1.00 36.29 ? 250  HIS B CG  1 
ATOM   2331 N ND1 . HIS B 1 41  ? -0.290  -32.846 -9.740  1.00 36.48 ? 250  HIS B ND1 1 
ATOM   2332 C CD2 . HIS B 1 41  ? 1.724   -32.664 -8.907  1.00 36.69 ? 250  HIS B CD2 1 
ATOM   2333 C CE1 . HIS B 1 41  ? 0.365   -33.952 -10.048 1.00 37.61 ? 250  HIS B CE1 1 
ATOM   2334 N NE2 . HIS B 1 41  ? 1.586   -33.873 -9.544  1.00 35.31 ? 250  HIS B NE2 1 
ATOM   2335 N N   . ASP B 1 42  ? -1.209  -32.443 -5.704  1.00 35.36 ? 251  ASP B N   1 
ATOM   2336 C CA  . ASP B 1 42  ? -2.225  -33.420 -5.323  1.00 36.21 ? 251  ASP B CA  1 
ATOM   2337 C C   . ASP B 1 42  ? -1.838  -34.017 -3.978  1.00 36.63 ? 251  ASP B C   1 
ATOM   2338 O O   . ASP B 1 42  ? -0.764  -33.703 -3.437  1.00 36.82 ? 251  ASP B O   1 
ATOM   2339 C CB  . ASP B 1 42  ? -2.387  -34.521 -6.406  1.00 36.47 ? 251  ASP B CB  1 
ATOM   2340 C CG  . ASP B 1 42  ? -1.063  -35.230 -6.759  1.00 36.67 ? 251  ASP B CG  1 
ATOM   2341 O OD1 . ASP B 1 42  ? -0.143  -35.280 -5.913  1.00 38.23 ? 251  ASP B OD1 1 
ATOM   2342 O OD2 . ASP B 1 42  ? -0.946  -35.768 -7.888  1.00 37.84 ? 251  ASP B OD2 1 
ATOM   2343 N N   . ILE B 1 43  ? -2.702  -34.871 -3.440  1.00 36.44 ? 252  ILE B N   1 
ATOM   2344 C CA  . ILE B 1 43  ? -2.447  -35.533 -2.157  1.00 36.95 ? 252  ILE B CA  1 
ATOM   2345 C C   . ILE B 1 43  ? -1.097  -36.247 -2.136  1.00 36.60 ? 252  ILE B C   1 
ATOM   2346 O O   . ILE B 1 43  ? -0.321  -36.120 -1.195  1.00 36.10 ? 252  ILE B O   1 
ATOM   2347 C CB  . ILE B 1 43  ? -3.528  -36.565 -1.846  1.00 37.09 ? 252  ILE B CB  1 
ATOM   2348 C CG1 . ILE B 1 43  ? -4.834  -35.871 -1.458  1.00 36.95 ? 252  ILE B CG1 1 
ATOM   2349 C CG2 . ILE B 1 43  ? -3.064  -37.531 -0.736  1.00 37.54 ? 252  ILE B CG2 1 
ATOM   2350 C CD1 . ILE B 1 43  ? -5.953  -36.836 -1.230  1.00 39.09 ? 252  ILE B CD1 1 
ATOM   2351 N N   . GLU B 1 44  ? -0.841  -37.006 -3.191  1.00 36.78 ? 253  GLU B N   1 
ATOM   2352 C CA  . GLU B 1 44  ? 0.320   -37.871 -3.248  1.00 37.21 ? 253  GLU B CA  1 
ATOM   2353 C C   . GLU B 1 44  ? 1.617   -37.072 -3.144  1.00 36.04 ? 253  GLU B C   1 
ATOM   2354 O O   . GLU B 1 44  ? 2.465   -37.379 -2.303  1.00 35.57 ? 253  GLU B O   1 
ATOM   2355 C CB  . GLU B 1 44  ? 0.271   -38.722 -4.519  1.00 37.57 ? 253  GLU B CB  1 
ATOM   2356 C CG  . GLU B 1 44  ? 0.991   -40.034 -4.396  1.00 41.06 ? 253  GLU B CG  1 
ATOM   2357 C CD  . GLU B 1 44  ? 2.479   -39.906 -4.674  1.00 46.70 ? 253  GLU B CD  1 
ATOM   2358 O OE1 . GLU B 1 44  ? 2.865   -39.121 -5.584  1.00 48.69 ? 253  GLU B OE1 1 
ATOM   2359 O OE2 . GLU B 1 44  ? 3.265   -40.596 -3.979  1.00 49.45 ? 253  GLU B OE2 1 
ATOM   2360 N N   . THR B 1 45  ? 1.753   -36.053 -3.994  1.00 35.56 ? 254  THR B N   1 
ATOM   2361 C CA  . THR B 1 45  ? 2.946   -35.198 -3.998  1.00 35.05 ? 254  THR B CA  1 
ATOM   2362 C C   . THR B 1 45  ? 3.136   -34.451 -2.669  1.00 35.22 ? 254  THR B C   1 
ATOM   2363 O O   . THR B 1 45  ? 4.279   -34.236 -2.240  1.00 35.20 ? 254  THR B O   1 
ATOM   2364 C CB  . THR B 1 45  ? 2.995   -34.217 -5.196  1.00 35.16 ? 254  THR B CB  1 
ATOM   2365 O OG1 . THR B 1 45  ? 1.756   -33.511 -5.329  1.00 35.20 ? 254  THR B OG1 1 
ATOM   2366 C CG2 . THR B 1 45  ? 3.312   -34.955 -6.504  1.00 34.42 ? 254  THR B CG2 1 
ATOM   2367 N N   . LEU B 1 46  ? 2.029   -34.079 -2.018  1.00 35.19 ? 255  LEU B N   1 
ATOM   2368 C CA  . LEU B 1 46  ? 2.094   -33.429 -0.698  1.00 35.80 ? 255  LEU B CA  1 
ATOM   2369 C C   . LEU B 1 46  ? 2.695   -34.387 0.302   1.00 36.03 ? 255  LEU B C   1 
ATOM   2370 O O   . LEU B 1 46  ? 3.592   -34.015 1.050   1.00 35.60 ? 255  LEU B O   1 
ATOM   2371 C CB  . LEU B 1 46  ? 0.723   -32.950 -0.201  1.00 35.45 ? 255  LEU B CB  1 
ATOM   2372 C CG  . LEU B 1 46  ? 0.695   -32.134 1.104   1.00 35.12 ? 255  LEU B CG  1 
ATOM   2373 C CD1 . LEU B 1 46  ? 1.629   -30.938 1.054   1.00 33.15 ? 255  LEU B CD1 1 
ATOM   2374 C CD2 . LEU B 1 46  ? -0.730  -31.659 1.412   1.00 35.93 ? 255  LEU B CD2 1 
ATOM   2375 N N   . TRP B 1 47  ? 2.195   -35.622 0.293   1.00 36.68 ? 256  TRP B N   1 
ATOM   2376 C CA  . TRP B 1 47  ? 2.699   -36.683 1.161   1.00 37.63 ? 256  TRP B CA  1 
ATOM   2377 C C   . TRP B 1 47  ? 4.207   -36.883 0.966   1.00 38.41 ? 256  TRP B C   1 
ATOM   2378 O O   . TRP B 1 47  ? 4.971   -36.944 1.929   1.00 37.93 ? 256  TRP B O   1 
ATOM   2379 C CB  . TRP B 1 47  ? 1.926   -37.992 0.906   1.00 37.18 ? 256  TRP B CB  1 
ATOM   2380 C CG  . TRP B 1 47  ? 2.378   -39.105 1.785   1.00 38.02 ? 256  TRP B CG  1 
ATOM   2381 C CD1 . TRP B 1 47  ? 2.162   -39.229 3.136   1.00 38.75 ? 256  TRP B CD1 1 
ATOM   2382 C CD2 . TRP B 1 47  ? 3.158   -40.240 1.398   1.00 37.56 ? 256  TRP B CD2 1 
ATOM   2383 N NE1 . TRP B 1 47  ? 2.753   -40.381 3.606   1.00 39.23 ? 256  TRP B NE1 1 
ATOM   2384 C CE2 . TRP B 1 47  ? 3.367   -41.021 2.561   1.00 37.81 ? 256  TRP B CE2 1 
ATOM   2385 C CE3 . TRP B 1 47  ? 3.687   -40.681 0.182   1.00 37.87 ? 256  TRP B CE3 1 
ATOM   2386 C CZ2 . TRP B 1 47  ? 4.084   -42.217 2.543   1.00 37.26 ? 256  TRP B CZ2 1 
ATOM   2387 C CZ3 . TRP B 1 47  ? 4.402   -41.879 0.167   1.00 39.17 ? 256  TRP B CZ3 1 
ATOM   2388 C CH2 . TRP B 1 47  ? 4.600   -42.628 1.350   1.00 37.56 ? 256  TRP B CH2 1 
ATOM   2389 N N   . GLN B 1 48  ? 4.616   -36.981 -0.292  1.00 39.22 ? 257  GLN B N   1 
ATOM   2390 C CA  . GLN B 1 48  ? 6.019   -37.044 -0.651  1.00 40.75 ? 257  GLN B CA  1 
ATOM   2391 C C   . GLN B 1 48  ? 6.808   -35.837 -0.130  1.00 40.71 ? 257  GLN B C   1 
ATOM   2392 O O   . GLN B 1 48  ? 7.881   -35.986 0.447   1.00 40.47 ? 257  GLN B O   1 
ATOM   2393 C CB  . GLN B 1 48  ? 6.123   -37.022 -2.155  1.00 41.10 ? 257  GLN B CB  1 
ATOM   2394 C CG  . GLN B 1 48  ? 7.057   -38.022 -2.688  1.00 45.99 ? 257  GLN B CG  1 
ATOM   2395 C CD  . GLN B 1 48  ? 6.326   -39.089 -3.422  1.00 50.31 ? 257  GLN B CD  1 
ATOM   2396 O OE1 . GLN B 1 48  ? 5.512   -38.795 -4.306  1.00 51.89 ? 257  GLN B OE1 1 
ATOM   2397 N NE2 . GLN B 1 48  ? 6.600   -40.345 -3.073  1.00 51.41 ? 257  GLN B NE2 1 
ATOM   2398 N N   . ALA B 1 49  ? 6.274   -34.641 -0.372  1.00 40.57 ? 258  ALA B N   1 
ATOM   2399 C CA  . ALA B 1 49  ? 6.908   -33.399 0.047   1.00 40.41 ? 258  ALA B CA  1 
ATOM   2400 C C   . ALA B 1 49  ? 7.143   -33.396 1.548   1.00 41.14 ? 258  ALA B C   1 
ATOM   2401 O O   . ALA B 1 49  ? 8.206   -32.979 2.011   1.00 40.35 ? 258  ALA B O   1 
ATOM   2402 C CB  . ALA B 1 49  ? 6.064   -32.231 -0.352  1.00 40.01 ? 258  ALA B CB  1 
ATOM   2403 N N   . GLU B 1 50  ? 6.154   -33.873 2.301   1.00 42.28 ? 259  GLU B N   1 
ATOM   2404 C CA  . GLU B 1 50  ? 6.246   -33.949 3.758   1.00 44.51 ? 259  GLU B CA  1 
ATOM   2405 C C   . GLU B 1 50  ? 7.203   -35.050 4.194   1.00 45.79 ? 259  GLU B C   1 
ATOM   2406 O O   . GLU B 1 50  ? 7.590   -35.104 5.359   1.00 46.23 ? 259  GLU B O   1 
ATOM   2407 C CB  . GLU B 1 50  ? 4.873   -34.228 4.390   1.00 44.73 ? 259  GLU B CB  1 
ATOM   2408 C CG  . GLU B 1 50  ? 3.760   -33.231 4.054   1.00 45.76 ? 259  GLU B CG  1 
ATOM   2409 C CD  . GLU B 1 50  ? 3.608   -32.165 5.093   1.00 47.99 ? 259  GLU B CD  1 
ATOM   2410 O OE1 . GLU B 1 50  ? 4.593   -31.916 5.821   1.00 51.02 ? 259  GLU B OE1 1 
ATOM   2411 O OE2 . GLU B 1 50  ? 2.513   -31.570 5.192   1.00 46.75 ? 259  GLU B OE2 1 
ATOM   2412 N N   . LYS B 1 51  ? 7.565   -35.934 3.264   1.00 47.89 ? 260  LYS B N   1 
ATOM   2413 C CA  . LYS B 1 51  ? 8.381   -37.119 3.574   1.00 49.32 ? 260  LYS B CA  1 
ATOM   2414 C C   . LYS B 1 51  ? 9.862   -36.769 3.723   1.00 50.13 ? 260  LYS B C   1 
ATOM   2415 O O   . LYS B 1 51  ? 10.675  -37.623 4.078   1.00 50.73 ? 260  LYS B O   1 
ATOM   2416 C CB  . LYS B 1 51  ? 8.183   -38.222 2.518   1.00 49.22 ? 260  LYS B CB  1 
ATOM   2417 C CG  . LYS B 1 51  ? 7.123   -39.269 2.831   1.00 50.50 ? 260  LYS B CG  1 
ATOM   2418 C CD  . LYS B 1 51  ? 7.179   -39.688 4.293   1.00 53.33 ? 260  LYS B CD  1 
ATOM   2419 C CE  . LYS B 1 51  ? 6.913   -41.162 4.478   1.00 54.73 ? 260  LYS B CE  1 
ATOM   2420 N NZ  . LYS B 1 51  ? 8.091   -42.012 4.097   1.00 55.81 ? 260  LYS B NZ  1 
ATOM   2421 N N   . GLY B 1 52  ? 10.204  -35.511 3.466   1.00 50.74 ? 261  GLY B N   1 
ATOM   2422 C CA  . GLY B 1 52  ? 11.564  -35.037 3.666   1.00 51.63 ? 261  GLY B CA  1 
ATOM   2423 C C   . GLY B 1 52  ? 12.042  -34.232 2.479   1.00 52.43 ? 261  GLY B C   1 
ATOM   2424 O O   . GLY B 1 52  ? 12.920  -33.364 2.619   1.00 52.94 ? 261  GLY B O   1 
ATOM   2425 N N   . LEU B 1 53  ? 11.449  -34.519 1.318   1.00 52.62 ? 262  LEU B N   1 
ATOM   2426 C CA  . LEU B 1 53  ? 11.754  -33.832 0.064   1.00 52.77 ? 262  LEU B CA  1 
ATOM   2427 C C   . LEU B 1 53  ? 11.630  -32.307 0.152   1.00 52.68 ? 262  LEU B C   1 
ATOM   2428 O O   . LEU B 1 53  ? 12.495  -31.578 -0.351  1.00 52.97 ? 262  LEU B O   1 
ATOM   2429 C CB  . LEU B 1 53  ? 10.855  -34.358 -1.066  1.00 53.31 ? 262  LEU B CB  1 
ATOM   2430 C CG  . LEU B 1 53  ? 11.358  -35.313 -2.156  1.00 53.73 ? 262  LEU B CG  1 
ATOM   2431 C CD1 . LEU B 1 53  ? 10.184  -35.729 -3.011  1.00 54.51 ? 262  LEU B CD1 1 
ATOM   2432 C CD2 . LEU B 1 53  ? 12.437  -34.666 -3.029  1.00 54.65 ? 262  LEU B CD2 1 
ATOM   2433 N N   . VAL B 1 54  ? 10.561  -31.827 0.785   1.00 52.10 ? 263  VAL B N   1 
ATOM   2434 C CA  . VAL B 1 54  ? 10.322  -30.394 0.881   1.00 51.60 ? 263  VAL B CA  1 
ATOM   2435 C C   . VAL B 1 54  ? 10.387  -29.937 2.338   1.00 51.94 ? 263  VAL B C   1 
ATOM   2436 O O   . VAL B 1 54  ? 11.045  -28.944 2.650   1.00 52.15 ? 263  VAL B O   1 
ATOM   2437 C CB  . VAL B 1 54  ? 9.004   -29.972 0.165   1.00 51.53 ? 263  VAL B CB  1 
ATOM   2438 C CG1 . VAL B 1 54  ? 8.661   -28.513 0.435   1.00 50.80 ? 263  VAL B CG1 1 
ATOM   2439 C CG2 . VAL B 1 54  ? 9.120   -30.210 -1.337  1.00 50.23 ? 263  VAL B CG2 1 
ATOM   2440 N N   . TRP B 1 55  ? 9.736   -30.677 3.230   1.00 51.99 ? 264  TRP B N   1 
ATOM   2441 C CA  . TRP B 1 55  ? 9.777   -30.353 4.648   1.00 52.11 ? 264  TRP B CA  1 
ATOM   2442 C C   . TRP B 1 55  ? 10.588  -31.363 5.462   1.00 52.67 ? 264  TRP B C   1 
ATOM   2443 O O   . TRP B 1 55  ? 10.352  -32.571 5.400   1.00 53.41 ? 264  TRP B O   1 
ATOM   2444 C CB  . TRP B 1 55  ? 8.357   -30.189 5.205   1.00 51.37 ? 264  TRP B CB  1 
ATOM   2445 C CG  . TRP B 1 55  ? 7.684   -28.951 4.703   1.00 50.50 ? 264  TRP B CG  1 
ATOM   2446 C CD1 . TRP B 1 55  ? 7.901   -27.678 5.130   1.00 50.23 ? 264  TRP B CD1 1 
ATOM   2447 C CD2 . TRP B 1 55  ? 6.687   -28.863 3.672   1.00 49.97 ? 264  TRP B CD2 1 
ATOM   2448 N NE1 . TRP B 1 55  ? 7.102   -26.795 4.439   1.00 49.63 ? 264  TRP B NE1 1 
ATOM   2449 C CE2 . TRP B 1 55  ? 6.346   -27.494 3.537   1.00 49.59 ? 264  TRP B CE2 1 
ATOM   2450 C CE3 . TRP B 1 55  ? 6.046   -29.804 2.853   1.00 49.36 ? 264  TRP B CE3 1 
ATOM   2451 C CZ2 . TRP B 1 55  ? 5.392   -27.041 2.617   1.00 49.23 ? 264  TRP B CZ2 1 
ATOM   2452 C CZ3 . TRP B 1 55  ? 5.100   -29.353 1.936   1.00 49.56 ? 264  TRP B CZ3 1 
ATOM   2453 C CH2 . TRP B 1 55  ? 4.781   -27.981 1.829   1.00 49.87 ? 264  TRP B CH2 1 
ATOM   2454 N N   . GLU B 1 67  ? -8.570  -34.149 6.548   1.00 42.97 ? 276  GLU B N   1 
ATOM   2455 C CA  . GLU B 1 67  ? -8.731  -34.044 5.099   1.00 42.39 ? 276  GLU B CA  1 
ATOM   2456 C C   . GLU B 1 67  ? -7.668  -33.131 4.475   1.00 42.08 ? 276  GLU B C   1 
ATOM   2457 O O   . GLU B 1 67  ? -7.041  -32.332 5.179   1.00 42.67 ? 276  GLU B O   1 
ATOM   2458 C CB  . GLU B 1 67  ? -10.137 -33.544 4.753   1.00 42.42 ? 276  GLU B CB  1 
ATOM   2459 C CG  . GLU B 1 67  ? -10.300 -32.042 4.850   1.00 44.11 ? 276  GLU B CG  1 
ATOM   2460 C CD  . GLU B 1 67  ? -11.737 -31.611 4.920   1.00 46.29 ? 276  GLU B CD  1 
ATOM   2461 O OE1 . GLU B 1 67  ? -12.303 -31.201 3.879   1.00 47.78 ? 276  GLU B OE1 1 
ATOM   2462 O OE2 . GLU B 1 67  ? -12.306 -31.679 6.024   1.00 47.44 ? 276  GLU B OE2 1 
ATOM   2463 N N   . ILE B 1 68  ? -7.482  -33.252 3.157   1.00 40.68 ? 277  ILE B N   1 
ATOM   2464 C CA  . ILE B 1 68  ? -6.493  -32.465 2.403   1.00 38.91 ? 277  ILE B CA  1 
ATOM   2465 C C   . ILE B 1 68  ? -6.609  -30.930 2.570   1.00 37.69 ? 277  ILE B C   1 
ATOM   2466 O O   . ILE B 1 68  ? -5.595  -30.262 2.764   1.00 37.46 ? 277  ILE B O   1 
ATOM   2467 C CB  . ILE B 1 68  ? -6.433  -32.890 0.878   1.00 39.12 ? 277  ILE B CB  1 
ATOM   2468 C CG1 . ILE B 1 68  ? -5.218  -32.287 0.165   1.00 38.89 ? 277  ILE B CG1 1 
ATOM   2469 C CG2 . ILE B 1 68  ? -7.738  -32.566 0.122   1.00 37.93 ? 277  ILE B CG2 1 
ATOM   2470 C CD1 . ILE B 1 68  ? -3.867  -32.702 0.767   1.00 42.62 ? 277  ILE B CD1 1 
ATOM   2471 N N   . SER B 1 69  ? -7.827  -30.388 2.493   1.00 36.26 ? 278  SER B N   1 
ATOM   2472 C CA  . SER B 1 69  ? -8.037  -28.937 2.571   1.00 34.90 ? 278  SER B CA  1 
ATOM   2473 C C   . SER B 1 69  ? -7.570  -28.339 3.906   1.00 34.14 ? 278  SER B C   1 
ATOM   2474 O O   . SER B 1 69  ? -6.987  -27.242 3.942   1.00 34.32 ? 278  SER B O   1 
ATOM   2475 C CB  . SER B 1 69  ? -9.515  -28.590 2.335   1.00 35.58 ? 278  SER B CB  1 
ATOM   2476 O OG  . SER B 1 69  ? -9.939  -29.015 1.048   1.00 36.09 ? 278  SER B OG  1 
ATOM   2477 N N   . VAL B 1 70  ? -7.847  -29.059 4.990   1.00 32.33 ? 279  VAL B N   1 
ATOM   2478 C CA  . VAL B 1 70  ? -7.533  -28.601 6.337   1.00 31.82 ? 279  VAL B CA  1 
ATOM   2479 C C   . VAL B 1 70  ? -6.033  -28.739 6.555   1.00 31.62 ? 279  VAL B C   1 
ATOM   2480 O O   . VAL B 1 70  ? -5.409  -27.851 7.123   1.00 30.81 ? 279  VAL B O   1 
ATOM   2481 C CB  . VAL B 1 70  ? -8.339  -29.373 7.396   1.00 31.71 ? 279  VAL B CB  1 
ATOM   2482 C CG1 . VAL B 1 70  ? -7.939  -28.963 8.795   1.00 32.92 ? 279  VAL B CG1 1 
ATOM   2483 C CG2 . VAL B 1 70  ? -9.846  -29.132 7.195   1.00 30.69 ? 279  VAL B CG2 1 
ATOM   2484 N N   . HIS B 1 71  ? -5.455  -29.833 6.072   1.00 30.86 ? 280  HIS B N   1 
ATOM   2485 C CA  . HIS B 1 71  ? -4.021  -30.000 6.170   1.00 31.58 ? 280  HIS B CA  1 
ATOM   2486 C C   . HIS B 1 71  ? -3.224  -28.864 5.484   1.00 30.74 ? 280  HIS B C   1 
ATOM   2487 O O   . HIS B 1 71  ? -2.296  -28.323 6.078   1.00 31.59 ? 280  HIS B O   1 
ATOM   2488 C CB  . HIS B 1 71  ? -3.567  -31.365 5.655   1.00 32.10 ? 280  HIS B CB  1 
ATOM   2489 C CG  . HIS B 1 71  ? -2.093  -31.560 5.787   1.00 33.91 ? 280  HIS B CG  1 
ATOM   2490 N ND1 . HIS B 1 71  ? -1.480  -31.788 7.001   1.00 36.91 ? 280  HIS B ND1 1 
ATOM   2491 C CD2 . HIS B 1 71  ? -1.101  -31.513 4.871   1.00 37.00 ? 280  HIS B CD2 1 
ATOM   2492 C CE1 . HIS B 1 71  ? -0.176  -31.892 6.823   1.00 36.45 ? 280  HIS B CE1 1 
ATOM   2493 N NE2 . HIS B 1 71  ? 0.079   -31.735 5.538   1.00 35.61 ? 280  HIS B NE2 1 
ATOM   2494 N N   . VAL B 1 72  ? -3.607  -28.513 4.256   1.00 29.67 ? 281  VAL B N   1 
ATOM   2495 C CA  . VAL B 1 72  ? -3.078  -27.355 3.541   1.00 29.78 ? 281  VAL B CA  1 
ATOM   2496 C C   . VAL B 1 72  ? -3.288  -26.045 4.312   1.00 29.17 ? 281  VAL B C   1 
ATOM   2497 O O   . VAL B 1 72  ? -2.374  -25.221 4.414   1.00 27.64 ? 281  VAL B O   1 
ATOM   2498 C CB  . VAL B 1 72  ? -3.632  -27.266 2.087   1.00 29.79 ? 281  VAL B CB  1 
ATOM   2499 C CG1 . VAL B 1 72  ? -3.226  -25.948 1.392   1.00 31.92 ? 281  VAL B CG1 1 
ATOM   2500 C CG2 . VAL B 1 72  ? -3.143  -28.464 1.263   1.00 30.89 ? 281  VAL B CG2 1 
ATOM   2501 N N   . PHE B 1 73  ? -4.474  -25.867 4.884   1.00 29.04 ? 282  PHE B N   1 
ATOM   2502 C CA  . PHE B 1 73  ? -4.735  -24.697 5.730   1.00 29.36 ? 282  PHE B CA  1 
ATOM   2503 C C   . PHE B 1 73  ? -3.734  -24.632 6.903   1.00 29.43 ? 282  PHE B C   1 
ATOM   2504 O O   . PHE B 1 73  ? -3.268  -23.547 7.254   1.00 29.20 ? 282  PHE B O   1 
ATOM   2505 C CB  . PHE B 1 73  ? -6.181  -24.753 6.229   1.00 29.42 ? 282  PHE B CB  1 
ATOM   2506 C CG  . PHE B 1 73  ? -6.658  -23.508 6.957   1.00 30.85 ? 282  PHE B CG  1 
ATOM   2507 C CD1 . PHE B 1 73  ? -6.694  -22.268 6.331   1.00 32.05 ? 282  PHE B CD1 1 
ATOM   2508 C CD2 . PHE B 1 73  ? -7.131  -23.602 8.257   1.00 32.59 ? 282  PHE B CD2 1 
ATOM   2509 C CE1 . PHE B 1 73  ? -7.177  -21.140 6.991   1.00 29.02 ? 282  PHE B CE1 1 
ATOM   2510 C CE2 . PHE B 1 73  ? -7.610  -22.463 8.933   1.00 31.41 ? 282  PHE B CE2 1 
ATOM   2511 C CZ  . PHE B 1 73  ? -7.633  -21.248 8.293   1.00 29.90 ? 282  PHE B CZ  1 
ATOM   2512 N N   . TYR B 1 74  ? -3.400  -25.786 7.492   1.00 29.76 ? 283  TYR B N   1 
ATOM   2513 C CA  . TYR B 1 74  ? -2.475  -25.829 8.636   1.00 29.93 ? 283  TYR B CA  1 
ATOM   2514 C C   . TYR B 1 74  ? -1.049  -25.479 8.211   1.00 29.55 ? 283  TYR B C   1 
ATOM   2515 O O   . TYR B 1 74  ? -0.311  -24.810 8.949   1.00 27.54 ? 283  TYR B O   1 
ATOM   2516 C CB  . TYR B 1 74  ? -2.486  -27.194 9.338   1.00 31.09 ? 283  TYR B CB  1 
ATOM   2517 C CG  . TYR B 1 74  ? -3.755  -27.490 10.122  1.00 33.00 ? 283  TYR B CG  1 
ATOM   2518 C CD1 . TYR B 1 74  ? -4.630  -26.470 10.504  1.00 34.25 ? 283  TYR B CD1 1 
ATOM   2519 C CD2 . TYR B 1 74  ? -4.063  -28.795 10.501  1.00 35.00 ? 283  TYR B CD2 1 
ATOM   2520 C CE1 . TYR B 1 74  ? -5.800  -26.747 11.227  1.00 34.49 ? 283  TYR B CE1 1 
ATOM   2521 C CE2 . TYR B 1 74  ? -5.216  -29.086 11.218  1.00 36.19 ? 283  TYR B CE2 1 
ATOM   2522 C CZ  . TYR B 1 74  ? -6.080  -28.063 11.583  1.00 35.41 ? 283  TYR B CZ  1 
ATOM   2523 O OH  . TYR B 1 74  ? -7.219  -28.373 12.305  1.00 35.49 ? 283  TYR B OH  1 
ATOM   2524 N N   . ARG B 1 75  ? -0.668  -25.940 7.022   1.00 29.42 ? 284  ARG B N   1 
ATOM   2525 C CA  . ARG B 1 75  ? 0.610   -25.556 6.408   1.00 29.75 ? 284  ARG B CA  1 
ATOM   2526 C C   . ARG B 1 75  ? 0.679   -24.047 6.156   1.00 28.64 ? 284  ARG B C   1 
ATOM   2527 O O   . ARG B 1 75  ? 1.728   -23.422 6.362   1.00 28.43 ? 284  ARG B O   1 
ATOM   2528 C CB  . ARG B 1 75  ? 0.772   -26.274 5.080   1.00 30.63 ? 284  ARG B CB  1 
ATOM   2529 C CG  . ARG B 1 75  ? 1.425   -27.610 5.181   1.00 35.11 ? 284  ARG B CG  1 
ATOM   2530 C CD  . ARG B 1 75  ? 2.942   -27.430 5.102   1.00 40.60 ? 284  ARG B CD  1 
ATOM   2531 N NE  . ARG B 1 75  ? 3.601   -28.506 5.811   1.00 45.62 ? 284  ARG B NE  1 
ATOM   2532 C CZ  . ARG B 1 75  ? 4.415   -28.341 6.843   1.00 47.67 ? 284  ARG B CZ  1 
ATOM   2533 N NH1 . ARG B 1 75  ? 4.713   -27.125 7.272   1.00 48.67 ? 284  ARG B NH1 1 
ATOM   2534 N NH2 . ARG B 1 75  ? 4.950   -29.407 7.423   1.00 49.15 ? 284  ARG B NH2 1 
ATOM   2535 N N   . CYS B 1 76  ? -0.426  -23.477 5.690   1.00 27.41 ? 285  CYS B N   1 
ATOM   2536 C CA  . CYS B 1 76  ? -0.548  -22.027 5.503   1.00 27.87 ? 285  CYS B CA  1 
ATOM   2537 C C   . CYS B 1 76  ? -0.339  -21.269 6.813   1.00 27.36 ? 285  CYS B C   1 
ATOM   2538 O O   . CYS B 1 76  ? 0.394   -20.272 6.837   1.00 26.82 ? 285  CYS B O   1 
ATOM   2539 C CB  . CYS B 1 76  ? -1.932  -21.672 4.958   1.00 28.24 ? 285  CYS B CB  1 
ATOM   2540 S SG  . CYS B 1 76  ? -2.150  -22.127 3.224   1.00 32.65 ? 285  CYS B SG  1 
ATOM   2541 N N   . GLN B 1 77  ? -1.008  -21.720 7.890   1.00 26.43 ? 286  GLN B N   1 
ATOM   2542 C CA  . GLN B 1 77  ? -0.857  -21.094 9.200   1.00 26.68 ? 286  GLN B CA  1 
ATOM   2543 C C   . GLN B 1 77  ? 0.585   -21.144 9.713   1.00 28.25 ? 286  GLN B C   1 
ATOM   2544 O O   . GLN B 1 77  ? 1.066   -20.206 10.344  1.00 27.63 ? 286  GLN B O   1 
ATOM   2545 C CB  . GLN B 1 77  ? -1.764  -21.761 10.222  1.00 26.78 ? 286  GLN B CB  1 
ATOM   2546 C CG  . GLN B 1 77  ? -3.273  -21.458 9.972   1.00 25.31 ? 286  GLN B CG  1 
ATOM   2547 C CD  . GLN B 1 77  ? -4.143  -21.991 11.063  1.00 28.25 ? 286  GLN B CD  1 
ATOM   2548 O OE1 . GLN B 1 77  ? -3.857  -21.796 12.245  1.00 28.35 ? 286  GLN B OE1 1 
ATOM   2549 N NE2 . GLN B 1 77  ? -5.243  -22.651 10.682  1.00 27.56 ? 286  GLN B NE2 1 
ATOM   2550 N N   . CYS B 1 78  ? 1.249   -22.259 9.476   1.00 29.87 ? 287  CYS B N   1 
ATOM   2551 C CA  . CYS B 1 78  ? 2.614   -22.444 9.936   1.00 30.02 ? 287  CYS B CA  1 
ATOM   2552 C C   . CYS B 1 78  ? 3.575   -21.432 9.250   1.00 29.06 ? 287  CYS B C   1 
ATOM   2553 O O   . CYS B 1 78  ? 4.411   -20.783 9.897   1.00 29.64 ? 287  CYS B O   1 
ATOM   2554 C CB  . CYS B 1 78  ? 3.000   -23.913 9.718   1.00 30.31 ? 287  CYS B CB  1 
ATOM   2555 S SG  . CYS B 1 78  ? 4.756   -24.274 10.093  1.00 38.88 ? 287  CYS B SG  1 
ATOM   2556 N N   . THR B 1 79  ? 3.400   -21.260 7.954   1.00 28.28 ? 288  THR B N   1 
ATOM   2557 C CA  . THR B 1 79  ? 4.167   -20.311 7.158   1.00 28.27 ? 288  THR B CA  1 
ATOM   2558 C C   . THR B 1 79  ? 3.883   -18.869 7.536   1.00 26.47 ? 288  THR B C   1 
ATOM   2559 O O   . THR B 1 79  ? 4.810   -18.093 7.721   1.00 25.81 ? 288  THR B O   1 
ATOM   2560 C CB  . THR B 1 79  ? 3.877   -20.518 5.663   1.00 28.45 ? 288  THR B CB  1 
ATOM   2561 O OG1 . THR B 1 79  ? 4.163   -21.882 5.330   1.00 31.85 ? 288  THR B OG1 1 
ATOM   2562 C CG2 . THR B 1 79  ? 4.746   -19.587 4.814   1.00 30.52 ? 288  THR B CG2 1 
ATOM   2563 N N   . THR B 1 80  ? 2.605   -18.494 7.698   1.00 24.92 ? 289  THR B N   1 
ATOM   2564 C CA  . THR B 1 80  ? 2.313   -17.103 8.010   1.00 22.60 ? 289  THR B CA  1 
ATOM   2565 C C   . THR B 1 80  ? 2.774   -16.715 9.401   1.00 22.48 ? 289  THR B C   1 
ATOM   2566 O O   . THR B 1 80  ? 3.276   -15.605 9.601   1.00 23.11 ? 289  THR B O   1 
ATOM   2567 C CB  . THR B 1 80  ? 0.796   -16.715 7.870   1.00 23.42 ? 289  THR B CB  1 
ATOM   2568 O OG1 . THR B 1 80  ? 0.045   -17.513 8.766   1.00 19.96 ? 289  THR B OG1 1 
ATOM   2569 C CG2 . THR B 1 80  ? 0.294   -16.905 6.457   1.00 20.97 ? 289  THR B CG2 1 
ATOM   2570 N N   . VAL B 1 81  ? 2.634   -17.615 10.362  1.00 21.57 ? 290  VAL B N   1 
ATOM   2571 C CA  . VAL B 1 81  ? 3.131   -17.344 11.735  1.00 22.67 ? 290  VAL B CA  1 
ATOM   2572 C C   . VAL B 1 81  ? 4.680   -17.192 11.768  1.00 22.86 ? 290  VAL B C   1 
ATOM   2573 O O   . VAL B 1 81  ? 5.230   -16.367 12.507  1.00 22.32 ? 290  VAL B O   1 
ATOM   2574 C CB  . VAL B 1 81  ? 2.600   -18.385 12.750  1.00 22.30 ? 290  VAL B CB  1 
ATOM   2575 C CG1 . VAL B 1 81  ? 3.314   -18.297 14.131  1.00 24.80 ? 290  VAL B CG1 1 
ATOM   2576 C CG2 . VAL B 1 81  ? 1.083   -18.166 12.976  1.00 22.21 ? 290  VAL B CG2 1 
ATOM   2577 N N   . GLU B 1 82  ? 5.365   -17.934 10.924  1.00 23.77 ? 291  GLU B N   1 
ATOM   2578 C CA  . GLU B 1 82  ? 6.833   -17.728 10.805  1.00 24.26 ? 291  GLU B CA  1 
ATOM   2579 C C   . GLU B 1 82  ? 7.126   -16.352 10.183  1.00 23.27 ? 291  GLU B C   1 
ATOM   2580 O O   . GLU B 1 82  ? 8.029   -15.642 10.633  1.00 23.98 ? 291  GLU B O   1 
ATOM   2581 C CB  . GLU B 1 82  ? 7.468   -18.864 9.987   1.00 25.12 ? 291  GLU B CB  1 
ATOM   2582 C CG  . GLU B 1 82  ? 9.008   -18.738 9.805   1.00 29.08 ? 291  GLU B CG  1 
ATOM   2583 C CD  . GLU B 1 82  ? 9.806   -18.623 11.121  1.00 34.90 ? 291  GLU B CD  1 
ATOM   2584 O OE1 . GLU B 1 82  ? 11.022  -18.306 11.042  1.00 39.80 ? 291  GLU B OE1 1 
ATOM   2585 O OE2 . GLU B 1 82  ? 9.258   -18.860 12.231  1.00 36.09 ? 291  GLU B OE2 1 
ATOM   2586 N N   . THR B 1 83  ? 6.346   -15.952 9.163   1.00 22.54 ? 292  THR B N   1 
ATOM   2587 C CA  . THR B 1 83  ? 6.506   -14.628 8.566   1.00 21.18 ? 292  THR B CA  1 
ATOM   2588 C C   . THR B 1 83  ? 6.167   -13.488 9.537   1.00 20.74 ? 292  THR B C   1 
ATOM   2589 O O   . THR B 1 83  ? 6.850   -12.487 9.543   1.00 20.41 ? 292  THR B O   1 
ATOM   2590 C CB  . THR B 1 83  ? 5.795   -14.486 7.196   1.00 21.33 ? 292  THR B CB  1 
ATOM   2591 O OG1 . THR B 1 83  ? 6.189   -15.572 6.379   1.00 21.16 ? 292  THR B OG1 1 
ATOM   2592 C CG2 . THR B 1 83  ? 6.206   -13.230 6.518   1.00 19.56 ? 292  THR B CG2 1 
ATOM   2593 N N   . VAL B 1 84  ? 5.142   -13.663 10.375  1.00 21.03 ? 293  VAL B N   1 
ATOM   2594 C CA  . VAL B 1 84  ? 4.875   -12.729 11.477  1.00 20.72 ? 293  VAL B CA  1 
ATOM   2595 C C   . VAL B 1 84  ? 6.095   -12.564 12.416  1.00 20.79 ? 293  VAL B C   1 
ATOM   2596 O O   . VAL B 1 84  ? 6.417   -11.472 12.820  1.00 19.58 ? 293  VAL B O   1 
ATOM   2597 C CB  . VAL B 1 84  ? 3.685   -13.179 12.325  1.00 19.75 ? 293  VAL B CB  1 
ATOM   2598 C CG1 . VAL B 1 84  ? 3.558   -12.289 13.534  1.00 19.56 ? 293  VAL B CG1 1 
ATOM   2599 C CG2 . VAL B 1 84  ? 2.364   -13.121 11.484  1.00 19.33 ? 293  VAL B CG2 1 
ATOM   2600 N N   . ARG B 1 85  ? 6.723   -13.666 12.793  1.00 22.71 ? 294  ARG B N   1 
ATOM   2601 C CA  . ARG B 1 85  ? 7.969   -13.597 13.556  1.00 24.74 ? 294  ARG B CA  1 
ATOM   2602 C C   . ARG B 1 85  ? 9.038   -12.775 12.883  1.00 23.45 ? 294  ARG B C   1 
ATOM   2603 O O   . ARG B 1 85  ? 9.639   -11.945 13.542  1.00 24.28 ? 294  ARG B O   1 
ATOM   2604 C CB  . ARG B 1 85  ? 8.540   -14.986 13.875  1.00 26.16 ? 294  ARG B CB  1 
ATOM   2605 C CG  . ARG B 1 85  ? 7.923   -15.620 15.111  1.00 32.33 ? 294  ARG B CG  1 
ATOM   2606 C CD  . ARG B 1 85  ? 8.480   -17.015 15.346  1.00 40.00 ? 294  ARG B CD  1 
ATOM   2607 N NE  . ARG B 1 85  ? 7.789   -17.698 16.446  1.00 44.16 ? 294  ARG B NE  1 
ATOM   2608 C CZ  . ARG B 1 85  ? 8.320   -17.929 17.654  1.00 46.08 ? 294  ARG B CZ  1 
ATOM   2609 N NH1 . ARG B 1 85  ? 9.550   -17.532 17.947  1.00 46.15 ? 294  ARG B NH1 1 
ATOM   2610 N NH2 . ARG B 1 85  ? 7.611   -18.567 18.580  1.00 48.20 ? 294  ARG B NH2 1 
ATOM   2611 N N   . GLU B 1 86  ? 9.296   -13.015 11.592  1.00 23.44 ? 295  GLU B N   1 
ATOM   2612 C CA  . GLU B 1 86  ? 10.326  -12.243 10.877  1.00 23.34 ? 295  GLU B CA  1 
ATOM   2613 C C   . GLU B 1 86  ? 9.944   -10.770 10.800  1.00 22.54 ? 295  GLU B C   1 
ATOM   2614 O O   . GLU B 1 86  ? 10.789  -9.894  10.943  1.00 22.17 ? 295  GLU B O   1 
ATOM   2615 C CB  . GLU B 1 86  ? 10.559  -12.807 9.459   1.00 22.80 ? 295  GLU B CB  1 
ATOM   2616 C CG  . GLU B 1 86  ? 11.082  -14.225 9.452   1.00 25.83 ? 295  GLU B CG  1 
ATOM   2617 C CD  . GLU B 1 86  ? 10.892  -14.934 8.127   1.00 31.26 ? 295  GLU B CD  1 
ATOM   2618 O OE1 . GLU B 1 86  ? 10.176  -14.431 7.238   1.00 34.56 ? 295  GLU B OE1 1 
ATOM   2619 O OE2 . GLU B 1 86  ? 11.439  -16.034 7.976   1.00 36.96 ? 295  GLU B OE2 1 
ATOM   2620 N N   . LEU B 1 87  ? 8.654   -10.482 10.566  1.00 20.22 ? 296  LEU B N   1 
ATOM   2621 C CA  . LEU B 1 87  ? 8.212   -9.090  10.481  1.00 18.53 ? 296  LEU B CA  1 
ATOM   2622 C C   . LEU B 1 87  ? 8.371   -8.379  11.810  1.00 18.00 ? 296  LEU B C   1 
ATOM   2623 O O   . LEU B 1 87  ? 8.662   -7.167  11.845  1.00 18.49 ? 296  LEU B O   1 
ATOM   2624 C CB  . LEU B 1 87  ? 6.707   -8.997  10.008  1.00 18.02 ? 296  LEU B CB  1 
ATOM   2625 C CG  . LEU B 1 87  ? 6.436   -9.183  8.506   1.00 17.43 ? 296  LEU B CG  1 
ATOM   2626 C CD1 . LEU B 1 87  ? 4.929   -9.605  8.219   1.00 19.54 ? 296  LEU B CD1 1 
ATOM   2627 C CD2 . LEU B 1 87  ? 6.787   -7.920  7.756   1.00 20.27 ? 296  LEU B CD2 1 
ATOM   2628 N N   . THR B 1 88  ? 8.149   -9.100  12.903  1.00 18.80 ? 297  THR B N   1 
ATOM   2629 C CA  . THR B 1 88  ? 8.301   -8.520  14.249  1.00 21.56 ? 297  THR B CA  1 
ATOM   2630 C C   . THR B 1 88  ? 9.790   -8.097  14.493  1.00 22.01 ? 297  THR B C   1 
ATOM   2631 O O   . THR B 1 88  ? 10.083  -7.001  14.981  1.00 22.21 ? 297  THR B O   1 
ATOM   2632 C CB  . THR B 1 88  ? 7.789   -9.519  15.318  1.00 22.02 ? 297  THR B CB  1 
ATOM   2633 O OG1 . THR B 1 88  ? 6.360   -9.697  15.180  1.00 25.93 ? 297  THR B OG1 1 
ATOM   2634 C CG2 . THR B 1 88  ? 8.050   -9.028  16.743  1.00 22.68 ? 297  THR B CG2 1 
ATOM   2635 N N   . GLU B 1 89  ? 10.702  -8.969  14.110  1.00 23.43 ? 298  GLU B N   1 
ATOM   2636 C CA  . GLU B 1 89  ? 12.163  -8.658  14.213  1.00 25.25 ? 298  GLU B CA  1 
ATOM   2637 C C   . GLU B 1 89  ? 12.575  -7.547  13.269  1.00 24.66 ? 298  GLU B C   1 
ATOM   2638 O O   . GLU B 1 89  ? 13.339  -6.675  13.641  1.00 25.45 ? 298  GLU B O   1 
ATOM   2639 C CB  . GLU B 1 89  ? 12.975  -9.927  13.975  1.00 25.85 ? 298  GLU B CB  1 
ATOM   2640 C CG  . GLU B 1 89  ? 12.759  -10.948 15.082  1.00 32.37 ? 298  GLU B CG  1 
ATOM   2641 C CD  . GLU B 1 89  ? 13.218  -10.422 16.447  1.00 40.11 ? 298  GLU B CD  1 
ATOM   2642 O OE1 . GLU B 1 89  ? 14.423  -10.088 16.586  1.00 41.52 ? 298  GLU B OE1 1 
ATOM   2643 O OE2 . GLU B 1 89  ? 12.361  -10.321 17.366  1.00 44.41 ? 298  GLU B OE2 1 
ATOM   2644 N N   . PHE B 1 90  ? 12.048  -7.561  12.041  1.00 25.53 ? 299  PHE B N   1 
ATOM   2645 C CA  . PHE B 1 90  ? 12.275  -6.499  11.045  1.00 24.72 ? 299  PHE B CA  1 
ATOM   2646 C C   . PHE B 1 90  ? 11.856  -5.122  11.540  1.00 24.41 ? 299  PHE B C   1 
ATOM   2647 O O   . PHE B 1 90  ? 12.576  -4.156  11.355  1.00 23.57 ? 299  PHE B O   1 
ATOM   2648 C CB  . PHE B 1 90  ? 11.517  -6.832  9.747   1.00 24.28 ? 299  PHE B CB  1 
ATOM   2649 C CG  . PHE B 1 90  ? 11.480  -5.703  8.742   1.00 25.15 ? 299  PHE B CG  1 
ATOM   2650 C CD1 . PHE B 1 90  ? 12.616  -5.367  8.003   1.00 24.23 ? 299  PHE B CD1 1 
ATOM   2651 C CD2 . PHE B 1 90  ? 10.285  -4.989  8.517   1.00 22.55 ? 299  PHE B CD2 1 
ATOM   2652 C CE1 . PHE B 1 90  ? 12.592  -4.318  7.066   1.00 27.32 ? 299  PHE B CE1 1 
ATOM   2653 C CE2 . PHE B 1 90  ? 10.233  -3.946  7.606   1.00 24.78 ? 299  PHE B CE2 1 
ATOM   2654 C CZ  . PHE B 1 90  ? 11.374  -3.598  6.854   1.00 26.48 ? 299  PHE B CZ  1 
ATOM   2655 N N   . ALA B 1 91  ? 10.674  -5.036  12.160  1.00 24.19 ? 300  ALA B N   1 
ATOM   2656 C CA  . ALA B 1 91  ? 10.130  -3.781  12.639  1.00 24.73 ? 300  ALA B CA  1 
ATOM   2657 C C   . ALA B 1 91  ? 11.079  -3.110  13.648  1.00 25.13 ? 300  ALA B C   1 
ATOM   2658 O O   . ALA B 1 91  ? 11.278  -1.912  13.627  1.00 24.88 ? 300  ALA B O   1 
ATOM   2659 C CB  . ALA B 1 91  ? 8.706   -3.994  13.254  1.00 23.42 ? 300  ALA B CB  1 
ATOM   2660 N N   . LYS B 1 92  ? 11.673  -3.896  14.519  1.00 27.67 ? 301  LYS B N   1 
ATOM   2661 C CA  . LYS B 1 92  ? 12.709  -3.373  15.416  1.00 30.91 ? 301  LYS B CA  1 
ATOM   2662 C C   . LYS B 1 92  ? 13.808  -2.567  14.698  1.00 32.75 ? 301  LYS B C   1 
ATOM   2663 O O   . LYS B 1 92  ? 14.429  -1.700  15.314  1.00 34.26 ? 301  LYS B O   1 
ATOM   2664 C CB  . LYS B 1 92  ? 13.318  -4.503  16.217  1.00 30.83 ? 301  LYS B CB  1 
ATOM   2665 C CG  . LYS B 1 92  ? 12.320  -5.171  17.113  1.00 32.25 ? 301  LYS B CG  1 
ATOM   2666 C CD  . LYS B 1 92  ? 12.923  -6.404  17.763  1.00 38.52 ? 301  LYS B CD  1 
ATOM   2667 C CE  . LYS B 1 92  ? 11.912  -7.076  18.706  1.00 38.83 ? 301  LYS B CE  1 
ATOM   2668 N NZ  . LYS B 1 92  ? 12.517  -8.296  19.322  1.00 42.01 ? 301  LYS B NZ  1 
ATOM   2669 N N   . SER B 1 93  ? 14.026  -2.800  13.402  1.00 33.85 ? 302  SER B N   1 
ATOM   2670 C CA  . SER B 1 93  ? 15.085  -2.060  12.700  1.00 34.91 ? 302  SER B CA  1 
ATOM   2671 C C   . SER B 1 93  ? 14.620  -0.807  11.944  1.00 35.42 ? 302  SER B C   1 
ATOM   2672 O O   . SER B 1 93  ? 15.458  -0.067  11.384  1.00 36.20 ? 302  SER B O   1 
ATOM   2673 C CB  . SER B 1 93  ? 15.869  -2.981  11.773  1.00 35.50 ? 302  SER B CB  1 
ATOM   2674 O OG  . SER B 1 93  ? 16.239  -4.180  12.443  1.00 36.43 ? 302  SER B OG  1 
ATOM   2675 N N   . ILE B 1 94  ? 13.306  -0.561  11.921  1.00 34.80 ? 303  ILE B N   1 
ATOM   2676 C CA  . ILE B 1 94  ? 12.753  0.645   11.309  1.00 34.21 ? 303  ILE B CA  1 
ATOM   2677 C C   . ILE B 1 94  ? 13.043  1.746   12.324  1.00 34.72 ? 303  ILE B C   1 
ATOM   2678 O O   . ILE B 1 94  ? 12.699  1.590   13.494  1.00 35.28 ? 303  ILE B O   1 
ATOM   2679 C CB  . ILE B 1 94  ? 11.215  0.504   11.064  1.00 34.21 ? 303  ILE B CB  1 
ATOM   2680 C CG1 . ILE B 1 94  ? 10.915  -0.660  10.129  1.00 32.44 ? 303  ILE B CG1 1 
ATOM   2681 C CG2 . ILE B 1 94  ? 10.632  1.744   10.444  1.00 33.24 ? 303  ILE B CG2 1 
ATOM   2682 C CD1 . ILE B 1 94  ? 9.445   -1.046  10.136  1.00 33.48 ? 303  ILE B CD1 1 
ATOM   2683 N N   . PRO B 1 95  ? 13.776  2.814   11.928  1.00 35.51 ? 304  PRO B N   1 
ATOM   2684 C CA  . PRO B 1 95  ? 14.031  3.925   12.869  1.00 34.85 ? 304  PRO B CA  1 
ATOM   2685 C C   . PRO B 1 95  ? 12.782  4.405   13.588  1.00 34.66 ? 304  PRO B C   1 
ATOM   2686 O O   . PRO B 1 95  ? 11.742  4.678   12.954  1.00 34.27 ? 304  PRO B O   1 
ATOM   2687 C CB  . PRO B 1 95  ? 14.594  5.022   11.973  1.00 34.75 ? 304  PRO B CB  1 
ATOM   2688 C CG  . PRO B 1 95  ? 15.378  4.244   10.944  1.00 35.41 ? 304  PRO B CG  1 
ATOM   2689 C CD  . PRO B 1 95  ? 14.489  3.031   10.650  1.00 35.66 ? 304  PRO B CD  1 
ATOM   2690 N N   . SER B 1 96  ? 12.908  4.455   14.915  1.00 33.69 ? 305  SER B N   1 
ATOM   2691 C CA  . SER B 1 96  ? 11.894  4.949   15.823  1.00 32.26 ? 305  SER B CA  1 
ATOM   2692 C C   . SER B 1 96  ? 10.762  3.981   16.185  1.00 30.85 ? 305  SER B C   1 
ATOM   2693 O O   . SER B 1 96  ? 10.014  4.266   17.109  1.00 30.64 ? 305  SER B O   1 
ATOM   2694 C CB  . SER B 1 96  ? 11.357  6.311   15.355  1.00 32.82 ? 305  SER B CB  1 
ATOM   2695 O OG  . SER B 1 96  ? 12.371  7.302   15.407  1.00 35.75 ? 305  SER B OG  1 
ATOM   2696 N N   . PHE B 1 97  ? 10.645  2.843   15.495  1.00 30.13 ? 306  PHE B N   1 
ATOM   2697 C CA  . PHE B 1 97  ? 9.653   1.817   15.886  1.00 29.40 ? 306  PHE B CA  1 
ATOM   2698 C C   . PHE B 1 97  ? 9.809   1.369   17.355  1.00 29.63 ? 306  PHE B C   1 
ATOM   2699 O O   . PHE B 1 97  ? 8.821   1.320   18.092  1.00 28.64 ? 306  PHE B O   1 
ATOM   2700 C CB  . PHE B 1 97  ? 9.668   0.595   14.954  1.00 27.38 ? 306  PHE B CB  1 
ATOM   2701 C CG  . PHE B 1 97  ? 8.642   -0.470  15.327  1.00 26.60 ? 306  PHE B CG  1 
ATOM   2702 C CD1 . PHE B 1 97  ? 8.991   -1.543  16.146  1.00 22.45 ? 306  PHE B CD1 1 
ATOM   2703 C CD2 . PHE B 1 97  ? 7.298   -0.377  14.864  1.00 24.11 ? 306  PHE B CD2 1 
ATOM   2704 C CE1 . PHE B 1 97  ? 8.042   -2.538  16.510  1.00 23.41 ? 306  PHE B CE1 1 
ATOM   2705 C CE2 . PHE B 1 97  ? 6.361   -1.345  15.196  1.00 20.92 ? 306  PHE B CE2 1 
ATOM   2706 C CZ  . PHE B 1 97  ? 6.702   -2.430  16.012  1.00 21.33 ? 306  PHE B CZ  1 
ATOM   2707 N N   . SER B 1 98  ? 11.040  1.019   17.740  1.00 30.48 ? 307  SER B N   1 
ATOM   2708 C CA  . SER B 1 98  ? 11.386  0.521   19.088  1.00 31.49 ? 307  SER B CA  1 
ATOM   2709 C C   . SER B 1 98  ? 11.187  1.543   20.182  1.00 31.97 ? 307  SER B C   1 
ATOM   2710 O O   . SER B 1 98  ? 11.027  1.180   21.352  1.00 32.47 ? 307  SER B O   1 
ATOM   2711 C CB  . SER B 1 98  ? 12.843  0.065   19.131  1.00 31.74 ? 307  SER B CB  1 
ATOM   2712 O OG  . SER B 1 98  ? 13.024  -1.116  18.383  1.00 33.87 ? 307  SER B OG  1 
ATOM   2713 N N   . SER B 1 99  ? 11.187  2.825   19.824  1.00 32.59 ? 308  SER B N   1 
ATOM   2714 C CA  . SER B 1 99  ? 10.963  3.870   20.804  1.00 33.08 ? 308  SER B CA  1 
ATOM   2715 C C   . SER B 1 99  ? 9.477   4.101   21.044  1.00 32.82 ? 308  SER B C   1 
ATOM   2716 O O   . SER B 1 99  ? 9.121   4.912   21.902  1.00 33.19 ? 308  SER B O   1 
ATOM   2717 C CB  . SER B 1 99  ? 11.647  5.177   20.384  1.00 33.86 ? 308  SER B CB  1 
ATOM   2718 O OG  . SER B 1 99  ? 10.867  5.872   19.396  1.00 38.08 ? 308  SER B OG  1 
ATOM   2719 N N   . LEU B 1 100 ? 8.600   3.407   20.304  1.00 31.03 ? 309  LEU B N   1 
ATOM   2720 C CA  . LEU B 1 100 ? 7.160   3.536   20.578  1.00 30.43 ? 309  LEU B CA  1 
ATOM   2721 C C   . LEU B 1 100 ? 6.837   2.716   21.823  1.00 29.48 ? 309  LEU B C   1 
ATOM   2722 O O   . LEU B 1 100 ? 7.558   1.756   22.150  1.00 30.15 ? 309  LEU B O   1 
ATOM   2723 C CB  . LEU B 1 100 ? 6.293   3.074   19.383  1.00 29.91 ? 309  LEU B CB  1 
ATOM   2724 C CG  . LEU B 1 100 ? 6.411   3.848   18.055  1.00 31.38 ? 309  LEU B CG  1 
ATOM   2725 C CD1 . LEU B 1 100 ? 5.772   3.089   16.892  1.00 29.95 ? 309  LEU B CD1 1 
ATOM   2726 C CD2 . LEU B 1 100 ? 5.820   5.246   18.151  1.00 32.80 ? 309  LEU B CD2 1 
ATOM   2727 N N   . PHE B 1 101 ? 5.788   3.087   22.541  1.00 28.75 ? 310  PHE B N   1 
ATOM   2728 C CA  . PHE B 1 101 ? 5.375   2.273   23.675  1.00 28.13 ? 310  PHE B CA  1 
ATOM   2729 C C   . PHE B 1 101 ? 5.047   0.878   23.144  1.00 27.05 ? 310  PHE B C   1 
ATOM   2730 O O   . PHE B 1 101 ? 4.597   0.735   21.993  1.00 25.52 ? 310  PHE B O   1 
ATOM   2731 C CB  . PHE B 1 101 ? 4.155   2.875   24.392  1.00 29.00 ? 310  PHE B CB  1 
ATOM   2732 C CG  . PHE B 1 101 ? 4.503   3.996   25.350  1.00 31.56 ? 310  PHE B CG  1 
ATOM   2733 C CD1 . PHE B 1 101 ? 4.926   3.721   26.644  1.00 32.50 ? 310  PHE B CD1 1 
ATOM   2734 C CD2 . PHE B 1 101 ? 4.412   5.331   24.948  1.00 36.53 ? 310  PHE B CD2 1 
ATOM   2735 C CE1 . PHE B 1 101 ? 5.259   4.757   27.535  1.00 33.78 ? 310  PHE B CE1 1 
ATOM   2736 C CE2 . PHE B 1 101 ? 4.761   6.381   25.827  1.00 37.49 ? 310  PHE B CE2 1 
ATOM   2737 C CZ  . PHE B 1 101 ? 5.176   6.082   27.122  1.00 34.26 ? 310  PHE B CZ  1 
ATOM   2738 N N   . LEU B 1 102 ? 5.251   -0.135  23.983  1.00 25.40 ? 311  LEU B N   1 
ATOM   2739 C CA  . LEU B 1 102 ? 5.094   -1.511  23.565  1.00 26.34 ? 311  LEU B CA  1 
ATOM   2740 C C   . LEU B 1 102 ? 3.669   -1.795  23.068  1.00 25.06 ? 311  LEU B C   1 
ATOM   2741 O O   . LEU B 1 102 ? 3.482   -2.561  22.121  1.00 24.93 ? 311  LEU B O   1 
ATOM   2742 C CB  . LEU B 1 102 ? 5.412   -2.423  24.750  1.00 27.04 ? 311  LEU B CB  1 
ATOM   2743 C CG  . LEU B 1 102 ? 6.148   -3.747  24.610  1.00 30.20 ? 311  LEU B CG  1 
ATOM   2744 C CD1 . LEU B 1 102 ? 7.471   -3.568  23.842  1.00 31.51 ? 311  LEU B CD1 1 
ATOM   2745 C CD2 . LEU B 1 102 ? 6.413   -4.299  26.035  1.00 28.66 ? 311  LEU B CD2 1 
ATOM   2746 N N   . ASN B 1 103 ? 2.677   -1.180  23.703  1.00 24.04 ? 312  ASN B N   1 
ATOM   2747 C CA  . ASN B 1 103 ? 1.280   -1.357  23.264  1.00 24.36 ? 312  ASN B CA  1 
ATOM   2748 C C   . ASN B 1 103 ? 1.062   -0.797  21.856  1.00 24.03 ? 312  ASN B C   1 
ATOM   2749 O O   . ASN B 1 103 ? 0.334   -1.395  21.076  1.00 24.53 ? 312  ASN B O   1 
ATOM   2750 C CB  . ASN B 1 103 ? 0.282   -0.777  24.279  1.00 23.67 ? 312  ASN B CB  1 
ATOM   2751 C CG  . ASN B 1 103 ? 0.502   0.692   24.524  1.00 26.25 ? 312  ASN B CG  1 
ATOM   2752 O OD1 . ASN B 1 103 ? 1.598   1.104   24.885  1.00 27.09 ? 312  ASN B OD1 1 
ATOM   2753 N ND2 . ASN B 1 103 ? -0.531  1.497   24.315  1.00 27.58 ? 312  ASN B ND2 1 
ATOM   2754 N N   . ASP B 1 104 ? 1.735   0.306   21.512  1.00 23.89 ? 313  ASP B N   1 
ATOM   2755 C CA  . ASP B 1 104 ? 1.679   0.816   20.128  1.00 24.66 ? 313  ASP B CA  1 
ATOM   2756 C C   . ASP B 1 104 ? 2.380   -0.090  19.116  1.00 23.26 ? 313  ASP B C   1 
ATOM   2757 O O   . ASP B 1 104 ? 1.858   -0.275  18.027  1.00 22.78 ? 313  ASP B O   1 
ATOM   2758 C CB  . ASP B 1 104 ? 2.175   2.274   19.995  1.00 25.51 ? 313  ASP B CB  1 
ATOM   2759 C CG  . ASP B 1 104 ? 1.080   3.303   20.285  1.00 29.22 ? 313  ASP B CG  1 
ATOM   2760 O OD1 . ASP B 1 104 ? -0.134  2.939   20.379  1.00 27.45 ? 313  ASP B OD1 1 
ATOM   2761 O OD2 . ASP B 1 104 ? 1.452   4.491   20.421  1.00 31.21 ? 313  ASP B OD2 1 
ATOM   2762 N N   . GLN B 1 105 ? 3.547   -0.661  19.467  1.00 22.89 ? 314  GLN B N   1 
ATOM   2763 C CA  . GLN B 1 105 ? 4.202   -1.654  18.614  1.00 20.83 ? 314  GLN B CA  1 
ATOM   2764 C C   . GLN B 1 105 ? 3.287   -2.826  18.309  1.00 20.77 ? 314  GLN B C   1 
ATOM   2765 O O   . GLN B 1 105 ? 3.199   -3.265  17.154  1.00 19.82 ? 314  GLN B O   1 
ATOM   2766 C CB  . GLN B 1 105 ? 5.503   -2.206  19.258  1.00 22.02 ? 314  GLN B CB  1 
ATOM   2767 C CG  . GLN B 1 105 ? 6.565   -1.130  19.526  1.00 20.21 ? 314  GLN B CG  1 
ATOM   2768 C CD  . GLN B 1 105 ? 7.785   -1.685  20.252  1.00 21.11 ? 314  GLN B CD  1 
ATOM   2769 O OE1 . GLN B 1 105 ? 8.425   -0.978  21.031  1.00 28.02 ? 314  GLN B OE1 1 
ATOM   2770 N NE2 . GLN B 1 105 ? 8.068   -2.937  20.053  1.00 20.06 ? 314  GLN B NE2 1 
ATOM   2771 N N   . VAL B 1 106 ? 2.615   -3.340  19.337  1.00 20.55 ? 315  VAL B N   1 
ATOM   2772 C CA  . VAL B 1 106 ? 1.675   -4.471  19.200  1.00 21.37 ? 315  VAL B CA  1 
ATOM   2773 C C   . VAL B 1 106 ? 0.475   -4.196  18.267  1.00 20.94 ? 315  VAL B C   1 
ATOM   2774 O O   . VAL B 1 106 ? 0.085   -5.070  17.467  1.00 20.53 ? 315  VAL B O   1 
ATOM   2775 C CB  . VAL B 1 106 ? 1.220   -5.004  20.596  1.00 21.29 ? 315  VAL B CB  1 
ATOM   2776 C CG1 . VAL B 1 106 ? 0.050   -5.975  20.480  1.00 22.56 ? 315  VAL B CG1 1 
ATOM   2777 C CG2 . VAL B 1 106 ? 2.406   -5.680  21.290  1.00 19.36 ? 315  VAL B CG2 1 
ATOM   2778 N N   . THR B 1 107 ? -0.103  -3.007  18.398  1.00 21.59 ? 316  THR B N   1 
ATOM   2779 C CA  . THR B 1 107 ? -1.210  -2.564  17.531  1.00 22.04 ? 316  THR B CA  1 
ATOM   2780 C C   . THR B 1 107 ? -0.712  -2.471  16.082  1.00 21.78 ? 316  THR B C   1 
ATOM   2781 O O   . THR B 1 107 ? -1.376  -2.912  15.158  1.00 21.23 ? 316  THR B O   1 
ATOM   2782 C CB  . THR B 1 107 ? -1.719  -1.161  17.975  1.00 23.09 ? 316  THR B CB  1 
ATOM   2783 O OG1 . THR B 1 107 ? -2.339  -1.265  19.263  1.00 24.69 ? 316  THR B OG1 1 
ATOM   2784 C CG2 . THR B 1 107 ? -2.736  -0.566  16.979  1.00 21.35 ? 316  THR B CG2 1 
ATOM   2785 N N   . LEU B 1 108 ? 0.457   -1.865  15.890  1.00 20.79 ? 317  LEU B N   1 
ATOM   2786 C CA  . LEU B 1 108 ? 1.047   -1.753  14.554  1.00 20.37 ? 317  LEU B CA  1 
ATOM   2787 C C   . LEU B 1 108 ? 1.279   -3.119  13.926  1.00 19.30 ? 317  LEU B C   1 
ATOM   2788 O O   . LEU B 1 108 ? 1.026   -3.319  12.741  1.00 20.57 ? 317  LEU B O   1 
ATOM   2789 C CB  . LEU B 1 108 ? 2.366   -0.957  14.642  1.00 20.45 ? 317  LEU B CB  1 
ATOM   2790 C CG  . LEU B 1 108 ? 2.438   0.539   14.289  1.00 22.38 ? 317  LEU B CG  1 
ATOM   2791 C CD1 . LEU B 1 108 ? 1.088   1.321   14.155  1.00 22.15 ? 317  LEU B CD1 1 
ATOM   2792 C CD2 . LEU B 1 108 ? 3.581   1.299   14.955  1.00 20.06 ? 317  LEU B CD2 1 
ATOM   2793 N N   . LEU B 1 109 ? 1.789   -4.062  14.695  1.00 19.17 ? 318  LEU B N   1 
ATOM   2794 C CA  . LEU B 1 109 ? 1.985   -5.430  14.176  1.00 18.78 ? 318  LEU B CA  1 
ATOM   2795 C C   . LEU B 1 109 ? 0.624   -6.122  13.944  1.00 18.83 ? 318  LEU B C   1 
ATOM   2796 O O   . LEU B 1 109 ? 0.364   -6.719  12.900  1.00 19.11 ? 318  LEU B O   1 
ATOM   2797 C CB  . LEU B 1 109 ? 2.894   -6.210  15.121  1.00 18.40 ? 318  LEU B CB  1 
ATOM   2798 C CG  . LEU B 1 109 ? 4.360   -5.648  15.103  1.00 19.15 ? 318  LEU B CG  1 
ATOM   2799 C CD1 . LEU B 1 109 ? 5.201   -6.226  16.236  1.00 18.89 ? 318  LEU B CD1 1 
ATOM   2800 C CD2 . LEU B 1 109 ? 5.054   -5.893  13.755  1.00 18.40 ? 318  LEU B CD2 1 
ATOM   2801 N N   . LYS B 1 110 ? -0.261  -6.021  14.913  1.00 19.27 ? 319  LYS B N   1 
ATOM   2802 C CA  . LYS B 1 110 ? -1.580  -6.662  14.757  1.00 19.45 ? 319  LYS B CA  1 
ATOM   2803 C C   . LYS B 1 110 ? -2.171  -6.349  13.390  1.00 18.57 ? 319  LYS B C   1 
ATOM   2804 O O   . LYS B 1 110 ? -2.484  -7.258  12.631  1.00 19.72 ? 319  LYS B O   1 
ATOM   2805 C CB  . LYS B 1 110 ? -2.503  -6.239  15.895  1.00 19.26 ? 319  LYS B CB  1 
ATOM   2806 C CG  . LYS B 1 110 ? -3.953  -6.791  15.759  1.00 20.51 ? 319  LYS B CG  1 
ATOM   2807 C CD  . LYS B 1 110 ? -4.774  -6.387  16.979  1.00 20.17 ? 319  LYS B CD  1 
ATOM   2808 C CE  . LYS B 1 110 ? -6.271  -6.752  16.821  1.00 20.85 ? 319  LYS B CE  1 
ATOM   2809 N NZ  . LYS B 1 110 ? -6.522  -8.147  17.248  1.00 25.88 ? 319  LYS B NZ  1 
ATOM   2810 N N   . TYR B 1 111 ? -2.246  -5.072  13.052  1.00 19.88 ? 320  TYR B N   1 
ATOM   2811 C CA  . TYR B 1 111 ? -2.959  -4.605  11.868  1.00 20.38 ? 320  TYR B CA  1 
ATOM   2812 C C   . TYR B 1 111 ? -2.162  -4.551  10.555  1.00 20.61 ? 320  TYR B C   1 
ATOM   2813 O O   . TYR B 1 111 ? -2.769  -4.505  9.470   1.00 19.78 ? 320  TYR B O   1 
ATOM   2814 C CB  . TYR B 1 111 ? -3.576  -3.259  12.176  1.00 21.64 ? 320  TYR B CB  1 
ATOM   2815 C CG  . TYR B 1 111 ? -4.847  -3.386  13.009  1.00 24.08 ? 320  TYR B CG  1 
ATOM   2816 C CD1 . TYR B 1 111 ? -6.087  -3.648  12.402  1.00 25.17 ? 320  TYR B CD1 1 
ATOM   2817 C CD2 . TYR B 1 111 ? -4.809  -3.252  14.400  1.00 23.43 ? 320  TYR B CD2 1 
ATOM   2818 C CE1 . TYR B 1 111 ? -7.278  -3.763  13.189  1.00 24.87 ? 320  TYR B CE1 1 
ATOM   2819 C CE2 . TYR B 1 111 ? -5.971  -3.344  15.168  1.00 23.17 ? 320  TYR B CE2 1 
ATOM   2820 C CZ  . TYR B 1 111 ? -7.193  -3.595  14.554  1.00 25.69 ? 320  TYR B CZ  1 
ATOM   2821 O OH  . TYR B 1 111 ? -8.314  -3.694  15.346  1.00 28.35 ? 320  TYR B OH  1 
ATOM   2822 N N   . GLY B 1 112 ? -0.821  -4.607  10.633  1.00 19.47 ? 321  GLY B N   1 
ATOM   2823 C CA  . GLY B 1 112 ? -0.005  -4.498  9.449   1.00 19.11 ? 321  GLY B CA  1 
ATOM   2824 C C   . GLY B 1 112 ? 0.667   -5.746  8.941   1.00 19.93 ? 321  GLY B C   1 
ATOM   2825 O O   . GLY B 1 112 ? 1.079   -5.827  7.789   1.00 20.35 ? 321  GLY B O   1 
ATOM   2826 N N   . VAL B 1 113 ? 0.790   -6.742  9.797   1.00 20.32 ? 322  VAL B N   1 
ATOM   2827 C CA  . VAL B 1 113 ? 1.615   -7.899  9.502   1.00 20.01 ? 322  VAL B CA  1 
ATOM   2828 C C   . VAL B 1 113 ? 1.050   -8.729  8.339   1.00 19.69 ? 322  VAL B C   1 
ATOM   2829 O O   . VAL B 1 113 ? 1.810   -9.121  7.448   1.00 18.20 ? 322  VAL B O   1 
ATOM   2830 C CB  . VAL B 1 113 ? 1.856   -8.642  10.836  1.00 20.92 ? 322  VAL B CB  1 
ATOM   2831 C CG1 . VAL B 1 113 ? 1.141   -9.932  10.942  1.00 22.05 ? 322  VAL B CG1 1 
ATOM   2832 C CG2 . VAL B 1 113 ? 3.338   -8.566  11.343  1.00 20.00 ? 322  VAL B CG2 1 
ATOM   2833 N N   . HIS B 1 114 ? -0.289  -8.929  8.284   1.00 18.27 ? 323  HIS B N   1 
ATOM   2834 C CA  . HIS B 1 114 ? -0.874  -9.553  7.088   1.00 17.82 ? 323  HIS B CA  1 
ATOM   2835 C C   . HIS B 1 114 ? -0.859  -8.718  5.820   1.00 16.74 ? 323  HIS B C   1 
ATOM   2836 O O   . HIS B 1 114 ? -0.783  -9.282  4.741   1.00 18.88 ? 323  HIS B O   1 
ATOM   2837 C CB  . HIS B 1 114 ? -2.301  -10.137 7.353   1.00 17.37 ? 323  HIS B CB  1 
ATOM   2838 C CG  . HIS B 1 114 ? -2.270  -11.419 8.143   1.00 18.71 ? 323  HIS B CG  1 
ATOM   2839 N ND1 . HIS B 1 114 ? -2.297  -11.445 9.524   1.00 20.60 ? 323  HIS B ND1 1 
ATOM   2840 C CD2 . HIS B 1 114 ? -2.106  -12.702 7.749   1.00 20.35 ? 323  HIS B CD2 1 
ATOM   2841 C CE1 . HIS B 1 114 ? -2.205  -12.695 9.944   1.00 21.14 ? 323  HIS B CE1 1 
ATOM   2842 N NE2 . HIS B 1 114 ? -2.111  -13.483 8.882   1.00 20.81 ? 323  HIS B NE2 1 
ATOM   2843 N N   . GLU B 1 115 ? -0.978  -7.400  5.897   1.00 17.45 ? 324  GLU B N   1 
ATOM   2844 C CA  . GLU B 1 115 ? -0.805  -6.581  4.699   1.00 18.33 ? 324  GLU B CA  1 
ATOM   2845 C C   . GLU B 1 115 ? 0.631   -6.813  4.172   1.00 18.77 ? 324  GLU B C   1 
ATOM   2846 O O   . GLU B 1 115 ? 0.885   -6.936  2.953   1.00 18.65 ? 324  GLU B O   1 
ATOM   2847 C CB  . GLU B 1 115 ? -0.987  -5.091  5.029   1.00 18.42 ? 324  GLU B CB  1 
ATOM   2848 C CG  . GLU B 1 115 ? -2.465  -4.724  5.449   1.00 19.96 ? 324  GLU B CG  1 
ATOM   2849 C CD  . GLU B 1 115 ? -2.662  -3.234  5.787   1.00 22.71 ? 324  GLU B CD  1 
ATOM   2850 O OE1 . GLU B 1 115 ? -1.692  -2.435  5.660   1.00 26.80 ? 324  GLU B OE1 1 
ATOM   2851 O OE2 . GLU B 1 115 ? -3.795  -2.843  6.191   1.00 24.12 ? 324  GLU B OE2 1 
ATOM   2852 N N   . ALA B 1 116 ? 1.573   -6.855  5.093   1.00 17.25 ? 325  ALA B N   1 
ATOM   2853 C CA  . ALA B 1 116 ? 2.995   -7.046  4.679   1.00 18.84 ? 325  ALA B CA  1 
ATOM   2854 C C   . ALA B 1 116 ? 3.184   -8.463  4.100   1.00 19.25 ? 325  ALA B C   1 
ATOM   2855 O O   . ALA B 1 116 ? 3.843   -8.662  3.079   1.00 21.23 ? 325  ALA B O   1 
ATOM   2856 C CB  . ALA B 1 116 ? 3.909   -6.794  5.895   1.00 16.99 ? 325  ALA B CB  1 
ATOM   2857 N N   . ILE B 1 117 ? 2.565   -9.450  4.734   1.00 19.74 ? 326  ILE B N   1 
ATOM   2858 C CA  . ILE B 1 117 ? 2.689   -10.833 4.300   1.00 20.25 ? 326  ILE B CA  1 
ATOM   2859 C C   . ILE B 1 117 ? 2.177   -10.996 2.871   1.00 20.69 ? 326  ILE B C   1 
ATOM   2860 O O   . ILE B 1 117 ? 2.789   -11.687 2.066   1.00 20.11 ? 326  ILE B O   1 
ATOM   2861 C CB  . ILE B 1 117 ? 1.906   -11.760 5.218   1.00 19.82 ? 326  ILE B CB  1 
ATOM   2862 C CG1 . ILE B 1 117 ? 2.626   -11.940 6.573   1.00 19.45 ? 326  ILE B CG1 1 
ATOM   2863 C CG2 . ILE B 1 117 ? 1.592   -13.112 4.526   1.00 22.25 ? 326  ILE B CG2 1 
ATOM   2864 C CD1 . ILE B 1 117 ? 1.847   -12.763 7.559   1.00 17.63 ? 326  ILE B CD1 1 
ATOM   2865 N N   . PHE B 1 118 ? 1.029   -10.391 2.584   1.00 20.41 ? 327  PHE B N   1 
ATOM   2866 C CA  . PHE B 1 118 ? 0.387   -10.599 1.275   1.00 21.28 ? 327  PHE B CA  1 
ATOM   2867 C C   . PHE B 1 118 ? 1.109   -9.790  0.176   1.00 21.04 ? 327  PHE B C   1 
ATOM   2868 O O   . PHE B 1 118 ? 1.190   -10.223 -0.957  1.00 22.48 ? 327  PHE B O   1 
ATOM   2869 C CB  . PHE B 1 118 ? -1.124  -10.261 1.351   1.00 21.07 ? 327  PHE B CB  1 
ATOM   2870 C CG  . PHE B 1 118 ? -1.930  -11.169 2.274   1.00 22.40 ? 327  PHE B CG  1 
ATOM   2871 C CD1 . PHE B 1 118 ? -1.595  -12.503 2.461   1.00 23.59 ? 327  PHE B CD1 1 
ATOM   2872 C CD2 . PHE B 1 118 ? -3.092  -10.684 2.903   1.00 25.88 ? 327  PHE B CD2 1 
ATOM   2873 C CE1 . PHE B 1 118 ? -2.365  -13.349 3.305   1.00 25.37 ? 327  PHE B CE1 1 
ATOM   2874 C CE2 . PHE B 1 118 ? -3.859  -11.517 3.740   1.00 24.67 ? 327  PHE B CE2 1 
ATOM   2875 C CZ  . PHE B 1 118 ? -3.476  -12.841 3.955   1.00 22.41 ? 327  PHE B CZ  1 
ATOM   2876 N N   . ALA B 1 119 ? 1.640   -8.624  0.502   1.00 21.67 ? 328  ALA B N   1 
ATOM   2877 C CA  . ALA B 1 119 ? 2.570   -7.906  -0.404  1.00 22.63 ? 328  ALA B CA  1 
ATOM   2878 C C   . ALA B 1 119 ? 3.820   -8.727  -0.780  1.00 23.78 ? 328  ALA B C   1 
ATOM   2879 O O   . ALA B 1 119 ? 4.205   -8.769  -1.957  1.00 24.75 ? 328  ALA B O   1 
ATOM   2880 C CB  . ALA B 1 119 ? 3.002   -6.596  0.218   1.00 21.72 ? 328  ALA B CB  1 
ATOM   2881 N N   . MET B 1 120 ? 4.435   -9.363  0.211   1.00 24.48 ? 329  MET B N   1 
ATOM   2882 C CA  . MET B 1 120 ? 5.678   -10.173 0.024   1.00 25.85 ? 329  MET B CA  1 
ATOM   2883 C C   . MET B 1 120 ? 5.394   -11.535 -0.598  1.00 25.67 ? 329  MET B C   1 
ATOM   2884 O O   . MET B 1 120 ? 6.237   -12.121 -1.283  1.00 24.55 ? 329  MET B O   1 
ATOM   2885 C CB  . MET B 1 120 ? 6.355   -10.402 1.375   1.00 25.25 ? 329  MET B CB  1 
ATOM   2886 C CG  . MET B 1 120 ? 7.087   -9.184  1.943   1.00 27.04 ? 329  MET B CG  1 
ATOM   2887 S SD  . MET B 1 120 ? 7.987   -9.600  3.472   1.00 29.89 ? 329  MET B SD  1 
ATOM   2888 C CE  . MET B 1 120 ? 6.695   -10.065 4.589   1.00 26.16 ? 329  MET B CE  1 
ATOM   2889 N N   . LEU B 1 121 ? 4.178   -12.042 -0.378  1.00 26.15 ? 330  LEU B N   1 
ATOM   2890 C CA  . LEU B 1 121 ? 3.696   -13.211 -1.116  1.00 26.35 ? 330  LEU B CA  1 
ATOM   2891 C C   . LEU B 1 121 ? 3.963   -13.112 -2.626  1.00 25.93 ? 330  LEU B C   1 
ATOM   2892 O O   . LEU B 1 121 ? 4.307   -14.102 -3.269  1.00 25.29 ? 330  LEU B O   1 
ATOM   2893 C CB  . LEU B 1 121 ? 2.172   -13.361 -0.904  1.00 26.82 ? 330  LEU B CB  1 
ATOM   2894 C CG  . LEU B 1 121 ? 1.546   -14.720 -0.673  1.00 30.71 ? 330  LEU B CG  1 
ATOM   2895 C CD1 . LEU B 1 121 ? 0.051   -14.795 -1.148  1.00 28.76 ? 330  LEU B CD1 1 
ATOM   2896 C CD2 . LEU B 1 121 ? 2.354   -15.806 -1.310  1.00 32.70 ? 330  LEU B CD2 1 
ATOM   2897 N N   . ALA B 1 122 ? 3.762   -11.929 -3.199  1.00 26.21 ? 331  ALA B N   1 
ATOM   2898 C CA  . ALA B 1 122 ? 3.882   -11.727 -4.646  1.00 26.43 ? 331  ALA B CA  1 
ATOM   2899 C C   . ALA B 1 122 ? 5.270   -12.081 -5.159  1.00 27.35 ? 331  ALA B C   1 
ATOM   2900 O O   . ALA B 1 122 ? 5.414   -12.565 -6.276  1.00 28.17 ? 331  ALA B O   1 
ATOM   2901 C CB  . ALA B 1 122 ? 3.546   -10.295 -4.998  1.00 26.07 ? 331  ALA B CB  1 
ATOM   2902 N N   . SER B 1 123 ? 6.281   -11.872 -4.313  1.00 27.58 ? 332  SER B N   1 
ATOM   2903 C CA  . SER B 1 123 ? 7.668   -12.179 -4.644  1.00 28.16 ? 332  SER B CA  1 
ATOM   2904 C C   . SER B 1 123 ? 7.888   -13.655 -4.957  1.00 29.18 ? 332  SER B C   1 
ATOM   2905 O O   . SER B 1 123 ? 8.857   -13.994 -5.648  1.00 29.03 ? 332  SER B O   1 
ATOM   2906 C CB  . SER B 1 123 ? 8.605   -11.756 -3.495  1.00 27.19 ? 332  SER B CB  1 
ATOM   2907 O OG  . SER B 1 123 ? 8.403   -10.382 -3.160  1.00 25.99 ? 332  SER B OG  1 
ATOM   2908 N N   . ILE B 1 124 ? 7.022   -14.529 -4.421  1.00 29.92 ? 333  ILE B N   1 
ATOM   2909 C CA  . ILE B 1 124 ? 7.214   -15.997 -4.531  1.00 30.30 ? 333  ILE B CA  1 
ATOM   2910 C C   . ILE B 1 124 ? 6.119   -16.692 -5.349  1.00 31.37 ? 333  ILE B C   1 
ATOM   2911 O O   . ILE B 1 124 ? 6.030   -17.921 -5.392  1.00 31.51 ? 333  ILE B O   1 
ATOM   2912 C CB  . ILE B 1 124 ? 7.389   -16.699 -3.131  1.00 30.29 ? 333  ILE B CB  1 
ATOM   2913 C CG1 . ILE B 1 124 ? 6.230   -16.346 -2.177  1.00 29.68 ? 333  ILE B CG1 1 
ATOM   2914 C CG2 . ILE B 1 124 ? 8.740   -16.364 -2.538  1.00 28.74 ? 333  ILE B CG2 1 
ATOM   2915 C CD1 . ILE B 1 124 ? 5.934   -17.411 -1.131  1.00 30.07 ? 333  ILE B CD1 1 
ATOM   2916 N N   . VAL B 1 125 ? 5.322   -15.876 -6.019  1.00 32.85 ? 334  VAL B N   1 
ATOM   2917 C CA  . VAL B 1 125 ? 4.191   -16.318 -6.827  1.00 34.75 ? 334  VAL B CA  1 
ATOM   2918 C C   . VAL B 1 125 ? 4.448   -16.079 -8.328  1.00 35.14 ? 334  VAL B C   1 
ATOM   2919 O O   . VAL B 1 125 ? 5.205   -15.170 -8.691  1.00 35.98 ? 334  VAL B O   1 
ATOM   2920 C CB  . VAL B 1 125 ? 2.907   -15.594 -6.341  1.00 34.17 ? 334  VAL B CB  1 
ATOM   2921 C CG1 . VAL B 1 125 ? 1.794   -15.631 -7.357  1.00 36.26 ? 334  VAL B CG1 1 
ATOM   2922 C CG2 . VAL B 1 125 ? 2.438   -16.202 -5.049  1.00 35.48 ? 334  VAL B CG2 1 
ATOM   2923 N N   . ASN B 1 126 ? 3.900   -16.960 -9.175  1.00 35.45 ? 335  ASN B N   1 
ATOM   2924 C CA  . ASN B 1 126 ? 3.546   -16.621 -10.559 1.00 35.74 ? 335  ASN B CA  1 
ATOM   2925 C C   . ASN B 1 126 ? 2.095   -17.097 -10.816 1.00 36.75 ? 335  ASN B C   1 
ATOM   2926 O O   . ASN B 1 126 ? 1.466   -17.656 -9.906  1.00 36.29 ? 335  ASN B O   1 
ATOM   2927 C CB  . ASN B 1 126 ? 4.565   -17.167 -11.580 1.00 35.69 ? 335  ASN B CB  1 
ATOM   2928 C CG  . ASN B 1 126 ? 4.631   -18.693 -11.609 1.00 35.14 ? 335  ASN B CG  1 
ATOM   2929 O OD1 . ASN B 1 126 ? 3.629   -19.372 -11.424 1.00 34.67 ? 335  ASN B OD1 1 
ATOM   2930 N ND2 . ASN B 1 126 ? 5.816   -19.231 -11.846 1.00 33.65 ? 335  ASN B ND2 1 
ATOM   2931 N N   . LYS B 1 127 ? 1.564   -16.862 -12.023 1.00 37.09 ? 336  LYS B N   1 
ATOM   2932 C CA  . LYS B 1 127 ? 0.186   -17.241 -12.375 1.00 37.94 ? 336  LYS B CA  1 
ATOM   2933 C C   . LYS B 1 127 ? -0.122  -18.720 -12.073 1.00 37.24 ? 336  LYS B C   1 
ATOM   2934 O O   . LYS B 1 127 ? -1.279  -19.091 -11.906 1.00 37.16 ? 336  LYS B O   1 
ATOM   2935 C CB  . LYS B 1 127 ? -0.094  -16.933 -13.868 1.00 37.95 ? 336  LYS B CB  1 
ATOM   2936 C CG  . LYS B 1 127 ? 0.822   -17.699 -14.831 1.00 39.64 ? 336  LYS B CG  1 
ATOM   2937 C CD  . LYS B 1 127 ? 0.696   -17.226 -16.297 1.00 40.18 ? 336  LYS B CD  1 
ATOM   2938 C CE  . LYS B 1 127 ? -0.205  -18.116 -17.124 1.00 44.32 ? 336  LYS B CE  1 
ATOM   2939 N NZ  . LYS B 1 127 ? 0.248   -19.544 -17.218 1.00 46.81 ? 336  LYS B NZ  1 
ATOM   2940 N N   . ASP B 1 128 ? 0.921   -19.547 -12.003 1.00 36.82 ? 337  ASP B N   1 
ATOM   2941 C CA  . ASP B 1 128 ? 0.789   -21.016 -11.908 1.00 37.18 ? 337  ASP B CA  1 
ATOM   2942 C C   . ASP B 1 128 ? 0.932   -21.599 -10.500 1.00 36.26 ? 337  ASP B C   1 
ATOM   2943 O O   . ASP B 1 128 ? 0.728   -22.792 -10.315 1.00 36.58 ? 337  ASP B O   1 
ATOM   2944 C CB  . ASP B 1 128 ? 1.848   -21.705 -12.770 1.00 37.85 ? 337  ASP B CB  1 
ATOM   2945 C CG  . ASP B 1 128 ? 1.696   -21.422 -14.258 1.00 40.08 ? 337  ASP B CG  1 
ATOM   2946 O OD1 . ASP B 1 128 ? 0.551   -21.285 -14.759 1.00 40.39 ? 337  ASP B OD1 1 
ATOM   2947 O OD2 . ASP B 1 128 ? 2.760   -21.350 -14.921 1.00 42.42 ? 337  ASP B OD2 1 
ATOM   2948 N N   . GLY B 1 129 ? 1.312   -20.782 -9.519  1.00 35.57 ? 338  GLY B N   1 
ATOM   2949 C CA  . GLY B 1 129 ? 1.568   -21.304 -8.175  1.00 34.53 ? 338  GLY B CA  1 
ATOM   2950 C C   . GLY B 1 129 ? 2.616   -20.552 -7.382  1.00 33.50 ? 338  GLY B C   1 
ATOM   2951 O O   . GLY B 1 129 ? 2.985   -19.433 -7.730  1.00 32.70 ? 338  GLY B O   1 
ATOM   2952 N N   . LEU B 1 130 ? 3.094   -21.174 -6.307  1.00 33.08 ? 339  LEU B N   1 
ATOM   2953 C CA  . LEU B 1 130 ? 3.946   -20.473 -5.357  1.00 32.93 ? 339  LEU B CA  1 
ATOM   2954 C C   . LEU B 1 130 ? 5.028   -21.344 -4.723  1.00 31.98 ? 339  LEU B C   1 
ATOM   2955 O O   . LEU B 1 130 ? 4.799   -22.522 -4.442  1.00 31.57 ? 339  LEU B O   1 
ATOM   2956 C CB  . LEU B 1 130 ? 3.078   -19.815 -4.277  1.00 33.23 ? 339  LEU B CB  1 
ATOM   2957 C CG  . LEU B 1 130 ? 2.890   -20.429 -2.892  1.00 35.32 ? 339  LEU B CG  1 
ATOM   2958 C CD1 . LEU B 1 130 ? 2.713   -19.283 -1.899  1.00 38.37 ? 339  LEU B CD1 1 
ATOM   2959 C CD2 . LEU B 1 130 ? 1.719   -21.372 -2.795  1.00 37.98 ? 339  LEU B CD2 1 
ATOM   2960 N N   . LEU B 1 131 ? 6.192   -20.743 -4.480  1.00 31.50 ? 340  LEU B N   1 
ATOM   2961 C CA  . LEU B 1 131 ? 7.313   -21.422 -3.808  1.00 31.58 ? 340  LEU B CA  1 
ATOM   2962 C C   . LEU B 1 131 ? 7.088   -21.599 -2.325  1.00 32.54 ? 340  LEU B C   1 
ATOM   2963 O O   . LEU B 1 131 ? 6.646   -20.666 -1.644  1.00 31.69 ? 340  LEU B O   1 
ATOM   2964 C CB  . LEU B 1 131 ? 8.628   -20.641 -3.979  1.00 31.71 ? 340  LEU B CB  1 
ATOM   2965 C CG  . LEU B 1 131 ? 9.340   -20.522 -5.314  1.00 31.16 ? 340  LEU B CG  1 
ATOM   2966 C CD1 . LEU B 1 131 ? 10.599  -19.686 -5.085  1.00 33.74 ? 340  LEU B CD1 1 
ATOM   2967 C CD2 . LEU B 1 131 ? 9.713   -21.894 -5.875  1.00 29.85 ? 340  LEU B CD2 1 
ATOM   2968 N N   . VAL B 1 132 ? 7.434   -22.771 -1.817  1.00 32.99 ? 341  VAL B N   1 
ATOM   2969 C CA  . VAL B 1 132 ? 7.303   -23.064 -0.397  1.00 34.84 ? 341  VAL B CA  1 
ATOM   2970 C C   . VAL B 1 132 ? 8.615   -23.606 0.180   1.00 36.25 ? 341  VAL B C   1 
ATOM   2971 O O   . VAL B 1 132 ? 9.567   -23.923 -0.569  1.00 36.56 ? 341  VAL B O   1 
ATOM   2972 C CB  . VAL B 1 132 ? 6.086   -23.989 -0.097  1.00 34.58 ? 341  VAL B CB  1 
ATOM   2973 C CG1 . VAL B 1 132 ? 4.786   -23.331 -0.594  1.00 34.80 ? 341  VAL B CG1 1 
ATOM   2974 C CG2 . VAL B 1 132 ? 6.249   -25.392 -0.740  1.00 35.50 ? 341  VAL B CG2 1 
ATOM   2975 N N   . ALA B 1 133 ? 8.671   -23.671 1.507   1.00 37.53 ? 342  ALA B N   1 
ATOM   2976 C CA  . ALA B 1 133 ? 9.839   -24.168 2.243   1.00 38.71 ? 342  ALA B CA  1 
ATOM   2977 C C   . ALA B 1 133 ? 11.157  -23.660 1.656   1.00 39.39 ? 342  ALA B C   1 
ATOM   2978 O O   . ALA B 1 133 ? 11.986  -24.430 1.175   1.00 39.63 ? 342  ALA B O   1 
ATOM   2979 C CB  . ALA B 1 133 ? 9.811   -25.696 2.324   1.00 38.48 ? 342  ALA B CB  1 
ATOM   2980 N N   . ASN B 1 134 ? 11.314  -22.343 1.660   1.00 40.46 ? 343  ASN B N   1 
ATOM   2981 C CA  . ASN B 1 134 ? 12.556  -21.695 1.234   1.00 41.02 ? 343  ASN B CA  1 
ATOM   2982 C C   . ASN B 1 134 ? 12.980  -22.050 -0.197  1.00 40.53 ? 343  ASN B C   1 
ATOM   2983 O O   . ASN B 1 134 ? 14.173  -22.178 -0.503  1.00 40.90 ? 343  ASN B O   1 
ATOM   2984 C CB  . ASN B 1 134 ? 13.661  -21.991 2.264   1.00 41.85 ? 343  ASN B CB  1 
ATOM   2985 C CG  . ASN B 1 134 ? 14.863  -21.067 2.137   1.00 44.65 ? 343  ASN B CG  1 
ATOM   2986 O OD1 . ASN B 1 134 ? 15.936  -21.366 2.681   1.00 46.48 ? 343  ASN B OD1 1 
ATOM   2987 N ND2 . ASN B 1 134 ? 14.702  -19.946 1.426   1.00 45.67 ? 343  ASN B ND2 1 
ATOM   2988 N N   . GLY B 1 135 ? 11.992  -22.187 -1.081  1.00 39.61 ? 344  GLY B N   1 
ATOM   2989 C CA  . GLY B 1 135 ? 12.240  -22.454 -2.491  1.00 38.61 ? 344  GLY B CA  1 
ATOM   2990 C C   . GLY B 1 135 ? 12.298  -23.917 -2.882  1.00 38.01 ? 344  GLY B C   1 
ATOM   2991 O O   . GLY B 1 135 ? 12.366  -24.228 -4.068  1.00 39.03 ? 344  GLY B O   1 
ATOM   2992 N N   . SER B 1 136 ? 12.256  -24.821 -1.904  1.00 37.10 ? 345  SER B N   1 
ATOM   2993 C CA  . SER B 1 136 ? 12.350  -26.273 -2.170  1.00 36.27 ? 345  SER B CA  1 
ATOM   2994 C C   . SER B 1 136 ? 11.148  -26.925 -2.863  1.00 35.30 ? 345  SER B C   1 
ATOM   2995 O O   . SER B 1 136 ? 11.265  -28.022 -3.434  1.00 34.74 ? 345  SER B O   1 
ATOM   2996 C CB  . SER B 1 136 ? 12.573  -27.002 -0.861  1.00 36.40 ? 345  SER B CB  1 
ATOM   2997 O OG  . SER B 1 136 ? 13.753  -26.523 -0.262  1.00 37.68 ? 345  SER B OG  1 
ATOM   2998 N N   . GLY B 1 137 ? 9.984   -26.287 -2.765  1.00 33.62 ? 346  GLY B N   1 
ATOM   2999 C CA  . GLY B 1 137 ? 8.742   -26.836 -3.340  1.00 31.28 ? 346  GLY B CA  1 
ATOM   3000 C C   . GLY B 1 137 ? 8.003   -25.778 -4.114  1.00 30.40 ? 346  GLY B C   1 
ATOM   3001 O O   . GLY B 1 137 ? 8.200   -24.588 -3.881  1.00 29.76 ? 346  GLY B O   1 
ATOM   3002 N N   . PHE B 1 138 ? 7.167   -26.208 -5.052  1.00 29.95 ? 347  PHE B N   1 
ATOM   3003 C CA  . PHE B 1 138 ? 6.289   -25.318 -5.784  1.00 29.90 ? 347  PHE B CA  1 
ATOM   3004 C C   . PHE B 1 138 ? 4.880   -25.909 -5.746  1.00 29.53 ? 347  PHE B C   1 
ATOM   3005 O O   . PHE B 1 138 ? 4.647   -26.995 -6.279  1.00 29.27 ? 347  PHE B O   1 
ATOM   3006 C CB  . PHE B 1 138 ? 6.797   -25.138 -7.227  1.00 30.20 ? 347  PHE B CB  1 
ATOM   3007 C CG  . PHE B 1 138 ? 5.971   -24.195 -8.063  1.00 31.27 ? 347  PHE B CG  1 
ATOM   3008 C CD1 . PHE B 1 138 ? 6.268   -22.838 -8.111  1.00 32.11 ? 347  PHE B CD1 1 
ATOM   3009 C CD2 . PHE B 1 138 ? 4.911   -24.671 -8.831  1.00 31.59 ? 347  PHE B CD2 1 
ATOM   3010 C CE1 . PHE B 1 138 ? 5.527   -21.979 -8.879  1.00 31.88 ? 347  PHE B CE1 1 
ATOM   3011 C CE2 . PHE B 1 138 ? 4.161   -23.807 -9.610  1.00 32.05 ? 347  PHE B CE2 1 
ATOM   3012 C CZ  . PHE B 1 138 ? 4.465   -22.462 -9.629  1.00 31.00 ? 347  PHE B CZ  1 
ATOM   3013 N N   . VAL B 1 139 ? 3.958   -25.205 -5.091  1.00 29.01 ? 348  VAL B N   1 
ATOM   3014 C CA  . VAL B 1 139 ? 2.578   -25.658 -4.931  1.00 29.08 ? 348  VAL B CA  1 
ATOM   3015 C C   . VAL B 1 139 ? 1.791   -24.968 -6.019  1.00 29.08 ? 348  VAL B C   1 
ATOM   3016 O O   . VAL B 1 139 ? 1.807   -23.741 -6.131  1.00 27.99 ? 348  VAL B O   1 
ATOM   3017 C CB  . VAL B 1 139 ? 2.004   -25.297 -3.500  1.00 29.10 ? 348  VAL B CB  1 
ATOM   3018 C CG1 . VAL B 1 139 ? 0.538   -25.700 -3.325  1.00 29.69 ? 348  VAL B CG1 1 
ATOM   3019 C CG2 . VAL B 1 139 ? 2.841   -25.940 -2.409  1.00 28.73 ? 348  VAL B CG2 1 
ATOM   3020 N N   . THR B 1 140 ? 1.073   -25.752 -6.817  1.00 30.37 ? 349  THR B N   1 
ATOM   3021 C CA  . THR B 1 140 ? 0.384   -25.189 -7.959  1.00 32.10 ? 349  THR B CA  1 
ATOM   3022 C C   . THR B 1 140 ? -0.920  -24.542 -7.540  1.00 33.04 ? 349  THR B C   1 
ATOM   3023 O O   . THR B 1 140 ? -1.577  -25.010 -6.614  1.00 34.01 ? 349  THR B O   1 
ATOM   3024 C CB  . THR B 1 140 ? 0.100   -26.252 -9.055  1.00 32.67 ? 349  THR B CB  1 
ATOM   3025 O OG1 . THR B 1 140 ? -0.905  -27.168 -8.588  1.00 31.88 ? 349  THR B OG1 1 
ATOM   3026 C CG2 . THR B 1 140 ? 1.389   -26.996 -9.435  1.00 31.85 ? 349  THR B CG2 1 
ATOM   3027 N N   . ARG B 1 141 ? -1.292  -23.479 -8.244  1.00 33.83 ? 350  ARG B N   1 
ATOM   3028 C CA  . ARG B 1 141 ? -2.509  -22.722 -7.963  1.00 34.98 ? 350  ARG B CA  1 
ATOM   3029 C C   . ARG B 1 141 ? -3.758  -23.551 -8.272  1.00 35.80 ? 350  ARG B C   1 
ATOM   3030 O O   . ARG B 1 141 ? -4.796  -23.400 -7.616  1.00 36.05 ? 350  ARG B O   1 
ATOM   3031 C CB  . ARG B 1 141 ? -2.491  -21.439 -8.800  1.00 35.05 ? 350  ARG B CB  1 
ATOM   3032 C CG  . ARG B 1 141 ? -3.611  -20.420 -8.550  1.00 35.13 ? 350  ARG B CG  1 
ATOM   3033 C CD  . ARG B 1 141 ? -3.430  -19.281 -9.562  1.00 35.49 ? 350  ARG B CD  1 
ATOM   3034 N NE  . ARG B 1 141 ? -4.337  -18.152 -9.367  1.00 37.04 ? 350  ARG B NE  1 
ATOM   3035 C CZ  . ARG B 1 141 ? -4.337  -17.055 -10.120 1.00 36.82 ? 350  ARG B CZ  1 
ATOM   3036 N NH1 . ARG B 1 141 ? -3.468  -16.923 -11.119 1.00 36.49 ? 350  ARG B NH1 1 
ATOM   3037 N NH2 . ARG B 1 141 ? -5.213  -16.083 -9.880  1.00 37.55 ? 350  ARG B NH2 1 
ATOM   3038 N N   . GLU B 1 142 ? -3.664  -24.415 -9.285  1.00 36.84 ? 351  GLU B N   1 
ATOM   3039 C CA  . GLU B 1 142 ? -4.762  -25.322 -9.602  1.00 37.89 ? 351  GLU B CA  1 
ATOM   3040 C C   . GLU B 1 142 ? -5.090  -26.302 -8.466  1.00 37.02 ? 351  GLU B C   1 
ATOM   3041 O O   . GLU B 1 142 ? -6.262  -26.533 -8.180  1.00 38.11 ? 351  GLU B O   1 
ATOM   3042 C CB  . GLU B 1 142 ? -4.538  -26.033 -10.953 1.00 39.15 ? 351  GLU B CB  1 
ATOM   3043 C CG  . GLU B 1 142 ? -4.804  -25.136 -12.195 1.00 42.68 ? 351  GLU B CG  1 
ATOM   3044 C CD  . GLU B 1 142 ? -5.863  -24.027 -11.964 1.00 48.41 ? 351  GLU B CD  1 
ATOM   3045 O OE1 . GLU B 1 142 ? -7.097  -24.322 -11.958 1.00 47.69 ? 351  GLU B OE1 1 
ATOM   3046 O OE2 . GLU B 1 142 ? -5.446  -22.843 -11.796 1.00 50.07 ? 351  GLU B OE2 1 
ATOM   3047 N N   . PHE B 1 143 ? -4.073  -26.860 -7.812  1.00 35.81 ? 352  PHE B N   1 
ATOM   3048 C CA  . PHE B 1 143 ? -4.273  -27.679 -6.600  1.00 35.03 ? 352  PHE B CA  1 
ATOM   3049 C C   . PHE B 1 143 ? -4.985  -26.899 -5.474  1.00 34.91 ? 352  PHE B C   1 
ATOM   3050 O O   . PHE B 1 143 ? -5.952  -27.393 -4.878  1.00 34.65 ? 352  PHE B O   1 
ATOM   3051 C CB  . PHE B 1 143 ? -2.926  -28.234 -6.116  1.00 34.99 ? 352  PHE B CB  1 
ATOM   3052 C CG  . PHE B 1 143 ? -2.970  -28.945 -4.773  1.00 33.96 ? 352  PHE B CG  1 
ATOM   3053 C CD1 . PHE B 1 143 ? -3.861  -30.000 -4.536  1.00 32.72 ? 352  PHE B CD1 1 
ATOM   3054 C CD2 . PHE B 1 143 ? -2.062  -28.597 -3.772  1.00 34.04 ? 352  PHE B CD2 1 
ATOM   3055 C CE1 . PHE B 1 143 ? -3.870  -30.672 -3.294  1.00 35.63 ? 352  PHE B CE1 1 
ATOM   3056 C CE2 . PHE B 1 143 ? -2.053  -29.253 -2.517  1.00 33.79 ? 352  PHE B CE2 1 
ATOM   3057 C CZ  . PHE B 1 143 ? -2.957  -30.290 -2.273  1.00 34.69 ? 352  PHE B CZ  1 
ATOM   3058 N N   . LEU B 1 144 ? -4.523  -25.676 -5.204  1.00 34.60 ? 353  LEU B N   1 
ATOM   3059 C CA  . LEU B 1 144 ? -5.120  -24.842 -4.171  1.00 34.71 ? 353  LEU B CA  1 
ATOM   3060 C C   . LEU B 1 144 ? -6.589  -24.477 -4.477  1.00 36.21 ? 353  LEU B C   1 
ATOM   3061 O O   . LEU B 1 144 ? -7.402  -24.350 -3.560  1.00 36.16 ? 353  LEU B O   1 
ATOM   3062 C CB  . LEU B 1 144 ? -4.261  -23.601 -3.921  1.00 34.70 ? 353  LEU B CB  1 
ATOM   3063 C CG  . LEU B 1 144 ? -2.807  -23.919 -3.513  1.00 32.65 ? 353  LEU B CG  1 
ATOM   3064 C CD1 . LEU B 1 144 ? -1.890  -22.695 -3.573  1.00 33.09 ? 353  LEU B CD1 1 
ATOM   3065 C CD2 . LEU B 1 144 ? -2.787  -24.526 -2.125  1.00 32.17 ? 353  LEU B CD2 1 
ATOM   3066 N N   . ARG B 1 145 ? -6.910  -24.329 -5.765  1.00 37.36 ? 354  ARG B N   1 
ATOM   3067 C CA  . ARG B 1 145 ? -8.276  -24.100 -6.249  1.00 39.20 ? 354  ARG B CA  1 
ATOM   3068 C C   . ARG B 1 145 ? -9.133  -25.351 -6.098  1.00 39.37 ? 354  ARG B C   1 
ATOM   3069 O O   . ARG B 1 145 ? -10.366 -25.280 -6.103  1.00 39.75 ? 354  ARG B O   1 
ATOM   3070 C CB  . ARG B 1 145 ? -8.255  -23.674 -7.724  1.00 39.41 ? 354  ARG B CB  1 
ATOM   3071 C CG  . ARG B 1 145 ? -7.993  -22.191 -7.952  1.00 40.30 ? 354  ARG B CG  1 
ATOM   3072 C CD  . ARG B 1 145 ? -7.644  -21.909 -9.418  1.00 40.99 ? 354  ARG B CD  1 
ATOM   3073 N NE  . ARG B 1 145 ? -7.879  -20.509 -9.789  1.00 44.17 ? 354  ARG B NE  1 
ATOM   3074 C CZ  . ARG B 1 145 ? -7.227  -19.859 -10.748 1.00 43.98 ? 354  ARG B CZ  1 
ATOM   3075 N NH1 . ARG B 1 145 ? -6.268  -20.460 -11.433 1.00 45.42 ? 354  ARG B NH1 1 
ATOM   3076 N NH2 . ARG B 1 145 ? -7.523  -18.596 -11.008 1.00 44.49 ? 354  ARG B NH2 1 
ATOM   3077 N N   . SER B 1 146 ? -8.471  -26.489 -5.934  1.00 39.24 ? 355  SER B N   1 
ATOM   3078 C CA  . SER B 1 146 ? -9.143  -27.766 -5.859  1.00 39.63 ? 355  SER B CA  1 
ATOM   3079 C C   . SER B 1 146 ? -9.582  -28.121 -4.433  1.00 39.98 ? 355  SER B C   1 
ATOM   3080 O O   . SER B 1 146 ? -10.252 -29.133 -4.222  1.00 39.90 ? 355  SER B O   1 
ATOM   3081 C CB  . SER B 1 146 ? -8.218  -28.858 -6.393  1.00 39.34 ? 355  SER B CB  1 
ATOM   3082 O OG  . SER B 1 146 ? -7.466  -29.416 -5.343  1.00 38.44 ? 355  SER B OG  1 
ATOM   3083 N N   . LEU B 1 147 ? -9.187  -27.307 -3.455  1.00 39.63 ? 356  LEU B N   1 
ATOM   3084 C CA  . LEU B 1 147 ? -9.547  -27.570 -2.074  1.00 39.48 ? 356  LEU B CA  1 
ATOM   3085 C C   . LEU B 1 147 ? -10.996 -27.169 -1.795  1.00 40.68 ? 356  LEU B C   1 
ATOM   3086 O O   . LEU B 1 147 ? -11.588 -26.380 -2.541  1.00 40.20 ? 356  LEU B O   1 
ATOM   3087 C CB  . LEU B 1 147 ? -8.594  -26.838 -1.137  1.00 39.08 ? 356  LEU B CB  1 
ATOM   3088 C CG  . LEU B 1 147 ? -7.095  -27.077 -1.363  1.00 36.80 ? 356  LEU B CG  1 
ATOM   3089 C CD1 . LEU B 1 147 ? -6.280  -26.164 -0.461  1.00 36.06 ? 356  LEU B CD1 1 
ATOM   3090 C CD2 . LEU B 1 147 ? -6.735  -28.560 -1.180  1.00 33.71 ? 356  LEU B CD2 1 
ATOM   3091 N N   . ARG B 1 148 ? -11.551 -27.708 -0.716  1.00 41.88 ? 357  ARG B N   1 
ATOM   3092 C CA  . ARG B 1 148 ? -12.936 -27.438 -0.315  1.00 44.23 ? 357  ARG B CA  1 
ATOM   3093 C C   . ARG B 1 148 ? -13.213 -25.952 -0.104  1.00 44.79 ? 357  ARG B C   1 
ATOM   3094 O O   . ARG B 1 148 ? -12.339 -25.209 0.347   1.00 44.29 ? 357  ARG B O   1 
ATOM   3095 C CB  . ARG B 1 148 ? -13.265 -28.198 0.978   1.00 44.49 ? 357  ARG B CB  1 
ATOM   3096 C CG  . ARG B 1 148 ? -14.589 -28.916 0.925   1.00 47.25 ? 357  ARG B CG  1 
ATOM   3097 C CD  . ARG B 1 148 ? -15.321 -28.859 2.253   1.00 50.13 ? 357  ARG B CD  1 
ATOM   3098 N NE  . ARG B 1 148 ? -14.509 -29.313 3.384   1.00 51.06 ? 357  ARG B NE  1 
ATOM   3099 C CZ  . ARG B 1 148 ? -14.311 -28.608 4.493   1.00 51.31 ? 357  ARG B CZ  1 
ATOM   3100 N NH1 . ARG B 1 148 ? -14.847 -27.403 4.627   1.00 51.96 ? 357  ARG B NH1 1 
ATOM   3101 N NH2 . ARG B 1 148 ? -13.579 -29.113 5.474   1.00 52.98 ? 357  ARG B NH2 1 
ATOM   3102 N N   . LYS B 1 149 ? -14.466 -25.563 -0.353  1.00 45.79 ? 358  LYS B N   1 
ATOM   3103 C CA  . LYS B 1 149 ? -14.874 -24.169 -0.554  1.00 47.02 ? 358  LYS B CA  1 
ATOM   3104 C C   . LYS B 1 149 ? -14.375 -23.099 0.411   1.00 46.96 ? 358  LYS B C   1 
ATOM   3105 O O   . LYS B 1 149 ? -13.930 -22.035 -0.065  1.00 47.98 ? 358  LYS B O   1 
ATOM   3106 C CB  . LYS B 1 149 ? -16.398 -24.016 -0.741  1.00 47.71 ? 358  LYS B CB  1 
ATOM   3107 C CG  . LYS B 1 149 ? -16.796 -22.725 -1.484  1.00 49.56 ? 358  LYS B CG  1 
ATOM   3108 C CD  . LYS B 1 149 ? -16.880 -22.938 -2.998  1.00 54.00 ? 358  LYS B CD  1 
ATOM   3109 C CE  . LYS B 1 149 ? -16.677 -21.635 -3.794  1.00 55.82 ? 358  LYS B CE  1 
ATOM   3110 N NZ  . LYS B 1 149 ? -17.628 -20.520 -3.431  1.00 58.11 ? 358  LYS B NZ  1 
ATOM   3111 N N   . PRO B 1 150 ? -14.440 -23.333 1.745   1.00 46.18 ? 359  PRO B N   1 
ATOM   3112 C CA  . PRO B 1 150 ? -13.956 -22.193 2.538   1.00 45.11 ? 359  PRO B CA  1 
ATOM   3113 C C   . PRO B 1 150 ? -12.482 -21.871 2.233   1.00 44.49 ? 359  PRO B C   1 
ATOM   3114 O O   . PRO B 1 150 ? -12.144 -20.707 2.026   1.00 44.25 ? 359  PRO B O   1 
ATOM   3115 C CB  . PRO B 1 150 ? -14.138 -22.652 3.987   1.00 44.87 ? 359  PRO B CB  1 
ATOM   3116 C CG  . PRO B 1 150 ? -14.243 -24.117 3.915   1.00 45.52 ? 359  PRO B CG  1 
ATOM   3117 C CD  . PRO B 1 150 ? -14.851 -24.467 2.588   1.00 45.87 ? 359  PRO B CD  1 
ATOM   3118 N N   . PHE B 1 151 ? -11.649 -22.906 2.167   1.00 43.49 ? 360  PHE B N   1 
ATOM   3119 C CA  . PHE B 1 151 ? -10.195 -22.769 2.014   1.00 43.51 ? 360  PHE B CA  1 
ATOM   3120 C C   . PHE B 1 151 ? -9.748  -22.307 0.616   1.00 43.89 ? 360  PHE B C   1 
ATOM   3121 O O   . PHE B 1 151 ? -8.888  -21.427 0.502   1.00 43.88 ? 360  PHE B O   1 
ATOM   3122 C CB  . PHE B 1 151 ? -9.498  -24.061 2.444   1.00 42.83 ? 360  PHE B CB  1 
ATOM   3123 C CG  . PHE B 1 151 ? -9.962  -24.575 3.783   1.00 42.52 ? 360  PHE B CG  1 
ATOM   3124 C CD1 . PHE B 1 151 ? -9.577  -23.943 4.960   1.00 42.20 ? 360  PHE B CD1 1 
ATOM   3125 C CD2 . PHE B 1 151 ? -10.813 -25.677 3.868   1.00 42.43 ? 360  PHE B CD2 1 
ATOM   3126 C CE1 . PHE B 1 151 ? -10.020 -24.402 6.209   1.00 41.93 ? 360  PHE B CE1 1 
ATOM   3127 C CE2 . PHE B 1 151 ? -11.256 -26.153 5.109   1.00 41.66 ? 360  PHE B CE2 1 
ATOM   3128 C CZ  . PHE B 1 151 ? -10.861 -25.508 6.284   1.00 42.60 ? 360  PHE B CZ  1 
ATOM   3129 N N   . SER B 1 152 ? -10.363 -22.858 -0.433  1.00 44.24 ? 361  SER B N   1 
ATOM   3130 C CA  . SER B 1 152 ? -10.050 -22.477 -1.819  1.00 44.75 ? 361  SER B CA  1 
ATOM   3131 C C   . SER B 1 152 ? -10.175 -20.977 -2.055  1.00 44.71 ? 361  SER B C   1 
ATOM   3132 O O   . SER B 1 152 ? -9.288  -20.363 -2.642  1.00 45.24 ? 361  SER B O   1 
ATOM   3133 C CB  . SER B 1 152 ? -10.926 -23.240 -2.831  1.00 45.38 ? 361  SER B CB  1 
ATOM   3134 O OG  . SER B 1 152 ? -12.321 -23.045 -2.588  1.00 45.95 ? 361  SER B OG  1 
ATOM   3135 N N   . ASP B 1 153 ? -11.259 -20.363 -1.597  1.00 44.45 ? 362  ASP B N   1 
ATOM   3136 C CA  . ASP B 1 153 ? -11.385 -18.936 -1.863  1.00 44.71 ? 362  ASP B CA  1 
ATOM   3137 C C   . ASP B 1 153 ? -10.840 -18.029 -0.754  1.00 43.05 ? 362  ASP B C   1 
ATOM   3138 O O   . ASP B 1 153 ? -10.936 -16.820 -0.849  1.00 42.63 ? 362  ASP B O   1 
ATOM   3139 C CB  . ASP B 1 153 ? -12.793 -18.542 -2.331  1.00 46.05 ? 362  ASP B CB  1 
ATOM   3140 C CG  . ASP B 1 153 ? -13.878 -19.264 -1.582  1.00 49.82 ? 362  ASP B CG  1 
ATOM   3141 O OD1 . ASP B 1 153 ? -13.616 -19.650 -0.419  1.00 53.34 ? 362  ASP B OD1 1 
ATOM   3142 O OD2 . ASP B 1 153 ? -14.981 -19.438 -2.155  1.00 51.29 ? 362  ASP B OD2 1 
ATOM   3143 N N   . ILE B 1 154 ? -10.230 -18.613 0.272   1.00 41.73 ? 363  ILE B N   1 
ATOM   3144 C CA  . ILE B 1 154 ? -9.320  -17.830 1.113   1.00 40.93 ? 363  ILE B CA  1 
ATOM   3145 C C   . ILE B 1 154 ? -8.040  -17.487 0.316   1.00 39.25 ? 363  ILE B C   1 
ATOM   3146 O O   . ILE B 1 154 ? -7.593  -16.342 0.303   1.00 38.77 ? 363  ILE B O   1 
ATOM   3147 C CB  . ILE B 1 154 ? -9.038  -18.525 2.473   1.00 40.92 ? 363  ILE B CB  1 
ATOM   3148 C CG1 . ILE B 1 154 ? -10.269 -18.376 3.373   1.00 41.31 ? 363  ILE B CG1 1 
ATOM   3149 C CG2 . ILE B 1 154 ? -7.874  -17.888 3.176   1.00 40.08 ? 363  ILE B CG2 1 
ATOM   3150 C CD1 . ILE B 1 154 ? -10.148 -19.065 4.745   1.00 42.12 ? 363  ILE B CD1 1 
ATOM   3151 N N   . ILE B 1 155 ? -7.522  -18.473 -0.410  1.00 38.32 ? 364  ILE B N   1 
ATOM   3152 C CA  . ILE B 1 155 ? -6.227  -18.385 -1.108  1.00 37.41 ? 364  ILE B CA  1 
ATOM   3153 C C   . ILE B 1 155 ? -6.223  -17.652 -2.462  1.00 36.90 ? 364  ILE B C   1 
ATOM   3154 O O   . ILE B 1 155 ? -5.267  -16.910 -2.785  1.00 36.32 ? 364  ILE B O   1 
ATOM   3155 C CB  . ILE B 1 155 ? -5.641  -19.797 -1.288  1.00 37.84 ? 364  ILE B CB  1 
ATOM   3156 C CG1 . ILE B 1 155 ? -5.609  -20.517 0.062   1.00 37.47 ? 364  ILE B CG1 1 
ATOM   3157 C CG2 . ILE B 1 155 ? -4.256  -19.742 -1.908  1.00 37.24 ? 364  ILE B CG2 1 
ATOM   3158 C CD1 . ILE B 1 155 ? -5.657  -22.010 -0.050  1.00 37.88 ? 364  ILE B CD1 1 
ATOM   3159 N N   . GLU B 1 156 ? -7.266  -17.881 -3.265  1.00 36.61 ? 365  GLU B N   1 
ATOM   3160 C CA  . GLU B 1 156 ? -7.327  -17.315 -4.623  1.00 36.07 ? 365  GLU B CA  1 
ATOM   3161 C C   . GLU B 1 156 ? -7.237  -15.776 -4.695  1.00 34.96 ? 365  GLU B C   1 
ATOM   3162 O O   . GLU B 1 156 ? -6.458  -15.257 -5.502  1.00 34.90 ? 365  GLU B O   1 
ATOM   3163 C CB  . GLU B 1 156 ? -8.527  -17.864 -5.430  1.00 36.52 ? 365  GLU B CB  1 
ATOM   3164 C CG  . GLU B 1 156 ? -8.638  -17.320 -6.878  1.00 37.28 ? 365  GLU B CG  1 
ATOM   3165 C CD  . GLU B 1 156 ? -7.449  -17.667 -7.802  1.00 38.36 ? 365  GLU B CD  1 
ATOM   3166 O OE1 . GLU B 1 156 ? -6.649  -18.585 -7.511  1.00 37.09 ? 365  GLU B OE1 1 
ATOM   3167 O OE2 . GLU B 1 156 ? -7.322  -17.007 -8.858  1.00 40.07 ? 365  GLU B OE2 1 
ATOM   3168 N N   . PRO B 1 157 ? -7.975  -15.046 -3.834  1.00 34.16 ? 366  PRO B N   1 
ATOM   3169 C CA  . PRO B 1 157 ? -7.835  -13.569 -3.864  1.00 34.07 ? 366  PRO B CA  1 
ATOM   3170 C C   . PRO B 1 157 ? -6.375  -13.084 -3.700  1.00 33.66 ? 366  PRO B C   1 
ATOM   3171 O O   . PRO B 1 157 ? -5.993  -12.045 -4.276  1.00 32.98 ? 366  PRO B O   1 
ATOM   3172 C CB  . PRO B 1 157 ? -8.664  -13.113 -2.660  1.00 34.42 ? 366  PRO B CB  1 
ATOM   3173 C CG  . PRO B 1 157 ? -9.635  -14.240 -2.417  1.00 34.58 ? 366  PRO B CG  1 
ATOM   3174 C CD  . PRO B 1 157 ? -8.910  -15.486 -2.781  1.00 33.94 ? 366  PRO B CD  1 
ATOM   3175 N N   . LYS B 1 158 ? -5.576  -13.831 -2.935  1.00 32.51 ? 367  LYS B N   1 
ATOM   3176 C CA  . LYS B 1 158 ? -4.148  -13.474 -2.706  1.00 32.03 ? 367  LYS B CA  1 
ATOM   3177 C C   . LYS B 1 158 ? -3.296  -13.634 -3.960  1.00 31.57 ? 367  LYS B C   1 
ATOM   3178 O O   . LYS B 1 158 ? -2.464  -12.779 -4.270  1.00 31.10 ? 367  LYS B O   1 
ATOM   3179 C CB  . LYS B 1 158 ? -3.543  -14.282 -1.546  1.00 31.87 ? 367  LYS B CB  1 
ATOM   3180 C CG  . LYS B 1 158 ? -3.900  -13.777 -0.168  1.00 32.08 ? 367  LYS B CG  1 
ATOM   3181 C CD  . LYS B 1 158 ? -5.400  -13.827 0.077   1.00 32.26 ? 367  LYS B CD  1 
ATOM   3182 C CE  . LYS B 1 158 ? -5.755  -13.914 1.542   1.00 31.30 ? 367  LYS B CE  1 
ATOM   3183 N NZ  . LYS B 1 158 ? -7.240  -14.117 1.731   1.00 32.82 ? 367  LYS B NZ  1 
ATOM   3184 N N   . PHE B 1 159 ? -3.501  -14.733 -4.680  1.00 31.59 ? 368  PHE B N   1 
ATOM   3185 C CA  . PHE B 1 159 ? -2.988  -14.862 -6.049  1.00 31.53 ? 368  PHE B CA  1 
ATOM   3186 C C   . PHE B 1 159 ? -3.398  -13.720 -6.988  1.00 31.95 ? 368  PHE B C   1 
ATOM   3187 O O   . PHE B 1 159 ? -2.559  -13.204 -7.744  1.00 31.88 ? 368  PHE B O   1 
ATOM   3188 C CB  . PHE B 1 159 ? -3.415  -16.197 -6.674  1.00 31.36 ? 368  PHE B CB  1 
ATOM   3189 C CG  . PHE B 1 159 ? -2.492  -17.339 -6.356  1.00 31.19 ? 368  PHE B CG  1 
ATOM   3190 C CD1 . PHE B 1 159 ? -1.342  -17.548 -7.122  1.00 30.30 ? 368  PHE B CD1 1 
ATOM   3191 C CD2 . PHE B 1 159 ? -2.770  -18.201 -5.299  1.00 31.78 ? 368  PHE B CD2 1 
ATOM   3192 C CE1 . PHE B 1 159 ? -0.495  -18.610 -6.841  1.00 31.78 ? 368  PHE B CE1 1 
ATOM   3193 C CE2 . PHE B 1 159 ? -1.923  -19.256 -4.990  1.00 31.69 ? 368  PHE B CE2 1 
ATOM   3194 C CZ  . PHE B 1 159 ? -0.777  -19.471 -5.760  1.00 31.40 ? 368  PHE B CZ  1 
ATOM   3195 N N   . GLU B 1 160 ? -4.676  -13.343 -6.969  1.00 31.88 ? 369  GLU B N   1 
ATOM   3196 C CA  . GLU B 1 160 ? -5.152  -12.282 -7.853  1.00 33.25 ? 369  GLU B CA  1 
ATOM   3197 C C   . GLU B 1 160 ? -4.431  -10.964 -7.545  1.00 31.96 ? 369  GLU B C   1 
ATOM   3198 O O   . GLU B 1 160 ? -3.916  -10.283 -8.456  1.00 31.77 ? 369  GLU B O   1 
ATOM   3199 C CB  . GLU B 1 160 ? -6.683  -12.139 -7.758  1.00 33.28 ? 369  GLU B CB  1 
ATOM   3200 C CG  . GLU B 1 160 ? -7.445  -13.134 -8.658  1.00 35.19 ? 369  GLU B CG  1 
ATOM   3201 C CD  . GLU B 1 160 ? -8.944  -13.256 -8.332  1.00 37.73 ? 369  GLU B CD  1 
ATOM   3202 O OE1 . GLU B 1 160 ? -9.520  -12.293 -7.738  1.00 42.84 ? 369  GLU B OE1 1 
ATOM   3203 O OE2 . GLU B 1 160 ? -9.531  -14.331 -8.669  1.00 41.20 ? 369  GLU B OE2 1 
ATOM   3204 N N   . PHE B 1 161 ? -4.363  -10.615 -6.262  1.00 30.51 ? 370  PHE B N   1 
ATOM   3205 C CA  . PHE B 1 161 ? -3.608  -9.426  -5.858  1.00 29.55 ? 370  PHE B CA  1 
ATOM   3206 C C   . PHE B 1 161 ? -2.136  -9.535  -6.312  1.00 28.86 ? 370  PHE B C   1 
ATOM   3207 O O   . PHE B 1 161 ? -1.572  -8.570  -6.818  1.00 28.14 ? 370  PHE B O   1 
ATOM   3208 C CB  . PHE B 1 161 ? -3.659  -9.188  -4.334  1.00 28.40 ? 370  PHE B CB  1 
ATOM   3209 C CG  . PHE B 1 161 ? -2.787  -8.031  -3.892  1.00 27.83 ? 370  PHE B CG  1 
ATOM   3210 C CD1 . PHE B 1 161 ? -1.426  -8.230  -3.572  1.00 25.44 ? 370  PHE B CD1 1 
ATOM   3211 C CD2 . PHE B 1 161 ? -3.303  -6.739  -3.856  1.00 25.67 ? 370  PHE B CD2 1 
ATOM   3212 C CE1 . PHE B 1 161 ? -0.627  -7.173  -3.187  1.00 24.45 ? 370  PHE B CE1 1 
ATOM   3213 C CE2 . PHE B 1 161 ? -2.502  -5.664  -3.481  1.00 26.41 ? 370  PHE B CE2 1 
ATOM   3214 C CZ  . PHE B 1 161 ? -1.147  -5.886  -3.159  1.00 25.92 ? 370  PHE B CZ  1 
ATOM   3215 N N   . ALA B 1 162 ? -1.531  -10.707 -6.118  1.00 29.69 ? 371  ALA B N   1 
ATOM   3216 C CA  . ALA B 1 162 ? -0.085  -10.893 -6.370  1.00 31.56 ? 371  ALA B CA  1 
ATOM   3217 C C   . ALA B 1 162 ? 0.342   -10.722 -7.841  1.00 32.53 ? 371  ALA B C   1 
ATOM   3218 O O   . ALA B 1 162 ? 1.364   -10.085 -8.134  1.00 33.23 ? 371  ALA B O   1 
ATOM   3219 C CB  . ALA B 1 162 ? 0.384   -12.247 -5.827  1.00 31.19 ? 371  ALA B CB  1 
ATOM   3220 N N   . VAL B 1 163 ? -0.432  -11.283 -8.767  1.00 33.32 ? 372  VAL B N   1 
ATOM   3221 C CA  . VAL B 1 163 ? -0.066  -11.232 -10.191 1.00 34.39 ? 372  VAL B CA  1 
ATOM   3222 C C   . VAL B 1 163 ? -0.099  -9.800  -10.704 1.00 34.63 ? 372  VAL B C   1 
ATOM   3223 O O   . VAL B 1 163 ? 0.818   -9.365  -11.426 1.00 35.63 ? 372  VAL B O   1 
ATOM   3224 C CB  . VAL B 1 163 ? -0.928  -12.172 -11.066 1.00 34.49 ? 372  VAL B CB  1 
ATOM   3225 C CG1 . VAL B 1 163 ? -0.536  -12.029 -12.546 1.00 36.19 ? 372  VAL B CG1 1 
ATOM   3226 C CG2 . VAL B 1 163 ? -0.759  -13.611 -10.604 1.00 34.68 ? 372  VAL B CG2 1 
ATOM   3227 N N   . LYS B 1 164 ? -1.117  -9.061  -10.272 1.00 34.65 ? 373  LYS B N   1 
ATOM   3228 C CA  . LYS B 1 164 ? -1.228  -7.635  -10.538 1.00 35.35 ? 373  LYS B CA  1 
ATOM   3229 C C   . LYS B 1 164 ? -0.078  -6.844  -9.911  1.00 34.82 ? 373  LYS B C   1 
ATOM   3230 O O   . LYS B 1 164 ? 0.534   -6.015  -10.566 1.00 34.92 ? 373  LYS B O   1 
ATOM   3231 C CB  . LYS B 1 164 ? -2.562  -7.112  -10.006 1.00 35.29 ? 373  LYS B CB  1 
ATOM   3232 C CG  . LYS B 1 164 ? -3.769  -7.686  -10.727 1.00 38.23 ? 373  LYS B CG  1 
ATOM   3233 C CD  . LYS B 1 164 ? -5.021  -6.896  -10.421 1.00 41.66 ? 373  LYS B CD  1 
ATOM   3234 C CE  . LYS B 1 164 ? -5.736  -7.412  -9.175  1.00 43.88 ? 373  LYS B CE  1 
ATOM   3235 N NZ  . LYS B 1 164 ? -6.988  -6.632  -8.991  1.00 45.17 ? 373  LYS B NZ  1 
ATOM   3236 N N   . PHE B 1 165 ? 0.200   -7.103  -8.633  1.00 33.81 ? 374  PHE B N   1 
ATOM   3237 C CA  . PHE B 1 165 ? 1.284   -6.435  -7.925  1.00 32.94 ? 374  PHE B CA  1 
ATOM   3238 C C   . PHE B 1 165 ? 2.621   -6.610  -8.648  1.00 33.08 ? 374  PHE B C   1 
ATOM   3239 O O   . PHE B 1 165 ? 3.397   -5.651  -8.793  1.00 32.95 ? 374  PHE B O   1 
ATOM   3240 C CB  . PHE B 1 165 ? 1.379   -6.949  -6.471  1.00 32.60 ? 374  PHE B CB  1 
ATOM   3241 C CG  . PHE B 1 165 ? 2.203   -6.055  -5.567  1.00 30.68 ? 374  PHE B CG  1 
ATOM   3242 C CD1 . PHE B 1 165 ? 1.742   -4.791  -5.215  1.00 28.58 ? 374  PHE B CD1 1 
ATOM   3243 C CD2 . PHE B 1 165 ? 3.439   -6.474  -5.090  1.00 29.45 ? 374  PHE B CD2 1 
ATOM   3244 C CE1 . PHE B 1 165 ? 2.500   -3.954  -4.390  1.00 31.20 ? 374  PHE B CE1 1 
ATOM   3245 C CE2 . PHE B 1 165 ? 4.220   -5.654  -4.248  1.00 29.47 ? 374  PHE B CE2 1 
ATOM   3246 C CZ  . PHE B 1 165 ? 3.758   -4.383  -3.907  1.00 30.57 ? 374  PHE B CZ  1 
ATOM   3247 N N   . ASN B 1 166 ? 2.881   -7.832  -9.103  1.00 33.29 ? 375  ASN B N   1 
ATOM   3248 C CA  . ASN B 1 166 ? 4.114   -8.162  -9.811  1.00 34.05 ? 375  ASN B CA  1 
ATOM   3249 C C   . ASN B 1 166 ? 4.370   -7.353  -11.095 1.00 34.49 ? 375  ASN B C   1 
ATOM   3250 O O   . ASN B 1 166 ? 5.528   -7.171  -11.485 1.00 33.77 ? 375  ASN B O   1 
ATOM   3251 C CB  . ASN B 1 166 ? 4.221   -9.680  -10.077 1.00 33.77 ? 375  ASN B CB  1 
ATOM   3252 C CG  . ASN B 1 166 ? 4.808   -10.445 -8.894  1.00 34.09 ? 375  ASN B CG  1 
ATOM   3253 O OD1 . ASN B 1 166 ? 5.470   -9.869  -8.040  1.00 36.34 ? 375  ASN B OD1 1 
ATOM   3254 N ND2 . ASN B 1 166 ? 4.594   -11.751 -8.862  1.00 33.63 ? 375  ASN B ND2 1 
ATOM   3255 N N   . ALA B 1 167 ? 3.294   -6.858  -11.713 1.00 35.11 ? 376  ALA B N   1 
ATOM   3256 C CA  . ALA B 1 167 ? 3.379   -6.034  -12.929 1.00 35.69 ? 376  ALA B CA  1 
ATOM   3257 C C   . ALA B 1 167 ? 4.053   -4.671  -12.674 1.00 36.22 ? 376  ALA B C   1 
ATOM   3258 O O   . ALA B 1 167 ? 4.550   -4.021  -13.618 1.00 36.85 ? 376  ALA B O   1 
ATOM   3259 C CB  . ALA B 1 167 ? 1.978   -5.857  -13.565 1.00 35.43 ? 376  ALA B CB  1 
ATOM   3260 N N   . LEU B 1 168 ? 4.099   -4.252  -11.401 1.00 35.80 ? 377  LEU B N   1 
ATOM   3261 C CA  . LEU B 1 168 ? 4.799   -3.025  -11.002 1.00 35.00 ? 377  LEU B CA  1 
ATOM   3262 C C   . LEU B 1 168 ? 6.316   -3.218  -11.013 1.00 34.83 ? 377  LEU B C   1 
ATOM   3263 O O   . LEU B 1 168 ? 7.062   -2.251  -11.054 1.00 33.91 ? 377  LEU B O   1 
ATOM   3264 C CB  . LEU B 1 168 ? 4.311   -2.527  -9.630  1.00 35.04 ? 377  LEU B CB  1 
ATOM   3265 C CG  . LEU B 1 168 ? 2.818   -2.180  -9.547  1.00 34.80 ? 377  LEU B CG  1 
ATOM   3266 C CD1 . LEU B 1 168 ? 2.471   -1.617  -8.187  1.00 35.18 ? 377  LEU B CD1 1 
ATOM   3267 C CD2 . LEU B 1 168 ? 2.461   -1.178  -10.631 1.00 35.75 ? 377  LEU B CD2 1 
ATOM   3268 N N   . GLU B 1 169 ? 6.733   -4.479  -10.991 1.00 35.16 ? 378  GLU B N   1 
ATOM   3269 C CA  . GLU B 1 169 ? 8.142   -4.907  -11.073 1.00 36.02 ? 378  GLU B CA  1 
ATOM   3270 C C   . GLU B 1 169 ? 9.067   -4.274  -10.024 1.00 34.39 ? 378  GLU B C   1 
ATOM   3271 O O   . GLU B 1 169 ? 10.179  -3.823  -10.331 1.00 33.89 ? 378  GLU B O   1 
ATOM   3272 C CB  . GLU B 1 169 ? 8.689   -4.807  -12.513 1.00 36.38 ? 378  GLU B CB  1 
ATOM   3273 C CG  . GLU B 1 169 ? 8.113   -5.900  -13.455 1.00 38.83 ? 378  GLU B CG  1 
ATOM   3274 C CD  . GLU B 1 169 ? 8.915   -6.078  -14.738 1.00 40.79 ? 378  GLU B CD  1 
ATOM   3275 O OE1 . GLU B 1 169 ? 9.547   -7.165  -14.909 1.00 47.25 ? 378  GLU B OE1 1 
ATOM   3276 O OE2 . GLU B 1 169 ? 8.935   -5.129  -15.569 1.00 46.99 ? 378  GLU B OE2 1 
ATOM   3277 N N   . LEU B 1 170 ? 8.607   -4.272  -8.771  1.00 32.64 ? 379  LEU B N   1 
ATOM   3278 C CA  . LEU B 1 170 ? 9.434   -3.788  -7.649  1.00 31.93 ? 379  LEU B CA  1 
ATOM   3279 C C   . LEU B 1 170 ? 10.590  -4.734  -7.432  1.00 31.64 ? 379  LEU B C   1 
ATOM   3280 O O   . LEU B 1 170 ? 10.495  -5.908  -7.780  1.00 32.22 ? 379  LEU B O   1 
ATOM   3281 C CB  . LEU B 1 170 ? 8.621   -3.699  -6.353  1.00 31.84 ? 379  LEU B CB  1 
ATOM   3282 C CG  . LEU B 1 170 ? 7.361   -2.828  -6.294  1.00 31.65 ? 379  LEU B CG  1 
ATOM   3283 C CD1 . LEU B 1 170 ? 6.907   -2.671  -4.856  1.00 33.43 ? 379  LEU B CD1 1 
ATOM   3284 C CD2 . LEU B 1 170 ? 7.619   -1.493  -6.896  1.00 31.52 ? 379  LEU B CD2 1 
ATOM   3285 N N   . ASP B 1 171 ? 11.677  -4.248  -6.846  1.00 31.05 ? 380  ASP B N   1 
ATOM   3286 C CA  . ASP B 1 171 ? 12.702  -5.159  -6.368  1.00 30.73 ? 380  ASP B CA  1 
ATOM   3287 C C   . ASP B 1 171 ? 12.741  -5.183  -4.830  1.00 30.14 ? 380  ASP B C   1 
ATOM   3288 O O   . ASP B 1 171 ? 11.930  -4.533  -4.164  1.00 28.95 ? 380  ASP B O   1 
ATOM   3289 C CB  . ASP B 1 171 ? 14.081  -4.840  -6.957  1.00 32.00 ? 380  ASP B CB  1 
ATOM   3290 C CG  . ASP B 1 171 ? 14.594  -3.485  -6.554  1.00 35.56 ? 380  ASP B CG  1 
ATOM   3291 O OD1 . ASP B 1 171 ? 14.248  -2.989  -5.459  1.00 40.58 ? 380  ASP B OD1 1 
ATOM   3292 O OD2 . ASP B 1 171 ? 15.361  -2.900  -7.344  1.00 42.46 ? 380  ASP B OD2 1 
ATOM   3293 N N   . ASP B 1 172 ? 13.700  -5.909  -4.271  1.00 28.95 ? 381  ASP B N   1 
ATOM   3294 C CA  . ASP B 1 172 ? 13.728  -6.116  -2.825  1.00 28.81 ? 381  ASP B CA  1 
ATOM   3295 C C   . ASP B 1 172 ? 13.979  -4.805  -2.092  1.00 28.07 ? 381  ASP B C   1 
ATOM   3296 O O   . ASP B 1 172 ? 13.448  -4.596  -1.000  1.00 28.59 ? 381  ASP B O   1 
ATOM   3297 C CB  . ASP B 1 172 ? 14.765  -7.182  -2.431  1.00 28.68 ? 381  ASP B CB  1 
ATOM   3298 C CG  . ASP B 1 172 ? 14.359  -8.585  -2.858  1.00 28.92 ? 381  ASP B CG  1 
ATOM   3299 O OD1 . ASP B 1 172 ? 13.289  -9.094  -2.396  1.00 29.04 ? 381  ASP B OD1 1 
ATOM   3300 O OD2 . ASP B 1 172 ? 15.112  -9.185  -3.661  1.00 29.91 ? 381  ASP B OD2 1 
ATOM   3301 N N   . SER B 1 173 ? 14.761  -3.921  -2.707  1.00 27.74 ? 382  SER B N   1 
ATOM   3302 C CA  . SER B 1 173 ? 15.068  -2.602  -2.131  1.00 27.10 ? 382  SER B CA  1 
ATOM   3303 C C   . SER B 1 173 ? 13.826  -1.714  -2.067  1.00 27.20 ? 382  SER B C   1 
ATOM   3304 O O   . SER B 1 173 ? 13.627  -0.982  -1.087  1.00 26.74 ? 382  SER B O   1 
ATOM   3305 C CB  . SER B 1 173 ? 16.207  -1.904  -2.879  1.00 26.39 ? 382  SER B CB  1 
ATOM   3306 O OG  . SER B 1 173 ? 15.818  -1.505  -4.185  1.00 24.29 ? 382  SER B OG  1 
ATOM   3307 N N   . ASP B 1 174 ? 12.985  -1.815  -3.097  1.00 26.89 ? 383  ASP B N   1 
ATOM   3308 C CA  . ASP B 1 174 ? 11.666  -1.156  -3.088  1.00 26.96 ? 383  ASP B CA  1 
ATOM   3309 C C   . ASP B 1 174 ? 10.747  -1.765  -2.044  1.00 26.00 ? 383  ASP B C   1 
ATOM   3310 O O   . ASP B 1 174 ? 10.103  -1.041  -1.313  1.00 26.10 ? 383  ASP B O   1 
ATOM   3311 C CB  . ASP B 1 174 ? 10.957  -1.249  -4.451  1.00 26.79 ? 383  ASP B CB  1 
ATOM   3312 C CG  . ASP B 1 174 ? 11.823  -0.785  -5.602  1.00 28.88 ? 383  ASP B CG  1 
ATOM   3313 O OD1 . ASP B 1 174 ? 12.505  0.270   -5.463  1.00 30.59 ? 383  ASP B OD1 1 
ATOM   3314 O OD2 . ASP B 1 174 ? 11.801  -1.495  -6.644  1.00 30.07 ? 383  ASP B OD2 1 
ATOM   3315 N N   . LEU B 1 175 ? 10.682  -3.093  -2.016  1.00 24.93 ? 384  LEU B N   1 
ATOM   3316 C CA  . LEU B 1 175 ? 9.812   -3.829  -1.091  1.00 24.64 ? 384  LEU B CA  1 
ATOM   3317 C C   . LEU B 1 175 ? 10.077  -3.577  0.377   1.00 23.46 ? 384  LEU B C   1 
ATOM   3318 O O   . LEU B 1 175 ? 9.146   -3.495  1.180   1.00 22.59 ? 384  LEU B O   1 
ATOM   3319 C CB  . LEU B 1 175 ? 9.915   -5.334  -1.354  1.00 25.35 ? 384  LEU B CB  1 
ATOM   3320 C CG  . LEU B 1 175 ? 9.061   -5.834  -2.502  1.00 28.92 ? 384  LEU B CG  1 
ATOM   3321 C CD1 . LEU B 1 175 ? 9.606   -7.189  -2.981  1.00 30.71 ? 384  LEU B CD1 1 
ATOM   3322 C CD2 . LEU B 1 175 ? 7.546   -5.912  -2.081  1.00 30.76 ? 384  LEU B CD2 1 
ATOM   3323 N N   . ALA B 1 176 ? 11.358  -3.465  0.730   1.00 22.08 ? 385  ALA B N   1 
ATOM   3324 C CA  . ALA B 1 176 ? 11.797  -3.144  2.073   1.00 20.30 ? 385  ALA B CA  1 
ATOM   3325 C C   . ALA B 1 176 ? 11.182  -1.848  2.596   1.00 19.35 ? 385  ALA B C   1 
ATOM   3326 O O   . ALA B 1 176 ? 10.805  -1.749  3.765   1.00 18.84 ? 385  ALA B O   1 
ATOM   3327 C CB  . ALA B 1 176 ? 13.370  -3.043  2.096   1.00 19.80 ? 385  ALA B CB  1 
ATOM   3328 N N   . LEU B 1 177 ? 11.118  -0.826  1.754   1.00 18.63 ? 386  LEU B N   1 
ATOM   3329 C CA  . LEU B 1 177 ? 10.571  0.428   2.193   1.00 19.45 ? 386  LEU B CA  1 
ATOM   3330 C C   . LEU B 1 177 ? 9.032   0.366   2.240   1.00 20.21 ? 386  LEU B C   1 
ATOM   3331 O O   . LEU B 1 177 ? 8.400   0.925   3.153   1.00 19.99 ? 386  LEU B O   1 
ATOM   3332 C CB  . LEU B 1 177 ? 11.036  1.564   1.297   1.00 20.12 ? 386  LEU B CB  1 
ATOM   3333 C CG  . LEU B 1 177 ? 12.492  1.998   1.562   1.00 18.24 ? 386  LEU B CG  1 
ATOM   3334 C CD1 . LEU B 1 177 ? 13.006  2.705   0.279   1.00 19.52 ? 386  LEU B CD1 1 
ATOM   3335 C CD2 . LEU B 1 177 ? 12.556  2.908   2.752   1.00 18.17 ? 386  LEU B CD2 1 
ATOM   3336 N N   . PHE B 1 178 ? 8.473   -0.355  1.275   1.00 20.55 ? 387  PHE B N   1 
ATOM   3337 C CA  . PHE B 1 178 ? 7.004   -0.553  1.161   1.00 21.56 ? 387  PHE B CA  1 
ATOM   3338 C C   . PHE B 1 178 ? 6.450   -1.238  2.409   1.00 21.87 ? 387  PHE B C   1 
ATOM   3339 O O   . PHE B 1 178 ? 5.544   -0.710  3.047   1.00 23.42 ? 387  PHE B O   1 
ATOM   3340 C CB  . PHE B 1 178 ? 6.686   -1.345  -0.119  1.00 20.83 ? 387  PHE B CB  1 
ATOM   3341 C CG  . PHE B 1 178 ? 5.186   -1.453  -0.434  1.00 22.22 ? 387  PHE B CG  1 
ATOM   3342 C CD1 . PHE B 1 178 ? 4.470   -0.341  -0.855  1.00 21.59 ? 387  PHE B CD1 1 
ATOM   3343 C CD2 . PHE B 1 178 ? 4.542   -2.679  -0.359  1.00 22.73 ? 387  PHE B CD2 1 
ATOM   3344 C CE1 . PHE B 1 178 ? 3.089   -0.441  -1.146  1.00 24.50 ? 387  PHE B CE1 1 
ATOM   3345 C CE2 . PHE B 1 178 ? 3.155   -2.791  -0.662  1.00 25.08 ? 387  PHE B CE2 1 
ATOM   3346 C CZ  . PHE B 1 178 ? 2.447   -1.676  -1.038  1.00 22.27 ? 387  PHE B CZ  1 
ATOM   3347 N N   . ILE B 1 179 ? 7.030   -2.378  2.791   1.00 22.18 ? 388  ILE B N   1 
ATOM   3348 C CA  . ILE B 1 179 ? 6.626   -3.084  4.013   1.00 22.72 ? 388  ILE B CA  1 
ATOM   3349 C C   . ILE B 1 179 ? 6.825   -2.260  5.279   1.00 21.39 ? 388  ILE B C   1 
ATOM   3350 O O   . ILE B 1 179 ? 5.925   -2.206  6.121   1.00 20.28 ? 388  ILE B O   1 
ATOM   3351 C CB  . ILE B 1 179 ? 7.191   -4.569  4.141   1.00 23.00 ? 388  ILE B CB  1 
ATOM   3352 C CG1 . ILE B 1 179 ? 8.666   -4.610  4.517   1.00 25.67 ? 388  ILE B CG1 1 
ATOM   3353 C CG2 . ILE B 1 179 ? 6.914   -5.398  2.845   1.00 24.96 ? 388  ILE B CG2 1 
ATOM   3354 C CD1 . ILE B 1 179 ? 9.195   -6.027  4.825   1.00 25.92 ? 388  ILE B CD1 1 
ATOM   3355 N N   . ALA B 1 180 ? 7.975   -1.574  5.402   1.00 20.86 ? 389  ALA B N   1 
ATOM   3356 C CA  . ALA B 1 180 ? 8.155   -0.599  6.480   1.00 20.36 ? 389  ALA B CA  1 
ATOM   3357 C C   . ALA B 1 180 ? 6.997   0.423   6.572   1.00 20.61 ? 389  ALA B C   1 
ATOM   3358 O O   . ALA B 1 180 ? 6.468   0.707   7.658   1.00 19.91 ? 389  ALA B O   1 
ATOM   3359 C CB  . ALA B 1 180 ? 9.514   0.100   6.356   1.00 20.14 ? 389  ALA B CB  1 
ATOM   3360 N N   . ALA B 1 181 ? 6.604   0.970   5.429   1.00 20.41 ? 390  ALA B N   1 
ATOM   3361 C CA  . ALA B 1 181 ? 5.566   1.974   5.381   1.00 20.71 ? 390  ALA B CA  1 
ATOM   3362 C C   . ALA B 1 181 ? 4.227   1.342   5.775   1.00 21.71 ? 390  ALA B C   1 
ATOM   3363 O O   . ALA B 1 181 ? 3.410   2.002   6.399   1.00 22.13 ? 390  ALA B O   1 
ATOM   3364 C CB  . ALA B 1 181 ? 5.470   2.595   3.985   1.00 21.00 ? 390  ALA B CB  1 
ATOM   3365 N N   . ILE B 1 182 ? 4.015   0.083   5.379   1.00 22.22 ? 391  ILE B N   1 
ATOM   3366 C CA  . ILE B 1 182 ? 2.821   -0.682  5.760   1.00 22.43 ? 391  ILE B CA  1 
ATOM   3367 C C   . ILE B 1 182 ? 2.693   -0.799  7.280   1.00 23.23 ? 391  ILE B C   1 
ATOM   3368 O O   . ILE B 1 182 ? 1.642   -0.494  7.822   1.00 22.90 ? 391  ILE B O   1 
ATOM   3369 C CB  . ILE B 1 182 ? 2.825   -2.087  5.134   1.00 22.50 ? 391  ILE B CB  1 
ATOM   3370 C CG1 . ILE B 1 182 ? 2.424   -1.990  3.651   1.00 23.16 ? 391  ILE B CG1 1 
ATOM   3371 C CG2 . ILE B 1 182 ? 1.837   -3.026  5.864   1.00 22.45 ? 391  ILE B CG2 1 
ATOM   3372 C CD1 . ILE B 1 182 ? 2.510   -3.340  2.936   1.00 23.35 ? 391  ILE B CD1 1 
ATOM   3373 N N   . ILE B 1 183 ? 3.761   -1.242  7.946   1.00 22.72 ? 392  ILE B N   1 
ATOM   3374 C CA  . ILE B 1 183 ? 3.797   -1.438  9.403   1.00 24.66 ? 392  ILE B CA  1 
ATOM   3375 C C   . ILE B 1 183 ? 3.581   -0.146  10.181  1.00 24.86 ? 392  ILE B C   1 
ATOM   3376 O O   . ILE B 1 183 ? 2.888   -0.130  11.208  1.00 25.15 ? 392  ILE B O   1 
ATOM   3377 C CB  . ILE B 1 183 ? 5.107   -2.160  9.880   1.00 24.09 ? 392  ILE B CB  1 
ATOM   3378 C CG1 . ILE B 1 183 ? 5.141   -3.616  9.379   1.00 25.01 ? 392  ILE B CG1 1 
ATOM   3379 C CG2 . ILE B 1 183 ? 5.185   -2.192  11.436  1.00 24.38 ? 392  ILE B CG2 1 
ATOM   3380 C CD1 . ILE B 1 183 ? 6.569   -4.255  9.438   1.00 26.58 ? 392  ILE B CD1 1 
ATOM   3381 N N   . LEU B 1 184 ? 4.133   0.950   9.686   1.00 26.10 ? 393  LEU B N   1 
ATOM   3382 C CA  . LEU B 1 184 ? 3.907   2.232   10.326  1.00 28.36 ? 393  LEU B CA  1 
ATOM   3383 C C   . LEU B 1 184 ? 2.677   3.026   9.873   1.00 30.52 ? 393  LEU B C   1 
ATOM   3384 O O   . LEU B 1 184 ? 2.768   4.223   9.662   1.00 31.59 ? 393  LEU B O   1 
ATOM   3385 C CB  . LEU B 1 184 ? 5.187   3.066   10.297  1.00 29.06 ? 393  LEU B CB  1 
ATOM   3386 C CG  . LEU B 1 184 ? 5.957   2.504   11.506  1.00 30.37 ? 393  LEU B CG  1 
ATOM   3387 C CD1 . LEU B 1 184 ? 7.070   1.575   11.091  1.00 31.40 ? 393  LEU B CD1 1 
ATOM   3388 C CD2 . LEU B 1 184 ? 6.427   3.578   12.417  1.00 28.28 ? 393  LEU B CD2 1 
ATOM   3389 N N   . CYS B 1 185 ? 1.528   2.374   9.737   1.00 32.74 ? 394  CYS B N   1 
ATOM   3390 C CA  . CYS B 1 185 ? 0.267   3.108   9.463   1.00 35.20 ? 394  CYS B CA  1 
ATOM   3391 C C   . CYS B 1 185 ? -0.327  3.798   10.692  1.00 34.37 ? 394  CYS B C   1 
ATOM   3392 O O   . CYS B 1 185 ? -0.577  3.177   11.720  1.00 34.13 ? 394  CYS B O   1 
ATOM   3393 C CB  . CYS B 1 185 ? -0.778  2.244   8.751   1.00 35.17 ? 394  CYS B CB  1 
ATOM   3394 S SG  . CYS B 1 185 ? -0.397  2.016   6.990   1.00 45.71 ? 394  CYS B SG  1 
ATOM   3395 N N   . GLY B 1 186 ? -0.536  5.103   10.575  1.00 34.56 ? 395  GLY B N   1 
ATOM   3396 C CA  . GLY B 1 186 ? -0.975  5.926   11.692  1.00 34.38 ? 395  GLY B CA  1 
ATOM   3397 C C   . GLY B 1 186 ? -2.459  5.821   11.980  1.00 35.02 ? 395  GLY B C   1 
ATOM   3398 O O   . GLY B 1 186 ? -2.920  6.276   13.036  1.00 35.75 ? 395  GLY B O   1 
ATOM   3399 N N   . ASP B 1 187 ? -3.204  5.194   11.073  1.00 35.14 ? 396  ASP B N   1 
ATOM   3400 C CA  . ASP B 1 187 ? -4.657  5.067   11.222  1.00 35.88 ? 396  ASP B CA  1 
ATOM   3401 C C   . ASP B 1 187 ? -5.120  3.703   11.702  1.00 34.62 ? 396  ASP B C   1 
ATOM   3402 O O   . ASP B 1 187 ? -6.283  3.360   11.519  1.00 35.17 ? 396  ASP B O   1 
ATOM   3403 C CB  . ASP B 1 187 ? -5.380  5.417   9.899   1.00 37.36 ? 396  ASP B CB  1 
ATOM   3404 C CG  . ASP B 1 187 ? -4.767  4.726   8.703   1.00 41.75 ? 396  ASP B CG  1 
ATOM   3405 O OD1 . ASP B 1 187 ? -4.762  5.309   7.589   1.00 47.62 ? 396  ASP B OD1 1 
ATOM   3406 O OD2 . ASP B 1 187 ? -4.268  3.592   8.884   1.00 47.15 ? 396  ASP B OD2 1 
ATOM   3407 N N   . ARG B 1 188 ? -4.237  2.923   12.320  1.00 32.78 ? 397  ARG B N   1 
ATOM   3408 C CA  . ARG B 1 188 ? -4.640  1.622   12.852  1.00 31.16 ? 397  ARG B CA  1 
ATOM   3409 C C   . ARG B 1 188 ? -5.574  1.853   14.050  1.00 31.56 ? 397  ARG B C   1 
ATOM   3410 O O   . ARG B 1 188 ? -5.308  2.734   14.870  1.00 31.23 ? 397  ARG B O   1 
ATOM   3411 C CB  . ARG B 1 188 ? -3.414  0.777   13.269  1.00 30.70 ? 397  ARG B CB  1 
ATOM   3412 C CG  . ARG B 1 188 ? -2.325  0.534   12.194  1.00 28.35 ? 397  ARG B CG  1 
ATOM   3413 C CD  . ARG B 1 188 ? -2.915  -0.016  10.911  1.00 27.93 ? 397  ARG B CD  1 
ATOM   3414 N NE  . ARG B 1 188 ? -1.903  -0.555  9.997   1.00 26.26 ? 397  ARG B NE  1 
ATOM   3415 C CZ  . ARG B 1 188 ? -2.184  -1.082  8.827   1.00 27.72 ? 397  ARG B CZ  1 
ATOM   3416 N NH1 . ARG B 1 188 ? -3.479  -1.187  8.452   1.00 24.27 ? 397  ARG B NH1 1 
ATOM   3417 N NH2 . ARG B 1 188 ? -1.190  -1.531  8.057   1.00 26.36 ? 397  ARG B NH2 1 
ATOM   3418 N N   . PRO B 1 189 ? -6.652  1.053   14.167  1.00 31.70 ? 398  PRO B N   1 
ATOM   3419 C CA  . PRO B 1 189 ? -7.587  1.177   15.291  1.00 31.97 ? 398  PRO B CA  1 
ATOM   3420 C C   . PRO B 1 189 ? -6.893  1.049   16.648  1.00 32.01 ? 398  PRO B C   1 
ATOM   3421 O O   . PRO B 1 189 ? -6.098  0.115   16.870  1.00 30.81 ? 398  PRO B O   1 
ATOM   3422 C CB  . PRO B 1 189 ? -8.536  -0.006  15.094  1.00 31.68 ? 398  PRO B CB  1 
ATOM   3423 C CG  . PRO B 1 189 ? -8.457  -0.314  13.636  1.00 32.74 ? 398  PRO B CG  1 
ATOM   3424 C CD  . PRO B 1 189 ? -7.029  -0.054  13.268  1.00 31.62 ? 398  PRO B CD  1 
ATOM   3425 N N   . GLY B 1 190 ? -7.186  2.005   17.531  1.00 32.38 ? 399  GLY B N   1 
ATOM   3426 C CA  . GLY B 1 190 ? -6.717  1.971   18.916  1.00 32.13 ? 399  GLY B CA  1 
ATOM   3427 C C   . GLY B 1 190 ? -5.280  2.402   19.127  1.00 32.49 ? 399  GLY B C   1 
ATOM   3428 O O   . GLY B 1 190 ? -4.702  2.104   20.163  1.00 31.74 ? 399  GLY B O   1 
ATOM   3429 N N   . LEU B 1 191 ? -4.692  3.079   18.145  1.00 32.91 ? 400  LEU B N   1 
ATOM   3430 C CA  . LEU B 1 191 ? -3.311  3.562   18.285  1.00 33.95 ? 400  LEU B CA  1 
ATOM   3431 C C   . LEU B 1 191 ? -3.243  4.656   19.328  1.00 34.29 ? 400  LEU B C   1 
ATOM   3432 O O   . LEU B 1 191 ? -4.114  5.525   19.362  1.00 33.73 ? 400  LEU B O   1 
ATOM   3433 C CB  . LEU B 1 191 ? -2.788  4.128   16.975  1.00 33.76 ? 400  LEU B CB  1 
ATOM   3434 C CG  . LEU B 1 191 ? -1.754  3.383   16.166  1.00 35.69 ? 400  LEU B CG  1 
ATOM   3435 C CD1 . LEU B 1 191 ? -1.178  4.368   15.159  1.00 34.33 ? 400  LEU B CD1 1 
ATOM   3436 C CD2 . LEU B 1 191 ? -0.623  2.789   17.024  1.00 34.26 ? 400  LEU B CD2 1 
ATOM   3437 N N   . MET B 1 192 ? -2.213  4.631   20.168  1.00 34.25 ? 401  MET B N   1 
ATOM   3438 C CA  . MET B 1 192 ? -2.125  5.624   21.212  1.00 34.92 ? 401  MET B CA  1 
ATOM   3439 C C   . MET B 1 192 ? -1.528  6.935   20.741  1.00 35.14 ? 401  MET B C   1 
ATOM   3440 O O   . MET B 1 192 ? -2.146  7.999   20.900  1.00 35.65 ? 401  MET B O   1 
ATOM   3441 C CB  . MET B 1 192 ? -1.355  5.080   22.408  1.00 35.22 ? 401  MET B CB  1 
ATOM   3442 C CG  . MET B 1 192 ? -1.499  5.924   23.647  1.00 35.12 ? 401  MET B CG  1 
ATOM   3443 S SD  . MET B 1 192 ? -0.569  5.132   24.966  1.00 36.63 ? 401  MET B SD  1 
ATOM   3444 C CE  . MET B 1 192 ? 1.115   5.322   24.375  1.00 36.86 ? 401  MET B CE  1 
ATOM   3445 N N   . ASN B 1 193 ? -0.323  6.874   20.180  1.00 34.24 ? 402  ASN B N   1 
ATOM   3446 C CA  . ASN B 1 193 ? 0.347   8.078   19.736  1.00 34.00 ? 402  ASN B CA  1 
ATOM   3447 C C   . ASN B 1 193 ? 0.244   8.210   18.217  1.00 32.95 ? 402  ASN B C   1 
ATOM   3448 O O   . ASN B 1 193 ? 1.182   7.925   17.495  1.00 31.97 ? 402  ASN B O   1 
ATOM   3449 C CB  . ASN B 1 193 ? 1.809   8.045   20.183  1.00 34.35 ? 402  ASN B CB  1 
ATOM   3450 C CG  . ASN B 1 193 ? 2.474   9.411   20.118  1.00 36.79 ? 402  ASN B CG  1 
ATOM   3451 O OD1 . ASN B 1 193 ? 2.028   10.307  19.395  1.00 35.95 ? 402  ASN B OD1 1 
ATOM   3452 N ND2 . ASN B 1 193 ? 3.567   9.575   20.882  1.00 38.37 ? 402  ASN B ND2 1 
ATOM   3453 N N   . VAL B 1 194 ? -0.921  8.625   17.737  1.00 32.64 ? 403  VAL B N   1 
ATOM   3454 C CA  . VAL B 1 194 ? -1.142  8.739   16.310  1.00 32.35 ? 403  VAL B CA  1 
ATOM   3455 C C   . VAL B 1 194 ? -0.123  9.650   15.640  1.00 32.58 ? 403  VAL B C   1 
ATOM   3456 O O   . VAL B 1 194 ? 0.488   9.241   14.679  1.00 33.11 ? 403  VAL B O   1 
ATOM   3457 C CB  . VAL B 1 194 ? -2.598  9.102   15.960  1.00 32.27 ? 403  VAL B CB  1 
ATOM   3458 C CG1 . VAL B 1 194 ? -2.739  9.340   14.472  1.00 31.04 ? 403  VAL B CG1 1 
ATOM   3459 C CG2 . VAL B 1 194 ? -3.517  7.966   16.397  1.00 31.89 ? 403  VAL B CG2 1 
ATOM   3460 N N   . PRO B 1 195 ? 0.083   10.874  16.153  1.00 33.38 ? 404  PRO B N   1 
ATOM   3461 C CA  . PRO B 1 195 ? 1.016   11.804  15.518  1.00 33.41 ? 404  PRO B CA  1 
ATOM   3462 C C   . PRO B 1 195 ? 2.468   11.303  15.378  1.00 33.31 ? 404  PRO B C   1 
ATOM   3463 O O   . PRO B 1 195 ? 3.110   11.587  14.376  1.00 33.53 ? 404  PRO B O   1 
ATOM   3464 C CB  . PRO B 1 195 ? 0.946   13.042  16.418  1.00 33.69 ? 404  PRO B CB  1 
ATOM   3465 C CG  . PRO B 1 195 ? -0.360  12.935  17.120  1.00 34.80 ? 404  PRO B CG  1 
ATOM   3466 C CD  . PRO B 1 195 ? -0.588  11.482  17.320  1.00 34.01 ? 404  PRO B CD  1 
ATOM   3467 N N   . ARG B 1 196 ? 2.976   10.558  16.351  1.00 33.23 ? 405  ARG B N   1 
ATOM   3468 C CA  . ARG B 1 196 ? 4.349   10.057  16.283  1.00 32.69 ? 405  ARG B CA  1 
ATOM   3469 C C   . ARG B 1 196 ? 4.481   8.989   15.176  1.00 31.88 ? 405  ARG B C   1 
ATOM   3470 O O   . ARG B 1 196 ? 5.402   9.040   14.368  1.00 31.98 ? 405  ARG B O   1 
ATOM   3471 C CB  . ARG B 1 196 ? 4.779   9.500   17.643  1.00 33.31 ? 405  ARG B CB  1 
ATOM   3472 C CG  . ARG B 1 196 ? 6.202   8.969   17.709  1.00 36.68 ? 405  ARG B CG  1 
ATOM   3473 C CD  . ARG B 1 196 ? 7.201   10.090  17.869  1.00 43.73 ? 405  ARG B CD  1 
ATOM   3474 N NE  . ARG B 1 196 ? 8.597   9.686   17.646  1.00 46.80 ? 405  ARG B NE  1 
ATOM   3475 C CZ  . ARG B 1 196 ? 9.238   9.829   16.482  1.00 50.17 ? 405  ARG B CZ  1 
ATOM   3476 N NH1 . ARG B 1 196 ? 8.600   10.329  15.426  1.00 51.39 ? 405  ARG B NH1 1 
ATOM   3477 N NH2 . ARG B 1 196 ? 10.516  9.469   16.360  1.00 50.67 ? 405  ARG B NH2 1 
ATOM   3478 N N   . VAL B 1 197 ? 3.553   8.036   15.152  1.00 30.52 ? 406  VAL B N   1 
ATOM   3479 C CA  . VAL B 1 197 ? 3.488   7.003   14.107  1.00 29.85 ? 406  VAL B CA  1 
ATOM   3480 C C   . VAL B 1 197 ? 3.394   7.633   12.705  1.00 29.53 ? 406  VAL B C   1 
ATOM   3481 O O   . VAL B 1 197 ? 4.069   7.192   11.782  1.00 29.32 ? 406  VAL B O   1 
ATOM   3482 C CB  . VAL B 1 197 ? 2.295   6.033   14.324  1.00 29.17 ? 406  VAL B CB  1 
ATOM   3483 C CG1 . VAL B 1 197 ? 2.181   5.035   13.153  1.00 27.64 ? 406  VAL B CG1 1 
ATOM   3484 C CG2 . VAL B 1 197 ? 2.449   5.295   15.659  1.00 29.96 ? 406  VAL B CG2 1 
ATOM   3485 N N   . GLU B 1 198 ? 2.555   8.654   12.569  1.00 29.65 ? 407  GLU B N   1 
ATOM   3486 C CA  . GLU B 1 198 ? 2.367   9.355   11.305  1.00 30.44 ? 407  GLU B CA  1 
ATOM   3487 C C   . GLU B 1 198 ? 3.668   9.989   10.842  1.00 30.49 ? 407  GLU B C   1 
ATOM   3488 O O   . GLU B 1 198 ? 4.036   9.874   9.666   1.00 31.03 ? 407  GLU B O   1 
ATOM   3489 C CB  . GLU B 1 198 ? 1.266   10.399  11.423  1.00 30.25 ? 407  GLU B CB  1 
ATOM   3490 C CG  . GLU B 1 198 ? -0.096  9.771   11.566  1.00 30.85 ? 407  GLU B CG  1 
ATOM   3491 C CD  . GLU B 1 198 ? -1.226  10.784  11.574  1.00 35.42 ? 407  GLU B CD  1 
ATOM   3492 O OE1 . GLU B 1 198 ? -0.980  11.983  11.844  1.00 35.78 ? 407  GLU B OE1 1 
ATOM   3493 O OE2 . GLU B 1 198 ? -2.376  10.369  11.309  1.00 38.46 ? 407  GLU B OE2 1 
ATOM   3494 N N   . ALA B 1 199 ? 4.363   10.630  11.779  1.00 30.77 ? 408  ALA B N   1 
ATOM   3495 C CA  . ALA B 1 199 ? 5.659   11.265  11.513  1.00 30.09 ? 408  ALA B CA  1 
ATOM   3496 C C   . ALA B 1 199 ? 6.708   10.261  11.041  1.00 29.66 ? 408  ALA B C   1 
ATOM   3497 O O   . ALA B 1 199 ? 7.362   10.494  10.033  1.00 30.21 ? 408  ALA B O   1 
ATOM   3498 C CB  . ALA B 1 199 ? 6.141   12.040  12.734  1.00 30.76 ? 408  ALA B CB  1 
ATOM   3499 N N   . ILE B 1 200 ? 6.860   9.134   11.735  1.00 28.93 ? 409  ILE B N   1 
ATOM   3500 C CA  . ILE B 1 200 ? 7.783   8.085   11.290  1.00 27.41 ? 409  ILE B CA  1 
ATOM   3501 C C   . ILE B 1 200 ? 7.386   7.569   9.916   1.00 26.92 ? 409  ILE B C   1 
ATOM   3502 O O   . ILE B 1 200 ? 8.234   7.380   9.078   1.00 24.98 ? 409  ILE B O   1 
ATOM   3503 C CB  . ILE B 1 200 ? 7.841   6.875   12.281  1.00 28.33 ? 409  ILE B CB  1 
ATOM   3504 C CG1 . ILE B 1 200 ? 8.187   7.356   13.715  1.00 28.06 ? 409  ILE B CG1 1 
ATOM   3505 C CG2 . ILE B 1 200 ? 8.787   5.764   11.756  1.00 27.57 ? 409  ILE B CG2 1 
ATOM   3506 C CD1 . ILE B 1 200 ? 7.966   6.315   14.802  1.00 27.42 ? 409  ILE B CD1 1 
ATOM   3507 N N   . GLN B 1 201 ? 6.089   7.349   9.670   1.00 26.25 ? 410  GLN B N   1 
ATOM   3508 C CA  . GLN B 1 201 ? 5.649   6.870   8.345   1.00 26.53 ? 410  GLN B CA  1 
ATOM   3509 C C   . GLN B 1 201 ? 6.025   7.843   7.228   1.00 26.80 ? 410  GLN B C   1 
ATOM   3510 O O   . GLN B 1 201 ? 6.397   7.448   6.130   1.00 25.94 ? 410  GLN B O   1 
ATOM   3511 C CB  . GLN B 1 201 ? 4.121   6.653   8.271   1.00 26.44 ? 410  GLN B CB  1 
ATOM   3512 C CG  . GLN B 1 201 ? 3.737   5.786   7.046   1.00 27.15 ? 410  GLN B CG  1 
ATOM   3513 C CD  . GLN B 1 201 ? 2.263   5.840   6.680   1.00 27.61 ? 410  GLN B CD  1 
ATOM   3514 O OE1 . GLN B 1 201 ? 1.651   6.898   6.710   1.00 30.31 ? 410  GLN B OE1 1 
ATOM   3515 N NE2 . GLN B 1 201 ? 1.709   4.708   6.278   1.00 28.40 ? 410  GLN B NE2 1 
ATOM   3516 N N   . ASP B 1 202 ? 5.886   9.126   7.509   1.00 27.80 ? 411  ASP B N   1 
ATOM   3517 C CA  . ASP B 1 202 ? 6.153   10.125  6.501   1.00 29.68 ? 411  ASP B CA  1 
ATOM   3518 C C   . ASP B 1 202 ? 7.620   10.075  6.094   1.00 29.45 ? 411  ASP B C   1 
ATOM   3519 O O   . ASP B 1 202 ? 7.926   10.189  4.906   1.00 28.88 ? 411  ASP B O   1 
ATOM   3520 C CB  . ASP B 1 202 ? 5.777   11.525  6.980   1.00 31.00 ? 411  ASP B CB  1 
ATOM   3521 C CG  . ASP B 1 202 ? 5.666   12.511  5.825   1.00 34.85 ? 411  ASP B CG  1 
ATOM   3522 O OD1 . ASP B 1 202 ? 4.747   12.357  4.978   1.00 37.68 ? 411  ASP B OD1 1 
ATOM   3523 O OD2 . ASP B 1 202 ? 6.531   13.410  5.756   1.00 39.25 ? 411  ASP B OD2 1 
ATOM   3524 N N   . THR B 1 203 ? 8.506   9.863   7.073   1.00 29.38 ? 412  THR B N   1 
ATOM   3525 C CA  . THR B 1 203 ? 9.949   9.719   6.812   1.00 29.35 ? 412  THR B CA  1 
ATOM   3526 C C   . THR B 1 203 ? 10.227  8.535   5.861   1.00 28.78 ? 412  THR B C   1 
ATOM   3527 O O   . THR B 1 203 ? 10.974  8.658   4.902   1.00 28.95 ? 412  THR B O   1 
ATOM   3528 C CB  . THR B 1 203 ? 10.695  9.552   8.142   1.00 29.57 ? 412  THR B CB  1 
ATOM   3529 O OG1 . THR B 1 203 ? 10.533  10.752  8.910   1.00 31.54 ? 412  THR B OG1 1 
ATOM   3530 C CG2 . THR B 1 203 ? 12.189  9.309   7.915   1.00 31.73 ? 412  THR B CG2 1 
ATOM   3531 N N   . ILE B 1 204 ? 9.597   7.389   6.124   1.00 27.96 ? 413  ILE B N   1 
ATOM   3532 C CA  . ILE B 1 204 ? 9.720   6.211   5.256   1.00 26.32 ? 413  ILE B CA  1 
ATOM   3533 C C   . ILE B 1 204 ? 9.224   6.507   3.842   1.00 25.44 ? 413  ILE B C   1 
ATOM   3534 O O   . ILE B 1 204 ? 9.848   6.116   2.875   1.00 24.49 ? 413  ILE B O   1 
ATOM   3535 C CB  . ILE B 1 204 ? 8.939   4.977   5.833   1.00 26.26 ? 413  ILE B CB  1 
ATOM   3536 C CG1 . ILE B 1 204 ? 9.467   4.593   7.228   1.00 26.88 ? 413  ILE B CG1 1 
ATOM   3537 C CG2 . ILE B 1 204 ? 8.969   3.790   4.832   1.00 24.08 ? 413  ILE B CG2 1 
ATOM   3538 C CD1 . ILE B 1 204 ? 8.420   3.863   8.118   1.00 25.84 ? 413  ILE B CD1 1 
ATOM   3539 N N   . LEU B 1 205 ? 8.085   7.177   3.742   1.00 24.97 ? 414  LEU B N   1 
ATOM   3540 C CA  . LEU B 1 205 ? 7.481   7.475   2.450   1.00 26.31 ? 414  LEU B CA  1 
ATOM   3541 C C   . LEU B 1 205 ? 8.283   8.461   1.608   1.00 26.21 ? 414  LEU B C   1 
ATOM   3542 O O   . LEU B 1 205 ? 8.338   8.330   0.415   1.00 26.54 ? 414  LEU B O   1 
ATOM   3543 C CB  . LEU B 1 205 ? 6.057   8.002   2.625   1.00 25.88 ? 414  LEU B CB  1 
ATOM   3544 C CG  . LEU B 1 205 ? 5.043   6.964   3.083   1.00 27.39 ? 414  LEU B CG  1 
ATOM   3545 C CD1 . LEU B 1 205 ? 3.674   7.633   3.263   1.00 28.63 ? 414  LEU B CD1 1 
ATOM   3546 C CD2 . LEU B 1 205 ? 4.983   5.785   2.086   1.00 29.11 ? 414  LEU B CD2 1 
ATOM   3547 N N   . ARG B 1 206 ? 8.870   9.466   2.234   1.00 27.37 ? 415  ARG B N   1 
ATOM   3548 C CA  . ARG B 1 206 ? 9.749   10.400  1.507   1.00 28.38 ? 415  ARG B CA  1 
ATOM   3549 C C   . ARG B 1 206 ? 10.934  9.618   0.965   1.00 27.86 ? 415  ARG B C   1 
ATOM   3550 O O   . ARG B 1 206 ? 11.310  9.792   -0.183  1.00 27.48 ? 415  ARG B O   1 
ATOM   3551 C CB  . ARG B 1 206 ? 10.214  11.563  2.405   1.00 28.52 ? 415  ARG B CB  1 
ATOM   3552 C CG  . ARG B 1 206 ? 9.047   12.346  2.994   1.00 31.02 ? 415  ARG B CG  1 
ATOM   3553 C CD  . ARG B 1 206 ? 9.279   13.841  3.100   1.00 32.96 ? 415  ARG B CD  1 
ATOM   3554 N NE  . ARG B 1 206 ? 8.126   14.512  3.725   1.00 37.89 ? 415  ARG B NE  1 
ATOM   3555 C CZ  . ARG B 1 206 ? 8.032   15.825  3.946   1.00 40.33 ? 415  ARG B CZ  1 
ATOM   3556 N NH1 . ARG B 1 206 ? 9.023   16.642  3.593   1.00 41.22 ? 415  ARG B NH1 1 
ATOM   3557 N NH2 . ARG B 1 206 ? 6.952   16.325  4.545   1.00 42.91 ? 415  ARG B NH2 1 
ATOM   3558 N N   . ALA B 1 207 ? 11.485  8.736   1.797   1.00 26.98 ? 416  ALA B N   1 
ATOM   3559 C CA  . ALA B 1 207 ? 12.537  7.802   1.369   1.00 27.03 ? 416  ALA B CA  1 
ATOM   3560 C C   . ALA B 1 207 ? 12.096  6.937   0.191   1.00 27.51 ? 416  ALA B C   1 
ATOM   3561 O O   . ALA B 1 207 ? 12.846  6.740   -0.781  1.00 25.98 ? 416  ALA B O   1 
ATOM   3562 C CB  . ALA B 1 207 ? 12.945  6.921   2.523   1.00 26.16 ? 416  ALA B CB  1 
ATOM   3563 N N   . LEU B 1 208 ? 10.874  6.396   0.291   1.00 27.74 ? 417  LEU B N   1 
ATOM   3564 C CA  . LEU B 1 208 ? 10.363  5.515   -0.734  1.00 28.59 ? 417  LEU B CA  1 
ATOM   3565 C C   . LEU B 1 208 ? 10.202  6.283   -2.044  1.00 29.91 ? 417  LEU B C   1 
ATOM   3566 O O   . LEU B 1 208 ? 10.549  5.782   -3.117  1.00 29.34 ? 417  LEU B O   1 
ATOM   3567 C CB  . LEU B 1 208 ? 9.021   4.890   -0.308  1.00 28.39 ? 417  LEU B CB  1 
ATOM   3568 C CG  . LEU B 1 208 ? 8.285   3.997   -1.326  1.00 29.27 ? 417  LEU B CG  1 
ATOM   3569 C CD1 . LEU B 1 208 ? 9.172   2.883   -1.910  1.00 28.12 ? 417  LEU B CD1 1 
ATOM   3570 C CD2 . LEU B 1 208 ? 7.009   3.437   -0.683  1.00 27.91 ? 417  LEU B CD2 1 
ATOM   3571 N N   . GLU B 1 209 ? 9.659   7.493   -1.961  1.00 31.51 ? 418  GLU B N   1 
ATOM   3572 C CA  . GLU B 1 209 ? 9.485   8.301   -3.163  1.00 33.65 ? 418  GLU B CA  1 
ATOM   3573 C C   . GLU B 1 209 ? 10.823  8.596   -3.818  1.00 33.55 ? 418  GLU B C   1 
ATOM   3574 O O   . GLU B 1 209 ? 10.971  8.463   -5.035  1.00 33.16 ? 418  GLU B O   1 
ATOM   3575 C CB  . GLU B 1 209 ? 8.771   9.604   -2.843  1.00 34.17 ? 418  GLU B CB  1 
ATOM   3576 C CG  . GLU B 1 209 ? 8.271   10.310  -4.088  1.00 39.27 ? 418  GLU B CG  1 
ATOM   3577 C CD  . GLU B 1 209 ? 7.251   11.385  -3.774  1.00 45.47 ? 418  GLU B CD  1 
ATOM   3578 O OE1 . GLU B 1 209 ? 7.201   11.835  -2.588  1.00 48.04 ? 418  GLU B OE1 1 
ATOM   3579 O OE2 . GLU B 1 209 ? 6.493   11.763  -4.714  1.00 48.11 ? 418  GLU B OE2 1 
ATOM   3580 N N   . PHE B 1 210 ? 11.793  8.987   -3.007  1.00 34.08 ? 419  PHE B N   1 
ATOM   3581 C CA  . PHE B 1 210 ? 13.156  9.216   -3.514  1.00 35.26 ? 419  PHE B CA  1 
ATOM   3582 C C   . PHE B 1 210 ? 13.748  7.961   -4.147  1.00 35.29 ? 419  PHE B C   1 
ATOM   3583 O O   . PHE B 1 210 ? 14.322  8.016   -5.236  1.00 35.50 ? 419  PHE B O   1 
ATOM   3584 C CB  . PHE B 1 210 ? 14.059  9.725   -2.387  1.00 36.18 ? 419  PHE B CB  1 
ATOM   3585 C CG  . PHE B 1 210 ? 15.530  9.695   -2.721  1.00 39.24 ? 419  PHE B CG  1 
ATOM   3586 C CD1 . PHE B 1 210 ? 16.149  10.800  -3.298  1.00 41.80 ? 419  PHE B CD1 1 
ATOM   3587 C CD2 . PHE B 1 210 ? 16.299  8.562   -2.456  1.00 40.49 ? 419  PHE B CD2 1 
ATOM   3588 C CE1 . PHE B 1 210 ? 17.536  10.774  -3.605  1.00 42.90 ? 419  PHE B CE1 1 
ATOM   3589 C CE2 . PHE B 1 210 ? 17.656  8.526   -2.761  1.00 41.54 ? 419  PHE B CE2 1 
ATOM   3590 C CZ  . PHE B 1 210 ? 18.276  9.636   -3.335  1.00 40.79 ? 419  PHE B CZ  1 
ATOM   3591 N N   . HIS B 1 211 ? 13.613  6.820   -3.468  1.00 35.11 ? 420  HIS B N   1 
ATOM   3592 C CA  . HIS B 1 211 ? 14.177  5.569   -3.959  1.00 34.40 ? 420  HIS B CA  1 
ATOM   3593 C C   . HIS B 1 211 ? 13.587  5.117   -5.290  1.00 34.93 ? 420  HIS B C   1 
ATOM   3594 O O   . HIS B 1 211 ? 14.306  4.598   -6.130  1.00 34.12 ? 420  HIS B O   1 
ATOM   3595 C CB  . HIS B 1 211 ? 14.003  4.473   -2.921  1.00 34.98 ? 420  HIS B CB  1 
ATOM   3596 C CG  . HIS B 1 211 ? 14.745  3.224   -3.251  1.00 34.16 ? 420  HIS B CG  1 
ATOM   3597 N ND1 . HIS B 1 211 ? 14.116  2.089   -3.713  1.00 34.34 ? 420  HIS B ND1 1 
ATOM   3598 C CD2 . HIS B 1 211 ? 16.069  2.939   -3.214  1.00 31.19 ? 420  HIS B CD2 1 
ATOM   3599 C CE1 . HIS B 1 211 ? 15.021  1.153   -3.940  1.00 32.55 ? 420  HIS B CE1 1 
ATOM   3600 N NE2 . HIS B 1 211 ? 16.213  1.643   -3.641  1.00 32.18 ? 420  HIS B NE2 1 
ATOM   3601 N N   . LEU B 1 212 ? 12.275  5.275   -5.463  1.00 35.67 ? 421  LEU B N   1 
ATOM   3602 C CA  . LEU B 1 212 ? 11.620  4.962   -6.744  1.00 37.32 ? 421  LEU B CA  1 
ATOM   3603 C C   . LEU B 1 212 ? 12.107  5.858   -7.904  1.00 39.70 ? 421  LEU B C   1 
ATOM   3604 O O   . LEU B 1 212 ? 12.219  5.375   -9.034  1.00 40.75 ? 421  LEU B O   1 
ATOM   3605 C CB  . LEU B 1 212 ? 10.081  5.039   -6.618  1.00 36.38 ? 421  LEU B CB  1 
ATOM   3606 C CG  . LEU B 1 212 ? 9.448   4.108   -5.567  1.00 33.47 ? 421  LEU B CG  1 
ATOM   3607 C CD1 . LEU B 1 212 ? 7.992   4.437   -5.298  1.00 30.88 ? 421  LEU B CD1 1 
ATOM   3608 C CD2 . LEU B 1 212 ? 9.637   2.639   -5.958  1.00 33.16 ? 421  LEU B CD2 1 
ATOM   3609 N N   . GLN B 1 213 ? 12.370  7.143   -7.633  1.00 42.05 ? 422  GLN B N   1 
ATOM   3610 C CA  . GLN B 1 213 ? 12.959  8.075   -8.640  1.00 45.05 ? 422  GLN B CA  1 
ATOM   3611 C C   . GLN B 1 213 ? 14.298  7.537   -9.135  1.00 44.94 ? 422  GLN B C   1 
ATOM   3612 O O   . GLN B 1 213 ? 14.563  7.488   -10.332 1.00 45.32 ? 422  GLN B O   1 
ATOM   3613 C CB  . GLN B 1 213 ? 13.268  9.472   -8.069  1.00 44.78 ? 422  GLN B CB  1 
ATOM   3614 C CG  . GLN B 1 213 ? 12.183  10.279  -7.381  1.00 47.61 ? 422  GLN B CG  1 
ATOM   3615 C CD  . GLN B 1 213 ? 12.789  11.398  -6.485  1.00 48.45 ? 422  GLN B CD  1 
ATOM   3616 O OE1 . GLN B 1 213 ? 13.941  11.823  -6.691  1.00 53.30 ? 422  GLN B OE1 1 
ATOM   3617 N NE2 . GLN B 1 213 ? 12.019  11.859  -5.482  1.00 50.67 ? 422  GLN B NE2 1 
ATOM   3618 N N   . ALA B 1 214 ? 15.142  7.159   -8.182  1.00 45.37 ? 423  ALA B N   1 
ATOM   3619 C CA  . ALA B 1 214 ? 16.479  6.646   -8.446  1.00 45.79 ? 423  ALA B CA  1 
ATOM   3620 C C   . ALA B 1 214 ? 16.444  5.278   -9.146  1.00 46.29 ? 423  ALA B C   1 
ATOM   3621 O O   . ALA B 1 214 ? 17.051  5.088   -10.200 1.00 46.28 ? 423  ALA B O   1 
ATOM   3622 C CB  . ALA B 1 214 ? 17.274  6.563   -7.122  1.00 45.31 ? 423  ALA B CB  1 
ATOM   3623 N N   . ASN B 1 215 ? 15.702  4.347   -8.548  1.00 46.50 ? 424  ASN B N   1 
ATOM   3624 C CA  . ASN B 1 215 ? 15.643  2.952   -8.949  1.00 46.43 ? 424  ASN B CA  1 
ATOM   3625 C C   . ASN B 1 215 ? 14.800  2.703   -10.203 1.00 46.25 ? 424  ASN B C   1 
ATOM   3626 O O   . ASN B 1 215 ? 15.120  1.819   -10.996 1.00 46.23 ? 424  ASN B O   1 
ATOM   3627 C CB  . ASN B 1 215 ? 15.074  2.149   -7.769  1.00 46.18 ? 424  ASN B CB  1 
ATOM   3628 C CG  . ASN B 1 215 ? 15.415  0.675   -7.825  1.00 47.28 ? 424  ASN B CG  1 
ATOM   3629 O OD1 . ASN B 1 215 ? 14.655  -0.169  -7.317  1.00 44.47 ? 424  ASN B OD1 1 
ATOM   3630 N ND2 . ASN B 1 215 ? 16.564  0.346   -8.429  1.00 47.33 ? 424  ASN B ND2 1 
ATOM   3631 N N   . HIS B 1 216 ? 13.717  3.466   -10.361 1.00 46.45 ? 425  HIS B N   1 
ATOM   3632 C CA  . HIS B 1 216 ? 12.773  3.306   -11.479 1.00 46.98 ? 425  HIS B CA  1 
ATOM   3633 C C   . HIS B 1 216 ? 12.565  4.639   -12.221 1.00 48.04 ? 425  HIS B C   1 
ATOM   3634 O O   . HIS B 1 216 ? 11.458  5.191   -12.195 1.00 47.22 ? 425  HIS B O   1 
ATOM   3635 C CB  . HIS B 1 216 ? 11.414  2.809   -10.975 1.00 46.59 ? 425  HIS B CB  1 
ATOM   3636 C CG  . HIS B 1 216 ? 11.472  1.489   -10.274 1.00 45.34 ? 425  HIS B CG  1 
ATOM   3637 N ND1 . HIS B 1 216 ? 11.070  0.313   -10.866 1.00 44.68 ? 425  HIS B ND1 1 
ATOM   3638 C CD2 . HIS B 1 216 ? 11.883  1.162   -9.028  1.00 43.83 ? 425  HIS B CD2 1 
ATOM   3639 C CE1 . HIS B 1 216 ? 11.248  -0.685  -10.019 1.00 44.03 ? 425  HIS B CE1 1 
ATOM   3640 N NE2 . HIS B 1 216 ? 11.737  -0.196  -8.896  1.00 41.73 ? 425  HIS B NE2 1 
ATOM   3641 N N   . PRO B 1 217 ? 13.614  5.145   -12.907 1.00 48.98 ? 426  PRO B N   1 
ATOM   3642 C CA  . PRO B 1 217 ? 13.529  6.532   -13.393 1.00 49.97 ? 426  PRO B CA  1 
ATOM   3643 C C   . PRO B 1 217 ? 12.398  6.732   -14.404 1.00 50.53 ? 426  PRO B C   1 
ATOM   3644 O O   . PRO B 1 217 ? 11.752  7.779   -14.404 1.00 50.72 ? 426  PRO B O   1 
ATOM   3645 C CB  . PRO B 1 217 ? 14.902  6.780   -14.038 1.00 49.99 ? 426  PRO B CB  1 
ATOM   3646 C CG  . PRO B 1 217 ? 15.790  5.666   -13.556 1.00 49.71 ? 426  PRO B CG  1 
ATOM   3647 C CD  . PRO B 1 217 ? 14.882  4.501   -13.301 1.00 49.46 ? 426  PRO B CD  1 
ATOM   3648 N N   . ASP B 1 218 ? 12.134  5.714   -15.214 1.00 51.22 ? 427  ASP B N   1 
ATOM   3649 C CA  . ASP B 1 218 ? 11.158  5.826   -16.288 1.00 52.10 ? 427  ASP B CA  1 
ATOM   3650 C C   . ASP B 1 218 ? 9.750   5.442   -15.871 1.00 52.21 ? 427  ASP B C   1 
ATOM   3651 O O   . ASP B 1 218 ? 8.807   5.591   -16.658 1.00 52.44 ? 427  ASP B O   1 
ATOM   3652 C CB  . ASP B 1 218 ? 11.596  4.993   -17.500 1.00 52.72 ? 427  ASP B CB  1 
ATOM   3653 C CG  . ASP B 1 218 ? 12.645  5.700   -18.341 1.00 53.90 ? 427  ASP B CG  1 
ATOM   3654 O OD1 . ASP B 1 218 ? 12.251  6.350   -19.337 1.00 56.08 ? 427  ASP B OD1 1 
ATOM   3655 O OD2 . ASP B 1 218 ? 13.847  5.633   -17.988 1.00 54.36 ? 427  ASP B OD2 1 
ATOM   3656 N N   . ALA B 1 219 ? 9.602   4.942   -14.647 1.00 52.01 ? 428  ALA B N   1 
ATOM   3657 C CA  . ALA B 1 219 ? 8.304   4.464   -14.190 1.00 51.63 ? 428  ALA B CA  1 
ATOM   3658 C C   . ALA B 1 219 ? 7.481   5.628   -13.672 1.00 51.65 ? 428  ALA B C   1 
ATOM   3659 O O   . ALA B 1 219 ? 7.456   5.933   -12.463 1.00 51.61 ? 428  ALA B O   1 
ATOM   3660 C CB  . ALA B 1 219 ? 8.451   3.375   -13.136 1.00 51.67 ? 428  ALA B CB  1 
ATOM   3661 N N   . GLN B 1 220 ? 6.820   6.293   -14.614 1.00 50.94 ? 429  GLN B N   1 
ATOM   3662 C CA  . GLN B 1 220 ? 5.884   7.353   -14.293 1.00 50.21 ? 429  GLN B CA  1 
ATOM   3663 C C   . GLN B 1 220 ? 4.833   6.744   -13.378 1.00 49.08 ? 429  GLN B C   1 
ATOM   3664 O O   . GLN B 1 220 ? 4.359   5.617   -13.629 1.00 49.95 ? 429  GLN B O   1 
ATOM   3665 C CB  . GLN B 1 220 ? 5.227   7.916   -15.586 1.00 50.30 ? 429  GLN B CB  1 
ATOM   3666 N N   . GLN B 1 221 ? 4.513   7.467   -12.305 1.00 46.77 ? 430  GLN B N   1 
ATOM   3667 C CA  . GLN B 1 221 ? 3.326   7.205   -11.478 1.00 44.80 ? 430  GLN B CA  1 
ATOM   3668 C C   . GLN B 1 221 ? 3.452   6.037   -10.493 1.00 42.68 ? 430  GLN B C   1 
ATOM   3669 O O   . GLN B 1 221 ? 2.451   5.638   -9.909  1.00 41.72 ? 430  GLN B O   1 
ATOM   3670 C CB  . GLN B 1 221 ? 2.053   7.021   -12.343 1.00 45.28 ? 430  GLN B CB  1 
ATOM   3671 C CG  . GLN B 1 221 ? 1.966   7.899   -13.624 1.00 48.26 ? 430  GLN B CG  1 
ATOM   3672 C CD  . GLN B 1 221 ? 1.713   9.377   -13.354 1.00 51.26 ? 430  GLN B CD  1 
ATOM   3673 O OE1 . GLN B 1 221 ? 1.467   9.786   -12.215 1.00 52.47 ? 430  GLN B OE1 1 
ATOM   3674 N NE2 . GLN B 1 221 ? 1.763   10.192  -14.419 1.00 52.47 ? 430  GLN B NE2 1 
ATOM   3675 N N   . LEU B 1 222 ? 4.661   5.511   -10.303 1.00 39.69 ? 431  LEU B N   1 
ATOM   3676 C CA  . LEU B 1 222 ? 4.871   4.352   -9.430  1.00 38.40 ? 431  LEU B CA  1 
ATOM   3677 C C   . LEU B 1 222 ? 4.493   4.626   -7.977  1.00 36.78 ? 431  LEU B C   1 
ATOM   3678 O O   . LEU B 1 222 ? 3.841   3.802   -7.353  1.00 36.29 ? 431  LEU B O   1 
ATOM   3679 C CB  . LEU B 1 222 ? 6.314   3.807   -9.521  1.00 38.42 ? 431  LEU B CB  1 
ATOM   3680 C CG  . LEU B 1 222 ? 6.650   2.423   -8.921  1.00 38.87 ? 431  LEU B CG  1 
ATOM   3681 C CD1 . LEU B 1 222 ? 5.678   1.306   -9.336  1.00 38.42 ? 431  LEU B CD1 1 
ATOM   3682 C CD2 . LEU B 1 222 ? 8.087   2.016   -9.262  1.00 38.68 ? 431  LEU B CD2 1 
ATOM   3683 N N   . PHE B 1 223 ? 4.850   5.802   -7.468  1.00 35.00 ? 432  PHE B N   1 
ATOM   3684 C CA  . PHE B 1 223 ? 4.619   6.112   -6.064  1.00 34.11 ? 432  PHE B CA  1 
ATOM   3685 C C   . PHE B 1 223 ? 3.125   6.281   -5.696  1.00 33.92 ? 432  PHE B C   1 
ATOM   3686 O O   . PHE B 1 223 ? 2.688   5.696   -4.708  1.00 33.62 ? 432  PHE B O   1 
ATOM   3687 C CB  . PHE B 1 223 ? 5.491   7.280   -5.607  1.00 33.24 ? 432  PHE B CB  1 
ATOM   3688 C CG  . PHE B 1 223 ? 5.340   7.633   -4.152  1.00 33.08 ? 432  PHE B CG  1 
ATOM   3689 C CD1 . PHE B 1 223 ? 5.880   6.821   -3.153  1.00 32.20 ? 432  PHE B CD1 1 
ATOM   3690 C CD2 . PHE B 1 223 ? 4.670   8.782   -3.778  1.00 33.98 ? 432  PHE B CD2 1 
ATOM   3691 C CE1 . PHE B 1 223 ? 5.767   7.157   -1.819  1.00 28.34 ? 432  PHE B CE1 1 
ATOM   3692 C CE2 . PHE B 1 223 ? 4.533   9.118   -2.421  1.00 34.19 ? 432  PHE B CE2 1 
ATOM   3693 C CZ  . PHE B 1 223 ? 5.095   8.294   -1.453  1.00 31.85 ? 432  PHE B CZ  1 
ATOM   3694 N N   . PRO B 1 224 ? 2.337   7.055   -6.483  1.00 33.89 ? 433  PRO B N   1 
ATOM   3695 C CA  . PRO B 1 224 ? 0.894   6.996   -6.192  1.00 33.38 ? 433  PRO B CA  1 
ATOM   3696 C C   . PRO B 1 224 ? 0.292   5.592   -6.422  1.00 32.76 ? 433  PRO B C   1 
ATOM   3697 O O   . PRO B 1 224 ? -0.670  5.223   -5.762  1.00 32.30 ? 433  PRO B O   1 
ATOM   3698 C CB  . PRO B 1 224 ? 0.282   8.010   -7.174  1.00 34.07 ? 433  PRO B CB  1 
ATOM   3699 C CG  . PRO B 1 224 ? 1.423   8.832   -7.691  1.00 34.04 ? 433  PRO B CG  1 
ATOM   3700 C CD  . PRO B 1 224 ? 2.638   7.972   -7.606  1.00 33.80 ? 433  PRO B CD  1 
ATOM   3701 N N   . LYS B 1 225 ? 0.842   4.822   -7.360  1.00 32.75 ? 434  LYS B N   1 
ATOM   3702 C CA  . LYS B 1 225 ? 0.371   3.448   -7.606  1.00 32.62 ? 434  LYS B CA  1 
ATOM   3703 C C   . LYS B 1 225 ? 0.551   2.576   -6.366  1.00 32.13 ? 434  LYS B C   1 
ATOM   3704 O O   . LYS B 1 225 ? -0.336  1.807   -5.994  1.00 32.33 ? 434  LYS B O   1 
ATOM   3705 C CB  . LYS B 1 225 ? 1.125   2.809   -8.774  1.00 33.12 ? 434  LYS B CB  1 
ATOM   3706 C CG  . LYS B 1 225 ? 0.555   3.178   -10.149 1.00 34.76 ? 434  LYS B CG  1 
ATOM   3707 C CD  . LYS B 1 225 ? 1.367   2.525   -11.225 1.00 38.56 ? 434  LYS B CD  1 
ATOM   3708 C CE  . LYS B 1 225 ? 0.876   2.917   -12.610 1.00 42.26 ? 434  LYS B CE  1 
ATOM   3709 N NZ  . LYS B 1 225 ? 1.463   1.982   -13.620 1.00 44.69 ? 434  LYS B NZ  1 
ATOM   3710 N N   . LEU B 1 226 ? 1.710   2.720   -5.740  1.00 30.36 ? 435  LEU B N   1 
ATOM   3711 C CA  . LEU B 1 226 ? 2.043   2.021   -4.483  1.00 29.28 ? 435  LEU B CA  1 
ATOM   3712 C C   . LEU B 1 226 ? 1.214   2.440   -3.279  1.00 28.27 ? 435  LEU B C   1 
ATOM   3713 O O   . LEU B 1 226 ? 0.792   1.590   -2.490  1.00 27.64 ? 435  LEU B O   1 
ATOM   3714 C CB  . LEU B 1 226 ? 3.535   2.156   -4.205  1.00 28.78 ? 435  LEU B CB  1 
ATOM   3715 C CG  . LEU B 1 226 ? 4.389   1.341   -5.166  1.00 28.59 ? 435  LEU B CG  1 
ATOM   3716 C CD1 . LEU B 1 226 ? 5.874   1.533   -4.867  1.00 30.76 ? 435  LEU B CD1 1 
ATOM   3717 C CD2 . LEU B 1 226 ? 4.035   -0.152  -5.057  1.00 29.53 ? 435  LEU B CD2 1 
ATOM   3718 N N   . LEU B 1 227 ? 0.964   3.745   -3.139  1.00 27.30 ? 436  LEU B N   1 
ATOM   3719 C CA  . LEU B 1 227 ? 0.093   4.223   -2.080  1.00 26.66 ? 436  LEU B CA  1 
ATOM   3720 C C   . LEU B 1 227 ? -1.315  3.605   -2.233  1.00 26.49 ? 436  LEU B C   1 
ATOM   3721 O O   . LEU B 1 227 ? -1.947  3.254   -1.239  1.00 25.24 ? 436  LEU B O   1 
ATOM   3722 C CB  . LEU B 1 227 ? 0.031   5.776   -2.041  1.00 26.77 ? 436  LEU B CB  1 
ATOM   3723 C CG  . LEU B 1 227 ? 1.269   6.604   -1.626  1.00 29.71 ? 436  LEU B CG  1 
ATOM   3724 C CD1 . LEU B 1 227 ? 1.044   8.140   -1.751  1.00 30.17 ? 436  LEU B CD1 1 
ATOM   3725 C CD2 . LEU B 1 227 ? 1.741   6.250   -0.193  1.00 30.22 ? 436  LEU B CD2 1 
ATOM   3726 N N   . GLN B 1 228 ? -1.777  3.446   -3.476  1.00 25.98 ? 437  GLN B N   1 
ATOM   3727 C CA  . GLN B 1 228 ? -3.084  2.804   -3.739  1.00 26.11 ? 437  GLN B CA  1 
ATOM   3728 C C   . GLN B 1 228 ? -3.042  1.291   -3.428  1.00 24.71 ? 437  GLN B C   1 
ATOM   3729 O O   . GLN B 1 228 ? -4.022  0.727   -2.968  1.00 25.48 ? 437  GLN B O   1 
ATOM   3730 C CB  . GLN B 1 228 ? -3.546  3.065   -5.200  1.00 26.44 ? 437  GLN B CB  1 
ATOM   3731 C CG  . GLN B 1 228 ? -4.913  2.402   -5.574  1.00 27.54 ? 437  GLN B CG  1 
ATOM   3732 C CD  . GLN B 1 228 ? -6.038  2.815   -4.654  1.00 30.61 ? 437  GLN B CD  1 
ATOM   3733 O OE1 . GLN B 1 228 ? -6.753  1.972   -4.111  1.00 34.85 ? 437  GLN B OE1 1 
ATOM   3734 N NE2 . GLN B 1 228 ? -6.198  4.111   -4.458  1.00 31.28 ? 437  GLN B NE2 1 
ATOM   3735 N N   . LYS B 1 229 ? -1.897  0.655   -3.658  1.00 23.48 ? 438  LYS B N   1 
ATOM   3736 C CA  . LYS B 1 229 ? -1.684  -0.746  -3.316  1.00 22.96 ? 438  LYS B CA  1 
ATOM   3737 C C   . LYS B 1 229 ? -1.803  -0.982  -1.804  1.00 23.02 ? 438  LYS B C   1 
ATOM   3738 O O   . LYS B 1 229 ? -2.231  -2.056  -1.392  1.00 20.73 ? 438  LYS B O   1 
ATOM   3739 C CB  . LYS B 1 229 ? -0.305  -1.247  -3.807  1.00 23.62 ? 438  LYS B CB  1 
ATOM   3740 C CG  . LYS B 1 229 ? -0.190  -1.539  -5.320  1.00 25.64 ? 438  LYS B CG  1 
ATOM   3741 C CD  . LYS B 1 229 ? -1.390  -2.303  -5.927  1.00 24.85 ? 438  LYS B CD  1 
ATOM   3742 C CE  . LYS B 1 229 ? -1.049  -2.645  -7.412  1.00 28.66 ? 438  LYS B CE  1 
ATOM   3743 N NZ  . LYS B 1 229 ? -2.168  -3.327  -8.146  1.00 26.46 ? 438  LYS B NZ  1 
ATOM   3744 N N   . MET B 1 230 ? -1.427  0.020   -1.002  1.00 23.74 ? 439  MET B N   1 
ATOM   3745 C CA  . MET B 1 230 ? -1.537  -0.068  0.459   1.00 26.27 ? 439  MET B CA  1 
ATOM   3746 C C   . MET B 1 230 ? -3.020  -0.080  0.888   1.00 25.84 ? 439  MET B C   1 
ATOM   3747 O O   . MET B 1 230 ? -3.423  -0.840  1.765   1.00 25.98 ? 439  MET B O   1 
ATOM   3748 C CB  . MET B 1 230 ? -0.766  1.079   1.135   1.00 26.15 ? 439  MET B CB  1 
ATOM   3749 C CG  . MET B 1 230 ? 0.784   0.998   0.975   1.00 28.09 ? 439  MET B CG  1 
ATOM   3750 S SD  . MET B 1 230 ? 1.652   2.480   1.613   1.00 31.17 ? 439  MET B SD  1 
ATOM   3751 C CE  . MET B 1 230 ? 1.415   2.205   3.373   1.00 29.59 ? 439  MET B CE  1 
ATOM   3752 N N   . ALA B 1 231 ? -3.827  0.766   0.263   1.00 26.26 ? 440  ALA B N   1 
ATOM   3753 C CA  . ALA B 1 231 ? -5.286  0.704   0.508   1.00 26.79 ? 440  ALA B CA  1 
ATOM   3754 C C   . ALA B 1 231 ? -5.890  -0.596  -0.010  1.00 26.65 ? 440  ALA B C   1 
ATOM   3755 O O   . ALA B 1 231 ? -6.726  -1.179  0.647   1.00 28.31 ? 440  ALA B O   1 
ATOM   3756 C CB  . ALA B 1 231 ? -5.984  1.921   -0.074  1.00 26.76 ? 440  ALA B CB  1 
ATOM   3757 N N   . ASP B 1 232 ? -5.453  -1.072  -1.174  1.00 27.03 ? 441  ASP B N   1 
ATOM   3758 C CA  . ASP B 1 232 ? -5.880  -2.375  -1.666  1.00 27.55 ? 441  ASP B CA  1 
ATOM   3759 C C   . ASP B 1 232 ? -5.567  -3.497  -0.680  1.00 26.79 ? 441  ASP B C   1 
ATOM   3760 O O   . ASP B 1 232 ? -6.407  -4.358  -0.431  1.00 26.73 ? 441  ASP B O   1 
ATOM   3761 C CB  . ASP B 1 232 ? -5.239  -2.710  -3.014  1.00 28.57 ? 441  ASP B CB  1 
ATOM   3762 C CG  . ASP B 1 232 ? -5.599  -1.714  -4.100  1.00 31.13 ? 441  ASP B CG  1 
ATOM   3763 O OD1 . ASP B 1 232 ? -6.423  -0.804  -3.839  1.00 32.44 ? 441  ASP B OD1 1 
ATOM   3764 O OD2 . ASP B 1 232 ? -5.007  -1.813  -5.198  1.00 33.66 ? 441  ASP B OD2 1 
ATOM   3765 N N   . LEU B 1 233 ? -4.356  -3.487  -0.123  1.00 24.78 ? 442  LEU B N   1 
ATOM   3766 C CA  . LEU B 1 233 ? -3.977  -4.486  0.881   1.00 23.68 ? 442  LEU B CA  1 
ATOM   3767 C C   . LEU B 1 233 ? -4.837  -4.379  2.136   1.00 22.19 ? 442  LEU B C   1 
ATOM   3768 O O   . LEU B 1 233 ? -5.136  -5.353  2.747   1.00 22.50 ? 442  LEU B O   1 
ATOM   3769 C CB  . LEU B 1 233 ? -2.507  -4.308  1.297   1.00 22.30 ? 442  LEU B CB  1 
ATOM   3770 C CG  . LEU B 1 233 ? -1.500  -4.855  0.291   1.00 22.59 ? 442  LEU B CG  1 
ATOM   3771 C CD1 . LEU B 1 233 ? -0.129  -4.251  0.545   1.00 21.75 ? 442  LEU B CD1 1 
ATOM   3772 C CD2 . LEU B 1 233 ? -1.477  -6.385  0.338   1.00 21.12 ? 442  LEU B CD2 1 
ATOM   3773 N N   . ARG B 1 234 ? -5.146  -3.180  2.566   1.00 22.50 ? 443  ARG B N   1 
ATOM   3774 C CA  . ARG B 1 234 ? -5.967  -3.081  3.750   1.00 23.40 ? 443  ARG B CA  1 
ATOM   3775 C C   . ARG B 1 234 ? -7.333  -3.750  3.510   1.00 22.07 ? 443  ARG B C   1 
ATOM   3776 O O   . ARG B 1 234 ? -7.866  -4.401  4.393   1.00 21.59 ? 443  ARG B O   1 
ATOM   3777 C CB  . ARG B 1 234 ? -6.143  -1.637  4.160   1.00 23.47 ? 443  ARG B CB  1 
ATOM   3778 C CG  . ARG B 1 234 ? -6.855  -1.536  5.493   1.00 27.25 ? 443  ARG B CG  1 
ATOM   3779 C CD  . ARG B 1 234 ? -7.036  -0.120  5.897   1.00 34.60 ? 443  ARG B CD  1 
ATOM   3780 N NE  . ARG B 1 234 ? -5.729  0.498   6.072   1.00 39.61 ? 443  ARG B NE  1 
ATOM   3781 C CZ  . ARG B 1 234 ? -5.506  1.601   6.775   1.00 41.22 ? 443  ARG B CZ  1 
ATOM   3782 N NH1 . ARG B 1 234 ? -6.506  2.226   7.400   1.00 41.58 ? 443  ARG B NH1 1 
ATOM   3783 N NH2 . ARG B 1 234 ? -4.273  2.061   6.857   1.00 40.64 ? 443  ARG B NH2 1 
ATOM   3784 N N   . GLN B 1 235 ? -7.864  -3.622  2.298   1.00 23.57 ? 444  GLN B N   1 
ATOM   3785 C CA  . GLN B 1 235 ? -9.195  -4.228  1.988   1.00 23.73 ? 444  GLN B CA  1 
ATOM   3786 C C   . GLN B 1 235 ? -9.050  -5.749  1.779   1.00 23.61 ? 444  GLN B C   1 
ATOM   3787 O O   . GLN B 1 235 ? -9.913  -6.523  2.201   1.00 24.15 ? 444  GLN B O   1 
ATOM   3788 C CB  . GLN B 1 235 ? -9.822  -3.526  0.761   1.00 23.58 ? 444  GLN B CB  1 
ATOM   3789 C CG  . GLN B 1 235 ? -11.216 -4.062  0.342   1.00 24.59 ? 444  GLN B CG  1 
ATOM   3790 C CD  . GLN B 1 235 ? -12.287 -3.959  1.431   1.00 24.48 ? 444  GLN B CD  1 
ATOM   3791 O OE1 . GLN B 1 235 ? -13.204 -4.781  1.477   1.00 30.54 ? 444  GLN B OE1 1 
ATOM   3792 N NE2 . GLN B 1 235 ? -12.201 -2.947  2.277   1.00 21.76 ? 444  GLN B NE2 1 
ATOM   3793 N N   . LEU B 1 236 ? -7.955  -6.179  1.135   1.00 22.97 ? 445  LEU B N   1 
ATOM   3794 C CA  . LEU B 1 236 ? -7.622  -7.619  1.038   1.00 22.56 ? 445  LEU B CA  1 
ATOM   3795 C C   . LEU B 1 236 ? -7.618  -8.248  2.449   1.00 23.13 ? 445  LEU B C   1 
ATOM   3796 O O   . LEU B 1 236 ? -8.134  -9.342  2.687   1.00 23.31 ? 445  LEU B O   1 
ATOM   3797 C CB  . LEU B 1 236 ? -6.240  -7.826  0.348   1.00 21.86 ? 445  LEU B CB  1 
ATOM   3798 C CG  . LEU B 1 236 ? -5.774  -9.217  -0.083  1.00 23.61 ? 445  LEU B CG  1 
ATOM   3799 C CD1 . LEU B 1 236 ? -6.745  -9.825  -1.132  1.00 25.79 ? 445  LEU B CD1 1 
ATOM   3800 C CD2 . LEU B 1 236 ? -4.338  -9.220  -0.659  1.00 22.18 ? 445  LEU B CD2 1 
ATOM   3801 N N   . VAL B 1 237 ? -6.999  -7.549  3.388   1.00 24.16 ? 446  VAL B N   1 
ATOM   3802 C CA  . VAL B 1 237 ? -6.829  -8.104  4.721   1.00 23.15 ? 446  VAL B CA  1 
ATOM   3803 C C   . VAL B 1 237 ? -8.153  -8.042  5.488   1.00 23.63 ? 446  VAL B C   1 
ATOM   3804 O O   . VAL B 1 237 ? -8.512  -8.978  6.195   1.00 24.48 ? 446  VAL B O   1 
ATOM   3805 C CB  . VAL B 1 237 ? -5.675  -7.412  5.472   1.00 23.39 ? 446  VAL B CB  1 
ATOM   3806 C CG1 . VAL B 1 237 ? -5.674  -7.862  6.886   1.00 20.89 ? 446  VAL B CG1 1 
ATOM   3807 C CG2 . VAL B 1 237 ? -4.294  -7.752  4.774   1.00 20.55 ? 446  VAL B CG2 1 
ATOM   3808 N N   . THR B 1 238 ? -8.865  -6.944  5.350   1.00 24.97 ? 447  THR B N   1 
ATOM   3809 C CA  . THR B 1 238 ? -10.230 -6.849  5.906   1.00 25.90 ? 447  THR B CA  1 
ATOM   3810 C C   . THR B 1 238 ? -11.057 -8.065  5.489   1.00 25.34 ? 447  THR B C   1 
ATOM   3811 O O   . THR B 1 238 ? -11.643 -8.725  6.328   1.00 25.66 ? 447  THR B O   1 
ATOM   3812 C CB  . THR B 1 238 ? -10.915 -5.544  5.491   1.00 26.15 ? 447  THR B CB  1 
ATOM   3813 O OG1 . THR B 1 238 ? -10.154 -4.425  5.982   1.00 26.71 ? 447  THR B OG1 1 
ATOM   3814 C CG2 . THR B 1 238 ? -12.391 -5.471  6.071   1.00 26.50 ? 447  THR B CG2 1 
ATOM   3815 N N   . GLU B 1 239 ? -11.065 -8.375  4.198   1.00 25.72 ? 448  GLU B N   1 
ATOM   3816 C CA  . GLU B 1 239 ? -11.833 -9.492  3.670   1.00 27.19 ? 448  GLU B CA  1 
ATOM   3817 C C   . GLU B 1 239 ? -11.269 -10.836 4.125   1.00 27.38 ? 448  GLU B C   1 
ATOM   3818 O O   . GLU B 1 239 ? -12.028 -11.756 4.460   1.00 26.47 ? 448  GLU B O   1 
ATOM   3819 C CB  . GLU B 1 239 ? -11.933 -9.401  2.141   1.00 27.47 ? 448  GLU B CB  1 
ATOM   3820 C CG  . GLU B 1 239 ? -12.916 -8.315  1.673   1.00 28.79 ? 448  GLU B CG  1 
ATOM   3821 C CD  . GLU B 1 239 ? -12.981 -8.195  0.156   1.00 30.24 ? 448  GLU B CD  1 
ATOM   3822 O OE1 . GLU B 1 239 ? -12.858 -7.068  -0.378  1.00 33.07 ? 448  GLU B OE1 1 
ATOM   3823 O OE2 . GLU B 1 239 ? -13.169 -9.243  -0.503  1.00 36.72 ? 448  GLU B OE2 1 
ATOM   3824 N N   . HIS B 1 240 ? -9.932  -10.930 4.188   1.00 26.65 ? 449  HIS B N   1 
ATOM   3825 C CA  . HIS B 1 240 ? -9.285  -12.103 4.788   1.00 25.75 ? 449  HIS B CA  1 
ATOM   3826 C C   . HIS B 1 240 ? -9.693  -12.368 6.226   1.00 25.12 ? 449  HIS B C   1 
ATOM   3827 O O   . HIS B 1 240 ? -10.003 -13.508 6.577   1.00 25.60 ? 449  HIS B O   1 
ATOM   3828 C CB  . HIS B 1 240 ? -7.747  -11.995 4.733   1.00 25.00 ? 449  HIS B CB  1 
ATOM   3829 C CG  . HIS B 1 240 ? -7.064  -13.249 5.161   1.00 24.23 ? 449  HIS B CG  1 
ATOM   3830 N ND1 . HIS B 1 240 ? -7.113  -14.401 4.419   1.00 25.06 ? 449  HIS B ND1 1 
ATOM   3831 C CD2 . HIS B 1 240 ? -6.350  -13.546 6.270   1.00 24.17 ? 449  HIS B CD2 1 
ATOM   3832 C CE1 . HIS B 1 240 ? -6.436  -15.351 5.035   1.00 24.43 ? 449  HIS B CE1 1 
ATOM   3833 N NE2 . HIS B 1 240 ? -5.983  -14.863 6.175   1.00 24.68 ? 449  HIS B NE2 1 
ATOM   3834 N N   . ALA B 1 241 ? -9.682  -11.334 7.063   1.00 25.94 ? 450  ALA B N   1 
ATOM   3835 C CA  . ALA B 1 241 ? -10.073 -11.475 8.468   1.00 26.51 ? 450  ALA B CA  1 
ATOM   3836 C C   . ALA B 1 241 ? -11.538 -11.964 8.618   1.00 27.95 ? 450  ALA B C   1 
ATOM   3837 O O   . ALA B 1 241 ? -11.831 -12.880 9.398   1.00 28.63 ? 450  ALA B O   1 
ATOM   3838 C CB  . ALA B 1 241 ? -9.858  -10.170 9.200   1.00 26.51 ? 450  ALA B CB  1 
ATOM   3839 N N   . GLN B 1 242 ? -12.442 -11.389 7.840   1.00 28.92 ? 451  GLN B N   1 
ATOM   3840 C CA  . GLN B 1 242 ? -13.866 -11.828 7.887   1.00 30.55 ? 451  GLN B CA  1 
ATOM   3841 C C   . GLN B 1 242 ? -13.950 -13.332 7.605   1.00 30.96 ? 451  GLN B C   1 
ATOM   3842 O O   . GLN B 1 242 ? -14.663 -14.053 8.305   1.00 31.44 ? 451  GLN B O   1 
ATOM   3843 C CB  . GLN B 1 242 ? -14.724 -11.035 6.894   1.00 29.68 ? 451  GLN B CB  1 
ATOM   3844 C CG  . GLN B 1 242 ? -14.802 -9.538  7.175   1.00 31.01 ? 451  GLN B CG  1 
ATOM   3845 C CD  . GLN B 1 242 ? -15.154 -8.728  5.927   1.00 31.58 ? 451  GLN B CD  1 
ATOM   3846 O OE1 . GLN B 1 242 ? -15.239 -9.281  4.833   1.00 36.52 ? 451  GLN B OE1 1 
ATOM   3847 N NE2 . GLN B 1 242 ? -15.337 -7.411  6.083   1.00 29.98 ? 451  GLN B NE2 1 
ATOM   3848 N N   . MET B 1 243 ? -13.190 -13.813 6.618   1.00 31.86 ? 452  MET B N   1 
ATOM   3849 C CA  . MET B 1 243 ? -13.162 -15.246 6.266   1.00 32.99 ? 452  MET B CA  1 
ATOM   3850 C C   . MET B 1 243 ? -12.545 -16.166 7.317   1.00 32.27 ? 452  MET B C   1 
ATOM   3851 O O   . MET B 1 243 ? -12.991 -17.313 7.495   1.00 29.98 ? 452  MET B O   1 
ATOM   3852 C CB  . MET B 1 243 ? -12.426 -15.464 4.948   1.00 33.58 ? 452  MET B CB  1 
ATOM   3853 C CG  . MET B 1 243 ? -13.112 -14.803 3.738   1.00 36.04 ? 452  MET B CG  1 
ATOM   3854 S SD  . MET B 1 243 ? -12.203 -15.221 2.241   1.00 39.35 ? 452  MET B SD  1 
ATOM   3855 C CE  . MET B 1 243 ? -12.039 -13.642 1.432   1.00 35.66 ? 452  MET B CE  1 
ATOM   3856 N N   . MET B 1 244 ? -11.469 -15.697 7.951   1.00 31.25 ? 453  MET B N   1 
ATOM   3857 C CA  . MET B 1 244 ? -10.820 -16.428 9.043   1.00 31.66 ? 453  MET B CA  1 
ATOM   3858 C C   . MET B 1 244 ? -11.712 -16.442 10.282  1.00 33.30 ? 453  MET B C   1 
ATOM   3859 O O   . MET B 1 244 ? -11.857 -17.474 10.939  1.00 32.64 ? 453  MET B O   1 
ATOM   3860 C CB  . MET B 1 244 ? -9.478  -15.772 9.405   1.00 30.46 ? 453  MET B CB  1 
ATOM   3861 C CG  . MET B 1 244 ? -8.452  -15.868 8.304   1.00 26.47 ? 453  MET B CG  1 
ATOM   3862 S SD  . MET B 1 244 ? -8.019  -17.553 7.895   1.00 26.01 ? 453  MET B SD  1 
ATOM   3863 C CE  . MET B 1 244 ? -7.240  -17.992 9.440   1.00 27.11 ? 453  MET B CE  1 
ATOM   3864 N N   . GLN B 1 245 ? -12.275 -15.278 10.597  1.00 35.49 ? 454  GLN B N   1 
ATOM   3865 C CA  . GLN B 1 245 ? -13.253 -15.129 11.690  1.00 38.41 ? 454  GLN B CA  1 
ATOM   3866 C C   . GLN B 1 245 ? -14.425 -16.093 11.543  1.00 39.35 ? 454  GLN B C   1 
ATOM   3867 O O   . GLN B 1 245 ? -14.918 -16.626 12.525  1.00 39.93 ? 454  GLN B O   1 
ATOM   3868 C CB  . GLN B 1 245 ? -13.743 -13.675 11.799  1.00 37.61 ? 454  GLN B CB  1 
ATOM   3869 C CG  . GLN B 1 245 ? -12.774 -12.758 12.564  1.00 38.44 ? 454  GLN B CG  1 
ATOM   3870 C CD  . GLN B 1 245 ? -12.971 -11.261 12.270  1.00 39.58 ? 454  GLN B CD  1 
ATOM   3871 O OE1 . GLN B 1 245 ? -13.907 -10.848 11.548  1.00 40.84 ? 454  GLN B OE1 1 
ATOM   3872 N NE2 . GLN B 1 245 ? -12.085 -10.437 12.835  1.00 40.32 ? 454  GLN B NE2 1 
ATOM   3873 N N   . ARG B 1 246 ? -14.830 -16.337 10.307  1.00 41.50 ? 455  ARG B N   1 
ATOM   3874 C CA  . ARG B 1 246 ? -15.967 -17.180 10.003  1.00 43.32 ? 455  ARG B CA  1 
ATOM   3875 C C   . ARG B 1 246 ? -15.606 -18.672 10.089  1.00 44.79 ? 455  ARG B C   1 
ATOM   3876 O O   . ARG B 1 246 ? -16.377 -19.457 10.637  1.00 45.17 ? 455  ARG B O   1 
ATOM   3877 C CB  . ARG B 1 246 ? -16.505 -16.822 8.615   1.00 43.06 ? 455  ARG B CB  1 
ATOM   3878 C CG  . ARG B 1 246 ? -17.958 -17.231 8.352   1.00 44.45 ? 455  ARG B CG  1 
ATOM   3879 C CD  . ARG B 1 246 ? -18.400 -16.865 6.917   1.00 43.66 ? 455  ARG B CD  1 
ATOM   3880 N NE  . ARG B 1 246 ? -18.709 -15.437 6.781   1.00 45.31 ? 455  ARG B NE  1 
ATOM   3881 C CZ  . ARG B 1 246 ? -18.064 -14.585 5.979   1.00 46.16 ? 455  ARG B CZ  1 
ATOM   3882 N NH1 . ARG B 1 246 ? -17.057 -14.986 5.201   1.00 48.64 ? 455  ARG B NH1 1 
ATOM   3883 N NH2 . ARG B 1 246 ? -18.418 -13.311 5.957   1.00 45.28 ? 455  ARG B NH2 1 
ATOM   3884 N N   . ILE B 1 247 ? -14.464 -19.069 9.522   1.00 46.22 ? 456  ILE B N   1 
ATOM   3885 C CA  . ILE B 1 247 ? -13.941 -20.440 9.672   1.00 47.86 ? 456  ILE B CA  1 
ATOM   3886 C C   . ILE B 1 247 ? -13.892 -20.838 11.150  1.00 48.89 ? 456  ILE B C   1 
ATOM   3887 O O   . ILE B 1 247 ? -14.165 -21.982 11.500  1.00 49.03 ? 456  ILE B O   1 
ATOM   3888 C CB  . ILE B 1 247 ? -12.508 -20.599 9.041   1.00 48.05 ? 456  ILE B CB  1 
ATOM   3889 C CG1 . ILE B 1 247 ? -12.593 -20.692 7.524   1.00 48.22 ? 456  ILE B CG1 1 
ATOM   3890 C CG2 . ILE B 1 247 ? -11.751 -21.826 9.600   1.00 47.07 ? 456  ILE B CG2 1 
ATOM   3891 C CD1 . ILE B 1 247 ? -11.251 -20.837 6.865   1.00 48.18 ? 456  ILE B CD1 1 
ATOM   3892 N N   . LYS B 1 248 ? -13.543 -19.889 12.011  1.00 50.73 ? 457  LYS B N   1 
ATOM   3893 C CA  . LYS B 1 248 ? -13.522 -20.120 13.451  1.00 52.56 ? 457  LYS B CA  1 
ATOM   3894 C C   . LYS B 1 248 ? -14.883 -20.594 13.986  1.00 53.86 ? 457  LYS B C   1 
ATOM   3895 O O   . LYS B 1 248 ? -14.934 -21.400 14.920  1.00 53.98 ? 457  LYS B O   1 
ATOM   3896 C CB  . LYS B 1 248 ? -13.043 -18.866 14.194  1.00 52.73 ? 457  LYS B CB  1 
ATOM   3897 C CG  . LYS B 1 248 ? -12.991 -19.019 15.710  1.00 54.15 ? 457  LYS B CG  1 
ATOM   3898 C CD  . LYS B 1 248 ? -12.105 -17.960 16.353  1.00 56.75 ? 457  LYS B CD  1 
ATOM   3899 C CE  . LYS B 1 248 ? -12.183 -18.033 17.879  1.00 57.57 ? 457  LYS B CE  1 
ATOM   3900 N NZ  . LYS B 1 248 ? -13.514 -17.566 18.379  1.00 57.75 ? 457  LYS B NZ  1 
ATOM   3901 N N   . LYS B 1 249 ? -15.978 -20.114 13.396  1.00 55.18 ? 458  LYS B N   1 
ATOM   3902 C CA  . LYS B 1 249 ? -17.308 -20.581 13.812  1.00 56.43 ? 458  LYS B CA  1 
ATOM   3903 C C   . LYS B 1 249 ? -17.792 -21.787 13.007  1.00 57.02 ? 458  LYS B C   1 
ATOM   3904 O O   . LYS B 1 249 ? -17.953 -22.862 13.578  1.00 58.04 ? 458  LYS B O   1 
ATOM   3905 C CB  . LYS B 1 249 ? -18.350 -19.443 13.863  1.00 56.60 ? 458  LYS B CB  1 
ATOM   3906 C CG  . LYS B 1 249 ? -18.963 -19.023 12.520  1.00 57.73 ? 458  LYS B CG  1 
ATOM   3907 C CD  . LYS B 1 249 ? -20.488 -18.859 12.606  1.00 59.42 ? 458  LYS B CD  1 
ATOM   3908 C CE  . LYS B 1 249 ? -21.205 -20.211 12.782  1.00 59.98 ? 458  LYS B CE  1 
ATOM   3909 N NZ  . LYS B 1 249 ? -22.563 -20.255 12.165  1.00 59.16 ? 458  LYS B NZ  1 
ATOM   3910 N N   . THR B 1 250 ? -17.991 -21.624 11.694  1.00 57.56 ? 459  THR B N   1 
ATOM   3911 C CA  . THR B 1 250 ? -18.552 -22.678 10.826  1.00 57.67 ? 459  THR B CA  1 
ATOM   3912 C C   . THR B 1 250 ? -17.732 -23.976 10.778  1.00 57.50 ? 459  THR B C   1 
ATOM   3913 O O   . THR B 1 250 ? -18.293 -25.071 10.677  1.00 57.50 ? 459  THR B O   1 
ATOM   3914 C CB  . THR B 1 250 ? -18.785 -22.180 9.373   1.00 58.01 ? 459  THR B CB  1 
ATOM   3915 O OG1 . THR B 1 250 ? -17.532 -21.834 8.761   1.00 58.64 ? 459  THR B OG1 1 
ATOM   3916 C CG2 . THR B 1 250 ? -19.720 -20.970 9.351   1.00 58.62 ? 459  THR B CG2 1 
ATOM   3917 N N   . GLU B 1 251 ? -16.407 -23.850 10.843  1.00 57.43 ? 460  GLU B N   1 
ATOM   3918 C CA  . GLU B 1 251 ? -15.509 -25.008 10.767  1.00 57.02 ? 460  GLU B CA  1 
ATOM   3919 C C   . GLU B 1 251 ? -15.055 -25.405 12.162  1.00 56.73 ? 460  GLU B C   1 
ATOM   3920 O O   . GLU B 1 251 ? -13.948 -25.068 12.594  1.00 56.43 ? 460  GLU B O   1 
ATOM   3921 C CB  . GLU B 1 251 ? -14.303 -24.699 9.873   1.00 57.31 ? 460  GLU B CB  1 
ATOM   3922 C CG  . GLU B 1 251 ? -14.604 -24.683 8.389   1.00 57.35 ? 460  GLU B CG  1 
ATOM   3923 C CD  . GLU B 1 251 ? -14.762 -26.073 7.811   1.00 58.50 ? 460  GLU B CD  1 
ATOM   3924 O OE1 . GLU B 1 251 ? -13.968 -26.968 8.170   1.00 58.42 ? 460  GLU B OE1 1 
ATOM   3925 O OE2 . GLU B 1 251 ? -15.679 -26.267 6.984   1.00 59.44 ? 460  GLU B OE2 1 
ATOM   3926 N N   . THR B 1 252 ? -15.921 -26.138 12.854  1.00 56.40 ? 461  THR B N   1 
ATOM   3927 C CA  . THR B 1 252 ? -15.756 -26.426 14.289  1.00 56.07 ? 461  THR B CA  1 
ATOM   3928 C C   . THR B 1 252 ? -14.484 -27.230 14.614  1.00 55.24 ? 461  THR B C   1 
ATOM   3929 O O   . THR B 1 252 ? -13.810 -26.964 15.613  1.00 55.56 ? 461  THR B O   1 
ATOM   3930 C CB  . THR B 1 252 ? -17.054 -27.061 14.914  1.00 56.05 ? 461  THR B CB  1 
ATOM   3931 O OG1 . THR B 1 252 ? -16.706 -28.052 15.890  1.00 57.00 ? 461  THR B OG1 1 
ATOM   3932 C CG2 . THR B 1 252 ? -17.961 -27.702 13.839  1.00 56.46 ? 461  THR B CG2 1 
ATOM   3933 N N   . GLU B 1 253 ? -14.151 -28.174 13.739  1.00 54.13 ? 462  GLU B N   1 
ATOM   3934 C CA  . GLU B 1 253 ? -13.054 -29.110 13.962  1.00 52.60 ? 462  GLU B CA  1 
ATOM   3935 C C   . GLU B 1 253 ? -11.662 -28.521 13.708  1.00 51.41 ? 462  GLU B C   1 
ATOM   3936 O O   . GLU B 1 253 ? -10.679 -29.032 14.225  1.00 51.47 ? 462  GLU B O   1 
ATOM   3937 C CB  . GLU B 1 253 ? -13.260 -30.357 13.109  1.00 52.68 ? 462  GLU B CB  1 
ATOM   3938 N N   . THR B 1 254 ? -11.569 -27.457 12.914  1.00 50.00 ? 463  THR B N   1 
ATOM   3939 C CA  . THR B 1 254 ? -10.249 -27.007 12.455  1.00 48.05 ? 463  THR B CA  1 
ATOM   3940 C C   . THR B 1 254 ? -9.637  -25.973 13.387  1.00 46.26 ? 463  THR B C   1 
ATOM   3941 O O   . THR B 1 254 ? -10.273 -24.989 13.757  1.00 46.02 ? 463  THR B O   1 
ATOM   3942 C CB  . THR B 1 254 ? -10.263 -26.475 11.009  1.00 48.51 ? 463  THR B CB  1 
ATOM   3943 O OG1 . THR B 1 254 ? -10.202 -25.041 11.014  1.00 50.38 ? 463  THR B OG1 1 
ATOM   3944 C CG2 . THR B 1 254 ? -11.492 -26.940 10.262  1.00 47.80 ? 463  THR B CG2 1 
ATOM   3945 N N   . SER B 1 255 ? -8.389  -26.197 13.767  1.00 44.25 ? 464  SER B N   1 
ATOM   3946 C CA  . SER B 1 255 ? -7.774  -25.324 14.731  1.00 42.02 ? 464  SER B CA  1 
ATOM   3947 C C   . SER B 1 255 ? -7.149  -24.080 14.072  1.00 40.91 ? 464  SER B C   1 
ATOM   3948 O O   . SER B 1 255 ? -6.861  -24.074 12.862  1.00 40.78 ? 464  SER B O   1 
ATOM   3949 C CB  . SER B 1 255 ? -6.786  -26.106 15.590  1.00 42.67 ? 464  SER B CB  1 
ATOM   3950 O OG  . SER B 1 255 ? -5.587  -26.364 14.908  1.00 41.42 ? 464  SER B OG  1 
ATOM   3951 N N   . LEU B 1 256 ? -7.029  -23.011 14.863  1.00 38.38 ? 465  LEU B N   1 
ATOM   3952 C CA  . LEU B 1 256 ? -6.356  -21.772 14.469  1.00 36.47 ? 465  LEU B CA  1 
ATOM   3953 C C   . LEU B 1 256 ? -5.196  -21.556 15.425  1.00 34.38 ? 465  LEU B C   1 
ATOM   3954 O O   . LEU B 1 256 ? -5.371  -21.659 16.627  1.00 34.29 ? 465  LEU B O   1 
ATOM   3955 C CB  . LEU B 1 256 ? -7.333  -20.585 14.530  1.00 36.40 ? 465  LEU B CB  1 
ATOM   3956 C CG  . LEU B 1 256 ? -8.479  -20.801 13.523  1.00 39.05 ? 465  LEU B CG  1 
ATOM   3957 C CD1 . LEU B 1 256 ? -9.863  -20.440 14.070  1.00 41.83 ? 465  LEU B CD1 1 
ATOM   3958 C CD2 . LEU B 1 256 ? -8.205  -20.110 12.184  1.00 41.50 ? 465  LEU B CD2 1 
ATOM   3959 N N   . HIS B 1 257 ? -4.009  -21.303 14.898  1.00 31.67 ? 466  HIS B N   1 
ATOM   3960 C CA  . HIS B 1 257 ? -2.844  -21.001 15.740  1.00 30.52 ? 466  HIS B CA  1 
ATOM   3961 C C   . HIS B 1 257 ? -3.204  -19.901 16.766  1.00 28.93 ? 466  HIS B C   1 
ATOM   3962 O O   . HIS B 1 257 ? -3.923  -18.967 16.424  1.00 28.43 ? 466  HIS B O   1 
ATOM   3963 C CB  . HIS B 1 257 ? -1.664  -20.568 14.861  1.00 30.72 ? 466  HIS B CB  1 
ATOM   3964 C CG  . HIS B 1 257 ? -0.391  -20.409 15.612  1.00 30.24 ? 466  HIS B CG  1 
ATOM   3965 N ND1 . HIS B 1 257 ? 0.698   -21.232 15.418  1.00 34.10 ? 466  HIS B ND1 1 
ATOM   3966 C CD2 . HIS B 1 257 ? -0.027  -19.521 16.564  1.00 31.62 ? 466  HIS B CD2 1 
ATOM   3967 C CE1 . HIS B 1 257 ? 1.675   -20.864 16.230  1.00 30.93 ? 466  HIS B CE1 1 
ATOM   3968 N NE2 . HIS B 1 257 ? 1.263   -19.825 16.932  1.00 33.61 ? 466  HIS B NE2 1 
ATOM   3969 N N   . PRO B 1 258 ? -2.750  -20.023 18.039  1.00 28.33 ? 467  PRO B N   1 
ATOM   3970 C CA  . PRO B 1 258 ? -3.159  -18.991 19.017  1.00 28.10 ? 467  PRO B CA  1 
ATOM   3971 C C   . PRO B 1 258 ? -2.693  -17.576 18.708  1.00 27.20 ? 467  PRO B C   1 
ATOM   3972 O O   . PRO B 1 258 ? -3.318  -16.623 19.135  1.00 28.06 ? 467  PRO B O   1 
ATOM   3973 C CB  . PRO B 1 258 ? -2.539  -19.459 20.346  1.00 27.92 ? 467  PRO B CB  1 
ATOM   3974 C CG  . PRO B 1 258 ? -2.120  -20.862 20.137  1.00 29.09 ? 467  PRO B CG  1 
ATOM   3975 C CD  . PRO B 1 258 ? -1.879  -21.040 18.646  1.00 28.97 ? 467  PRO B CD  1 
ATOM   3976 N N   . LEU B 1 259 ? -1.598  -17.417 17.986  1.00 26.61 ? 468  LEU B N   1 
ATOM   3977 C CA  . LEU B 1 259 ? -1.163  -16.056 17.649  1.00 25.93 ? 468  LEU B CA  1 
ATOM   3978 C C   . LEU B 1 259 ? -2.085  -15.452 16.580  1.00 25.62 ? 468  LEU B C   1 
ATOM   3979 O O   . LEU B 1 259 ? -2.445  -14.285 16.634  1.00 24.18 ? 468  LEU B O   1 
ATOM   3980 C CB  . LEU B 1 259 ? 0.321   -16.069 17.225  1.00 25.47 ? 468  LEU B CB  1 
ATOM   3981 C CG  . LEU B 1 259 ? 0.970   -14.733 16.841  1.00 26.92 ? 468  LEU B CG  1 
ATOM   3982 C CD1 . LEU B 1 259 ? 1.008   -13.816 18.051  1.00 27.20 ? 468  LEU B CD1 1 
ATOM   3983 C CD2 . LEU B 1 259 ? 2.362   -14.978 16.253  1.00 27.18 ? 468  LEU B CD2 1 
ATOM   3984 N N   . LEU B 1 260 ? -2.467  -16.272 15.608  1.00 26.22 ? 469  LEU B N   1 
ATOM   3985 C CA  . LEU B 1 260 ? -3.455  -15.864 14.601  1.00 27.07 ? 469  LEU B CA  1 
ATOM   3986 C C   . LEU B 1 260 ? -4.812  -15.559 15.234  1.00 26.86 ? 469  LEU B C   1 
ATOM   3987 O O   . LEU B 1 260 ? -5.472  -14.583 14.878  1.00 27.81 ? 469  LEU B O   1 
ATOM   3988 C CB  . LEU B 1 260 ? -3.617  -16.978 13.570  1.00 26.56 ? 469  LEU B CB  1 
ATOM   3989 C CG  . LEU B 1 260 ? -2.761  -16.935 12.291  1.00 28.18 ? 469  LEU B CG  1 
ATOM   3990 C CD1 . LEU B 1 260 ? -1.627  -15.916 12.258  1.00 28.95 ? 469  LEU B CD1 1 
ATOM   3991 C CD2 . LEU B 1 260 ? -2.310  -18.291 11.866  1.00 26.38 ? 469  LEU B CD2 1 
ATOM   3992 N N   . GLN B 1 261 ? -5.236  -16.412 16.151  1.00 27.07 ? 470  GLN B N   1 
ATOM   3993 C CA  . GLN B 1 261 ? -6.441  -16.128 16.936  1.00 26.94 ? 470  GLN B CA  1 
ATOM   3994 C C   . GLN B 1 261 ? -6.335  -14.723 17.574  1.00 27.32 ? 470  GLN B C   1 
ATOM   3995 O O   . GLN B 1 261 ? -7.296  -13.967 17.550  1.00 26.89 ? 470  GLN B O   1 
ATOM   3996 C CB  . GLN B 1 261 ? -6.636  -17.207 18.010  1.00 27.23 ? 470  GLN B CB  1 
ATOM   3997 N N   . GLU B 1 262 ? -5.156  -14.369 18.109  1.00 27.10 ? 471  GLU B N   1 
ATOM   3998 C CA  . GLU B 1 262 ? -4.962  -13.062 18.769  1.00 28.02 ? 471  GLU B CA  1 
ATOM   3999 C C   . GLU B 1 262 ? -5.001  -11.936 17.751  1.00 26.93 ? 471  GLU B C   1 
ATOM   4000 O O   . GLU B 1 262 ? -5.564  -10.885 17.999  1.00 27.50 ? 471  GLU B O   1 
ATOM   4001 C CB  . GLU B 1 262 ? -3.624  -13.009 19.553  1.00 27.99 ? 471  GLU B CB  1 
ATOM   4002 C CG  . GLU B 1 262 ? -3.647  -13.738 20.877  1.00 31.50 ? 471  GLU B CG  1 
ATOM   4003 C CD  . GLU B 1 262 ? -4.914  -13.472 21.723  1.00 34.79 ? 471  GLU B CD  1 
ATOM   4004 O OE1 . GLU B 1 262 ? -5.626  -14.463 22.024  1.00 39.25 ? 471  GLU B OE1 1 
ATOM   4005 O OE2 . GLU B 1 262 ? -5.203  -12.301 22.082  1.00 34.34 ? 471  GLU B OE2 1 
ATOM   4006 N N   . ILE B 1 263 ? -4.374  -12.161 16.599  1.00 26.65 ? 472  ILE B N   1 
ATOM   4007 C CA  . ILE B 1 263 ? -4.362  -11.159 15.518  1.00 25.32 ? 472  ILE B CA  1 
ATOM   4008 C C   . ILE B 1 263 ? -5.777  -10.842 15.003  1.00 25.99 ? 472  ILE B C   1 
ATOM   4009 O O   . ILE B 1 263 ? -6.103  -9.676  14.781  1.00 25.25 ? 472  ILE B O   1 
ATOM   4010 C CB  . ILE B 1 263 ? -3.398  -11.562 14.384  1.00 24.84 ? 472  ILE B CB  1 
ATOM   4011 C CG1 . ILE B 1 263 ? -1.932  -11.374 14.832  1.00 24.42 ? 472  ILE B CG1 1 
ATOM   4012 C CG2 . ILE B 1 263 ? -3.654  -10.769 13.113  1.00 22.79 ? 472  ILE B CG2 1 
ATOM   4013 C CD1 . ILE B 1 263 ? -0.903  -11.878 13.815  1.00 24.43 ? 472  ILE B CD1 1 
ATOM   4014 N N   . TYR B 1 264 ? -6.597  -11.868 14.814  1.00 27.43 ? 473  TYR B N   1 
ATOM   4015 C CA  . TYR B 1 264 ? -7.967  -11.664 14.283  1.00 29.75 ? 473  TYR B CA  1 
ATOM   4016 C C   . TYR B 1 264 ? -9.012  -11.273 15.351  1.00 31.89 ? 473  TYR B C   1 
ATOM   4017 O O   . TYR B 1 264 ? -10.107 -10.794 15.013  1.00 32.33 ? 473  TYR B O   1 
ATOM   4018 C CB  . TYR B 1 264 ? -8.420  -12.891 13.473  1.00 30.10 ? 473  TYR B CB  1 
ATOM   4019 C CG  . TYR B 1 264 ? -7.523  -13.138 12.269  1.00 29.54 ? 473  TYR B CG  1 
ATOM   4020 C CD1 . TYR B 1 264 ? -7.336  -12.142 11.319  1.00 28.92 ? 473  TYR B CD1 1 
ATOM   4021 C CD2 . TYR B 1 264 ? -6.827  -14.343 12.104  1.00 30.76 ? 473  TYR B CD2 1 
ATOM   4022 C CE1 . TYR B 1 264 ? -6.506  -12.330 10.222  1.00 29.46 ? 473  TYR B CE1 1 
ATOM   4023 C CE2 . TYR B 1 264 ? -5.970  -14.537 10.989  1.00 28.55 ? 473  TYR B CE2 1 
ATOM   4024 C CZ  . TYR B 1 264 ? -5.827  -13.523 10.061  1.00 29.60 ? 473  TYR B CZ  1 
ATOM   4025 O OH  . TYR B 1 264 ? -4.998  -13.660 8.952   1.00 31.12 ? 473  TYR B OH  1 
ATOM   4026 N N   . LYS B 1 265 ? -8.672  -11.476 16.623  1.00 33.93 ? 474  LYS B N   1 
ATOM   4027 C CA  . LYS B 1 265 ? -9.530  -11.069 17.743  1.00 36.09 ? 474  LYS B CA  1 
ATOM   4028 C C   . LYS B 1 265 ? -9.886  -9.586  17.674  1.00 36.95 ? 474  LYS B C   1 
ATOM   4029 O O   . LYS B 1 265 ? -9.010  -8.696  17.782  1.00 37.33 ? 474  LYS B O   1 
ATOM   4030 C CB  . LYS B 1 265 ? -8.877  -11.424 19.097  1.00 36.06 ? 474  LYS B CB  1 
ATOM   4031 C CG  . LYS B 1 265 ? -9.811  -11.254 20.299  1.00 37.78 ? 474  LYS B CG  1 
ATOM   4032 C CD  . LYS B 1 265 ? -9.206  -11.731 21.631  1.00 37.55 ? 474  LYS B CD  1 
ATOM   4033 C CE  . LYS B 1 265 ? -8.063  -10.846 22.085  1.00 41.02 ? 474  LYS B CE  1 
ATOM   4034 N NZ  . LYS B 1 265 ? -7.386  -11.303 23.359  1.00 43.51 ? 474  LYS B NZ  1 
ATOM   4035 N N   . ASP B 1 266 ? -11.174 -9.316  17.474  1.00 38.28 ? 475  ASP B N   1 
ATOM   4036 C CA  . ASP B 1 266 ? -11.693 -7.941  17.410  1.00 39.94 ? 475  ASP B CA  1 
ATOM   4037 C C   . ASP B 1 266 ? -11.088 -7.111  16.267  1.00 39.52 ? 475  ASP B C   1 
ATOM   4038 O O   . ASP B 1 266 ? -10.936 -5.891  16.397  1.00 40.52 ? 475  ASP B O   1 
ATOM   4039 C CB  . ASP B 1 266 ? -11.440 -7.208  18.739  1.00 40.61 ? 475  ASP B CB  1 
ATOM   4040 C CG  . ASP B 1 266 ? -12.118 -7.872  19.928  1.00 43.78 ? 475  ASP B CG  1 
ATOM   4041 O OD1 . ASP B 1 266 ? -13.321 -8.264  19.823  1.00 45.97 ? 475  ASP B OD1 1 
ATOM   4042 O OD2 . ASP B 1 266 ? -11.447 -7.966  20.985  1.00 45.96 ? 475  ASP B OD2 1 
ATOM   4043 N N   . MET B 1 267 ? -10.733 -7.757  15.159  1.00 38.71 ? 476  MET B N   1 
ATOM   4044 C CA  . MET B 1 267 ? -10.111 -7.044  14.042  1.00 37.71 ? 476  MET B CA  1 
ATOM   4045 C C   . MET B 1 267 ? -11.174 -6.691  13.006  1.00 37.76 ? 476  MET B C   1 
ATOM   4046 O O   . MET B 1 267 ? -11.884 -7.588  12.535  1.00 37.75 ? 476  MET B O   1 
ATOM   4047 C CB  . MET B 1 267 ? -9.000  -7.901  13.408  1.00 37.75 ? 476  MET B CB  1 
ATOM   4048 C CG  . MET B 1 267 ? -8.207  -7.200  12.329  1.00 37.56 ? 476  MET B CG  1 
ATOM   4049 S SD  . MET B 1 267 ? -7.198  -8.295  11.303  1.00 36.09 ? 476  MET B SD  1 
ATOM   4050 C CE  . MET B 1 267 ? -6.058  -7.110  10.598  1.00 39.06 ? 476  MET B CE  1 
HETATM 4051 C C5  . B7G C 2 .   ? -3.451  -7.328  22.839  1.00 40.20 ? 1920 B7G A C5  1 
HETATM 4052 O O5  . B7G C 2 .   ? -2.938  -8.038  21.679  1.00 38.92 ? 1920 B7G A O5  1 
HETATM 4053 C C1  . B7G C 2 .   ? -3.768  -8.150  20.500  1.00 37.59 ? 1920 B7G A C1  1 
HETATM 4054 C C2  . B7G C 2 .   ? -5.189  -8.626  20.856  1.00 39.39 ? 1920 B7G A C2  1 
HETATM 4055 C C3  . B7G C 2 .   ? -5.785  -7.649  21.860  1.00 39.59 ? 1920 B7G A C3  1 
HETATM 4056 C C4  . B7G C 2 .   ? -4.945  -7.582  23.130  1.00 39.68 ? 1920 B7G A C4  1 
HETATM 4057 C C6  . B7G C 2 .   ? -2.614  -7.729  24.058  1.00 40.22 ? 1920 B7G A C6  1 
HETATM 4058 O O1  . B7G C 2 .   ? -3.215  -9.137  19.637  1.00 36.31 ? 1920 B7G A O1  1 
HETATM 4059 C C7  . B7G C 2 .   ? -2.061  -8.732  18.898  1.00 33.46 ? 1920 B7G A C7  1 
HETATM 4060 C C8  . B7G C 2 .   ? -1.375  -10.010 18.434  1.00 34.61 ? 1920 B7G A C8  1 
HETATM 4061 C C9  . B7G C 2 .   ? -0.353  -9.662  17.366  1.00 34.67 ? 1920 B7G A C9  1 
HETATM 4062 C C10 . B7G C 2 .   ? 0.995   -9.840  18.015  1.00 34.65 ? 1920 B7G A C10 1 
HETATM 4063 C C11 . B7G C 2 .   ? 2.123   -9.830  17.001  1.00 35.78 ? 1920 B7G A C11 1 
HETATM 4064 C C12 . B7G C 2 .   ? 3.427   -9.599  17.747  1.00 35.90 ? 1920 B7G A C12 1 
HETATM 4065 O O2  . B7G C 2 .   ? -6.044  -8.682  19.701  1.00 38.29 ? 1920 B7G A O2  1 
HETATM 4066 O O3  . B7G C 2 .   ? -7.125  -8.025  22.191  1.00 41.29 ? 1920 B7G A O3  1 
HETATM 4067 O O4  . B7G C 2 .   ? -5.489  -6.511  23.903  1.00 39.37 ? 1920 B7G A O4  1 
HETATM 4068 O O6  . B7G C 2 .   ? -1.255  -7.321  23.858  1.00 39.30 ? 1920 B7G A O6  1 
HETATM 4069 C C13 . B7G C 2 .   ? 3.679   -10.661 18.793  1.00 37.78 ? 1920 B7G A C13 1 
HETATM 4070 O O2  . VCA D 3 .   ? -2.029  5.638   37.475  1.00 20.00 ? 1001 VCA A O2  1 
HETATM 4071 C C1  . VCA D 3 .   ? -3.124  6.118   37.840  1.00 20.00 ? 1001 VCA A C1  1 
HETATM 4072 O O1  . VCA D 3 .   ? -4.176  5.476   38.047  1.00 20.00 ? 1001 VCA A O1  1 
HETATM 4073 C C2  . VCA D 3 .   ? -3.182  7.632   38.051  1.00 20.00 ? 1001 VCA A C2  1 
HETATM 4074 C C3  . VCA D 3 .   ? -4.002  7.981   39.295  1.00 20.00 ? 1001 VCA A C3  1 
HETATM 4075 C C4  . VCA D 3 .   ? -3.537  7.169   40.505  1.00 20.00 ? 1001 VCA A C4  1 
HETATM 4076 C C5  . VCA D 3 .   ? -4.516  7.313   41.671  1.00 20.00 ? 1001 VCA A C5  1 
HETATM 4077 C C6  . VCA D 3 .   ? -3.794  7.772   42.940  1.00 20.00 ? 1001 VCA A C6  1 
HETATM 4078 C C7  . VCA D 3 .   ? -3.173  6.584   43.677  1.00 20.00 ? 1001 VCA A C7  1 
HETATM 4079 C C8  . VCA D 3 .   ? -1.651  6.722   43.756  1.00 20.00 ? 1001 VCA A C8  1 
HETATM 4080 C C9  . VCA D 3 .   ? -1.254  7.912   44.633  1.00 20.00 ? 1001 VCA A C9  1 
HETATM 4081 C C10 . VCA D 3 .   ? 0.231   7.850   44.999  1.00 20.00 ? 1001 VCA A C10 1 
HETATM 4082 C C11 . VCA D 3 .   ? 1.027   7.905   43.861  1.00 20.00 ? 1001 VCA A C11 1 
HETATM 4083 C C12 . VCA D 3 .   ? 1.953   8.931   43.710  1.00 20.00 ? 1001 VCA A C12 1 
HETATM 4084 C C13 . VCA D 3 .   ? 2.082   9.902   44.697  1.00 20.00 ? 1001 VCA A C13 1 
HETATM 4085 C C14 . VCA D 3 .   ? 2.090   11.305  44.087  1.00 20.00 ? 1001 VCA A C14 1 
HETATM 4086 C C15 . VCA D 3 .   ? 1.296   12.284  44.955  1.00 20.00 ? 1001 VCA A C15 1 
HETATM 4087 C C16 . VCA D 3 .   ? 1.625   13.732  44.588  1.00 20.00 ? 1001 VCA A C16 1 
HETATM 4088 C C17 . VCA D 3 .   ? 0.562   14.690  45.132  1.00 20.00 ? 1001 VCA A C17 1 
HETATM 4089 C C18 . VCA D 3 .   ? 0.846   16.129  44.695  1.00 20.00 ? 1001 VCA A C18 1 
HETATM 4090 C C5  . B7G E 2 .   ? -3.464  -3.161  23.318  1.00 40.12 ? 920  B7G B C5  1 
HETATM 4091 O O5  . B7G E 2 .   ? -2.992  -2.275  24.365  1.00 40.00 ? 920  B7G B O5  1 
HETATM 4092 C C1  . B7G E 2 .   ? -3.765  -2.290  25.580  1.00 38.91 ? 920  B7G B C1  1 
HETATM 4093 C C2  . B7G E 2 .   ? -5.209  -1.880  25.257  1.00 39.49 ? 920  B7G B C2  1 
HETATM 4094 C C3  . B7G E 2 .   ? -5.811  -2.894  24.282  1.00 40.34 ? 920  B7G B C3  1 
HETATM 4095 C C4  . B7G E 2 .   ? -4.954  -2.996  23.016  1.00 40.72 ? 920  B7G B C4  1 
HETATM 4096 C C6  . B7G E 2 .   ? -2.694  -2.870  22.033  1.00 40.10 ? 920  B7G B C6  1 
HETATM 4097 O O1  . B7G E 2 .   ? -3.214  -1.361  26.513  1.00 37.59 ? 920  B7G B O1  1 
HETATM 4098 C C7  . B7G E 2 .   ? -2.093  -1.863  27.226  1.00 36.46 ? 920  B7G B C7  1 
HETATM 4099 C C8  . B7G E 2 .   ? -1.451  -0.723  27.993  1.00 37.42 ? 920  B7G B C8  1 
HETATM 4100 C C9  . B7G E 2 .   ? -0.292  -1.279  28.810  1.00 35.42 ? 920  B7G B C9  1 
HETATM 4101 C C10 . B7G E 2 .   ? 0.979   -0.576  28.387  1.00 36.76 ? 920  B7G B C10 1 
HETATM 4102 C C11 . B7G E 2 .   ? 2.204   -1.316  28.881  1.00 37.45 ? 920  B7G B C11 1 
HETATM 4103 C C12 . B7G E 2 .   ? 3.441   -0.453  28.693  1.00 38.85 ? 920  B7G B C12 1 
HETATM 4104 O O2  . B7G E 2 .   ? -6.007  -1.846  26.434  1.00 37.02 ? 920  B7G B O2  1 
HETATM 4105 O O3  . B7G E 2 .   ? -7.137  -2.495  23.945  1.00 41.54 ? 920  B7G B O3  1 
HETATM 4106 O O4  . B7G E 2 .   ? -5.369  -4.120  22.235  1.00 41.25 ? 920  B7G B O4  1 
HETATM 4107 O O6  . B7G E 2 .   ? -1.310  -3.135  22.249  1.00 37.78 ? 920  B7G B O6  1 
HETATM 4108 C C13 . B7G E 2 .   ? 3.888   -0.494  27.254  1.00 41.06 ? 920  B7G B C13 1 
HETATM 4109 O O2  . VCA F 3 .   ? -2.079  -16.178 8.638   1.00 20.00 ? 2001 VCA B O2  1 
HETATM 4110 C C1  . VCA F 3 .   ? -3.182  -16.685 8.341   1.00 20.00 ? 2001 VCA B C1  1 
HETATM 4111 O O1  . VCA F 3 .   ? -4.279  -16.087 8.304   1.00 20.00 ? 2001 VCA B O1  1 
HETATM 4112 C C2  . VCA F 3 .   ? -3.191  -18.174 7.990   1.00 20.00 ? 2001 VCA B C2  1 
HETATM 4113 C C3  . VCA F 3 .   ? -4.052  -18.441 6.754   1.00 20.00 ? 2001 VCA B C3  1 
HETATM 4114 C C4  . VCA F 3 .   ? -3.345  -17.971 5.481   1.00 20.00 ? 2001 VCA B C4  1 
HETATM 4115 C C5  . VCA F 3 .   ? -3.847  -18.742 4.258   1.00 20.00 ? 2001 VCA B C5  1 
HETATM 4116 C C6  . VCA F 3 .   ? -4.709  -17.849 3.363   1.00 20.00 ? 2001 VCA B C6  1 
HETATM 4117 C C7  . VCA F 3 .   ? -3.843  -16.864 2.575   1.00 20.00 ? 2001 VCA B C7  1 
HETATM 4118 C C8  . VCA F 3 .   ? -2.522  -17.511 2.153   1.00 20.00 ? 2001 VCA B C8  1 
HETATM 4119 C C9  . VCA F 3 .   ? -1.328  -16.705 2.669   1.00 20.00 ? 2001 VCA B C9  1 
HETATM 4120 C C10 . VCA F 3 .   ? -0.022  -17.482 2.487   1.00 20.00 ? 2001 VCA B C10 1 
HETATM 4121 C C11 . VCA F 3 .   ? 0.029   -18.577 3.342   1.00 20.00 ? 2001 VCA B C11 1 
HETATM 4122 C C12 . VCA F 3 .   ? 1.023   -19.536 3.186   1.00 20.00 ? 2001 VCA B C12 1 
HETATM 4123 C C13 . VCA F 3 .   ? 1.967   -19.400 2.175   1.00 20.00 ? 2001 VCA B C13 1 
HETATM 4124 C C14 . VCA F 3 .   ? 2.009   -20.648 1.292   1.00 20.00 ? 2001 VCA B C14 1 
HETATM 4125 C C15 . VCA F 3 .   ? 1.854   -21.919 2.130   1.00 20.00 ? 2001 VCA B C15 1 
HETATM 4126 C C16 . VCA F 3 .   ? 2.011   -23.170 1.264   1.00 20.00 ? 2001 VCA B C16 1 
HETATM 4127 C C17 . VCA F 3 .   ? 0.766   -24.056 1.350   1.00 20.00 ? 2001 VCA B C17 1 
HETATM 4128 C C18 . VCA F 3 .   ? 1.146   -25.538 1.342   1.00 20.00 ? 2001 VCA B C18 1 
HETATM 4129 O O   . HOH G 4 .   ? -8.501  1.034   45.145  1.00 23.08 ? 1921 HOH A O   1 
HETATM 4130 O O   . HOH G 4 .   ? 6.521   -1.903  49.807  1.00 17.41 ? 1922 HOH A O   1 
HETATM 4131 O O   . HOH G 4 .   ? 3.325   2.341   57.646  1.00 22.35 ? 1923 HOH A O   1 
HETATM 4132 O O   . HOH G 4 .   ? 6.207   -4.802  54.089  1.00 26.55 ? 1924 HOH A O   1 
HETATM 4133 O O   . HOH G 4 .   ? 15.906  -11.057 46.300  1.00 25.14 ? 1925 HOH A O   1 
HETATM 4134 O O   . HOH G 4 .   ? -2.505  -10.626 41.256  1.00 33.71 ? 1926 HOH A O   1 
HETATM 4135 O O   . HOH G 4 .   ? 2.861   -21.172 41.072  1.00 37.26 ? 1927 HOH A O   1 
HETATM 4136 O O   . HOH G 4 .   ? 0.505   -9.298  35.216  1.00 19.94 ? 1928 HOH A O   1 
HETATM 4137 O O   . HOH G 4 .   ? 17.989  -15.448 48.829  1.00 38.32 ? 1929 HOH A O   1 
HETATM 4138 O O   . HOH G 4 .   ? -16.934 2.419   36.753  1.00 31.61 ? 1930 HOH A O   1 
HETATM 4139 O O   . HOH G 4 .   ? -2.254  -4.749  53.103  1.00 31.49 ? 1931 HOH A O   1 
HETATM 4140 O O   . HOH G 4 .   ? 10.067  1.664   29.620  1.00 27.76 ? 1932 HOH A O   1 
HETATM 4141 O O   . HOH G 4 .   ? 6.479   -2.545  52.457  1.00 26.73 ? 1933 HOH A O   1 
HETATM 4142 O O   . HOH G 4 .   ? -2.169  -11.562 54.066  1.00 28.20 ? 1934 HOH A O   1 
HETATM 4143 O O   . HOH G 4 .   ? 15.108  -2.624  52.156  1.00 35.26 ? 1935 HOH A O   1 
HETATM 4144 O O   . HOH G 4 .   ? 16.064  -4.326  33.637  1.00 34.77 ? 1936 HOH A O   1 
HETATM 4145 O O   . HOH G 4 .   ? 3.983   -15.666 24.670  1.00 30.42 ? 1937 HOH A O   1 
HETATM 4146 O O   . HOH G 4 .   ? -1.438  13.437  57.643  1.00 35.42 ? 1938 HOH A O   1 
HETATM 4147 O O   . HOH G 4 .   ? 5.344   10.721  33.941  1.00 30.98 ? 1939 HOH A O   1 
HETATM 4148 O O   . HOH G 4 .   ? -10.663 0.580   46.905  1.00 26.74 ? 1940 HOH A O   1 
HETATM 4149 O O   . HOH G 4 .   ? -2.967  24.621  55.989  1.00 36.79 ? 1941 HOH A O   1 
HETATM 4150 O O   . HOH G 4 .   ? 9.490   -0.306  46.911  1.00 40.76 ? 1942 HOH A O   1 
HETATM 4151 O O   . HOH G 4 .   ? 16.887  -5.523  50.884  1.00 30.03 ? 1943 HOH A O   1 
HETATM 4152 O O   . HOH G 4 .   ? 14.944  -13.450 29.747  1.00 42.69 ? 1944 HOH A O   1 
HETATM 4153 O O   . HOH G 4 .   ? 17.950  1.823   43.408  1.00 27.93 ? 1945 HOH A O   1 
HETATM 4154 O O   . HOH G 4 .   ? 6.361   11.894  43.148  1.00 34.57 ? 1946 HOH A O   1 
HETATM 4155 O O   . HOH G 4 .   ? -5.105  2.995   57.768  1.00 37.19 ? 1947 HOH A O   1 
HETATM 4156 O O   . HOH G 4 .   ? 2.953   4.506   59.961  1.00 43.02 ? 1948 HOH A O   1 
HETATM 4157 O O   . HOH G 4 .   ? 7.469   -11.117 20.217  1.00 27.93 ? 1949 HOH A O   1 
HETATM 4158 O O   . HOH G 4 .   ? -1.688  18.140  56.842  1.00 39.84 ? 1950 HOH A O   1 
HETATM 4159 O O   . HOH G 4 .   ? 22.694  -10.853 40.189  1.00 33.89 ? 1951 HOH A O   1 
HETATM 4160 O O   . HOH G 4 .   ? -9.132  -9.520  48.735  1.00 41.69 ? 1952 HOH A O   1 
HETATM 4161 O O   . HOH G 4 .   ? 11.166  -22.780 47.285  1.00 36.76 ? 1953 HOH A O   1 
HETATM 4162 O O   . HOH G 4 .   ? -2.253  -11.685 25.366  1.00 29.80 ? 1954 HOH A O   1 
HETATM 4163 O O   . HOH G 4 .   ? -4.188  -9.702  53.756  1.00 36.40 ? 1955 HOH A O   1 
HETATM 4164 O O   . HOH G 4 .   ? 4.241   -23.554 49.495  1.00 41.69 ? 1956 HOH A O   1 
HETATM 4165 O O   . HOH G 4 .   ? -0.784  -17.238 38.051  1.00 38.93 ? 1957 HOH A O   1 
HETATM 4166 O O   . HOH G 4 .   ? 8.697   5.380   40.918  1.00 38.31 ? 1958 HOH A O   1 
HETATM 4167 O O   . HOH G 4 .   ? 9.519   9.640   46.436  1.00 46.08 ? 1959 HOH A O   1 
HETATM 4168 O O   . HOH G 4 .   ? 11.253  -26.722 44.232  1.00 57.55 ? 1960 HOH A O   1 
HETATM 4169 O O   . HOH G 4 .   ? -8.896  -14.502 29.150  1.00 40.52 ? 1961 HOH A O   1 
HETATM 4170 O O   . HOH G 4 .   ? -14.705 0.904   42.619  1.00 35.64 ? 1962 HOH A O   1 
HETATM 4171 O O   . HOH G 4 .   ? 19.692  -14.022 47.209  1.00 29.42 ? 1963 HOH A O   1 
HETATM 4172 O O   . HOH G 4 .   ? 18.409  -23.539 45.421  1.00 58.58 ? 1964 HOH A O   1 
HETATM 4173 O O   . HOH G 4 .   ? 11.650  5.141   41.580  1.00 39.87 ? 1965 HOH A O   1 
HETATM 4174 O O   . HOH G 4 .   ? 13.284  -11.444 30.531  1.00 34.43 ? 1966 HOH A O   1 
HETATM 4175 O O   . HOH G 4 .   ? 7.420   -2.270  57.032  1.00 35.36 ? 1967 HOH A O   1 
HETATM 4176 O O   . HOH G 4 .   ? 13.911  2.101   34.921  1.00 32.44 ? 1968 HOH A O   1 
HETATM 4177 O O   . HOH G 4 .   ? 16.427  -14.040 38.225  1.00 61.56 ? 1969 HOH A O   1 
HETATM 4178 O O   . HOH G 4 .   ? 2.295   -0.373  59.272  1.00 36.21 ? 1970 HOH A O   1 
HETATM 4179 O O   . HOH G 4 .   ? 10.459  3.744   43.088  1.00 59.05 ? 1971 HOH A O   1 
HETATM 4180 O O   . HOH G 4 .   ? 9.838   8.204   44.373  1.00 44.43 ? 1972 HOH A O   1 
HETATM 4181 O O   . HOH G 4 .   ? 12.403  -7.264  25.777  1.00 31.81 ? 1973 HOH A O   1 
HETATM 4182 O O   . HOH G 4 .   ? -5.636  10.024  52.023  1.00 36.53 ? 1974 HOH A O   1 
HETATM 4183 O O   . HOH G 4 .   ? -4.831  6.579   24.835  1.00 33.44 ? 1975 HOH A O   1 
HETATM 4184 O O   . HOH G 4 .   ? 8.450   21.560  55.304  1.00 35.89 ? 1976 HOH A O   1 
HETATM 4185 O O   . HOH G 4 .   ? 5.285   -26.310 38.937  1.00 38.93 ? 1977 HOH A O   1 
HETATM 4186 O O   . HOH G 4 .   ? 18.421  -11.278 46.998  1.00 32.93 ? 1978 HOH A O   1 
HETATM 4187 O O   . HOH G 4 .   ? 12.282  5.498   32.780  1.00 41.94 ? 1979 HOH A O   1 
HETATM 4188 O O   . HOH G 4 .   ? 5.874   22.888  54.678  1.00 37.52 ? 1980 HOH A O   1 
HETATM 4189 O O   . HOH G 4 .   ? 5.924   2.178   29.890  1.00 41.07 ? 1981 HOH A O   1 
HETATM 4190 O O   . HOH G 4 .   ? 0.583   26.905  53.968  1.00 41.83 ? 1982 HOH A O   1 
HETATM 4191 O O   . HOH G 4 .   ? -4.582  0.288   57.252  1.00 39.37 ? 1983 HOH A O   1 
HETATM 4192 O O   . HOH G 4 .   ? 19.630  1.565   45.614  1.00 35.05 ? 1984 HOH A O   1 
HETATM 4193 O O   . HOH G 4 .   ? 12.273  -22.695 50.808  1.00 40.63 ? 1985 HOH A O   1 
HETATM 4194 O O   . HOH G 4 .   ? 2.471   -24.334 33.586  1.00 35.80 ? 1986 HOH A O   1 
HETATM 4195 O O   . HOH G 4 .   ? 9.901   2.285   46.313  1.00 45.38 ? 1987 HOH A O   1 
HETATM 4196 O O   . HOH G 4 .   ? 17.072  -10.858 57.268  1.00 57.29 ? 1988 HOH A O   1 
HETATM 4197 O O   . HOH G 4 .   ? -2.540  -17.596 52.211  1.00 39.97 ? 1989 HOH A O   1 
HETATM 4198 O O   . HOH G 4 .   ? -3.463  4.538   59.319  1.00 39.90 ? 1990 HOH A O   1 
HETATM 4199 O O   . HOH G 4 .   ? 16.485  2.227   55.923  1.00 39.27 ? 1991 HOH A O   1 
HETATM 4200 O O   . HOH G 4 .   ? -2.479  8.346   63.310  1.00 59.36 ? 1992 HOH A O   1 
HETATM 4201 O O   . HOH G 4 .   ? 12.841  21.273  53.276  1.00 51.23 ? 1993 HOH A O   1 
HETATM 4202 O O   . HOH G 4 .   ? 22.404  -13.614 40.429  1.00 49.36 ? 1994 HOH A O   1 
HETATM 4203 O O   . HOH G 4 .   ? 16.413  -17.613 63.460  1.00 55.30 ? 1995 HOH A O   1 
HETATM 4204 O O   . HOH G 4 .   ? -6.232  -16.636 28.732  1.00 30.96 ? 1996 HOH A O   1 
HETATM 4205 O O   . HOH G 4 .   ? 9.239   -24.124 39.142  1.00 36.37 ? 1997 HOH A O   1 
HETATM 4206 O O   . HOH G 4 .   ? -1.290  -10.550 56.529  1.00 42.05 ? 1998 HOH A O   1 
HETATM 4207 O O   . HOH G 4 .   ? -9.936  21.095  36.604  1.00 42.73 ? 1999 HOH A O   1 
HETATM 4208 O O   . HOH G 4 .   ? 15.481  -20.618 52.655  1.00 43.47 ? 2000 HOH A O   1 
HETATM 4209 O O   . HOH G 4 .   ? 19.752  -7.912  37.249  1.00 39.06 ? 2001 HOH A O   1 
HETATM 4210 O O   . HOH G 4 .   ? -2.294  -3.908  37.818  1.00 27.72 ? 2002 HOH A O   1 
HETATM 4211 O O   . HOH G 4 .   ? -5.989  -9.866  36.626  1.00 25.37 ? 2003 HOH A O   1 
HETATM 4212 O O   . HOH G 4 .   ? -2.486  -1.978  35.849  1.00 20.63 ? 2004 HOH A O   1 
HETATM 4213 O O   . HOH G 4 .   ? -8.761  -7.435  20.599  1.00 35.97 ? 2005 HOH A O   1 
HETATM 4214 O O   . HOH G 4 .   ? -5.619  21.736  37.230  1.00 35.79 ? 2006 HOH A O   1 
HETATM 4215 O O   . HOH G 4 .   ? -8.250  -5.781  36.973  1.00 40.04 ? 2007 HOH A O   1 
HETATM 4216 O O   . HOH G 4 .   ? 17.542  -1.551  49.014  1.00 39.56 ? 2008 HOH A O   1 
HETATM 4217 O O   . HOH G 4 .   ? 5.271   4.996   30.826  1.00 34.80 ? 2009 HOH A O   1 
HETATM 4218 O O   . HOH G 4 .   ? -14.197 -1.186  49.399  1.00 51.09 ? 2010 HOH A O   1 
HETATM 4219 O O   . HOH G 4 .   ? 3.492   -23.638 52.763  1.00 50.04 ? 2011 HOH A O   1 
HETATM 4220 O O   . HOH G 4 .   ? -5.005  -6.241  38.209  1.00 26.60 ? 2012 HOH A O   1 
HETATM 4221 O O   . HOH G 4 .   ? 4.862   3.085   43.372  1.00 36.74 ? 2013 HOH A O   1 
HETATM 4222 O O   . HOH G 4 .   ? -7.812  -10.169 52.119  1.00 50.70 ? 2014 HOH A O   1 
HETATM 4223 O O   . HOH G 4 .   ? -6.965  -7.617  37.269  1.00 32.92 ? 2015 HOH A O   1 
HETATM 4224 O O   . HOH G 4 .   ? 14.609  -7.822  56.932  1.00 43.48 ? 2016 HOH A O   1 
HETATM 4225 O O   . HOH G 4 .   ? -14.934 -4.574  37.570  1.00 34.37 ? 2017 HOH A O   1 
HETATM 4226 O O   . HOH G 4 .   ? 16.390  -25.387 42.845  1.00 60.53 ? 2018 HOH A O   1 
HETATM 4227 O O   . HOH G 4 .   ? 15.170  -6.819  26.440  1.00 55.71 ? 2019 HOH A O   1 
HETATM 4228 O O   . HOH G 4 .   ? 19.950  -9.757  48.726  1.00 43.19 ? 2020 HOH A O   1 
HETATM 4229 O O   . HOH G 4 .   ? 14.286  26.081  45.676  1.00 53.71 ? 2021 HOH A O   1 
HETATM 4230 O O   . HOH G 4 .   ? 19.989  -21.709 46.392  1.00 59.80 ? 2022 HOH A O   1 
HETATM 4231 O O   . HOH G 4 .   ? 23.734  -16.392 44.525  1.00 45.53 ? 2023 HOH A O   1 
HETATM 4232 O O   . HOH G 4 .   ? -3.251  12.066  59.040  1.00 52.95 ? 2024 HOH A O   1 
HETATM 4233 O O   . HOH G 4 .   ? -2.945  -14.533 44.448  1.00 51.94 ? 2025 HOH A O   1 
HETATM 4234 O O   . HOH G 4 .   ? -8.024  -15.318 36.851  1.00 59.22 ? 2026 HOH A O   1 
HETATM 4235 O O   . HOH G 4 .   ? 23.318  -14.368 52.094  1.00 65.00 ? 2027 HOH A O   1 
HETATM 4236 O O   . HOH G 4 .   ? -8.169  -5.243  48.532  1.00 34.73 ? 2028 HOH A O   1 
HETATM 4237 O O   . HOH G 4 .   ? 7.185   7.639   39.869  1.00 43.51 ? 2029 HOH A O   1 
HETATM 4238 O O   . HOH G 4 .   ? 10.814  29.420  40.236  1.00 52.56 ? 2030 HOH A O   1 
HETATM 4239 O O   . HOH G 4 .   ? -13.113 0.874   23.885  1.00 48.63 ? 2031 HOH A O   1 
HETATM 4240 O O   . HOH G 4 .   ? 13.477  20.706  49.054  1.00 57.89 ? 2032 HOH A O   1 
HETATM 4241 O O   . HOH G 4 .   ? -15.985 9.084   45.649  1.00 59.13 ? 2033 HOH A O   1 
HETATM 4242 O O   . HOH G 4 .   ? 0.021   2.668   61.703  1.00 46.69 ? 2034 HOH A O   1 
HETATM 4243 O O   . HOH G 4 .   ? -0.417  -12.013 40.136  1.00 41.18 ? 2035 HOH A O   1 
HETATM 4244 O O   . HOH G 4 .   ? 13.762  -1.409  54.127  1.00 39.27 ? 2036 HOH A O   1 
HETATM 4245 O O   . HOH G 4 .   ? -1.205  1.055   48.261  1.00 38.07 ? 2037 HOH A O   1 
HETATM 4246 O O   . HOH G 4 .   ? 14.661  18.401  41.709  1.00 67.44 ? 2038 HOH A O   1 
HETATM 4247 O O   . HOH G 4 .   ? 19.059  -25.999 43.189  1.00 73.19 ? 2039 HOH A O   1 
HETATM 4248 O O   . HOH G 4 .   ? -7.873  -0.696  50.648  1.00 35.05 ? 2040 HOH A O   1 
HETATM 4249 O O   . HOH G 4 .   ? -7.288  9.557   27.680  1.00 46.12 ? 2041 HOH A O   1 
HETATM 4250 O O   . HOH G 4 .   ? -8.730  -10.676 44.148  1.00 36.83 ? 2042 HOH A O   1 
HETATM 4251 O O   . HOH G 4 .   ? -8.347  4.373   24.226  1.00 46.71 ? 2043 HOH A O   1 
HETATM 4252 O O   . HOH G 4 .   ? -12.348 1.561   55.278  1.00 47.68 ? 2044 HOH A O   1 
HETATM 4253 O O   . HOH G 4 .   ? 11.876  8.470   42.560  1.00 51.91 ? 2045 HOH A O   1 
HETATM 4254 O O   . HOH G 4 .   ? 7.771   2.069   28.482  1.00 40.18 ? 2046 HOH A O   1 
HETATM 4255 O O   . HOH G 4 .   ? 23.068  -3.625  53.832  1.00 56.67 ? 2047 HOH A O   1 
HETATM 4256 O O   . HOH G 4 .   ? -9.808  -11.551 38.941  1.00 45.19 ? 2048 HOH A O   1 
HETATM 4257 O O   . HOH G 4 .   ? 10.887  -16.961 22.264  1.00 48.16 ? 2049 HOH A O   1 
HETATM 4258 O O   . HOH G 4 .   ? -10.201 -3.411  47.511  1.00 39.74 ? 2050 HOH A O   1 
HETATM 4259 O O   . HOH G 4 .   ? -12.988 15.418  51.109  1.00 57.76 ? 2051 HOH A O   1 
HETATM 4260 O O   . HOH H 4 .   ? -8.598  -11.632 1.069   1.00 20.37 ? 2002 HOH B O   1 
HETATM 4261 O O   . HOH H 4 .   ? 3.372   -12.950 -11.539 1.00 22.42 ? 2003 HOH B O   1 
HETATM 4262 O O   . HOH H 4 .   ? -2.416  -6.530  8.280   1.00 28.99 ? 2004 HOH B O   1 
HETATM 4263 O O   . HOH H 4 .   ? -2.381  0.036   4.747   1.00 29.83 ? 2005 HOH B O   1 
HETATM 4264 O O   . HOH H 4 .   ? -2.806  -37.836 -5.167  1.00 34.97 ? 2006 HOH B O   1 
HETATM 4265 O O   . HOH H 4 .   ? 0.448   -1.307  10.924  1.00 20.14 ? 2007 HOH B O   1 
HETATM 4266 O O   . HOH H 4 .   ? 15.932  0.421   -0.231  1.00 28.68 ? 2008 HOH B O   1 
HETATM 4267 O O   . HOH H 4 .   ? 6.506   -8.679  -3.612  1.00 21.83 ? 2009 HOH B O   1 
HETATM 4268 O O   . HOH H 4 .   ? 6.099   -5.776  -7.948  1.00 24.44 ? 2010 HOH B O   1 
HETATM 4269 O O   . HOH H 4 .   ? 5.316   -15.825 15.360  1.00 35.01 ? 2011 HOH B O   1 
HETATM 4270 O O   . HOH H 4 .   ? 6.572   -8.076  -6.240  1.00 23.28 ? 2012 HOH B O   1 
HETATM 4271 O O   . HOH H 4 .   ? 3.924   5.043   21.418  1.00 32.14 ? 2013 HOH B O   1 
HETATM 4272 O O   . HOH H 4 .   ? -10.650 -11.110 -0.819  1.00 27.40 ? 2014 HOH B O   1 
HETATM 4273 O O   . HOH H 4 .   ? 17.623  -8.863  -2.930  1.00 42.00 ? 2015 HOH B O   1 
HETATM 4274 O O   . HOH H 4 .   ? 5.337   -21.231 12.401  1.00 28.71 ? 2016 HOH B O   1 
HETATM 4275 O O   . HOH H 4 .   ? -2.346  -5.729  -6.976  1.00 33.30 ? 2017 HOH B O   1 
HETATM 4276 O O   . HOH H 4 .   ? -2.083  0.915   -7.852  1.00 23.47 ? 2018 HOH B O   1 
HETATM 4277 O O   . HOH H 4 .   ? 11.035  12.183  -1.297  1.00 33.18 ? 2019 HOH B O   1 
HETATM 4278 O O   . HOH H 4 .   ? 7.522   0.522   25.953  1.00 31.17 ? 2020 HOH B O   1 
HETATM 4279 O O   . HOH H 4 .   ? -1.237  -11.455 -1.989  1.00 35.05 ? 2021 HOH B O   1 
HETATM 4280 O O   . HOH H 4 .   ? -5.173  -13.471 -11.517 1.00 36.93 ? 2022 HOH B O   1 
HETATM 4281 O O   . HOH H 4 .   ? -14.695 -11.475 3.506   1.00 34.00 ? 2023 HOH B O   1 
HETATM 4282 O O   . HOH H 4 .   ? 13.221  0.952   15.655  1.00 39.72 ? 2024 HOH B O   1 
HETATM 4283 O O   . HOH H 4 .   ? 8.062   12.818  9.582   1.00 31.99 ? 2025 HOH B O   1 
HETATM 4284 O O   . HOH H 4 .   ? 9.521   -20.340 -0.563  1.00 40.34 ? 2026 HOH B O   1 
HETATM 4285 O O   . HOH H 4 .   ? 3.974   13.185  -3.045  1.00 43.36 ? 2027 HOH B O   1 
HETATM 4286 O O   . HOH H 4 .   ? 7.263   -19.690 13.657  1.00 39.60 ? 2028 HOH B O   1 
HETATM 4287 O O   . HOH H 4 .   ? -3.085  -35.100 -9.690  1.00 35.62 ? 2029 HOH B O   1 
HETATM 4288 O O   . HOH H 4 .   ? -2.189  1.011   20.676  1.00 28.91 ? 2030 HOH B O   1 
HETATM 4289 O O   . HOH H 4 .   ? -19.326 -12.341 2.700   1.00 28.83 ? 2031 HOH B O   1 
HETATM 4290 O O   . HOH H 4 .   ? 22.693  0.248   5.891   1.00 35.38 ? 2032 HOH B O   1 
HETATM 4291 O O   . HOH H 4 .   ? 12.688  2.826   -14.897 1.00 42.06 ? 2033 HOH B O   1 
HETATM 4292 O O   . HOH H 4 .   ? 18.470  -11.735 -1.695  1.00 39.14 ? 2034 HOH B O   1 
HETATM 4293 O O   . HOH H 4 .   ? 18.322  12.925  0.748   1.00 53.90 ? 2035 HOH B O   1 
HETATM 4294 O O   . HOH H 4 .   ? 15.961  -6.388  12.560  1.00 31.16 ? 2036 HOH B O   1 
HETATM 4295 O O   . HOH H 4 .   ? 15.287  2.574   16.286  1.00 44.62 ? 2037 HOH B O   1 
HETATM 4296 O O   . HOH H 4 .   ? 7.852   7.782   20.779  1.00 50.57 ? 2038 HOH B O   1 
HETATM 4297 O O   . HOH H 4 .   ? -1.727  -28.674 -10.686 1.00 36.97 ? 2039 HOH B O   1 
HETATM 4298 O O   . HOH H 4 .   ? 9.563   -10.303 -0.700  1.00 44.77 ? 2040 HOH B O   1 
HETATM 4299 O O   . HOH H 4 .   ? -1.920  -38.796 -7.512  1.00 35.05 ? 2041 HOH B O   1 
HETATM 4300 O O   . HOH H 4 .   ? -10.186 -7.104  -1.325  1.00 39.49 ? 2042 HOH B O   1 
HETATM 4301 O O   . HOH H 4 .   ? 13.994  -12.592 11.509  1.00 33.76 ? 2043 HOH B O   1 
HETATM 4302 O O   . HOH H 4 .   ? 15.082  -7.804  -6.087  1.00 35.77 ? 2044 HOH B O   1 
HETATM 4303 O O   . HOH H 4 .   ? -4.423  -0.742  -7.357  1.00 37.46 ? 2045 HOH B O   1 
HETATM 4304 O O   . HOH H 4 .   ? 2.960   -15.067 -13.822 1.00 42.57 ? 2046 HOH B O   1 
HETATM 4305 O O   . HOH H 4 .   ? 7.476   -16.701 -13.545 1.00 45.78 ? 2047 HOH B O   1 
HETATM 4306 O O   . HOH H 4 .   ? 6.455   -22.478 2.964   1.00 35.14 ? 2048 HOH B O   1 
HETATM 4307 O O   . HOH H 4 .   ? 7.637   -8.511  -10.843 1.00 32.89 ? 2049 HOH B O   1 
HETATM 4308 O O   . HOH H 4 .   ? 15.889  10.020  -6.619  1.00 51.29 ? 2050 HOH B O   1 
HETATM 4309 O O   . HOH H 4 .   ? 10.001  -12.858 -0.060  1.00 40.18 ? 2051 HOH B O   1 
HETATM 4310 O O   . HOH H 4 .   ? 8.687   -16.075 5.861   1.00 38.81 ? 2052 HOH B O   1 
HETATM 4311 O O   . HOH H 4 .   ? 18.452  0.804   -0.830  1.00 39.17 ? 2053 HOH B O   1 
HETATM 4312 O O   . HOH H 4 .   ? 5.776   7.015   22.098  1.00 50.43 ? 2054 HOH B O   1 
HETATM 4313 O O   . HOH H 4 .   ? -14.929 -5.938  8.843   1.00 37.02 ? 2055 HOH B O   1 
HETATM 4314 O O   . HOH H 4 .   ? -2.854  -11.194 22.778  1.00 33.23 ? 2056 HOH B O   1 
HETATM 4315 O O   . HOH H 4 .   ? 8.417   -32.084 -9.154  1.00 33.62 ? 2057 HOH B O   1 
HETATM 4316 O O   . HOH H 4 .   ? 17.889  5.206   -2.669  1.00 35.34 ? 2058 HOH B O   1 
HETATM 4317 O O   . HOH H 4 .   ? -16.944 -12.886 9.421   1.00 31.24 ? 2059 HOH B O   1 
HETATM 4318 O O   . HOH H 4 .   ? 10.013  -12.273 16.515  1.00 32.11 ? 2060 HOH B O   1 
HETATM 4319 O O   . HOH H 4 .   ? -2.846  0.512   23.447  1.00 35.53 ? 2061 HOH B O   1 
HETATM 4320 O O   . HOH H 4 .   ? -9.334  -10.451 25.139  1.00 47.86 ? 2062 HOH B O   1 
HETATM 4321 O O   . HOH H 4 .   ? 16.995  -5.045  -4.749  1.00 30.96 ? 2063 HOH B O   1 
HETATM 4322 O O   . HOH H 4 .   ? -1.561  -0.040  -10.394 1.00 42.27 ? 2064 HOH B O   1 
HETATM 4323 O O   . HOH H 4 .   ? -0.739  -13.781 -15.470 1.00 49.12 ? 2065 HOH B O   1 
HETATM 4324 O O   . HOH H 4 .   ? 9.812   -18.663 1.397   1.00 39.93 ? 2066 HOH B O   1 
HETATM 4325 O O   . HOH H 4 .   ? 9.350   -6.134  17.591  1.00 58.01 ? 2067 HOH B O   1 
HETATM 4326 O O   . HOH H 4 .   ? -10.530 -1.423  3.535   1.00 28.18 ? 2068 HOH B O   1 
HETATM 4327 O O   . HOH H 4 .   ? 19.647  3.470   -1.011  1.00 30.65 ? 2069 HOH B O   1 
HETATM 4328 O O   . HOH H 4 .   ? -5.125  -32.522 -7.195  1.00 44.66 ? 2070 HOH B O   1 
HETATM 4329 O O   . HOH H 4 .   ? -10.767 -1.944  6.300   1.00 28.75 ? 2071 HOH B O   1 
HETATM 4330 O O   . HOH H 4 .   ? 12.888  -32.108 -6.774  1.00 57.35 ? 2072 HOH B O   1 
HETATM 4331 O O   . HOH H 4 .   ? -3.585  -14.881 -12.958 1.00 47.57 ? 2073 HOH B O   1 
HETATM 4332 O O   . HOH H 4 .   ? -13.391 -3.519  -2.342  1.00 39.81 ? 2074 HOH B O   1 
HETATM 4333 O O   . HOH H 4 .   ? -8.927  4.053   17.014  1.00 41.39 ? 2075 HOH B O   1 
HETATM 4334 O O   . HOH H 4 .   ? -8.828  -35.350 1.518   1.00 48.83 ? 2076 HOH B O   1 
HETATM 4335 O O   . HOH H 4 .   ? -3.160  -22.251 -12.778 1.00 47.78 ? 2077 HOH B O   1 
HETATM 4336 O O   . HOH H 4 .   ? 9.308   -38.203 -0.418  1.00 48.32 ? 2078 HOH B O   1 
HETATM 4337 O O   . HOH H 4 .   ? 19.696  -2.622  8.916   1.00 40.14 ? 2079 HOH B O   1 
HETATM 4338 O O   . HOH H 4 .   ? 9.863   -14.508 3.281   1.00 54.52 ? 2080 HOH B O   1 
HETATM 4339 O O   . HOH H 4 .   ? -10.673 -31.538 1.709   1.00 35.61 ? 2081 HOH B O   1 
HETATM 4340 O O   . HOH H 4 .   ? -4.527  -10.803 -11.100 1.00 37.86 ? 2082 HOH B O   1 
HETATM 4341 O O   . HOH H 4 .   ? -16.190 -27.052 -2.013  1.00 39.45 ? 2083 HOH B O   1 
HETATM 4342 O O   . HOH H 4 .   ? 5.001   -5.119  -16.373 1.00 47.29 ? 2084 HOH B O   1 
HETATM 4343 O O   . HOH H 4 .   ? 5.924   -12.942 16.350  1.00 49.13 ? 2085 HOH B O   1 
HETATM 4344 O O   . HOH H 4 .   ? 22.414  3.421   5.899   1.00 48.18 ? 2086 HOH B O   1 
HETATM 4345 O O   . HOH H 4 .   ? 11.559  -38.933 0.797   1.00 48.94 ? 2087 HOH B O   1 
HETATM 4346 O O   . HOH H 4 .   ? 11.866  -15.917 4.210   1.00 46.24 ? 2088 HOH B O   1 
HETATM 4347 O O   . HOH H 4 .   ? -3.137  -18.549 -17.314 1.00 68.59 ? 2089 HOH B O   1 
HETATM 4348 O O   . HOH H 4 .   ? -3.158  -19.712 -13.853 1.00 44.95 ? 2090 HOH B O   1 
HETATM 4349 O O   . HOH H 4 .   ? 9.984   -0.134  -13.337 1.00 47.61 ? 2091 HOH B O   1 
HETATM 4350 O O   . HOH H 4 .   ? 6.776   13.190  16.130  1.00 40.55 ? 2092 HOH B O   1 
HETATM 4351 O O   . HOH H 4 .   ? 4.724   -9.244  -14.201 1.00 42.01 ? 2093 HOH B O   1 
HETATM 4352 O O   . HOH H 4 .   ? 6.512   -11.540 18.032  1.00 58.24 ? 2094 HOH B O   1 
HETATM 4353 O O   . HOH H 4 .   ? 5.669   -33.536 -8.519  1.00 38.60 ? 2095 HOH B O   1 
HETATM 4354 O O   . HOH H 4 .   ? 0.639   -37.680 -7.775  1.00 39.35 ? 2096 HOH B O   1 
HETATM 4355 O O   . HOH H 4 .   ? -1.625  -23.966 -11.670 1.00 39.86 ? 2097 HOH B O   1 
HETATM 4356 O O   . HOH H 4 .   ? 2.101   -9.776  -13.405 1.00 53.10 ? 2098 HOH B O   1 
HETATM 4357 O O   . HOH H 4 .   ? 17.071  -10.810 12.786  1.00 40.56 ? 2099 HOH B O   1 
HETATM 4358 O O   . HOH H 4 .   ? -10.924 -3.084  13.740  1.00 52.09 ? 2100 HOH B O   1 
HETATM 4359 O O   . HOH H 4 .   ? 6.825   7.760   -8.779  1.00 47.05 ? 2101 HOH B O   1 
HETATM 4360 O O   . HOH H 4 .   ? -2.536  -8.603  10.330  1.00 17.28 ? 2102 HOH B O   1 
HETATM 4361 O O   . HOH H 4 .   ? -5.049  -4.397  7.843   1.00 28.80 ? 2103 HOH B O   1 
HETATM 4362 O O   . HOH H 4 .   ? -6.038  -0.716  9.615   1.00 24.18 ? 2104 HOH B O   1 
HETATM 4363 O O   . HOH H 4 .   ? 22.750  11.697  -1.319  1.00 62.91 ? 2105 HOH B O   1 
HETATM 4364 O O   . HOH H 4 .   ? 18.595  -26.963 -8.137  1.00 53.68 ? 2106 HOH B O   1 
HETATM 4365 O O   . HOH H 4 .   ? 26.760  2.761   4.445   1.00 60.84 ? 2107 HOH B O   1 
HETATM 4366 O O   . HOH H 4 .   ? 18.461  2.696   -6.798  1.00 54.91 ? 2108 HOH B O   1 
HETATM 4367 O O   . HOH H 4 .   ? -8.276  -5.384  -2.338  1.00 35.06 ? 2109 HOH B O   1 
HETATM 4368 O O   . HOH H 4 .   ? 4.874   -13.582 2.778   1.00 36.53 ? 2110 HOH B O   1 
HETATM 4369 O O   . HOH H 4 .   ? 17.456  0.675   -10.834 1.00 56.20 ? 2111 HOH B O   1 
HETATM 4370 O O   . HOH H 4 .   ? -7.890  -0.618  -6.105  1.00 46.90 ? 2112 HOH B O   1 
HETATM 4371 O O   . HOH H 4 .   ? -9.442  -0.985  -2.319  1.00 49.60 ? 2113 HOH B O   1 
HETATM 4372 O O   . HOH H 4 .   ? -9.250  3.131   -2.012  1.00 39.73 ? 2114 HOH B O   1 
HETATM 4373 O O   . HOH H 4 .   ? 23.126  -9.667  -3.120  1.00 55.57 ? 2115 HOH B O   1 
HETATM 4374 O O   . HOH H 4 .   ? 19.762  -0.731  -2.577  1.00 40.23 ? 2116 HOH B O   1 
HETATM 4375 O O   . HOH H 4 .   ? 19.325  16.023  3.027   1.00 55.70 ? 2117 HOH B O   1 
HETATM 4376 O O   . HOH H 4 .   ? 15.870  -0.893  18.221  1.00 52.70 ? 2118 HOH B O   1 
HETATM 4377 O O   . HOH H 4 .   ? -14.201 -8.814  14.685  1.00 57.91 ? 2119 HOH B O   1 
HETATM 4378 O O   . HOH H 4 .   ? -8.911  2.663   6.636   1.00 54.09 ? 2120 HOH B O   1 
HETATM 4379 O O   . HOH H 4 .   ? -2.989  -32.342 9.152   1.00 54.34 ? 2121 HOH B O   1 
HETATM 4380 O O   . HOH H 4 .   ? 7.525   -42.918 -0.115  1.00 57.90 ? 2122 HOH B O   1 
HETATM 4381 O O   . HOH H 4 .   ? -15.998 -19.537 0.686   1.00 52.24 ? 2123 HOH B O   1 
HETATM 4382 O O   . HOH H 4 .   ? 18.035  -1.722  -6.653  1.00 39.82 ? 2124 HOH B O   1 
HETATM 4383 O O   . HOH H 4 .   ? 14.305  -25.792 1.950   1.00 52.94 ? 2125 HOH B O   1 
HETATM 4384 O O   . HOH H 4 .   ? 19.658  8.556   7.201   1.00 51.49 ? 2126 HOH B O   1 
HETATM 4385 O O   . HOH H 4 .   ? 14.817  -2.704  -10.503 1.00 44.98 ? 2127 HOH B O   1 
HETATM 4386 O O   . HOH H 4 .   ? -8.067  2.815   3.333   1.00 50.12 ? 2128 HOH B O   1 
HETATM 4387 O O   . HOH H 4 .   ? -7.194  -3.027  8.994   1.00 32.73 ? 2129 HOH B O   1 
HETATM 4388 O O   . HOH H 4 .   ? 16.579  3.521   8.241   1.00 47.62 ? 2130 HOH B O   1 
HETATM 4389 O O   . HOH H 4 .   ? -10.011 -3.575  -3.374  1.00 34.42 ? 2131 HOH B O   1 
HETATM 4390 O O   . HOH H 4 .   ? 18.679  -18.467 -13.118 1.00 57.36 ? 2132 HOH B O   1 
HETATM 4391 O O   . HOH H 4 .   ? -8.613  0.358   2.017   1.00 38.79 ? 2133 HOH B O   1 
HETATM 4392 O O   . HOH H 4 .   ? 10.907  5.773   23.976  1.00 45.39 ? 2134 HOH B O   1 
HETATM 4393 O O   . HOH H 4 .   ? 15.683  1.472   13.994  1.00 66.93 ? 2135 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   210 210 ASP ASP A . n 
A 1 2   LEU 2   211 211 LEU LEU A . n 
A 1 3   LYS 3   212 212 LYS LYS A . n 
A 1 4   ALA 4   213 213 ALA ALA A . n 
A 1 5   PHE 5   214 214 PHE PHE A . n 
A 1 6   SER 6   215 215 SER SER A . n 
A 1 7   LYS 7   216 216 LYS LYS A . n 
A 1 8   HIS 8   217 217 HIS HIS A . n 
A 1 9   ILE 9   218 218 ILE ILE A . n 
A 1 10  TYR 10  219 219 TYR TYR A . n 
A 1 11  ASN 11  220 220 ASN ASN A . n 
A 1 12  ALA 12  221 221 ALA ALA A . n 
A 1 13  TYR 13  222 222 TYR TYR A . n 
A 1 14  LEU 14  223 223 LEU LEU A . n 
A 1 15  LYS 15  224 224 LYS LYS A . n 
A 1 16  ASN 16  225 225 ASN ASN A . n 
A 1 17  PHE 17  226 226 PHE PHE A . n 
A 1 18  ASN 18  227 227 ASN ASN A . n 
A 1 19  MET 19  228 228 MET MET A . n 
A 1 20  THR 20  229 229 THR THR A . n 
A 1 21  LYS 21  230 230 LYS LYS A . n 
A 1 22  LYS 22  231 231 LYS LYS A . n 
A 1 23  LYS 23  232 232 LYS LYS A . n 
A 1 24  ALA 24  233 233 ALA ALA A . n 
A 1 25  ARG 25  234 234 ARG ARG A . n 
A 1 26  SER 26  235 235 SER SER A . n 
A 1 27  ILE 27  236 236 ILE ILE A . n 
A 1 28  LEU 28  237 237 LEU LEU A . n 
A 1 29  THR 29  238 238 THR THR A . n 
A 1 30  GLY 30  239 ?   ?   ?   A . n 
A 1 31  LYS 31  240 ?   ?   ?   A . n 
A 1 32  ALA 32  241 ?   ?   ?   A . n 
A 1 33  SER 33  242 ?   ?   ?   A . n 
A 1 34  HIS 34  243 243 HIS HIS A . n 
A 1 35  THR 35  244 244 THR THR A . n 
A 1 36  ALA 36  245 245 ALA ALA A . n 
A 1 37  PRO 37  246 246 PRO PRO A . n 
A 1 38  PHE 38  247 247 PHE PHE A . n 
A 1 39  VAL 39  248 248 VAL VAL A . n 
A 1 40  ILE 40  249 249 ILE ILE A . n 
A 1 41  HIS 41  250 250 HIS HIS A . n 
A 1 42  ASP 42  251 251 ASP ASP A . n 
A 1 43  ILE 43  252 252 ILE ILE A . n 
A 1 44  GLU 44  253 253 GLU GLU A . n 
A 1 45  THR 45  254 254 THR THR A . n 
A 1 46  LEU 46  255 255 LEU LEU A . n 
A 1 47  TRP 47  256 256 TRP TRP A . n 
A 1 48  GLN 48  257 257 GLN GLN A . n 
A 1 49  ALA 49  258 258 ALA ALA A . n 
A 1 50  GLU 50  259 259 GLU GLU A . n 
A 1 51  LYS 51  260 260 LYS LYS A . n 
A 1 52  GLY 52  261 261 GLY GLY A . n 
A 1 53  LEU 53  262 262 LEU LEU A . n 
A 1 54  VAL 54  263 263 VAL VAL A . n 
A 1 55  TRP 55  264 264 TRP TRP A . n 
A 1 56  LYS 56  265 265 LYS LYS A . n 
A 1 57  GLN 57  266 ?   ?   ?   A . n 
A 1 58  LEU 58  267 ?   ?   ?   A . n 
A 1 59  VAL 59  268 ?   ?   ?   A . n 
A 1 60  ASN 60  269 ?   ?   ?   A . n 
A 1 61  GLY 61  270 ?   ?   ?   A . n 
A 1 62  LEU 62  271 ?   ?   ?   A . n 
A 1 63  PRO 63  272 ?   ?   ?   A . n 
A 1 64  PRO 64  273 ?   ?   ?   A . n 
A 1 65  TYR 65  274 ?   ?   ?   A . n 
A 1 66  LYS 66  275 ?   ?   ?   A . n 
A 1 67  GLU 67  276 276 GLU GLU A . n 
A 1 68  ILE 68  277 277 ILE ILE A . n 
A 1 69  SER 69  278 278 SER SER A . n 
A 1 70  VAL 70  279 279 VAL VAL A . n 
A 1 71  HIS 71  280 280 HIS HIS A . n 
A 1 72  VAL 72  281 281 VAL VAL A . n 
A 1 73  PHE 73  282 282 PHE PHE A . n 
A 1 74  TYR 74  283 283 TYR TYR A . n 
A 1 75  ARG 75  284 284 ARG ARG A . n 
A 1 76  CYS 76  285 285 CYS CYS A . n 
A 1 77  GLN 77  286 286 GLN GLN A . n 
A 1 78  CYS 78  287 287 CYS CYS A . n 
A 1 79  THR 79  288 288 THR THR A . n 
A 1 80  THR 80  289 289 THR THR A . n 
A 1 81  VAL 81  290 290 VAL VAL A . n 
A 1 82  GLU 82  291 291 GLU GLU A . n 
A 1 83  THR 83  292 292 THR THR A . n 
A 1 84  VAL 84  293 293 VAL VAL A . n 
A 1 85  ARG 85  294 294 ARG ARG A . n 
A 1 86  GLU 86  295 295 GLU GLU A . n 
A 1 87  LEU 87  296 296 LEU LEU A . n 
A 1 88  THR 88  297 297 THR THR A . n 
A 1 89  GLU 89  298 298 GLU GLU A . n 
A 1 90  PHE 90  299 299 PHE PHE A . n 
A 1 91  ALA 91  300 300 ALA ALA A . n 
A 1 92  LYS 92  301 301 LYS LYS A . n 
A 1 93  SER 93  302 302 SER SER A . n 
A 1 94  ILE 94  303 303 ILE ILE A . n 
A 1 95  PRO 95  304 304 PRO PRO A . n 
A 1 96  SER 96  305 305 SER SER A . n 
A 1 97  PHE 97  306 306 PHE PHE A . n 
A 1 98  SER 98  307 307 SER SER A . n 
A 1 99  SER 99  308 308 SER SER A . n 
A 1 100 LEU 100 309 309 LEU LEU A . n 
A 1 101 PHE 101 310 310 PHE PHE A . n 
A 1 102 LEU 102 311 311 LEU LEU A . n 
A 1 103 ASN 103 312 312 ASN ASN A . n 
A 1 104 ASP 104 313 313 ASP ASP A . n 
A 1 105 GLN 105 314 314 GLN GLN A . n 
A 1 106 VAL 106 315 315 VAL VAL A . n 
A 1 107 THR 107 316 316 THR THR A . n 
A 1 108 LEU 108 317 317 LEU LEU A . n 
A 1 109 LEU 109 318 318 LEU LEU A . n 
A 1 110 LYS 110 319 319 LYS LYS A . n 
A 1 111 TYR 111 320 320 TYR TYR A . n 
A 1 112 GLY 112 321 321 GLY GLY A . n 
A 1 113 VAL 113 322 322 VAL VAL A . n 
A 1 114 HIS 114 323 323 HIS HIS A . n 
A 1 115 GLU 115 324 324 GLU GLU A . n 
A 1 116 ALA 116 325 325 ALA ALA A . n 
A 1 117 ILE 117 326 326 ILE ILE A . n 
A 1 118 PHE 118 327 327 PHE PHE A . n 
A 1 119 ALA 119 328 328 ALA ALA A . n 
A 1 120 MET 120 329 329 MET MET A . n 
A 1 121 LEU 121 330 330 LEU LEU A . n 
A 1 122 ALA 122 331 331 ALA ALA A . n 
A 1 123 SER 123 332 332 SER SER A . n 
A 1 124 ILE 124 333 333 ILE ILE A . n 
A 1 125 VAL 125 334 334 VAL VAL A . n 
A 1 126 ASN 126 335 335 ASN ASN A . n 
A 1 127 LYS 127 336 336 LYS LYS A . n 
A 1 128 ASP 128 337 337 ASP ASP A . n 
A 1 129 GLY 129 338 338 GLY GLY A . n 
A 1 130 LEU 130 339 339 LEU LEU A . n 
A 1 131 LEU 131 340 340 LEU LEU A . n 
A 1 132 VAL 132 341 341 VAL VAL A . n 
A 1 133 ALA 133 342 342 ALA ALA A . n 
A 1 134 ASN 134 343 343 ASN ASN A . n 
A 1 135 GLY 135 344 344 GLY GLY A . n 
A 1 136 SER 136 345 345 SER SER A . n 
A 1 137 GLY 137 346 346 GLY GLY A . n 
A 1 138 PHE 138 347 347 PHE PHE A . n 
A 1 139 VAL 139 348 348 VAL VAL A . n 
A 1 140 THR 140 349 349 THR THR A . n 
A 1 141 ARG 141 350 350 ARG ARG A . n 
A 1 142 GLU 142 351 351 GLU GLU A . n 
A 1 143 PHE 143 352 352 PHE PHE A . n 
A 1 144 LEU 144 353 353 LEU LEU A . n 
A 1 145 ARG 145 354 354 ARG ARG A . n 
A 1 146 SER 146 355 355 SER SER A . n 
A 1 147 LEU 147 356 356 LEU LEU A . n 
A 1 148 ARG 148 357 357 ARG ARG A . n 
A 1 149 LYS 149 358 358 LYS LYS A . n 
A 1 150 PRO 150 359 359 PRO PRO A . n 
A 1 151 PHE 151 360 360 PHE PHE A . n 
A 1 152 SER 152 361 361 SER SER A . n 
A 1 153 ASP 153 362 362 ASP ASP A . n 
A 1 154 ILE 154 363 363 ILE ILE A . n 
A 1 155 ILE 155 364 364 ILE ILE A . n 
A 1 156 GLU 156 365 365 GLU GLU A . n 
A 1 157 PRO 157 366 366 PRO PRO A . n 
A 1 158 LYS 158 367 367 LYS LYS A . n 
A 1 159 PHE 159 368 368 PHE PHE A . n 
A 1 160 GLU 160 369 369 GLU GLU A . n 
A 1 161 PHE 161 370 370 PHE PHE A . n 
A 1 162 ALA 162 371 371 ALA ALA A . n 
A 1 163 VAL 163 372 372 VAL VAL A . n 
A 1 164 LYS 164 373 373 LYS LYS A . n 
A 1 165 PHE 165 374 374 PHE PHE A . n 
A 1 166 ASN 166 375 375 ASN ASN A . n 
A 1 167 ALA 167 376 376 ALA ALA A . n 
A 1 168 LEU 168 377 377 LEU LEU A . n 
A 1 169 GLU 169 378 378 GLU GLU A . n 
A 1 170 LEU 170 379 379 LEU LEU A . n 
A 1 171 ASP 171 380 380 ASP ASP A . n 
A 1 172 ASP 172 381 381 ASP ASP A . n 
A 1 173 SER 173 382 382 SER SER A . n 
A 1 174 ASP 174 383 383 ASP ASP A . n 
A 1 175 LEU 175 384 384 LEU LEU A . n 
A 1 176 ALA 176 385 385 ALA ALA A . n 
A 1 177 LEU 177 386 386 LEU LEU A . n 
A 1 178 PHE 178 387 387 PHE PHE A . n 
A 1 179 ILE 179 388 388 ILE ILE A . n 
A 1 180 ALA 180 389 389 ALA ALA A . n 
A 1 181 ALA 181 390 390 ALA ALA A . n 
A 1 182 ILE 182 391 391 ILE ILE A . n 
A 1 183 ILE 183 392 392 ILE ILE A . n 
A 1 184 LEU 184 393 393 LEU LEU A . n 
A 1 185 CYS 185 394 394 CYS CYS A . n 
A 1 186 GLY 186 395 395 GLY GLY A . n 
A 1 187 ASP 187 396 396 ASP ASP A . n 
A 1 188 ARG 188 397 397 ARG ARG A . n 
A 1 189 PRO 189 398 398 PRO PRO A . n 
A 1 190 GLY 190 399 399 GLY GLY A . n 
A 1 191 LEU 191 400 400 LEU LEU A . n 
A 1 192 MET 192 401 401 MET MET A . n 
A 1 193 ASN 193 402 402 ASN ASN A . n 
A 1 194 VAL 194 403 403 VAL VAL A . n 
A 1 195 PRO 195 404 404 PRO PRO A . n 
A 1 196 ARG 196 405 405 ARG ARG A . n 
A 1 197 VAL 197 406 406 VAL VAL A . n 
A 1 198 GLU 198 407 407 GLU GLU A . n 
A 1 199 ALA 199 408 408 ALA ALA A . n 
A 1 200 ILE 200 409 409 ILE ILE A . n 
A 1 201 GLN 201 410 410 GLN GLN A . n 
A 1 202 ASP 202 411 411 ASP ASP A . n 
A 1 203 THR 203 412 412 THR THR A . n 
A 1 204 ILE 204 413 413 ILE ILE A . n 
A 1 205 LEU 205 414 414 LEU LEU A . n 
A 1 206 ARG 206 415 415 ARG ARG A . n 
A 1 207 ALA 207 416 416 ALA ALA A . n 
A 1 208 LEU 208 417 417 LEU LEU A . n 
A 1 209 GLU 209 418 418 GLU GLU A . n 
A 1 210 PHE 210 419 419 PHE PHE A . n 
A 1 211 HIS 211 420 420 HIS HIS A . n 
A 1 212 LEU 212 421 421 LEU LEU A . n 
A 1 213 GLN 213 422 422 GLN GLN A . n 
A 1 214 ALA 214 423 423 ALA ALA A . n 
A 1 215 ASN 215 424 424 ASN ASN A . n 
A 1 216 HIS 216 425 425 HIS HIS A . n 
A 1 217 PRO 217 426 426 PRO PRO A . n 
A 1 218 ASP 218 427 427 ASP ASP A . n 
A 1 219 ALA 219 428 428 ALA ALA A . n 
A 1 220 GLN 220 429 429 GLN ALA A . n 
A 1 221 GLN 221 430 430 GLN GLN A . n 
A 1 222 LEU 222 431 431 LEU LEU A . n 
A 1 223 PHE 223 432 432 PHE PHE A . n 
A 1 224 PRO 224 433 433 PRO PRO A . n 
A 1 225 LYS 225 434 434 LYS LYS A . n 
A 1 226 LEU 226 435 435 LEU LEU A . n 
A 1 227 LEU 227 436 436 LEU LEU A . n 
A 1 228 GLN 228 437 437 GLN GLN A . n 
A 1 229 LYS 229 438 438 LYS LYS A . n 
A 1 230 MET 230 439 439 MET MET A . n 
A 1 231 ALA 231 440 440 ALA ALA A . n 
A 1 232 ASP 232 441 441 ASP ASP A . n 
A 1 233 LEU 233 442 442 LEU LEU A . n 
A 1 234 ARG 234 443 443 ARG ARG A . n 
A 1 235 GLN 235 444 444 GLN GLN A . n 
A 1 236 LEU 236 445 445 LEU LEU A . n 
A 1 237 VAL 237 446 446 VAL VAL A . n 
A 1 238 THR 238 447 447 THR THR A . n 
A 1 239 GLU 239 448 448 GLU GLU A . n 
A 1 240 HIS 240 449 449 HIS HIS A . n 
A 1 241 ALA 241 450 450 ALA ALA A . n 
A 1 242 GLN 242 451 451 GLN GLN A . n 
A 1 243 MET 243 452 452 MET MET A . n 
A 1 244 MET 244 453 453 MET MET A . n 
A 1 245 GLN 245 454 454 GLN GLN A . n 
A 1 246 ARG 246 455 455 ARG ARG A . n 
A 1 247 ILE 247 456 456 ILE ILE A . n 
A 1 248 LYS 248 457 457 LYS LYS A . n 
A 1 249 LYS 249 458 458 LYS LYS A . n 
A 1 250 THR 250 459 459 THR THR A . n 
A 1 251 GLU 251 460 460 GLU GLU A . n 
A 1 252 THR 252 461 461 THR THR A . n 
A 1 253 GLU 253 462 462 GLU ALA A . n 
A 1 254 THR 254 463 463 THR THR A . n 
A 1 255 SER 255 464 464 SER SER A . n 
A 1 256 LEU 256 465 465 LEU LEU A . n 
A 1 257 HIS 257 466 466 HIS HIS A . n 
A 1 258 PRO 258 467 467 PRO PRO A . n 
A 1 259 LEU 259 468 468 LEU LEU A . n 
A 1 260 LEU 260 469 469 LEU LEU A . n 
A 1 261 GLN 261 470 470 GLN ALA A . n 
A 1 262 GLU 262 471 471 GLU GLU A . n 
A 1 263 ILE 263 472 472 ILE ILE A . n 
A 1 264 TYR 264 473 473 TYR TYR A . n 
A 1 265 LYS 265 474 474 LYS LYS A . n 
A 1 266 ASP 266 475 475 ASP ASP A . n 
A 1 267 MET 267 476 476 MET MET A . n 
A 1 268 TYR 268 477 477 TYR TYR A . n 
B 1 1   ASP 1   210 210 ASP ASP B . n 
B 1 2   LEU 2   211 211 LEU LEU B . n 
B 1 3   LYS 3   212 212 LYS LYS B . n 
B 1 4   ALA 4   213 213 ALA ALA B . n 
B 1 5   PHE 5   214 214 PHE PHE B . n 
B 1 6   SER 6   215 215 SER SER B . n 
B 1 7   LYS 7   216 216 LYS LYS B . n 
B 1 8   HIS 8   217 217 HIS HIS B . n 
B 1 9   ILE 9   218 218 ILE ILE B . n 
B 1 10  TYR 10  219 219 TYR TYR B . n 
B 1 11  ASN 11  220 220 ASN ASN B . n 
B 1 12  ALA 12  221 221 ALA ALA B . n 
B 1 13  TYR 13  222 222 TYR TYR B . n 
B 1 14  LEU 14  223 223 LEU LEU B . n 
B 1 15  LYS 15  224 224 LYS LYS B . n 
B 1 16  ASN 16  225 225 ASN ASN B . n 
B 1 17  PHE 17  226 226 PHE PHE B . n 
B 1 18  ASN 18  227 227 ASN ASN B . n 
B 1 19  MET 19  228 228 MET MET B . n 
B 1 20  THR 20  229 229 THR THR B . n 
B 1 21  LYS 21  230 230 LYS LYS B . n 
B 1 22  LYS 22  231 231 LYS LYS B . n 
B 1 23  LYS 23  232 232 LYS LYS B . n 
B 1 24  ALA 24  233 233 ALA ALA B . n 
B 1 25  ARG 25  234 234 ARG ARG B . n 
B 1 26  SER 26  235 235 SER SER B . n 
B 1 27  ILE 27  236 236 ILE ILE B . n 
B 1 28  LEU 28  237 237 LEU LEU B . n 
B 1 29  THR 29  238 238 THR THR B . n 
B 1 30  GLY 30  239 ?   ?   ?   B . n 
B 1 31  LYS 31  240 ?   ?   ?   B . n 
B 1 32  ALA 32  241 ?   ?   ?   B . n 
B 1 33  SER 33  242 ?   ?   ?   B . n 
B 1 34  HIS 34  243 ?   ?   ?   B . n 
B 1 35  THR 35  244 ?   ?   ?   B . n 
B 1 36  ALA 36  245 245 ALA ALA B . n 
B 1 37  PRO 37  246 246 PRO PRO B . n 
B 1 38  PHE 38  247 247 PHE PHE B . n 
B 1 39  VAL 39  248 248 VAL VAL B . n 
B 1 40  ILE 40  249 249 ILE ILE B . n 
B 1 41  HIS 41  250 250 HIS HIS B . n 
B 1 42  ASP 42  251 251 ASP ASP B . n 
B 1 43  ILE 43  252 252 ILE ILE B . n 
B 1 44  GLU 44  253 253 GLU GLU B . n 
B 1 45  THR 45  254 254 THR THR B . n 
B 1 46  LEU 46  255 255 LEU LEU B . n 
B 1 47  TRP 47  256 256 TRP TRP B . n 
B 1 48  GLN 48  257 257 GLN GLN B . n 
B 1 49  ALA 49  258 258 ALA ALA B . n 
B 1 50  GLU 50  259 259 GLU GLU B . n 
B 1 51  LYS 51  260 260 LYS LYS B . n 
B 1 52  GLY 52  261 261 GLY GLY B . n 
B 1 53  LEU 53  262 262 LEU LEU B . n 
B 1 54  VAL 54  263 263 VAL VAL B . n 
B 1 55  TRP 55  264 264 TRP TRP B . n 
B 1 56  LYS 56  265 ?   ?   ?   B . n 
B 1 57  GLN 57  266 ?   ?   ?   B . n 
B 1 58  LEU 58  267 ?   ?   ?   B . n 
B 1 59  VAL 59  268 ?   ?   ?   B . n 
B 1 60  ASN 60  269 ?   ?   ?   B . n 
B 1 61  GLY 61  270 ?   ?   ?   B . n 
B 1 62  LEU 62  271 ?   ?   ?   B . n 
B 1 63  PRO 63  272 ?   ?   ?   B . n 
B 1 64  PRO 64  273 ?   ?   ?   B . n 
B 1 65  TYR 65  274 ?   ?   ?   B . n 
B 1 66  LYS 66  275 ?   ?   ?   B . n 
B 1 67  GLU 67  276 276 GLU GLU B . n 
B 1 68  ILE 68  277 277 ILE ILE B . n 
B 1 69  SER 69  278 278 SER SER B . n 
B 1 70  VAL 70  279 279 VAL VAL B . n 
B 1 71  HIS 71  280 280 HIS HIS B . n 
B 1 72  VAL 72  281 281 VAL VAL B . n 
B 1 73  PHE 73  282 282 PHE PHE B . n 
B 1 74  TYR 74  283 283 TYR TYR B . n 
B 1 75  ARG 75  284 284 ARG ARG B . n 
B 1 76  CYS 76  285 285 CYS CYS B . n 
B 1 77  GLN 77  286 286 GLN GLN B . n 
B 1 78  CYS 78  287 287 CYS CYS B . n 
B 1 79  THR 79  288 288 THR THR B . n 
B 1 80  THR 80  289 289 THR THR B . n 
B 1 81  VAL 81  290 290 VAL VAL B . n 
B 1 82  GLU 82  291 291 GLU GLU B . n 
B 1 83  THR 83  292 292 THR THR B . n 
B 1 84  VAL 84  293 293 VAL VAL B . n 
B 1 85  ARG 85  294 294 ARG ARG B . n 
B 1 86  GLU 86  295 295 GLU GLU B . n 
B 1 87  LEU 87  296 296 LEU LEU B . n 
B 1 88  THR 88  297 297 THR THR B . n 
B 1 89  GLU 89  298 298 GLU GLU B . n 
B 1 90  PHE 90  299 299 PHE PHE B . n 
B 1 91  ALA 91  300 300 ALA ALA B . n 
B 1 92  LYS 92  301 301 LYS LYS B . n 
B 1 93  SER 93  302 302 SER SER B . n 
B 1 94  ILE 94  303 303 ILE ILE B . n 
B 1 95  PRO 95  304 304 PRO PRO B . n 
B 1 96  SER 96  305 305 SER SER B . n 
B 1 97  PHE 97  306 306 PHE PHE B . n 
B 1 98  SER 98  307 307 SER SER B . n 
B 1 99  SER 99  308 308 SER SER B . n 
B 1 100 LEU 100 309 309 LEU LEU B . n 
B 1 101 PHE 101 310 310 PHE PHE B . n 
B 1 102 LEU 102 311 311 LEU LEU B . n 
B 1 103 ASN 103 312 312 ASN ASN B . n 
B 1 104 ASP 104 313 313 ASP ASP B . n 
B 1 105 GLN 105 314 314 GLN GLN B . n 
B 1 106 VAL 106 315 315 VAL VAL B . n 
B 1 107 THR 107 316 316 THR THR B . n 
B 1 108 LEU 108 317 317 LEU LEU B . n 
B 1 109 LEU 109 318 318 LEU LEU B . n 
B 1 110 LYS 110 319 319 LYS LYS B . n 
B 1 111 TYR 111 320 320 TYR TYR B . n 
B 1 112 GLY 112 321 321 GLY GLY B . n 
B 1 113 VAL 113 322 322 VAL VAL B . n 
B 1 114 HIS 114 323 323 HIS HIS B . n 
B 1 115 GLU 115 324 324 GLU GLU B . n 
B 1 116 ALA 116 325 325 ALA ALA B . n 
B 1 117 ILE 117 326 326 ILE ILE B . n 
B 1 118 PHE 118 327 327 PHE PHE B . n 
B 1 119 ALA 119 328 328 ALA ALA B . n 
B 1 120 MET 120 329 329 MET MET B . n 
B 1 121 LEU 121 330 330 LEU LEU B . n 
B 1 122 ALA 122 331 331 ALA ALA B . n 
B 1 123 SER 123 332 332 SER SER B . n 
B 1 124 ILE 124 333 333 ILE ILE B . n 
B 1 125 VAL 125 334 334 VAL VAL B . n 
B 1 126 ASN 126 335 335 ASN ASN B . n 
B 1 127 LYS 127 336 336 LYS LYS B . n 
B 1 128 ASP 128 337 337 ASP ASP B . n 
B 1 129 GLY 129 338 338 GLY GLY B . n 
B 1 130 LEU 130 339 339 LEU LEU B . n 
B 1 131 LEU 131 340 340 LEU LEU B . n 
B 1 132 VAL 132 341 341 VAL VAL B . n 
B 1 133 ALA 133 342 342 ALA ALA B . n 
B 1 134 ASN 134 343 343 ASN ASN B . n 
B 1 135 GLY 135 344 344 GLY GLY B . n 
B 1 136 SER 136 345 345 SER SER B . n 
B 1 137 GLY 137 346 346 GLY GLY B . n 
B 1 138 PHE 138 347 347 PHE PHE B . n 
B 1 139 VAL 139 348 348 VAL VAL B . n 
B 1 140 THR 140 349 349 THR THR B . n 
B 1 141 ARG 141 350 350 ARG ARG B . n 
B 1 142 GLU 142 351 351 GLU GLU B . n 
B 1 143 PHE 143 352 352 PHE PHE B . n 
B 1 144 LEU 144 353 353 LEU LEU B . n 
B 1 145 ARG 145 354 354 ARG ARG B . n 
B 1 146 SER 146 355 355 SER SER B . n 
B 1 147 LEU 147 356 356 LEU LEU B . n 
B 1 148 ARG 148 357 357 ARG ARG B . n 
B 1 149 LYS 149 358 358 LYS LYS B . n 
B 1 150 PRO 150 359 359 PRO PRO B . n 
B 1 151 PHE 151 360 360 PHE PHE B . n 
B 1 152 SER 152 361 361 SER SER B . n 
B 1 153 ASP 153 362 362 ASP ASP B . n 
B 1 154 ILE 154 363 363 ILE ILE B . n 
B 1 155 ILE 155 364 364 ILE ILE B . n 
B 1 156 GLU 156 365 365 GLU GLU B . n 
B 1 157 PRO 157 366 366 PRO PRO B . n 
B 1 158 LYS 158 367 367 LYS LYS B . n 
B 1 159 PHE 159 368 368 PHE PHE B . n 
B 1 160 GLU 160 369 369 GLU GLU B . n 
B 1 161 PHE 161 370 370 PHE PHE B . n 
B 1 162 ALA 162 371 371 ALA ALA B . n 
B 1 163 VAL 163 372 372 VAL VAL B . n 
B 1 164 LYS 164 373 373 LYS LYS B . n 
B 1 165 PHE 165 374 374 PHE PHE B . n 
B 1 166 ASN 166 375 375 ASN ASN B . n 
B 1 167 ALA 167 376 376 ALA ALA B . n 
B 1 168 LEU 168 377 377 LEU LEU B . n 
B 1 169 GLU 169 378 378 GLU GLU B . n 
B 1 170 LEU 170 379 379 LEU LEU B . n 
B 1 171 ASP 171 380 380 ASP ASP B . n 
B 1 172 ASP 172 381 381 ASP ASP B . n 
B 1 173 SER 173 382 382 SER SER B . n 
B 1 174 ASP 174 383 383 ASP ASP B . n 
B 1 175 LEU 175 384 384 LEU LEU B . n 
B 1 176 ALA 176 385 385 ALA ALA B . n 
B 1 177 LEU 177 386 386 LEU LEU B . n 
B 1 178 PHE 178 387 387 PHE PHE B . n 
B 1 179 ILE 179 388 388 ILE ILE B . n 
B 1 180 ALA 180 389 389 ALA ALA B . n 
B 1 181 ALA 181 390 390 ALA ALA B . n 
B 1 182 ILE 182 391 391 ILE ILE B . n 
B 1 183 ILE 183 392 392 ILE ILE B . n 
B 1 184 LEU 184 393 393 LEU LEU B . n 
B 1 185 CYS 185 394 394 CYS CYS B . n 
B 1 186 GLY 186 395 395 GLY GLY B . n 
B 1 187 ASP 187 396 396 ASP ASP B . n 
B 1 188 ARG 188 397 397 ARG ARG B . n 
B 1 189 PRO 189 398 398 PRO PRO B . n 
B 1 190 GLY 190 399 399 GLY GLY B . n 
B 1 191 LEU 191 400 400 LEU LEU B . n 
B 1 192 MET 192 401 401 MET MET B . n 
B 1 193 ASN 193 402 402 ASN ASN B . n 
B 1 194 VAL 194 403 403 VAL VAL B . n 
B 1 195 PRO 195 404 404 PRO PRO B . n 
B 1 196 ARG 196 405 405 ARG ARG B . n 
B 1 197 VAL 197 406 406 VAL VAL B . n 
B 1 198 GLU 198 407 407 GLU GLU B . n 
B 1 199 ALA 199 408 408 ALA ALA B . n 
B 1 200 ILE 200 409 409 ILE ILE B . n 
B 1 201 GLN 201 410 410 GLN GLN B . n 
B 1 202 ASP 202 411 411 ASP ASP B . n 
B 1 203 THR 203 412 412 THR THR B . n 
B 1 204 ILE 204 413 413 ILE ILE B . n 
B 1 205 LEU 205 414 414 LEU LEU B . n 
B 1 206 ARG 206 415 415 ARG ARG B . n 
B 1 207 ALA 207 416 416 ALA ALA B . n 
B 1 208 LEU 208 417 417 LEU LEU B . n 
B 1 209 GLU 209 418 418 GLU GLU B . n 
B 1 210 PHE 210 419 419 PHE PHE B . n 
B 1 211 HIS 211 420 420 HIS HIS B . n 
B 1 212 LEU 212 421 421 LEU LEU B . n 
B 1 213 GLN 213 422 422 GLN GLN B . n 
B 1 214 ALA 214 423 423 ALA ALA B . n 
B 1 215 ASN 215 424 424 ASN ASN B . n 
B 1 216 HIS 216 425 425 HIS HIS B . n 
B 1 217 PRO 217 426 426 PRO PRO B . n 
B 1 218 ASP 218 427 427 ASP ASP B . n 
B 1 219 ALA 219 428 428 ALA ALA B . n 
B 1 220 GLN 220 429 429 GLN ALA B . n 
B 1 221 GLN 221 430 430 GLN GLN B . n 
B 1 222 LEU 222 431 431 LEU LEU B . n 
B 1 223 PHE 223 432 432 PHE PHE B . n 
B 1 224 PRO 224 433 433 PRO PRO B . n 
B 1 225 LYS 225 434 434 LYS LYS B . n 
B 1 226 LEU 226 435 435 LEU LEU B . n 
B 1 227 LEU 227 436 436 LEU LEU B . n 
B 1 228 GLN 228 437 437 GLN GLN B . n 
B 1 229 LYS 229 438 438 LYS LYS B . n 
B 1 230 MET 230 439 439 MET MET B . n 
B 1 231 ALA 231 440 440 ALA ALA B . n 
B 1 232 ASP 232 441 441 ASP ASP B . n 
B 1 233 LEU 233 442 442 LEU LEU B . n 
B 1 234 ARG 234 443 443 ARG ARG B . n 
B 1 235 GLN 235 444 444 GLN GLN B . n 
B 1 236 LEU 236 445 445 LEU LEU B . n 
B 1 237 VAL 237 446 446 VAL VAL B . n 
B 1 238 THR 238 447 447 THR THR B . n 
B 1 239 GLU 239 448 448 GLU GLU B . n 
B 1 240 HIS 240 449 449 HIS HIS B . n 
B 1 241 ALA 241 450 450 ALA ALA B . n 
B 1 242 GLN 242 451 451 GLN GLN B . n 
B 1 243 MET 243 452 452 MET MET B . n 
B 1 244 MET 244 453 453 MET MET B . n 
B 1 245 GLN 245 454 454 GLN GLN B . n 
B 1 246 ARG 246 455 455 ARG ARG B . n 
B 1 247 ILE 247 456 456 ILE ILE B . n 
B 1 248 LYS 248 457 457 LYS LYS B . n 
B 1 249 LYS 249 458 458 LYS LYS B . n 
B 1 250 THR 250 459 459 THR THR B . n 
B 1 251 GLU 251 460 460 GLU GLU B . n 
B 1 252 THR 252 461 461 THR THR B . n 
B 1 253 GLU 253 462 462 GLU ALA B . n 
B 1 254 THR 254 463 463 THR THR B . n 
B 1 255 SER 255 464 464 SER SER B . n 
B 1 256 LEU 256 465 465 LEU LEU B . n 
B 1 257 HIS 257 466 466 HIS HIS B . n 
B 1 258 PRO 258 467 467 PRO PRO B . n 
B 1 259 LEU 259 468 468 LEU LEU B . n 
B 1 260 LEU 260 469 469 LEU LEU B . n 
B 1 261 GLN 261 470 470 GLN ALA B . n 
B 1 262 GLU 262 471 471 GLU GLU B . n 
B 1 263 ILE 263 472 472 ILE ILE B . n 
B 1 264 TYR 264 473 473 TYR TYR B . n 
B 1 265 LYS 265 474 474 LYS LYS B . n 
B 1 266 ASP 266 475 475 ASP ASP B . n 
B 1 267 MET 267 476 476 MET MET B . n 
B 1 268 TYR 268 477 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-14 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_diffrn_reflns.pdbx_d_res_low      43.03 
_diffrn_reflns.pdbx_d_res_high     2.00 
_diffrn_reflns.number              173465 
_diffrn_reflns.pdbx_Rmerge_I_obs   0.104 
_diffrn_reflns.pdbx_redundancy     4.06 
_diffrn_reflns.diffrn_id           1 
# 
_pdbx_phasing_MR.entry_id                     2AWH 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.432 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.549 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           42.840 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        42.840 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       CCP4_3.1.9 25/6/2002       program 'Phil Evans'      pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran ? 1 
MOLREP      .          ?               program 'A. Vagin'        alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html Fortran ? 2 
REFMAC      5.2.0005   ?               program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html             Fortran ? 3 
PDB_EXTRACT 1.700      'May. 30, 2005' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/            C++     ? 4 
MOSFLM      .          ?               ?       ?                 ?                        'data reduction'  ? ?       ? 5 
CCP4        '(SCALA)'  ?               ?       ?                 ?                        'data scaling'    ? ?       ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    302 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1936 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              393 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              393 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              393 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                98.47 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -16.83 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 263 ? ? -120.27 -50.52 
2  1 SER A 305 ? ? 83.87   -12.53 
3  1 LEU A 393 ? ? -90.39  41.10  
4  1 ASN A 402 ? ? -101.24 77.54  
5  1 MET A 476 ? ? -72.69  -90.72 
6  1 LEU B 237 ? ? -62.98  3.82   
7  1 SER B 305 ? ? 80.97   -10.79 
8  1 LEU B 393 ? ? -88.35  44.94  
9  1 ASN B 402 ? ? -102.72 76.97  
10 1 LYS B 458 ? ? -90.98  -63.50 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 429 ? CG  ? A GLN 220 CG  
2  1 Y 1 A GLN 429 ? CD  ? A GLN 220 CD  
3  1 Y 1 A GLN 429 ? OE1 ? A GLN 220 OE1 
4  1 Y 1 A GLN 429 ? NE2 ? A GLN 220 NE2 
5  1 Y 1 A GLU 462 ? CG  ? A GLU 253 CG  
6  1 Y 1 A GLU 462 ? CD  ? A GLU 253 CD  
7  1 Y 1 A GLU 462 ? OE1 ? A GLU 253 OE1 
8  1 Y 1 A GLU 462 ? OE2 ? A GLU 253 OE2 
9  1 Y 1 A GLN 470 ? CG  ? A GLN 261 CG  
10 1 Y 1 A GLN 470 ? CD  ? A GLN 261 CD  
11 1 Y 1 A GLN 470 ? OE1 ? A GLN 261 OE1 
12 1 Y 1 A GLN 470 ? NE2 ? A GLN 261 NE2 
13 1 Y 1 B GLN 429 ? CG  ? B GLN 220 CG  
14 1 Y 1 B GLN 429 ? CD  ? B GLN 220 CD  
15 1 Y 1 B GLN 429 ? OE1 ? B GLN 220 OE1 
16 1 Y 1 B GLN 429 ? NE2 ? B GLN 220 NE2 
17 1 Y 1 B GLU 462 ? CG  ? B GLU 253 CG  
18 1 Y 1 B GLU 462 ? CD  ? B GLU 253 CD  
19 1 Y 1 B GLU 462 ? OE1 ? B GLU 253 OE1 
20 1 Y 1 B GLU 462 ? OE2 ? B GLU 253 OE2 
21 1 Y 1 B GLN 470 ? CG  ? B GLN 261 CG  
22 1 Y 1 B GLN 470 ? CD  ? B GLN 261 CD  
23 1 Y 1 B GLN 470 ? OE1 ? B GLN 261 OE1 
24 1 Y 1 B GLN 470 ? NE2 ? B GLN 261 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 239 ? A GLY 30  
2  1 Y 1 A LYS 240 ? A LYS 31  
3  1 Y 1 A ALA 241 ? A ALA 32  
4  1 Y 1 A SER 242 ? A SER 33  
5  1 Y 1 A GLN 266 ? A GLN 57  
6  1 Y 1 A LEU 267 ? A LEU 58  
7  1 Y 1 A VAL 268 ? A VAL 59  
8  1 Y 1 A ASN 269 ? A ASN 60  
9  1 Y 1 A GLY 270 ? A GLY 61  
10 1 Y 1 A LEU 271 ? A LEU 62  
11 1 Y 1 A PRO 272 ? A PRO 63  
12 1 Y 1 A PRO 273 ? A PRO 64  
13 1 Y 1 A TYR 274 ? A TYR 65  
14 1 Y 1 A LYS 275 ? A LYS 66  
15 1 Y 1 B GLY 239 ? B GLY 30  
16 1 Y 1 B LYS 240 ? B LYS 31  
17 1 Y 1 B ALA 241 ? B ALA 32  
18 1 Y 1 B SER 242 ? B SER 33  
19 1 Y 1 B HIS 243 ? B HIS 34  
20 1 Y 1 B THR 244 ? B THR 35  
21 1 Y 1 B LYS 265 ? B LYS 56  
22 1 Y 1 B GLN 266 ? B GLN 57  
23 1 Y 1 B LEU 267 ? B LEU 58  
24 1 Y 1 B VAL 268 ? B VAL 59  
25 1 Y 1 B ASN 269 ? B ASN 60  
26 1 Y 1 B GLY 270 ? B GLY 61  
27 1 Y 1 B LEU 271 ? B LEU 62  
28 1 Y 1 B PRO 272 ? B PRO 63  
29 1 Y 1 B PRO 273 ? B PRO 64  
30 1 Y 1 B TYR 274 ? B TYR 65  
31 1 Y 1 B LYS 275 ? B LYS 66  
32 1 Y 1 B TYR 477 ? B TYR 268 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 HEPTYL-BETA-D-GLUCOPYRANOSIDE B7G 
3 'VACCENIC ACID'               VCA 
4 water                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 B7G 1   1920 920 B7G B7G A . 
D 3 VCA 1   1001 1   VCA DRG A . 
E 2 B7G 1   920  920 B7G B7G B . 
F 3 VCA 1   2001 1   VCA DRG B . 
G 4 HOH 1   1921 1   HOH HOH A . 
G 4 HOH 2   1922 5   HOH HOH A . 
G 4 HOH 3   1923 6   HOH HOH A . 
G 4 HOH 4   1924 9   HOH HOH A . 
G 4 HOH 5   1925 13  HOH HOH A . 
G 4 HOH 6   1926 15  HOH HOH A . 
G 4 HOH 7   1927 16  HOH HOH A . 
G 4 HOH 8   1928 18  HOH HOH A . 
G 4 HOH 9   1929 21  HOH HOH A . 
G 4 HOH 10  1930 22  HOH HOH A . 
G 4 HOH 11  1931 23  HOH HOH A . 
G 4 HOH 12  1932 25  HOH HOH A . 
G 4 HOH 13  1933 26  HOH HOH A . 
G 4 HOH 14  1934 27  HOH HOH A . 
G 4 HOH 15  1935 28  HOH HOH A . 
G 4 HOH 16  1936 29  HOH HOH A . 
G 4 HOH 17  1937 30  HOH HOH A . 
G 4 HOH 18  1938 31  HOH HOH A . 
G 4 HOH 19  1939 32  HOH HOH A . 
G 4 HOH 20  1940 35  HOH HOH A . 
G 4 HOH 21  1941 36  HOH HOH A . 
G 4 HOH 22  1942 43  HOH HOH A . 
G 4 HOH 23  1943 45  HOH HOH A . 
G 4 HOH 24  1944 48  HOH HOH A . 
G 4 HOH 25  1945 49  HOH HOH A . 
G 4 HOH 26  1946 52  HOH HOH A . 
G 4 HOH 27  1947 53  HOH HOH A . 
G 4 HOH 28  1948 54  HOH HOH A . 
G 4 HOH 29  1949 56  HOH HOH A . 
G 4 HOH 30  1950 59  HOH HOH A . 
G 4 HOH 31  1951 62  HOH HOH A . 
G 4 HOH 32  1952 68  HOH HOH A . 
G 4 HOH 33  1953 69  HOH HOH A . 
G 4 HOH 34  1954 74  HOH HOH A . 
G 4 HOH 35  1955 75  HOH HOH A . 
G 4 HOH 36  1956 79  HOH HOH A . 
G 4 HOH 37  1957 85  HOH HOH A . 
G 4 HOH 38  1958 86  HOH HOH A . 
G 4 HOH 39  1959 88  HOH HOH A . 
G 4 HOH 40  1960 90  HOH HOH A . 
G 4 HOH 41  1961 94  HOH HOH A . 
G 4 HOH 42  1962 95  HOH HOH A . 
G 4 HOH 43  1963 96  HOH HOH A . 
G 4 HOH 44  1964 97  HOH HOH A . 
G 4 HOH 45  1965 98  HOH HOH A . 
G 4 HOH 46  1966 101 HOH HOH A . 
G 4 HOH 47  1967 105 HOH HOH A . 
G 4 HOH 48  1968 109 HOH HOH A . 
G 4 HOH 49  1969 111 HOH HOH A . 
G 4 HOH 50  1970 112 HOH HOH A . 
G 4 HOH 51  1971 114 HOH HOH A . 
G 4 HOH 52  1972 115 HOH HOH A . 
G 4 HOH 53  1973 117 HOH HOH A . 
G 4 HOH 54  1974 119 HOH HOH A . 
G 4 HOH 55  1975 121 HOH HOH A . 
G 4 HOH 56  1976 122 HOH HOH A . 
G 4 HOH 57  1977 124 HOH HOH A . 
G 4 HOH 58  1978 130 HOH HOH A . 
G 4 HOH 59  1979 131 HOH HOH A . 
G 4 HOH 60  1980 135 HOH HOH A . 
G 4 HOH 61  1981 140 HOH HOH A . 
G 4 HOH 62  1982 141 HOH HOH A . 
G 4 HOH 63  1983 142 HOH HOH A . 
G 4 HOH 64  1984 144 HOH HOH A . 
G 4 HOH 65  1985 149 HOH HOH A . 
G 4 HOH 66  1986 150 HOH HOH A . 
G 4 HOH 67  1987 154 HOH HOH A . 
G 4 HOH 68  1988 157 HOH HOH A . 
G 4 HOH 69  1989 161 HOH HOH A . 
G 4 HOH 70  1990 163 HOH HOH A . 
G 4 HOH 71  1991 164 HOH HOH A . 
G 4 HOH 72  1992 165 HOH HOH A . 
G 4 HOH 73  1993 168 HOH HOH A . 
G 4 HOH 74  1994 169 HOH HOH A . 
G 4 HOH 75  1995 170 HOH HOH A . 
G 4 HOH 76  1996 173 HOH HOH A . 
G 4 HOH 77  1997 174 HOH HOH A . 
G 4 HOH 78  1998 175 HOH HOH A . 
G 4 HOH 79  1999 177 HOH HOH A . 
G 4 HOH 80  2000 178 HOH HOH A . 
G 4 HOH 81  2001 181 HOH HOH A . 
G 4 HOH 82  2002 182 HOH HOH A . 
G 4 HOH 83  2003 183 HOH HOH A . 
G 4 HOH 84  2004 184 HOH HOH A . 
G 4 HOH 85  2005 187 HOH HOH A . 
G 4 HOH 86  2006 189 HOH HOH A . 
G 4 HOH 87  2007 190 HOH HOH A . 
G 4 HOH 88  2008 192 HOH HOH A . 
G 4 HOH 89  2009 196 HOH HOH A . 
G 4 HOH 90  2010 197 HOH HOH A . 
G 4 HOH 91  2011 198 HOH HOH A . 
G 4 HOH 92  2012 199 HOH HOH A . 
G 4 HOH 93  2013 200 HOH HOH A . 
G 4 HOH 94  2014 203 HOH HOH A . 
G 4 HOH 95  2015 204 HOH HOH A . 
G 4 HOH 96  2016 205 HOH HOH A . 
G 4 HOH 97  2017 206 HOH HOH A . 
G 4 HOH 98  2018 209 HOH HOH A . 
G 4 HOH 99  2019 212 HOH HOH A . 
G 4 HOH 100 2020 213 HOH HOH A . 
G 4 HOH 101 2021 216 HOH HOH A . 
G 4 HOH 102 2022 219 HOH HOH A . 
G 4 HOH 103 2023 220 HOH HOH A . 
G 4 HOH 104 2024 221 HOH HOH A . 
G 4 HOH 105 2025 224 HOH HOH A . 
G 4 HOH 106 2026 226 HOH HOH A . 
G 4 HOH 107 2027 227 HOH HOH A . 
G 4 HOH 108 2028 229 HOH HOH A . 
G 4 HOH 109 2029 231 HOH HOH A . 
G 4 HOH 110 2030 233 HOH HOH A . 
G 4 HOH 111 2031 234 HOH HOH A . 
G 4 HOH 112 2032 237 HOH HOH A . 
G 4 HOH 113 2033 238 HOH HOH A . 
G 4 HOH 114 2034 240 HOH HOH A . 
G 4 HOH 115 2035 241 HOH HOH A . 
G 4 HOH 116 2036 242 HOH HOH A . 
G 4 HOH 117 2037 247 HOH HOH A . 
G 4 HOH 118 2038 248 HOH HOH A . 
G 4 HOH 119 2039 249 HOH HOH A . 
G 4 HOH 120 2040 250 HOH HOH A . 
G 4 HOH 121 2041 252 HOH HOH A . 
G 4 HOH 122 2042 253 HOH HOH A . 
G 4 HOH 123 2043 254 HOH HOH A . 
G 4 HOH 124 2044 255 HOH HOH A . 
G 4 HOH 125 2045 256 HOH HOH A . 
G 4 HOH 126 2046 257 HOH HOH A . 
G 4 HOH 127 2047 259 HOH HOH A . 
G 4 HOH 128 2048 260 HOH HOH A . 
G 4 HOH 129 2049 261 HOH HOH A . 
G 4 HOH 130 2050 264 HOH HOH A . 
G 4 HOH 131 2051 265 HOH HOH A . 
H 4 HOH 1   2002 2   HOH HOH B . 
H 4 HOH 2   2003 3   HOH HOH B . 
H 4 HOH 3   2004 4   HOH HOH B . 
H 4 HOH 4   2005 7   HOH HOH B . 
H 4 HOH 5   2006 8   HOH HOH B . 
H 4 HOH 6   2007 10  HOH HOH B . 
H 4 HOH 7   2008 11  HOH HOH B . 
H 4 HOH 8   2009 12  HOH HOH B . 
H 4 HOH 9   2010 14  HOH HOH B . 
H 4 HOH 10  2011 17  HOH HOH B . 
H 4 HOH 11  2012 19  HOH HOH B . 
H 4 HOH 12  2013 20  HOH HOH B . 
H 4 HOH 13  2014 24  HOH HOH B . 
H 4 HOH 14  2015 33  HOH HOH B . 
H 4 HOH 15  2016 34  HOH HOH B . 
H 4 HOH 16  2017 37  HOH HOH B . 
H 4 HOH 17  2018 38  HOH HOH B . 
H 4 HOH 18  2019 39  HOH HOH B . 
H 4 HOH 19  2020 40  HOH HOH B . 
H 4 HOH 20  2021 41  HOH HOH B . 
H 4 HOH 21  2022 42  HOH HOH B . 
H 4 HOH 22  2023 44  HOH HOH B . 
H 4 HOH 23  2024 46  HOH HOH B . 
H 4 HOH 24  2025 47  HOH HOH B . 
H 4 HOH 25  2026 50  HOH HOH B . 
H 4 HOH 26  2027 51  HOH HOH B . 
H 4 HOH 27  2028 55  HOH HOH B . 
H 4 HOH 28  2029 57  HOH HOH B . 
H 4 HOH 29  2030 58  HOH HOH B . 
H 4 HOH 30  2031 60  HOH HOH B . 
H 4 HOH 31  2032 61  HOH HOH B . 
H 4 HOH 32  2033 63  HOH HOH B . 
H 4 HOH 33  2034 64  HOH HOH B . 
H 4 HOH 34  2035 65  HOH HOH B . 
H 4 HOH 35  2036 66  HOH HOH B . 
H 4 HOH 36  2037 67  HOH HOH B . 
H 4 HOH 37  2038 70  HOH HOH B . 
H 4 HOH 38  2039 71  HOH HOH B . 
H 4 HOH 39  2040 72  HOH HOH B . 
H 4 HOH 40  2041 73  HOH HOH B . 
H 4 HOH 41  2042 76  HOH HOH B . 
H 4 HOH 42  2043 77  HOH HOH B . 
H 4 HOH 43  2044 78  HOH HOH B . 
H 4 HOH 44  2045 80  HOH HOH B . 
H 4 HOH 45  2046 81  HOH HOH B . 
H 4 HOH 46  2047 82  HOH HOH B . 
H 4 HOH 47  2048 83  HOH HOH B . 
H 4 HOH 48  2049 84  HOH HOH B . 
H 4 HOH 49  2050 87  HOH HOH B . 
H 4 HOH 50  2051 89  HOH HOH B . 
H 4 HOH 51  2052 91  HOH HOH B . 
H 4 HOH 52  2053 92  HOH HOH B . 
H 4 HOH 53  2054 93  HOH HOH B . 
H 4 HOH 54  2055 99  HOH HOH B . 
H 4 HOH 55  2056 100 HOH HOH B . 
H 4 HOH 56  2057 102 HOH HOH B . 
H 4 HOH 57  2058 103 HOH HOH B . 
H 4 HOH 58  2059 104 HOH HOH B . 
H 4 HOH 59  2060 106 HOH HOH B . 
H 4 HOH 60  2061 107 HOH HOH B . 
H 4 HOH 61  2062 108 HOH HOH B . 
H 4 HOH 62  2063 110 HOH HOH B . 
H 4 HOH 63  2064 113 HOH HOH B . 
H 4 HOH 64  2065 116 HOH HOH B . 
H 4 HOH 65  2066 118 HOH HOH B . 
H 4 HOH 66  2067 120 HOH HOH B . 
H 4 HOH 67  2068 123 HOH HOH B . 
H 4 HOH 68  2069 125 HOH HOH B . 
H 4 HOH 69  2070 126 HOH HOH B . 
H 4 HOH 70  2071 127 HOH HOH B . 
H 4 HOH 71  2072 128 HOH HOH B . 
H 4 HOH 72  2073 129 HOH HOH B . 
H 4 HOH 73  2074 132 HOH HOH B . 
H 4 HOH 74  2075 133 HOH HOH B . 
H 4 HOH 75  2076 134 HOH HOH B . 
H 4 HOH 76  2077 136 HOH HOH B . 
H 4 HOH 77  2078 137 HOH HOH B . 
H 4 HOH 78  2079 138 HOH HOH B . 
H 4 HOH 79  2080 139 HOH HOH B . 
H 4 HOH 80  2081 143 HOH HOH B . 
H 4 HOH 81  2082 145 HOH HOH B . 
H 4 HOH 82  2083 146 HOH HOH B . 
H 4 HOH 83  2084 147 HOH HOH B . 
H 4 HOH 84  2085 148 HOH HOH B . 
H 4 HOH 85  2086 151 HOH HOH B . 
H 4 HOH 86  2087 152 HOH HOH B . 
H 4 HOH 87  2088 153 HOH HOH B . 
H 4 HOH 88  2089 155 HOH HOH B . 
H 4 HOH 89  2090 156 HOH HOH B . 
H 4 HOH 90  2091 158 HOH HOH B . 
H 4 HOH 91  2092 159 HOH HOH B . 
H 4 HOH 92  2093 160 HOH HOH B . 
H 4 HOH 93  2094 162 HOH HOH B . 
H 4 HOH 94  2095 166 HOH HOH B . 
H 4 HOH 95  2096 167 HOH HOH B . 
H 4 HOH 96  2097 171 HOH HOH B . 
H 4 HOH 97  2098 172 HOH HOH B . 
H 4 HOH 98  2099 176 HOH HOH B . 
H 4 HOH 99  2100 179 HOH HOH B . 
H 4 HOH 100 2101 180 HOH HOH B . 
H 4 HOH 101 2102 185 HOH HOH B . 
H 4 HOH 102 2103 186 HOH HOH B . 
H 4 HOH 103 2104 188 HOH HOH B . 
H 4 HOH 104 2105 191 HOH HOH B . 
H 4 HOH 105 2106 193 HOH HOH B . 
H 4 HOH 106 2107 194 HOH HOH B . 
H 4 HOH 107 2108 195 HOH HOH B . 
H 4 HOH 108 2109 201 HOH HOH B . 
H 4 HOH 109 2110 202 HOH HOH B . 
H 4 HOH 110 2111 207 HOH HOH B . 
H 4 HOH 111 2112 208 HOH HOH B . 
H 4 HOH 112 2113 210 HOH HOH B . 
H 4 HOH 113 2114 211 HOH HOH B . 
H 4 HOH 114 2115 214 HOH HOH B . 
H 4 HOH 115 2116 215 HOH HOH B . 
H 4 HOH 116 2117 217 HOH HOH B . 
H 4 HOH 117 2118 218 HOH HOH B . 
H 4 HOH 118 2119 222 HOH HOH B . 
H 4 HOH 119 2120 223 HOH HOH B . 
H 4 HOH 120 2121 225 HOH HOH B . 
H 4 HOH 121 2122 228 HOH HOH B . 
H 4 HOH 122 2123 230 HOH HOH B . 
H 4 HOH 123 2124 232 HOH HOH B . 
H 4 HOH 124 2125 235 HOH HOH B . 
H 4 HOH 125 2126 236 HOH HOH B . 
H 4 HOH 126 2127 239 HOH HOH B . 
H 4 HOH 127 2128 243 HOH HOH B . 
H 4 HOH 128 2129 244 HOH HOH B . 
H 4 HOH 129 2130 245 HOH HOH B . 
H 4 HOH 130 2131 246 HOH HOH B . 
H 4 HOH 131 2132 251 HOH HOH B . 
H 4 HOH 132 2133 258 HOH HOH B . 
H 4 HOH 133 2134 262 HOH HOH B . 
H 4 HOH 134 2135 263 HOH HOH B . 
#