data_2AWP
# 
_entry.id   2AWP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AWP         
RCSB  RCSB034403   
WWPDB D_1000034403 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AWP 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, A.'                             1  
'Zhao, Y.'                             2  
'Lew, J.'                              3  
'Alam, Z.'                             4  
'Melone, M.'                           5  
'Wasney, G.'                           6  
'Vedadi, M.'                           7  
'Koeieradzki, I.'                      8  
'Edwards, A.M.'                        9  
'Arrowsmith, C.H.'                     10 
'Weigelt, J.'                          11 
'Sundstrom, M.'                        12 
'Bochkarev, A.'                        13 
'Hui, R.'                              14 
'Amani, M.'                            15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.' 
_citation.journal_abbrev            Mol.Biochem.Parasitol. 
_citation.journal_volume            151 
_citation.page_first                100 
_citation.page_last                 110 
_citation.year                      2007 
_citation.journal_id_ASTM           MBIPDP 
_citation.country                   NE 
_citation.journal_id_ISSN           0166-6851 
_citation.journal_id_CSD            2085 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17125854 
_citation.pdbx_database_id_DOI      10.1016/j.molbiopara.2006.10.011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vedadi, M.'       1  
primary 'Lew, J.'          2  
primary 'Artz, J.'         3  
primary 'Amani, M.'        4  
primary 'Zhao, Y.'         5  
primary 'Dong, A.'         6  
primary 'Wasney, G.A.'     7  
primary 'Gao, M.'          8  
primary 'Hills, T.'        9  
primary 'Brokx, S.'        10 
primary 'Qiu, W.'          11 
primary 'Sharma, S.'       12 
primary 'Diassiti, A.'     13 
primary 'Alam, Z.'         14 
primary 'Melone, M.'       15 
primary 'Mulichak, A.'     16 
primary 'Wernimont, A.'    17 
primary 'Bray, J.'         18 
primary 'Loppnau, P.'      19 
primary 'Plotnikova, O.'   20 
primary 'Newberry, K.'     21 
primary 'Sundararajan, E.' 22 
primary 'Houston, S.'      23 
primary 'Walker, J.'       24 
primary 'Tempel, W.'       25 
primary 'Bochkarev, A.'    26 
primary 'Kozieradzki, I.'  27 
primary 'Edwards, A.'      28 
primary 'Arrowsmith, C.'   29 
primary 'Roos, D.'         30 
primary 'Kain, K.'         31 
primary 'Hui, R.'          32 
# 
_cell.entry_id           2AWP 
_cell.length_a           55.240 
_cell.length_b           79.053 
_cell.length_c           88.672 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2AWP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Iron Super-Oxide Dismutase' 22711.605 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'CHLORIDE ION'               35.453    2   ?        ? ? ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'        ?         3   ?        ? ? ? 
4 water       nat water                        18.015    559 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDS
MGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIW
EHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKKALQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDS
MGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIW
EHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKKALQK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ILE n 
1 4   ILE n 
1 5   LEU n 
1 6   PRO n 
1 7   LYS n 
1 8   LEU n 
1 9   LYS n 
1 10  TYR n 
1 11  ALA n 
1 12  LEU n 
1 13  ASN n 
1 14  ALA n 
1 15  LEU n 
1 16  SER n 
1 17  PRO n 
1 18  HIS n 
1 19  ILE n 
1 20  SER n 
1 21  GLU n 
1 22  GLU n 
1 23  THR n 
1 24  LEU n 
1 25  ASN n 
1 26  PHE n 
1 27  HIS n 
1 28  TYR n 
1 29  ASN n 
1 30  LYS n 
1 31  HIS n 
1 32  HIS n 
1 33  ALA n 
1 34  GLY n 
1 35  TYR n 
1 36  VAL n 
1 37  ASN n 
1 38  LYS n 
1 39  LEU n 
1 40  ASN n 
1 41  GLY n 
1 42  LEU n 
1 43  ILE n 
1 44  LYS n 
1 45  ASP n 
1 46  THR n 
1 47  PRO n 
1 48  PHE n 
1 49  ALA n 
1 50  THR n 
1 51  LYS n 
1 52  SER n 
1 53  LEU n 
1 54  VAL n 
1 55  GLU n 
1 56  ILE n 
1 57  MET n 
1 58  LYS n 
1 59  GLU n 
1 60  SER n 
1 61  THR n 
1 62  GLY n 
1 63  ALA n 
1 64  ILE n 
1 65  PHE n 
1 66  ASN n 
1 67  ASN n 
1 68  ALA n 
1 69  ALA n 
1 70  GLN n 
1 71  ILE n 
1 72  TRP n 
1 73  ASN n 
1 74  HIS n 
1 75  SER n 
1 76  PHE n 
1 77  TYR n 
1 78  TRP n 
1 79  ASP n 
1 80  SER n 
1 81  MET n 
1 82  GLY n 
1 83  PRO n 
1 84  ASN n 
1 85  CYS n 
1 86  GLY n 
1 87  GLY n 
1 88  GLU n 
1 89  PRO n 
1 90  HIS n 
1 91  GLY n 
1 92  GLU n 
1 93  ILE n 
1 94  LYS n 
1 95  GLU n 
1 96  LYS n 
1 97  ILE n 
1 98  GLN n 
1 99  GLU n 
1 100 ASP n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 PHE n 
1 105 ASN n 
1 106 ASN n 
1 107 PHE n 
1 108 LYS n 
1 109 ASN n 
1 110 GLU n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 VAL n 
1 115 LEU n 
1 116 CYS n 
1 117 GLY n 
1 118 HIS n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 GLY n 
1 123 TRP n 
1 124 GLY n 
1 125 TRP n 
1 126 LEU n 
1 127 VAL n 
1 128 LEU n 
1 129 ASN n 
1 130 ASN n 
1 131 ASN n 
1 132 ASN n 
1 133 LYS n 
1 134 LEU n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLN n 
1 139 THR n 
1 140 HIS n 
1 141 ASP n 
1 142 ALA n 
1 143 GLY n 
1 144 ASN n 
1 145 PRO n 
1 146 ILE n 
1 147 LYS n 
1 148 ASP n 
1 149 ASN n 
1 150 THR n 
1 151 GLY n 
1 152 ILE n 
1 153 PRO n 
1 154 ILE n 
1 155 LEU n 
1 156 THR n 
1 157 CYS n 
1 158 ASP n 
1 159 ILE n 
1 160 TRP n 
1 161 GLU n 
1 162 HIS n 
1 163 ALA n 
1 164 TYR n 
1 165 TYR n 
1 166 ILE n 
1 167 ASP n 
1 168 TYR n 
1 169 ARG n 
1 170 ASN n 
1 171 ASP n 
1 172 ARG n 
1 173 PRO n 
1 174 SER n 
1 175 TYR n 
1 176 VAL n 
1 177 LYS n 
1 178 ALA n 
1 179 TRP n 
1 180 TRP n 
1 181 ASN n 
1 182 LEU n 
1 183 VAL n 
1 184 ASN n 
1 185 TRP n 
1 186 ASN n 
1 187 PHE n 
1 188 ALA n 
1 189 ASN n 
1 190 GLU n 
1 191 ASN n 
1 192 LEU n 
1 193 LYS n 
1 194 LYS n 
1 195 ALA n 
1 196 LEU n 
1 197 GLN n 
1 198 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Plasmodium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Plasmodium knowlesi' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5850 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pET28aLIC 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2AWP 
_struct_ref.pdbx_db_accession          2AWP 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AWP A 1 ? 198 ? 2AWP 1 ? 198 ? 1 198 
2 1 2AWP B 1 ? 198 ? 2AWP 1 ? 198 ? 1 198 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'        ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2AWP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.pdbx_details    
'30%PEG4K,0.2M NH4 Acetate,0.1M Na Cacodylate,5mM MnCl2, pH 5.1, VAPOR DIFFUSION, temperature 297K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2005-08-05 
_diffrn_detector.details                VeriMax 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    VeriMax 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     2AWP 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   26770 
_reflns.number_all                   26770 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.157 
_reflns.pdbx_Rsym_value              0.157 
_reflns.pdbx_netI_over_sigmaI        4.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   90.7 
_reflns_shell.Rmerge_I_obs           0.578 
_reflns_shell.pdbx_Rsym_value        0.578 
_reflns_shell.meanI_over_sigI_obs    2.43 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AWP 
_refine.ls_number_reflns_obs                     25638 
_refine.ls_number_reflns_all                     25638 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.45 
_refine.ls_R_factor_obs                          0.1609 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15817 
_refine.ls_R_factor_R_free                       0.2254 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.1 
_refine.ls_number_reflns_R_free                  1091 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               14.707 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            -0.94 
_refine.aniso_B[3][3]                            0.91 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2AO3 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.190 
_refine.pdbx_overall_ESU_R_Free                  0.175 
_refine.overall_SU_ML                            0.107 
_refine.overall_SU_B                             3.712 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3177 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             559 
_refine_hist.number_atoms_total               3741 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.021  ? 3277 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.355  1.906  ? 4456 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.998  5.000  ? 390  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.980 25.385 ? 169  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.434 15.000 ? 523  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       5.586  15.000 ? 4    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.102  0.200  ? 456  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 2560 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.199  0.200  ? 1723 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 2244 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.145  0.200  ? 404  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.176  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.193  0.200  ? 50   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.785  1.500  ? 2001 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.252  2.000  ? 3126 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.077  3.000  ? 1516 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.110  4.500  ? 1330 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.053 
_refine_ls_shell.number_reflns_R_work             1839 
_refine_ls_shell.R_factor_R_work                  0.18 
_refine_ls_shell.percent_reflns_obs               97.88 
_refine_ls_shell.R_factor_R_free                  0.264 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             97 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2AWP 
_struct.title                     'Crystal structure of Plasmodium knowlesi structure of Iron Super-Oxide Dismutase' 
_struct.pdbx_descriptor           'Iron Super-Oxide Dismutase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AWP 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'Iron Super-Oxide Dismutase, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 20  ? LYS A 30  ? SER A 20  LYS A 30  1 ? 11 
HELX_P HELX_P2  2  LYS A 30  ? LYS A 44  ? LYS A 30  LYS A 44  1 ? 15 
HELX_P HELX_P3  3  THR A 46  ? LYS A 51  ? THR A 46  LYS A 51  5 ? 6  
HELX_P HELX_P4  4  SER A 52  ? SER A 60  ? SER A 52  SER A 60  1 ? 9  
HELX_P HELX_P5  5  THR A 61  ? SER A 80  ? THR A 61  SER A 80  1 ? 20 
HELX_P HELX_P6  6  GLY A 91  ? GLY A 102 ? GLY A 91  GLY A 102 1 ? 12 
HELX_P HELX_P7  7  SER A 103 ? HIS A 118 ? SER A 103 HIS A 118 1 ? 16 
HELX_P HELX_P8  8  ASN A 144 ? ASN A 149 ? ASN A 144 ASN A 149 1 ? 6  
HELX_P HELX_P9  9  TRP A 160 ? ALA A 163 ? TRP A 160 ALA A 163 5 ? 4  
HELX_P HELX_P10 10 TYR A 164 ? ARG A 169 ? TYR A 164 ARG A 169 1 ? 6  
HELX_P HELX_P11 11 ASP A 171 ? TRP A 180 ? ASP A 171 TRP A 180 1 ? 10 
HELX_P HELX_P12 12 ASN A 184 ? GLN A 197 ? ASN A 184 GLN A 197 1 ? 14 
HELX_P HELX_P13 13 SER B 20  ? LYS B 30  ? SER B 20  LYS B 30  1 ? 11 
HELX_P HELX_P14 14 LYS B 30  ? LYS B 44  ? LYS B 30  LYS B 44  1 ? 15 
HELX_P HELX_P15 15 THR B 46  ? LYS B 51  ? THR B 46  LYS B 51  5 ? 6  
HELX_P HELX_P16 16 SER B 52  ? SER B 60  ? SER B 52  SER B 60  1 ? 9  
HELX_P HELX_P17 17 THR B 61  ? SER B 80  ? THR B 61  SER B 80  1 ? 20 
HELX_P HELX_P18 18 GLY B 91  ? GLY B 102 ? GLY B 91  GLY B 102 1 ? 12 
HELX_P HELX_P19 19 SER B 103 ? HIS B 118 ? SER B 103 HIS B 118 1 ? 16 
HELX_P HELX_P20 20 ASN B 144 ? ASN B 149 ? ASN B 144 ASN B 149 1 ? 6  
HELX_P HELX_P21 21 TRP B 160 ? ALA B 163 ? TRP B 160 ALA B 163 5 ? 4  
HELX_P HELX_P22 22 TYR B 164 ? ARG B 169 ? TYR B 164 ARG B 169 1 ? 6  
HELX_P HELX_P23 23 ASP B 171 ? TRP B 180 ? ASP B 171 TRP B 180 1 ? 10 
HELX_P HELX_P24 24 ASN B 184 ? LEU B 196 ? ASN B 184 LEU B 196 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 16 A . ? SER 16 A PRO 17 A ? PRO 17 A 1 -3.05 
2 SER 16 B . ? SER 16 B PRO 17 B ? PRO 17 B 1 0.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 134 ? HIS A 140 ? LEU A 134 HIS A 140 
A 2 GLY A 122 ? ASN A 129 ? GLY A 122 ASN A 129 
A 3 GLY A 151 ? ASP A 158 ? GLY A 151 ASP A 158 
B 1 LEU B 134 ? HIS B 140 ? LEU B 134 HIS B 140 
B 2 GLY B 122 ? LEU B 128 ? GLY B 122 LEU B 128 
B 3 ILE B 152 ? ASP B 158 ? ILE B 152 ASP B 158 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 137 ? O LEU A 137 N TRP A 125 ? N TRP A 125 
A 2 3 N LEU A 126 ? N LEU A 126 O ILE A 154 ? O ILE A 154 
B 1 2 O LEU B 137 ? O LEU B 137 N TRP B 125 ? N TRP B 125 
B 2 3 N LEU B 126 ? N LEU B 126 O ILE B 154 ? O ILE B 154 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 2001'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 2002'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE UNX A 1000' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE UNX B 1001' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE UNX B 3001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HOH H .   ? HOH A 2105 . ? 4_575 ? 
2  AC1 4 HIS B 90  ? HIS B 90   . ? 1_555 ? 
3  AC1 4 TRP B 185 ? TRP B 185  . ? 1_555 ? 
4  AC1 4 HOH I .   ? HOH B 3060 . ? 1_555 ? 
5  AC2 3 ASN A 25  ? ASN A 25   . ? 1_555 ? 
6  AC2 3 HIS B 90  ? HIS B 90   . ? 4_475 ? 
7  AC2 3 GLY B 91  ? GLY B 91   . ? 4_475 ? 
8  AC3 5 HIS A 27  ? HIS A 27   . ? 1_555 ? 
9  AC3 5 HIS A 74  ? HIS A 74   . ? 1_555 ? 
10 AC3 5 ASP A 158 ? ASP A 158  . ? 1_555 ? 
11 AC3 5 HIS A 162 ? HIS A 162  . ? 1_555 ? 
12 AC3 5 HOH H .   ? HOH A 2015 . ? 1_555 ? 
13 AC4 5 HIS B 27  ? HIS B 27   . ? 1_555 ? 
14 AC4 5 HIS B 74  ? HIS B 74   . ? 1_555 ? 
15 AC4 5 ASP B 158 ? ASP B 158  . ? 1_555 ? 
16 AC4 5 HIS B 162 ? HIS B 162  . ? 1_555 ? 
17 AC4 5 HOH I .   ? HOH B 3004 . ? 1_555 ? 
18 AC5 1 ASP B 167 ? ASP B 167  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AWP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AWP 
_atom_sites.fract_transf_matrix[1][1]   0.018103 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012650 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011278 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 24.204 85.540  -1.423  1.00 34.33  ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 25.489 84.824  -1.663  1.00 33.39  ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 25.347 83.391  -1.193  1.00 32.50  ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 25.285 83.123  0.007   1.00 33.22  ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 26.641 85.513  -0.935  1.00 35.12  ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 26.950 86.933  -1.435  1.00 37.06  ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 27.764 86.937  -3.054  1.00 44.25  ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 27.562 88.667  -3.517  1.00 40.95  ? 1    MET A CE  1 
ATOM   9    N  N   . ALA A 1 2   ? 25.276 82.477  -2.154  1.00 30.35  ? 2    ALA A N   1 
ATOM   10   C  CA  . ALA A 1 2   ? 25.163 81.052  -1.897  1.00 28.47  ? 2    ALA A CA  1 
ATOM   11   C  C   . ALA A 1 2   ? 25.926 80.526  -0.654  1.00 26.70  ? 2    ALA A C   1 
ATOM   12   O  O   . ALA A 1 2   ? 25.353 79.751  0.122   1.00 27.85  ? 2    ALA A O   1 
ATOM   13   C  CB  . ALA A 1 2   ? 25.548 80.269  -3.140  1.00 28.76  ? 2    ALA A CB  1 
ATOM   14   N  N   . ILE A 1 3   ? 27.195 80.906  -0.467  1.00 23.43  ? 3    ILE A N   1 
ATOM   15   C  CA  . ILE A 1 3   ? 27.961 80.407  0.709   1.00 20.56  ? 3    ILE A CA  1 
ATOM   16   C  C   . ILE A 1 3   ? 28.015 81.484  1.804   1.00 18.08  ? 3    ILE A C   1 
ATOM   17   O  O   . ILE A 1 3   ? 28.418 82.621  1.556   1.00 16.12  ? 3    ILE A O   1 
ATOM   18   C  CB  . ILE A 1 3   ? 29.404 79.892  0.347   1.00 20.43  ? 3    ILE A CB  1 
ATOM   19   C  CG1 . ILE A 1 3   ? 29.392 78.912  -0.842  1.00 20.59  ? 3    ILE A CG1 1 
ATOM   20   C  CG2 . ILE A 1 3   ? 30.119 79.265  1.579   1.00 21.77  ? 3    ILE A CG2 1 
ATOM   21   C  CD1 . ILE A 1 3   ? 28.777 77.561  -0.555  1.00 22.03  ? 3    ILE A CD1 1 
ATOM   22   N  N   . ILE A 1 4   ? 27.590 81.112  3.006   1.00 16.58  ? 4    ILE A N   1 
ATOM   23   C  CA  . ILE A 1 4   ? 27.596 82.020  4.152   1.00 15.90  ? 4    ILE A CA  1 
ATOM   24   C  C   . ILE A 1 4   ? 28.628 81.601  5.181   1.00 14.54  ? 4    ILE A C   1 
ATOM   25   O  O   . ILE A 1 4   ? 28.699 80.423  5.539   1.00 15.59  ? 4    ILE A O   1 
ATOM   26   C  CB  . ILE A 1 4   ? 26.194 82.093  4.843   1.00 16.21  ? 4    ILE A CB  1 
ATOM   27   C  CG1 . ILE A 1 4   ? 25.139 82.637  3.849   1.00 17.22  ? 4    ILE A CG1 1 
ATOM   28   C  CG2 . ILE A 1 4   ? 26.249 82.960  6.122   1.00 16.31  ? 4    ILE A CG2 1 
ATOM   29   C  CD1 . ILE A 1 4   ? 23.651 82.409  4.271   1.00 15.63  ? 4    ILE A CD1 1 
ATOM   30   N  N   . LEU A 1 5   ? 29.410 82.566  5.668   1.00 13.96  ? 5    LEU A N   1 
ATOM   31   C  CA  . LEU A 1 5   ? 30.345 82.357  6.795   1.00 12.71  ? 5    LEU A CA  1 
ATOM   32   C  C   . LEU A 1 5   ? 29.606 81.928  8.087   1.00 13.12  ? 5    LEU A C   1 
ATOM   33   O  O   . LEU A 1 5   ? 28.843 82.703  8.655   1.00 12.57  ? 5    LEU A O   1 
ATOM   34   C  CB  . LEU A 1 5   ? 31.168 83.635  7.057   1.00 12.15  ? 5    LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 5   ? 32.243 83.537  8.157   1.00 12.31  ? 5    LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 5   ? 33.351 82.533  7.771   1.00 8.02   ? 5    LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 5   ? 32.853 84.935  8.543   1.00 12.38  ? 5    LEU A CD2 1 
ATOM   38   N  N   . PRO A 1 6   ? 29.826 80.685  8.556   1.00 13.32  ? 6    PRO A N   1 
ATOM   39   C  CA  . PRO A 1 6   ? 29.180 80.316  9.806   1.00 13.25  ? 6    PRO A CA  1 
ATOM   40   C  C   . PRO A 1 6   ? 29.723 81.096  10.965  1.00 13.89  ? 6    PRO A C   1 
ATOM   41   O  O   . PRO A 1 6   ? 30.923 81.377  11.024  1.00 13.64  ? 6    PRO A O   1 
ATOM   42   C  CB  . PRO A 1 6   ? 29.514 78.825  9.959   1.00 13.28  ? 6    PRO A CB  1 
ATOM   43   C  CG  . PRO A 1 6   ? 29.778 78.369  8.581   1.00 13.26  ? 6    PRO A CG  1 
ATOM   44   C  CD  . PRO A 1 6   ? 30.541 79.539  7.967   1.00 13.13  ? 6    PRO A CD  1 
ATOM   45   N  N   . LYS A 1 7   ? 28.833 81.457  11.881  1.00 14.27  ? 7    LYS A N   1 
ATOM   46   C  CA  . LYS A 1 7   ? 29.223 82.143  13.113  1.00 15.49  ? 7    LYS A CA  1 
ATOM   47   C  C   . LYS A 1 7   ? 30.146 81.296  13.983  1.00 15.29  ? 7    LYS A C   1 
ATOM   48   O  O   . LYS A 1 7   ? 30.031 80.061  14.037  1.00 15.17  ? 7    LYS A O   1 
ATOM   49   C  CB  . LYS A 1 7   ? 27.967 82.528  13.923  1.00 16.02  ? 7    LYS A CB  1 
ATOM   50   C  CG  . LYS A 1 7   ? 27.125 83.635  13.298  1.00 20.05  ? 7    LYS A CG  1 
ATOM   51   C  CD  . LYS A 1 7   ? 27.878 84.954  13.379  1.00 25.44  ? 7    LYS A CD  1 
ATOM   52   C  CE  . LYS A 1 7   ? 27.010 86.140  12.997  1.00 31.04  ? 7    LYS A CE  1 
ATOM   53   N  NZ  . LYS A 1 7   ? 27.503 87.404  13.641  1.00 32.69  ? 7    LYS A NZ  1 
ATOM   54   N  N   . LEU A 1 8   ? 31.058 81.981  14.664  1.00 15.66  ? 8    LEU A N   1 
ATOM   55   C  CA  . LEU A 1 8   ? 31.733 81.432  15.844  1.00 15.40  ? 8    LEU A CA  1 
ATOM   56   C  C   . LEU A 1 8   ? 30.714 81.134  16.939  1.00 15.68  ? 8    LEU A C   1 
ATOM   57   O  O   . LEU A 1 8   ? 29.748 81.879  17.123  1.00 14.84  ? 8    LEU A O   1 
ATOM   58   C  CB  . LEU A 1 8   ? 32.765 82.422  16.389  1.00 14.74  ? 8    LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 8   ? 33.966 82.884  15.548  1.00 15.66  ? 8    LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 8   ? 34.778 83.863  16.337  1.00 13.04  ? 8    LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 8   ? 34.884 81.741  15.091  1.00 12.81  ? 8    LEU A CD2 1 
ATOM   62   N  N   . LYS A 1 9   ? 30.972 80.077  17.709  1.00 15.07  ? 9    LYS A N   1 
ATOM   63   C  CA  . LYS A 1 9   ? 30.065 79.669  18.769  1.00 15.03  ? 9    LYS A CA  1 
ATOM   64   C  C   . LYS A 1 9   ? 30.358 80.348  20.106  1.00 15.01  ? 9    LYS A C   1 
ATOM   65   O  O   . LYS A 1 9   ? 29.845 79.933  21.156  1.00 15.83  ? 9    LYS A O   1 
ATOM   66   C  CB  . LYS A 1 9   ? 30.110 78.138  18.885  1.00 14.42  ? 9    LYS A CB  1 
ATOM   67   C  CG  . LYS A 1 9   ? 29.525 77.475  17.606  1.00 15.95  ? 9    LYS A CG  1 
ATOM   68   C  CD  . LYS A 1 9   ? 29.679 75.964  17.621  1.00 19.02  ? 9    LYS A CD  1 
ATOM   69   C  CE  . LYS A 1 9   ? 28.734 75.356  16.591  1.00 21.74  ? 9    LYS A CE  1 
ATOM   70   N  NZ  . LYS A 1 9   ? 29.171 75.697  15.221  1.00 26.03  ? 9    LYS A NZ  1 
ATOM   71   N  N   . TYR A 1 10  ? 31.213 81.362  20.051  1.00 14.00  ? 10   TYR A N   1 
ATOM   72   C  CA  . TYR A 1 10  ? 31.740 82.051  21.211  1.00 13.98  ? 10   TYR A CA  1 
ATOM   73   C  C   . TYR A 1 10  ? 32.248 83.431  20.776  1.00 14.43  ? 10   TYR A C   1 
ATOM   74   O  O   . TYR A 1 10  ? 32.406 83.730  19.571  1.00 13.61  ? 10   TYR A O   1 
ATOM   75   C  CB  . TYR A 1 10  ? 32.897 81.252  21.878  1.00 13.31  ? 10   TYR A CB  1 
ATOM   76   C  CG  . TYR A 1 10  ? 33.880 80.614  20.902  1.00 12.40  ? 10   TYR A CG  1 
ATOM   77   C  CD1 . TYR A 1 10  ? 34.829 81.394  20.205  1.00 13.39  ? 10   TYR A CD1 1 
ATOM   78   C  CD2 . TYR A 1 10  ? 33.845 79.241  20.650  1.00 11.55  ? 10   TYR A CD2 1 
ATOM   79   C  CE1 . TYR A 1 10  ? 35.718 80.817  19.290  1.00 12.76  ? 10   TYR A CE1 1 
ATOM   80   C  CE2 . TYR A 1 10  ? 34.725 78.653  19.739  1.00 12.34  ? 10   TYR A CE2 1 
ATOM   81   C  CZ  . TYR A 1 10  ? 35.671 79.450  19.072  1.00 11.50  ? 10   TYR A CZ  1 
ATOM   82   O  OH  . TYR A 1 10  ? 36.544 78.890  18.186  1.00 10.94  ? 10   TYR A OH  1 
ATOM   83   N  N   . ALA A 1 11  ? 32.518 84.259  21.774  1.00 14.56  ? 11   ALA A N   1 
ATOM   84   C  CA  . ALA A 1 11  ? 32.995 85.614  21.560  1.00 14.63  ? 11   ALA A CA  1 
ATOM   85   C  C   . ALA A 1 11  ? 34.438 85.626  21.018  1.00 15.21  ? 11   ALA A C   1 
ATOM   86   O  O   . ALA A 1 11  ? 35.213 84.661  21.195  1.00 15.37  ? 11   ALA A O   1 
ATOM   87   C  CB  . ALA A 1 11  ? 32.894 86.420  22.868  1.00 14.67  ? 11   ALA A CB  1 
ATOM   88   N  N   . LEU A 1 12  ? 34.773 86.734  20.366  1.00 13.82  ? 12   LEU A N   1 
ATOM   89   C  CA  . LEU A 1 12  ? 36.049 86.933  19.709  1.00 13.96  ? 12   LEU A CA  1 
ATOM   90   C  C   . LEU A 1 12  ? 37.205 86.870  20.692  1.00 13.07  ? 12   LEU A C   1 
ATOM   91   O  O   . LEU A 1 12  ? 38.309 86.521  20.318  1.00 12.49  ? 12   LEU A O   1 
ATOM   92   C  CB  . LEU A 1 12  ? 36.024 88.298  18.994  1.00 14.11  ? 12   LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 12  ? 36.771 88.480  17.693  1.00 13.23  ? 12   LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 12  ? 36.186 87.593  16.605  1.00 11.34  ? 12   LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 12  ? 36.678 89.935  17.304  1.00 11.85  ? 12   LEU A CD2 1 
ATOM   96   N  N   . ASN A 1 13  ? 36.940 87.204  21.954  1.00 12.31  ? 13   ASN A N   1 
ATOM   97   C  CA  . ASN A 1 13  ? 37.953 87.153  23.003  1.00 13.09  ? 13   ASN A CA  1 
ATOM   98   C  C   . ASN A 1 13  ? 37.864 85.859  23.841  1.00 12.18  ? 13   ASN A C   1 
ATOM   99   O  O   . ASN A 1 13  ? 38.536 85.753  24.846  1.00 13.59  ? 13   ASN A O   1 
ATOM   100  C  CB  . ASN A 1 13  ? 37.841 88.382  23.946  1.00 12.50  ? 13   ASN A CB  1 
ATOM   101  C  CG  . ASN A 1 13  ? 36.577 88.357  24.765  1.00 15.15  ? 13   ASN A CG  1 
ATOM   102  O  OD1 . ASN A 1 13  ? 35.722 87.512  24.546  1.00 14.66  ? 13   ASN A OD1 1 
ATOM   103  N  ND2 . ASN A 1 13  ? 36.424 89.308  25.673  1.00 16.98  ? 13   ASN A ND2 1 
ATOM   104  N  N   . ALA A 1 14  ? 37.017 84.906  23.457  1.00 12.30  ? 14   ALA A N   1 
ATOM   105  C  CA  . ALA A 1 14  ? 36.713 83.757  24.327  1.00 11.82  ? 14   ALA A CA  1 
ATOM   106  C  C   . ALA A 1 14  ? 37.870 82.777  24.431  1.00 12.03  ? 14   ALA A C   1 
ATOM   107  O  O   . ALA A 1 14  ? 37.898 81.946  25.355  1.00 12.25  ? 14   ALA A O   1 
ATOM   108  C  CB  . ALA A 1 14  ? 35.431 83.019  23.856  1.00 11.24  ? 14   ALA A CB  1 
ATOM   109  N  N   . LEU A 1 15  ? 38.825 82.858  23.496  1.00 12.10  ? 15   LEU A N   1 
ATOM   110  C  CA  . LEU A 1 15  ? 39.967 81.937  23.510  1.00 12.48  ? 15   LEU A CA  1 
ATOM   111  C  C   . LEU A 1 15  ? 41.209 82.571  24.123  1.00 12.23  ? 15   LEU A C   1 
ATOM   112  O  O   . LEU A 1 15  ? 42.260 81.972  24.161  1.00 12.29  ? 15   LEU A O   1 
ATOM   113  C  CB  . LEU A 1 15  ? 40.266 81.347  22.118  1.00 11.66  ? 15   LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 15  ? 39.036 80.866  21.335  1.00 12.61  ? 15   LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 15  ? 39.435 80.348  19.931  1.00 7.69   ? 15   LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 15  ? 38.258 79.783  22.088  1.00 10.23  ? 15   LEU A CD2 1 
ATOM   117  N  N   . SER A 1 16  ? 41.058 83.773  24.658  1.00 13.40  ? 16   SER A N   1 
ATOM   118  C  CA  . SER A 1 16  ? 42.174 84.519  25.214  1.00 14.16  ? 16   SER A CA  1 
ATOM   119  C  C   . SER A 1 16  ? 42.521 83.903  26.594  1.00 14.41  ? 16   SER A C   1 
ATOM   120  O  O   . SER A 1 16  ? 41.655 83.326  27.224  1.00 15.03  ? 16   SER A O   1 
ATOM   121  C  CB  . SER A 1 16  ? 41.752 85.985  25.339  1.00 15.08  ? 16   SER A CB  1 
ATOM   122  O  OG  . SER A 1 16  ? 42.853 86.774  25.744  1.00 20.44  ? 16   SER A OG  1 
ATOM   123  N  N   . PRO A 1 17  ? 43.794 83.971  27.034  1.00 14.19  ? 17   PRO A N   1 
ATOM   124  C  CA  . PRO A 1 17  ? 44.954 84.526  26.314  1.00 13.95  ? 17   PRO A CA  1 
ATOM   125  C  C   . PRO A 1 17  ? 45.670 83.512  25.380  1.00 14.17  ? 17   PRO A C   1 
ATOM   126  O  O   . PRO A 1 17  ? 46.752 83.824  24.831  1.00 13.70  ? 17   PRO A O   1 
ATOM   127  C  CB  . PRO A 1 17  ? 45.867 84.943  27.462  1.00 13.35  ? 17   PRO A CB  1 
ATOM   128  C  CG  . PRO A 1 17  ? 45.673 83.753  28.436  1.00 14.63  ? 17   PRO A CG  1 
ATOM   129  C  CD  . PRO A 1 17  ? 44.186 83.463  28.368  1.00 14.27  ? 17   PRO A CD  1 
ATOM   130  N  N   . HIS A 1 18  ? 45.092 82.315  25.223  1.00 13.17  ? 18   HIS A N   1 
ATOM   131  C  CA  . HIS A 1 18  ? 45.706 81.237  24.423  1.00 12.02  ? 18   HIS A CA  1 
ATOM   132  C  C   . HIS A 1 18  ? 45.860 81.615  22.954  1.00 12.04  ? 18   HIS A C   1 
ATOM   133  O  O   . HIS A 1 18  ? 46.919 81.407  22.351  1.00 12.27  ? 18   HIS A O   1 
ATOM   134  C  CB  . HIS A 1 18  ? 44.917 79.940  24.632  1.00 11.24  ? 18   HIS A CB  1 
ATOM   135  C  CG  . HIS A 1 18  ? 44.629 79.672  26.078  1.00 11.55  ? 18   HIS A CG  1 
ATOM   136  N  ND1 . HIS A 1 18  ? 45.634 79.553  27.013  1.00 13.33  ? 18   HIS A ND1 1 
ATOM   137  C  CD2 . HIS A 1 18  ? 43.462 79.613  26.770  1.00 9.34   ? 18   HIS A CD2 1 
ATOM   138  C  CE1 . HIS A 1 18  ? 45.103 79.384  28.214  1.00 12.22  ? 18   HIS A CE1 1 
ATOM   139  N  NE2 . HIS A 1 18  ? 43.787 79.418  28.093  1.00 14.01  ? 18   HIS A NE2 1 
ATOM   140  N  N   . ILE A 1 19  ? 44.778 82.139  22.390  1.00 11.69  ? 19   ILE A N   1 
ATOM   141  C  CA  . ILE A 1 19  ? 44.769 82.818  21.131  1.00 11.10  ? 19   ILE A CA  1 
ATOM   142  C  C   . ILE A 1 19  ? 44.007 84.116  21.411  1.00 11.72  ? 19   ILE A C   1 
ATOM   143  O  O   . ILE A 1 19  ? 42.865 84.092  21.895  1.00 10.95  ? 19   ILE A O   1 
ATOM   144  C  CB  . ILE A 1 19  ? 44.049 81.997  20.045  1.00 12.00  ? 19   ILE A CB  1 
ATOM   145  C  CG1 . ILE A 1 19  ? 44.721 80.614  19.843  1.00 10.92  ? 19   ILE A CG1 1 
ATOM   146  C  CG2 . ILE A 1 19  ? 44.020 82.777  18.711  1.00 9.55   ? 19   ILE A CG2 1 
ATOM   147  C  CD1 . ILE A 1 19  ? 43.868 79.654  19.005  1.00 11.26  ? 19   ILE A CD1 1 
ATOM   148  N  N   . SER A 1 20  ? 44.641 85.237  21.084  1.00 11.73  ? 20   SER A N   1 
ATOM   149  C  CA  . SER A 1 20  ? 44.114 86.561  21.375  1.00 10.68  ? 20   SER A CA  1 
ATOM   150  C  C   . SER A 1 20  ? 42.870 86.958  20.591  1.00 10.69  ? 20   SER A C   1 
ATOM   151  O  O   . SER A 1 20  ? 42.580 86.421  19.527  1.00 9.86   ? 20   SER A O   1 
ATOM   152  C  CB  . SER A 1 20  ? 45.217 87.607  21.145  1.00 10.52  ? 20   SER A CB  1 
ATOM   153  O  OG  . SER A 1 20  ? 45.536 87.760  19.771  1.00 9.45   ? 20   SER A OG  1 
ATOM   154  N  N   . GLU A 1 21  ? 42.130 87.920  21.133  1.00 10.36  ? 21   GLU A N   1 
ATOM   155  C  CA  . GLU A 1 21  ? 41.059 88.547  20.394  1.00 11.29  ? 21   GLU A CA  1 
ATOM   156  C  C   . GLU A 1 21  ? 41.552 89.139  19.049  1.00 10.15  ? 21   GLU A C   1 
ATOM   157  O  O   . GLU A 1 21  ? 40.896 88.989  18.021  1.00 9.55   ? 21   GLU A O   1 
ATOM   158  C  CB  . GLU A 1 21  ? 40.372 89.632  21.262  1.00 10.99  ? 21   GLU A CB  1 
ATOM   159  C  CG  . GLU A 1 21  ? 39.088 90.158  20.618  1.00 13.20  ? 21   GLU A CG  1 
ATOM   160  C  CD  . GLU A 1 21  ? 38.435 91.255  21.462  1.00 14.75  ? 21   GLU A CD  1 
ATOM   161  O  OE1 . GLU A 1 21  ? 38.846 91.443  22.626  1.00 18.90  ? 21   GLU A OE1 1 
ATOM   162  O  OE2 . GLU A 1 21  ? 37.525 91.919  20.951  1.00 21.51  ? 21   GLU A OE2 1 
ATOM   163  N  N   . GLU A 1 22  ? 42.695 89.801  19.054  1.00 10.49  ? 22   GLU A N   1 
ATOM   164  C  CA  . GLU A 1 22  ? 43.270 90.302  17.796  1.00 10.28  ? 22   GLU A CA  1 
ATOM   165  C  C   . GLU A 1 22  ? 43.436 89.198  16.752  1.00 9.69   ? 22   GLU A C   1 
ATOM   166  O  O   . GLU A 1 22  ? 43.061 89.377  15.589  1.00 8.99   ? 22   GLU A O   1 
ATOM   167  C  CB  . GLU A 1 22  ? 44.614 90.989  18.022  1.00 11.12  ? 22   GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 22  ? 45.182 91.583  16.728  1.00 10.20  ? 22   GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 22  ? 46.515 92.323  16.887  1.00 11.82  ? 22   GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 22  ? 47.011 92.481  18.037  1.00 13.79  ? 22   GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 22  ? 47.073 92.723  15.831  1.00 12.99  ? 22   GLU A OE2 1 
ATOM   172  N  N   . THR A 1 23  ? 44.008 88.070  17.164  1.00 9.57   ? 23   THR A N   1 
ATOM   173  C  CA  . THR A 1 23  ? 44.131 86.886  16.272  1.00 8.80   ? 23   THR A CA  1 
ATOM   174  C  C   . THR A 1 23  ? 42.776 86.439  15.731  1.00 9.07   ? 23   THR A C   1 
ATOM   175  O  O   . THR A 1 23  ? 42.613 86.347  14.522  1.00 9.77   ? 23   THR A O   1 
ATOM   176  C  CB  . THR A 1 23  ? 44.934 85.713  16.903  1.00 7.30   ? 23   THR A CB  1 
ATOM   177  O  OG1 . THR A 1 23  ? 46.312 86.100  17.030  1.00 8.00   ? 23   THR A OG1 1 
ATOM   178  C  CG2 . THR A 1 23  ? 44.898 84.454  16.005  1.00 6.64   ? 23   THR A CG2 1 
ATOM   179  N  N   . LEU A 1 24  ? 41.797 86.206  16.611  1.00 9.46   ? 24   LEU A N   1 
ATOM   180  C  CA  . LEU A 1 24  ? 40.454 85.855  16.152  1.00 9.03   ? 24   LEU A CA  1 
ATOM   181  C  C   . LEU A 1 24  ? 39.923 86.908  15.201  1.00 8.75   ? 24   LEU A C   1 
ATOM   182  O  O   . LEU A 1 24  ? 39.347 86.559  14.184  1.00 8.35   ? 24   LEU A O   1 
ATOM   183  C  CB  . LEU A 1 24  ? 39.482 85.589  17.323  1.00 9.57   ? 24   LEU A CB  1 
ATOM   184  C  CG  . LEU A 1 24  ? 39.362 84.081  17.635  1.00 11.58  ? 24   LEU A CG  1 
ATOM   185  C  CD1 . LEU A 1 24  ? 40.743 83.520  18.006  1.00 13.64  ? 24   LEU A CD1 1 
ATOM   186  C  CD2 . LEU A 1 24  ? 38.361 83.813  18.732  1.00 7.34   ? 24   LEU A CD2 1 
ATOM   187  N  N   . ASN A 1 25  ? 40.141 88.187  15.506  1.00 8.28   ? 25   ASN A N   1 
ATOM   188  C  CA  . ASN A 1 25  ? 39.703 89.263  14.590  1.00 8.65   ? 25   ASN A CA  1 
ATOM   189  C  C   . ASN A 1 25  ? 40.265 89.095  13.161  1.00 8.84   ? 25   ASN A C   1 
ATOM   190  O  O   . ASN A 1 25  ? 39.501 88.999  12.195  1.00 9.73   ? 25   ASN A O   1 
ATOM   191  C  CB  . ASN A 1 25  ? 39.981 90.676  15.160  1.00 7.83   ? 25   ASN A CB  1 
ATOM   192  C  CG  . ASN A 1 25  ? 39.145 91.765  14.471  1.00 9.91   ? 25   ASN A CG  1 
ATOM   193  O  OD1 . ASN A 1 25  ? 38.091 91.475  13.875  1.00 11.21  ? 25   ASN A OD1 1 
ATOM   194  N  ND2 . ASN A 1 25  ? 39.605 93.020  14.550  1.00 8.94   ? 25   ASN A ND2 1 
ATOM   195  N  N   . PHE A 1 26  ? 41.577 89.011  13.024  1.00 8.45   ? 26   PHE A N   1 
ATOM   196  C  CA  . PHE A 1 26  ? 42.172 88.805  11.689  1.00 9.56   ? 26   PHE A CA  1 
ATOM   197  C  C   . PHE A 1 26  ? 41.831 87.434  11.062  1.00 9.13   ? 26   PHE A C   1 
ATOM   198  O  O   . PHE A 1 26  ? 41.443 87.341  9.893   1.00 10.01  ? 26   PHE A O   1 
ATOM   199  C  CB  . PHE A 1 26  ? 43.701 89.056  11.719  1.00 8.96   ? 26   PHE A CB  1 
ATOM   200  C  CG  . PHE A 1 26  ? 44.083 90.508  11.850  1.00 8.58   ? 26   PHE A CG  1 
ATOM   201  C  CD1 . PHE A 1 26  ? 44.148 91.324  10.734  1.00 8.54   ? 26   PHE A CD1 1 
ATOM   202  C  CD2 . PHE A 1 26  ? 44.334 91.073  13.106  1.00 11.39  ? 26   PHE A CD2 1 
ATOM   203  C  CE1 . PHE A 1 26  ? 44.472 92.697  10.847  1.00 10.38  ? 26   PHE A CE1 1 
ATOM   204  C  CE2 . PHE A 1 26  ? 44.659 92.454  13.246  1.00 11.40  ? 26   PHE A CE2 1 
ATOM   205  C  CZ  . PHE A 1 26  ? 44.736 93.269  12.105  1.00 9.40   ? 26   PHE A CZ  1 
ATOM   206  N  N   . HIS A 1 27  ? 41.938 86.385  11.866  1.00 9.42   ? 27   HIS A N   1 
ATOM   207  C  CA  . HIS A 1 27  ? 41.830 85.024  11.386  1.00 8.94   ? 27   HIS A CA  1 
ATOM   208  C  C   . HIS A 1 27  ? 40.399 84.748  10.933  1.00 9.32   ? 27   HIS A C   1 
ATOM   209  O  O   . HIS A 1 27  ? 40.187 84.278  9.806   1.00 8.55   ? 27   HIS A O   1 
ATOM   210  C  CB  . HIS A 1 27  ? 42.258 84.075  12.500  1.00 8.93   ? 27   HIS A CB  1 
ATOM   211  C  CG  . HIS A 1 27  ? 42.708 82.723  12.031  1.00 8.27   ? 27   HIS A CG  1 
ATOM   212  N  ND1 . HIS A 1 27  ? 43.293 81.814  12.882  1.00 8.53   ? 27   HIS A ND1 1 
ATOM   213  C  CD2 . HIS A 1 27  ? 42.672 82.125  10.815  1.00 7.14   ? 27   HIS A CD2 1 
ATOM   214  C  CE1 . HIS A 1 27  ? 43.570 80.705  12.227  1.00 5.57   ? 27   HIS A CE1 1 
ATOM   215  N  NE2 . HIS A 1 27  ? 43.191 80.865  10.982  1.00 5.96   ? 27   HIS A NE2 1 
ATOM   216  N  N   . TYR A 1 28  ? 39.429 85.127  11.762  1.00 8.90   ? 28   TYR A N   1 
ATOM   217  C  CA  . TYR A 1 28  ? 38.009 84.917  11.413  1.00 10.15  ? 28   TYR A CA  1 
ATOM   218  C  C   . TYR A 1 28  ? 37.423 85.998  10.486  1.00 10.36  ? 28   TYR A C   1 
ATOM   219  O  O   . TYR A 1 28  ? 36.864 85.683  9.440   1.00 10.58  ? 28   TYR A O   1 
ATOM   220  C  CB  . TYR A 1 28  ? 37.153 84.764  12.679  1.00 10.12  ? 28   TYR A CB  1 
ATOM   221  C  CG  . TYR A 1 28  ? 35.677 84.566  12.398  1.00 11.23  ? 28   TYR A CG  1 
ATOM   222  C  CD1 . TYR A 1 28  ? 35.210 83.359  11.869  1.00 10.66  ? 28   TYR A CD1 1 
ATOM   223  C  CD2 . TYR A 1 28  ? 34.754 85.606  12.626  1.00 10.33  ? 28   TYR A CD2 1 
ATOM   224  C  CE1 . TYR A 1 28  ? 33.824 83.150  11.606  1.00 13.09  ? 28   TYR A CE1 1 
ATOM   225  C  CE2 . TYR A 1 28  ? 33.377 85.421  12.359  1.00 11.85  ? 28   TYR A CE2 1 
ATOM   226  C  CZ  . TYR A 1 28  ? 32.922 84.192  11.862  1.00 11.83  ? 28   TYR A CZ  1 
ATOM   227  O  OH  . TYR A 1 28  ? 31.570 84.000  11.592  1.00 13.55  ? 28   TYR A OH  1 
ATOM   228  N  N   . ASN A 1 29  ? 37.557 87.265  10.867  1.00 11.21  ? 29   ASN A N   1 
ATOM   229  C  CA  . ASN A 1 29  ? 36.920 88.360  10.113  1.00 10.68  ? 29   ASN A CA  1 
ATOM   230  C  C   . ASN A 1 29  ? 37.669 88.767  8.847   1.00 9.81   ? 29   ASN A C   1 
ATOM   231  O  O   . ASN A 1 29  ? 37.071 89.325  7.927   1.00 9.25   ? 29   ASN A O   1 
ATOM   232  C  CB  . ASN A 1 29  ? 36.672 89.587  11.022  1.00 11.61  ? 29   ASN A CB  1 
ATOM   233  C  CG  . ASN A 1 29  ? 35.562 89.352  12.053  1.00 12.22  ? 29   ASN A CG  1 
ATOM   234  O  OD1 . ASN A 1 29  ? 34.468 88.852  11.744  1.00 13.61  ? 29   ASN A OD1 1 
ATOM   235  N  ND2 . ASN A 1 29  ? 35.844 89.732  13.304  1.00 12.31  ? 29   ASN A ND2 1 
ATOM   236  N  N   . LYS A 1 30  ? 38.968 88.469  8.770   1.00 8.28   ? 30   LYS A N   1 
ATOM   237  C  CA  . LYS A 1 30  ? 39.727 88.754  7.551   1.00 7.71   ? 30   LYS A CA  1 
ATOM   238  C  C   . LYS A 1 30  ? 40.005 87.503  6.678   1.00 6.61   ? 30   LYS A C   1 
ATOM   239  O  O   . LYS A 1 30  ? 39.486 87.389  5.575   1.00 6.41   ? 30   LYS A O   1 
ATOM   240  C  CB  . LYS A 1 30  ? 41.004 89.538  7.881   1.00 6.80   ? 30   LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 30  ? 40.776 90.812  8.689   1.00 10.95  ? 30   LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 30  ? 39.843 91.832  7.974   1.00 11.47  ? 30   LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 30  ? 39.116 92.693  9.037   1.00 15.23  ? 30   LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 30  ? 38.341 93.831  8.443   1.00 12.85  ? 30   LYS A NZ  1 
ATOM   245  N  N   . HIS A 1 31  ? 40.822 86.569  7.177   1.00 7.27   ? 31   HIS A N   1 
ATOM   246  C  CA  . HIS A 1 31  ? 41.125 85.335  6.448   1.00 6.54   ? 31   HIS A CA  1 
ATOM   247  C  C   . HIS A 1 31  ? 39.895 84.496  6.110   1.00 6.71   ? 31   HIS A C   1 
ATOM   248  O  O   . HIS A 1 31  ? 39.601 84.273  4.925   1.00 6.52   ? 31   HIS A O   1 
ATOM   249  C  CB  . HIS A 1 31  ? 42.216 84.493  7.184   1.00 6.59   ? 31   HIS A CB  1 
ATOM   250  C  CG  . HIS A 1 31  ? 43.562 85.163  7.229   1.00 8.37   ? 31   HIS A CG  1 
ATOM   251  N  ND1 . HIS A 1 31  ? 44.415 85.201  6.140   1.00 7.14   ? 31   HIS A ND1 1 
ATOM   252  C  CD2 . HIS A 1 31  ? 44.188 85.849  8.219   1.00 9.04   ? 31   HIS A CD2 1 
ATOM   253  C  CE1 . HIS A 1 31  ? 45.532 85.822  6.480   1.00 10.36  ? 31   HIS A CE1 1 
ATOM   254  N  NE2 . HIS A 1 31  ? 45.422 86.225  7.734   1.00 9.44   ? 31   HIS A NE2 1 
ATOM   255  N  N   . HIS A 1 32  ? 39.154 84.064  7.130   1.00 6.49   ? 32   HIS A N   1 
ATOM   256  C  CA  . HIS A 1 32  ? 38.031 83.132  6.955   1.00 6.82   ? 32   HIS A CA  1 
ATOM   257  C  C   . HIS A 1 32  ? 36.920 83.796  6.103   1.00 7.46   ? 32   HIS A C   1 
ATOM   258  O  O   . HIS A 1 32  ? 36.425 83.236  5.096   1.00 5.87   ? 32   HIS A O   1 
ATOM   259  C  CB  . HIS A 1 32  ? 37.501 82.672  8.338   1.00 6.55   ? 32   HIS A CB  1 
ATOM   260  C  CG  . HIS A 1 32  ? 36.671 81.412  8.297   1.00 7.06   ? 32   HIS A CG  1 
ATOM   261  N  ND1 . HIS A 1 32  ? 36.226 80.780  9.441   1.00 7.56   ? 32   HIS A ND1 1 
ATOM   262  C  CD2 . HIS A 1 32  ? 36.182 80.692  7.254   1.00 5.46   ? 32   HIS A CD2 1 
ATOM   263  C  CE1 . HIS A 1 32  ? 35.509 79.721  9.103   1.00 6.60   ? 32   HIS A CE1 1 
ATOM   264  N  NE2 . HIS A 1 32  ? 35.464 79.649  7.784   1.00 8.28   ? 32   HIS A NE2 1 
ATOM   265  N  N   . ALA A 1 33  ? 36.570 85.023  6.474   1.00 7.47   ? 33   ALA A N   1 
ATOM   266  C  CA  . ALA A 1 33  ? 35.557 85.772  5.709   1.00 8.21   ? 33   ALA A CA  1 
ATOM   267  C  C   . ALA A 1 33  ? 35.980 85.915  4.247   1.00 8.10   ? 33   ALA A C   1 
ATOM   268  O  O   . ALA A 1 33  ? 35.155 85.783  3.329   1.00 8.75   ? 33   ALA A O   1 
ATOM   269  C  CB  . ALA A 1 33  ? 35.333 87.150  6.347   1.00 7.33   ? 33   ALA A CB  1 
ATOM   270  N  N   . GLY A 1 34  ? 37.274 86.196  4.057   1.00 8.38   ? 34   GLY A N   1 
ATOM   271  C  CA  . GLY A 1 34  ? 37.914 86.325  2.759   1.00 8.93   ? 34   GLY A CA  1 
ATOM   272  C  C   . GLY A 1 34  ? 37.804 85.115  1.848   1.00 9.98   ? 34   GLY A C   1 
ATOM   273  O  O   . GLY A 1 34  ? 37.630 85.277  0.625   1.00 8.90   ? 34   GLY A O   1 
ATOM   274  N  N   . TYR A 1 35  ? 37.941 83.903  2.415   1.00 9.99   ? 35   TYR A N   1 
ATOM   275  C  CA  . TYR A 1 35  ? 37.773 82.677  1.633   1.00 10.05  ? 35   TYR A CA  1 
ATOM   276  C  C   . TYR A 1 35  ? 36.314 82.484  1.171   1.00 11.04  ? 35   TYR A C   1 
ATOM   277  O  O   . TYR A 1 35  ? 36.087 82.029  0.054   1.00 10.99  ? 35   TYR A O   1 
ATOM   278  C  CB  . TYR A 1 35  ? 38.163 81.455  2.434   1.00 10.23  ? 35   TYR A CB  1 
ATOM   279  C  CG  . TYR A 1 35  ? 39.641 81.342  2.802   1.00 10.84  ? 35   TYR A CG  1 
ATOM   280  C  CD1 . TYR A 1 35  ? 40.621 81.260  1.812   1.00 10.21  ? 35   TYR A CD1 1 
ATOM   281  C  CD2 . TYR A 1 35  ? 40.026 81.222  4.134   1.00 9.56   ? 35   TYR A CD2 1 
ATOM   282  C  CE1 . TYR A 1 35  ? 41.975 81.126  2.134   1.00 10.52  ? 35   TYR A CE1 1 
ATOM   283  C  CE2 . TYR A 1 35  ? 41.393 81.086  4.491   1.00 10.74  ? 35   TYR A CE2 1 
ATOM   284  C  CZ  . TYR A 1 35  ? 42.352 81.027  3.492   1.00 11.31  ? 35   TYR A CZ  1 
ATOM   285  O  OH  . TYR A 1 35  ? 43.681 80.881  3.842   1.00 14.08  ? 35   TYR A OH  1 
ATOM   286  N  N   . VAL A 1 36  ? 35.351 82.799  2.048   1.00 10.58  ? 36   VAL A N   1 
ATOM   287  C  CA  . VAL A 1 36  ? 33.926 82.832  1.678   1.00 10.88  ? 36   VAL A CA  1 
ATOM   288  C  C   . VAL A 1 36  ? 33.655 83.831  0.531   1.00 11.27  ? 36   VAL A C   1 
ATOM   289  O  O   . VAL A 1 36  ? 33.076 83.445  -0.480  1.00 11.38  ? 36   VAL A O   1 
ATOM   290  C  CB  . VAL A 1 36  ? 33.007 83.113  2.889   1.00 11.52  ? 36   VAL A CB  1 
ATOM   291  C  CG1 . VAL A 1 36  ? 31.546 83.300  2.472   1.00 10.74  ? 36   VAL A CG1 1 
ATOM   292  C  CG2 . VAL A 1 36  ? 33.090 81.985  3.921   1.00 9.59   ? 36   VAL A CG2 1 
ATOM   293  N  N   . ASN A 1 37  ? 34.088 85.086  0.678   1.00 11.42  ? 37   ASN A N   1 
ATOM   294  C  CA  . ASN A 1 37  ? 33.864 86.105  -0.337  1.00 12.83  ? 37   ASN A CA  1 
ATOM   295  C  C   . ASN A 1 37  ? 34.520 85.685  -1.635  1.00 13.60  ? 37   ASN A C   1 
ATOM   296  O  O   . ASN A 1 37  ? 33.911 85.797  -2.712  1.00 13.87  ? 37   ASN A O   1 
ATOM   297  C  CB  . ASN A 1 37  ? 34.346 87.498  0.140   1.00 13.14  ? 37   ASN A CB  1 
ATOM   298  C  CG  . ASN A 1 37  ? 33.678 87.912  1.447   1.00 13.87  ? 37   ASN A CG  1 
ATOM   299  O  OD1 . ASN A 1 37  ? 32.595 87.413  1.762   1.00 16.90  ? 37   ASN A OD1 1 
ATOM   300  N  ND2 . ASN A 1 37  ? 34.323 88.782  2.232   1.00 12.22  ? 37   ASN A ND2 1 
ATOM   301  N  N   . LYS A 1 38  ? 35.716 85.111  -1.532  1.00 13.32  ? 38   LYS A N   1 
ATOM   302  C  CA  . LYS A 1 38  ? 36.425 84.716  -2.728  1.00 14.15  ? 38   LYS A CA  1 
ATOM   303  C  C   . LYS A 1 38  ? 35.737 83.552  -3.437  1.00 13.83  ? 38   LYS A C   1 
ATOM   304  O  O   . LYS A 1 38  ? 35.576 83.578  -4.657  1.00 13.91  ? 38   LYS A O   1 
ATOM   305  C  CB  . LYS A 1 38  ? 37.902 84.429  -2.435  1.00 14.35  ? 38   LYS A CB  1 
ATOM   306  C  CG  . LYS A 1 38  ? 38.677 83.952  -3.672  1.00 18.00  ? 38   LYS A CG  1 
ATOM   307  C  CD  . LYS A 1 38  ? 39.713 84.960  -4.124  1.00 26.00  ? 38   LYS A CD  1 
ATOM   308  C  CE  . LYS A 1 38  ? 39.143 85.997  -5.108  1.00 30.18  ? 38   LYS A CE  1 
ATOM   309  N  NZ  . LYS A 1 38  ? 39.122 85.510  -6.537  1.00 34.71  ? 38   LYS A NZ  1 
ATOM   310  N  N   . LEU A 1 39  ? 35.342 82.526  -2.685  1.00 13.16  ? 39   LEU A N   1 
ATOM   311  C  CA  . LEU A 1 39  ? 34.652 81.387  -3.288  1.00 12.96  ? 39   LEU A CA  1 
ATOM   312  C  C   . LEU A 1 39  ? 33.382 81.788  -4.018  1.00 12.71  ? 39   LEU A C   1 
ATOM   313  O  O   . LEU A 1 39  ? 33.146 81.331  -5.141  1.00 11.92  ? 39   LEU A O   1 
ATOM   314  C  CB  . LEU A 1 39  ? 34.305 80.315  -2.252  1.00 12.24  ? 39   LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 39  ? 33.698 79.031  -2.839  1.00 11.92  ? 39   LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 39  ? 34.725 78.241  -3.659  1.00 11.41  ? 39   LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 39  ? 33.104 78.190  -1.716  1.00 11.35  ? 39   LEU A CD2 1 
ATOM   318  N  N   . ASN A 1 40  ? 32.567 82.626  -3.378  1.00 12.91  ? 40   ASN A N   1 
ATOM   319  C  CA  . ASN A 1 40  ? 31.314 83.094  -3.999  1.00 14.64  ? 40   ASN A CA  1 
ATOM   320  C  C   . ASN A 1 40  ? 31.560 83.765  -5.351  1.00 14.97  ? 40   ASN A C   1 
ATOM   321  O  O   . ASN A 1 40  ? 30.804 83.555  -6.287  1.00 15.94  ? 40   ASN A O   1 
ATOM   322  C  CB  . ASN A 1 40  ? 30.519 84.001  -3.024  1.00 14.37  ? 40   ASN A CB  1 
ATOM   323  C  CG  . ASN A 1 40  ? 29.766 83.198  -1.984  1.00 14.28  ? 40   ASN A CG  1 
ATOM   324  O  OD1 . ASN A 1 40  ? 29.117 82.200  -2.313  1.00 13.35  ? 40   ASN A OD1 1 
ATOM   325  N  ND2 . ASN A 1 40  ? 29.857 83.608  -0.730  1.00 10.60  ? 40   ASN A ND2 1 
ATOM   326  N  N   . GLY A 1 41  ? 32.640 84.535  -5.452  1.00 16.22  ? 41   GLY A N   1 
ATOM   327  C  CA  . GLY A 1 41  ? 33.059 85.139  -6.723  1.00 17.37  ? 41   GLY A CA  1 
ATOM   328  C  C   . GLY A 1 41  ? 33.447 84.096  -7.760  1.00 18.43  ? 41   GLY A C   1 
ATOM   329  O  O   . GLY A 1 41  ? 33.053 84.171  -8.918  1.00 18.42  ? 41   GLY A O   1 
ATOM   330  N  N   . LEU A 1 42  ? 34.186 83.091  -7.324  1.00 18.46  ? 42   LEU A N   1 
ATOM   331  C  CA  . LEU A 1 42  ? 34.697 82.067  -8.213  1.00 18.54  ? 42   LEU A CA  1 
ATOM   332  C  C   . LEU A 1 42  ? 33.654 81.095  -8.761  1.00 18.72  ? 42   LEU A C   1 
ATOM   333  O  O   . LEU A 1 42  ? 33.814 80.589  -9.893  1.00 18.03  ? 42   LEU A O   1 
ATOM   334  C  CB  . LEU A 1 42  ? 35.763 81.254  -7.478  1.00 18.41  ? 42   LEU A CB  1 
ATOM   335  C  CG  . LEU A 1 42  ? 37.093 81.929  -7.187  1.00 20.93  ? 42   LEU A CG  1 
ATOM   336  C  CD1 . LEU A 1 42  ? 37.967 80.955  -6.411  1.00 21.77  ? 42   LEU A CD1 1 
ATOM   337  C  CD2 . LEU A 1 42  ? 37.773 82.408  -8.468  1.00 20.26  ? 42   LEU A CD2 1 
ATOM   338  N  N   . ILE A 1 43  ? 32.613 80.814  -7.971  1.00 18.36  ? 43   ILE A N   1 
ATOM   339  C  CA  . ILE A 1 43  ? 31.637 79.769  -8.351  1.00 19.79  ? 43   ILE A CA  1 
ATOM   340  C  C   . ILE A 1 43  ? 30.493 80.251  -9.255  1.00 21.59  ? 43   ILE A C   1 
ATOM   341  O  O   . ILE A 1 43  ? 29.805 79.445  -9.886  1.00 21.41  ? 43   ILE A O   1 
ATOM   342  C  CB  . ILE A 1 43  ? 31.134 78.918  -7.151  1.00 19.44  ? 43   ILE A CB  1 
ATOM   343  C  CG1 . ILE A 1 43  ? 30.244 79.734  -6.199  1.00 18.37  ? 43   ILE A CG1 1 
ATOM   344  C  CG2 . ILE A 1 43  ? 32.335 78.222  -6.478  1.00 17.55  ? 43   ILE A CG2 1 
ATOM   345  C  CD1 . ILE A 1 43  ? 29.754 78.973  -4.953  1.00 18.36  ? 43   ILE A CD1 1 
ATOM   346  N  N   . LYS A 1 44  ? 30.332 81.563  -9.338  1.00 24.12  ? 44   LYS A N   1 
ATOM   347  C  CA  . LYS A 1 44  ? 29.437 82.185  -10.321 1.00 26.77  ? 44   LYS A CA  1 
ATOM   348  C  C   . LYS A 1 44  ? 29.749 81.659  -11.748 1.00 27.59  ? 44   LYS A C   1 
ATOM   349  O  O   . LYS A 1 44  ? 30.922 81.577  -12.157 1.00 27.99  ? 44   LYS A O   1 
ATOM   350  C  CB  . LYS A 1 44  ? 29.531 83.717  -10.184 1.00 27.10  ? 44   LYS A CB  1 
ATOM   351  C  CG  . LYS A 1 44  ? 29.104 84.541  -11.400 1.00 31.81  ? 44   LYS A CG  1 
ATOM   352  C  CD  . LYS A 1 44  ? 27.659 85.061  -11.358 1.00 37.00  ? 44   LYS A CD  1 
ATOM   353  C  CE  . LYS A 1 44  ? 27.593 86.504  -10.843 1.00 41.09  ? 44   LYS A CE  1 
ATOM   354  N  NZ  . LYS A 1 44  ? 26.211 87.097  -10.880 1.00 42.51  ? 44   LYS A NZ  1 
ATOM   355  N  N   . ASP A 1 45  ? 28.695 81.251  -12.463 1.00 28.07  ? 45   ASP A N   1 
ATOM   356  C  CA  . ASP A 1 45  ? 28.765 80.805  -13.860 1.00 28.75  ? 45   ASP A CA  1 
ATOM   357  C  C   . ASP A 1 45  ? 29.496 79.482  -13.996 1.00 28.37  ? 45   ASP A C   1 
ATOM   358  O  O   . ASP A 1 45  ? 30.081 79.177  -15.042 1.00 29.00  ? 45   ASP A O   1 
ATOM   359  C  CB  . ASP A 1 45  ? 29.411 81.866  -14.769 1.00 29.06  ? 45   ASP A CB  1 
ATOM   360  C  CG  . ASP A 1 45  ? 28.693 83.201  -14.722 1.00 31.18  ? 45   ASP A CG  1 
ATOM   361  O  OD1 . ASP A 1 45  ? 27.449 83.221  -14.835 1.00 35.80  ? 45   ASP A OD1 1 
ATOM   362  O  OD2 . ASP A 1 45  ? 29.376 84.242  -14.583 1.00 34.38  ? 45   ASP A OD2 1 
ATOM   363  N  N   . THR A 1 46  ? 29.463 78.702  -12.925 1.00 27.65  ? 46   THR A N   1 
ATOM   364  C  CA  . THR A 1 46  ? 30.001 77.363  -12.928 1.00 26.53  ? 46   THR A CA  1 
ATOM   365  C  C   . THR A 1 46  ? 28.912 76.429  -12.389 1.00 25.85  ? 46   THR A C   1 
ATOM   366  O  O   . THR A 1 46  ? 27.984 76.886  -11.708 1.00 26.01  ? 46   THR A O   1 
ATOM   367  C  CB  . THR A 1 46  ? 31.296 77.275  -12.046 1.00 26.73  ? 46   THR A CB  1 
ATOM   368  O  OG1 . THR A 1 46  ? 30.946 77.266  -10.652 1.00 25.49  ? 46   THR A OG1 1 
ATOM   369  C  CG2 . THR A 1 46  ? 32.244 78.453  -12.334 1.00 26.65  ? 46   THR A CG2 1 
ATOM   370  N  N   . PRO A 1 47  ? 29.022 75.117  -12.669 1.00 25.09  ? 47   PRO A N   1 
ATOM   371  C  CA  . PRO A 1 47  ? 28.169 74.127  -11.977 1.00 23.98  ? 47   PRO A CA  1 
ATOM   372  C  C   . PRO A 1 47  ? 28.352 74.063  -10.449 1.00 22.90  ? 47   PRO A C   1 
ATOM   373  O  O   . PRO A 1 47  ? 27.536 73.454  -9.752  1.00 22.75  ? 47   PRO A O   1 
ATOM   374  C  CB  . PRO A 1 47  ? 28.599 72.789  -12.602 1.00 24.69  ? 47   PRO A CB  1 
ATOM   375  C  CG  . PRO A 1 47  ? 29.296 73.129  -13.836 1.00 25.24  ? 47   PRO A CG  1 
ATOM   376  C  CD  . PRO A 1 47  ? 29.922 74.483  -13.650 1.00 25.12  ? 47   PRO A CD  1 
ATOM   377  N  N   . PHE A 1 48  ? 29.407 74.693  -9.918  1.00 21.22  ? 48   PHE A N   1 
ATOM   378  C  CA  . PHE A 1 48  ? 29.613 74.715  -8.466  1.00 18.92  ? 48   PHE A CA  1 
ATOM   379  C  C   . PHE A 1 48  ? 28.643 75.664  -7.758  1.00 18.69  ? 48   PHE A C   1 
ATOM   380  O  O   . PHE A 1 48  ? 28.420 75.550  -6.550  1.00 16.71  ? 48   PHE A O   1 
ATOM   381  C  CB  . PHE A 1 48  ? 31.091 75.007  -8.127  1.00 18.76  ? 48   PHE A CB  1 
ATOM   382  C  CG  . PHE A 1 48  ? 32.032 73.938  -8.605  1.00 16.63  ? 48   PHE A CG  1 
ATOM   383  C  CD1 . PHE A 1 48  ? 32.112 72.713  -7.940  1.00 17.63  ? 48   PHE A CD1 1 
ATOM   384  C  CD2 . PHE A 1 48  ? 32.826 74.139  -9.733  1.00 18.29  ? 48   PHE A CD2 1 
ATOM   385  C  CE1 . PHE A 1 48  ? 32.959 71.685  -8.415  1.00 17.63  ? 48   PHE A CE1 1 
ATOM   386  C  CE2 . PHE A 1 48  ? 33.671 73.133  -10.202 1.00 15.91  ? 48   PHE A CE2 1 
ATOM   387  C  CZ  . PHE A 1 48  ? 33.747 71.913  -9.549  1.00 17.39  ? 48   PHE A CZ  1 
ATOM   388  N  N   . ALA A 1 49  ? 28.040 76.576  -8.530  1.00 19.20  ? 49   ALA A N   1 
ATOM   389  C  CA  . ALA A 1 49  ? 27.155 77.635  -7.996  1.00 19.37  ? 49   ALA A CA  1 
ATOM   390  C  C   . ALA A 1 49  ? 26.004 77.153  -7.091  1.00 19.11  ? 49   ALA A C   1 
ATOM   391  O  O   . ALA A 1 49  ? 25.590 77.869  -6.166  1.00 19.11  ? 49   ALA A O   1 
ATOM   392  C  CB  . ALA A 1 49  ? 26.624 78.513  -9.142  1.00 19.42  ? 49   ALA A CB  1 
ATOM   393  N  N   . THR A 1 50  ? 25.506 75.942  -7.332  1.00 18.07  ? 50   THR A N   1 
ATOM   394  C  CA  . THR A 1 50  ? 24.367 75.407  -6.576  1.00 18.36  ? 50   THR A CA  1 
ATOM   395  C  C   . THR A 1 50  ? 24.716 74.170  -5.739  1.00 18.01  ? 50   THR A C   1 
ATOM   396  O  O   . THR A 1 50  ? 23.839 73.472  -5.206  1.00 18.10  ? 50   THR A O   1 
ATOM   397  C  CB  . THR A 1 50  ? 23.185 75.087  -7.516  1.00 18.49  ? 50   THR A CB  1 
ATOM   398  O  OG1 . THR A 1 50  ? 23.652 74.243  -8.584  1.00 19.02  ? 50   THR A OG1 1 
ATOM   399  C  CG2 . THR A 1 50  ? 22.599 76.385  -8.082  1.00 18.81  ? 50   THR A CG2 1 
ATOM   400  N  N   . LYS A 1 51  ? 26.008 73.890  -5.625  1.00 17.15  ? 51   LYS A N   1 
ATOM   401  C  CA  . LYS A 1 51  ? 26.478 72.818  -4.765  1.00 15.61  ? 51   LYS A CA  1 
ATOM   402  C  C   . LYS A 1 51  ? 26.736 73.336  -3.366  1.00 15.37  ? 51   LYS A C   1 
ATOM   403  O  O   . LYS A 1 51  ? 26.996 74.530  -3.169  1.00 14.67  ? 51   LYS A O   1 
ATOM   404  C  CB  . LYS A 1 51  ? 27.752 72.205  -5.348  1.00 16.14  ? 51   LYS A CB  1 
ATOM   405  C  CG  . LYS A 1 51  ? 27.483 71.369  -6.586  1.00 16.96  ? 51   LYS A CG  1 
ATOM   406  C  CD  . LYS A 1 51  ? 28.750 71.050  -7.364  1.00 18.72  ? 51   LYS A CD  1 
ATOM   407  C  CE  . LYS A 1 51  ? 28.410 70.408  -8.706  1.00 17.04  ? 51   LYS A CE  1 
ATOM   408  N  NZ  . LYS A 1 51  ? 27.987 68.992  -8.491  1.00 19.25  ? 51   LYS A NZ  1 
ATOM   409  N  N   . SER A 1 52  ? 26.692 72.432  -2.390  1.00 14.62  ? 52   SER A N   1 
ATOM   410  C  CA  . SER A 1 52  ? 27.010 72.783  -1.035  1.00 14.87  ? 52   SER A CA  1 
ATOM   411  C  C   . SER A 1 52  ? 28.525 72.977  -0.903  1.00 14.85  ? 52   SER A C   1 
ATOM   412  O  O   . SER A 1 52  ? 29.298 72.573  -1.789  1.00 15.02  ? 52   SER A O   1 
ATOM   413  C  CB  . SER A 1 52  ? 26.545 71.679  -0.082  1.00 14.76  ? 52   SER A CB  1 
ATOM   414  O  OG  . SER A 1 52  ? 27.359 70.524  -0.261  1.00 14.05  ? 52   SER A OG  1 
ATOM   415  N  N   . LEU A 1 53  ? 28.946 73.586  0.202   1.00 14.34  ? 53   LEU A N   1 
ATOM   416  C  CA  . LEU A 1 53  ? 30.370 73.766  0.455   1.00 13.80  ? 53   LEU A CA  1 
ATOM   417  C  C   . LEU A 1 53  ? 31.105 72.438  0.422   1.00 14.64  ? 53   LEU A C   1 
ATOM   418  O  O   . LEU A 1 53  ? 32.186 72.319  -0.184  1.00 13.88  ? 53   LEU A O   1 
ATOM   419  C  CB  . LEU A 1 53  ? 30.596 74.468  1.794   1.00 13.30  ? 53   LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 53  ? 32.059 74.750  2.193   1.00 13.17  ? 53   LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 53  ? 32.659 75.818  1.337   1.00 9.24   ? 53   LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 53  ? 32.180 75.162  3.641   1.00 12.58  ? 53   LEU A CD2 1 
ATOM   423  N  N   . VAL A 1 54  ? 30.533 71.440  1.103   1.00 15.09  ? 54   VAL A N   1 
ATOM   424  C  CA  . VAL A 1 54  ? 31.127 70.110  1.153   1.00 15.93  ? 54   VAL A CA  1 
ATOM   425  C  C   . VAL A 1 54  ? 31.248 69.457  -0.232  1.00 15.46  ? 54   VAL A C   1 
ATOM   426  O  O   . VAL A 1 54  ? 32.290 68.894  -0.577  1.00 15.73  ? 54   VAL A O   1 
ATOM   427  C  CB  . VAL A 1 54  ? 30.371 69.214  2.157   1.00 16.87  ? 54   VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 54  ? 30.618 67.745  1.883   1.00 17.20  ? 54   VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 54  ? 30.788 69.586  3.545   1.00 18.76  ? 54   VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 55  ? 30.197 69.558  -1.030  1.00 14.37  ? 55   GLU A N   1 
ATOM   431  C  CA  . GLU A 1 55  ? 30.222 69.051  -2.392  1.00 14.30  ? 55   GLU A CA  1 
ATOM   432  C  C   . GLU A 1 55  ? 31.267 69.764  -3.245  1.00 13.91  ? 55   GLU A C   1 
ATOM   433  O  O   . GLU A 1 55  ? 32.030 69.114  -3.958  1.00 13.77  ? 55   GLU A O   1 
ATOM   434  C  CB  . GLU A 1 55  ? 28.835 69.151  -3.024  1.00 14.28  ? 55   GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 55  ? 27.854 68.247  -2.332  1.00 13.98  ? 55   GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 55  ? 26.422 68.508  -2.749  1.00 15.85  ? 55   GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 55  ? 26.132 69.634  -3.188  1.00 14.70  ? 55   GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 55  ? 25.600 67.582  -2.622  1.00 17.18  ? 55   GLU A OE2 1 
ATOM   439  N  N   . ILE A 1 56  ? 31.346 71.084  -3.123  1.00 13.62  ? 56   ILE A N   1 
ATOM   440  C  CA  . ILE A 1 56  ? 32.363 71.857  -3.855  1.00 13.55  ? 56   ILE A CA  1 
ATOM   441  C  C   . ILE A 1 56  ? 33.765 71.368  -3.494  1.00 13.80  ? 56   ILE A C   1 
ATOM   442  O  O   . ILE A 1 56  ? 34.556 71.041  -4.383  1.00 13.94  ? 56   ILE A O   1 
ATOM   443  C  CB  . ILE A 1 56  ? 32.230 73.394  -3.629  1.00 13.30  ? 56   ILE A CB  1 
ATOM   444  C  CG1 . ILE A 1 56  ? 30.928 73.906  -4.265  1.00 13.35  ? 56   ILE A CG1 1 
ATOM   445  C  CG2 . ILE A 1 56  ? 33.398 74.135  -4.321  1.00 12.35  ? 56   ILE A CG2 1 
ATOM   446  C  CD1 . ILE A 1 56  ? 30.442 75.226  -3.699  1.00 14.37  ? 56   ILE A CD1 1 
ATOM   447  N  N   . MET A 1 57  ? 34.044 71.286  -2.188  1.00 13.82  ? 57   MET A N   1 
ATOM   448  C  CA  . MET A 1 57  ? 35.327 70.803  -1.667  1.00 15.30  ? 57   MET A CA  1 
ATOM   449  C  C   . MET A 1 57  ? 35.710 69.418  -2.238  1.00 15.51  ? 57   MET A C   1 
ATOM   450  O  O   . MET A 1 57  ? 36.848 69.201  -2.716  1.00 14.37  ? 57   MET A O   1 
ATOM   451  C  CB  . MET A 1 57  ? 35.231 70.769  -0.146  1.00 15.04  ? 57   MET A CB  1 
ATOM   452  C  CG  . MET A 1 57  ? 36.446 70.334  0.582   1.00 16.62  ? 57   MET A CG  1 
ATOM   453  S  SD  . MET A 1 57  ? 36.086 70.512  2.328   1.00 17.17  ? 57   MET A SD  1 
ATOM   454  C  CE  . MET A 1 57  ? 35.270 68.951  2.777   1.00 13.78  ? 57   MET A CE  1 
ATOM   455  N  N   . LYS A 1 58  ? 34.754 68.492  -2.193  1.00 15.92  ? 58   LYS A N   1 
ATOM   456  C  CA  . LYS A 1 58  ? 34.956 67.136  -2.712  1.00 17.16  ? 58   LYS A CA  1 
ATOM   457  C  C   . LYS A 1 58  ? 35.096 67.058  -4.230  1.00 16.84  ? 58   LYS A C   1 
ATOM   458  O  O   . LYS A 1 58  ? 35.730 66.135  -4.752  1.00 17.37  ? 58   LYS A O   1 
ATOM   459  C  CB  . LYS A 1 58  ? 33.830 66.206  -2.242  1.00 16.86  ? 58   LYS A CB  1 
ATOM   460  C  CG  . LYS A 1 58  ? 33.962 65.793  -0.773  1.00 18.38  ? 58   LYS A CG  1 
ATOM   461  C  CD  . LYS A 1 58  ? 32.699 65.163  -0.171  1.00 18.88  ? 58   LYS A CD  1 
ATOM   462  C  CE  . LYS A 1 58  ? 32.480 63.705  -0.629  1.00 23.96  ? 58   LYS A CE  1 
ATOM   463  N  NZ  . LYS A 1 58  ? 33.688 62.777  -0.482  1.00 26.10  ? 58   LYS A NZ  1 
ATOM   464  N  N   . GLU A 1 59  ? 34.534 68.016  -4.955  1.00 16.86  ? 59   GLU A N   1 
ATOM   465  C  CA  . GLU A 1 59  ? 34.508 67.906  -6.416  1.00 17.57  ? 59   GLU A CA  1 
ATOM   466  C  C   . GLU A 1 59  ? 35.332 68.903  -7.236  1.00 18.00  ? 59   GLU A C   1 
ATOM   467  O  O   . GLU A 1 59  ? 35.329 68.817  -8.458  1.00 19.38  ? 59   GLU A O   1 
ATOM   468  C  CB  . GLU A 1 59  ? 33.069 67.962  -6.915  1.00 17.77  ? 59   GLU A CB  1 
ATOM   469  C  CG  . GLU A 1 59  ? 32.168 66.904  -6.337  1.00 18.51  ? 59   GLU A CG  1 
ATOM   470  C  CD  . GLU A 1 59  ? 30.689 67.180  -6.621  1.00 22.29  ? 59   GLU A CD  1 
ATOM   471  O  OE1 . GLU A 1 59  ? 30.369 67.723  -7.690  1.00 19.86  ? 59   GLU A OE1 1 
ATOM   472  O  OE2 . GLU A 1 59  ? 29.852 66.864  -5.754  1.00 23.00  ? 59   GLU A OE2 1 
ATOM   473  N  N   . SER A 1 60  ? 35.980 69.871  -6.597  1.00 17.55  ? 60   SER A N   1 
ATOM   474  C  CA  . SER A 1 60  ? 36.726 70.909  -7.331  1.00 17.06  ? 60   SER A CA  1 
ATOM   475  C  C   . SER A 1 60  ? 38.248 70.744  -7.230  1.00 16.85  ? 60   SER A C   1 
ATOM   476  O  O   . SER A 1 60  ? 38.738 69.871  -6.526  1.00 16.02  ? 60   SER A O   1 
ATOM   477  C  CB  . SER A 1 60  ? 36.361 72.275  -6.788  1.00 16.80  ? 60   SER A CB  1 
ATOM   478  O  OG  . SER A 1 60  ? 36.654 72.324  -5.402  1.00 17.20  ? 60   SER A OG  1 
ATOM   479  N  N   . THR A 1 61  ? 38.980 71.609  -7.934  1.00 17.21  ? 61   THR A N   1 
ATOM   480  C  CA  . THR A 1 61  ? 40.449 71.654  -7.855  1.00 17.58  ? 61   THR A CA  1 
ATOM   481  C  C   . THR A 1 61  ? 40.842 73.141  -7.959  1.00 16.73  ? 61   THR A C   1 
ATOM   482  O  O   . THR A 1 61  ? 39.977 73.996  -8.069  1.00 16.21  ? 61   THR A O   1 
ATOM   483  C  CB  . THR A 1 61  ? 41.096 70.841  -9.012  1.00 17.85  ? 61   THR A CB  1 
ATOM   484  O  OG1 . THR A 1 61  ? 40.642 71.387  -10.257 1.00 19.84  ? 61   THR A OG1 1 
ATOM   485  C  CG2 . THR A 1 61  ? 40.683 69.385  -8.950  1.00 19.00  ? 61   THR A CG2 1 
ATOM   486  N  N   . GLY A 1 62  ? 42.135 73.456  -7.923  1.00 16.25  ? 62   GLY A N   1 
ATOM   487  C  CA  . GLY A 1 62  ? 42.575 74.831  -8.168  1.00 15.06  ? 62   GLY A CA  1 
ATOM   488  C  C   . GLY A 1 62  ? 42.079 75.820  -7.116  1.00 14.47  ? 62   GLY A C   1 
ATOM   489  O  O   . GLY A 1 62  ? 41.915 75.459  -5.947  1.00 13.94  ? 62   GLY A O   1 
ATOM   490  N  N   . ALA A 1 63  ? 41.843 77.066  -7.526  1.00 13.98  ? 63   ALA A N   1 
ATOM   491  C  CA  . ALA A 1 63  ? 41.407 78.114  -6.619  1.00 13.50  ? 63   ALA A CA  1 
ATOM   492  C  C   . ALA A 1 63  ? 40.080 77.850  -5.915  1.00 13.61  ? 63   ALA A C   1 
ATOM   493  O  O   . ALA A 1 63  ? 39.910 78.233  -4.745  1.00 13.13  ? 63   ALA A O   1 
ATOM   494  C  CB  . ALA A 1 63  ? 41.378 79.492  -7.325  1.00 14.73  ? 63   ALA A CB  1 
ATOM   495  N  N   . ILE A 1 64  ? 39.141 77.223  -6.628  1.00 12.49  ? 64   ILE A N   1 
ATOM   496  C  CA  . ILE A 1 64  ? 37.816 76.886  -6.053  1.00 12.71  ? 64   ILE A CA  1 
ATOM   497  C  C   . ILE A 1 64  ? 38.003 75.936  -4.884  1.00 11.87  ? 64   ILE A C   1 
ATOM   498  O  O   . ILE A 1 64  ? 37.492 76.176  -3.804  1.00 11.00  ? 64   ILE A O   1 
ATOM   499  C  CB  . ILE A 1 64  ? 36.801 76.309  -7.111  1.00 12.64  ? 64   ILE A CB  1 
ATOM   500  C  CG1 . ILE A 1 64  ? 36.353 77.399  -8.083  1.00 11.97  ? 64   ILE A CG1 1 
ATOM   501  C  CG2 . ILE A 1 64  ? 35.537 75.732  -6.410  1.00 12.26  ? 64   ILE A CG2 1 
ATOM   502  C  CD1 . ILE A 1 64  ? 35.675 76.783  -9.376  1.00 12.62  ? 64   ILE A CD1 1 
ATOM   503  N  N   . PHE A 1 65  ? 38.808 74.900  -5.094  1.00 11.75  ? 65   PHE A N   1 
ATOM   504  C  CA  . PHE A 1 65  ? 39.096 73.968  -4.015  1.00 11.36  ? 65   PHE A CA  1 
ATOM   505  C  C   . PHE A 1 65  ? 39.773 74.670  -2.851  1.00 11.03  ? 65   PHE A C   1 
ATOM   506  O  O   . PHE A 1 65  ? 39.358 74.518  -1.689  1.00 9.69   ? 65   PHE A O   1 
ATOM   507  C  CB  . PHE A 1 65  ? 39.944 72.777  -4.469  1.00 10.88  ? 65   PHE A CB  1 
ATOM   508  C  CG  . PHE A 1 65  ? 40.373 71.893  -3.322  1.00 12.40  ? 65   PHE A CG  1 
ATOM   509  C  CD1 . PHE A 1 65  ? 39.493 70.938  -2.801  1.00 12.56  ? 65   PHE A CD1 1 
ATOM   510  C  CD2 . PHE A 1 65  ? 41.624 72.070  -2.719  1.00 10.70  ? 65   PHE A CD2 1 
ATOM   511  C  CE1 . PHE A 1 65  ? 39.868 70.159  -1.714  1.00 13.95  ? 65   PHE A CE1 1 
ATOM   512  C  CE2 . PHE A 1 65  ? 42.021 71.282  -1.641  1.00 11.10  ? 65   PHE A CE2 1 
ATOM   513  C  CZ  . PHE A 1 65  ? 41.155 70.332  -1.139  1.00 10.80  ? 65   PHE A CZ  1 
ATOM   514  N  N   . ASN A 1 66  ? 40.813 75.440  -3.159  1.00 10.64  ? 66   ASN A N   1 
ATOM   515  C  CA  . ASN A 1 66  ? 41.586 76.099  -2.113  1.00 10.82  ? 66   ASN A CA  1 
ATOM   516  C  C   . ASN A 1 66  ? 40.672 76.933  -1.208  1.00 10.48  ? 66   ASN A C   1 
ATOM   517  O  O   . ASN A 1 66  ? 40.723 76.806  0.016   1.00 9.80   ? 66   ASN A O   1 
ATOM   518  C  CB  . ASN A 1 66  ? 42.688 76.971  -2.722  1.00 11.00  ? 66   ASN A CB  1 
ATOM   519  C  CG  . ASN A 1 66  ? 43.845 76.150  -3.295  1.00 12.04  ? 66   ASN A CG  1 
ATOM   520  O  OD1 . ASN A 1 66  ? 44.022 74.964  -2.990  1.00 12.19  ? 66   ASN A OD1 1 
ATOM   521  N  ND2 . ASN A 1 66  ? 44.635 76.789  -4.126  1.00 11.10  ? 66   ASN A ND2 1 
ATOM   522  N  N   . ASN A 1 67  ? 39.814 77.758  -1.820  1.00 9.77   ? 67   ASN A N   1 
ATOM   523  C  CA  . ASN A 1 67  ? 38.880 78.566  -1.052  1.00 10.33  ? 67   ASN A CA  1 
ATOM   524  C  C   . ASN A 1 67  ? 37.804 77.761  -0.327  1.00 9.59   ? 67   ASN A C   1 
ATOM   525  O  O   . ASN A 1 67  ? 37.612 77.949  0.864   1.00 8.91   ? 67   ASN A O   1 
ATOM   526  C  CB  . ASN A 1 67  ? 38.275 79.683  -1.900  1.00 9.78   ? 67   ASN A CB  1 
ATOM   527  C  CG  . ASN A 1 67  ? 39.275 80.744  -2.198  1.00 10.49  ? 67   ASN A CG  1 
ATOM   528  O  OD1 . ASN A 1 67  ? 39.542 81.617  -1.349  1.00 10.07  ? 67   ASN A OD1 1 
ATOM   529  N  ND2 . ASN A 1 67  ? 39.930 80.628  -3.379  1.00 9.43   ? 67   ASN A ND2 1 
ATOM   530  N  N   . ALA A 1 68  ? 37.113 76.881  -1.049  1.00 9.32   ? 68   ALA A N   1 
ATOM   531  C  CA  . ALA A 1 68  ? 36.109 75.971  -0.431  1.00 9.48   ? 68   ALA A CA  1 
ATOM   532  C  C   . ALA A 1 68  ? 36.675 75.167  0.755   1.00 8.72   ? 68   ALA A C   1 
ATOM   533  O  O   . ALA A 1 68  ? 36.073 75.112  1.820   1.00 9.58   ? 68   ALA A O   1 
ATOM   534  C  CB  . ALA A 1 68  ? 35.553 75.017  -1.468  1.00 7.74   ? 68   ALA A CB  1 
ATOM   535  N  N   . ALA A 1 69  ? 37.811 74.519  0.556   1.00 8.57   ? 69   ALA A N   1 
ATOM   536  C  CA  . ALA A 1 69  ? 38.388 73.677  1.622   1.00 8.19   ? 69   ALA A CA  1 
ATOM   537  C  C   . ALA A 1 69  ? 38.832 74.544  2.808   1.00 8.00   ? 69   ALA A C   1 
ATOM   538  O  O   . ALA A 1 69  ? 38.601 74.192  3.960   1.00 6.58   ? 69   ALA A O   1 
ATOM   539  C  CB  . ALA A 1 69  ? 39.542 72.855  1.080   1.00 8.08   ? 69   ALA A CB  1 
ATOM   540  N  N   . GLN A 1 70  ? 39.419 75.714  2.537   1.00 7.40   ? 70   GLN A N   1 
ATOM   541  C  CA  . GLN A 1 70  ? 39.737 76.607  3.640   1.00 6.82   ? 70   GLN A CA  1 
ATOM   542  C  C   . GLN A 1 70  ? 38.518 77.065  4.442   1.00 7.59   ? 70   GLN A C   1 
ATOM   543  O  O   . GLN A 1 70  ? 38.595 77.174  5.673   1.00 7.77   ? 70   GLN A O   1 
ATOM   544  C  CB  . GLN A 1 70  ? 40.578 77.800  3.196   1.00 6.73   ? 70   GLN A CB  1 
ATOM   545  C  CG  . GLN A 1 70  ? 42.021 77.436  2.836   1.00 4.22   ? 70   GLN A CG  1 
ATOM   546  C  CD  . GLN A 1 70  ? 42.851 77.000  3.996   1.00 6.88   ? 70   GLN A CD  1 
ATOM   547  O  OE1 . GLN A 1 70  ? 42.777 75.850  4.419   1.00 6.93   ? 70   GLN A OE1 1 
ATOM   548  N  NE2 . GLN A 1 70  ? 43.704 77.915  4.508   1.00 11.75  ? 70   GLN A NE2 1 
ATOM   549  N  N   . ILE A 1 71  ? 37.410 77.388  3.769   1.00 7.77   ? 71   ILE A N   1 
ATOM   550  C  CA  . ILE A 1 71  ? 36.210 77.760  4.534   1.00 7.63   ? 71   ILE A CA  1 
ATOM   551  C  C   . ILE A 1 71  ? 35.847 76.605  5.483   1.00 7.33   ? 71   ILE A C   1 
ATOM   552  O  O   . ILE A 1 71  ? 35.566 76.833  6.650   1.00 8.17   ? 71   ILE A O   1 
ATOM   553  C  CB  . ILE A 1 71  ? 34.997 78.036  3.660   1.00 7.08   ? 71   ILE A CB  1 
ATOM   554  C  CG1 . ILE A 1 71  ? 35.236 79.257  2.751   1.00 7.18   ? 71   ILE A CG1 1 
ATOM   555  C  CG2 . ILE A 1 71  ? 33.731 78.283  4.554   1.00 5.96   ? 71   ILE A CG2 1 
ATOM   556  C  CD1 . ILE A 1 71  ? 34.408 79.186  1.476   1.00 5.63   ? 71   ILE A CD1 1 
ATOM   557  N  N   . TRP A 1 72  ? 35.804 75.386  4.950   1.00 8.24   ? 72   TRP A N   1 
ATOM   558  C  CA  . TRP A 1 72  ? 35.367 74.216  5.719   1.00 8.35   ? 72   TRP A CA  1 
ATOM   559  C  C   . TRP A 1 72  ? 36.364 73.929  6.859   1.00 8.22   ? 72   TRP A C   1 
ATOM   560  O  O   . TRP A 1 72  ? 35.977 73.711  8.043   1.00 8.26   ? 72   TRP A O   1 
ATOM   561  C  CB  . TRP A 1 72  ? 35.209 73.003  4.791   1.00 9.88   ? 72   TRP A CB  1 
ATOM   562  C  CG  . TRP A 1 72  ? 34.544 71.803  5.486   1.00 9.33   ? 72   TRP A CG  1 
ATOM   563  C  CD1 . TRP A 1 72  ? 33.221 71.456  5.438   1.00 10.30  ? 72   TRP A CD1 1 
ATOM   564  C  CD2 . TRP A 1 72  ? 35.182 70.852  6.355   1.00 11.14  ? 72   TRP A CD2 1 
ATOM   565  N  NE1 . TRP A 1 72  ? 32.992 70.342  6.236   1.00 12.36  ? 72   TRP A NE1 1 
ATOM   566  C  CE2 . TRP A 1 72  ? 34.182 69.949  6.798   1.00 10.85  ? 72   TRP A CE2 1 
ATOM   567  C  CE3 . TRP A 1 72  ? 36.510 70.669  6.797   1.00 12.28  ? 72   TRP A CE3 1 
ATOM   568  C  CZ2 . TRP A 1 72  ? 34.468 68.875  7.669   1.00 12.21  ? 72   TRP A CZ2 1 
ATOM   569  C  CZ3 . TRP A 1 72  ? 36.794 69.601  7.663   1.00 10.50  ? 72   TRP A CZ3 1 
ATOM   570  C  CH2 . TRP A 1 72  ? 35.772 68.728  8.100   1.00 9.88   ? 72   TRP A CH2 1 
ATOM   571  N  N   . ASN A 1 73  ? 37.645 73.947  6.518   1.00 7.46   ? 73   ASN A N   1 
ATOM   572  C  CA  . ASN A 1 73  ? 38.719 73.670  7.514   1.00 7.47   ? 73   ASN A CA  1 
ATOM   573  C  C   . ASN A 1 73  ? 38.650 74.672  8.658   1.00 7.56   ? 73   ASN A C   1 
ATOM   574  O  O   . ASN A 1 73  ? 38.896 74.336  9.810   1.00 7.93   ? 73   ASN A O   1 
ATOM   575  C  CB  . ASN A 1 73  ? 40.095 73.827  6.858   1.00 6.73   ? 73   ASN A CB  1 
ATOM   576  C  CG  . ASN A 1 73  ? 40.393 72.781  5.805   1.00 8.30   ? 73   ASN A CG  1 
ATOM   577  O  OD1 . ASN A 1 73  ? 39.761 71.730  5.748   1.00 10.45  ? 73   ASN A OD1 1 
ATOM   578  N  ND2 . ASN A 1 73  ? 41.380 73.069  4.959   1.00 6.09   ? 73   ASN A ND2 1 
ATOM   579  N  N   . HIS A 1 74  ? 38.393 75.942  8.334   1.00 8.00   ? 74   HIS A N   1 
ATOM   580  C  CA  . HIS A 1 74  ? 38.377 76.961  9.396   1.00 8.12   ? 74   HIS A CA  1 
ATOM   581  C  C   . HIS A 1 74  ? 37.180 76.819  10.301  1.00 7.95   ? 74   HIS A C   1 
ATOM   582  O  O   . HIS A 1 74  ? 37.283 76.970  11.509  1.00 8.84   ? 74   HIS A O   1 
ATOM   583  C  CB  . HIS A 1 74  ? 38.449 78.376  8.804   1.00 7.40   ? 74   HIS A CB  1 
ATOM   584  C  CG  . HIS A 1 74  ? 39.819 78.754  8.381   1.00 7.08   ? 74   HIS A CG  1 
ATOM   585  N  ND1 . HIS A 1 74  ? 40.352 78.378  7.163   1.00 6.34   ? 74   HIS A ND1 1 
ATOM   586  C  CD2 . HIS A 1 74  ? 40.806 79.393  9.050   1.00 4.51   ? 74   HIS A CD2 1 
ATOM   587  C  CE1 . HIS A 1 74  ? 41.599 78.807  7.088   1.00 4.95   ? 74   HIS A CE1 1 
ATOM   588  N  NE2 . HIS A 1 74  ? 41.891 79.422  8.218   1.00 3.10   ? 74   HIS A NE2 1 
ATOM   589  N  N   . SER A 1 75  ? 36.026 76.534  9.716   1.00 8.75   ? 75   SER A N   1 
ATOM   590  C  CA  . SER A 1 75  ? 34.851 76.298  10.539  1.00 8.97   ? 75   SER A CA  1 
ATOM   591  C  C   . SER A 1 75  ? 35.035 75.119  11.498  1.00 8.97   ? 75   SER A C   1 
ATOM   592  O  O   . SER A 1 75  ? 34.665 75.201  12.668  1.00 8.90   ? 75   SER A O   1 
ATOM   593  C  CB  . SER A 1 75  ? 33.622 76.135  9.669   1.00 8.41   ? 75   SER A CB  1 
ATOM   594  O  OG  . SER A 1 75  ? 33.261 77.409  9.177   1.00 9.86   ? 75   SER A OG  1 
ATOM   595  N  N   . PHE A 1 76  ? 35.637 74.049  10.990  1.00 8.93   ? 76   PHE A N   1 
ATOM   596  C  CA  . PHE A 1 76  ? 36.002 72.872  11.783  1.00 9.25   ? 76   PHE A CA  1 
ATOM   597  C  C   . PHE A 1 76  ? 37.036 73.224  12.866  1.00 9.42   ? 76   PHE A C   1 
ATOM   598  O  O   . PHE A 1 76  ? 36.981 72.707  13.970  1.00 11.06  ? 76   PHE A O   1 
ATOM   599  C  CB  . PHE A 1 76  ? 36.509 71.759  10.847  1.00 9.33   ? 76   PHE A CB  1 
ATOM   600  C  CG  . PHE A 1 76  ? 36.412 70.358  11.442  1.00 9.89   ? 76   PHE A CG  1 
ATOM   601  C  CD1 . PHE A 1 76  ? 35.200 69.671  11.433  1.00 10.85  ? 76   PHE A CD1 1 
ATOM   602  C  CD2 . PHE A 1 76  ? 37.525 69.743  12.000  1.00 7.89   ? 76   PHE A CD2 1 
ATOM   603  C  CE1 . PHE A 1 76  ? 35.093 68.388  11.957  1.00 11.05  ? 76   PHE A CE1 1 
ATOM   604  C  CE2 . PHE A 1 76  ? 37.433 68.458  12.529  1.00 10.83  ? 76   PHE A CE2 1 
ATOM   605  C  CZ  . PHE A 1 76  ? 36.209 67.777  12.515  1.00 9.25   ? 76   PHE A CZ  1 
ATOM   606  N  N   . TYR A 1 77  ? 37.976 74.108  12.538  1.00 10.33  ? 77   TYR A N   1 
ATOM   607  C  CA  . TYR A 1 77  ? 38.954 74.633  13.472  1.00 10.50  ? 77   TYR A CA  1 
ATOM   608  C  C   . TYR A 1 77  ? 38.318 75.431  14.626  1.00 10.53  ? 77   TYR A C   1 
ATOM   609  O  O   . TYR A 1 77  ? 38.617 75.178  15.794  1.00 11.17  ? 77   TYR A O   1 
ATOM   610  C  CB  . TYR A 1 77  ? 39.964 75.482  12.703  1.00 9.44   ? 77   TYR A CB  1 
ATOM   611  C  CG  . TYR A 1 77  ? 40.999 76.243  13.516  1.00 10.67  ? 77   TYR A CG  1 
ATOM   612  C  CD1 . TYR A 1 77  ? 41.970 75.569  14.267  1.00 9.11   ? 77   TYR A CD1 1 
ATOM   613  C  CD2 . TYR A 1 77  ? 41.028 77.646  13.495  1.00 8.14   ? 77   TYR A CD2 1 
ATOM   614  C  CE1 . TYR A 1 77  ? 42.930 76.273  15.002  1.00 8.42   ? 77   TYR A CE1 1 
ATOM   615  C  CE2 . TYR A 1 77  ? 41.988 78.368  14.222  1.00 9.20   ? 77   TYR A CE2 1 
ATOM   616  C  CZ  . TYR A 1 77  ? 42.950 77.674  14.961  1.00 8.24   ? 77   TYR A CZ  1 
ATOM   617  O  OH  . TYR A 1 77  ? 43.923 78.365  15.674  1.00 8.83   ? 77   TYR A OH  1 
ATOM   618  N  N   . TRP A 1 78  ? 37.434 76.365  14.296  1.00 10.66  ? 78   TRP A N   1 
ATOM   619  C  CA  . TRP A 1 78  ? 36.754 77.172  15.320  1.00 10.31  ? 78   TRP A CA  1 
ATOM   620  C  C   . TRP A 1 78  ? 35.917 76.287  16.258  1.00 10.50  ? 78   TRP A C   1 
ATOM   621  O  O   . TRP A 1 78  ? 35.962 76.470  17.473  1.00 10.21  ? 78   TRP A O   1 
ATOM   622  C  CB  . TRP A 1 78  ? 35.875 78.269  14.665  1.00 8.98   ? 78   TRP A CB  1 
ATOM   623  C  CG  . TRP A 1 78  ? 36.686 79.247  13.830  1.00 9.01   ? 78   TRP A CG  1 
ATOM   624  C  CD1 . TRP A 1 78  ? 36.468 79.596  12.541  1.00 9.77   ? 78   TRP A CD1 1 
ATOM   625  C  CD2 . TRP A 1 78  ? 37.862 79.955  14.244  1.00 8.79   ? 78   TRP A CD2 1 
ATOM   626  N  NE1 . TRP A 1 78  ? 37.436 80.480  12.112  1.00 9.56   ? 78   TRP A NE1 1 
ATOM   627  C  CE2 . TRP A 1 78  ? 38.302 80.714  13.145  1.00 8.88   ? 78   TRP A CE2 1 
ATOM   628  C  CE3 . TRP A 1 78  ? 38.592 80.013  15.446  1.00 10.15  ? 78   TRP A CE3 1 
ATOM   629  C  CZ2 . TRP A 1 78  ? 39.447 81.527  13.204  1.00 8.45   ? 78   TRP A CZ2 1 
ATOM   630  C  CZ3 . TRP A 1 78  ? 39.713 80.835  15.515  1.00 8.43   ? 78   TRP A CZ3 1 
ATOM   631  C  CH2 . TRP A 1 78  ? 40.137 81.568  14.395  1.00 8.81   ? 78   TRP A CH2 1 
ATOM   632  N  N   . ASP A 1 79  ? 35.155 75.357  15.665  1.00 10.75  ? 79   ASP A N   1 
ATOM   633  C  CA  . ASP A 1 79  ? 34.319 74.393  16.396  1.00 10.83  ? 79   ASP A CA  1 
ATOM   634  C  C   . ASP A 1 79  ? 35.107 73.379  17.217  1.00 10.81  ? 79   ASP A C   1 
ATOM   635  O  O   . ASP A 1 79  ? 34.589 72.827  18.215  1.00 8.94   ? 79   ASP A O   1 
ATOM   636  C  CB  . ASP A 1 79  ? 33.341 73.694  15.444  1.00 10.69  ? 79   ASP A CB  1 
ATOM   637  C  CG  . ASP A 1 79  ? 32.395 74.665  14.787  1.00 13.84  ? 79   ASP A CG  1 
ATOM   638  O  OD1 . ASP A 1 79  ? 32.448 75.879  15.127  1.00 13.45  ? 79   ASP A OD1 1 
ATOM   639  O  OD2 . ASP A 1 79  ? 31.608 74.215  13.915  1.00 17.03  ? 79   ASP A OD2 1 
ATOM   640  N  N   . SER A 1 80  ? 36.366 73.164  16.821  1.00 10.05  ? 80   SER A N   1 
ATOM   641  C  CA  . SER A 1 80  ? 37.301 72.310  17.575  1.00 10.84  ? 80   SER A CA  1 
ATOM   642  C  C   . SER A 1 80  ? 37.840 72.950  18.850  1.00 10.74  ? 80   SER A C   1 
ATOM   643  O  O   . SER A 1 80  ? 38.603 72.313  19.596  1.00 11.50  ? 80   SER A O   1 
ATOM   644  C  CB  . SER A 1 80  ? 38.509 71.913  16.698  1.00 10.68  ? 80   SER A CB  1 
ATOM   645  O  OG  . SER A 1 80  ? 38.128 70.989  15.692  1.00 12.13  ? 80   SER A OG  1 
ATOM   646  N  N   . MET A 1 81  ? 37.469 74.208  19.090  1.00 10.78  ? 81   MET A N   1 
ATOM   647  C  CA  . MET A 1 81  ? 37.918 74.953  20.263  1.00 10.32  ? 81   MET A CA  1 
ATOM   648  C  C   . MET A 1 81  ? 36.743 75.560  20.998  1.00 10.73  ? 81   MET A C   1 
ATOM   649  O  O   . MET A 1 81  ? 35.637 75.527  20.504  1.00 12.09  ? 81   MET A O   1 
ATOM   650  C  CB  . MET A 1 81  ? 38.858 76.097  19.848  1.00 10.54  ? 81   MET A CB  1 
ATOM   651  C  CG  . MET A 1 81  ? 40.155 75.596  19.283  1.00 8.97   ? 81   MET A CG  1 
ATOM   652  S  SD  . MET A 1 81  ? 41.260 76.932  18.851  1.00 9.84   ? 81   MET A SD  1 
ATOM   653  C  CE  . MET A 1 81  ? 40.384 77.698  17.480  1.00 9.99   ? 81   MET A CE  1 
ATOM   654  N  N   . GLY A 1 82  ? 37.002 76.162  22.155  1.00 11.59  ? 82   GLY A N   1 
ATOM   655  C  CA  . GLY A 1 82  ? 35.960 76.869  22.884  1.00 13.24  ? 82   GLY A CA  1 
ATOM   656  C  C   . GLY A 1 82  ? 36.393 77.366  24.238  1.00 13.68  ? 82   GLY A C   1 
ATOM   657  O  O   . GLY A 1 82  ? 37.425 76.925  24.767  1.00 13.58  ? 82   GLY A O   1 
ATOM   658  N  N   . PRO A 1 83  ? 35.598 78.281  24.827  1.00 14.62  ? 83   PRO A N   1 
ATOM   659  C  CA  . PRO A 1 83  ? 35.878 78.665  26.203  1.00 15.73  ? 83   PRO A CA  1 
ATOM   660  C  C   . PRO A 1 83  ? 35.408 77.525  27.128  1.00 16.35  ? 83   PRO A C   1 
ATOM   661  O  O   . PRO A 1 83  ? 34.559 76.729  26.743  1.00 16.93  ? 83   PRO A O   1 
ATOM   662  C  CB  . PRO A 1 83  ? 35.041 79.949  26.402  1.00 14.59  ? 83   PRO A CB  1 
ATOM   663  C  CG  . PRO A 1 83  ? 33.869 79.760  25.470  1.00 15.85  ? 83   PRO A CG  1 
ATOM   664  C  CD  . PRO A 1 83  ? 34.414 78.983  24.277  1.00 14.94  ? 83   PRO A CD  1 
ATOM   665  N  N   . ASN A 1 84  ? 35.996 77.417  28.308  1.00 17.81  ? 84   ASN A N   1 
ATOM   666  C  CA  . ASN A 1 84  ? 35.579 76.388  29.257  1.00 19.17  ? 84   ASN A CA  1 
ATOM   667  C  C   . ASN A 1 84  ? 35.807 74.954  28.716  1.00 18.51  ? 84   ASN A C   1 
ATOM   668  O  O   . ASN A 1 84  ? 35.042 74.044  29.011  1.00 18.23  ? 84   ASN A O   1 
ATOM   669  C  CB  . ASN A 1 84  ? 34.096 76.590  29.613  1.00 20.29  ? 84   ASN A CB  1 
ATOM   670  C  CG  . ASN A 1 84  ? 33.722 78.071  29.811  1.00 24.82  ? 84   ASN A CG  1 
ATOM   671  O  OD1 . ASN A 1 84  ? 32.724 78.568  29.243  1.00 29.05  ? 84   ASN A OD1 1 
ATOM   672  N  ND2 . ASN A 1 84  ? 34.533 78.785  30.593  1.00 28.05  ? 84   ASN A ND2 1 
ATOM   673  N  N   . CYS A 1 85  ? 36.836 74.785  27.888  1.00 17.56  ? 85   CYS A N   1 
ATOM   674  C  CA  . CYS A 1 85  ? 37.132 73.498  27.257  1.00 17.24  ? 85   CYS A CA  1 
ATOM   675  C  C   . CYS A 1 85  ? 38.554 73.113  27.635  1.00 16.76  ? 85   CYS A C   1 
ATOM   676  O  O   . CYS A 1 85  ? 39.027 73.485  28.705  1.00 16.81  ? 85   CYS A O   1 
ATOM   677  C  CB  . CYS A 1 85  ? 36.977 73.579  25.725  1.00 16.29  ? 85   CYS A CB  1 
ATOM   678  S  SG  . CYS A 1 85  ? 35.287 73.711  25.116  1.00 17.56  ? 85   CYS A SG  1 
ATOM   679  N  N   . GLY A 1 86  ? 39.255 72.408  26.750  1.00 16.32  ? 86   GLY A N   1 
ATOM   680  C  CA  . GLY A 1 86  ? 40.605 71.941  27.061  1.00 14.89  ? 86   GLY A CA  1 
ATOM   681  C  C   . GLY A 1 86  ? 40.590 70.830  28.108  1.00 14.86  ? 86   GLY A C   1 
ATOM   682  O  O   . GLY A 1 86  ? 39.554 70.143  28.328  1.00 13.15  ? 86   GLY A O   1 
ATOM   683  N  N   . GLY A 1 87  ? 41.734 70.665  28.771  1.00 14.44  ? 87   GLY A N   1 
ATOM   684  C  CA  . GLY A 1 87  ? 41.875 69.619  29.790  1.00 14.74  ? 87   GLY A CA  1 
ATOM   685  C  C   . GLY A 1 87  ? 41.845 68.213  29.193  1.00 14.57  ? 87   GLY A C   1 
ATOM   686  O  O   . GLY A 1 87  ? 42.210 68.004  28.013  1.00 13.88  ? 87   GLY A O   1 
ATOM   687  N  N   . GLU A 1 88  ? 41.436 67.251  30.020  1.00 13.78  ? 88   GLU A N   1 
ATOM   688  C  CA  . GLU A 1 88  ? 41.414 65.841  29.652  1.00 14.41  ? 88   GLU A CA  1 
ATOM   689  C  C   . GLU A 1 88  ? 40.202 65.591  28.791  1.00 14.46  ? 88   GLU A C   1 
ATOM   690  O  O   . GLU A 1 88  ? 39.138 66.198  29.035  1.00 14.08  ? 88   GLU A O   1 
ATOM   691  C  CB  . GLU A 1 88  ? 41.244 64.960  30.904  1.00 15.31  ? 88   GLU A CB  1 
ATOM   692  C  CG  . GLU A 1 88  ? 42.452 64.879  31.790  1.00 19.28  ? 88   GLU A CG  1 
ATOM   693  C  CD  . GLU A 1 88  ? 43.606 64.143  31.157  1.00 23.26  ? 88   GLU A CD  1 
ATOM   694  O  OE1 . GLU A 1 88  ? 43.414 63.037  30.580  1.00 26.50  ? 88   GLU A OE1 1 
ATOM   695  O  OE2 . GLU A 1 88  ? 44.716 64.677  31.249  1.00 25.68  ? 88   GLU A OE2 1 
ATOM   696  N  N   . PRO A 1 89  ? 40.310 64.663  27.824  1.00 14.40  ? 89   PRO A N   1 
ATOM   697  C  CA  . PRO A 1 89  ? 39.074 64.318  27.108  1.00 14.88  ? 89   PRO A CA  1 
ATOM   698  C  C   . PRO A 1 89  ? 38.037 63.706  28.052  1.00 15.10  ? 89   PRO A C   1 
ATOM   699  O  O   . PRO A 1 89  ? 38.386 63.250  29.134  1.00 14.32  ? 89   PRO A O   1 
ATOM   700  C  CB  . PRO A 1 89  ? 39.533 63.284  26.055  1.00 14.98  ? 89   PRO A CB  1 
ATOM   701  C  CG  . PRO A 1 89  ? 40.846 62.858  26.440  1.00 14.76  ? 89   PRO A CG  1 
ATOM   702  C  CD  . PRO A 1 89  ? 41.471 63.909  27.327  1.00 15.54  ? 89   PRO A CD  1 
ATOM   703  N  N   . HIS A 1 90  ? 36.772 63.691  27.637  1.00 15.55  ? 90   HIS A N   1 
ATOM   704  C  CA  . HIS A 1 90  ? 35.721 63.101  28.447  1.00 15.42  ? 90   HIS A CA  1 
ATOM   705  C  C   . HIS A 1 90  ? 34.677 62.545  27.489  1.00 16.38  ? 90   HIS A C   1 
ATOM   706  O  O   . HIS A 1 90  ? 34.649 62.933  26.313  1.00 15.95  ? 90   HIS A O   1 
ATOM   707  C  CB  . HIS A 1 90  ? 35.113 64.152  29.386  1.00 15.80  ? 90   HIS A CB  1 
ATOM   708  C  CG  . HIS A 1 90  ? 34.757 65.436  28.710  1.00 14.02  ? 90   HIS A CG  1 
ATOM   709  N  ND1 . HIS A 1 90  ? 33.544 65.640  28.090  1.00 14.58  ? 90   HIS A ND1 1 
ATOM   710  C  CD2 . HIS A 1 90  ? 35.456 66.588  28.558  1.00 16.03  ? 90   HIS A CD2 1 
ATOM   711  C  CE1 . HIS A 1 90  ? 33.515 66.855  27.569  1.00 14.77  ? 90   HIS A CE1 1 
ATOM   712  N  NE2 . HIS A 1 90  ? 34.663 67.453  27.840  1.00 14.97  ? 90   HIS A NE2 1 
ATOM   713  N  N   . GLY A 1 91  ? 33.833 61.631  27.969  1.00 16.08  ? 91   GLY A N   1 
ATOM   714  C  CA  . GLY A 1 91  ? 32.856 61.014  27.083  1.00 16.54  ? 91   GLY A CA  1 
ATOM   715  C  C   . GLY A 1 91  ? 33.536 60.014  26.159  1.00 16.76  ? 91   GLY A C   1 
ATOM   716  O  O   . GLY A 1 91  ? 34.621 59.541  26.435  1.00 16.89  ? 91   GLY A O   1 
ATOM   717  N  N   . GLU A 1 92  ? 32.896 59.720  25.048  1.00 17.49  ? 92   GLU A N   1 
ATOM   718  C  CA  . GLU A 1 92  ? 33.320 58.635  24.155  1.00 18.61  ? 92   GLU A CA  1 
ATOM   719  C  C   . GLU A 1 92  ? 34.766 58.740  23.647  1.00 17.34  ? 92   GLU A C   1 
ATOM   720  O  O   . GLU A 1 92  ? 35.487 57.743  23.597  1.00 17.09  ? 92   GLU A O   1 
ATOM   721  C  CB  . GLU A 1 92  ? 32.331 58.521  22.994  1.00 19.06  ? 92   GLU A CB  1 
ATOM   722  C  CG  . GLU A 1 92  ? 31.607 57.177  22.973  1.00 25.92  ? 92   GLU A CG  1 
ATOM   723  C  CD  . GLU A 1 92  ? 30.560 57.015  24.075  1.00 33.71  ? 92   GLU A CD  1 
ATOM   724  O  OE1 . GLU A 1 92  ? 29.569 57.780  24.081  1.00 38.37  ? 92   GLU A OE1 1 
ATOM   725  O  OE2 . GLU A 1 92  ? 30.715 56.105  24.928  1.00 35.71  ? 92   GLU A OE2 1 
ATOM   726  N  N   . ILE A 1 93  ? 35.182 59.965  23.313  1.00 15.75  ? 93   ILE A N   1 
ATOM   727  C  CA  . ILE A 1 93  ? 36.528 60.245  22.824  1.00 13.97  ? 93   ILE A CA  1 
ATOM   728  C  C   . ILE A 1 93  ? 37.666 59.912  23.816  1.00 13.69  ? 93   ILE A C   1 
ATOM   729  O  O   . ILE A 1 93  ? 38.755 59.520  23.421  1.00 13.02  ? 93   ILE A O   1 
ATOM   730  C  CB  . ILE A 1 93  ? 36.647 61.726  22.295  1.00 13.71  ? 93   ILE A CB  1 
ATOM   731  C  CG1 . ILE A 1 93  ? 37.980 61.943  21.563  1.00 12.23  ? 93   ILE A CG1 1 
ATOM   732  C  CG2 . ILE A 1 93  ? 36.525 62.748  23.446  1.00 12.42  ? 93   ILE A CG2 1 
ATOM   733  C  CD1 . ILE A 1 93  ? 38.060 61.193  20.245  1.00 10.10  ? 93   ILE A CD1 1 
ATOM   734  N  N   . LYS A 1 94  ? 37.421 60.069  25.108  1.00 13.80  ? 94   LYS A N   1 
ATOM   735  C  CA  . LYS A 1 94  ? 38.410 59.680  26.106  1.00 13.42  ? 94   LYS A CA  1 
ATOM   736  C  C   . LYS A 1 94  ? 38.783 58.181  25.984  1.00 13.38  ? 94   LYS A C   1 
ATOM   737  O  O   . LYS A 1 94  ? 39.961 57.806  26.012  1.00 13.20  ? 94   LYS A O   1 
ATOM   738  C  CB  . LYS A 1 94  ? 37.815 59.929  27.482  1.00 13.86  ? 94   LYS A CB  1 
ATOM   739  C  CG  . LYS A 1 94  ? 38.671 59.497  28.640  1.00 13.74  ? 94   LYS A CG  1 
ATOM   740  C  CD  . LYS A 1 94  ? 37.871 59.713  29.919  1.00 14.93  ? 94   LYS A CD  1 
ATOM   741  C  CE  . LYS A 1 94  ? 38.772 59.940  31.090  1.00 16.46  ? 94   LYS A CE  1 
ATOM   742  N  NZ  . LYS A 1 94  ? 39.701 61.123  30.930  1.00 21.70  ? 94   LYS A NZ  1 
ATOM   743  N  N   . GLU A 1 95  ? 37.766 57.339  25.907  1.00 13.70  ? 95   GLU A N   1 
ATOM   744  C  CA  . GLU A 1 95  ? 37.967 55.893  25.857  1.00 15.20  ? 95   GLU A CA  1 
ATOM   745  C  C   . GLU A 1 95  ? 38.587 55.471  24.523  1.00 13.40  ? 95   GLU A C   1 
ATOM   746  O  O   . GLU A 1 95  ? 39.471 54.638  24.496  1.00 13.95  ? 95   GLU A O   1 
ATOM   747  C  CB  . GLU A 1 95  ? 36.662 55.154  26.157  1.00 16.35  ? 95   GLU A CB  1 
ATOM   748  C  CG  . GLU A 1 95  ? 36.078 55.450  27.555  1.00 23.89  ? 95   GLU A CG  1 
ATOM   749  C  CD  . GLU A 1 95  ? 34.542 55.341  27.596  1.00 31.55  ? 95   GLU A CD  1 
ATOM   750  O  OE1 . GLU A 1 95  ? 34.006 54.259  27.237  1.00 36.09  ? 95   GLU A OE1 1 
ATOM   751  O  OE2 . GLU A 1 95  ? 33.866 56.339  27.968  1.00 36.42  ? 95   GLU A OE2 1 
ATOM   752  N  N   . LYS A 1 96  ? 38.159 56.092  23.426  1.00 13.58  ? 96   LYS A N   1 
ATOM   753  C  CA  . LYS A 1 96  ? 38.702 55.838  22.087  1.00 12.14  ? 96   LYS A CA  1 
ATOM   754  C  C   . LYS A 1 96  ? 40.185 56.216  21.990  1.00 12.23  ? 96   LYS A C   1 
ATOM   755  O  O   . LYS A 1 96  ? 40.989 55.488  21.368  1.00 11.20  ? 96   LYS A O   1 
ATOM   756  C  CB  . LYS A 1 96  ? 37.895 56.602  21.011  1.00 12.97  ? 96   LYS A CB  1 
ATOM   757  C  CG  . LYS A 1 96  ? 38.208 56.181  19.564  1.00 11.25  ? 96   LYS A CG  1 
ATOM   758  C  CD  . LYS A 1 96  ? 37.594 54.856  19.192  1.00 12.52  ? 96   LYS A CD  1 
ATOM   759  C  CE  . LYS A 1 96  ? 38.015 54.452  17.786  1.00 15.44  ? 96   LYS A CE  1 
ATOM   760  N  NZ  . LYS A 1 96  ? 37.758 53.027  17.518  1.00 15.83  ? 96   LYS A NZ  1 
ATOM   761  N  N   . ILE A 1 97  ? 40.548 57.352  22.585  1.00 11.01  ? 97   ILE A N   1 
ATOM   762  C  CA  . ILE A 1 97  ? 41.952 57.744  22.656  1.00 10.97  ? 97   ILE A CA  1 
ATOM   763  C  C   . ILE A 1 97  ? 42.791 56.748  23.485  1.00 11.20  ? 97   ILE A C   1 
ATOM   764  O  O   . ILE A 1 97  ? 43.924 56.368  23.110  1.00 10.88  ? 97   ILE A O   1 
ATOM   765  C  CB  . ILE A 1 97  ? 42.113 59.226  23.208  1.00 11.42  ? 97   ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 97  ? 41.735 60.227  22.094  1.00 10.16  ? 97   ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 97  ? 43.540 59.444  23.700  1.00 9.12   ? 97   ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 97  ? 41.531 61.702  22.521  1.00 10.94  ? 97   ILE A CD1 1 
ATOM   769  N  N   . GLN A 1 98  ? 42.249 56.337  24.628  1.00 12.00  ? 98   GLN A N   1 
ATOM   770  C  CA  . GLN A 1 98  ? 42.904 55.271  25.417  1.00 12.63  ? 98   GLN A CA  1 
ATOM   771  C  C   . GLN A 1 98  ? 43.180 54.046  24.532  1.00 11.56  ? 98   GLN A C   1 
ATOM   772  O  O   . GLN A 1 98  ? 44.276 53.499  24.550  1.00 11.42  ? 98   GLN A O   1 
ATOM   773  C  CB  . GLN A 1 98  ? 42.056 54.870  26.645  1.00 12.48  ? 98   GLN A CB  1 
ATOM   774  C  CG  . GLN A 1 98  ? 41.963 55.950  27.718  1.00 12.92  ? 98   GLN A CG  1 
ATOM   775  C  CD  . GLN A 1 98  ? 40.784 55.767  28.657  1.00 13.19  ? 98   GLN A CD  1 
ATOM   776  O  OE1 . GLN A 1 98  ? 39.954 54.860  28.472  1.00 14.77  ? 98   GLN A OE1 1 
ATOM   777  N  NE2 . GLN A 1 98  ? 40.699 56.634  29.680  1.00 10.79  ? 98   GLN A NE2 1 
ATOM   778  N  N   . GLU A 1 99  ? 42.184 53.613  23.761  1.00 12.50  ? 99   GLU A N   1 
ATOM   779  C  CA  . GLU A 1 99  ? 42.307 52.399  22.970  1.00 12.51  ? 99   GLU A CA  1 
ATOM   780  C  C   . GLU A 1 99  ? 43.358 52.523  21.887  1.00 13.13  ? 99   GLU A C   1 
ATOM   781  O  O   . GLU A 1 99  ? 44.157 51.599  21.653  1.00 12.86  ? 99   GLU A O   1 
ATOM   782  C  CB  . GLU A 1 99  ? 40.960 52.051  22.328  1.00 13.41  ? 99   GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 99  ? 39.934 51.573  23.311  1.00 15.91  ? 99   GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 99  ? 38.559 51.409  22.678  1.00 21.19  ? 99   GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 99  ? 38.486 51.370  21.427  1.00 24.23  ? 99   GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 99  ? 37.558 51.329  23.426  1.00 22.41  ? 99   GLU A OE2 1 
ATOM   787  N  N   . ASP A 1 100 ? 43.365 53.681  21.217  1.00 12.82  ? 100  ASP A N   1 
ATOM   788  C  CA  . ASP A 1 100 ? 44.133 53.830  19.997  1.00 12.12  ? 100  ASP A CA  1 
ATOM   789  C  C   . ASP A 1 100 ? 45.503 54.481  20.223  1.00 11.59  ? 100  ASP A C   1 
ATOM   790  O  O   . ASP A 1 100 ? 46.395 54.325  19.397  1.00 11.43  ? 100  ASP A O   1 
ATOM   791  C  CB  . ASP A 1 100 ? 43.278 54.565  18.926  1.00 12.28  ? 100  ASP A CB  1 
ATOM   792  C  CG  . ASP A 1 100 ? 42.035 53.767  18.526  1.00 12.44  ? 100  ASP A CG  1 
ATOM   793  O  OD1 . ASP A 1 100 ? 41.941 52.558  18.873  1.00 10.45  ? 100  ASP A OD1 1 
ATOM   794  O  OD2 . ASP A 1 100 ? 41.130 54.342  17.895  1.00 9.98   ? 100  ASP A OD2 1 
ATOM   795  N  N   . PHE A 1 101 ? 45.682 55.186  21.341  1.00 11.34  ? 101  PHE A N   1 
ATOM   796  C  CA  . PHE A 1 101 ? 46.989 55.804  21.646  1.00 11.60  ? 101  PHE A CA  1 
ATOM   797  C  C   . PHE A 1 101 ? 47.588 55.336  22.961  1.00 11.50  ? 101  PHE A C   1 
ATOM   798  O  O   . PHE A 1 101 ? 48.749 55.630  23.242  1.00 12.14  ? 101  PHE A O   1 
ATOM   799  C  CB  . PHE A 1 101 ? 46.915 57.364  21.611  1.00 12.62  ? 101  PHE A CB  1 
ATOM   800  C  CG  . PHE A 1 101 ? 46.490 57.917  20.270  1.00 11.32  ? 101  PHE A CG  1 
ATOM   801  C  CD1 . PHE A 1 101 ? 47.423 58.142  19.271  1.00 12.65  ? 101  PHE A CD1 1 
ATOM   802  C  CD2 . PHE A 1 101 ? 45.160 58.175  20.002  1.00 13.56  ? 101  PHE A CD2 1 
ATOM   803  C  CE1 . PHE A 1 101 ? 47.048 58.649  18.020  1.00 7.25   ? 101  PHE A CE1 1 
ATOM   804  C  CE2 . PHE A 1 101 ? 44.751 58.684  18.729  1.00 13.42  ? 101  PHE A CE2 1 
ATOM   805  C  CZ  . PHE A 1 101 ? 45.694 58.904  17.743  1.00 11.86  ? 101  PHE A CZ  1 
ATOM   806  N  N   . GLY A 1 102 ? 46.811 54.598  23.753  1.00 11.53  ? 102  GLY A N   1 
ATOM   807  C  CA  . GLY A 1 102 ? 47.288 54.105  25.062  1.00 11.37  ? 102  GLY A CA  1 
ATOM   808  C  C   . GLY A 1 102 ? 46.942 55.042  26.198  1.00 11.58  ? 102  GLY A C   1 
ATOM   809  O  O   . GLY A 1 102 ? 46.611 54.600  27.311  1.00 11.78  ? 102  GLY A O   1 
ATOM   810  N  N   . SER A 1 103 ? 47.013 56.355  25.927  1.00 12.07  ? 103  SER A N   1 
ATOM   811  C  CA  . SER A 1 103 ? 46.727 57.389  26.924  1.00 11.64  ? 103  SER A CA  1 
ATOM   812  C  C   . SER A 1 103 ? 46.500 58.722  26.233  1.00 11.95  ? 103  SER A C   1 
ATOM   813  O  O   . SER A 1 103 ? 46.983 58.927  25.118  1.00 11.75  ? 103  SER A O   1 
ATOM   814  C  CB  . SER A 1 103 ? 47.890 57.523  27.918  1.00 11.69  ? 103  SER A CB  1 
ATOM   815  O  OG  . SER A 1 103 ? 49.038 58.112  27.356  1.00 11.05  ? 103  SER A OG  1 
ATOM   816  N  N   . PHE A 1 104 ? 45.800 59.631  26.905  1.00 12.11  ? 104  PHE A N   1 
ATOM   817  C  CA  . PHE A 1 104 ? 45.712 61.004  26.414  1.00 13.11  ? 104  PHE A CA  1 
ATOM   818  C  C   . PHE A 1 104 ? 47.094 61.637  26.267  1.00 12.42  ? 104  PHE A C   1 
ATOM   819  O  O   . PHE A 1 104 ? 47.357 62.297  25.269  1.00 12.29  ? 104  PHE A O   1 
ATOM   820  C  CB  . PHE A 1 104 ? 44.788 61.891  27.271  1.00 13.60  ? 104  PHE A CB  1 
ATOM   821  C  CG  . PHE A 1 104 ? 44.838 63.341  26.883  1.00 15.31  ? 104  PHE A CG  1 
ATOM   822  C  CD1 . PHE A 1 104 ? 44.410 63.756  25.611  1.00 15.97  ? 104  PHE A CD1 1 
ATOM   823  C  CD2 . PHE A 1 104 ? 45.368 64.290  27.762  1.00 17.81  ? 104  PHE A CD2 1 
ATOM   824  C  CE1 . PHE A 1 104 ? 44.458 65.109  25.245  1.00 14.81  ? 104  PHE A CE1 1 
ATOM   825  C  CE2 . PHE A 1 104 ? 45.430 65.642  27.396  1.00 15.79  ? 104  PHE A CE2 1 
ATOM   826  C  CZ  . PHE A 1 104 ? 44.976 66.040  26.143  1.00 15.41  ? 104  PHE A CZ  1 
ATOM   827  N  N   . ASN A 1 105 ? 47.983 61.439  27.242  1.00 13.04  ? 105  ASN A N   1 
ATOM   828  C  CA  . ASN A 1 105 ? 49.340 62.011  27.121  1.00 14.26  ? 105  ASN A CA  1 
ATOM   829  C  C   . ASN A 1 105 ? 50.110 61.540  25.895  1.00 12.99  ? 105  ASN A C   1 
ATOM   830  O  O   . ASN A 1 105 ? 50.839 62.323  25.268  1.00 13.08  ? 105  ASN A O   1 
ATOM   831  C  CB  . ASN A 1 105 ? 50.188 61.822  28.382  1.00 14.63  ? 105  ASN A CB  1 
ATOM   832  C  CG  . ASN A 1 105 ? 49.894 62.880  29.456  1.00 20.60  ? 105  ASN A CG  1 
ATOM   833  O  OD1 . ASN A 1 105 ? 50.165 62.657  30.641  1.00 23.74  ? 105  ASN A OD1 1 
ATOM   834  N  ND2 . ASN A 1 105 ? 49.307 64.032  29.051  1.00 24.14  ? 105  ASN A ND2 1 
ATOM   835  N  N   . ASN A 1 106 ? 49.974 60.262  25.554  1.00 12.45  ? 106  ASN A N   1 
ATOM   836  C  CA  . ASN A 1 106 ? 50.589 59.759  24.332  1.00 12.06  ? 106  ASN A CA  1 
ATOM   837  C  C   . ASN A 1 106 ? 50.025 60.501  23.132  1.00 11.74  ? 106  ASN A C   1 
ATOM   838  O  O   . ASN A 1 106 ? 50.787 60.968  22.283  1.00 11.64  ? 106  ASN A O   1 
ATOM   839  C  CB  . ASN A 1 106 ? 50.427 58.237  24.178  1.00 12.41  ? 106  ASN A CB  1 
ATOM   840  C  CG  . ASN A 1 106 ? 51.238 57.446  25.226  1.00 15.71  ? 106  ASN A CG  1 
ATOM   841  O  OD1 . ASN A 1 106 ? 52.094 58.005  25.928  1.00 19.63  ? 106  ASN A OD1 1 
ATOM   842  N  ND2 . ASN A 1 106 ? 50.942 56.153  25.356  1.00 17.16  ? 106  ASN A ND2 1 
ATOM   843  N  N   . PHE A 1 107 ? 48.699 60.601  23.048  1.00 10.40  ? 107  PHE A N   1 
ATOM   844  C  CA  . PHE A 1 107 ? 48.082 61.299  21.921  1.00 11.02  ? 107  PHE A CA  1 
ATOM   845  C  C   . PHE A 1 107 ? 48.588 62.762  21.833  1.00 11.50  ? 107  PHE A C   1 
ATOM   846  O  O   . PHE A 1 107 ? 48.979 63.241  20.752  1.00 11.33  ? 107  PHE A O   1 
ATOM   847  C  CB  . PHE A 1 107 ? 46.550 61.230  21.991  1.00 10.85  ? 107  PHE A CB  1 
ATOM   848  C  CG  . PHE A 1 107 ? 45.873 62.272  21.160  1.00 11.93  ? 107  PHE A CG  1 
ATOM   849  C  CD1 . PHE A 1 107 ? 45.944 62.225  19.775  1.00 12.34  ? 107  PHE A CD1 1 
ATOM   850  C  CD2 . PHE A 1 107 ? 45.199 63.336  21.770  1.00 14.99  ? 107  PHE A CD2 1 
ATOM   851  C  CE1 . PHE A 1 107 ? 45.352 63.244  18.998  1.00 12.34  ? 107  PHE A CE1 1 
ATOM   852  C  CE2 . PHE A 1 107 ? 44.580 64.330  21.011  1.00 14.00  ? 107  PHE A CE2 1 
ATOM   853  C  CZ  . PHE A 1 107 ? 44.650 64.278  19.623  1.00 14.40  ? 107  PHE A CZ  1 
ATOM   854  N  N   . LYS A 1 108 ? 48.596 63.442  22.985  1.00 11.15  ? 108  LYS A N   1 
ATOM   855  C  CA  . LYS A 1 108 ? 48.980 64.854  23.091  1.00 12.83  ? 108  LYS A CA  1 
ATOM   856  C  C   . LYS A 1 108 ? 50.409 65.068  22.591  1.00 12.67  ? 108  LYS A C   1 
ATOM   857  O  O   . LYS A 1 108 ? 50.693 66.026  21.834  1.00 12.70  ? 108  LYS A O   1 
ATOM   858  C  CB  . LYS A 1 108 ? 48.869 65.296  24.562  1.00 12.35  ? 108  LYS A CB  1 
ATOM   859  C  CG  . LYS A 1 108 ? 49.210 66.752  24.805  1.00 14.91  ? 108  LYS A CG  1 
ATOM   860  C  CD  . LYS A 1 108 ? 48.621 67.206  26.139  1.00 18.52  ? 108  LYS A CD  1 
ATOM   861  C  CE  . LYS A 1 108 ? 49.207 68.530  26.554  1.00 23.78  ? 108  LYS A CE  1 
ATOM   862  N  NZ  . LYS A 1 108 ? 48.743 68.860  27.915  1.00 25.67  ? 108  LYS A NZ  1 
ATOM   863  N  N   . ASN A 1 109 ? 51.300 64.159  23.003  1.00 13.27  ? 109  ASN A N   1 
ATOM   864  C  CA  . ASN A 1 109 ? 52.693 64.170  22.564  1.00 13.91  ? 109  ASN A CA  1 
ATOM   865  C  C   . ASN A 1 109 ? 52.890 64.008  21.067  1.00 13.86  ? 109  ASN A C   1 
ATOM   866  O  O   . ASN A 1 109 ? 53.621 64.797  20.463  1.00 11.87  ? 109  ASN A O   1 
ATOM   867  C  CB  . ASN A 1 109 ? 53.541 63.173  23.347  1.00 14.21  ? 109  ASN A CB  1 
ATOM   868  C  CG  . ASN A 1 109 ? 53.783 63.637  24.784  1.00 19.35  ? 109  ASN A CG  1 
ATOM   869  O  OD1 . ASN A 1 109 ? 53.610 64.817  25.098  1.00 23.81  ? 109  ASN A OD1 1 
ATOM   870  N  ND2 . ASN A 1 109 ? 54.166 62.711  25.665  1.00 23.77  ? 109  ASN A ND2 1 
ATOM   871  N  N   . GLU A 1 110 ? 52.248 62.992  20.476  1.00 13.23  ? 110  GLU A N   1 
ATOM   872  C  CA  . GLU A 1 110 ? 52.356 62.772  19.040  1.00 14.34  ? 110  GLU A CA  1 
ATOM   873  C  C   . GLU A 1 110 ? 51.699 63.907  18.252  1.00 12.71  ? 110  GLU A C   1 
ATOM   874  O  O   . GLU A 1 110 ? 52.269 64.372  17.292  1.00 12.05  ? 110  GLU A O   1 
ATOM   875  C  CB  . GLU A 1 110 ? 51.743 61.434  18.629  1.00 14.65  ? 110  GLU A CB  1 
ATOM   876  C  CG  . GLU A 1 110 ? 52.213 60.274  19.499  1.00 17.27  ? 110  GLU A CG  1 
ATOM   877  C  CD  . GLU A 1 110 ? 51.481 58.958  19.200  1.00 19.26  ? 110  GLU A CD  1 
ATOM   878  O  OE1 . GLU A 1 110 ? 50.938 58.801  18.053  1.00 20.00  ? 110  GLU A OE1 1 
ATOM   879  O  OE2 . GLU A 1 110 ? 51.450 58.120  20.146  1.00 19.24  ? 110  GLU A OE2 1 
ATOM   880  N  N   . PHE A 1 111 ? 50.516 64.350  18.665  1.00 12.13  ? 111  PHE A N   1 
ATOM   881  C  CA  . PHE A 1 111 ? 49.836 65.438  17.970  1.00 12.45  ? 111  PHE A CA  1 
ATOM   882  C  C   . PHE A 1 111 ? 50.655 66.711  17.981  1.00 12.36  ? 111  PHE A C   1 
ATOM   883  O  O   . PHE A 1 111 ? 50.793 67.342  16.939  1.00 12.44  ? 111  PHE A O   1 
ATOM   884  C  CB  . PHE A 1 111 ? 48.428 65.727  18.509  1.00 12.23  ? 111  PHE A CB  1 
ATOM   885  C  CG  . PHE A 1 111 ? 47.547 66.453  17.524  1.00 12.82  ? 111  PHE A CG  1 
ATOM   886  C  CD1 . PHE A 1 111 ? 47.545 66.103  16.173  1.00 12.82  ? 111  PHE A CD1 1 
ATOM   887  C  CD2 . PHE A 1 111 ? 46.691 67.461  17.945  1.00 14.43  ? 111  PHE A CD2 1 
ATOM   888  C  CE1 . PHE A 1 111 ? 46.709 66.770  15.243  1.00 12.16  ? 111  PHE A CE1 1 
ATOM   889  C  CE2 . PHE A 1 111 ? 45.835 68.118  17.031  1.00 14.05  ? 111  PHE A CE2 1 
ATOM   890  C  CZ  . PHE A 1 111 ? 45.845 67.768  15.688  1.00 12.05  ? 111  PHE A CZ  1 
ATOM   891  N  N   . SER A 1 112 ? 51.219 67.059  19.143  1.00 12.56  ? 112  SER A N   1 
ATOM   892  C  CA  . SER A 1 112 ? 52.056 68.253  19.277  1.00 12.21  ? 112  SER A CA  1 
ATOM   893  C  C   . SER A 1 112 ? 53.294 68.170  18.378  1.00 12.86  ? 112  SER A C   1 
ATOM   894  O  O   . SER A 1 112 ? 53.685 69.165  17.759  1.00 12.90  ? 112  SER A O   1 
ATOM   895  C  CB  . SER A 1 112 ? 52.465 68.457  20.734  1.00 12.09  ? 112  SER A CB  1 
ATOM   896  O  OG  . SER A 1 112 ? 51.313 68.566  21.573  1.00 13.16  ? 112  SER A OG  1 
ATOM   897  N  N   . ASN A 1 113 ? 53.888 66.976  18.302  1.00 12.94  ? 113  ASN A N   1 
ATOM   898  C  CA  . ASN A 1 113 ? 55.042 66.708  17.437  1.00 12.26  ? 113  ASN A CA  1 
ATOM   899  C  C   . ASN A 1 113 ? 54.719 66.921  15.960  1.00 11.30  ? 113  ASN A C   1 
ATOM   900  O  O   . ASN A 1 113 ? 55.456 67.601  15.224  1.00 10.38  ? 113  ASN A O   1 
ATOM   901  C  CB  . ASN A 1 113 ? 55.576 65.295  17.655  1.00 12.19  ? 113  ASN A CB  1 
ATOM   902  C  CG  . ASN A 1 113 ? 56.374 65.168  18.958  1.00 16.25  ? 113  ASN A CG  1 
ATOM   903  O  OD1 . ASN A 1 113 ? 56.753 66.173  19.567  1.00 16.12  ? 113  ASN A OD1 1 
ATOM   904  N  ND2 . ASN A 1 113 ? 56.604 63.919  19.402  1.00 15.03  ? 113  ASN A ND2 1 
ATOM   905  N  N   . VAL A 1 114 ? 53.605 66.358  15.538  1.00 10.64  ? 114  VAL A N   1 
ATOM   906  C  CA  . VAL A 1 114 ? 53.153 66.547  14.165  1.00 10.03  ? 114  VAL A CA  1 
ATOM   907  C  C   . VAL A 1 114 ? 52.895 68.017  13.834  1.00 10.52  ? 114  VAL A C   1 
ATOM   908  O  O   . VAL A 1 114 ? 53.372 68.516  12.802  1.00 10.93  ? 114  VAL A O   1 
ATOM   909  C  CB  . VAL A 1 114 ? 51.913 65.675  13.843  1.00 9.91   ? 114  VAL A CB  1 
ATOM   910  C  CG1 . VAL A 1 114 ? 51.233 66.158  12.510  1.00 8.75   ? 114  VAL A CG1 1 
ATOM   911  C  CG2 . VAL A 1 114 ? 52.350 64.213  13.738  1.00 8.51   ? 114  VAL A CG2 1 
ATOM   912  N  N   . LEU A 1 115 ? 52.107 68.685  14.680  1.00 9.93   ? 115  LEU A N   1 
ATOM   913  C  CA  . LEU A 1 115 ? 51.803 70.116  14.538  1.00 10.63  ? 115  LEU A CA  1 
ATOM   914  C  C   . LEU A 1 115 ? 53.054 70.990  14.501  1.00 10.71  ? 115  LEU A C   1 
ATOM   915  O  O   . LEU A 1 115 ? 53.173 71.896  13.653  1.00 12.24  ? 115  LEU A O   1 
ATOM   916  C  CB  . LEU A 1 115 ? 50.867 70.589  15.688  1.00 9.64   ? 115  LEU A CB  1 
ATOM   917  C  CG  . LEU A 1 115 ? 49.439 70.035  15.602  1.00 11.86  ? 115  LEU A CG  1 
ATOM   918  C  CD1 . LEU A 1 115 ? 48.715 70.268  16.903  1.00 9.53   ? 115  LEU A CD1 1 
ATOM   919  C  CD2 . LEU A 1 115 ? 48.632 70.634  14.409  1.00 10.87  ? 115  LEU A CD2 1 
ATOM   920  N  N   . CYS A 1 116 ? 53.995 70.729  15.411  1.00 10.44  ? 116  CYS A N   1 
ATOM   921  C  CA  . CYS A 1 116 ? 55.249 71.465  15.424  1.00 10.13  ? 116  CYS A CA  1 
ATOM   922  C  C   . CYS A 1 116 ? 56.132 71.198  14.218  1.00 9.76   ? 116  CYS A C   1 
ATOM   923  O  O   . CYS A 1 116 ? 56.893 72.080  13.802  1.00 9.52   ? 116  CYS A O   1 
ATOM   924  C  CB  . CYS A 1 116 ? 56.043 71.183  16.703  1.00 10.50  ? 116  CYS A CB  1 
ATOM   925  S  SG  . CYS A 1 116 ? 55.358 71.946  18.154  1.00 13.79  ? 116  CYS A SG  1 
ATOM   926  N  N   . GLY A 1 117 ? 56.044 69.987  13.672  1.00 9.08   ? 117  GLY A N   1 
ATOM   927  C  CA  . GLY A 1 117 ? 56.944 69.571  12.613  1.00 9.14   ? 117  GLY A CA  1 
ATOM   928  C  C   . GLY A 1 117 ? 56.480 69.951  11.214  1.00 9.50   ? 117  GLY A C   1 
ATOM   929  O  O   . GLY A 1 117 ? 57.251 69.855  10.279  1.00 9.80   ? 117  GLY A O   1 
ATOM   930  N  N   . HIS A 1 118 ? 55.238 70.392  11.035  1.00 9.19   ? 118  HIS A N   1 
ATOM   931  C  CA  . HIS A 1 118 ? 54.757 70.612  9.655   1.00 9.64   ? 118  HIS A CA  1 
ATOM   932  C  C   . HIS A 1 118 ? 55.464 71.779  8.961   1.00 9.30   ? 118  HIS A C   1 
ATOM   933  O  O   . HIS A 1 118 ? 55.467 72.879  9.493   1.00 10.71  ? 118  HIS A O   1 
ATOM   934  C  CB  . HIS A 1 118 ? 53.240 70.823  9.579   1.00 7.28   ? 118  HIS A CB  1 
ATOM   935  C  CG  . HIS A 1 118 ? 52.722 70.765  8.172   1.00 9.25   ? 118  HIS A CG  1 
ATOM   936  N  ND1 . HIS A 1 118 ? 52.437 69.579  7.539   1.00 7.61   ? 118  HIS A ND1 1 
ATOM   937  C  CD2 . HIS A 1 118 ? 52.484 71.744  7.262   1.00 8.64   ? 118  HIS A CD2 1 
ATOM   938  C  CE1 . HIS A 1 118 ? 52.034 69.821  6.302   1.00 10.06  ? 118  HIS A CE1 1 
ATOM   939  N  NE2 . HIS A 1 118 ? 52.055 71.129  6.110   1.00 12.02  ? 118  HIS A NE2 1 
ATOM   940  N  N   . PHE A 1 119 ? 56.062 71.526  7.794   1.00 10.03  ? 119  PHE A N   1 
ATOM   941  C  CA  . PHE A 1 119 ? 56.745 72.551  7.013   1.00 8.79   ? 119  PHE A CA  1 
ATOM   942  C  C   . PHE A 1 119 ? 55.764 73.293  6.083   1.00 9.21   ? 119  PHE A C   1 
ATOM   943  O  O   . PHE A 1 119 ? 55.043 72.671  5.295   1.00 8.63   ? 119  PHE A O   1 
ATOM   944  C  CB  . PHE A 1 119 ? 57.865 71.930  6.161   1.00 8.93   ? 119  PHE A CB  1 
ATOM   945  C  CG  . PHE A 1 119 ? 58.666 72.957  5.406   1.00 8.31   ? 119  PHE A CG  1 
ATOM   946  C  CD1 . PHE A 1 119 ? 59.593 73.750  6.073   1.00 8.50   ? 119  PHE A CD1 1 
ATOM   947  C  CD2 . PHE A 1 119 ? 58.478 73.143  4.038   1.00 7.89   ? 119  PHE A CD2 1 
ATOM   948  C  CE1 . PHE A 1 119 ? 60.324 74.731  5.392   1.00 7.08   ? 119  PHE A CE1 1 
ATOM   949  C  CE2 . PHE A 1 119 ? 59.212 74.130  3.349   1.00 8.52   ? 119  PHE A CE2 1 
ATOM   950  C  CZ  . PHE A 1 119 ? 60.148 74.904  4.032   1.00 5.89   ? 119  PHE A CZ  1 
ATOM   951  N  N   . GLY A 1 120 ? 55.791 74.625  6.145   1.00 8.92   ? 120  GLY A N   1 
ATOM   952  C  CA  . GLY A 1 120 ? 54.912 75.472  5.339   1.00 8.24   ? 120  GLY A CA  1 
ATOM   953  C  C   . GLY A 1 120 ? 53.514 75.540  5.927   1.00 7.48   ? 120  GLY A C   1 
ATOM   954  O  O   . GLY A 1 120 ? 53.298 75.202  7.098   1.00 6.66   ? 120  GLY A O   1 
ATOM   955  N  N   . SER A 1 121 ? 52.560 75.950  5.094   1.00 7.56   ? 121  SER A N   1 
ATOM   956  C  CA  . SER A 1 121 ? 51.159 76.143  5.504   1.00 8.44   ? 121  SER A CA  1 
ATOM   957  C  C   . SER A 1 121 ? 50.455 74.795  5.613   1.00 8.49   ? 121  SER A C   1 
ATOM   958  O  O   . SER A 1 121 ? 50.638 73.955  4.734   1.00 8.11   ? 121  SER A O   1 
ATOM   959  C  CB  . SER A 1 121 ? 50.430 77.025  4.458   1.00 7.77   ? 121  SER A CB  1 
ATOM   960  O  OG  . SER A 1 121 ? 51.013 78.343  4.446   1.00 10.08  ? 121  SER A OG  1 
ATOM   961  N  N   . GLY A 1 122 ? 49.631 74.589  6.648   1.00 8.29   ? 122  GLY A N   1 
ATOM   962  C  CA  . GLY A 1 122 ? 48.957 73.281  6.782   1.00 8.69   ? 122  GLY A CA  1 
ATOM   963  C  C   . GLY A 1 122 ? 48.133 73.095  8.043   1.00 8.31   ? 122  GLY A C   1 
ATOM   964  O  O   . GLY A 1 122 ? 47.836 74.052  8.745   1.00 7.97   ? 122  GLY A O   1 
ATOM   965  N  N   . TRP A 1 123 ? 47.815 71.842  8.360   1.00 7.24   ? 123  TRP A N   1 
ATOM   966  C  CA  . TRP A 1 123 ? 46.754 71.509  9.326   1.00 8.08   ? 123  TRP A CA  1 
ATOM   967  C  C   . TRP A 1 123 ? 47.128 70.191  9.921   1.00 7.89   ? 123  TRP A C   1 
ATOM   968  O  O   . TRP A 1 123 ? 47.567 69.317  9.177   1.00 7.93   ? 123  TRP A O   1 
ATOM   969  C  CB  . TRP A 1 123 ? 45.385 71.308  8.613   1.00 6.71   ? 123  TRP A CB  1 
ATOM   970  C  CG  . TRP A 1 123 ? 44.806 72.588  7.958   1.00 7.44   ? 123  TRP A CG  1 
ATOM   971  C  CD1 . TRP A 1 123 ? 45.012 73.029  6.677   1.00 7.33   ? 123  TRP A CD1 1 
ATOM   972  C  CD2 . TRP A 1 123 ? 43.923 73.546  8.572   1.00 6.55   ? 123  TRP A CD2 1 
ATOM   973  N  NE1 . TRP A 1 123 ? 44.319 74.204  6.457   1.00 9.15   ? 123  TRP A NE1 1 
ATOM   974  C  CE2 . TRP A 1 123 ? 43.661 74.552  7.610   1.00 6.94   ? 123  TRP A CE2 1 
ATOM   975  C  CE3 . TRP A 1 123 ? 43.313 73.635  9.824   1.00 7.43   ? 123  TRP A CE3 1 
ATOM   976  C  CZ2 . TRP A 1 123 ? 42.839 75.614  7.869   1.00 6.61   ? 123  TRP A CZ2 1 
ATOM   977  C  CZ3 . TRP A 1 123 ? 42.498 74.743  10.096  1.00 8.20   ? 123  TRP A CZ3 1 
ATOM   978  C  CH2 . TRP A 1 123 ? 42.270 75.701  9.134   1.00 6.07   ? 123  TRP A CH2 1 
ATOM   979  N  N   . GLY A 1 124 ? 46.972 70.054  11.235  1.00 8.28   ? 124  GLY A N   1 
ATOM   980  C  CA  . GLY A 1 124 ? 47.074 68.746  11.894  1.00 7.81   ? 124  GLY A CA  1 
ATOM   981  C  C   . GLY A 1 124 ? 45.665 68.234  12.178  1.00 9.22   ? 124  GLY A C   1 
ATOM   982  O  O   . GLY A 1 124 ? 44.768 69.020  12.493  1.00 9.25   ? 124  GLY A O   1 
ATOM   983  N  N   . TRP A 1 125 ? 45.452 66.925  12.051  1.00 9.58   ? 125  TRP A N   1 
ATOM   984  C  CA  . TRP A 1 125 ? 44.115 66.361  12.242  1.00 9.67   ? 125  TRP A CA  1 
ATOM   985  C  C   . TRP A 1 125 ? 44.125 65.168  13.208  1.00 9.99   ? 125  TRP A C   1 
ATOM   986  O  O   . TRP A 1 125 ? 45.072 64.391  13.233  1.00 8.82   ? 125  TRP A O   1 
ATOM   987  C  CB  . TRP A 1 125 ? 43.534 65.878  10.906  1.00 9.96   ? 125  TRP A CB  1 
ATOM   988  C  CG  . TRP A 1 125 ? 43.482 66.911  9.859   1.00 7.92   ? 125  TRP A CG  1 
ATOM   989  C  CD1 . TRP A 1 125 ? 44.483 67.241  8.984   1.00 7.66   ? 125  TRP A CD1 1 
ATOM   990  C  CD2 . TRP A 1 125 ? 42.381 67.775  9.564   1.00 9.61   ? 125  TRP A CD2 1 
ATOM   991  N  NE1 . TRP A 1 125 ? 44.071 68.243  8.169   1.00 8.02   ? 125  TRP A NE1 1 
ATOM   992  C  CE2 . TRP A 1 125 ? 42.782 68.595  8.493   1.00 8.17   ? 125  TRP A CE2 1 
ATOM   993  C  CE3 . TRP A 1 125 ? 41.080 67.914  10.082  1.00 9.31   ? 125  TRP A CE3 1 
ATOM   994  C  CZ2 . TRP A 1 125 ? 41.938 69.564  7.923   1.00 8.11   ? 125  TRP A CZ2 1 
ATOM   995  C  CZ3 . TRP A 1 125 ? 40.231 68.903  9.519   1.00 9.21   ? 125  TRP A CZ3 1 
ATOM   996  C  CH2 . TRP A 1 125 ? 40.670 69.704  8.448   1.00 9.51   ? 125  TRP A CH2 1 
ATOM   997  N  N   . LEU A 1 126 ? 43.063 65.058  14.013  1.00 10.15  ? 126  LEU A N   1 
ATOM   998  C  CA  . LEU A 1 126 ? 42.704 63.788  14.595  1.00 10.60  ? 126  LEU A CA  1 
ATOM   999  C  C   . LEU A 1 126 ? 41.596 63.276  13.696  1.00 10.99  ? 126  LEU A C   1 
ATOM   1000 O  O   . LEU A 1 126 ? 40.637 64.012  13.414  1.00 9.70   ? 126  LEU A O   1 
ATOM   1001 C  CB  . LEU A 1 126 ? 42.202 63.925  16.041  1.00 11.23  ? 126  LEU A CB  1 
ATOM   1002 C  CG  . LEU A 1 126 ? 41.704 62.613  16.666  1.00 11.41  ? 126  LEU A CG  1 
ATOM   1003 C  CD1 . LEU A 1 126 ? 42.832 61.591  16.783  1.00 5.53   ? 126  LEU A CD1 1 
ATOM   1004 C  CD2 . LEU A 1 126 ? 41.053 62.927  18.029  1.00 11.70  ? 126  LEU A CD2 1 
ATOM   1005 N  N   . VAL A 1 127 ? 41.747 62.034  13.224  1.00 10.74  ? 127  VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 127 ? 40.763 61.452  12.297  1.00 11.96  ? 127  VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 127 ? 40.415 60.024  12.712  1.00 11.82  ? 127  VAL A C   1 
ATOM   1008 O  O   . VAL A 1 127 ? 41.232 59.334  13.312  1.00 11.52  ? 127  VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 127 ? 41.196 61.473  10.777  1.00 13.03  ? 127  VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 127 ? 41.994 62.749  10.394  1.00 12.25  ? 127  VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 127 ? 41.965 60.239  10.391  1.00 13.09  ? 127  VAL A CG2 1 
ATOM   1012 N  N   . LEU A 1 128 ? 39.183 59.617  12.421  1.00 11.39  ? 128  LEU A N   1 
ATOM   1013 C  CA  . LEU A 1 128 ? 38.852 58.206  12.457  1.00 10.92  ? 128  LEU A CA  1 
ATOM   1014 C  C   . LEU A 1 128 ? 39.154 57.666  11.069  1.00 10.37  ? 128  LEU A C   1 
ATOM   1015 O  O   . LEU A 1 128 ? 38.492 58.011  10.111  1.00 8.35   ? 128  LEU A O   1 
ATOM   1016 C  CB  . LEU A 1 128 ? 37.381 57.984  12.815  1.00 10.48  ? 128  LEU A CB  1 
ATOM   1017 C  CG  . LEU A 1 128 ? 36.970 56.530  13.093  1.00 13.08  ? 128  LEU A CG  1 
ATOM   1018 C  CD1 . LEU A 1 128 ? 37.514 56.055  14.459  1.00 8.78   ? 128  LEU A CD1 1 
ATOM   1019 C  CD2 . LEU A 1 128 ? 35.416 56.344  12.979  1.00 10.33  ? 128  LEU A CD2 1 
ATOM   1020 N  N   . ASN A 1 129 ? 40.157 56.799  10.987  1.00 10.74  ? 129  ASN A N   1 
ATOM   1021 C  CA  . ASN A 1 129 ? 40.574 56.274  9.695   1.00 10.16  ? 129  ASN A CA  1 
ATOM   1022 C  C   . ASN A 1 129 ? 39.586 55.243  9.114   1.00 10.82  ? 129  ASN A C   1 
ATOM   1023 O  O   . ASN A 1 129 ? 38.554 54.915  9.720   1.00 9.53   ? 129  ASN A O   1 
ATOM   1024 C  CB  . ASN A 1 129 ? 42.041 55.801  9.741   1.00 9.84   ? 129  ASN A CB  1 
ATOM   1025 C  CG  . ASN A 1 129 ? 42.230 54.432  10.410  1.00 8.72   ? 129  ASN A CG  1 
ATOM   1026 O  OD1 . ASN A 1 129 ? 41.273 53.704  10.697  1.00 10.52  ? 129  ASN A OD1 1 
ATOM   1027 N  ND2 . ASN A 1 129 ? 43.484 54.095  10.693  1.00 6.99   ? 129  ASN A ND2 1 
ATOM   1028 N  N   . ASN A 1 130 ? 39.890 54.759  7.919   1.00 11.00  ? 130  ASN A N   1 
ATOM   1029 C  CA  . ASN A 1 130 ? 38.971 53.858  7.211   1.00 11.63  ? 130  ASN A CA  1 
ATOM   1030 C  C   . ASN A 1 130 ? 38.984 52.422  7.800   1.00 12.03  ? 130  ASN A C   1 
ATOM   1031 O  O   . ASN A 1 130 ? 38.276 51.533  7.308   1.00 11.99  ? 130  ASN A O   1 
ATOM   1032 C  CB  . ASN A 1 130 ? 39.265 53.893  5.713   1.00 11.22  ? 130  ASN A CB  1 
ATOM   1033 C  CG  . ASN A 1 130 ? 39.118 55.296  5.127   1.00 12.74  ? 130  ASN A CG  1 
ATOM   1034 O  OD1 . ASN A 1 130 ? 38.198 56.044  5.494   1.00 8.88   ? 130  ASN A OD1 1 
ATOM   1035 N  ND2 . ASN A 1 130 ? 40.032 55.659  4.219   1.00 11.86  ? 130  ASN A ND2 1 
ATOM   1036 N  N   . ASN A 1 131 ? 39.762 52.239  8.876   1.00 11.60  ? 131  ASN A N   1 
ATOM   1037 C  CA  . ASN A 1 131 ? 39.774 51.008  9.682   1.00 11.08  ? 131  ASN A CA  1 
ATOM   1038 C  C   . ASN A 1 131 ? 39.189 51.237  11.102  1.00 11.18  ? 131  ASN A C   1 
ATOM   1039 O  O   . ASN A 1 131 ? 39.456 50.461  12.024  1.00 10.72  ? 131  ASN A O   1 
ATOM   1040 C  CB  . ASN A 1 131 ? 41.208 50.415  9.658   1.00 11.03  ? 131  ASN A CB  1 
ATOM   1041 C  CG  . ASN A 1 131 ? 41.387 49.143  10.504  1.00 11.89  ? 131  ASN A CG  1 
ATOM   1042 O  OD1 . ASN A 1 131 ? 42.337 49.056  11.285  1.00 11.19  ? 131  ASN A OD1 1 
ATOM   1043 N  ND2 . ASN A 1 131 ? 40.510 48.154  10.333  1.00 9.82   ? 131  ASN A ND2 1 
ATOM   1044 N  N   . ASN A 1 132 ? 38.402 52.307  11.273  1.00 10.80  ? 132  ASN A N   1 
ATOM   1045 C  CA  . ASN A 1 132 ? 37.718 52.595  12.551  1.00 12.51  ? 132  ASN A CA  1 
ATOM   1046 C  C   . ASN A 1 132 ? 38.709 52.914  13.682  1.00 11.60  ? 132  ASN A C   1 
ATOM   1047 O  O   . ASN A 1 132 ? 38.375 52.732  14.833  1.00 10.92  ? 132  ASN A O   1 
ATOM   1048 C  CB  . ASN A 1 132 ? 36.825 51.389  12.969  1.00 12.97  ? 132  ASN A CB  1 
ATOM   1049 C  CG  . ASN A 1 132 ? 35.567 51.807  13.740  1.00 19.84  ? 132  ASN A CG  1 
ATOM   1050 O  OD1 . ASN A 1 132 ? 35.295 51.310  14.856  1.00 22.66  ? 132  ASN A OD1 1 
ATOM   1051 N  ND2 . ASN A 1 132 ? 34.788 52.715  13.148  1.00 20.63  ? 132  ASN A ND2 1 
ATOM   1052 N  N   . LYS A 1 133 ? 39.942 53.315  13.347  1.00 11.11  ? 133  LYS A N   1 
ATOM   1053 C  CA  . LYS A 1 133 ? 40.947 53.666  14.366  1.00 10.25  ? 133  LYS A CA  1 
ATOM   1054 C  C   . LYS A 1 133 ? 41.263 55.155  14.330  1.00 10.13  ? 133  LYS A C   1 
ATOM   1055 O  O   . LYS A 1 133 ? 41.464 55.719  13.242  1.00 9.17   ? 133  LYS A O   1 
ATOM   1056 C  CB  . LYS A 1 133 ? 42.271 52.922  14.149  1.00 10.77  ? 133  LYS A CB  1 
ATOM   1057 C  CG  . LYS A 1 133 ? 42.210 51.389  14.166  1.00 13.07  ? 133  LYS A CG  1 
ATOM   1058 C  CD  . LYS A 1 133 ? 41.594 50.832  15.410  1.00 14.23  ? 133  LYS A CD  1 
ATOM   1059 C  CE  . LYS A 1 133 ? 42.031 49.362  15.594  1.00 18.08  ? 133  LYS A CE  1 
ATOM   1060 N  NZ  . LYS A 1 133 ? 41.332 48.778  16.746  1.00 20.26  ? 133  LYS A NZ  1 
ATOM   1061 N  N   . LEU A 1 134 ? 41.395 55.771  15.509  1.00 10.22  ? 134  LEU A N   1 
ATOM   1062 C  CA  . LEU A 1 134 ? 41.895 57.160  15.585  1.00 10.81  ? 134  LEU A CA  1 
ATOM   1063 C  C   . LEU A 1 134 ? 43.363 57.230  15.206  1.00 10.38  ? 134  LEU A C   1 
ATOM   1064 O  O   . LEU A 1 134 ? 44.193 56.506  15.733  1.00 10.39  ? 134  LEU A O   1 
ATOM   1065 C  CB  . LEU A 1 134 ? 41.724 57.776  16.987  1.00 9.75   ? 134  LEU A CB  1 
ATOM   1066 C  CG  . LEU A 1 134 ? 40.307 58.067  17.488  1.00 11.69  ? 134  LEU A CG  1 
ATOM   1067 C  CD1 . LEU A 1 134 ? 40.362 58.711  18.894  1.00 10.93  ? 134  LEU A CD1 1 
ATOM   1068 C  CD2 . LEU A 1 134 ? 39.525 58.930  16.521  1.00 8.15   ? 134  LEU A CD2 1 
ATOM   1069 N  N   . VAL A 1 135 ? 43.684 58.138  14.297  1.00 10.87  ? 135  VAL A N   1 
ATOM   1070 C  CA  . VAL A 1 135 ? 45.064 58.402  13.980  1.00 9.41   ? 135  VAL A CA  1 
ATOM   1071 C  C   . VAL A 1 135 ? 45.284 59.922  13.847  1.00 10.29  ? 135  VAL A C   1 
ATOM   1072 O  O   . VAL A 1 135 ? 44.323 60.703  13.748  1.00 10.45  ? 135  VAL A O   1 
ATOM   1073 C  CB  . VAL A 1 135 ? 45.501 57.651  12.695  1.00 9.95   ? 135  VAL A CB  1 
ATOM   1074 C  CG1 . VAL A 1 135 ? 45.339 56.083  12.864  1.00 7.66   ? 135  VAL A CG1 1 
ATOM   1075 C  CG2 . VAL A 1 135 ? 44.760 58.177  11.458  1.00 8.21   ? 135  VAL A CG2 1 
ATOM   1076 N  N   . ILE A 1 136 ? 46.546 60.318  13.810  1.00 10.22  ? 136  ILE A N   1 
ATOM   1077 C  CA  . ILE A 1 136 ? 46.930 61.695  13.563  1.00 10.71  ? 136  ILE A CA  1 
ATOM   1078 C  C   . ILE A 1 136 ? 47.418 61.806  12.124  1.00 10.98  ? 136  ILE A C   1 
ATOM   1079 O  O   . ILE A 1 136 ? 48.220 60.995  11.681  1.00 11.02  ? 136  ILE A O   1 
ATOM   1080 C  CB  . ILE A 1 136 ? 48.077 62.156  14.511  1.00 10.42  ? 136  ILE A CB  1 
ATOM   1081 C  CG1 . ILE A 1 136 ? 47.612 62.199  15.956  1.00 10.28  ? 136  ILE A CG1 1 
ATOM   1082 C  CG2 . ILE A 1 136 ? 48.603 63.521  14.096  1.00 9.25   ? 136  ILE A CG2 1 
ATOM   1083 C  CD1 . ILE A 1 136 ? 48.794 62.122  16.959  1.00 8.97   ? 136  ILE A CD1 1 
ATOM   1084 N  N   . LEU A 1 137 ? 46.920 62.811  11.412  1.00 10.12  ? 137  LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 137 ? 47.322 63.079  10.040  1.00 9.83   ? 137  LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 137 ? 47.670 64.554  9.921   1.00 9.04   ? 137  LEU A C   1 
ATOM   1087 O  O   . LEU A 1 137 ? 47.230 65.365  10.727  1.00 8.85   ? 137  LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 137 ? 46.164 62.777  9.056   1.00 10.15  ? 137  LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 137 ? 45.664 61.323  8.902   1.00 11.11  ? 137  LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 137 ? 44.535 61.281  7.862   1.00 10.02  ? 137  LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 137 ? 46.798 60.347  8.520   1.00 10.03  ? 137  LEU A CD2 1 
ATOM   1092 N  N   . GLN A 1 138 ? 48.456 64.900  8.913   1.00 8.31   ? 138  GLN A N   1 
ATOM   1093 C  CA  . GLN A 1 138 ? 48.695 66.291  8.613   1.00 9.39   ? 138  GLN A CA  1 
ATOM   1094 C  C   . GLN A 1 138 ? 48.380 66.522  7.154   1.00 9.62   ? 138  GLN A C   1 
ATOM   1095 O  O   . GLN A 1 138 ? 48.542 65.610  6.338   1.00 9.74   ? 138  GLN A O   1 
ATOM   1096 C  CB  . GLN A 1 138 ? 50.151 66.665  8.917   1.00 8.91   ? 138  GLN A CB  1 
ATOM   1097 C  CG  . GLN A 1 138 ? 51.184 65.888  8.161   1.00 9.88   ? 138  GLN A CG  1 
ATOM   1098 C  CD  . GLN A 1 138 ? 52.551 66.134  8.704   1.00 12.84  ? 138  GLN A CD  1 
ATOM   1099 O  OE1 . GLN A 1 138 ? 52.996 67.277  8.789   1.00 11.41  ? 138  GLN A OE1 1 
ATOM   1100 N  NE2 . GLN A 1 138 ? 53.233 65.061  9.104   1.00 14.62  ? 138  GLN A NE2 1 
ATOM   1101 N  N   . THR A 1 139 ? 47.919 67.723  6.827   1.00 8.97   ? 139  THR A N   1 
ATOM   1102 C  CA  . THR A 1 139 ? 47.705 68.070  5.418   1.00 9.66   ? 139  THR A CA  1 
ATOM   1103 C  C   . THR A 1 139 ? 48.321 69.401  5.118   1.00 9.54   ? 139  THR A C   1 
ATOM   1104 O  O   . THR A 1 139 ? 48.581 70.202  6.028   1.00 9.56   ? 139  THR A O   1 
ATOM   1105 C  CB  . THR A 1 139 ? 46.202 68.140  5.038   1.00 9.10   ? 139  THR A CB  1 
ATOM   1106 O  OG1 . THR A 1 139 ? 45.547 69.104  5.881   1.00 8.92   ? 139  THR A OG1 1 
ATOM   1107 C  CG2 . THR A 1 139 ? 45.553 66.788  5.237   1.00 8.92   ? 139  THR A CG2 1 
ATOM   1108 N  N   . HIS A 1 140 ? 48.531 69.642  3.829   1.00 9.70   ? 140  HIS A N   1 
ATOM   1109 C  CA  . HIS A 1 140 ? 49.269 70.802  3.382   1.00 9.58   ? 140  HIS A CA  1 
ATOM   1110 C  C   . HIS A 1 140 ? 48.345 71.822  2.747   1.00 9.55   ? 140  HIS A C   1 
ATOM   1111 O  O   . HIS A 1 140 ? 47.435 71.452  1.992   1.00 9.20   ? 140  HIS A O   1 
ATOM   1112 C  CB  . HIS A 1 140 ? 50.333 70.374  2.376   1.00 10.31  ? 140  HIS A CB  1 
ATOM   1113 C  CG  . HIS A 1 140 ? 51.476 71.349  2.253   1.00 11.35  ? 140  HIS A CG  1 
ATOM   1114 N  ND1 . HIS A 1 140 ? 52.218 71.771  3.335   1.00 10.22  ? 140  HIS A ND1 1 
ATOM   1115 C  CD2 . HIS A 1 140 ? 52.004 71.969  1.169   1.00 10.30  ? 140  HIS A CD2 1 
ATOM   1116 C  CE1 . HIS A 1 140 ? 53.152 72.609  2.922   1.00 10.50  ? 140  HIS A CE1 1 
ATOM   1117 N  NE2 . HIS A 1 140 ? 53.046 72.742  1.616   1.00 10.45  ? 140  HIS A NE2 1 
ATOM   1118 N  N   . ASP A 1 141 ? 48.578 73.099  3.067   1.00 9.18   ? 141  ASP A N   1 
ATOM   1119 C  CA  . ASP A 1 141 ? 47.784 74.205  2.515   1.00 10.11  ? 141  ASP A CA  1 
ATOM   1120 C  C   . ASP A 1 141 ? 46.281 74.083  2.872   1.00 9.29   ? 141  ASP A C   1 
ATOM   1121 O  O   . ASP A 1 141 ? 45.934 74.234  4.044   1.00 10.70  ? 141  ASP A O   1 
ATOM   1122 C  CB  . ASP A 1 141 ? 48.053 74.327  0.999   1.00 10.68  ? 141  ASP A CB  1 
ATOM   1123 C  CG  . ASP A 1 141 ? 49.521 74.585  0.693   1.00 10.15  ? 141  ASP A CG  1 
ATOM   1124 O  OD1 . ASP A 1 141 ? 50.163 75.400  1.363   1.00 11.68  ? 141  ASP A OD1 1 
ATOM   1125 O  OD2 . ASP A 1 141 ? 50.045 73.978  -0.231  1.00 14.95  ? 141  ASP A OD2 1 
ATOM   1126 N  N   . ALA A 1 142 ? 45.411 73.838  1.890   1.00 9.74   ? 142  ALA A N   1 
ATOM   1127 C  CA  . ALA A 1 142 ? 43.948 73.708  2.101   1.00 9.24   ? 142  ALA A CA  1 
ATOM   1128 C  C   . ALA A 1 142 ? 43.477 72.247  2.181   1.00 9.85   ? 142  ALA A C   1 
ATOM   1129 O  O   . ALA A 1 142 ? 42.266 71.964  2.302   1.00 9.74   ? 142  ALA A O   1 
ATOM   1130 C  CB  . ALA A 1 142 ? 43.191 74.423  1.007   1.00 9.98   ? 142  ALA A CB  1 
ATOM   1131 N  N   . GLY A 1 143 ? 44.423 71.326  2.107   1.00 9.46   ? 143  GLY A N   1 
ATOM   1132 C  CA  . GLY A 1 143 ? 44.083 69.907  2.057   1.00 10.18  ? 143  GLY A CA  1 
ATOM   1133 C  C   . GLY A 1 143 ? 43.364 69.422  3.297   1.00 10.02  ? 143  GLY A C   1 
ATOM   1134 O  O   . GLY A 1 143 ? 43.589 69.928  4.392   1.00 9.04   ? 143  GLY A O   1 
ATOM   1135 N  N   . ASN A 1 144 ? 42.485 68.439  3.128   1.00 11.09  ? 144  ASN A N   1 
ATOM   1136 C  CA  . ASN A 1 144 ? 41.918 67.787  4.311   1.00 11.96  ? 144  ASN A CA  1 
ATOM   1137 C  C   . ASN A 1 144 ? 41.601 66.308  4.081   1.00 11.40  ? 144  ASN A C   1 
ATOM   1138 O  O   . ASN A 1 144 ? 41.582 65.838  2.927   1.00 11.29  ? 144  ASN A O   1 
ATOM   1139 C  CB  . ASN A 1 144 ? 40.735 68.580  4.887   1.00 12.61  ? 144  ASN A CB  1 
ATOM   1140 C  CG  . ASN A 1 144 ? 39.537 68.640  3.941   1.00 13.68  ? 144  ASN A CG  1 
ATOM   1141 O  OD1 . ASN A 1 144 ? 39.093 67.616  3.397   1.00 14.95  ? 144  ASN A OD1 1 
ATOM   1142 N  ND2 . ASN A 1 144 ? 38.993 69.833  3.772   1.00 16.40  ? 144  ASN A ND2 1 
ATOM   1143 N  N   . PRO A 1 145 ? 41.412 65.562  5.166   1.00 10.77  ? 145  PRO A N   1 
ATOM   1144 C  CA  . PRO A 1 145 ? 41.137 64.117  5.042   1.00 11.40  ? 145  PRO A CA  1 
ATOM   1145 C  C   . PRO A 1 145 ? 39.850 63.709  4.263   1.00 11.67  ? 145  PRO A C   1 
ATOM   1146 O  O   . PRO A 1 145 ? 39.775 62.593  3.786   1.00 12.21  ? 145  PRO A O   1 
ATOM   1147 C  CB  . PRO A 1 145 ? 41.085 63.638  6.513   1.00 10.66  ? 145  PRO A CB  1 
ATOM   1148 C  CG  . PRO A 1 145 ? 41.922 64.693  7.274   1.00 11.29  ? 145  PRO A CG  1 
ATOM   1149 C  CD  . PRO A 1 145 ? 41.518 65.980  6.577   1.00 11.57  ? 145  PRO A CD  1 
ATOM   1150 N  N   . ILE A 1 146 ? 38.840 64.578  4.184   1.00 12.50  ? 146  ILE A N   1 
ATOM   1151 C  CA  . ILE A 1 146 ? 37.631 64.283  3.402   1.00 12.44  ? 146  ILE A CA  1 
ATOM   1152 C  C   . ILE A 1 146 ? 37.977 64.234  1.916   1.00 12.88  ? 146  ILE A C   1 
ATOM   1153 O  O   . ILE A 1 146 ? 37.638 63.261  1.218   1.00 12.75  ? 146  ILE A O   1 
ATOM   1154 C  CB  . ILE A 1 146 ? 36.494 65.285  3.688   1.00 12.88  ? 146  ILE A CB  1 
ATOM   1155 C  CG1 . ILE A 1 146 ? 36.047 65.157  5.153   1.00 13.42  ? 146  ILE A CG1 1 
ATOM   1156 C  CG2 . ILE A 1 146 ? 35.289 65.076  2.724   1.00 14.50  ? 146  ILE A CG2 1 
ATOM   1157 C  CD1 . ILE A 1 146 ? 35.072 66.225  5.597   1.00 14.91  ? 146  ILE A CD1 1 
ATOM   1158 N  N   . LYS A 1 147 ? 38.673 65.270  1.439   1.00 12.87  ? 147  LYS A N   1 
ATOM   1159 C  CA  . LYS A 1 147 ? 39.167 65.290  0.073   1.00 13.40  ? 147  LYS A CA  1 
ATOM   1160 C  C   . LYS A 1 147 ? 40.084 64.114  -0.170  1.00 13.64  ? 147  LYS A C   1 
ATOM   1161 O  O   . LYS A 1 147 ? 39.910 63.404  -1.151  1.00 14.05  ? 147  LYS A O   1 
ATOM   1162 C  CB  . LYS A 1 147 ? 39.875 66.610  -0.265  1.00 13.27  ? 147  LYS A CB  1 
ATOM   1163 C  CG  . LYS A 1 147 ? 40.306 66.721  -1.707  1.00 14.83  ? 147  LYS A CG  1 
ATOM   1164 C  CD  . LYS A 1 147 ? 39.111 66.609  -2.637  1.00 18.51  ? 147  LYS A CD  1 
ATOM   1165 C  CE  . LYS A 1 147 ? 39.479 66.750  -4.087  1.00 21.66  ? 147  LYS A CE  1 
ATOM   1166 N  NZ  . LYS A 1 147 ? 38.625 67.811  -4.719  1.00 24.58  ? 147  LYS A NZ  1 
ATOM   1167 N  N   . ASP A 1 148 ? 41.039 63.886  0.723   1.00 12.69  ? 148  ASP A N   1 
ATOM   1168 C  CA  . ASP A 1 148 ? 41.983 62.773  0.555   1.00 13.19  ? 148  ASP A CA  1 
ATOM   1169 C  C   . ASP A 1 148 ? 41.336 61.397  0.747   1.00 13.42  ? 148  ASP A C   1 
ATOM   1170 O  O   . ASP A 1 148 ? 41.942 60.386  0.398   1.00 13.42  ? 148  ASP A O   1 
ATOM   1171 C  CB  . ASP A 1 148 ? 43.148 62.908  1.551   1.00 11.82  ? 148  ASP A CB  1 
ATOM   1172 C  CG  . ASP A 1 148 ? 43.962 64.203  1.359   1.00 13.11  ? 148  ASP A CG  1 
ATOM   1173 O  OD1 . ASP A 1 148 ? 43.839 64.885  0.305   1.00 13.82  ? 148  ASP A OD1 1 
ATOM   1174 O  OD2 . ASP A 1 148 ? 44.758 64.524  2.270   1.00 11.25  ? 148  ASP A OD2 1 
ATOM   1175 N  N   . ASN A 1 149 ? 40.141 61.355  1.351   1.00 14.17  ? 149  ASN A N   1 
ATOM   1176 C  CA  . ASN A 1 149 ? 39.455 60.084  1.689   1.00 13.67  ? 149  ASN A CA  1 
ATOM   1177 C  C   . ASN A 1 149 ? 40.269 59.180  2.647   1.00 13.81  ? 149  ASN A C   1 
ATOM   1178 O  O   . ASN A 1 149 ? 40.249 57.930  2.566   1.00 12.24  ? 149  ASN A O   1 
ATOM   1179 C  CB  . ASN A 1 149 ? 39.042 59.327  0.409   1.00 15.14  ? 149  ASN A CB  1 
ATOM   1180 C  CG  . ASN A 1 149 ? 38.036 58.221  0.688   1.00 14.52  ? 149  ASN A CG  1 
ATOM   1181 O  OD1 . ASN A 1 149 ? 37.140 58.408  1.496   1.00 13.45  ? 149  ASN A OD1 1 
ATOM   1182 N  ND2 . ASN A 1 149 ? 38.202 57.071  0.045   1.00 13.88  ? 149  ASN A ND2 1 
ATOM   1183 N  N   . THR A 1 150 ? 40.973 59.825  3.579   1.00 13.58  ? 150  THR A N   1 
ATOM   1184 C  CA  . THR A 1 150 ? 41.890 59.131  4.504   1.00 12.95  ? 150  THR A CA  1 
ATOM   1185 C  C   . THR A 1 150 ? 41.249 58.892  5.887   1.00 12.34  ? 150  THR A C   1 
ATOM   1186 O  O   . THR A 1 150 ? 41.815 58.215  6.739   1.00 12.55  ? 150  THR A O   1 
ATOM   1187 C  CB  . THR A 1 150 ? 43.195 59.935  4.676   1.00 14.58  ? 150  THR A CB  1 
ATOM   1188 O  OG1 . THR A 1 150 ? 42.871 61.315  4.924   1.00 12.65  ? 150  THR A OG1 1 
ATOM   1189 C  CG2 . THR A 1 150 ? 44.075 59.827  3.403   1.00 12.79  ? 150  THR A CG2 1 
ATOM   1190 N  N   . GLY A 1 151 ? 40.064 59.452  6.093   1.00 12.49  ? 151  GLY A N   1 
ATOM   1191 C  CA  . GLY A 1 151 ? 39.243 59.163  7.266   1.00 12.65  ? 151  GLY A CA  1 
ATOM   1192 C  C   . GLY A 1 151 ? 38.313 60.328  7.552   1.00 13.49  ? 151  GLY A C   1 
ATOM   1193 O  O   . GLY A 1 151 ? 38.228 61.255  6.761   1.00 13.09  ? 151  GLY A O   1 
ATOM   1194 N  N   . ILE A 1 152 ? 37.637 60.271  8.698   1.00 12.90  ? 152  ILE A N   1 
ATOM   1195 C  CA  . ILE A 1 152 ? 36.646 61.260  9.075   1.00 13.22  ? 152  ILE A CA  1 
ATOM   1196 C  C   . ILE A 1 152 ? 37.226 62.180  10.130  1.00 11.85  ? 152  ILE A C   1 
ATOM   1197 O  O   . ILE A 1 152 ? 37.534 61.742  11.218  1.00 11.99  ? 152  ILE A O   1 
ATOM   1198 C  CB  . ILE A 1 152 ? 35.348 60.586  9.599   1.00 12.72  ? 152  ILE A CB  1 
ATOM   1199 C  CG1 . ILE A 1 152 ? 34.657 59.826  8.454   1.00 14.45  ? 152  ILE A CG1 1 
ATOM   1200 C  CG2 . ILE A 1 152 ? 34.430 61.606  10.258  1.00 14.65  ? 152  ILE A CG2 1 
ATOM   1201 C  CD1 . ILE A 1 152 ? 33.734 58.697  8.944   1.00 16.03  ? 152  ILE A CD1 1 
ATOM   1202 N  N   . PRO A 1 153 ? 37.373 63.468  9.793   1.00 12.03  ? 153  PRO A N   1 
ATOM   1203 C  CA  . PRO A 1 153 ? 37.867 64.490  10.716  1.00 11.47  ? 153  PRO A CA  1 
ATOM   1204 C  C   . PRO A 1 153 ? 37.135 64.510  12.087  1.00 11.16  ? 153  PRO A C   1 
ATOM   1205 O  O   . PRO A 1 153 ? 35.908 64.505  12.150  1.00 10.50  ? 153  PRO A O   1 
ATOM   1206 C  CB  . PRO A 1 153 ? 37.626 65.781  9.943   1.00 11.73  ? 153  PRO A CB  1 
ATOM   1207 C  CG  . PRO A 1 153 ? 37.875 65.349  8.456   1.00 10.66  ? 153  PRO A CG  1 
ATOM   1208 C  CD  . PRO A 1 153 ? 37.079 64.036  8.454   1.00 11.42  ? 153  PRO A CD  1 
ATOM   1209 N  N   . ILE A 1 154 ? 37.903 64.541  13.164  1.00 9.83   ? 154  ILE A N   1 
ATOM   1210 C  CA  . ILE A 1 154 ? 37.341 64.579  14.516  1.00 9.58   ? 154  ILE A CA  1 
ATOM   1211 C  C   . ILE A 1 154 ? 37.646 65.952  15.181  1.00 9.25   ? 154  ILE A C   1 
ATOM   1212 O  O   . ILE A 1 154 ? 36.781 66.553  15.829  1.00 7.58   ? 154  ILE A O   1 
ATOM   1213 C  CB  . ILE A 1 154 ? 37.928 63.408  15.408  1.00 9.34   ? 154  ILE A CB  1 
ATOM   1214 C  CG1 . ILE A 1 154 ? 37.633 62.005  14.803  1.00 9.47   ? 154  ILE A CG1 1 
ATOM   1215 C  CG2 . ILE A 1 154 ? 37.453 63.517  16.827  1.00 7.12   ? 154  ILE A CG2 1 
ATOM   1216 C  CD1 . ILE A 1 154 ? 36.145 61.612  14.680  1.00 7.58   ? 154  ILE A CD1 1 
ATOM   1217 N  N   . LEU A 1 155 ? 38.898 66.394  15.030  1.00 9.37   ? 155  LEU A N   1 
ATOM   1218 C  CA  . LEU A 1 155 ? 39.392 67.700  15.473  1.00 9.63   ? 155  LEU A CA  1 
ATOM   1219 C  C   . LEU A 1 155 ? 40.480 68.177  14.496  1.00 9.88   ? 155  LEU A C   1 
ATOM   1220 O  O   . LEU A 1 155 ? 41.155 67.357  13.875  1.00 8.46   ? 155  LEU A O   1 
ATOM   1221 C  CB  . LEU A 1 155 ? 40.034 67.618  16.867  1.00 9.64   ? 155  LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1 155 ? 39.226 67.314  18.115  1.00 10.84  ? 155  LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1 155 ? 40.131 66.949  19.294  1.00 10.85  ? 155  LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1 155 ? 38.291 68.489  18.468  1.00 12.41  ? 155  LEU A CD2 1 
ATOM   1225 N  N   . THR A 1 156 ? 40.647 69.493  14.378  1.00 9.46   ? 156  THR A N   1 
ATOM   1226 C  CA  . THR A 1 156 ? 41.799 70.032  13.633  1.00 9.60   ? 156  THR A CA  1 
ATOM   1227 C  C   . THR A 1 156 ? 42.445 71.199  14.370  1.00 9.18   ? 156  THR A C   1 
ATOM   1228 O  O   . THR A 1 156 ? 41.808 71.843  15.244  1.00 9.02   ? 156  THR A O   1 
ATOM   1229 C  CB  . THR A 1 156 ? 41.428 70.473  12.196  1.00 9.16   ? 156  THR A CB  1 
ATOM   1230 O  OG1 . THR A 1 156 ? 42.620 70.656  11.418  1.00 9.45   ? 156  THR A OG1 1 
ATOM   1231 C  CG2 . THR A 1 156 ? 40.613 71.766  12.201  1.00 8.18   ? 156  THR A CG2 1 
ATOM   1232 N  N   . CYS A 1 157 ? 43.718 71.427  14.011  1.00 9.19   ? 157  CYS A N   1 
ATOM   1233 C  CA  . CYS A 1 157 ? 44.530 72.549  14.473  1.00 9.00   ? 157  CYS A CA  1 
ATOM   1234 C  C   . CYS A 1 157 ? 45.262 73.147  13.269  1.00 9.06   ? 157  CYS A C   1 
ATOM   1235 O  O   . CYS A 1 157 ? 45.992 72.470  12.530  1.00 9.45   ? 157  CYS A O   1 
ATOM   1236 C  CB  . CYS A 1 157 ? 45.522 72.157  15.595  1.00 8.73   ? 157  CYS A CB  1 
ATOM   1237 S  SG  . CYS A 1 157 ? 46.444 73.631  16.264  1.00 10.39  ? 157  CYS A SG  1 
ATOM   1238 N  N   . ASP A 1 158 ? 45.023 74.432  13.063  1.00 8.21   ? 158  ASP A N   1 
ATOM   1239 C  CA  . ASP A 1 158 ? 45.623 75.183  11.981  1.00 8.09   ? 158  ASP A CA  1 
ATOM   1240 C  C   . ASP A 1 158 ? 47.022 75.550  12.362  1.00 8.39   ? 158  ASP A C   1 
ATOM   1241 O  O   . ASP A 1 158 ? 47.251 76.103  13.452  1.00 8.95   ? 158  ASP A O   1 
ATOM   1242 C  CB  . ASP A 1 158 ? 44.830 76.465  11.864  1.00 8.40   ? 158  ASP A CB  1 
ATOM   1243 C  CG  . ASP A 1 158 ? 45.150 77.262  10.647  1.00 8.40   ? 158  ASP A CG  1 
ATOM   1244 O  OD1 . ASP A 1 158 ? 45.974 76.910  9.788   1.00 11.69  ? 158  ASP A OD1 1 
ATOM   1245 O  OD2 . ASP A 1 158 ? 44.531 78.306  10.585  1.00 9.76   ? 158  ASP A OD2 1 
ATOM   1246 N  N   . ILE A 1 159 ? 47.972 75.247  11.480  1.00 8.02   ? 159  ILE A N   1 
ATOM   1247 C  CA  . ILE A 1 159 ? 49.326 75.727  11.716  1.00 8.50   ? 159  ILE A CA  1 
ATOM   1248 C  C   . ILE A 1 159 ? 49.844 76.655  10.624  1.00 7.75   ? 159  ILE A C   1 
ATOM   1249 O  O   . ILE A 1 159 ? 51.024 76.981  10.633  1.00 8.29   ? 159  ILE A O   1 
ATOM   1250 C  CB  . ILE A 1 159 ? 50.347 74.598  12.074  1.00 8.06   ? 159  ILE A CB  1 
ATOM   1251 C  CG1 . ILE A 1 159 ? 50.340 73.442  11.066  1.00 7.58   ? 159  ILE A CG1 1 
ATOM   1252 C  CG2 . ILE A 1 159 ? 50.103 74.109  13.527  1.00 10.29  ? 159  ILE A CG2 1 
ATOM   1253 C  CD1 . ILE A 1 159 ? 51.095 73.774  9.827   1.00 10.40  ? 159  ILE A CD1 1 
ATOM   1254 N  N   . TRP A 1 160 ? 48.968 77.129  9.723   1.00 7.93   ? 160  TRP A N   1 
ATOM   1255 C  CA  . TRP A 1 160 ? 49.348 78.309  8.902   1.00 7.89   ? 160  TRP A CA  1 
ATOM   1256 C  C   . TRP A 1 160 ? 49.901 79.379  9.856   1.00 8.64   ? 160  TRP A C   1 
ATOM   1257 O  O   . TRP A 1 160 ? 49.391 79.540  10.975  1.00 9.38   ? 160  TRP A O   1 
ATOM   1258 C  CB  . TRP A 1 160 ? 48.176 78.907  8.144   1.00 7.28   ? 160  TRP A CB  1 
ATOM   1259 C  CG  . TRP A 1 160 ? 47.692 78.155  6.893   1.00 7.91   ? 160  TRP A CG  1 
ATOM   1260 C  CD1 . TRP A 1 160 ? 47.254 76.864  6.821   1.00 6.98   ? 160  TRP A CD1 1 
ATOM   1261 C  CD2 . TRP A 1 160 ? 47.523 78.703  5.578   1.00 8.26   ? 160  TRP A CD2 1 
ATOM   1262 N  NE1 . TRP A 1 160 ? 46.858 76.566  5.539   1.00 8.01   ? 160  TRP A NE1 1 
ATOM   1263 C  CE2 . TRP A 1 160 ? 47.006 77.677  4.759   1.00 7.91   ? 160  TRP A CE2 1 
ATOM   1264 C  CE3 . TRP A 1 160 ? 47.826 79.941  4.998   1.00 8.11   ? 160  TRP A CE3 1 
ATOM   1265 C  CZ2 . TRP A 1 160 ? 46.782 77.853  3.387   1.00 8.90   ? 160  TRP A CZ2 1 
ATOM   1266 C  CZ3 . TRP A 1 160 ? 47.588 80.124  3.655   1.00 7.42   ? 160  TRP A CZ3 1 
ATOM   1267 C  CH2 . TRP A 1 160 ? 47.034 79.103  2.862   1.00 8.18   ? 160  TRP A CH2 1 
ATOM   1268 N  N   . GLU A 1 161 ? 50.919 80.124  9.406   1.00 8.71   ? 161  GLU A N   1 
ATOM   1269 C  CA  . GLU A 1 161 ? 51.529 81.186  10.234  1.00 8.95   ? 161  GLU A CA  1 
ATOM   1270 C  C   . GLU A 1 161 ? 50.588 82.258  10.783  1.00 8.65   ? 161  GLU A C   1 
ATOM   1271 O  O   . GLU A 1 161 ? 50.775 82.691  11.924  1.00 9.07   ? 161  GLU A O   1 
ATOM   1272 C  CB  . GLU A 1 161 ? 52.753 81.803  9.566   1.00 8.10   ? 161  GLU A CB  1 
ATOM   1273 C  CG  . GLU A 1 161 ? 53.870 80.748  9.340   1.00 8.04   ? 161  GLU A CG  1 
ATOM   1274 C  CD  . GLU A 1 161 ? 55.106 81.273  8.647   1.00 9.35   ? 161  GLU A CD  1 
ATOM   1275 O  OE1 . GLU A 1 161 ? 54.967 82.035  7.654   1.00 6.32   ? 161  GLU A OE1 1 
ATOM   1276 O  OE2 . GLU A 1 161 ? 56.226 80.925  9.121   1.00 9.55   ? 161  GLU A OE2 1 
ATOM   1277 N  N   . HIS A 1 162 ? 49.576 82.657  10.014  1.00 8.41   ? 162  HIS A N   1 
ATOM   1278 C  CA  . HIS A 1 162 ? 48.586 83.648  10.494  1.00 8.05   ? 162  HIS A CA  1 
ATOM   1279 C  C   . HIS A 1 162 ? 47.798 83.161  11.698  1.00 7.73   ? 162  HIS A C   1 
ATOM   1280 O  O   . HIS A 1 162 ? 47.252 83.974  12.439  1.00 8.45   ? 162  HIS A O   1 
ATOM   1281 C  CB  . HIS A 1 162 ? 47.640 84.129  9.377   1.00 7.16   ? 162  HIS A CB  1 
ATOM   1282 C  CG  . HIS A 1 162 ? 46.773 83.055  8.795   1.00 6.50   ? 162  HIS A CG  1 
ATOM   1283 N  ND1 . HIS A 1 162 ? 46.846 82.683  7.472   1.00 7.55   ? 162  HIS A ND1 1 
ATOM   1284 C  CD2 . HIS A 1 162 ? 45.805 82.278  9.347   1.00 6.82   ? 162  HIS A CD2 1 
ATOM   1285 C  CE1 . HIS A 1 162 ? 45.974 81.724  7.235   1.00 6.45   ? 162  HIS A CE1 1 
ATOM   1286 N  NE2 . HIS A 1 162 ? 45.323 81.474  8.346   1.00 6.93   ? 162  HIS A NE2 1 
ATOM   1287 N  N   . ALA A 1 163 ? 47.782 81.843  11.935  1.00 7.93   ? 163  ALA A N   1 
ATOM   1288 C  CA  . ALA A 1 163 ? 47.081 81.324  13.110  1.00 7.77   ? 163  ALA A CA  1 
ATOM   1289 C  C   . ALA A 1 163 ? 47.764 81.763  14.421  1.00 8.36   ? 163  ALA A C   1 
ATOM   1290 O  O   . ALA A 1 163 ? 47.094 81.848  15.460  1.00 8.05   ? 163  ALA A O   1 
ATOM   1291 C  CB  . ALA A 1 163 ? 46.965 79.811  13.068  1.00 6.82   ? 163  ALA A CB  1 
ATOM   1292 N  N   . TYR A 1 164 ? 49.078 81.998  14.395  1.00 7.22   ? 164  TYR A N   1 
ATOM   1293 C  CA  . TYR A 1 164 ? 49.785 82.237  15.661  1.00 7.62   ? 164  TYR A CA  1 
ATOM   1294 C  C   . TYR A 1 164 ? 50.758 83.413  15.685  1.00 8.39   ? 164  TYR A C   1 
ATOM   1295 O  O   . TYR A 1 164 ? 51.178 83.831  16.781  1.00 7.58   ? 164  TYR A O   1 
ATOM   1296 C  CB  . TYR A 1 164 ? 50.494 80.951  16.122  1.00 8.18   ? 164  TYR A CB  1 
ATOM   1297 C  CG  . TYR A 1 164 ? 51.473 80.389  15.091  1.00 6.51   ? 164  TYR A CG  1 
ATOM   1298 C  CD1 . TYR A 1 164 ? 52.800 80.838  15.043  1.00 6.90   ? 164  TYR A CD1 1 
ATOM   1299 C  CD2 . TYR A 1 164 ? 51.073 79.401  14.203  1.00 4.80   ? 164  TYR A CD2 1 
ATOM   1300 C  CE1 . TYR A 1 164 ? 53.704 80.331  14.092  1.00 7.77   ? 164  TYR A CE1 1 
ATOM   1301 C  CE2 . TYR A 1 164 ? 51.964 78.855  13.264  1.00 5.98   ? 164  TYR A CE2 1 
ATOM   1302 C  CZ  . TYR A 1 164 ? 53.269 79.330  13.213  1.00 8.15   ? 164  TYR A CZ  1 
ATOM   1303 O  OH  . TYR A 1 164 ? 54.131 78.781  12.296  1.00 7.92   ? 164  TYR A OH  1 
ATOM   1304 N  N   . TYR A 1 165 ? 51.076 83.972  14.503  1.00 8.76   ? 165  TYR A N   1 
ATOM   1305 C  CA  . TYR A 1 165 ? 52.176 84.970  14.366  1.00 9.53   ? 165  TYR A CA  1 
ATOM   1306 C  C   . TYR A 1 165 ? 52.007 86.279  15.184  1.00 10.34  ? 165  TYR A C   1 
ATOM   1307 O  O   . TYR A 1 165 ? 53.018 86.882  15.655  1.00 10.76  ? 165  TYR A O   1 
ATOM   1308 C  CB  . TYR A 1 165 ? 52.524 85.269  12.870  1.00 9.12   ? 165  TYR A CB  1 
ATOM   1309 C  CG  . TYR A 1 165 ? 54.034 85.344  12.696  1.00 9.77   ? 165  TYR A CG  1 
ATOM   1310 C  CD1 . TYR A 1 165 ? 54.790 84.177  12.544  1.00 9.20   ? 165  TYR A CD1 1 
ATOM   1311 C  CD2 . TYR A 1 165 ? 54.712 86.566  12.718  1.00 8.46   ? 165  TYR A CD2 1 
ATOM   1312 C  CE1 . TYR A 1 165 ? 56.189 84.213  12.438  1.00 9.08   ? 165  TYR A CE1 1 
ATOM   1313 C  CE2 . TYR A 1 165 ? 56.126 86.617  12.568  1.00 7.23   ? 165  TYR A CE2 1 
ATOM   1314 C  CZ  . TYR A 1 165 ? 56.845 85.431  12.465  1.00 9.26   ? 165  TYR A CZ  1 
ATOM   1315 O  OH  . TYR A 1 165 ? 58.211 85.445  12.361  1.00 8.40   ? 165  TYR A OH  1 
ATOM   1316 N  N   . ILE A 1 166 ? 50.758 86.722  15.346  1.00 9.42   ? 166  ILE A N   1 
ATOM   1317 C  CA  . ILE A 1 166 ? 50.431 87.894  16.215  1.00 9.54   ? 166  ILE A CA  1 
ATOM   1318 C  C   . ILE A 1 166 ? 50.819 87.618  17.682  1.00 10.07  ? 166  ILE A C   1 
ATOM   1319 O  O   . ILE A 1 166 ? 51.448 88.445  18.360  1.00 10.25  ? 166  ILE A O   1 
ATOM   1320 C  CB  . ILE A 1 166 ? 48.902 88.235  16.117  1.00 9.03   ? 166  ILE A CB  1 
ATOM   1321 C  CG1 . ILE A 1 166 ? 48.562 88.609  14.674  1.00 8.48   ? 166  ILE A CG1 1 
ATOM   1322 C  CG2 . ILE A 1 166 ? 48.514 89.424  17.045  1.00 8.37   ? 166  ILE A CG2 1 
ATOM   1323 C  CD1 . ILE A 1 166 ? 47.038 88.663  14.354  1.00 7.03   ? 166  ILE A CD1 1 
ATOM   1324 N  N   . ASP A 1 167 ? 50.491 86.419  18.144  1.00 10.62  ? 167  ASP A N   1 
ATOM   1325 C  CA  . ASP A 1 167 ? 50.600 86.082  19.549  1.00 11.25  ? 167  ASP A CA  1 
ATOM   1326 C  C   . ASP A 1 167 ? 51.937 85.465  19.923  1.00 11.30  ? 167  ASP A C   1 
ATOM   1327 O  O   . ASP A 1 167 ? 52.362 85.621  21.068  1.00 11.12  ? 167  ASP A O   1 
ATOM   1328 C  CB  . ASP A 1 167 ? 49.460 85.149  19.949  1.00 11.11  ? 167  ASP A CB  1 
ATOM   1329 C  CG  . ASP A 1 167 ? 48.104 85.769  19.708  1.00 13.00  ? 167  ASP A CG  1 
ATOM   1330 O  OD1 . ASP A 1 167 ? 47.994 87.027  19.849  1.00 12.10  ? 167  ASP A OD1 1 
ATOM   1331 O  OD2 . ASP A 1 167 ? 47.140 85.013  19.387  1.00 12.50  ? 167  ASP A OD2 1 
ATOM   1332 N  N   . TYR A 1 168 ? 52.577 84.759  18.976  1.00 10.22  ? 168  TYR A N   1 
ATOM   1333 C  CA  . TYR A 1 168 ? 53.717 83.904  19.293  1.00 10.35  ? 168  TYR A CA  1 
ATOM   1334 C  C   . TYR A 1 168 ? 54.869 84.088  18.317  1.00 10.57  ? 168  TYR A C   1 
ATOM   1335 O  O   . TYR A 1 168 ? 55.924 83.445  18.480  1.00 10.54  ? 168  TYR A O   1 
ATOM   1336 C  CB  . TYR A 1 168 ? 53.307 82.431  19.308  1.00 10.79  ? 168  TYR A CB  1 
ATOM   1337 C  CG  . TYR A 1 168 ? 52.250 82.116  20.343  1.00 11.09  ? 168  TYR A CG  1 
ATOM   1338 C  CD1 . TYR A 1 168 ? 52.608 81.920  21.696  1.00 12.20  ? 168  TYR A CD1 1 
ATOM   1339 C  CD2 . TYR A 1 168 ? 50.907 82.034  19.984  1.00 10.89  ? 168  TYR A CD2 1 
ATOM   1340 C  CE1 . TYR A 1 168 ? 51.657 81.653  22.648  1.00 10.16  ? 168  TYR A CE1 1 
ATOM   1341 C  CE2 . TYR A 1 168 ? 49.922 81.772  20.937  1.00 9.36   ? 168  TYR A CE2 1 
ATOM   1342 C  CZ  . TYR A 1 168 ? 50.314 81.586  22.259  1.00 11.72  ? 168  TYR A CZ  1 
ATOM   1343 O  OH  . TYR A 1 168 ? 49.367 81.337  23.194  1.00 10.41  ? 168  TYR A OH  1 
ATOM   1344 N  N   . ARG A 1 169 ? 54.678 84.936  17.299  1.00 9.78   ? 169  ARG A N   1 
ATOM   1345 C  CA  . ARG A 1 169 ? 55.721 85.112  16.271  1.00 9.80   ? 169  ARG A CA  1 
ATOM   1346 C  C   . ARG A 1 169 ? 56.137 83.742  15.694  1.00 10.21  ? 169  ARG A C   1 
ATOM   1347 O  O   . ARG A 1 169 ? 55.265 82.951  15.307  1.00 9.74   ? 169  ARG A O   1 
ATOM   1348 C  CB  . ARG A 1 169 ? 56.910 85.898  16.859  1.00 10.25  ? 169  ARG A CB  1 
ATOM   1349 C  CG  . ARG A 1 169 ? 56.523 87.310  17.303  1.00 9.63   ? 169  ARG A CG  1 
ATOM   1350 C  CD  . ARG A 1 169 ? 56.342 88.217  16.107  1.00 13.80  ? 169  ARG A CD  1 
ATOM   1351 N  NE  . ARG A 1 169 ? 56.160 89.608  16.521  1.00 13.99  ? 169  ARG A NE  1 
ATOM   1352 C  CZ  . ARG A 1 169 ? 54.981 90.191  16.706  1.00 13.71  ? 169  ARG A CZ  1 
ATOM   1353 N  NH1 . ARG A 1 169 ? 53.860 89.499  16.495  1.00 8.98   ? 169  ARG A NH1 1 
ATOM   1354 N  NH2 . ARG A 1 169 ? 54.921 91.481  17.077  1.00 11.94  ? 169  ARG A NH2 1 
ATOM   1355 N  N   . ASN A 1 170 ? 57.445 83.461  15.634  1.00 10.00  ? 170  ASN A N   1 
ATOM   1356 C  CA  . ASN A 1 170 ? 57.953 82.196  15.093  1.00 10.16  ? 170  ASN A CA  1 
ATOM   1357 C  C   . ASN A 1 170 ? 57.707 80.992  15.998  1.00 10.23  ? 170  ASN A C   1 
ATOM   1358 O  O   . ASN A 1 170 ? 58.022 79.868  15.604  1.00 9.39   ? 170  ASN A O   1 
ATOM   1359 C  CB  . ASN A 1 170 ? 59.490 82.275  14.900  1.00 10.53  ? 170  ASN A CB  1 
ATOM   1360 C  CG  . ASN A 1 170 ? 60.224 82.461  16.214  1.00 10.97  ? 170  ASN A CG  1 
ATOM   1361 O  OD1 . ASN A 1 170 ? 60.076 83.488  16.882  1.00 11.01  ? 170  ASN A OD1 1 
ATOM   1362 N  ND2 . ASN A 1 170 ? 60.999 81.450  16.623  1.00 12.77  ? 170  ASN A ND2 1 
ATOM   1363 N  N   . ASP A 1 171 ? 57.226 81.229  17.222  1.00 10.50  ? 171  ASP A N   1 
ATOM   1364 C  CA  . ASP A 1 171 ? 57.230 80.194  18.294  1.00 10.38  ? 171  ASP A CA  1 
ATOM   1365 C  C   . ASP A 1 171 ? 55.949 79.368  18.235  1.00 10.19  ? 171  ASP A C   1 
ATOM   1366 O  O   . ASP A 1 171 ? 55.082 79.458  19.125  1.00 9.18   ? 171  ASP A O   1 
ATOM   1367 C  CB  . ASP A 1 171 ? 57.414 80.821  19.667  1.00 10.03  ? 171  ASP A CB  1 
ATOM   1368 C  CG  . ASP A 1 171 ? 57.690 79.800  20.757  1.00 11.83  ? 171  ASP A CG  1 
ATOM   1369 O  OD1 . ASP A 1 171 ? 57.827 78.586  20.478  1.00 9.75   ? 171  ASP A OD1 1 
ATOM   1370 O  OD2 . ASP A 1 171 ? 57.705 80.215  21.936  1.00 11.04  ? 171  ASP A OD2 1 
ATOM   1371 N  N   . ARG A 1 172 ? 55.843 78.596  17.150  1.00 9.70   ? 172  ARG A N   1 
ATOM   1372 C  CA  . ARG A 1 172 ? 54.729 77.683  16.933  1.00 10.30  ? 172  ARG A CA  1 
ATOM   1373 C  C   . ARG A 1 172 ? 54.537 76.736  18.114  1.00 10.44  ? 172  ARG A C   1 
ATOM   1374 O  O   . ARG A 1 172 ? 53.399 76.478  18.476  1.00 11.13  ? 172  ARG A O   1 
ATOM   1375 C  CB  . ARG A 1 172 ? 54.882 76.862  15.630  1.00 9.08   ? 172  ARG A CB  1 
ATOM   1376 C  CG  . ARG A 1 172 ? 53.588 76.140  15.246  1.00 9.23   ? 172  ARG A CG  1 
ATOM   1377 C  CD  . ARG A 1 172 ? 53.738 75.140  14.127  1.00 8.66   ? 172  ARG A CD  1 
ATOM   1378 N  NE  . ARG A 1 172 ? 54.122 75.754  12.869  1.00 8.56   ? 172  ARG A NE  1 
ATOM   1379 C  CZ  . ARG A 1 172 ? 54.443 75.069  11.778  1.00 10.89  ? 172  ARG A CZ  1 
ATOM   1380 N  NH1 . ARG A 1 172 ? 54.420 73.729  11.793  1.00 8.74   ? 172  ARG A NH1 1 
ATOM   1381 N  NH2 . ARG A 1 172 ? 54.806 75.722  10.674  1.00 8.62   ? 172  ARG A NH2 1 
ATOM   1382 N  N   . PRO A 1 173 ? 55.630 76.165  18.672  1.00 10.97  ? 173  PRO A N   1 
ATOM   1383 C  CA  . PRO A 1 173 ? 55.409 75.245  19.806  1.00 11.62  ? 173  PRO A CA  1 
ATOM   1384 C  C   . PRO A 1 173 ? 54.628 75.824  20.969  1.00 11.81  ? 173  PRO A C   1 
ATOM   1385 O  O   . PRO A 1 173 ? 53.841 75.091  21.599  1.00 12.91  ? 173  PRO A O   1 
ATOM   1386 C  CB  . PRO A 1 173 ? 56.831 74.888  20.241  1.00 11.31  ? 173  PRO A CB  1 
ATOM   1387 C  CG  . PRO A 1 173 ? 57.590 74.930  18.952  1.00 12.06  ? 173  PRO A CG  1 
ATOM   1388 C  CD  . PRO A 1 173 ? 57.059 76.185  18.291  1.00 10.94  ? 173  PRO A CD  1 
ATOM   1389 N  N   . SER A 1 174 ? 54.838 77.116  21.267  1.00 11.83  ? 174  SER A N   1 
ATOM   1390 C  CA  . SER A 1 174 ? 54.080 77.775  22.328  1.00 11.41  ? 174  SER A CA  1 
ATOM   1391 C  C   . SER A 1 174 ? 52.625 77.918  21.964  1.00 10.68  ? 174  SER A C   1 
ATOM   1392 O  O   . SER A 1 174 ? 51.763 77.771  22.817  1.00 10.23  ? 174  SER A O   1 
ATOM   1393 C  CB  . SER A 1 174 ? 54.667 79.127  22.716  1.00 10.98  ? 174  SER A CB  1 
ATOM   1394 O  OG  . SER A 1 174 ? 55.867 78.879  23.418  1.00 13.46  ? 174  SER A OG  1 
ATOM   1395 N  N   . TYR A 1 175 ? 52.348 78.185  20.693  1.00 10.88  ? 175  TYR A N   1 
ATOM   1396 C  CA  . TYR A 1 175 ? 50.968 78.194  20.225  1.00 10.81  ? 175  TYR A CA  1 
ATOM   1397 C  C   . TYR A 1 175 ? 50.300 76.827  20.390  1.00 10.55  ? 175  TYR A C   1 
ATOM   1398 O  O   . TYR A 1 175 ? 49.149 76.754  20.788  1.00 8.51   ? 175  TYR A O   1 
ATOM   1399 C  CB  . TYR A 1 175 ? 50.914 78.610  18.765  1.00 10.43  ? 175  TYR A CB  1 
ATOM   1400 C  CG  . TYR A 1 175 ? 49.663 78.192  17.985  1.00 10.75  ? 175  TYR A CG  1 
ATOM   1401 C  CD1 . TYR A 1 175 ? 48.426 78.822  18.201  1.00 9.79   ? 175  TYR A CD1 1 
ATOM   1402 C  CD2 . TYR A 1 175 ? 49.750 77.219  16.978  1.00 10.00  ? 175  TYR A CD2 1 
ATOM   1403 C  CE1 . TYR A 1 175 ? 47.290 78.447  17.450  1.00 11.58  ? 175  TYR A CE1 1 
ATOM   1404 C  CE2 . TYR A 1 175 ? 48.640 76.837  16.242  1.00 9.06   ? 175  TYR A CE2 1 
ATOM   1405 C  CZ  . TYR A 1 175 ? 47.410 77.461  16.474  1.00 10.68  ? 175  TYR A CZ  1 
ATOM   1406 O  OH  . TYR A 1 175 ? 46.327 77.099  15.709  1.00 9.67   ? 175  TYR A OH  1 
ATOM   1407 N  N   . VAL A 1 176 ? 51.019 75.770  20.007  1.00 10.70  ? 176  VAL A N   1 
ATOM   1408 C  CA  . VAL A 1 176 ? 50.505 74.381  20.095  1.00 12.01  ? 176  VAL A CA  1 
ATOM   1409 C  C   . VAL A 1 176 ? 50.217 74.028  21.562  1.00 12.53  ? 176  VAL A C   1 
ATOM   1410 O  O   . VAL A 1 176 ? 49.153 73.488  21.883  1.00 13.40  ? 176  VAL A O   1 
ATOM   1411 C  CB  . VAL A 1 176 ? 51.479 73.379  19.405  1.00 11.66  ? 176  VAL A CB  1 
ATOM   1412 C  CG1 . VAL A 1 176 ? 51.112 71.887  19.693  1.00 11.50  ? 176  VAL A CG1 1 
ATOM   1413 C  CG2 . VAL A 1 176 ? 51.510 73.666  17.921  1.00 9.72   ? 176  VAL A CG2 1 
ATOM   1414 N  N   . LYS A 1 177 ? 51.128 74.400  22.453  1.00 13.69  ? 177  LYS A N   1 
ATOM   1415 C  CA  . LYS A 1 177 ? 50.957 74.148  23.880  1.00 14.00  ? 177  LYS A CA  1 
ATOM   1416 C  C   . LYS A 1 177 ? 49.719 74.871  24.444  1.00 13.64  ? 177  LYS A C   1 
ATOM   1417 O  O   . LYS A 1 177 ? 48.935 74.284  25.192  1.00 13.25  ? 177  LYS A O   1 
ATOM   1418 C  CB  . LYS A 1 177 ? 52.239 74.562  24.625  1.00 15.22  ? 177  LYS A CB  1 
ATOM   1419 C  CG  . LYS A 1 177 ? 52.384 73.980  26.020  1.00 19.24  ? 177  LYS A CG  1 
ATOM   1420 C  CD  . LYS A 1 177 ? 53.873 73.926  26.441  1.00 25.88  ? 177  LYS A CD  1 
ATOM   1421 C  CE  . LYS A 1 177 ? 54.509 72.587  26.104  1.00 28.23  ? 177  LYS A CE  1 
ATOM   1422 N  NZ  . LYS A 1 177 ? 54.198 71.471  27.087  1.00 31.50  ? 177  LYS A NZ  1 
ATOM   1423 N  N   . ALA A 1 178 ? 49.544 76.140  24.078  1.00 12.63  ? 178  ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 178 ? 48.401 76.932  24.515  1.00 12.62  ? 178  ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 178 ? 47.042 76.388  23.995  1.00 12.58  ? 178  ALA A C   1 
ATOM   1426 O  O   . ALA A 1 178 ? 45.987 76.501  24.655  1.00 11.86  ? 178  ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 178 ? 48.607 78.399  24.102  1.00 12.80  ? 178  ALA A CB  1 
ATOM   1428 N  N   . TRP A 1 179 ? 47.093 75.804  22.803  1.00 12.45  ? 179  TRP A N   1 
ATOM   1429 C  CA  . TRP A 1 179 ? 45.925 75.268  22.107  1.00 11.51  ? 179  TRP A CA  1 
ATOM   1430 C  C   . TRP A 1 179 ? 45.260 74.122  22.894  1.00 11.76  ? 179  TRP A C   1 
ATOM   1431 O  O   . TRP A 1 179 ? 44.033 73.976  22.845  1.00 10.50  ? 179  TRP A O   1 
ATOM   1432 C  CB  . TRP A 1 179 ? 46.344 74.798  20.719  1.00 11.50  ? 179  TRP A CB  1 
ATOM   1433 C  CG  . TRP A 1 179 ? 45.203 74.238  19.909  1.00 12.25  ? 179  TRP A CG  1 
ATOM   1434 C  CD1 . TRP A 1 179 ? 44.312 74.948  19.142  1.00 13.19  ? 179  TRP A CD1 1 
ATOM   1435 C  CD2 . TRP A 1 179 ? 44.840 72.858  19.780  1.00 13.44  ? 179  TRP A CD2 1 
ATOM   1436 N  NE1 . TRP A 1 179 ? 43.416 74.090  18.542  1.00 12.52  ? 179  TRP A NE1 1 
ATOM   1437 C  CE2 . TRP A 1 179 ? 43.722 72.801  18.912  1.00 13.44  ? 179  TRP A CE2 1 
ATOM   1438 C  CE3 . TRP A 1 179 ? 45.354 71.659  20.312  1.00 12.81  ? 179  TRP A CE3 1 
ATOM   1439 C  CZ2 . TRP A 1 179 ? 43.104 71.594  18.560  1.00 13.04  ? 179  TRP A CZ2 1 
ATOM   1440 C  CZ3 . TRP A 1 179 ? 44.739 70.463  19.955  1.00 12.65  ? 179  TRP A CZ3 1 
ATOM   1441 C  CH2 . TRP A 1 179 ? 43.611 70.444  19.099  1.00 11.54  ? 179  TRP A CH2 1 
ATOM   1442 N  N   . TRP A 1 180 ? 46.072 73.337  23.626  1.00 11.56  ? 180  TRP A N   1 
ATOM   1443 C  CA  . TRP A 1 180 ? 45.563 72.289  24.523  1.00 12.68  ? 180  TRP A CA  1 
ATOM   1444 C  C   . TRP A 1 180 ? 44.573 72.809  25.577  1.00 12.98  ? 180  TRP A C   1 
ATOM   1445 O  O   . TRP A 1 180 ? 43.684 72.075  26.022  1.00 13.40  ? 180  TRP A O   1 
ATOM   1446 C  CB  . TRP A 1 180 ? 46.722 71.447  25.122  1.00 12.12  ? 180  TRP A CB  1 
ATOM   1447 C  CG  . TRP A 1 180 ? 47.440 70.669  24.010  1.00 12.66  ? 180  TRP A CG  1 
ATOM   1448 C  CD1 . TRP A 1 180 ? 48.656 70.965  23.457  1.00 11.27  ? 180  TRP A CD1 1 
ATOM   1449 C  CD2 . TRP A 1 180 ? 46.939 69.527  23.281  1.00 10.80  ? 180  TRP A CD2 1 
ATOM   1450 N  NE1 . TRP A 1 180 ? 48.949 70.081  22.447  1.00 12.31  ? 180  TRP A NE1 1 
ATOM   1451 C  CE2 . TRP A 1 180 ? 47.926 69.182  22.319  1.00 11.13  ? 180  TRP A CE2 1 
ATOM   1452 C  CE3 . TRP A 1 180 ? 45.754 68.775  23.342  1.00 10.72  ? 180  TRP A CE3 1 
ATOM   1453 C  CZ2 . TRP A 1 180 ? 47.780 68.085  21.430  1.00 11.20  ? 180  TRP A CZ2 1 
ATOM   1454 C  CZ3 . TRP A 1 180 ? 45.603 67.666  22.474  1.00 12.28  ? 180  TRP A CZ3 1 
ATOM   1455 C  CH2 . TRP A 1 180 ? 46.613 67.340  21.529  1.00 12.67  ? 180  TRP A CH2 1 
ATOM   1456 N  N   . ASN A 1 181 ? 44.655 74.105  25.904  1.00 12.55  ? 181  ASN A N   1 
ATOM   1457 C  CA  . ASN A 1 181 ? 43.688 74.737  26.822  1.00 12.90  ? 181  ASN A CA  1 
ATOM   1458 C  C   . ASN A 1 181 ? 42.322 75.017  26.188  1.00 12.62  ? 181  ASN A C   1 
ATOM   1459 O  O   . ASN A 1 181 ? 41.381 75.380  26.886  1.00 14.03  ? 181  ASN A O   1 
ATOM   1460 C  CB  . ASN A 1 181 ? 44.248 76.052  27.350  1.00 12.88  ? 181  ASN A CB  1 
ATOM   1461 C  CG  . ASN A 1 181 ? 45.531 75.867  28.130  1.00 14.59  ? 181  ASN A CG  1 
ATOM   1462 O  OD1 . ASN A 1 181 ? 45.521 75.262  29.190  1.00 17.56  ? 181  ASN A OD1 1 
ATOM   1463 N  ND2 . ASN A 1 181 ? 46.637 76.386  27.611  1.00 15.10  ? 181  ASN A ND2 1 
ATOM   1464 N  N   . LEU A 1 182 ? 42.227 74.855  24.876  1.00 12.49  ? 182  LEU A N   1 
ATOM   1465 C  CA  . LEU A 1 182 ? 41.042 75.258  24.094  1.00 12.30  ? 182  LEU A CA  1 
ATOM   1466 C  C   . LEU A 1 182 ? 40.297 74.105  23.424  1.00 12.15  ? 182  LEU A C   1 
ATOM   1467 O  O   . LEU A 1 182 ? 39.115 74.255  23.080  1.00 11.94  ? 182  LEU A O   1 
ATOM   1468 C  CB  . LEU A 1 182 ? 41.474 76.247  23.006  1.00 12.20  ? 182  LEU A CB  1 
ATOM   1469 C  CG  . LEU A 1 182 ? 42.191 77.541  23.428  1.00 10.18  ? 182  LEU A CG  1 
ATOM   1470 C  CD1 . LEU A 1 182 ? 42.621 78.294  22.148  1.00 9.20   ? 182  LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A 1 182 ? 41.303 78.428  24.337  1.00 9.61   ? 182  LEU A CD2 1 
ATOM   1472 N  N   . VAL A 1 183 ? 40.975 72.964  23.277  1.00 12.62  ? 183  VAL A N   1 
ATOM   1473 C  CA  . VAL A 1 183 ? 40.425 71.757  22.628  1.00 12.63  ? 183  VAL A CA  1 
ATOM   1474 C  C   . VAL A 1 183 ? 39.029 71.409  23.115  1.00 12.91  ? 183  VAL A C   1 
ATOM   1475 O  O   . VAL A 1 183 ? 38.812 71.206  24.308  1.00 12.94  ? 183  VAL A O   1 
ATOM   1476 C  CB  . VAL A 1 183 ? 41.303 70.480  22.862  1.00 13.15  ? 183  VAL A CB  1 
ATOM   1477 C  CG1 . VAL A 1 183 ? 40.714 69.287  22.074  1.00 12.79  ? 183  VAL A CG1 1 
ATOM   1478 C  CG2 . VAL A 1 183 ? 42.690 70.709  22.448  1.00 13.75  ? 183  VAL A CG2 1 
ATOM   1479 N  N   . ASN A 1 184 ? 38.099 71.303  22.173  1.00 12.74  ? 184  ASN A N   1 
ATOM   1480 C  CA  . ASN A 1 184 ? 36.706 71.088  22.488  1.00 12.89  ? 184  ASN A CA  1 
ATOM   1481 C  C   . ASN A 1 184 ? 36.349 69.620  22.315  1.00 13.13  ? 184  ASN A C   1 
ATOM   1482 O  O   . ASN A 1 184 ? 36.054 69.193  21.199  1.00 12.68  ? 184  ASN A O   1 
ATOM   1483 C  CB  . ASN A 1 184 ? 35.860 71.916  21.525  1.00 12.80  ? 184  ASN A CB  1 
ATOM   1484 C  CG  . ASN A 1 184 ? 34.421 71.979  21.921  1.00 13.27  ? 184  ASN A CG  1 
ATOM   1485 O  OD1 . ASN A 1 184 ? 33.902 71.088  22.597  1.00 11.25  ? 184  ASN A OD1 1 
ATOM   1486 N  ND2 . ASN A 1 184 ? 33.744 73.033  21.475  1.00 12.59  ? 184  ASN A ND2 1 
ATOM   1487 N  N   . TRP A 1 185 ? 36.342 68.880  23.423  1.00 12.44  ? 185  TRP A N   1 
ATOM   1488 C  CA  . TRP A 1 185 ? 36.030 67.443  23.413  1.00 12.91  ? 185  TRP A CA  1 
ATOM   1489 C  C   . TRP A 1 185 ? 34.565 67.173  23.117  1.00 13.42  ? 185  TRP A C   1 
ATOM   1490 O  O   . TRP A 1 185 ? 34.234 66.121  22.580  1.00 13.71  ? 185  TRP A O   1 
ATOM   1491 C  CB  . TRP A 1 185 ? 36.432 66.811  24.741  1.00 12.28  ? 185  TRP A CB  1 
ATOM   1492 C  CG  . TRP A 1 185 ? 37.894 67.004  25.042  1.00 12.56  ? 185  TRP A CG  1 
ATOM   1493 C  CD1 . TRP A 1 185 ? 38.447 67.746  26.077  1.00 12.11  ? 185  TRP A CD1 1 
ATOM   1494 C  CD2 . TRP A 1 185 ? 38.990 66.481  24.298  1.00 11.87  ? 185  TRP A CD2 1 
ATOM   1495 N  NE1 . TRP A 1 185 ? 39.823 67.680  26.027  1.00 11.06  ? 185  TRP A NE1 1 
ATOM   1496 C  CE2 . TRP A 1 185 ? 40.183 66.908  24.949  1.00 12.69  ? 185  TRP A CE2 1 
ATOM   1497 C  CE3 . TRP A 1 185 ? 39.090 65.670  23.146  1.00 12.65  ? 185  TRP A CE3 1 
ATOM   1498 C  CZ2 . TRP A 1 185 ? 41.461 66.561  24.474  1.00 12.80  ? 185  TRP A CZ2 1 
ATOM   1499 C  CZ3 . TRP A 1 185 ? 40.360 65.320  22.681  1.00 11.73  ? 185  TRP A CZ3 1 
ATOM   1500 C  CH2 . TRP A 1 185 ? 41.528 65.757  23.355  1.00 12.87  ? 185  TRP A CH2 1 
ATOM   1501 N  N   . ASN A 1 186 ? 33.687 68.127  23.435  1.00 13.34  ? 186  ASN A N   1 
ATOM   1502 C  CA  . ASN A 1 186 ? 32.288 67.972  23.056  1.00 14.40  ? 186  ASN A CA  1 
ATOM   1503 C  C   . ASN A 1 186 ? 32.156 67.891  21.536  1.00 13.63  ? 186  ASN A C   1 
ATOM   1504 O  O   . ASN A 1 186 ? 31.413 67.049  21.019  1.00 14.56  ? 186  ASN A O   1 
ATOM   1505 C  CB  . ASN A 1 186 ? 31.391 69.083  23.642  1.00 13.69  ? 186  ASN A CB  1 
ATOM   1506 C  CG  . ASN A 1 186 ? 31.514 69.187  25.139  1.00 17.19  ? 186  ASN A CG  1 
ATOM   1507 O  OD1 . ASN A 1 186 ? 31.465 68.181  25.839  1.00 20.58  ? 186  ASN A OD1 1 
ATOM   1508 N  ND2 . ASN A 1 186 ? 31.723 70.404  25.644  1.00 20.70  ? 186  ASN A ND2 1 
ATOM   1509 N  N   . PHE A 1 187 ? 32.863 68.768  20.821  1.00 13.08  ? 187  PHE A N   1 
ATOM   1510 C  CA  . PHE A 1 187 ? 32.905 68.680  19.350  1.00 12.38  ? 187  PHE A CA  1 
ATOM   1511 C  C   . PHE A 1 187 ? 33.467 67.343  18.866  1.00 12.34  ? 187  PHE A C   1 
ATOM   1512 O  O   . PHE A 1 187 ? 32.889 66.717  17.964  1.00 12.65  ? 187  PHE A O   1 
ATOM   1513 C  CB  . PHE A 1 187 ? 33.705 69.842  18.716  1.00 11.44  ? 187  PHE A CB  1 
ATOM   1514 C  CG  . PHE A 1 187 ? 33.508 69.974  17.209  1.00 11.43  ? 187  PHE A CG  1 
ATOM   1515 C  CD1 . PHE A 1 187 ? 32.221 70.117  16.665  1.00 8.82   ? 187  PHE A CD1 1 
ATOM   1516 C  CD2 . PHE A 1 187 ? 34.622 69.994  16.340  1.00 11.84  ? 187  PHE A CD2 1 
ATOM   1517 C  CE1 . PHE A 1 187 ? 32.025 70.275  15.273  1.00 9.72   ? 187  PHE A CE1 1 
ATOM   1518 C  CE2 . PHE A 1 187 ? 34.452 70.116  14.949  1.00 10.82  ? 187  PHE A CE2 1 
ATOM   1519 C  CZ  . PHE A 1 187 ? 33.138 70.256  14.409  1.00 9.04   ? 187  PHE A CZ  1 
ATOM   1520 N  N   . ALA A 1 188 ? 34.595 66.911  19.442  1.00 11.90  ? 188  ALA A N   1 
ATOM   1521 C  CA  . ALA A 1 188 ? 35.206 65.628  19.061  1.00 11.98  ? 188  ALA A CA  1 
ATOM   1522 C  C   . ALA A 1 188 ? 34.185 64.468  19.205  1.00 12.02  ? 188  ALA A C   1 
ATOM   1523 O  O   . ALA A 1 188 ? 34.124 63.568  18.360  1.00 12.55  ? 188  ALA A O   1 
ATOM   1524 C  CB  . ALA A 1 188 ? 36.406 65.346  19.939  1.00 11.59  ? 188  ALA A CB  1 
ATOM   1525 N  N   . ASN A 1 189 ? 33.417 64.504  20.293  1.00 11.84  ? 189  ASN A N   1 
ATOM   1526 C  CA  . ASN A 1 189 ? 32.416 63.471  20.618  1.00 12.13  ? 189  ASN A CA  1 
ATOM   1527 C  C   . ASN A 1 189 ? 31.304 63.444  19.600  1.00 11.99  ? 189  ASN A C   1 
ATOM   1528 O  O   . ASN A 1 189 ? 30.873 62.389  19.166  1.00 11.84  ? 189  ASN A O   1 
ATOM   1529 C  CB  . ASN A 1 189 ? 31.852 63.708  22.015  1.00 11.72  ? 189  ASN A CB  1 
ATOM   1530 C  CG  . ASN A 1 189 ? 32.700 63.069  23.078  1.00 12.74  ? 189  ASN A CG  1 
ATOM   1531 O  OD1 . ASN A 1 189 ? 33.371 62.086  22.820  1.00 11.04  ? 189  ASN A OD1 1 
ATOM   1532 N  ND2 . ASN A 1 189 ? 32.672 63.618  24.279  1.00 11.56  ? 189  ASN A ND2 1 
ATOM   1533 N  N   . GLU A 1 190 ? 30.879 64.628  19.194  1.00 11.95  ? 190  GLU A N   1 
ATOM   1534 C  CA  . GLU A 1 190 ? 29.871 64.740  18.176  1.00 13.77  ? 190  GLU A CA  1 
ATOM   1535 C  C   . GLU A 1 190 ? 30.355 64.142  16.849  1.00 13.42  ? 190  GLU A C   1 
ATOM   1536 O  O   . GLU A 1 190 ? 29.608 63.415  16.174  1.00 13.08  ? 190  GLU A O   1 
ATOM   1537 C  CB  . GLU A 1 190 ? 29.488 66.195  18.016  1.00 13.82  ? 190  GLU A CB  1 
ATOM   1538 C  CG  . GLU A 1 190 ? 28.592 66.451  16.842  1.00 19.60  ? 190  GLU A CG  1 
ATOM   1539 C  CD  . GLU A 1 190 ? 28.271 67.927  16.677  1.00 26.53  ? 190  GLU A CD  1 
ATOM   1540 O  OE1 . GLU A 1 190 ? 28.712 68.748  17.513  1.00 29.05  ? 190  GLU A OE1 1 
ATOM   1541 O  OE2 . GLU A 1 190 ? 27.580 68.256  15.691  1.00 31.54  ? 190  GLU A OE2 1 
ATOM   1542 N  N   . ASN A 1 191 ? 31.607 64.430  16.496  1.00 12.67  ? 191  ASN A N   1 
ATOM   1543 C  CA  . ASN A 1 191 ? 32.189 63.937  15.260  1.00 12.84  ? 191  ASN A CA  1 
ATOM   1544 C  C   . ASN A 1 191 ? 32.396 62.419  15.310  1.00 13.21  ? 191  ASN A C   1 
ATOM   1545 O  O   . ASN A 1 191 ? 32.143 61.708  14.330  1.00 12.89  ? 191  ASN A O   1 
ATOM   1546 C  CB  . ASN A 1 191 ? 33.502 64.680  14.963  1.00 12.23  ? 191  ASN A CB  1 
ATOM   1547 C  CG  . ASN A 1 191 ? 33.263 66.154  14.625  1.00 13.99  ? 191  ASN A CG  1 
ATOM   1548 O  OD1 . ASN A 1 191 ? 32.261 66.493  13.977  1.00 13.80  ? 191  ASN A OD1 1 
ATOM   1549 N  ND2 . ASN A 1 191 ? 34.160 67.032  15.080  1.00 12.73  ? 191  ASN A ND2 1 
ATOM   1550 N  N   . LEU A 1 192 ? 32.861 61.938  16.448  1.00 13.50  ? 192  LEU A N   1 
ATOM   1551 C  CA  . LEU A 1 192 ? 33.091 60.499  16.639  1.00 14.18  ? 192  LEU A CA  1 
ATOM   1552 C  C   . LEU A 1 192 ? 31.807 59.696  16.460  1.00 14.86  ? 192  LEU A C   1 
ATOM   1553 O  O   . LEU A 1 192 ? 31.795 58.720  15.721  1.00 13.82  ? 192  LEU A O   1 
ATOM   1554 C  CB  . LEU A 1 192 ? 33.690 60.221  18.018  1.00 13.63  ? 192  LEU A CB  1 
ATOM   1555 C  CG  . LEU A 1 192 ? 34.139 58.786  18.354  1.00 13.97  ? 192  LEU A CG  1 
ATOM   1556 C  CD1 . LEU A 1 192 ? 35.223 58.226  17.380  1.00 15.09  ? 192  LEU A CD1 1 
ATOM   1557 C  CD2 . LEU A 1 192 ? 34.610 58.684  19.827  1.00 14.21  ? 192  LEU A CD2 1 
ATOM   1558 N  N   . LYS A 1 193 ? 30.735 60.120  17.137  1.00 15.42  ? 193  LYS A N   1 
ATOM   1559 C  CA  . LYS A 1 193 ? 29.443 59.464  17.029  1.00 17.00  ? 193  LYS A CA  1 
ATOM   1560 C  C   . LYS A 1 193 ? 28.954 59.385  15.585  1.00 17.88  ? 193  LYS A C   1 
ATOM   1561 O  O   . LYS A 1 193 ? 28.457 58.326  15.157  1.00 17.37  ? 193  LYS A O   1 
ATOM   1562 C  CB  . LYS A 1 193 ? 28.393 60.143  17.939  1.00 16.92  ? 193  LYS A CB  1 
ATOM   1563 C  CG  . LYS A 1 193 ? 26.963 59.613  17.735  1.00 17.74  ? 193  LYS A CG  1 
ATOM   1564 C  CD  . LYS A 1 193 ? 25.938 60.310  18.628  1.00 17.69  ? 193  LYS A CD  1 
ATOM   1565 C  CE  . LYS A 1 193 ? 24.524 59.758  18.381  1.00 20.89  ? 193  LYS A CE  1 
ATOM   1566 N  NZ  . LYS A 1 193 ? 23.520 60.324  19.351  1.00 22.21  ? 193  LYS A NZ  1 
ATOM   1567 N  N   . LYS A 1 194 ? 29.078 60.489  14.843  1.00 18.91  ? 194  LYS A N   1 
ATOM   1568 C  CA  . LYS A 1 194 ? 28.672 60.496  13.436  1.00 20.98  ? 194  LYS A CA  1 
ATOM   1569 C  C   . LYS A 1 194 ? 29.568 59.548  12.671  1.00 21.98  ? 194  LYS A C   1 
ATOM   1570 O  O   . LYS A 1 194 ? 29.089 58.767  11.851  1.00 22.14  ? 194  LYS A O   1 
ATOM   1571 C  CB  . LYS A 1 194 ? 28.821 61.874  12.787  1.00 21.84  ? 194  LYS A CB  1 
ATOM   1572 C  CG  . LYS A 1 194 ? 27.927 62.945  13.271  1.00 24.85  ? 194  LYS A CG  1 
ATOM   1573 C  CD  . LYS A 1 194 ? 28.190 64.194  12.433  1.00 31.96  ? 194  LYS A CD  1 
ATOM   1574 C  CE  . LYS A 1 194 ? 27.580 65.416  13.079  1.00 33.65  ? 194  LYS A CE  1 
ATOM   1575 N  NZ  . LYS A 1 194 ? 28.332 66.612  12.638  1.00 37.03  ? 194  LYS A NZ  1 
ATOM   1576 N  N   . ALA A 1 195 ? 30.875 59.640  12.935  1.00 22.64  ? 195  ALA A N   1 
ATOM   1577 C  CA  . ALA A 1 195 ? 31.891 58.856  12.212  1.00 23.86  ? 195  ALA A CA  1 
ATOM   1578 C  C   . ALA A 1 195 ? 31.710 57.355  12.346  1.00 25.11  ? 195  ALA A C   1 
ATOM   1579 O  O   . ALA A 1 195 ? 31.869 56.614  11.385  1.00 25.08  ? 195  ALA A O   1 
ATOM   1580 C  CB  . ALA A 1 195 ? 33.291 59.243  12.666  1.00 23.48  ? 195  ALA A CB  1 
ATOM   1581 N  N   . LEU A 1 196 ? 31.413 56.915  13.560  1.00 27.02  ? 196  LEU A N   1 
ATOM   1582 C  CA  . LEU A 1 196 ? 31.219 55.504  13.842  1.00 28.89  ? 196  LEU A CA  1 
ATOM   1583 C  C   . LEU A 1 196 ? 29.878 54.976  13.302  1.00 30.31  ? 196  LEU A C   1 
ATOM   1584 O  O   . LEU A 1 196 ? 29.707 53.759  13.180  1.00 31.25  ? 196  LEU A O   1 
ATOM   1585 C  CB  . LEU A 1 196 ? 31.328 55.249  15.342  1.00 28.09  ? 196  LEU A CB  1 
ATOM   1586 C  CG  . LEU A 1 196 ? 32.709 55.314  15.976  1.00 27.91  ? 196  LEU A CG  1 
ATOM   1587 C  CD1 . LEU A 1 196 ? 32.549 55.514  17.468  1.00 25.68  ? 196  LEU A CD1 1 
ATOM   1588 C  CD2 . LEU A 1 196 ? 33.502 54.031  15.654  1.00 27.18  ? 196  LEU A CD2 1 
ATOM   1589 N  N   . GLN A 1 197 ? 28.939 55.881  13.010  1.00 31.68  ? 197  GLN A N   1 
ATOM   1590 C  CA  . GLN A 1 197 ? 27.677 55.531  12.342  1.00 33.64  ? 197  GLN A CA  1 
ATOM   1591 C  C   . GLN A 1 197 ? 27.910 55.411  10.840  1.00 33.63  ? 197  GLN A C   1 
ATOM   1592 O  O   . GLN A 1 197 ? 28.009 54.301  10.306  1.00 34.10  ? 197  GLN A O   1 
ATOM   1593 C  CB  . GLN A 1 197 ? 26.576 56.568  12.626  1.00 33.44  ? 197  GLN A CB  1 
ATOM   1594 C  CG  . GLN A 1 197 ? 25.748 56.274  13.901  1.00 35.78  ? 197  GLN A CG  1 
ATOM   1595 C  CD  . GLN A 1 197 ? 24.992 57.500  14.503  1.00 35.97  ? 197  GLN A CD  1 
ATOM   1596 O  OE1 . GLN A 1 197 ? 25.146 58.651  14.064  1.00 39.10  ? 197  GLN A OE1 1 
ATOM   1597 N  NE2 . GLN A 1 197 ? 24.172 57.232  15.521  1.00 37.95  ? 197  GLN A NE2 1 
ATOM   1598 N  N   . ALA B 1 2   ? 79.050 73.895  10.432  1.00 21.32  ? 2    ALA B N   1 
ATOM   1599 C  CA  . ALA B 1 2   ? 79.577 73.711  9.037   1.00 21.50  ? 2    ALA B CA  1 
ATOM   1600 C  C   . ALA B 1 2   ? 78.936 74.680  8.013   1.00 20.98  ? 2    ALA B C   1 
ATOM   1601 O  O   . ALA B 1 2   ? 79.577 75.693  7.681   1.00 20.69  ? 2    ALA B O   1 
ATOM   1602 C  CB  . ALA B 1 2   ? 79.473 72.254  8.585   1.00 22.98  ? 2    ALA B CB  1 
ATOM   1603 N  N   . ILE B 1 3   ? 77.698 74.421  7.534   1.00 18.60  ? 3    ILE B N   1 
ATOM   1604 C  CA  . ILE B 1 3   ? 76.970 75.468  6.781   1.00 16.11  ? 3    ILE B CA  1 
ATOM   1605 C  C   . ILE B 1 3   ? 76.833 76.712  7.650   1.00 14.74  ? 3    ILE B C   1 
ATOM   1606 O  O   . ILE B 1 3   ? 76.461 76.642  8.839   1.00 13.25  ? 3    ILE B O   1 
ATOM   1607 C  CB  . ILE B 1 3   ? 75.565 75.024  6.233   1.00 16.13  ? 3    ILE B CB  1 
ATOM   1608 C  CG1 . ILE B 1 3   ? 75.690 73.798  5.314   1.00 17.03  ? 3    ILE B CG1 1 
ATOM   1609 C  CG2 . ILE B 1 3   ? 74.894 76.167  5.462   1.00 16.24  ? 3    ILE B CG2 1 
ATOM   1610 C  CD1 . ILE B 1 3   ? 76.326 74.058  3.922   1.00 17.05  ? 3    ILE B CD1 1 
ATOM   1611 N  N   . ILE B 1 4   ? 77.157 77.856  7.059   1.00 14.07  ? 4    ILE B N   1 
ATOM   1612 C  CA  . ILE B 1 4   ? 77.173 79.132  7.775   1.00 13.43  ? 4    ILE B CA  1 
ATOM   1613 C  C   . ILE B 1 4   ? 76.101 80.092  7.242   1.00 12.56  ? 4    ILE B C   1 
ATOM   1614 O  O   . ILE B 1 4   ? 75.916 80.211  6.033   1.00 13.03  ? 4    ILE B O   1 
ATOM   1615 C  CB  . ILE B 1 4   ? 78.592 79.778  7.671   1.00 13.08  ? 4    ILE B CB  1 
ATOM   1616 C  CG1 . ILE B 1 4   ? 79.634 78.880  8.372   1.00 14.79  ? 4    ILE B CG1 1 
ATOM   1617 C  CG2 . ILE B 1 4   ? 78.595 81.225  8.202   1.00 14.14  ? 4    ILE B CG2 1 
ATOM   1618 C  CD1 . ILE B 1 4   ? 81.098 79.210  8.015   1.00 13.24  ? 4    ILE B CD1 1 
ATOM   1619 N  N   . LEU B 1 5   ? 75.422 80.788  8.147   1.00 12.01  ? 5    LEU B N   1 
ATOM   1620 C  CA  . LEU B 1 5   ? 74.448 81.827  7.767   1.00 12.18  ? 5    LEU B CA  1 
ATOM   1621 C  C   . LEU B 1 5   ? 75.187 83.068  7.224   1.00 11.12  ? 5    LEU B C   1 
ATOM   1622 O  O   . LEU B 1 5   ? 75.955 83.698  7.972   1.00 12.26  ? 5    LEU B O   1 
ATOM   1623 C  CB  . LEU B 1 5   ? 73.587 82.195  8.984   1.00 10.98  ? 5    LEU B CB  1 
ATOM   1624 C  CG  . LEU B 1 5   ? 72.563 83.336  8.843   1.00 12.29  ? 5    LEU B CG  1 
ATOM   1625 C  CD1 . LEU B 1 5   ? 71.454 83.049  7.849   1.00 10.98  ? 5    LEU B CD1 1 
ATOM   1626 C  CD2 . LEU B 1 5   ? 72.009 83.699  10.225  1.00 11.24  ? 5    LEU B CD2 1 
ATOM   1627 N  N   . PRO B 1 6   ? 74.997 83.406  5.940   1.00 11.81  ? 6    PRO B N   1 
ATOM   1628 C  CA  . PRO B 1 6   ? 75.650 84.626  5.430   1.00 12.06  ? 6    PRO B CA  1 
ATOM   1629 C  C   . PRO B 1 6   ? 75.155 85.914  6.088   1.00 13.05  ? 6    PRO B C   1 
ATOM   1630 O  O   . PRO B 1 6   ? 73.953 86.021  6.458   1.00 11.96  ? 6    PRO B O   1 
ATOM   1631 C  CB  . PRO B 1 6   ? 75.312 84.610  3.933   1.00 11.27  ? 6    PRO B CB  1 
ATOM   1632 C  CG  . PRO B 1 6   ? 75.047 83.173  3.641   1.00 11.75  ? 6    PRO B CG  1 
ATOM   1633 C  CD  . PRO B 1 6   ? 74.282 82.704  4.853   1.00 11.01  ? 6    PRO B CD  1 
ATOM   1634 N  N   . LYS B 1 7   ? 76.087 86.855  6.270   1.00 12.31  ? 7    LYS B N   1 
ATOM   1635 C  CA  . LYS B 1 7   ? 75.751 88.181  6.809   1.00 14.00  ? 7    LYS B CA  1 
ATOM   1636 C  C   . LYS B 1 7   ? 74.776 88.901  5.890   1.00 12.97  ? 7    LYS B C   1 
ATOM   1637 O  O   . LYS B 1 7   ? 74.868 88.783  4.684   1.00 12.77  ? 7    LYS B O   1 
ATOM   1638 C  CB  . LYS B 1 7   ? 77.017 89.035  6.959   1.00 14.54  ? 7    LYS B CB  1 
ATOM   1639 C  CG  . LYS B 1 7   ? 77.906 88.579  8.103   1.00 18.61  ? 7    LYS B CG  1 
ATOM   1640 C  CD  . LYS B 1 7   ? 77.089 88.492  9.407   1.00 24.61  ? 7    LYS B CD  1 
ATOM   1641 C  CE  . LYS B 1 7   ? 77.740 87.588  10.463  1.00 29.74  ? 7    LYS B CE  1 
ATOM   1642 N  NZ  . LYS B 1 7   ? 78.824 88.280  11.226  1.00 33.00  ? 7    LYS B NZ  1 
ATOM   1643 N  N   . LEU B 1 8   ? 73.819 89.621  6.467   1.00 13.78  ? 8    LEU B N   1 
ATOM   1644 C  CA  . LEU B 1 8   ? 73.097 90.637  5.706   1.00 12.58  ? 8    LEU B CA  1 
ATOM   1645 C  C   . LEU B 1 8   ? 74.120 91.678  5.210   1.00 12.64  ? 8    LEU B C   1 
ATOM   1646 O  O   . LEU B 1 8   ? 75.134 91.895  5.846   1.00 12.38  ? 8    LEU B O   1 
ATOM   1647 C  CB  . LEU B 1 8   ? 72.055 91.334  6.589   1.00 12.81  ? 8    LEU B CB  1 
ATOM   1648 C  CG  . LEU B 1 8   ? 70.943 90.545  7.261   1.00 12.08  ? 8    LEU B CG  1 
ATOM   1649 C  CD1 . LEU B 1 8   ? 69.996 91.464  8.069   1.00 10.75  ? 8    LEU B CD1 1 
ATOM   1650 C  CD2 . LEU B 1 8   ? 70.172 89.779  6.179   1.00 12.75  ? 8    LEU B CD2 1 
ATOM   1651 N  N   . LYS B 1 9   ? 73.840 92.324  4.089   1.00 13.60  ? 9    LYS B N   1 
ATOM   1652 C  CA  . LYS B 1 9   ? 74.705 93.409  3.611   1.00 13.56  ? 9    LYS B CA  1 
ATOM   1653 C  C   . LYS B 1 9   ? 74.344 94.775  4.193   1.00 12.90  ? 9    LYS B C   1 
ATOM   1654 O  O   . LYS B 1 9   ? 74.942 95.770  3.834   1.00 12.57  ? 9    LYS B O   1 
ATOM   1655 C  CB  . LYS B 1 9   ? 74.724 93.436  2.078   1.00 14.38  ? 9    LYS B CB  1 
ATOM   1656 C  CG  . LYS B 1 9   ? 75.057 92.081  1.439   1.00 15.56  ? 9    LYS B CG  1 
ATOM   1657 C  CD  . LYS B 1 9   ? 75.367 92.275  -0.052  1.00 20.97  ? 9    LYS B CD  1 
ATOM   1658 C  CE  . LYS B 1 9   ? 75.631 90.956  -0.782  1.00 21.17  ? 9    LYS B CE  1 
ATOM   1659 N  NZ  . LYS B 1 9   ? 75.198 91.116  -2.221  1.00 19.36  ? 9    LYS B NZ  1 
ATOM   1660 N  N   . TYR B 1 10  ? 73.385 94.803  5.112   1.00 12.53  ? 10   TYR B N   1 
ATOM   1661 C  CA  . TYR B 1 10  ? 72.886 96.030  5.718   1.00 12.19  ? 10   TYR B CA  1 
ATOM   1662 C  C   . TYR B 1 10  ? 72.345 95.710  7.108   1.00 12.31  ? 10   TYR B C   1 
ATOM   1663 O  O   . TYR B 1 10  ? 72.210 94.560  7.488   1.00 12.89  ? 10   TYR B O   1 
ATOM   1664 C  CB  . TYR B 1 10  ? 71.773 96.678  4.848   1.00 12.09  ? 10   TYR B CB  1 
ATOM   1665 C  CG  . TYR B 1 10  ? 70.778 95.667  4.323   1.00 12.20  ? 10   TYR B CG  1 
ATOM   1666 C  CD1 . TYR B 1 10  ? 69.758 95.169  5.138   1.00 9.13   ? 10   TYR B CD1 1 
ATOM   1667 C  CD2 . TYR B 1 10  ? 70.884 95.175  3.021   1.00 12.34  ? 10   TYR B CD2 1 
ATOM   1668 C  CE1 . TYR B 1 10  ? 68.840 94.216  4.639   1.00 11.87  ? 10   TYR B CE1 1 
ATOM   1669 C  CE2 . TYR B 1 10  ? 69.979 94.217  2.536   1.00 12.76  ? 10   TYR B CE2 1 
ATOM   1670 C  CZ  . TYR B 1 10  ? 68.966 93.748  3.360   1.00 11.47  ? 10   TYR B CZ  1 
ATOM   1671 O  OH  . TYR B 1 10  ? 68.061 92.834  2.869   1.00 13.20  ? 10   TYR B OH  1 
ATOM   1672 N  N   . ALA B 1 11  ? 72.034 96.759  7.851   1.00 12.56  ? 11   ALA B N   1 
ATOM   1673 C  CA  . ALA B 1 11  ? 71.565 96.671  9.214   1.00 12.33  ? 11   ALA B CA  1 
ATOM   1674 C  C   . ALA B 1 11  ? 70.099 96.219  9.242   1.00 11.73  ? 11   ALA B C   1 
ATOM   1675 O  O   . ALA B 1 11  ? 69.393 96.359  8.225   1.00 10.32  ? 11   ALA B O   1 
ATOM   1676 C  CB  . ALA B 1 11  ? 71.711 98.037  9.860   1.00 13.21  ? 11   ALA B CB  1 
ATOM   1677 N  N   . LEU B 1 12  ? 69.639 95.722  10.398  1.00 10.31  ? 12   LEU B N   1 
ATOM   1678 C  CA  . LEU B 1 12  ? 68.256 95.229  10.535  1.00 11.22  ? 12   LEU B CA  1 
ATOM   1679 C  C   . LEU B 1 12  ? 67.138 96.244  10.283  1.00 10.80  ? 12   LEU B C   1 
ATOM   1680 O  O   . LEU B 1 12  ? 66.009 95.846  9.959   1.00 10.84  ? 12   LEU B O   1 
ATOM   1681 C  CB  . LEU B 1 12  ? 68.015 94.612  11.906  1.00 11.90  ? 12   LEU B CB  1 
ATOM   1682 C  CG  . LEU B 1 12  ? 68.714 93.387  12.502  1.00 14.77  ? 12   LEU B CG  1 
ATOM   1683 C  CD1 . LEU B 1 12  ? 67.940 93.049  13.815  1.00 16.16  ? 12   LEU B CD1 1 
ATOM   1684 C  CD2 . LEU B 1 12  ? 68.689 92.191  11.555  1.00 17.13  ? 12   LEU B CD2 1 
ATOM   1685 N  N   . ASN B 1 13  ? 67.428 97.529  10.494  1.00 10.22  ? 13   ASN B N   1 
ATOM   1686 C  CA  . ASN B 1 13  ? 66.455 98.624  10.319  1.00 10.52  ? 13   ASN B CA  1 
ATOM   1687 C  C   . ASN B 1 13  ? 66.533 99.186  8.914   1.00 9.89   ? 13   ASN B C   1 
ATOM   1688 O  O   . ASN B 1 13  ? 65.713 100.044 8.559   1.00 9.82   ? 13   ASN B O   1 
ATOM   1689 C  CB  . ASN B 1 13  ? 66.752 99.800  11.282  1.00 10.95  ? 13   ASN B CB  1 
ATOM   1690 C  CG  . ASN B 1 13  ? 68.101 100.476 10.976  1.00 13.83  ? 13   ASN B CG  1 
ATOM   1691 O  OD1 . ASN B 1 13  ? 69.132 99.869  11.128  1.00 11.88  ? 13   ASN B OD1 1 
ATOM   1692 N  ND2 . ASN B 1 13  ? 68.074 101.742 10.544  1.00 16.68  ? 13   ASN B ND2 1 
ATOM   1693 N  N   . ALA B 1 14  ? 67.484 98.689  8.110   1.00 8.97   ? 14   ALA B N   1 
ATOM   1694 C  CA  . ALA B 1 14  ? 67.790 99.306  6.795   1.00 9.79   ? 14   ALA B CA  1 
ATOM   1695 C  C   . ALA B 1 14  ? 66.622 99.293  5.797   1.00 9.80   ? 14   ALA B C   1 
ATOM   1696 O  O   . ALA B 1 14  ? 66.585 100.116 4.888   1.00 9.03   ? 14   ALA B O   1 
ATOM   1697 C  CB  . ALA B 1 14  ? 69.064 98.702  6.163   1.00 9.12   ? 14   ALA B CB  1 
ATOM   1698 N  N   . LEU B 1 15  ? 65.673 98.369  5.978   1.00 10.19  ? 15   LEU B N   1 
ATOM   1699 C  CA  . LEU B 1 15  ? 64.526 98.242  5.081   1.00 10.04  ? 15   LEU B CA  1 
ATOM   1700 C  C   . LEU B 1 15  ? 63.252 98.948  5.598   1.00 10.14  ? 15   LEU B C   1 
ATOM   1701 O  O   . LEU B 1 15  ? 62.214 98.909  4.925   1.00 8.44   ? 15   LEU B O   1 
ATOM   1702 C  CB  . LEU B 1 15  ? 64.254 96.731  4.763   1.00 10.15  ? 15   LEU B CB  1 
ATOM   1703 C  CG  . LEU B 1 15  ? 65.515 95.943  4.341   1.00 9.66   ? 15   LEU B CG  1 
ATOM   1704 C  CD1 . LEU B 1 15  ? 65.141 94.530  3.853   1.00 7.74   ? 15   LEU B CD1 1 
ATOM   1705 C  CD2 . LEU B 1 15  ? 66.346 96.682  3.221   1.00 4.22   ? 15   LEU B CD2 1 
ATOM   1706 N  N   . SER B 1 16  ? 63.347 99.610  6.765   1.00 10.78  ? 16   SER B N   1 
ATOM   1707 C  CA  . SER B 1 16  ? 62.191 100.245 7.382   1.00 11.80  ? 16   SER B CA  1 
ATOM   1708 C  C   . SER B 1 16  ? 61.829 101.578 6.699   1.00 12.09  ? 16   SER B C   1 
ATOM   1709 O  O   . SER B 1 16  ? 62.677 102.213 6.091   1.00 12.17  ? 16   SER B O   1 
ATOM   1710 C  CB  . SER B 1 16  ? 62.340 100.378 8.907   1.00 12.85  ? 16   SER B CB  1 
ATOM   1711 O  OG  . SER B 1 16  ? 63.517 101.079 9.277   1.00 17.09  ? 16   SER B OG  1 
ATOM   1712 N  N   . PRO B 1 17  ? 60.543 101.968 6.739   1.00 12.03  ? 17   PRO B N   1 
ATOM   1713 C  CA  . PRO B 1 17  ? 59.467 101.233 7.375   1.00 11.45  ? 17   PRO B CA  1 
ATOM   1714 C  C   . PRO B 1 17  ? 58.850 100.151 6.487   1.00 11.48  ? 17   PRO B C   1 
ATOM   1715 O  O   . PRO B 1 17  ? 57.860 99.551  6.888   1.00 12.24  ? 17   PRO B O   1 
ATOM   1716 C  CB  . PRO B 1 17  ? 58.443 102.327 7.671   1.00 11.53  ? 17   PRO B CB  1 
ATOM   1717 C  CG  . PRO B 1 17  ? 58.622 103.308 6.505   1.00 12.39  ? 17   PRO B CG  1 
ATOM   1718 C  CD  . PRO B 1 17  ? 60.086 103.227 6.136   1.00 12.08  ? 17   PRO B CD  1 
ATOM   1719 N  N   . HIS B 1 18  ? 59.417 99.912  5.298   1.00 10.68  ? 18   HIS B N   1 
ATOM   1720 C  CA  . HIS B 1 18  ? 58.804 99.040  4.281   1.00 10.70  ? 18   HIS B CA  1 
ATOM   1721 C  C   . HIS B 1 18  ? 58.764 97.620  4.803   1.00 10.17  ? 18   HIS B C   1 
ATOM   1722 O  O   . HIS B 1 18  ? 57.755 96.942  4.679   1.00 10.30  ? 18   HIS B O   1 
ATOM   1723 C  CB  . HIS B 1 18  ? 59.514 99.155  2.925   1.00 9.93   ? 18   HIS B CB  1 
ATOM   1724 C  CG  . HIS B 1 18  ? 59.844 100.573 2.560   1.00 10.56  ? 18   HIS B CG  1 
ATOM   1725 N  ND1 . HIS B 1 18  ? 58.883 101.476 2.166   1.00 12.38  ? 18   HIS B ND1 1 
ATOM   1726 C  CD2 . HIS B 1 18  ? 61.019 101.249 2.562   1.00 9.24   ? 18   HIS B CD2 1 
ATOM   1727 C  CE1 . HIS B 1 18  ? 59.446 102.649 1.936   1.00 11.04  ? 18   HIS B CE1 1 
ATOM   1728 N  NE2 . HIS B 1 18  ? 60.741 102.540 2.176   1.00 14.10  ? 18   HIS B NE2 1 
ATOM   1729 N  N   . ILE B 1 19  ? 59.849 97.223  5.450   1.00 9.05   ? 19   ILE B N   1 
ATOM   1730 C  CA  . ILE B 1 19  ? 59.865 96.015  6.261   1.00 10.08  ? 19   ILE B CA  1 
ATOM   1731 C  C   . ILE B 1 19  ? 60.494 96.461  7.577   1.00 9.71   ? 19   ILE B C   1 
ATOM   1732 O  O   . ILE B 1 19  ? 61.585 97.009  7.580   1.00 10.73  ? 19   ILE B O   1 
ATOM   1733 C  CB  . ILE B 1 19  ? 60.678 94.864  5.605   1.00 9.37   ? 19   ILE B CB  1 
ATOM   1734 C  CG1 . ILE B 1 19  ? 60.040 94.445  4.257   1.00 11.02  ? 19   ILE B CG1 1 
ATOM   1735 C  CG2 . ILE B 1 19  ? 60.713 93.654  6.556   1.00 9.67   ? 19   ILE B CG2 1 
ATOM   1736 C  CD1 . ILE B 1 19  ? 60.885 93.381  3.476   1.00 9.44   ? 19   ILE B CD1 1 
ATOM   1737 N  N   . SER B 1 20  ? 59.823 96.216  8.687   1.00 9.37   ? 20   SER B N   1 
ATOM   1738 C  CA  . SER B 1 20  ? 60.320 96.706  9.965   1.00 9.33   ? 20   SER B CA  1 
ATOM   1739 C  C   . SER B 1 20  ? 61.598 96.010  10.441  1.00 9.55   ? 20   SER B C   1 
ATOM   1740 O  O   . SER B 1 20  ? 61.941 94.900  10.006  1.00 8.49   ? 20   SER B O   1 
ATOM   1741 C  CB  . SER B 1 20  ? 59.234 96.618  11.059  1.00 9.01   ? 20   SER B CB  1 
ATOM   1742 O  OG  . SER B 1 20  ? 58.998 95.279  11.469  1.00 7.69   ? 20   SER B OG  1 
ATOM   1743 N  N   . GLU B 1 21  ? 62.282 96.679  11.354  1.00 7.93   ? 21   GLU B N   1 
ATOM   1744 C  CA  . GLU B 1 21  ? 63.416 96.093  12.025  1.00 8.11   ? 21   GLU B CA  1 
ATOM   1745 C  C   . GLU B 1 21  ? 63.010 94.858  12.836  1.00 7.84   ? 21   GLU B C   1 
ATOM   1746 O  O   . GLU B 1 21  ? 63.780 93.906  12.929  1.00 8.52   ? 21   GLU B O   1 
ATOM   1747 C  CB  . GLU B 1 21  ? 64.090 97.128  12.922  1.00 7.67   ? 21   GLU B CB  1 
ATOM   1748 C  CG  . GLU B 1 21  ? 65.362 96.610  13.649  1.00 7.49   ? 21   GLU B CG  1 
ATOM   1749 C  CD  . GLU B 1 21  ? 66.076 97.709  14.400  1.00 8.40   ? 21   GLU B CD  1 
ATOM   1750 O  OE1 . GLU B 1 21  ? 65.409 98.664  14.870  1.00 11.16  ? 21   GLU B OE1 1 
ATOM   1751 O  OE2 . GLU B 1 21  ? 67.315 97.657  14.455  1.00 11.54  ? 21   GLU B OE2 1 
ATOM   1752 N  N   . GLU B 1 22  ? 61.817 94.872  13.430  1.00 7.62   ? 22   GLU B N   1 
ATOM   1753 C  CA  . GLU B 1 22  ? 61.343 93.722  14.172  1.00 8.10   ? 22   GLU B CA  1 
ATOM   1754 C  C   . GLU B 1 22  ? 61.161 92.542  13.222  1.00 7.87   ? 22   GLU B C   1 
ATOM   1755 O  O   . GLU B 1 22  ? 61.597 91.417  13.511  1.00 6.99   ? 22   GLU B O   1 
ATOM   1756 C  CB  . GLU B 1 22  ? 60.007 94.007  14.894  1.00 7.82   ? 22   GLU B CB  1 
ATOM   1757 C  CG  . GLU B 1 22  ? 59.568 92.822  15.762  1.00 9.33   ? 22   GLU B CG  1 
ATOM   1758 C  CD  . GLU B 1 22  ? 58.295 93.075  16.504  1.00 10.88  ? 22   GLU B CD  1 
ATOM   1759 O  OE1 . GLU B 1 22  ? 57.991 94.260  16.785  1.00 11.94  ? 22   GLU B OE1 1 
ATOM   1760 O  OE2 . GLU B 1 22  ? 57.588 92.089  16.803  1.00 12.43  ? 22   GLU B OE2 1 
ATOM   1761 N  N   . THR B 1 23  ? 60.535 92.800  12.076  1.00 7.96   ? 23   THR B N   1 
ATOM   1762 C  CA  . THR B 1 23  ? 60.413 91.742  11.058  1.00 8.28   ? 23   THR B CA  1 
ATOM   1763 C  C   . THR B 1 23  ? 61.773 91.134  10.676  1.00 8.73   ? 23   THR B C   1 
ATOM   1764 O  O   . THR B 1 23  ? 61.926 89.912  10.742  1.00 10.32  ? 23   THR B O   1 
ATOM   1765 C  CB  . THR B 1 23  ? 59.656 92.185  9.817   1.00 7.76   ? 23   THR B CB  1 
ATOM   1766 O  OG1 . THR B 1 23  ? 58.290 92.375  10.161  1.00 7.73   ? 23   THR B OG1 1 
ATOM   1767 C  CG2 . THR B 1 23  ? 59.745 91.124  8.710   1.00 6.85   ? 23   THR B CG2 1 
ATOM   1768 N  N   . LEU B 1 24  ? 62.758 91.977  10.354  1.00 8.50   ? 24   LEU B N   1 
ATOM   1769 C  CA  . LEU B 1 24  ? 64.109 91.493  10.011  1.00 9.77   ? 24   LEU B CA  1 
ATOM   1770 C  C   . LEU B 1 24  ? 64.753 90.715  11.150  1.00 9.78   ? 24   LEU B C   1 
ATOM   1771 O  O   . LEU B 1 24  ? 65.436 89.701  10.930  1.00 10.76  ? 24   LEU B O   1 
ATOM   1772 C  CB  . LEU B 1 24  ? 65.030 92.635  9.485   1.00 8.94   ? 24   LEU B CB  1 
ATOM   1773 C  CG  . LEU B 1 24  ? 65.126 92.698  7.943   1.00 10.41  ? 24   LEU B CG  1 
ATOM   1774 C  CD1 . LEU B 1 24  ? 63.794 93.080  7.309   1.00 14.86  ? 24   LEU B CD1 1 
ATOM   1775 C  CD2 . LEU B 1 24  ? 66.204 93.612  7.424   1.00 9.35   ? 24   LEU B CD2 1 
ATOM   1776 N  N   . ASN B 1 25  ? 64.518 91.163  12.371  1.00 9.86   ? 25   ASN B N   1 
ATOM   1777 C  CA  . ASN B 1 25  ? 64.994 90.433  13.539  1.00 10.76  ? 25   ASN B CA  1 
ATOM   1778 C  C   . ASN B 1 25  ? 64.461 88.975  13.604  1.00 9.83   ? 25   ASN B C   1 
ATOM   1779 O  O   . ASN B 1 25  ? 65.235 88.016  13.683  1.00 9.86   ? 25   ASN B O   1 
ATOM   1780 C  CB  . ASN B 1 25  ? 64.666 91.251  14.800  1.00 10.92  ? 25   ASN B CB  1 
ATOM   1781 C  CG  . ASN B 1 25  ? 65.677 91.033  15.918  1.00 13.90  ? 25   ASN B CG  1 
ATOM   1782 O  OD1 . ASN B 1 25  ? 66.438 90.076  15.889  1.00 14.26  ? 25   ASN B OD1 1 
ATOM   1783 N  ND2 . ASN B 1 25  ? 65.655 91.908  16.928  1.00 12.09  ? 25   ASN B ND2 1 
ATOM   1784 N  N   . PHE B 1 26  ? 63.145 88.798  13.561  1.00 9.98   ? 26   PHE B N   1 
ATOM   1785 C  CA  . PHE B 1 26  ? 62.561 87.444  13.556  1.00 10.58  ? 26   PHE B CA  1 
ATOM   1786 C  C   . PHE B 1 26  ? 62.901 86.640  12.308  1.00 10.43  ? 26   PHE B C   1 
ATOM   1787 O  O   . PHE B 1 26  ? 63.274 85.468  12.387  1.00 10.81  ? 26   PHE B O   1 
ATOM   1788 C  CB  . PHE B 1 26  ? 61.044 87.499  13.758  1.00 10.33  ? 26   PHE B CB  1 
ATOM   1789 C  CG  . PHE B 1 26  ? 60.646 87.808  15.187  1.00 11.06  ? 26   PHE B CG  1 
ATOM   1790 C  CD1 . PHE B 1 26  ? 60.475 86.776  16.110  1.00 10.21  ? 26   PHE B CD1 1 
ATOM   1791 C  CD2 . PHE B 1 26  ? 60.444 89.133  15.594  1.00 10.53  ? 26   PHE B CD2 1 
ATOM   1792 C  CE1 . PHE B 1 26  ? 60.121 87.049  17.439  1.00 12.70  ? 26   PHE B CE1 1 
ATOM   1793 C  CE2 . PHE B 1 26  ? 60.092 89.416  16.929  1.00 12.37  ? 26   PHE B CE2 1 
ATOM   1794 C  CZ  . PHE B 1 26  ? 59.914 88.370  17.837  1.00 12.33  ? 26   PHE B CZ  1 
ATOM   1795 N  N   . HIS B 1 27  ? 62.779 87.293  11.157  1.00 10.14  ? 27   HIS B N   1 
ATOM   1796 C  CA  . HIS B 1 27  ? 62.960 86.649  9.854   1.00 9.28   ? 27   HIS B CA  1 
ATOM   1797 C  C   . HIS B 1 27  ? 64.395 86.167  9.689   1.00 9.35   ? 27   HIS B C   1 
ATOM   1798 O  O   . HIS B 1 27  ? 64.636 85.032  9.277   1.00 8.81   ? 27   HIS B O   1 
ATOM   1799 C  CB  . HIS B 1 27  ? 62.573 87.640  8.739   1.00 9.30   ? 27   HIS B CB  1 
ATOM   1800 C  CG  . HIS B 1 27  ? 62.137 86.983  7.475   1.00 8.23   ? 27   HIS B CG  1 
ATOM   1801 N  ND1 . HIS B 1 27  ? 61.600 87.689  6.423   1.00 6.62   ? 27   HIS B ND1 1 
ATOM   1802 C  CD2 . HIS B 1 27  ? 62.152 85.681  7.092   1.00 3.84   ? 27   HIS B CD2 1 
ATOM   1803 C  CE1 . HIS B 1 27  ? 61.322 86.856  5.438   1.00 6.43   ? 27   HIS B CE1 1 
ATOM   1804 N  NE2 . HIS B 1 27  ? 61.674 85.645  5.813   1.00 4.24   ? 27   HIS B NE2 1 
ATOM   1805 N  N   . TYR B 1 28  ? 65.351 87.007  10.063  1.00 9.25   ? 28   TYR B N   1 
ATOM   1806 C  CA  . TYR B 1 28  ? 66.766 86.646  9.926   1.00 10.48  ? 28   TYR B CA  1 
ATOM   1807 C  C   . TYR B 1 28  ? 67.289 85.820  11.108  1.00 10.76  ? 28   TYR B C   1 
ATOM   1808 O  O   . TYR B 1 28  ? 67.824 84.729  10.915  1.00 10.96  ? 28   TYR B O   1 
ATOM   1809 C  CB  . TYR B 1 28  ? 67.632 87.911  9.702   1.00 9.91   ? 28   TYR B CB  1 
ATOM   1810 C  CG  . TYR B 1 28  ? 69.092 87.617  9.520   1.00 11.06  ? 28   TYR B CG  1 
ATOM   1811 C  CD1 . TYR B 1 28  ? 69.551 87.030  8.338   1.00 8.38   ? 28   TYR B CD1 1 
ATOM   1812 C  CD2 . TYR B 1 28  ? 70.024 87.925  10.517  1.00 9.77   ? 28   TYR B CD2 1 
ATOM   1813 C  CE1 . TYR B 1 28  ? 70.921 86.779  8.125   1.00 11.16  ? 28   TYR B CE1 1 
ATOM   1814 C  CE2 . TYR B 1 28  ? 71.408 87.664  10.324  1.00 10.42  ? 28   TYR B CE2 1 
ATOM   1815 C  CZ  . TYR B 1 28  ? 71.835 87.084  9.122   1.00 10.73  ? 28   TYR B CZ  1 
ATOM   1816 O  OH  . TYR B 1 28  ? 73.162 86.817  8.888   1.00 11.88  ? 28   TYR B OH  1 
ATOM   1817 N  N   . ASN B 1 29  ? 67.115 86.324  12.329  1.00 11.11  ? 29   ASN B N   1 
ATOM   1818 C  CA  . ASN B 1 29  ? 67.655 85.653  13.516  1.00 11.12  ? 29   ASN B CA  1 
ATOM   1819 C  C   . ASN B 1 29  ? 66.882 84.442  14.051  1.00 10.88  ? 29   ASN B C   1 
ATOM   1820 O  O   . ASN B 1 29  ? 67.473 83.591  14.729  1.00 10.27  ? 29   ASN B O   1 
ATOM   1821 C  CB  . ASN B 1 29  ? 67.901 86.666  14.638  1.00 11.56  ? 29   ASN B CB  1 
ATOM   1822 C  CG  . ASN B 1 29  ? 68.965 87.665  14.271  1.00 11.87  ? 29   ASN B CG  1 
ATOM   1823 O  OD1 . ASN B 1 29  ? 70.047 87.282  13.847  1.00 11.51  ? 29   ASN B OD1 1 
ATOM   1824 N  ND2 . ASN B 1 29  ? 68.666 88.952  14.427  1.00 11.89  ? 29   ASN B ND2 1 
ATOM   1825 N  N   . LYS B 1 30  ? 65.580 84.350  13.768  1.00 11.01  ? 30   LYS B N   1 
ATOM   1826 C  CA  . LYS B 1 30  ? 64.838 83.125  14.072  1.00 11.17  ? 30   LYS B CA  1 
ATOM   1827 C  C   . LYS B 1 30  ? 64.676 82.225  12.835  1.00 10.86  ? 30   LYS B C   1 
ATOM   1828 O  O   . LYS B 1 30  ? 65.151 81.093  12.842  1.00 11.94  ? 30   LYS B O   1 
ATOM   1829 C  CB  . LYS B 1 30  ? 63.442 83.425  14.678  1.00 11.49  ? 30   LYS B CB  1 
ATOM   1830 C  CG  . LYS B 1 30  ? 63.435 84.167  16.022  1.00 13.56  ? 30   LYS B CG  1 
ATOM   1831 C  CD  . LYS B 1 30  ? 64.195 83.363  17.084  1.00 16.33  ? 30   LYS B CD  1 
ATOM   1832 C  CE  . LYS B 1 30  ? 64.399 84.194  18.320  1.00 18.35  ? 30   LYS B CE  1 
ATOM   1833 N  NZ  . LYS B 1 30  ? 64.749 83.297  19.473  1.00 20.13  ? 30   LYS B NZ  1 
ATOM   1834 N  N   . HIS B 1 31  ? 63.983 82.695  11.795  1.00 10.05  ? 31   HIS B N   1 
ATOM   1835 C  CA  . HIS B 1 31  ? 63.691 81.833  10.646  1.00 9.87   ? 31   HIS B CA  1 
ATOM   1836 C  C   . HIS B 1 31  ? 64.945 81.379  9.882   1.00 10.67  ? 31   HIS B C   1 
ATOM   1837 O  O   . HIS B 1 31  ? 65.243 80.159  9.801   1.00 11.06  ? 31   HIS B O   1 
ATOM   1838 C  CB  . HIS B 1 31  ? 62.631 82.458  9.707   1.00 9.96   ? 31   HIS B CB  1 
ATOM   1839 C  CG  . HIS B 1 31  ? 61.278 82.578  10.352  1.00 10.77  ? 31   HIS B CG  1 
ATOM   1840 N  ND1 . HIS B 1 31  ? 60.515 81.475  10.676  1.00 10.86  ? 31   HIS B ND1 1 
ATOM   1841 C  CD2 . HIS B 1 31  ? 60.579 83.661  10.778  1.00 10.34  ? 31   HIS B CD2 1 
ATOM   1842 C  CE1 . HIS B 1 31  ? 59.394 81.875  11.262  1.00 10.47  ? 31   HIS B CE1 1 
ATOM   1843 N  NE2 . HIS B 1 31  ? 59.410 83.197  11.345  1.00 10.85  ? 31   HIS B NE2 1 
ATOM   1844 N  N   . HIS B 1 32  ? 65.693 82.353  9.364   1.00 9.77   ? 32   HIS B N   1 
ATOM   1845 C  CA  . HIS B 1 32  ? 66.811 82.074  8.473   1.00 11.02  ? 32   HIS B CA  1 
ATOM   1846 C  C   . HIS B 1 32  ? 67.909 81.307  9.244   1.00 10.53  ? 32   HIS B C   1 
ATOM   1847 O  O   . HIS B 1 32  ? 68.389 80.262  8.774   1.00 10.81  ? 32   HIS B O   1 
ATOM   1848 C  CB  . HIS B 1 32  ? 67.348 83.391  7.859   1.00 9.69   ? 32   HIS B CB  1 
ATOM   1849 C  CG  . HIS B 1 32  ? 68.254 83.189  6.680   1.00 10.84  ? 32   HIS B CG  1 
ATOM   1850 N  ND1 . HIS B 1 32  ? 68.767 84.241  5.948   1.00 7.92   ? 32   HIS B ND1 1 
ATOM   1851 C  CD2 . HIS B 1 32  ? 68.691 82.060  6.075   1.00 7.88   ? 32   HIS B CD2 1 
ATOM   1852 C  CE1 . HIS B 1 32  ? 69.514 83.766  4.968   1.00 7.69   ? 32   HIS B CE1 1 
ATOM   1853 N  NE2 . HIS B 1 32  ? 69.482 82.446  5.020   1.00 6.14   ? 32   HIS B NE2 1 
ATOM   1854 N  N   . ALA B 1 33  ? 68.275 81.806  10.427  1.00 10.90  ? 33   ALA B N   1 
ATOM   1855 C  CA  . ALA B 1 33  ? 69.230 81.133  11.333  1.00 10.84  ? 33   ALA B CA  1 
ATOM   1856 C  C   . ALA B 1 33  ? 68.829 79.708  11.724  1.00 11.35  ? 33   ALA B C   1 
ATOM   1857 O  O   . ALA B 1 33  ? 69.675 78.790  11.718  1.00 11.61  ? 33   ALA B O   1 
ATOM   1858 C  CB  . ALA B 1 33  ? 69.485 81.994  12.609  1.00 10.85  ? 33   ALA B CB  1 
ATOM   1859 N  N   . GLY B 1 34  ? 67.543 79.531  12.036  1.00 11.49  ? 34   GLY B N   1 
ATOM   1860 C  CA  . GLY B 1 34  ? 66.932 78.220  12.309  1.00 10.67  ? 34   GLY B CA  1 
ATOM   1861 C  C   . GLY B 1 34  ? 67.032 77.212  11.167  1.00 10.43  ? 34   GLY B C   1 
ATOM   1862 O  O   . GLY B 1 34  ? 67.307 76.028  11.402  1.00 9.91   ? 34   GLY B O   1 
ATOM   1863 N  N   . TYR B 1 35  ? 66.826 77.653  9.927   1.00 9.89   ? 35   TYR B N   1 
ATOM   1864 C  CA  . TYR B 1 35  ? 67.102 76.797  8.759   1.00 9.41   ? 35   TYR B CA  1 
ATOM   1865 C  C   . TYR B 1 35  ? 68.562 76.283  8.720   1.00 9.68   ? 35   TYR B C   1 
ATOM   1866 O  O   . TYR B 1 35  ? 68.812 75.090  8.472   1.00 9.16   ? 35   TYR B O   1 
ATOM   1867 C  CB  . TYR B 1 35  ? 66.765 77.515  7.443   1.00 10.18  ? 35   TYR B CB  1 
ATOM   1868 C  CG  . TYR B 1 35  ? 65.300 77.881  7.254   1.00 11.31  ? 35   TYR B CG  1 
ATOM   1869 C  CD1 . TYR B 1 35  ? 64.295 76.902  7.325   1.00 10.23  ? 35   TYR B CD1 1 
ATOM   1870 C  CD2 . TYR B 1 35  ? 64.920 79.191  6.948   1.00 10.73  ? 35   TYR B CD2 1 
ATOM   1871 C  CE1 . TYR B 1 35  ? 62.949 77.243  7.161   1.00 10.68  ? 35   TYR B CE1 1 
ATOM   1872 C  CE2 . TYR B 1 35  ? 63.558 79.536  6.785   1.00 10.44  ? 35   TYR B CE2 1 
ATOM   1873 C  CZ  . TYR B 1 35  ? 62.597 78.558  6.887   1.00 10.08  ? 35   TYR B CZ  1 
ATOM   1874 O  OH  . TYR B 1 35  ? 61.270 78.869  6.668   1.00 12.98  ? 35   TYR B OH  1 
ATOM   1875 N  N   . VAL B 1 36  ? 69.522 77.184  8.941   1.00 9.99   ? 36   VAL B N   1 
ATOM   1876 C  CA  . VAL B 1 36  ? 70.946 76.804  8.996   1.00 10.46  ? 36   VAL B CA  1 
ATOM   1877 C  C   . VAL B 1 36  ? 71.221 75.770  10.119  1.00 11.16  ? 36   VAL B C   1 
ATOM   1878 O  O   . VAL B 1 36  ? 71.854 74.729  9.907   1.00 10.63  ? 36   VAL B O   1 
ATOM   1879 C  CB  . VAL B 1 36  ? 71.839 78.061  9.172   1.00 10.67  ? 36   VAL B CB  1 
ATOM   1880 C  CG1 . VAL B 1 36  ? 73.325 77.661  9.395   1.00 8.96   ? 36   VAL B CG1 1 
ATOM   1881 C  CG2 . VAL B 1 36  ? 71.704 78.943  7.978   1.00 10.32  ? 36   VAL B CG2 1 
ATOM   1882 N  N   . ASN B 1 37  ? 70.728 76.077  11.311  1.00 12.00  ? 37   ASN B N   1 
ATOM   1883 C  CA  . ASN B 1 37  ? 70.912 75.208  12.459  1.00 13.34  ? 37   ASN B CA  1 
ATOM   1884 C  C   . ASN B 1 37  ? 70.246 73.849  12.280  1.00 13.73  ? 37   ASN B C   1 
ATOM   1885 O  O   . ASN B 1 37  ? 70.864 72.826  12.555  1.00 13.20  ? 37   ASN B O   1 
ATOM   1886 C  CB  . ASN B 1 37  ? 70.399 75.872  13.722  1.00 13.67  ? 37   ASN B CB  1 
ATOM   1887 C  CG  . ASN B 1 37  ? 71.105 77.183  14.030  1.00 17.09  ? 37   ASN B CG  1 
ATOM   1888 O  OD1 . ASN B 1 37  ? 72.210 77.476  13.523  1.00 18.24  ? 37   ASN B OD1 1 
ATOM   1889 N  ND2 . ASN B 1 37  ? 70.478 77.982  14.881  1.00 18.85  ? 37   ASN B ND2 1 
ATOM   1890 N  N   . LYS B 1 38  ? 68.995 73.832  11.831  1.00 13.51  ? 38   LYS B N   1 
ATOM   1891 C  CA  . LYS B 1 38  ? 68.331 72.566  11.557  1.00 14.43  ? 38   LYS B CA  1 
ATOM   1892 C  C   . LYS B 1 38  ? 69.064 71.779  10.461  1.00 13.67  ? 38   LYS B C   1 
ATOM   1893 O  O   . LYS B 1 38  ? 69.244 70.567  10.588  1.00 13.80  ? 38   LYS B O   1 
ATOM   1894 C  CB  . LYS B 1 38  ? 66.852 72.767  11.219  1.00 15.46  ? 38   LYS B CB  1 
ATOM   1895 C  CG  . LYS B 1 38  ? 66.045 71.458  11.171  1.00 18.46  ? 38   LYS B CG  1 
ATOM   1896 C  CD  . LYS B 1 38  ? 64.564 71.702  11.530  1.00 23.95  ? 38   LYS B CD  1 
ATOM   1897 C  CE  . LYS B 1 38  ? 63.689 70.451  11.282  1.00 24.81  ? 38   LYS B CE  1 
ATOM   1898 N  NZ  . LYS B 1 38  ? 63.306 70.293  9.815   1.00 28.44  ? 38   LYS B NZ  1 
ATOM   1899 N  N   . LEU B 1 39  ? 69.498 72.447  9.392   1.00 12.55  ? 39   LEU B N   1 
ATOM   1900 C  CA  . LEU B 1 39  ? 70.188 71.717  8.327   1.00 11.78  ? 39   LEU B CA  1 
ATOM   1901 C  C   . LEU B 1 39  ? 71.482 71.042  8.834   1.00 11.83  ? 39   LEU B C   1 
ATOM   1902 O  O   . LEU B 1 39  ? 71.754 69.871  8.502   1.00 10.61  ? 39   LEU B O   1 
ATOM   1903 C  CB  . LEU B 1 39  ? 70.474 72.603  7.094   1.00 10.69  ? 39   LEU B CB  1 
ATOM   1904 C  CG  . LEU B 1 39  ? 71.172 71.880  5.921   1.00 11.95  ? 39   LEU B CG  1 
ATOM   1905 C  CD1 . LEU B 1 39  ? 70.288 70.783  5.275   1.00 9.08   ? 39   LEU B CD1 1 
ATOM   1906 C  CD2 . LEU B 1 39  ? 71.661 72.877  4.883   1.00 11.77  ? 39   LEU B CD2 1 
ATOM   1907 N  N   . ASN B 1 40  ? 72.282 71.771  9.617   1.00 12.00  ? 40   ASN B N   1 
ATOM   1908 C  CA  . ASN B 1 40  ? 73.551 71.200  10.122  1.00 12.91  ? 40   ASN B CA  1 
ATOM   1909 C  C   . ASN B 1 40  ? 73.300 69.908  10.964  1.00 13.74  ? 40   ASN B C   1 
ATOM   1910 O  O   . ASN B 1 40  ? 74.006 68.894  10.805  1.00 14.35  ? 40   ASN B O   1 
ATOM   1911 C  CB  . ASN B 1 40  ? 74.371 72.270  10.888  1.00 12.98  ? 40   ASN B CB  1 
ATOM   1912 C  CG  . ASN B 1 40  ? 75.059 73.254  9.958   1.00 12.31  ? 40   ASN B CG  1 
ATOM   1913 O  OD1 . ASN B 1 40  ? 75.612 72.858  8.941   1.00 11.76  ? 40   ASN B OD1 1 
ATOM   1914 N  ND2 . ASN B 1 40  ? 75.002 74.540  10.282  1.00 12.03  ? 40   ASN B ND2 1 
ATOM   1915 N  N   . GLY B 1 41  ? 72.284 69.940  11.826  1.00 13.44  ? 41   GLY B N   1 
ATOM   1916 C  CA  . GLY B 1 41  ? 71.910 68.768  12.620  1.00 14.25  ? 41   GLY B CA  1 
ATOM   1917 C  C   . GLY B 1 41  ? 71.483 67.610  11.729  1.00 15.39  ? 41   GLY B C   1 
ATOM   1918 O  O   . GLY B 1 41  ? 71.855 66.451  11.993  1.00 14.82  ? 41   GLY B O   1 
ATOM   1919 N  N   . LEU B 1 42  ? 70.726 67.920  10.662  1.00 14.48  ? 42   LEU B N   1 
ATOM   1920 C  CA  . LEU B 1 42  ? 70.226 66.904  9.733   1.00 14.78  ? 42   LEU B CA  1 
ATOM   1921 C  C   . LEU B 1 42  ? 71.296 66.204  8.882   1.00 15.15  ? 42   LEU B C   1 
ATOM   1922 O  O   . LEU B 1 42  ? 71.174 64.999  8.599   1.00 13.82  ? 42   LEU B O   1 
ATOM   1923 C  CB  . LEU B 1 42  ? 69.152 67.484  8.800   1.00 13.73  ? 42   LEU B CB  1 
ATOM   1924 C  CG  . LEU B 1 42  ? 67.765 67.723  9.404   1.00 14.31  ? 42   LEU B CG  1 
ATOM   1925 C  CD1 . LEU B 1 42  ? 66.868 68.490  8.377   1.00 11.43  ? 42   LEU B CD1 1 
ATOM   1926 C  CD2 . LEU B 1 42  ? 67.114 66.410  9.832   1.00 14.29  ? 42   LEU B CD2 1 
ATOM   1927 N  N   . ILE B 1 43  ? 72.322 66.954  8.471   1.00 15.49  ? 43   ILE B N   1 
ATOM   1928 C  CA  . ILE B 1 43  ? 73.325 66.440  7.510   1.00 16.86  ? 43   ILE B CA  1 
ATOM   1929 C  C   . ILE B 1 43  ? 74.581 65.851  8.156   1.00 17.98  ? 43   ILE B C   1 
ATOM   1930 O  O   . ILE B 1 43  ? 75.378 65.222  7.466   1.00 17.14  ? 43   ILE B O   1 
ATOM   1931 C  CB  . ILE B 1 43  ? 73.738 67.475  6.410   1.00 15.58  ? 43   ILE B CB  1 
ATOM   1932 C  CG1 . ILE B 1 43  ? 74.531 68.649  7.013   1.00 16.16  ? 43   ILE B CG1 1 
ATOM   1933 C  CG2 . ILE B 1 43  ? 72.508 67.918  5.603   1.00 15.43  ? 43   ILE B CG2 1 
ATOM   1934 C  CD1 . ILE B 1 43  ? 74.984 69.705  6.006   1.00 15.58  ? 43   ILE B CD1 1 
ATOM   1935 N  N   . LYS B 1 44  ? 74.751 66.070  9.460   1.00 20.57  ? 44   LYS B N   1 
ATOM   1936 C  CA  . LYS B 1 44  ? 75.836 65.429  10.230  1.00 23.88  ? 44   LYS B CA  1 
ATOM   1937 C  C   . LYS B 1 44  ? 75.751 63.923  9.956   1.00 24.56  ? 44   LYS B C   1 
ATOM   1938 O  O   . LYS B 1 44  ? 74.674 63.338  10.030  1.00 25.53  ? 44   LYS B O   1 
ATOM   1939 C  CB  . LYS B 1 44  ? 75.673 65.720  11.743  1.00 24.26  ? 44   LYS B CB  1 
ATOM   1940 C  CG  . LYS B 1 44  ? 76.684 65.003  12.667  1.00 26.26  ? 44   LYS B CG  1 
ATOM   1941 C  CD  . LYS B 1 44  ? 76.308 65.078  14.174  1.00 25.79  ? 44   LYS B CD  1 
ATOM   1942 C  CE  . LYS B 1 44  ? 77.434 64.476  15.074  1.00 27.27  ? 44   LYS B CE  1 
ATOM   1943 N  NZ  . LYS B 1 44  ? 77.160 64.554  16.566  1.00 29.07  ? 44   LYS B NZ  1 
ATOM   1944 N  N   . ASP B 1 45  ? 76.859 63.284  9.604   1.00 26.11  ? 45   ASP B N   1 
ATOM   1945 C  CA  . ASP B 1 45  ? 76.828 61.816  9.429   1.00 26.47  ? 45   ASP B CA  1 
ATOM   1946 C  C   . ASP B 1 45  ? 76.146 61.352  8.129   1.00 25.95  ? 45   ASP B C   1 
ATOM   1947 O  O   . ASP B 1 45  ? 75.769 60.175  7.987   1.00 25.46  ? 45   ASP B O   1 
ATOM   1948 C  CB  . ASP B 1 45  ? 76.150 61.128  10.637  1.00 28.11  ? 45   ASP B CB  1 
ATOM   1949 C  CG  . ASP B 1 45  ? 76.806 61.473  11.962  1.00 31.60  ? 45   ASP B CG  1 
ATOM   1950 O  OD1 . ASP B 1 45  ? 78.060 61.567  11.998  1.00 37.19  ? 45   ASP B OD1 1 
ATOM   1951 O  OD2 . ASP B 1 45  ? 76.069 61.653  12.975  1.00 36.54  ? 45   ASP B OD2 1 
ATOM   1952 N  N   . THR B 1 46  ? 75.974 62.268  7.175   1.00 24.10  ? 46   THR B N   1 
ATOM   1953 C  CA  . THR B 1 46  ? 75.454 61.877  5.882   1.00 22.64  ? 46   THR B CA  1 
ATOM   1954 C  C   . THR B 1 46  ? 76.492 62.262  4.829   1.00 21.61  ? 46   THR B C   1 
ATOM   1955 O  O   . THR B 1 46  ? 77.415 63.016  5.148   1.00 21.50  ? 46   THR B O   1 
ATOM   1956 C  CB  . THR B 1 46  ? 74.080 62.542  5.611   1.00 22.74  ? 46   THR B CB  1 
ATOM   1957 O  OG1 . THR B 1 46  ? 74.274 63.945  5.443   1.00 21.21  ? 46   THR B OG1 1 
ATOM   1958 C  CG2 . THR B 1 46  ? 73.082 62.273  6.761   1.00 21.70  ? 46   THR B CG2 1 
ATOM   1959 N  N   . PRO B 1 47  ? 76.371 61.743  3.583   1.00 20.88  ? 47   PRO B N   1 
ATOM   1960 C  CA  . PRO B 1 47  ? 77.238 62.261  2.516   1.00 20.32  ? 47   PRO B CA  1 
ATOM   1961 C  C   . PRO B 1 47  ? 77.002 63.744  2.206   1.00 19.33  ? 47   PRO B C   1 
ATOM   1962 O  O   . PRO B 1 47  ? 77.761 64.340  1.445   1.00 18.99  ? 47   PRO B O   1 
ATOM   1963 C  CB  . PRO B 1 47  ? 76.868 61.388  1.295   1.00 20.45  ? 47   PRO B CB  1 
ATOM   1964 C  CG  . PRO B 1 47  ? 76.237 60.173  1.861   1.00 21.39  ? 47   PRO B CG  1 
ATOM   1965 C  CD  . PRO B 1 47  ? 75.510 60.649  3.092   1.00 21.53  ? 47   PRO B CD  1 
ATOM   1966 N  N   . PHE B 1 48  ? 75.951 64.337  2.778   1.00 18.46  ? 48   PHE B N   1 
ATOM   1967 C  CA  . PHE B 1 48  ? 75.659 65.762  2.568   1.00 17.56  ? 48   PHE B CA  1 
ATOM   1968 C  C   . PHE B 1 48  ? 76.587 66.681  3.367   1.00 17.83  ? 48   PHE B C   1 
ATOM   1969 O  O   . PHE B 1 48  ? 76.744 67.844  3.018   1.00 18.34  ? 48   PHE B O   1 
ATOM   1970 C  CB  . PHE B 1 48  ? 74.190 66.098  2.905   1.00 17.52  ? 48   PHE B CB  1 
ATOM   1971 C  CG  . PHE B 1 48  ? 73.180 65.488  1.951   1.00 16.63  ? 48   PHE B CG  1 
ATOM   1972 C  CD1 . PHE B 1 48  ? 73.067 65.948  0.641   1.00 17.19  ? 48   PHE B CD1 1 
ATOM   1973 C  CD2 . PHE B 1 48  ? 72.365 64.435  2.364   1.00 16.56  ? 48   PHE B CD2 1 
ATOM   1974 C  CE1 . PHE B 1 48  ? 72.143 65.364  -0.253  1.00 14.48  ? 48   PHE B CE1 1 
ATOM   1975 C  CE2 . PHE B 1 48  ? 71.439 63.855  1.488   1.00 16.84  ? 48   PHE B CE2 1 
ATOM   1976 C  CZ  . PHE B 1 48  ? 71.329 64.329  0.177   1.00 15.34  ? 48   PHE B CZ  1 
ATOM   1977 N  N   . ALA B 1 49  ? 77.174 66.175  4.441   1.00 18.02  ? 49   ALA B N   1 
ATOM   1978 C  CA  . ALA B 1 49  ? 78.083 66.962  5.305   1.00 19.04  ? 49   ALA B CA  1 
ATOM   1979 C  C   . ALA B 1 49  ? 79.294 67.613  4.607   1.00 18.99  ? 49   ALA B C   1 
ATOM   1980 O  O   . ALA B 1 49  ? 79.867 68.582  5.117   1.00 20.75  ? 49   ALA B O   1 
ATOM   1981 C  CB  . ALA B 1 49  ? 78.551 66.098  6.511   1.00 19.36  ? 49   ALA B CB  1 
ATOM   1982 N  N   . THR B 1 50  ? 79.672 67.108  3.440   1.00 18.04  ? 50   THR B N   1 
ATOM   1983 C  CA  . THR B 1 50  ? 80.850 67.601  2.730   1.00 17.79  ? 50   THR B CA  1 
ATOM   1984 C  C   . THR B 1 50  ? 80.492 68.252  1.395   1.00 17.37  ? 50   THR B C   1 
ATOM   1985 O  O   . THR B 1 50  ? 81.383 68.605  0.612   1.00 17.00  ? 50   THR B O   1 
ATOM   1986 C  CB  . THR B 1 50  ? 81.849 66.464  2.461   1.00 17.57  ? 50   THR B CB  1 
ATOM   1987 O  OG1 . THR B 1 50  ? 81.186 65.418  1.731   1.00 17.90  ? 50   THR B OG1 1 
ATOM   1988 C  CG2 . THR B 1 50  ? 82.432 65.930  3.755   1.00 17.90  ? 50   THR B CG2 1 
ATOM   1989 N  N   . LYS B 1 51  ? 79.189 68.405  1.143   1.00 16.24  ? 51   LYS B N   1 
ATOM   1990 C  CA  . LYS B 1 51  ? 78.694 69.035  -0.082  1.00 15.46  ? 51   LYS B CA  1 
ATOM   1991 C  C   . LYS B 1 51  ? 78.404 70.512  0.195   1.00 14.65  ? 51   LYS B C   1 
ATOM   1992 O  O   . LYS B 1 51  ? 78.275 70.914  1.349   1.00 15.16  ? 51   LYS B O   1 
ATOM   1993 C  CB  . LYS B 1 51  ? 77.440 68.306  -0.595  1.00 14.60  ? 51   LYS B CB  1 
ATOM   1994 C  CG  . LYS B 1 51  ? 77.664 66.818  -0.926  1.00 15.74  ? 51   LYS B CG  1 
ATOM   1995 C  CD  . LYS B 1 51  ? 76.379 66.189  -1.510  1.00 16.30  ? 51   LYS B CD  1 
ATOM   1996 C  CE  . LYS B 1 51  ? 76.559 64.697  -1.777  1.00 17.79  ? 51   LYS B CE  1 
ATOM   1997 N  NZ  . LYS B 1 51  ? 77.113 64.478  -3.135  1.00 16.82  ? 51   LYS B NZ  1 
ATOM   1998 N  N   . SER B 1 52  ? 78.355 71.326  -0.852  1.00 13.24  ? 52   SER B N   1 
ATOM   1999 C  CA  . SER B 1 52  ? 78.053 72.757  -0.713  1.00 12.10  ? 52   SER B CA  1 
ATOM   2000 C  C   . SER B 1 52  ? 76.531 72.910  -0.531  1.00 12.28  ? 52   SER B C   1 
ATOM   2001 O  O   . SER B 1 52  ? 75.785 71.951  -0.744  1.00 10.86  ? 52   SER B O   1 
ATOM   2002 C  CB  . SER B 1 52  ? 78.499 73.500  -1.963  1.00 12.22  ? 52   SER B CB  1 
ATOM   2003 O  OG  . SER B 1 52  ? 77.708 73.127  -3.086  1.00 11.18  ? 52   SER B OG  1 
ATOM   2004 N  N   . LEU B 1 53  ? 76.078 74.084  -0.091  1.00 11.91  ? 53   LEU B N   1 
ATOM   2005 C  CA  . LEU B 1 53  ? 74.629 74.359  -0.009  1.00 12.75  ? 53   LEU B CA  1 
ATOM   2006 C  C   . LEU B 1 53  ? 73.857 74.086  -1.321  1.00 12.93  ? 53   LEU B C   1 
ATOM   2007 O  O   . LEU B 1 53  ? 72.760 73.492  -1.304  1.00 12.99  ? 53   LEU B O   1 
ATOM   2008 C  CB  . LEU B 1 53  ? 74.395 75.815  0.403   1.00 13.39  ? 53   LEU B CB  1 
ATOM   2009 C  CG  . LEU B 1 53  ? 72.939 76.154  0.730   1.00 12.08  ? 53   LEU B CG  1 
ATOM   2010 C  CD1 . LEU B 1 53  ? 72.464 75.240  1.906   1.00 8.74   ? 53   LEU B CD1 1 
ATOM   2011 C  CD2 . LEU B 1 53  ? 72.817 77.637  1.058   1.00 11.20  ? 53   LEU B CD2 1 
ATOM   2012 N  N   . VAL B 1 54  ? 74.418 74.557  -2.436  1.00 11.87  ? 54   VAL B N   1 
ATOM   2013 C  CA  . VAL B 1 54  ? 73.838 74.365  -3.761  1.00 12.50  ? 54   VAL B CA  1 
ATOM   2014 C  C   . VAL B 1 54  ? 73.756 72.837  -4.084  1.00 11.94  ? 54   VAL B C   1 
ATOM   2015 O  O   . VAL B 1 54  ? 72.702 72.330  -4.559  1.00 11.88  ? 54   VAL B O   1 
ATOM   2016 C  CB  . VAL B 1 54  ? 74.677 75.134  -4.828  1.00 12.39  ? 54   VAL B CB  1 
ATOM   2017 C  CG1 . VAL B 1 54  ? 74.378 74.650  -6.270  1.00 15.37  ? 54   VAL B CG1 1 
ATOM   2018 C  CG2 . VAL B 1 54  ? 74.472 76.651  -4.681  1.00 13.84  ? 54   VAL B CG2 1 
ATOM   2019 N  N   . GLU B 1 55  ? 74.836 72.107  -3.794  1.00 10.91  ? 55   GLU B N   1 
ATOM   2020 C  CA  . GLU B 1 55  ? 74.849 70.641  -4.022  1.00 11.57  ? 55   GLU B CA  1 
ATOM   2021 C  C   . GLU B 1 55  ? 73.795 69.927  -3.157  1.00 10.86  ? 55   GLU B C   1 
ATOM   2022 O  O   . GLU B 1 55  ? 73.015 69.166  -3.680  1.00 11.70  ? 55   GLU B O   1 
ATOM   2023 C  CB  . GLU B 1 55  ? 76.239 70.052  -3.831  1.00 10.42  ? 55   GLU B CB  1 
ATOM   2024 C  CG  . GLU B 1 55  ? 77.147 70.388  -5.008  1.00 10.86  ? 55   GLU B CG  1 
ATOM   2025 C  CD  . GLU B 1 55  ? 78.585 70.107  -4.708  1.00 12.38  ? 55   GLU B CD  1 
ATOM   2026 O  OE1 . GLU B 1 55  ? 78.926 69.988  -3.522  1.00 9.60   ? 55   GLU B OE1 1 
ATOM   2027 O  OE2 . GLU B 1 55  ? 79.384 70.047  -5.658  1.00 15.40  ? 55   GLU B OE2 1 
ATOM   2028 N  N   . ILE B 1 56  ? 73.751 70.220  -1.858  1.00 10.64  ? 56   ILE B N   1 
ATOM   2029 C  CA  . ILE B 1 56  ? 72.701 69.710  -0.964  1.00 10.21  ? 56   ILE B CA  1 
ATOM   2030 C  C   . ILE B 1 56  ? 71.283 70.003  -1.495  1.00 11.18  ? 56   ILE B C   1 
ATOM   2031 O  O   . ILE B 1 56  ? 70.435 69.107  -1.589  1.00 10.39  ? 56   ILE B O   1 
ATOM   2032 C  CB  . ILE B 1 56  ? 72.888 70.257  0.491   1.00 10.60  ? 56   ILE B CB  1 
ATOM   2033 C  CG1 . ILE B 1 56  ? 74.223 69.776  1.062   1.00 9.97   ? 56   ILE B CG1 1 
ATOM   2034 C  CG2 . ILE B 1 56  ? 71.752 69.804  1.438   1.00 9.60   ? 56   ILE B CG2 1 
ATOM   2035 C  CD1 . ILE B 1 56  ? 74.675 70.493  2.334   1.00 9.44   ? 56   ILE B CD1 1 
ATOM   2036 N  N   . MET B 1 57  ? 71.045 71.273  -1.830  1.00 10.53  ? 57   MET B N   1 
ATOM   2037 C  CA  . MET B 1 57  ? 69.799 71.740  -2.396  1.00 12.06  ? 57   MET B CA  1 
ATOM   2038 C  C   . MET B 1 57  ? 69.405 70.908  -3.619  1.00 11.19  ? 57   MET B C   1 
ATOM   2039 O  O   . MET B 1 57  ? 68.272 70.444  -3.733  1.00 11.80  ? 57   MET B O   1 
ATOM   2040 C  CB  . MET B 1 57  ? 69.996 73.231  -2.767  1.00 11.68  ? 57   MET B CB  1 
ATOM   2041 C  CG  . MET B 1 57  ? 68.774 73.962  -3.189  1.00 16.74  ? 57   MET B CG  1 
ATOM   2042 S  SD  . MET B 1 57  ? 69.097 75.750  -3.079  1.00 12.96  ? 57   MET B SD  1 
ATOM   2043 C  CE  . MET B 1 57  ? 70.097 75.978  -4.549  1.00 16.11  ? 57   MET B CE  1 
ATOM   2044 N  N   . LYS B 1 58  ? 70.358 70.671  -4.513  1.00 10.65  ? 58   LYS B N   1 
ATOM   2045 C  CA  . LYS B 1 58  ? 70.096 69.934  -5.743  1.00 10.65  ? 58   LYS B CA  1 
ATOM   2046 C  C   . LYS B 1 58  ? 69.850 68.433  -5.550  1.00 10.92  ? 58   LYS B C   1 
ATOM   2047 O  O   . LYS B 1 58  ? 69.002 67.848  -6.229  1.00 10.02  ? 58   LYS B O   1 
ATOM   2048 C  CB  . LYS B 1 58  ? 71.200 70.208  -6.771  1.00 10.72  ? 58   LYS B CB  1 
ATOM   2049 C  CG  . LYS B 1 58  ? 70.915 71.431  -7.624  1.00 14.16  ? 58   LYS B CG  1 
ATOM   2050 C  CD  . LYS B 1 58  ? 72.180 71.863  -8.381  1.00 18.48  ? 58   LYS B CD  1 
ATOM   2051 C  CE  . LYS B 1 58  ? 71.864 72.678  -9.597  1.00 20.91  ? 58   LYS B CE  1 
ATOM   2052 N  NZ  . LYS B 1 58  ? 72.855 72.381  -10.668 1.00 26.38  ? 58   LYS B NZ  1 
ATOM   2053 N  N   . GLU B 1 59  ? 70.500 67.852  -4.544  1.00 10.84  ? 59   GLU B N   1 
ATOM   2054 C  CA  . GLU B 1 59  ? 70.547 66.405  -4.362  1.00 12.00  ? 59   GLU B CA  1 
ATOM   2055 C  C   . GLU B 1 59  ? 69.645 65.842  -3.265  1.00 11.97  ? 59   GLU B C   1 
ATOM   2056 O  O   . GLU B 1 59  ? 69.564 64.628  -3.092  1.00 12.71  ? 59   GLU B O   1 
ATOM   2057 C  CB  . GLU B 1 59  ? 72.000 65.969  -4.112  1.00 12.02  ? 59   GLU B CB  1 
ATOM   2058 C  CG  . GLU B 1 59  ? 72.868 66.230  -5.323  1.00 13.56  ? 59   GLU B CG  1 
ATOM   2059 C  CD  . GLU B 1 59  ? 74.331 65.917  -5.073  1.00 18.15  ? 59   GLU B CD  1 
ATOM   2060 O  OE1 . GLU B 1 59  ? 74.640 64.969  -4.333  1.00 19.18  ? 59   GLU B OE1 1 
ATOM   2061 O  OE2 . GLU B 1 59  ? 75.181 66.621  -5.641  1.00 22.48  ? 59   GLU B OE2 1 
ATOM   2062 N  N   . SER B 1 60  ? 68.962 66.719  -2.535  1.00 11.70  ? 60   SER B N   1 
ATOM   2063 C  CA  . SER B 1 60  ? 68.144 66.288  -1.409  1.00 11.38  ? 60   SER B CA  1 
ATOM   2064 C  C   . SER B 1 60  ? 66.649 66.339  -1.713  1.00 10.49  ? 60   SER B C   1 
ATOM   2065 O  O   . SER B 1 60  ? 66.219 66.889  -2.727  1.00 11.59  ? 60   SER B O   1 
ATOM   2066 C  CB  . SER B 1 60  ? 68.445 67.150  -0.166  1.00 10.31  ? 60   SER B CB  1 
ATOM   2067 O  OG  . SER B 1 60  ? 68.213 68.529  -0.463  1.00 12.20  ? 60   SER B OG  1 
ATOM   2068 N  N   . THR B 1 61  ? 65.866 65.761  -0.802  1.00 10.05  ? 61   THR B N   1 
ATOM   2069 C  CA  . THR B 1 61  ? 64.403 65.872  -0.806  1.00 9.92   ? 61   THR B CA  1 
ATOM   2070 C  C   . THR B 1 61  ? 64.002 66.102  0.643   1.00 9.88   ? 61   THR B C   1 
ATOM   2071 O  O   . THR B 1 61  ? 64.874 66.196  1.506   1.00 8.85   ? 61   THR B O   1 
ATOM   2072 C  CB  . THR B 1 61  ? 63.690 64.578  -1.301  1.00 9.90   ? 61   THR B CB  1 
ATOM   2073 O  OG1 . THR B 1 61  ? 63.958 63.523  -0.376  1.00 11.29  ? 61   THR B OG1 1 
ATOM   2074 C  CG2 . THR B 1 61  ? 64.157 64.149  -2.685  1.00 10.26  ? 61   THR B CG2 1 
ATOM   2075 N  N   . GLY B 1 62  ? 62.691 66.172  0.916   1.00 10.32  ? 62   GLY B N   1 
ATOM   2076 C  CA  . GLY B 1 62  ? 62.162 66.242  2.291   1.00 9.99   ? 62   GLY B CA  1 
ATOM   2077 C  C   . GLY B 1 62  ? 62.751 67.341  3.167   1.00 10.42  ? 62   GLY B C   1 
ATOM   2078 O  O   . GLY B 1 62  ? 62.981 68.465  2.695   1.00 11.06  ? 62   GLY B O   1 
ATOM   2079 N  N   . ALA B 1 63  ? 62.960 67.027  4.448   1.00 10.38  ? 63   ALA B N   1 
ATOM   2080 C  CA  . ALA B 1 63  ? 63.488 67.973  5.440   1.00 9.90   ? 63   ALA B CA  1 
ATOM   2081 C  C   . ALA B 1 63  ? 64.829 68.608  5.068   1.00 10.05  ? 63   ALA B C   1 
ATOM   2082 O  O   . ALA B 1 63  ? 65.001 69.827  5.235   1.00 7.53   ? 63   ALA B O   1 
ATOM   2083 C  CB  . ALA B 1 63  ? 63.592 67.320  6.811   1.00 10.67  ? 63   ALA B CB  1 
ATOM   2084 N  N   . ILE B 1 64  ? 65.791 67.791  4.620   1.00 9.16   ? 64   ILE B N   1 
ATOM   2085 C  CA  . ILE B 1 64  ? 67.074 68.341  4.153   1.00 9.95   ? 64   ILE B CA  1 
ATOM   2086 C  C   . ILE B 1 64  ? 66.904 69.357  3.038   1.00 9.48   ? 64   ILE B C   1 
ATOM   2087 O  O   . ILE B 1 64  ? 67.494 70.462  3.099   1.00 9.98   ? 64   ILE B O   1 
ATOM   2088 C  CB  . ILE B 1 64  ? 68.106 67.239  3.747   1.00 10.24  ? 64   ILE B CB  1 
ATOM   2089 C  CG1 . ILE B 1 64  ? 68.445 66.396  4.968   1.00 10.23  ? 64   ILE B CG1 1 
ATOM   2090 C  CG2 . ILE B 1 64  ? 69.373 67.874  3.097   1.00 9.23   ? 64   ILE B CG2 1 
ATOM   2091 C  CD1 . ILE B 1 64  ? 69.242 65.076  4.659   1.00 10.51  ? 64   ILE B CD1 1 
ATOM   2092 N  N   . PHE B 1 65  ? 66.082 69.027  2.043   1.00 9.08   ? 65   PHE B N   1 
ATOM   2093 C  CA  . PHE B 1 65  ? 65.824 69.982  0.967   1.00 8.75   ? 65   PHE B CA  1 
ATOM   2094 C  C   . PHE B 1 65  ? 65.158 71.238  1.500   1.00 9.68   ? 65   PHE B C   1 
ATOM   2095 O  O   . PHE B 1 65  ? 65.615 72.344  1.231   1.00 9.99   ? 65   PHE B O   1 
ATOM   2096 C  CB  . PHE B 1 65  ? 64.957 69.427  -0.167  1.00 8.55   ? 65   PHE B CB  1 
ATOM   2097 C  CG  . PHE B 1 65  ? 64.596 70.497  -1.184  1.00 9.76   ? 65   PHE B CG  1 
ATOM   2098 C  CD1 . PHE B 1 65  ? 65.554 70.939  -2.101  1.00 7.61   ? 65   PHE B CD1 1 
ATOM   2099 C  CD2 . PHE B 1 65  ? 63.348 71.145  -1.141  1.00 10.11  ? 65   PHE B CD2 1 
ATOM   2100 C  CE1 . PHE B 1 65  ? 65.258 71.985  -3.017  1.00 10.17  ? 65   PHE B CE1 1 
ATOM   2101 C  CE2 . PHE B 1 65  ? 63.042 72.187  -2.063  1.00 9.60   ? 65   PHE B CE2 1 
ATOM   2102 C  CZ  . PHE B 1 65  ? 64.018 72.601  -2.999  1.00 7.36   ? 65   PHE B CZ  1 
ATOM   2103 N  N   . ASN B 1 66  ? 64.064 71.058  2.243   1.00 9.21   ? 66   ASN B N   1 
ATOM   2104 C  CA  . ASN B 1 66  ? 63.314 72.196  2.791   1.00 10.08  ? 66   ASN B CA  1 
ATOM   2105 C  C   . ASN B 1 66  ? 64.222 73.218  3.511   1.00 9.28   ? 66   ASN B C   1 
ATOM   2106 O  O   . ASN B 1 66  ? 64.146 74.431  3.281   1.00 8.54   ? 66   ASN B O   1 
ATOM   2107 C  CB  . ASN B 1 66  ? 62.204 71.719  3.728   1.00 7.92   ? 66   ASN B CB  1 
ATOM   2108 C  CG  . ASN B 1 66  ? 61.067 71.046  3.011   1.00 9.82   ? 66   ASN B CG  1 
ATOM   2109 O  OD1 . ASN B 1 66  ? 60.935 71.115  1.780   1.00 8.05   ? 66   ASN B OD1 1 
ATOM   2110 N  ND2 . ASN B 1 66  ? 60.234 70.352  3.777   1.00 6.68   ? 66   ASN B ND2 1 
ATOM   2111 N  N   . ASN B 1 67  ? 65.089 72.718  4.392   1.00 10.16  ? 67   ASN B N   1 
ATOM   2112 C  CA  . ASN B 1 67  ? 66.011 73.588  5.107   1.00 9.89   ? 67   ASN B CA  1 
ATOM   2113 C  C   . ASN B 1 67  ? 67.125 74.228  4.258   1.00 9.49   ? 67   ASN B C   1 
ATOM   2114 O  O   . ASN B 1 67  ? 67.343 75.419  4.371   1.00 10.57  ? 67   ASN B O   1 
ATOM   2115 C  CB  . ASN B 1 67  ? 66.564 72.867  6.343   1.00 10.53  ? 67   ASN B CB  1 
ATOM   2116 C  CG  . ASN B 1 67  ? 65.519 72.763  7.441   1.00 10.99  ? 67   ASN B CG  1 
ATOM   2117 O  OD1 . ASN B 1 67  ? 65.233 73.741  8.118   1.00 12.53  ? 67   ASN B OD1 1 
ATOM   2118 N  ND2 . ASN B 1 67  ? 64.924 71.584  7.587   1.00 9.48   ? 67   ASN B ND2 1 
ATOM   2119 N  N   . ALA B 1 68  ? 67.837 73.433  3.452   1.00 9.29   ? 68   ALA B N   1 
ATOM   2120 C  CA  . ALA B 1 68  ? 68.900 73.890  2.540   1.00 8.45   ? 68   ALA B CA  1 
ATOM   2121 C  C   . ALA B 1 68  ? 68.404 74.931  1.546   1.00 9.39   ? 68   ALA B C   1 
ATOM   2122 O  O   . ALA B 1 68  ? 69.027 75.972  1.381   1.00 8.33   ? 68   ALA B O   1 
ATOM   2123 C  CB  . ALA B 1 68  ? 69.478 72.706  1.766   1.00 8.12   ? 68   ALA B CB  1 
ATOM   2124 N  N   . ALA B 1 69  ? 67.274 74.646  0.878   1.00 8.88   ? 69   ALA B N   1 
ATOM   2125 C  CA  . ALA B 1 69  ? 66.750 75.569  -0.112  1.00 8.61   ? 69   ALA B CA  1 
ATOM   2126 C  C   . ALA B 1 69  ? 66.286 76.878  0.538   1.00 8.77   ? 69   ALA B C   1 
ATOM   2127 O  O   . ALA B 1 69  ? 66.491 77.939  -0.043  1.00 8.62   ? 69   ALA B O   1 
ATOM   2128 C  CB  . ALA B 1 69  ? 65.631 74.937  -0.906  1.00 8.87   ? 69   ALA B CB  1 
ATOM   2129 N  N   . GLN B 1 70  ? 65.693 76.797  1.738   1.00 8.05   ? 70   GLN B N   1 
ATOM   2130 C  CA  . GLN B 1 70  ? 65.243 78.000  2.464   1.00 8.49   ? 70   GLN B CA  1 
ATOM   2131 C  C   . GLN B 1 70  ? 66.425 78.886  2.888   1.00 9.80   ? 70   GLN B C   1 
ATOM   2132 O  O   . GLN B 1 70  ? 66.280 80.093  2.919   1.00 11.65  ? 70   GLN B O   1 
ATOM   2133 C  CB  . GLN B 1 70  ? 64.397 77.658  3.695   1.00 7.61   ? 70   GLN B CB  1 
ATOM   2134 C  CG  . GLN B 1 70  ? 62.913 77.268  3.413   1.00 6.35   ? 70   GLN B CG  1 
ATOM   2135 C  CD  . GLN B 1 70  ? 62.104 78.403  2.813   1.00 8.17   ? 70   GLN B CD  1 
ATOM   2136 O  OE1 . GLN B 1 70  ? 62.213 78.664  1.635   1.00 10.88  ? 70   GLN B OE1 1 
ATOM   2137 N  NE2 . GLN B 1 70  ? 61.290 79.077  3.625   1.00 7.13   ? 70   GLN B NE2 1 
ATOM   2138 N  N   . ILE B 1 71  ? 67.568 78.280  3.228   1.00 9.00   ? 71   ILE B N   1 
ATOM   2139 C  CA  . ILE B 1 71  ? 68.795 79.033  3.530   1.00 9.27   ? 71   ILE B CA  1 
ATOM   2140 C  C   . ILE B 1 71  ? 69.203 79.834  2.296   1.00 9.14   ? 71   ILE B C   1 
ATOM   2141 O  O   . ILE B 1 71  ? 69.355 81.039  2.376   1.00 8.20   ? 71   ILE B O   1 
ATOM   2142 C  CB  . ILE B 1 71  ? 69.978 78.142  3.959   1.00 9.06   ? 71   ILE B CB  1 
ATOM   2143 C  CG1 . ILE B 1 71  ? 69.639 77.381  5.255   1.00 10.28  ? 71   ILE B CG1 1 
ATOM   2144 C  CG2 . ILE B 1 71  ? 71.218 78.991  4.225   1.00 9.38   ? 71   ILE B CG2 1 
ATOM   2145 C  CD1 . ILE B 1 71  ? 70.543 76.119  5.532   1.00 7.30   ? 71   ILE B CD1 1 
ATOM   2146 N  N   . TRP B 1 72  ? 69.321 79.151  1.163   1.00 8.76   ? 72   TRP B N   1 
ATOM   2147 C  CA  . TRP B 1 72  ? 69.723 79.790  -0.088  1.00 9.73   ? 72   TRP B CA  1 
ATOM   2148 C  C   . TRP B 1 72  ? 68.696 80.842  -0.536  1.00 10.23  ? 72   TRP B C   1 
ATOM   2149 O  O   . TRP B 1 72  ? 69.066 81.960  -0.955  1.00 9.78   ? 72   TRP B O   1 
ATOM   2150 C  CB  . TRP B 1 72  ? 69.889 78.714  -1.182  1.00 9.85   ? 72   TRP B CB  1 
ATOM   2151 C  CG  . TRP B 1 72  ? 70.558 79.274  -2.411  1.00 11.41  ? 72   TRP B CG  1 
ATOM   2152 C  CD1 . TRP B 1 72  ? 71.899 79.250  -2.711  1.00 10.99  ? 72   TRP B CD1 1 
ATOM   2153 C  CD2 . TRP B 1 72  ? 69.915 79.957  -3.491  1.00 10.50  ? 72   TRP B CD2 1 
ATOM   2154 N  NE1 . TRP B 1 72  ? 72.124 79.890  -3.921  1.00 12.82  ? 72   TRP B NE1 1 
ATOM   2155 C  CE2 . TRP B 1 72  ? 70.920 80.319  -4.421  1.00 12.96  ? 72   TRP B CE2 1 
ATOM   2156 C  CE3 . TRP B 1 72  ? 68.586 80.300  -3.762  1.00 10.12  ? 72   TRP B CE3 1 
ATOM   2157 C  CZ2 . TRP B 1 72  ? 70.629 81.025  -5.590  1.00 11.69  ? 72   TRP B CZ2 1 
ATOM   2158 C  CZ3 . TRP B 1 72  ? 68.293 80.970  -4.922  1.00 11.81  ? 72   TRP B CZ3 1 
ATOM   2159 C  CH2 . TRP B 1 72  ? 69.312 81.329  -5.828  1.00 11.75  ? 72   TRP B CH2 1 
ATOM   2160 N  N   . ASN B 1 73  ? 67.413 80.477  -0.474  1.00 9.10   ? 73   ASN B N   1 
ATOM   2161 C  CA  . ASN B 1 73  ? 66.337 81.404  -0.849  1.00 9.38   ? 73   ASN B CA  1 
ATOM   2162 C  C   . ASN B 1 73  ? 66.367 82.676  -0.021  1.00 8.90   ? 73   ASN B C   1 
ATOM   2163 O  O   . ASN B 1 73  ? 66.173 83.759  -0.562  1.00 9.01   ? 73   ASN B O   1 
ATOM   2164 C  CB  . ASN B 1 73  ? 64.942 80.783  -0.660  1.00 8.97   ? 73   ASN B CB  1 
ATOM   2165 C  CG  . ASN B 1 73  ? 64.674 79.602  -1.565  1.00 8.03   ? 73   ASN B CG  1 
ATOM   2166 O  OD1 . ASN B 1 73  ? 65.356 79.383  -2.566  1.00 8.91   ? 73   ASN B OD1 1 
ATOM   2167 N  ND2 . ASN B 1 73  ? 63.649 78.829  -1.210  1.00 8.66   ? 73   ASN B ND2 1 
ATOM   2168 N  N   . HIS B 1 74  ? 66.572 82.549  1.288   1.00 8.78   ? 74   HIS B N   1 
ATOM   2169 C  CA  . HIS B 1 74  ? 66.591 83.752  2.133   1.00 9.54   ? 74   HIS B CA  1 
ATOM   2170 C  C   . HIS B 1 74  ? 67.761 84.663  1.928   1.00 9.38   ? 74   HIS B C   1 
ATOM   2171 O  O   . HIS B 1 74  ? 67.604 85.857  1.996   1.00 9.18   ? 74   HIS B O   1 
ATOM   2172 C  CB  . HIS B 1 74  ? 66.449 83.433  3.613   1.00 9.78   ? 74   HIS B CB  1 
ATOM   2173 C  CG  . HIS B 1 74  ? 65.079 83.023  3.985   1.00 9.02   ? 74   HIS B CG  1 
ATOM   2174 N  ND1 . HIS B 1 74  ? 64.604 81.746  3.762   1.00 7.79   ? 74   HIS B ND1 1 
ATOM   2175 C  CD2 . HIS B 1 74  ? 64.058 83.727  4.527   1.00 3.55   ? 74   HIS B CD2 1 
ATOM   2176 C  CE1 . HIS B 1 74  ? 63.347 81.689  4.146   1.00 5.85   ? 74   HIS B CE1 1 
ATOM   2177 N  NE2 . HIS B 1 74  ? 63.009 82.870  4.626   1.00 4.07   ? 74   HIS B NE2 1 
ATOM   2178 N  N   . SER B 1 75  ? 68.941 84.107  1.686   1.00 10.86  ? 75   SER B N   1 
ATOM   2179 C  CA  . SER B 1 75  ? 70.102 84.933  1.325   1.00 10.33  ? 75   SER B CA  1 
ATOM   2180 C  C   . SER B 1 75  ? 69.856 85.666  0.000   1.00 10.49  ? 75   SER B C   1 
ATOM   2181 O  O   . SER B 1 75  ? 70.215 86.840  -0.173  1.00 9.90   ? 75   SER B O   1 
ATOM   2182 C  CB  . SER B 1 75  ? 71.342 84.066  1.201   1.00 9.64   ? 75   SER B CB  1 
ATOM   2183 O  OG  . SER B 1 75  ? 71.704 83.539  2.464   1.00 11.76  ? 75   SER B OG  1 
ATOM   2184 N  N   . PHE B 1 76  ? 69.253 84.968  -0.942  1.00 10.23  ? 76   PHE B N   1 
ATOM   2185 C  CA  . PHE B 1 76  ? 68.937 85.604  -2.206  1.00 10.48  ? 76   PHE B CA  1 
ATOM   2186 C  C   . PHE B 1 76  ? 67.904 86.742  -2.035  1.00 9.86   ? 76   PHE B C   1 
ATOM   2187 O  O   . PHE B 1 76  ? 67.981 87.786  -2.705  1.00 9.69   ? 76   PHE B O   1 
ATOM   2188 C  CB  . PHE B 1 76  ? 68.502 84.545  -3.232  1.00 10.19  ? 76   PHE B CB  1 
ATOM   2189 C  CG  . PHE B 1 76  ? 68.654 85.004  -4.659  1.00 11.15  ? 76   PHE B CG  1 
ATOM   2190 C  CD1 . PHE B 1 76  ? 69.898 84.974  -5.277  1.00 10.49  ? 76   PHE B CD1 1 
ATOM   2191 C  CD2 . PHE B 1 76  ? 67.557 85.464  -5.382  1.00 9.02   ? 76   PHE B CD2 1 
ATOM   2192 C  CE1 . PHE B 1 76  ? 70.050 85.394  -6.611  1.00 10.19  ? 76   PHE B CE1 1 
ATOM   2193 C  CE2 . PHE B 1 76  ? 67.720 85.893  -6.699  1.00 8.60   ? 76   PHE B CE2 1 
ATOM   2194 C  CZ  . PHE B 1 76  ? 68.973 85.865  -7.299  1.00 6.84   ? 76   PHE B CZ  1 
ATOM   2195 N  N   . TYR B 1 77  ? 66.961 86.524  -1.122  1.00 8.88   ? 77   TYR B N   1 
ATOM   2196 C  CA  . TYR B 1 77  ? 65.923 87.501  -0.754  1.00 8.53   ? 77   TYR B CA  1 
ATOM   2197 C  C   . TYR B 1 77  ? 66.529 88.737  -0.106  1.00 8.76   ? 77   TYR B C   1 
ATOM   2198 O  O   . TYR B 1 77  ? 66.237 89.852  -0.535  1.00 8.56   ? 77   TYR B O   1 
ATOM   2199 C  CB  . TYR B 1 77  ? 64.925 86.837  0.218   1.00 8.12   ? 77   TYR B CB  1 
ATOM   2200 C  CG  . TYR B 1 77  ? 63.882 87.711  0.894   1.00 6.62   ? 77   TYR B CG  1 
ATOM   2201 C  CD1 . TYR B 1 77  ? 62.917 88.399  0.149   1.00 6.36   ? 77   TYR B CD1 1 
ATOM   2202 C  CD2 . TYR B 1 77  ? 63.777 87.756  2.292   1.00 7.74   ? 77   TYR B CD2 1 
ATOM   2203 C  CE1 . TYR B 1 77  ? 61.920 89.173  0.773   1.00 4.03   ? 77   TYR B CE1 1 
ATOM   2204 C  CE2 . TYR B 1 77  ? 62.746 88.507  2.932   1.00 7.19   ? 77   TYR B CE2 1 
ATOM   2205 C  CZ  . TYR B 1 77  ? 61.835 89.228  2.144   1.00 6.98   ? 77   TYR B CZ  1 
ATOM   2206 O  OH  . TYR B 1 77  ? 60.796 89.962  2.706   1.00 7.70   ? 77   TYR B OH  1 
ATOM   2207 N  N   . TRP B 1 78  ? 67.388 88.549  0.897   1.00 8.65   ? 78   TRP B N   1 
ATOM   2208 C  CA  . TRP B 1 78  ? 68.061 89.695  1.518   1.00 8.90   ? 78   TRP B CA  1 
ATOM   2209 C  C   . TRP B 1 78  ? 68.888 90.506  0.538   1.00 9.28   ? 78   TRP B C   1 
ATOM   2210 O  O   . TRP B 1 78  ? 68.828 91.739  0.553   1.00 8.91   ? 78   TRP B O   1 
ATOM   2211 C  CB  . TRP B 1 78  ? 68.945 89.258  2.688   1.00 9.62   ? 78   TRP B CB  1 
ATOM   2212 C  CG  . TRP B 1 78  ? 68.213 88.543  3.762   1.00 8.26   ? 78   TRP B CG  1 
ATOM   2213 C  CD1 . TRP B 1 78  ? 68.560 87.327  4.315   1.00 8.34   ? 78   TRP B CD1 1 
ATOM   2214 C  CD2 . TRP B 1 78  ? 67.001 88.952  4.419   1.00 10.14  ? 78   TRP B CD2 1 
ATOM   2215 N  NE1 . TRP B 1 78  ? 67.642 86.969  5.256   1.00 7.83   ? 78   TRP B NE1 1 
ATOM   2216 C  CE2 . TRP B 1 78  ? 66.677 87.937  5.353   1.00 9.44   ? 78   TRP B CE2 1 
ATOM   2217 C  CE3 . TRP B 1 78  ? 66.153 90.080  4.317   1.00 8.09   ? 78   TRP B CE3 1 
ATOM   2218 C  CZ2 . TRP B 1 78  ? 65.541 88.009  6.177   1.00 10.01  ? 78   TRP B CZ2 1 
ATOM   2219 C  CZ3 . TRP B 1 78  ? 65.030 90.149  5.140   1.00 9.52   ? 78   TRP B CZ3 1 
ATOM   2220 C  CH2 . TRP B 1 78  ? 64.738 89.133  6.053   1.00 9.52   ? 78   TRP B CH2 1 
ATOM   2221 N  N   . ASP B 1 79  ? 69.646 89.813  -0.310  1.00 8.83   ? 79   ASP B N   1 
ATOM   2222 C  CA  . ASP B 1 79  ? 70.487 90.437  -1.325  1.00 9.11   ? 79   ASP B CA  1 
ATOM   2223 C  C   . ASP B 1 79  ? 69.676 91.120  -2.444  1.00 8.81   ? 79   ASP B C   1 
ATOM   2224 O  O   . ASP B 1 79  ? 70.181 92.038  -3.089  1.00 8.20   ? 79   ASP B O   1 
ATOM   2225 C  CB  . ASP B 1 79  ? 71.427 89.384  -1.930  1.00 10.41  ? 79   ASP B CB  1 
ATOM   2226 C  CG  . ASP B 1 79  ? 72.397 88.781  -0.890  1.00 12.04  ? 79   ASP B CG  1 
ATOM   2227 O  OD1 . ASP B 1 79  ? 72.448 89.269  0.274   1.00 13.60  ? 79   ASP B OD1 1 
ATOM   2228 O  OD2 . ASP B 1 79  ? 73.086 87.808  -1.244  1.00 15.30  ? 79   ASP B OD2 1 
ATOM   2229 N  N   . SER B 1 80  ? 68.424 90.678  -2.645  1.00 7.96   ? 80   SER B N   1 
ATOM   2230 C  CA  . SER B 1 80  ? 67.466 91.300  -3.585  1.00 9.04   ? 80   SER B CA  1 
ATOM   2231 C  C   . SER B 1 80  ? 66.881 92.637  -3.100  1.00 8.75   ? 80   SER B C   1 
ATOM   2232 O  O   . SER B 1 80  ? 66.118 93.285  -3.830  1.00 9.96   ? 80   SER B O   1 
ATOM   2233 C  CB  . SER B 1 80  ? 66.318 90.311  -3.925  1.00 8.56   ? 80   SER B CB  1 
ATOM   2234 O  OG  . SER B 1 80  ? 66.819 89.161  -4.612  1.00 9.32   ? 80   SER B OG  1 
ATOM   2235 N  N   . MET B 1 81  ? 67.237 93.043  -1.882  1.00 8.92   ? 81   MET B N   1 
ATOM   2236 C  CA  . MET B 1 81  ? 66.786 94.315  -1.302  1.00 9.08   ? 81   MET B CA  1 
ATOM   2237 C  C   . MET B 1 81  ? 67.952 95.137  -0.795  1.00 8.47   ? 81   MET B C   1 
ATOM   2238 O  O   . MET B 1 81  ? 69.069 94.640  -0.720  1.00 7.88   ? 81   MET B O   1 
ATOM   2239 C  CB  . MET B 1 81  ? 65.823 94.019  -0.146  1.00 10.14  ? 81   MET B CB  1 
ATOM   2240 C  CG  . MET B 1 81  ? 64.612 93.234  -0.602  1.00 8.29   ? 81   MET B CG  1 
ATOM   2241 S  SD  . MET B 1 81  ? 63.421 92.937  0.719   1.00 8.39   ? 81   MET B SD  1 
ATOM   2242 C  CE  . MET B 1 81  ? 64.315 91.746  1.727   1.00 2.83   ? 81   MET B CE  1 
ATOM   2243 N  N   . GLY B 1 82  ? 67.685 96.391  -0.438  1.00 9.97   ? 82   GLY B N   1 
ATOM   2244 C  CA  . GLY B 1 82  ? 68.656 97.205  0.286   1.00 9.76   ? 82   GLY B CA  1 
ATOM   2245 C  C   . GLY B 1 82  ? 68.155 98.591  0.663   1.00 11.31  ? 82   GLY B C   1 
ATOM   2246 O  O   . GLY B 1 82  ? 67.161 99.112  0.075   1.00 14.86  ? 82   GLY B O   1 
ATOM   2247 N  N   . PRO B 1 83  ? 68.862 99.254  1.582   1.00 10.95  ? 83   PRO B N   1 
ATOM   2248 C  CA  . PRO B 1 83  ? 68.599 100.673 1.771   1.00 12.04  ? 83   PRO B CA  1 
ATOM   2249 C  C   . PRO B 1 83  ? 69.053 101.361 0.463   1.00 12.97  ? 83   PRO B C   1 
ATOM   2250 O  O   . PRO B 1 83  ? 69.839 100.782 -0.296  1.00 14.73  ? 83   PRO B O   1 
ATOM   2251 C  CB  . PRO B 1 83  ? 69.552 101.055 2.919   1.00 11.83  ? 83   PRO B CB  1 
ATOM   2252 C  CG  . PRO B 1 83  ? 70.709 100.071 2.800   1.00 12.33  ? 83   PRO B CG  1 
ATOM   2253 C  CD  . PRO B 1 83  ? 69.981 98.771  2.408   1.00 11.26  ? 83   PRO B CD  1 
ATOM   2254 N  N   . ASN B 1 84  ? 68.581 102.561 0.185   1.00 13.92  ? 84   ASN B N   1 
ATOM   2255 C  CA  . ASN B 1 84  ? 69.035 103.313 -1.023  1.00 14.57  ? 84   ASN B CA  1 
ATOM   2256 C  C   . ASN B 1 84  ? 68.738 102.611 -2.356  1.00 14.48  ? 84   ASN B C   1 
ATOM   2257 O  O   . ASN B 1 84  ? 69.407 102.859 -3.368  1.00 15.28  ? 84   ASN B O   1 
ATOM   2258 C  CB  . ASN B 1 84  ? 70.536 103.642 -0.905  1.00 15.08  ? 84   ASN B CB  1 
ATOM   2259 C  CG  . ASN B 1 84  ? 70.911 104.084 0.499   1.00 15.27  ? 84   ASN B CG  1 
ATOM   2260 O  OD1 . ASN B 1 84  ? 70.326 105.046 1.004   1.00 17.20  ? 84   ASN B OD1 1 
ATOM   2261 N  ND2 . ASN B 1 84  ? 71.824 103.357 1.157   1.00 12.74  ? 84   ASN B ND2 1 
ATOM   2262 N  N   . CYS B 1 85  ? 67.742 101.733 -2.356  1.00 14.00  ? 85   CYS B N   1 
ATOM   2263 C  CA  . CYS B 1 85  ? 67.404 100.935 -3.555  1.00 14.19  ? 85   CYS B CA  1 
ATOM   2264 C  C   . CYS B 1 85  ? 65.994 101.272 -3.999  1.00 13.44  ? 85   CYS B C   1 
ATOM   2265 O  O   . CYS B 1 85  ? 65.532 102.382 -3.752  1.00 13.97  ? 85   CYS B O   1 
ATOM   2266 C  CB  . CYS B 1 85  ? 67.564 99.420  -3.302  1.00 13.03  ? 85   CYS B CB  1 
ATOM   2267 S  SG  . CYS B 1 85  ? 69.280 98.949  -3.019  1.00 14.54  ? 85   CYS B SG  1 
ATOM   2268 N  N   . GLY B 1 86  ? 65.323 100.343 -4.680  1.00 12.94  ? 86   GLY B N   1 
ATOM   2269 C  CA  . GLY B 1 86  ? 63.920 100.561 -5.082  1.00 12.18  ? 86   GLY B CA  1 
ATOM   2270 C  C   . GLY B 1 86  ? 63.681 101.482 -6.281  1.00 11.54  ? 86   GLY B C   1 
ATOM   2271 O  O   . GLY B 1 86  ? 64.585 101.780 -7.053  1.00 11.57  ? 86   GLY B O   1 
ATOM   2272 N  N   . GLY B 1 87  ? 62.433 101.906 -6.442  1.00 12.03  ? 87   GLY B N   1 
ATOM   2273 C  CA  . GLY B 1 87  ? 62.001 102.766 -7.546  1.00 10.79  ? 87   GLY B CA  1 
ATOM   2274 C  C   . GLY B 1 87  ? 62.344 102.209 -8.914  1.00 11.27  ? 87   GLY B C   1 
ATOM   2275 O  O   . GLY B 1 87  ? 62.340 100.982 -9.120  1.00 10.21  ? 87   GLY B O   1 
ATOM   2276 N  N   . GLU B 1 88  ? 62.624 103.114 -9.847  1.00 10.68  ? 88   GLU B N   1 
ATOM   2277 C  CA  . GLU B 1 88  ? 62.913 102.758 -11.238 1.00 12.28  ? 88   GLU B CA  1 
ATOM   2278 C  C   . GLU B 1 88  ? 64.176 101.914 -11.373 1.00 11.89  ? 88   GLU B C   1 
ATOM   2279 O  O   . GLU B 1 88  ? 65.200 102.175 -10.687 1.00 11.72  ? 88   GLU B O   1 
ATOM   2280 C  CB  . GLU B 1 88  ? 63.005 104.028 -12.117 1.00 12.58  ? 88   GLU B CB  1 
ATOM   2281 C  CG  . GLU B 1 88  ? 61.703 104.851 -12.184 1.00 12.05  ? 88   GLU B CG  1 
ATOM   2282 C  CD  . GLU B 1 88  ? 60.554 104.114 -12.851 1.00 16.95  ? 88   GLU B CD  1 
ATOM   2283 O  OE1 . GLU B 1 88  ? 60.770 103.533 -13.941 1.00 16.53  ? 88   GLU B OE1 1 
ATOM   2284 O  OE2 . GLU B 1 88  ? 59.435 104.120 -12.279 1.00 19.11  ? 88   GLU B OE2 1 
ATOM   2285 N  N   . PRO B 1 89  ? 64.127 100.885 -12.249 1.00 11.77  ? 89   PRO B N   1 
ATOM   2286 C  CA  . PRO B 1 89  ? 65.319 100.102 -12.518 1.00 11.16  ? 89   PRO B CA  1 
ATOM   2287 C  C   . PRO B 1 89  ? 66.355 100.980 -13.199 1.00 11.74  ? 89   PRO B C   1 
ATOM   2288 O  O   . PRO B 1 89  ? 65.989 101.995 -13.758 1.00 11.12  ? 89   PRO B O   1 
ATOM   2289 C  CB  . PRO B 1 89  ? 64.811 99.045  -13.504 1.00 11.54  ? 89   PRO B CB  1 
ATOM   2290 C  CG  . PRO B 1 89  ? 63.686 99.691  -14.195 1.00 11.86  ? 89   PRO B CG  1 
ATOM   2291 C  CD  . PRO B 1 89  ? 62.986 100.408 -13.056 1.00 11.66  ? 89   PRO B CD  1 
ATOM   2292 N  N   . HIS B 1 90  ? 67.631 100.601 -13.130 1.00 12.15  ? 90   HIS B N   1 
ATOM   2293 C  CA  . HIS B 1 90  ? 68.697 101.327 -13.812 1.00 12.83  ? 90   HIS B CA  1 
ATOM   2294 C  C   . HIS B 1 90  ? 69.771 100.338 -14.283 1.00 13.53  ? 90   HIS B C   1 
ATOM   2295 O  O   . HIS B 1 90  ? 69.903 99.244  -13.724 1.00 13.83  ? 90   HIS B O   1 
ATOM   2296 C  CB  . HIS B 1 90  ? 69.313 102.377 -12.872 1.00 13.36  ? 90   HIS B CB  1 
ATOM   2297 C  CG  . HIS B 1 90  ? 69.732 101.822 -11.539 1.00 12.10  ? 90   HIS B CG  1 
ATOM   2298 N  ND1 . HIS B 1 90  ? 70.919 101.150 -11.350 1.00 12.70  ? 90   HIS B ND1 1 
ATOM   2299 C  CD2 . HIS B 1 90  ? 69.093 101.795 -10.351 1.00 12.59  ? 90   HIS B CD2 1 
ATOM   2300 C  CE1 . HIS B 1 90  ? 71.017 100.774 -10.091 1.00 12.05  ? 90   HIS B CE1 1 
ATOM   2301 N  NE2 . HIS B 1 90  ? 69.919 101.144 -9.463  1.00 15.36  ? 90   HIS B NE2 1 
ATOM   2302 N  N   . GLY B 1 91  ? 70.537 100.744 -15.296 1.00 13.61  ? 91   GLY B N   1 
ATOM   2303 C  CA  . GLY B 1 91  ? 71.598 99.927  -15.861 1.00 13.28  ? 91   GLY B CA  1 
ATOM   2304 C  C   . GLY B 1 91  ? 70.982 98.824  -16.701 1.00 13.37  ? 91   GLY B C   1 
ATOM   2305 O  O   . GLY B 1 91  ? 69.864 98.972  -17.214 1.00 13.36  ? 91   GLY B O   1 
ATOM   2306 N  N   . GLU B 1 92  ? 71.698 97.715  -16.824 1.00 13.16  ? 92   GLU B N   1 
ATOM   2307 C  CA  . GLU B 1 92  ? 71.341 96.680  -17.784 1.00 13.91  ? 92   GLU B CA  1 
ATOM   2308 C  C   . GLU B 1 92  ? 69.939 96.096  -17.550 1.00 12.51  ? 92   GLU B C   1 
ATOM   2309 O  O   . GLU B 1 92  ? 69.216 95.806  -18.513 1.00 11.34  ? 92   GLU B O   1 
ATOM   2310 C  CB  . GLU B 1 92  ? 72.412 95.578  -17.835 1.00 14.68  ? 92   GLU B CB  1 
ATOM   2311 C  CG  . GLU B 1 92  ? 73.768 96.053  -18.335 1.00 20.64  ? 92   GLU B CG  1 
ATOM   2312 C  CD  . GLU B 1 92  ? 73.736 96.513  -19.809 1.00 25.92  ? 92   GLU B CD  1 
ATOM   2313 O  OE1 . GLU B 1 92  ? 73.625 95.654  -20.711 1.00 29.70  ? 92   GLU B OE1 1 
ATOM   2314 O  OE2 . GLU B 1 92  ? 73.832 97.728  -20.069 1.00 28.45  ? 92   GLU B OE2 1 
ATOM   2315 N  N   . ILE B 1 93  ? 69.556 95.947  -16.280 1.00 11.85  ? 93   ILE B N   1 
ATOM   2316 C  CA  . ILE B 1 93  ? 68.263 95.320  -15.916 1.00 11.65  ? 93   ILE B CA  1 
ATOM   2317 C  C   . ILE B 1 93  ? 67.093 96.157  -16.430 1.00 12.43  ? 93   ILE B C   1 
ATOM   2318 O  O   . ILE B 1 93  ? 66.049 95.602  -16.811 1.00 11.96  ? 93   ILE B O   1 
ATOM   2319 C  CB  . ILE B 1 93  ? 68.112 95.084  -14.369 1.00 11.90  ? 93   ILE B CB  1 
ATOM   2320 C  CG1 . ILE B 1 93  ? 66.912 94.166  -14.046 1.00 11.53  ? 93   ILE B CG1 1 
ATOM   2321 C  CG2 . ILE B 1 93  ? 68.004 96.434  -13.606 1.00 8.41   ? 93   ILE B CG2 1 
ATOM   2322 C  CD1 . ILE B 1 93  ? 66.977 92.749  -14.699 1.00 9.02   ? 93   ILE B CD1 1 
ATOM   2323 N  N   . LYS B 1 94  ? 67.271 97.489  -16.454 1.00 11.66  ? 94   LYS B N   1 
ATOM   2324 C  CA  . LYS B 1 94  ? 66.221 98.376  -16.966 1.00 11.89  ? 94   LYS B CA  1 
ATOM   2325 C  C   . LYS B 1 94  ? 65.934 98.082  -18.438 1.00 11.91  ? 94   LYS B C   1 
ATOM   2326 O  O   . LYS B 1 94  ? 64.774 97.872  -18.856 1.00 10.75  ? 94   LYS B O   1 
ATOM   2327 C  CB  . LYS B 1 94  ? 66.617 99.869  -16.801 1.00 11.19  ? 94   LYS B CB  1 
ATOM   2328 C  CG  . LYS B 1 94  ? 65.636 100.780 -17.538 1.00 12.12  ? 94   LYS B CG  1 
ATOM   2329 C  CD  . LYS B 1 94  ? 65.924 102.260 -17.311 1.00 11.87  ? 94   LYS B CD  1 
ATOM   2330 C  CE  . LYS B 1 94  ? 64.962 103.105 -18.146 1.00 13.82  ? 94   LYS B CE  1 
ATOM   2331 N  NZ  . LYS B 1 94  ? 65.401 104.516 -18.120 1.00 14.35  ? 94   LYS B NZ  1 
ATOM   2332 N  N   . GLU B 1 95  ? 67.009 98.047  -19.221 1.00 12.93  ? 95   GLU B N   1 
ATOM   2333 C  CA  . GLU B 1 95  ? 66.912 97.761  -20.643 1.00 14.56  ? 95   GLU B CA  1 
ATOM   2334 C  C   . GLU B 1 95  ? 66.289 96.401  -20.883 1.00 13.41  ? 95   GLU B C   1 
ATOM   2335 O  O   . GLU B 1 95  ? 65.416 96.260  -21.735 1.00 13.17  ? 95   GLU B O   1 
ATOM   2336 C  CB  . GLU B 1 95  ? 68.294 97.832  -21.313 1.00 15.26  ? 95   GLU B CB  1 
ATOM   2337 C  CG  . GLU B 1 95  ? 68.979 99.227  -21.223 1.00 22.70  ? 95   GLU B CG  1 
ATOM   2338 C  CD  . GLU B 1 95  ? 68.015 100.410 -21.489 1.00 28.37  ? 95   GLU B CD  1 
ATOM   2339 O  OE1 . GLU B 1 95  ? 67.524 100.524 -22.643 1.00 30.52  ? 95   GLU B OE1 1 
ATOM   2340 O  OE2 . GLU B 1 95  ? 67.761 101.221 -20.542 1.00 29.22  ? 95   GLU B OE2 1 
ATOM   2341 N  N   . LYS B 1 96  ? 66.752 95.400  -20.126 1.00 13.42  ? 96   LYS B N   1 
ATOM   2342 C  CA  . LYS B 1 96  ? 66.300 94.017  -20.307 1.00 12.21  ? 96   LYS B CA  1 
ATOM   2343 C  C   . LYS B 1 96  ? 64.804 93.875  -19.942 1.00 12.02  ? 96   LYS B C   1 
ATOM   2344 O  O   . LYS B 1 96  ? 64.042 93.207  -20.639 1.00 11.26  ? 96   LYS B O   1 
ATOM   2345 C  CB  . LYS B 1 96  ? 67.186 93.056  -19.494 1.00 12.29  ? 96   LYS B CB  1 
ATOM   2346 C  CG  . LYS B 1 96  ? 67.133 91.589  -19.925 1.00 10.95  ? 96   LYS B CG  1 
ATOM   2347 C  CD  . LYS B 1 96  ? 67.966 91.317  -21.149 1.00 15.87  ? 96   LYS B CD  1 
ATOM   2348 C  CE  . LYS B 1 96  ? 67.884 89.855  -21.592 1.00 14.66  ? 96   LYS B CE  1 
ATOM   2349 N  NZ  . LYS B 1 96  ? 66.615 89.608  -22.329 1.00 18.61  ? 96   LYS B NZ  1 
ATOM   2350 N  N   . ILE B 1 97  ? 64.384 94.521  -18.860 1.00 12.19  ? 97   ILE B N   1 
ATOM   2351 C  CA  . ILE B 1 97  ? 62.961 94.564  -18.488 1.00 11.78  ? 97   ILE B CA  1 
ATOM   2352 C  C   . ILE B 1 97  ? 62.162 95.223  -19.633 1.00 12.58  ? 97   ILE B C   1 
ATOM   2353 O  O   . ILE B 1 97  ? 61.100 94.734  -20.020 1.00 10.54  ? 97   ILE B O   1 
ATOM   2354 C  CB  . ILE B 1 97  ? 62.733 95.266  -17.101 1.00 12.35  ? 97   ILE B CB  1 
ATOM   2355 C  CG1 . ILE B 1 97  ? 63.146 94.311  -15.953 1.00 12.11  ? 97   ILE B CG1 1 
ATOM   2356 C  CG2 . ILE B 1 97  ? 61.294 95.698  -16.943 1.00 11.24  ? 97   ILE B CG2 1 
ATOM   2357 C  CD1 . ILE B 1 97  ? 63.266 94.942  -14.565 1.00 11.88  ? 97   ILE B CD1 1 
ATOM   2358 N  N   . GLN B 1 98  ? 62.695 96.303  -20.217 1.00 12.95  ? 98   GLN B N   1 
ATOM   2359 C  CA  . GLN B 1 98  ? 61.985 96.923  -21.338 1.00 14.03  ? 98   GLN B CA  1 
ATOM   2360 C  C   . GLN B 1 98  ? 61.845 95.966  -22.501 1.00 14.25  ? 98   GLN B C   1 
ATOM   2361 O  O   . GLN B 1 98  ? 60.785 95.909  -23.128 1.00 14.77  ? 98   GLN B O   1 
ATOM   2362 C  CB  . GLN B 1 98  ? 62.635 98.244  -21.757 1.00 14.34  ? 98   GLN B CB  1 
ATOM   2363 C  CG  . GLN B 1 98  ? 62.289 99.367  -20.791 1.00 15.30  ? 98   GLN B CG  1 
ATOM   2364 C  CD  . GLN B 1 98  ? 63.086 100.667 -21.007 1.00 16.26  ? 98   GLN B CD  1 
ATOM   2365 O  OE1 . GLN B 1 98  ? 63.910 100.782 -21.924 1.00 19.32  ? 98   GLN B OE1 1 
ATOM   2366 N  NE2 . GLN B 1 98  ? 62.810 101.653 -20.168 1.00 15.71  ? 98   GLN B NE2 1 
ATOM   2367 N  N   . GLU B 1 99  ? 62.895 95.189  -22.775 1.00 14.63  ? 99   GLU B N   1 
ATOM   2368 C  CA  . GLU B 1 99  ? 62.867 94.263  -23.892 1.00 16.59  ? 99   GLU B CA  1 
ATOM   2369 C  C   . GLU B 1 99  ? 61.839 93.159  -23.642 1.00 15.41  ? 99   GLU B C   1 
ATOM   2370 O  O   . GLU B 1 99  ? 61.025 92.855  -24.500 1.00 14.69  ? 99   GLU B O   1 
ATOM   2371 C  CB  . GLU B 1 99  ? 64.244 93.642  -24.117 1.00 17.03  ? 99   GLU B CB  1 
ATOM   2372 C  CG  . GLU B 1 99  ? 64.332 92.878  -25.415 1.00 20.50  ? 99   GLU B CG  1 
ATOM   2373 C  CD  . GLU B 1 99  ? 65.563 91.983  -25.549 1.00 20.69  ? 99   GLU B CD  1 
ATOM   2374 O  OE1 . GLU B 1 99  ? 66.486 92.021  -24.683 1.00 25.58  ? 99   GLU B OE1 1 
ATOM   2375 O  OE2 . GLU B 1 99  ? 65.581 91.204  -26.547 1.00 28.58  ? 99   GLU B OE2 1 
ATOM   2376 N  N   . ASP B 1 100 ? 61.869 92.592  -22.444 1.00 13.67  ? 100  ASP B N   1 
ATOM   2377 C  CA  . ASP B 1 100 ? 61.139 91.343  -22.195 1.00 12.88  ? 100  ASP B CA  1 
ATOM   2378 C  C   . ASP B 1 100 ? 59.755 91.549  -21.655 1.00 11.86  ? 100  ASP B C   1 
ATOM   2379 O  O   . ASP B 1 100 ? 58.930 90.675  -21.791 1.00 11.63  ? 100  ASP B O   1 
ATOM   2380 C  CB  . ASP B 1 100 ? 61.955 90.428  -21.274 1.00 12.23  ? 100  ASP B CB  1 
ATOM   2381 C  CG  . ASP B 1 100 ? 63.214 89.954  -21.946 1.00 14.00  ? 100  ASP B CG  1 
ATOM   2382 O  OD1 . ASP B 1 100 ? 63.241 90.021  -23.203 1.00 12.70  ? 100  ASP B OD1 1 
ATOM   2383 O  OD2 . ASP B 1 100 ? 64.167 89.559  -21.249 1.00 12.75  ? 100  ASP B OD2 1 
ATOM   2384 N  N   . PHE B 1 101 ? 59.527 92.691  -21.017 1.00 11.27  ? 101  PHE B N   1 
ATOM   2385 C  CA  . PHE B 1 101 ? 58.200 93.010  -20.466 1.00 11.49  ? 101  PHE B CA  1 
ATOM   2386 C  C   . PHE B 1 101 ? 57.518 94.190  -21.116 1.00 11.46  ? 101  PHE B C   1 
ATOM   2387 O  O   . PHE B 1 101 ? 56.351 94.452  -20.832 1.00 12.04  ? 101  PHE B O   1 
ATOM   2388 C  CB  . PHE B 1 101 ? 58.253 93.169  -18.949 1.00 10.84  ? 101  PHE B CB  1 
ATOM   2389 C  CG  . PHE B 1 101 ? 58.723 91.929  -18.245 1.00 11.11  ? 101  PHE B CG  1 
ATOM   2390 C  CD1 . PHE B 1 101 ? 57.854 90.868  -18.019 1.00 12.33  ? 101  PHE B CD1 1 
ATOM   2391 C  CD2 . PHE B 1 101 ? 60.059 91.814  -17.827 1.00 11.43  ? 101  PHE B CD2 1 
ATOM   2392 C  CE1 . PHE B 1 101 ? 58.297 89.717  -17.394 1.00 12.85  ? 101  PHE B CE1 1 
ATOM   2393 C  CE2 . PHE B 1 101 ? 60.510 90.669  -17.166 1.00 11.21  ? 101  PHE B CE2 1 
ATOM   2394 C  CZ  . PHE B 1 101 ? 59.623 89.611  -16.960 1.00 13.06  ? 101  PHE B CZ  1 
ATOM   2395 N  N   . GLY B 1 102 ? 58.235 94.885  -22.002 1.00 11.49  ? 102  GLY B N   1 
ATOM   2396 C  CA  . GLY B 1 102 ? 57.695 96.086  -22.684 1.00 11.72  ? 102  GLY B CA  1 
ATOM   2397 C  C   . GLY B 1 102 ? 58.010 97.362  -21.901 1.00 12.82  ? 102  GLY B C   1 
ATOM   2398 O  O   . GLY B 1 102 ? 58.467 98.351  -22.455 1.00 12.69  ? 102  GLY B O   1 
ATOM   2399 N  N   . SER B 1 103 ? 57.734 97.348  -20.598 1.00 12.75  ? 103  SER B N   1 
ATOM   2400 C  CA  . SER B 1 103 ? 58.102 98.460  -19.727 1.00 13.06  ? 103  SER B CA  1 
ATOM   2401 C  C   . SER B 1 103 ? 58.253 97.947  -18.306 1.00 12.28  ? 103  SER B C   1 
ATOM   2402 O  O   . SER B 1 103 ? 57.792 96.837  -17.983 1.00 11.87  ? 103  SER B O   1 
ATOM   2403 C  CB  . SER B 1 103 ? 57.036 99.559  -19.746 1.00 12.77  ? 103  SER B CB  1 
ATOM   2404 O  OG  . SER B 1 103 ? 55.802 99.038  -19.260 1.00 12.21  ? 103  SER B OG  1 
ATOM   2405 N  N   . PHE B 1 104 ? 58.836 98.786  -17.452 1.00 12.48  ? 104  PHE B N   1 
ATOM   2406 C  CA  . PHE B 1 104 ? 58.890 98.512  -16.015 1.00 12.21  ? 104  PHE B CA  1 
ATOM   2407 C  C   . PHE B 1 104 ? 57.488 98.421  -15.407 1.00 13.03  ? 104  PHE B C   1 
ATOM   2408 O  O   . PHE B 1 104 ? 57.231 97.540  -14.579 1.00 13.61  ? 104  PHE B O   1 
ATOM   2409 C  CB  . PHE B 1 104 ? 59.750 99.548  -15.267 1.00 11.69  ? 104  PHE B CB  1 
ATOM   2410 C  CG  . PHE B 1 104 ? 59.708 99.401  -13.745 1.00 9.10   ? 104  PHE B CG  1 
ATOM   2411 C  CD1 . PHE B 1 104 ? 60.125 98.211  -13.128 1.00 8.73   ? 104  PHE B CD1 1 
ATOM   2412 C  CD2 . PHE B 1 104 ? 59.263 100.451 -12.944 1.00 9.07   ? 104  PHE B CD2 1 
ATOM   2413 C  CE1 . PHE B 1 104 ? 60.057 98.070  -11.741 1.00 10.92  ? 104  PHE B CE1 1 
ATOM   2414 C  CE2 . PHE B 1 104 ? 59.210 100.322 -11.536 1.00 8.01   ? 104  PHE B CE2 1 
ATOM   2415 C  CZ  . PHE B 1 104 ? 59.608 99.133  -10.948 1.00 10.34  ? 104  PHE B CZ  1 
ATOM   2416 N  N   . ASN B 1 105 ? 56.593 99.325  -15.812 1.00 13.24  ? 105  ASN B N   1 
ATOM   2417 C  CA  . ASN B 1 105 ? 55.234 99.336  -15.311 1.00 13.80  ? 105  ASN B CA  1 
ATOM   2418 C  C   . ASN B 1 105 ? 54.563 97.993  -15.567 1.00 13.10  ? 105  ASN B C   1 
ATOM   2419 O  O   . ASN B 1 105 ? 53.876 97.468  -14.679 1.00 12.16  ? 105  ASN B O   1 
ATOM   2420 C  CB  . ASN B 1 105 ? 54.416 100.471 -15.940 1.00 15.43  ? 105  ASN B CB  1 
ATOM   2421 C  CG  . ASN B 1 105 ? 52.975 100.517 -15.425 1.00 20.09  ? 105  ASN B CG  1 
ATOM   2422 O  OD1 . ASN B 1 105 ? 52.015 100.317 -16.187 1.00 27.19  ? 105  ASN B OD1 1 
ATOM   2423 N  ND2 . ASN B 1 105 ? 52.819 100.748 -14.127 1.00 22.99  ? 105  ASN B ND2 1 
ATOM   2424 N  N   . ASN B 1 106 ? 54.761 97.468  -16.783 1.00 11.59  ? 106  ASN B N   1 
ATOM   2425 C  CA  . ASN B 1 106 ? 54.256 96.162  -17.156 1.00 11.83  ? 106  ASN B CA  1 
ATOM   2426 C  C   . ASN B 1 106 ? 54.820 95.055  -16.258 1.00 11.20  ? 106  ASN B C   1 
ATOM   2427 O  O   . ASN B 1 106 ? 54.039 94.290  -15.685 1.00 11.91  ? 106  ASN B O   1 
ATOM   2428 C  CB  . ASN B 1 106 ? 54.508 95.856  -18.636 1.00 11.54  ? 106  ASN B CB  1 
ATOM   2429 C  CG  . ASN B 1 106 ? 53.500 96.528  -19.557 1.00 12.87  ? 106  ASN B CG  1 
ATOM   2430 O  OD1 . ASN B 1 106 ? 52.577 97.222  -19.106 1.00 14.50  ? 106  ASN B OD1 1 
ATOM   2431 N  ND2 . ASN B 1 106 ? 53.661 96.308  -20.867 1.00 12.58  ? 106  ASN B ND2 1 
ATOM   2432 N  N   . PHE B 1 107 ? 56.151 94.988  -16.133 1.00 10.89  ? 107  PHE B N   1 
ATOM   2433 C  CA  . PHE B 1 107 ? 56.816 94.073  -15.209 1.00 11.10  ? 107  PHE B CA  1 
ATOM   2434 C  C   . PHE B 1 107 ? 56.316 94.139  -13.756 1.00 11.83  ? 107  PHE B C   1 
ATOM   2435 O  O   . PHE B 1 107 ? 55.902 93.110  -13.162 1.00 11.11  ? 107  PHE B O   1 
ATOM   2436 C  CB  . PHE B 1 107 ? 58.343 94.248  -15.234 1.00 11.39  ? 107  PHE B CB  1 
ATOM   2437 C  CG  . PHE B 1 107 ? 59.046 93.469  -14.148 1.00 11.61  ? 107  PHE B CG  1 
ATOM   2438 C  CD1 . PHE B 1 107 ? 59.024 92.067  -14.153 1.00 11.60  ? 107  PHE B CD1 1 
ATOM   2439 C  CD2 . PHE B 1 107 ? 59.679 94.133  -13.096 1.00 10.13  ? 107  PHE B CD2 1 
ATOM   2440 C  CE1 . PHE B 1 107 ? 59.644 91.349  -13.144 1.00 13.18  ? 107  PHE B CE1 1 
ATOM   2441 C  CE2 . PHE B 1 107 ? 60.307 93.408  -12.082 1.00 11.91  ? 107  PHE B CE2 1 
ATOM   2442 C  CZ  . PHE B 1 107 ? 60.282 92.035  -12.096 1.00 11.76  ? 107  PHE B CZ  1 
ATOM   2443 N  N   . LYS B 1 108 ? 56.381 95.350  -13.198 1.00 11.73  ? 108  LYS B N   1 
ATOM   2444 C  CA  . LYS B 1 108 ? 55.941 95.645  -11.850 1.00 12.60  ? 108  LYS B CA  1 
ATOM   2445 C  C   . LYS B 1 108 ? 54.510 95.152  -11.558 1.00 12.77  ? 108  LYS B C   1 
ATOM   2446 O  O   . LYS B 1 108 ? 54.263 94.466  -10.527 1.00 12.96  ? 108  LYS B O   1 
ATOM   2447 C  CB  . LYS B 1 108 ? 56.053 97.156  -11.594 1.00 12.71  ? 108  LYS B CB  1 
ATOM   2448 C  CG  . LYS B 1 108 ? 55.550 97.571  -10.239 1.00 13.51  ? 108  LYS B CG  1 
ATOM   2449 C  CD  . LYS B 1 108 ? 55.665 99.058  -10.003 1.00 13.70  ? 108  LYS B CD  1 
ATOM   2450 C  CE  . LYS B 1 108 ? 55.328 99.366  -8.556  1.00 17.02  ? 108  LYS B CE  1 
ATOM   2451 N  NZ  . LYS B 1 108 ? 55.570 100.816 -8.243  1.00 19.79  ? 108  LYS B NZ  1 
ATOM   2452 N  N   . ASN B 1 109 ? 53.567 95.507  -12.430 1.00 12.76  ? 109  ASN B N   1 
ATOM   2453 C  CA  . ASN B 1 109 ? 52.162 95.051  -12.259 1.00 13.37  ? 109  ASN B CA  1 
ATOM   2454 C  C   . ASN B 1 109 ? 52.026 93.513  -12.318 1.00 13.06  ? 109  ASN B C   1 
ATOM   2455 O  O   . ASN B 1 109 ? 51.356 92.917  -11.481 1.00 13.11  ? 109  ASN B O   1 
ATOM   2456 C  CB  . ASN B 1 109 ? 51.211 95.700  -13.271 1.00 14.39  ? 109  ASN B CB  1 
ATOM   2457 C  CG  . ASN B 1 109 ? 51.051 97.187  -13.065 1.00 17.46  ? 109  ASN B CG  1 
ATOM   2458 O  OD1 . ASN B 1 109 ? 51.358 97.726  -12.002 1.00 24.47  ? 109  ASN B OD1 1 
ATOM   2459 N  ND2 . ASN B 1 109 ? 50.577 97.871  -14.096 1.00 25.78  ? 109  ASN B ND2 1 
ATOM   2460 N  N   . GLU B 1 110 ? 52.670 92.883  -13.290 1.00 12.88  ? 110  GLU B N   1 
ATOM   2461 C  CA  . GLU B 1 110 ? 52.571 91.431  -13.401 1.00 13.52  ? 110  GLU B CA  1 
ATOM   2462 C  C   . GLU B 1 110 ? 53.285 90.758  -12.235 1.00 12.72  ? 110  GLU B C   1 
ATOM   2463 O  O   . GLU B 1 110 ? 52.723 89.846  -11.649 1.00 13.40  ? 110  GLU B O   1 
ATOM   2464 C  CB  . GLU B 1 110 ? 53.044 90.901  -14.766 1.00 14.23  ? 110  GLU B CB  1 
ATOM   2465 C  CG  . GLU B 1 110 ? 52.992 89.330  -14.968 1.00 15.13  ? 110  GLU B CG  1 
ATOM   2466 C  CD  . GLU B 1 110 ? 51.617 88.650  -14.796 1.00 22.93  ? 110  GLU B CD  1 
ATOM   2467 O  OE1 . GLU B 1 110 ? 50.586 89.356  -14.642 1.00 22.73  ? 110  GLU B OE1 1 
ATOM   2468 O  OE2 . GLU B 1 110 ? 51.570 87.372  -14.821 1.00 23.41  ? 110  GLU B OE2 1 
ATOM   2469 N  N   . PHE B 1 111 ? 54.494 91.210  -11.881 1.00 11.59  ? 111  PHE B N   1 
ATOM   2470 C  CA  . PHE B 1 111 ? 55.179 90.621  -10.736 1.00 11.04  ? 111  PHE B CA  1 
ATOM   2471 C  C   . PHE B 1 111 ? 54.340 90.756  -9.478  1.00 10.60  ? 111  PHE B C   1 
ATOM   2472 O  O   . PHE B 1 111 ? 54.208 89.795  -8.719  1.00 9.72   ? 111  PHE B O   1 
ATOM   2473 C  CB  . PHE B 1 111 ? 56.569 91.215  -10.508 1.00 10.67  ? 111  PHE B CB  1 
ATOM   2474 C  CG  . PHE B 1 111 ? 57.475 90.318  -9.721  1.00 13.04  ? 111  PHE B CG  1 
ATOM   2475 C  CD1 . PHE B 1 111 ? 57.569 88.948  -10.033 1.00 10.88  ? 111  PHE B CD1 1 
ATOM   2476 C  CD2 . PHE B 1 111 ? 58.239 90.816  -8.672  1.00 12.57  ? 111  PHE B CD2 1 
ATOM   2477 C  CE1 . PHE B 1 111 ? 58.413 88.099  -9.301  1.00 11.58  ? 111  PHE B CE1 1 
ATOM   2478 C  CE2 . PHE B 1 111 ? 59.102 89.969  -7.941  1.00 12.63  ? 111  PHE B CE2 1 
ATOM   2479 C  CZ  . PHE B 1 111 ? 59.196 88.625  -8.257  1.00 11.78  ? 111  PHE B CZ  1 
ATOM   2480 N  N   . SER B 1 112 ? 53.760 91.936  -9.270  1.00 9.84   ? 112  SER B N   1 
ATOM   2481 C  CA  . SER B 1 112 ? 52.871 92.156  -8.140  1.00 11.01  ? 112  SER B CA  1 
ATOM   2482 C  C   . SER B 1 112 ? 51.695 91.213  -8.132  1.00 10.90  ? 112  SER B C   1 
ATOM   2483 O  O   . SER B 1 112 ? 51.337 90.709  -7.070  1.00 10.38  ? 112  SER B O   1 
ATOM   2484 C  CB  . SER B 1 112 ? 52.323 93.611  -8.084  1.00 10.36  ? 112  SER B CB  1 
ATOM   2485 O  OG  . SER B 1 112 ? 53.359 94.530  -7.848  1.00 13.61  ? 112  SER B OG  1 
ATOM   2486 N  N   . ASN B 1 113 ? 51.068 91.002  -9.295  1.00 11.29  ? 113  ASN B N   1 
ATOM   2487 C  CA  . ASN B 1 113 ? 49.928 90.064  -9.377  1.00 11.90  ? 113  ASN B CA  1 
ATOM   2488 C  C   . ASN B 1 113 ? 50.331 88.673  -8.931  1.00 11.68  ? 113  ASN B C   1 
ATOM   2489 O  O   . ASN B 1 113 ? 49.632 88.047  -8.153  1.00 11.30  ? 113  ASN B O   1 
ATOM   2490 C  CB  . ASN B 1 113 ? 49.338 90.001  -10.804 1.00 13.05  ? 113  ASN B CB  1 
ATOM   2491 C  CG  . ASN B 1 113 ? 48.473 91.223  -11.140 1.00 14.98  ? 113  ASN B CG  1 
ATOM   2492 O  OD1 . ASN B 1 113 ? 48.266 92.094  -10.297 1.00 15.43  ? 113  ASN B OD1 1 
ATOM   2493 N  ND2 . ASN B 1 113 ? 47.978 91.291  -12.386 1.00 17.83  ? 113  ASN B ND2 1 
ATOM   2494 N  N   . VAL B 1 114 ? 51.457 88.204  -9.453  1.00 11.72  ? 114  VAL B N   1 
ATOM   2495 C  CA  . VAL B 1 114 ? 51.969 86.889  -9.125  1.00 11.62  ? 114  VAL B CA  1 
ATOM   2496 C  C   . VAL B 1 114 ? 52.245 86.759  -7.606  1.00 10.90  ? 114  VAL B C   1 
ATOM   2497 O  O   . VAL B 1 114 ? 51.782 85.801  -6.974  1.00 10.71  ? 114  VAL B O   1 
ATOM   2498 C  CB  . VAL B 1 114 ? 53.226 86.508  -10.004 1.00 11.64  ? 114  VAL B CB  1 
ATOM   2499 C  CG1 . VAL B 1 114 ? 53.955 85.265  -9.420  1.00 11.97  ? 114  VAL B CG1 1 
ATOM   2500 C  CG2 . VAL B 1 114 ? 52.817 86.245  -11.483 1.00 11.14  ? 114  VAL B CG2 1 
ATOM   2501 N  N   . LEU B 1 115 ? 52.969 87.722  -7.027  1.00 10.16  ? 115  LEU B N   1 
ATOM   2502 C  CA  . LEU B 1 115 ? 53.276 87.707  -5.601  1.00 9.66   ? 115  LEU B CA  1 
ATOM   2503 C  C   . LEU B 1 115 ? 52.007 87.688  -4.726  1.00 10.07  ? 115  LEU B C   1 
ATOM   2504 O  O   . LEU B 1 115 ? 51.935 86.958  -3.714  1.00 10.83  ? 115  LEU B O   1 
ATOM   2505 C  CB  . LEU B 1 115 ? 54.182 88.906  -5.226  1.00 10.00  ? 115  LEU B CB  1 
ATOM   2506 C  CG  . LEU B 1 115 ? 55.651 88.879  -5.710  1.00 6.91   ? 115  LEU B CG  1 
ATOM   2507 C  CD1 . LEU B 1 115 ? 56.368 90.239  -5.535  1.00 3.61   ? 115  LEU B CD1 1 
ATOM   2508 C  CD2 . LEU B 1 115 ? 56.421 87.743  -5.079  1.00 9.11   ? 115  LEU B CD2 1 
ATOM   2509 N  N   . CYS B 1 116 ? 50.994 88.451  -5.130  1.00 10.38  ? 116  CYS B N   1 
ATOM   2510 C  CA  . CYS B 1 116 ? 49.739 88.552  -4.341  1.00 10.80  ? 116  CYS B CA  1 
ATOM   2511 C  C   . CYS B 1 116 ? 48.864 87.315  -4.535  1.00 10.04  ? 116  CYS B C   1 
ATOM   2512 O  O   . CYS B 1 116 ? 48.079 86.952  -3.653  1.00 10.99  ? 116  CYS B O   1 
ATOM   2513 C  CB  . CYS B 1 116 ? 48.955 89.831  -4.708  1.00 11.58  ? 116  CYS B CB  1 
ATOM   2514 S  SG  . CYS B 1 116 ? 49.761 91.431  -4.287  1.00 13.71  ? 116  CYS B SG  1 
ATOM   2515 N  N   . GLY B 1 117 ? 49.008 86.644  -5.672  1.00 9.80   ? 117  GLY B N   1 
ATOM   2516 C  CA  . GLY B 1 117 ? 48.081 85.576  -6.017  1.00 10.14  ? 117  GLY B CA  1 
ATOM   2517 C  C   . GLY B 1 117 ? 48.487 84.227  -5.434  1.00 10.70  ? 117  GLY B C   1 
ATOM   2518 O  O   . GLY B 1 117 ? 47.707 83.271  -5.479  1.00 10.69  ? 117  GLY B O   1 
ATOM   2519 N  N   . HIS B 1 118 ? 49.710 84.127  -4.892  1.00 10.29  ? 118  HIS B N   1 
ATOM   2520 C  CA  . HIS B 1 118 ? 50.239 82.810  -4.552  1.00 9.93   ? 118  HIS B CA  1 
ATOM   2521 C  C   . HIS B 1 118 ? 49.574 82.289  -3.277  1.00 10.01  ? 118  HIS B C   1 
ATOM   2522 O  O   . HIS B 1 118 ? 49.576 82.976  -2.242  1.00 9.96   ? 118  HIS B O   1 
ATOM   2523 C  CB  . HIS B 1 118 ? 51.777 82.801  -4.410  1.00 8.68   ? 118  HIS B CB  1 
ATOM   2524 C  CG  . HIS B 1 118 ? 52.352 81.424  -4.276  1.00 10.16  ? 118  HIS B CG  1 
ATOM   2525 N  ND1 . HIS B 1 118 ? 52.801 80.698  -5.357  1.00 9.72   ? 118  HIS B ND1 1 
ATOM   2526 C  CD2 . HIS B 1 118 ? 52.546 80.638  -3.185  1.00 10.40  ? 118  HIS B CD2 1 
ATOM   2527 C  CE1 . HIS B 1 118 ? 53.237 79.518  -4.942  1.00 11.02  ? 118  HIS B CE1 1 
ATOM   2528 N  NE2 . HIS B 1 118 ? 53.079 79.452  -3.628  1.00 10.97  ? 118  HIS B NE2 1 
ATOM   2529 N  N   . PHE B 1 119 ? 49.017 81.082  -3.378  1.00 9.02   ? 119  PHE B N   1 
ATOM   2530 C  CA  . PHE B 1 119 ? 48.289 80.454  -2.273  1.00 8.83   ? 119  PHE B CA  1 
ATOM   2531 C  C   . PHE B 1 119 ? 49.238 79.659  -1.387  1.00 8.47   ? 119  PHE B C   1 
ATOM   2532 O  O   . PHE B 1 119 ? 49.983 78.819  -1.888  1.00 9.53   ? 119  PHE B O   1 
ATOM   2533 C  CB  . PHE B 1 119 ? 47.169 79.531  -2.786  1.00 8.50   ? 119  PHE B CB  1 
ATOM   2534 C  CG  . PHE B 1 119 ? 46.335 78.948  -1.682  1.00 8.98   ? 119  PHE B CG  1 
ATOM   2535 C  CD1 . PHE B 1 119 ? 45.442 79.745  -0.986  1.00 11.58  ? 119  PHE B CD1 1 
ATOM   2536 C  CD2 . PHE B 1 119 ? 46.475 77.617  -1.305  1.00 9.97   ? 119  PHE B CD2 1 
ATOM   2537 C  CE1 . PHE B 1 119 ? 44.681 79.237  0.055   1.00 12.75  ? 119  PHE B CE1 1 
ATOM   2538 C  CE2 . PHE B 1 119 ? 45.702 77.091  -0.260  1.00 9.30   ? 119  PHE B CE2 1 
ATOM   2539 C  CZ  . PHE B 1 119 ? 44.811 77.911  0.420   1.00 8.49   ? 119  PHE B CZ  1 
ATOM   2540 N  N   . GLY B 1 120 ? 49.176 79.916  -0.086  1.00 7.27   ? 120  GLY B N   1 
ATOM   2541 C  CA  . GLY B 1 120 ? 50.034 79.251  0.902   1.00 7.12   ? 120  GLY B CA  1 
ATOM   2542 C  C   . GLY B 1 120 ? 51.402 79.896  0.900   1.00 7.43   ? 120  GLY B C   1 
ATOM   2543 O  O   . GLY B 1 120 ? 51.553 81.043  0.441   1.00 7.62   ? 120  GLY B O   1 
ATOM   2544 N  N   . SER B 1 121 ? 52.401 79.146  1.373   1.00 6.71   ? 121  SER B N   1 
ATOM   2545 C  CA  . SER B 1 121 ? 53.770 79.663  1.492   1.00 6.42   ? 121  SER B CA  1 
ATOM   2546 C  C   . SER B 1 121 ? 54.490 79.518  0.161   1.00 6.93   ? 121  SER B C   1 
ATOM   2547 O  O   . SER B 1 121 ? 54.326 78.495  -0.530  1.00 7.92   ? 121  SER B O   1 
ATOM   2548 C  CB  . SER B 1 121 ? 54.505 78.895  2.603   1.00 5.10   ? 121  SER B CB  1 
ATOM   2549 O  OG  . SER B 1 121 ? 53.750 78.932  3.815   1.00 4.91   ? 121  SER B OG  1 
ATOM   2550 N  N   . GLY B 1 122 ? 55.265 80.538  -0.204  1.00 8.03   ? 122  GLY B N   1 
ATOM   2551 C  CA  . GLY B 1 122 ? 56.140 80.496  -1.370  1.00 7.63   ? 122  GLY B CA  1 
ATOM   2552 C  C   . GLY B 1 122 ? 56.891 81.778  -1.716  1.00 7.99   ? 122  GLY B C   1 
ATOM   2553 O  O   . GLY B 1 122 ? 57.111 82.692  -0.866  1.00 7.50   ? 122  GLY B O   1 
ATOM   2554 N  N   . TRP B 1 123 ? 57.243 81.868  -2.994  1.00 8.27   ? 123  TRP B N   1 
ATOM   2555 C  CA  . TRP B 1 123 ? 58.211 82.840  -3.486  1.00 7.26   ? 123  TRP B CA  1 
ATOM   2556 C  C   . TRP B 1 123 ? 57.847 83.252  -4.906  1.00 8.15   ? 123  TRP B C   1 
ATOM   2557 O  O   . TRP B 1 123 ? 57.464 82.407  -5.740  1.00 8.42   ? 123  TRP B O   1 
ATOM   2558 C  CB  . TRP B 1 123 ? 59.610 82.213  -3.535  1.00 6.99   ? 123  TRP B CB  1 
ATOM   2559 C  CG  . TRP B 1 123 ? 60.152 81.729  -2.226  1.00 7.13   ? 123  TRP B CG  1 
ATOM   2560 C  CD1 . TRP B 1 123 ? 59.889 80.533  -1.610  1.00 6.70   ? 123  TRP B CD1 1 
ATOM   2561 C  CD2 . TRP B 1 123 ? 61.049 82.442  -1.350  1.00 6.67   ? 123  TRP B CD2 1 
ATOM   2562 N  NE1 . TRP B 1 123 ? 60.569 80.449  -0.418  1.00 5.68   ? 123  TRP B NE1 1 
ATOM   2563 C  CE2 . TRP B 1 123 ? 61.307 81.594  -0.240  1.00 6.47   ? 123  TRP B CE2 1 
ATOM   2564 C  CE3 . TRP B 1 123 ? 61.689 83.693  -1.422  1.00 5.37   ? 123  TRP B CE3 1 
ATOM   2565 C  CZ2 . TRP B 1 123 ? 62.120 81.984  0.827   1.00 8.33   ? 123  TRP B CZ2 1 
ATOM   2566 C  CZ3 . TRP B 1 123 ? 62.521 84.089  -0.354  1.00 5.84   ? 123  TRP B CZ3 1 
ATOM   2567 C  CH2 . TRP B 1 123 ? 62.738 83.225  0.741   1.00 7.59   ? 123  TRP B CH2 1 
ATOM   2568 N  N   . GLY B 1 124 ? 58.006 84.547  -5.206  1.00 8.79   ? 124  GLY B N   1 
ATOM   2569 C  CA  . GLY B 1 124 ? 58.048 85.011  -6.601  1.00 8.54   ? 124  GLY B CA  1 
ATOM   2570 C  C   . GLY B 1 124 ? 59.480 85.212  -7.086  1.00 8.95   ? 124  GLY B C   1 
ATOM   2571 O  O   . GLY B 1 124 ? 60.364 85.616  -6.301  1.00 8.43   ? 124  GLY B O   1 
ATOM   2572 N  N   . TRP B 1 125 ? 59.738 84.930  -8.377  1.00 8.17   ? 125  TRP B N   1 
ATOM   2573 C  CA  . TRP B 1 125 ? 61.103 85.048  -8.943  1.00 8.46   ? 125  TRP B CA  1 
ATOM   2574 C  C   . TRP B 1 125 ? 61.139 85.806  -10.262 1.00 8.87   ? 125  TRP B C   1 
ATOM   2575 O  O   . TRP B 1 125 ? 60.239 85.684  -11.090 1.00 7.90   ? 125  TRP B O   1 
ATOM   2576 C  CB  . TRP B 1 125 ? 61.718 83.668  -9.242  1.00 8.11   ? 125  TRP B CB  1 
ATOM   2577 C  CG  . TRP B 1 125 ? 61.729 82.734  -8.031  1.00 6.20   ? 125  TRP B CG  1 
ATOM   2578 C  CD1 . TRP B 1 125 ? 60.725 81.917  -7.624  1.00 4.66   ? 125  TRP B CD1 1 
ATOM   2579 C  CD2 . TRP B 1 125 ? 62.803 82.536  -7.124  1.00 7.75   ? 125  TRP B CD2 1 
ATOM   2580 N  NE1 . TRP B 1 125 ? 61.088 81.246  -6.487  1.00 7.40   ? 125  TRP B NE1 1 
ATOM   2581 C  CE2 . TRP B 1 125 ? 62.362 81.601  -6.150  1.00 8.16   ? 125  TRP B CE2 1 
ATOM   2582 C  CE3 . TRP B 1 125 ? 64.098 83.060  -7.023  1.00 7.48   ? 125  TRP B CE3 1 
ATOM   2583 C  CZ2 . TRP B 1 125 ? 63.167 81.180  -5.086  1.00 8.31   ? 125  TRP B CZ2 1 
ATOM   2584 C  CZ3 . TRP B 1 125 ? 64.896 82.645  -5.959  1.00 6.57   ? 125  TRP B CZ3 1 
ATOM   2585 C  CH2 . TRP B 1 125 ? 64.426 81.700  -5.005  1.00 5.39   ? 125  TRP B CH2 1 
ATOM   2586 N  N   . LEU B 1 126 ? 62.201 86.574  -10.438 1.00 9.23   ? 126  LEU B N   1 
ATOM   2587 C  CA  . LEU B 1 126 ? 62.617 86.992  -11.748 1.00 9.86   ? 126  LEU B CA  1 
ATOM   2588 C  C   . LEU B 1 126 ? 63.838 86.158  -12.095 1.00 9.95   ? 126  LEU B C   1 
ATOM   2589 O  O   . LEU B 1 126 ? 64.816 86.145  -11.349 1.00 9.46   ? 126  LEU B O   1 
ATOM   2590 C  CB  . LEU B 1 126 ? 62.960 88.491  -11.755 1.00 10.54  ? 126  LEU B CB  1 
ATOM   2591 C  CG  . LEU B 1 126 ? 63.431 89.057  -13.088 1.00 9.55   ? 126  LEU B CG  1 
ATOM   2592 C  CD1 . LEU B 1 126 ? 62.329 88.920  -14.219 1.00 9.60   ? 126  LEU B CD1 1 
ATOM   2593 C  CD2 . LEU B 1 126 ? 63.915 90.493  -12.892 1.00 10.37  ? 126  LEU B CD2 1 
ATOM   2594 N  N   . VAL B 1 127 ? 63.762 85.433  -13.210 1.00 10.51  ? 127  VAL B N   1 
ATOM   2595 C  CA  . VAL B 1 127 ? 64.848 84.576  -13.644 1.00 10.80  ? 127  VAL B CA  1 
ATOM   2596 C  C   . VAL B 1 127 ? 65.139 84.842  -15.117 1.00 11.33  ? 127  VAL B C   1 
ATOM   2597 O  O   . VAL B 1 127 ? 64.305 85.388  -15.832 1.00 11.47  ? 127  VAL B O   1 
ATOM   2598 C  CB  . VAL B 1 127 ? 64.543 83.027  -13.429 1.00 11.59  ? 127  VAL B CB  1 
ATOM   2599 C  CG1 . VAL B 1 127 ? 63.875 82.779  -12.060 1.00 11.60  ? 127  VAL B CG1 1 
ATOM   2600 C  CG2 . VAL B 1 127 ? 63.673 82.477  -14.533 1.00 10.13  ? 127  VAL B CG2 1 
ATOM   2601 N  N   . LEU B 1 128 ? 66.333 84.476  -15.559 1.00 11.18  ? 128  LEU B N   1 
ATOM   2602 C  CA  . LEU B 1 128 ? 66.692 84.556  -16.969 1.00 12.76  ? 128  LEU B CA  1 
ATOM   2603 C  C   . LEU B 1 128 ? 66.666 83.123  -17.455 1.00 13.80  ? 128  LEU B C   1 
ATOM   2604 O  O   . LEU B 1 128 ? 67.358 82.278  -16.892 1.00 13.71  ? 128  LEU B O   1 
ATOM   2605 C  CB  . LEU B 1 128 ? 68.114 85.114  -17.127 1.00 11.74  ? 128  LEU B CB  1 
ATOM   2606 C  CG  . LEU B 1 128 ? 68.536 85.417  -18.572 1.00 11.67  ? 128  LEU B CG  1 
ATOM   2607 C  CD1 . LEU B 1 128 ? 67.890 86.735  -19.145 1.00 9.07   ? 128  LEU B CD1 1 
ATOM   2608 C  CD2 . LEU B 1 128 ? 70.067 85.439  -18.717 1.00 11.61  ? 128  LEU B CD2 1 
ATOM   2609 N  N   . ASN B 1 129 ? 65.888 82.842  -18.488 1.00 16.56  ? 129  ASN B N   1 
ATOM   2610 C  CA  . ASN B 1 129 ? 65.778 81.443  -18.985 1.00 18.35  ? 129  ASN B CA  1 
ATOM   2611 C  C   . ASN B 1 129 ? 66.895 81.114  -19.974 1.00 20.28  ? 129  ASN B C   1 
ATOM   2612 O  O   . ASN B 1 129 ? 67.791 81.948  -20.189 1.00 20.18  ? 129  ASN B O   1 
ATOM   2613 C  CB  . ASN B 1 129 ? 64.383 81.166  -19.578 1.00 18.09  ? 129  ASN B CB  1 
ATOM   2614 C  CG  . ASN B 1 129 ? 64.163 81.815  -20.934 1.00 15.17  ? 129  ASN B CG  1 
ATOM   2615 O  OD1 . ASN B 1 129 ? 65.074 82.300  -21.565 1.00 15.37  ? 129  ASN B OD1 1 
ATOM   2616 N  ND2 . ASN B 1 129 ? 62.930 81.819  -21.378 1.00 16.67  ? 129  ASN B ND2 1 
ATOM   2617 N  N   . ASN B 1 130 ? 66.853 79.913  -20.564 1.00 22.39  ? 130  ASN B N   1 
ATOM   2618 C  CA  . ASN B 1 130 ? 67.930 79.464  -21.485 1.00 24.72  ? 130  ASN B CA  1 
ATOM   2619 C  C   . ASN B 1 130 ? 67.983 80.241  -22.800 1.00 24.70  ? 130  ASN B C   1 
ATOM   2620 O  O   . ASN B 1 130 ? 69.039 80.320  -23.451 1.00 25.35  ? 130  ASN B O   1 
ATOM   2621 C  CB  . ASN B 1 130 ? 67.894 77.938  -21.729 1.00 25.89  ? 130  ASN B CB  1 
ATOM   2622 C  CG  . ASN B 1 130 ? 66.711 77.491  -22.595 1.00 29.89  ? 130  ASN B CG  1 
ATOM   2623 O  OD1 . ASN B 1 130 ? 66.890 77.061  -23.756 1.00 35.17  ? 130  ASN B OD1 1 
ATOM   2624 N  ND2 . ASN B 1 130 ? 65.493 77.580  -22.037 1.00 34.46  ? 130  ASN B ND2 1 
ATOM   2625 N  N   . ASN B 1 131 ? 66.854 80.826  -23.190 1.00 24.69  ? 131  ASN B N   1 
ATOM   2626 C  CA  . ASN B 1 131 ? 66.844 81.701  -24.356 1.00 24.63  ? 131  ASN B CA  1 
ATOM   2627 C  C   . ASN B 1 131 ? 67.207 83.135  -23.995 1.00 22.97  ? 131  ASN B C   1 
ATOM   2628 O  O   . ASN B 1 131 ? 66.901 84.049  -24.748 1.00 23.56  ? 131  ASN B O   1 
ATOM   2629 C  CB  . ASN B 1 131 ? 65.479 81.681  -25.058 1.00 25.44  ? 131  ASN B CB  1 
ATOM   2630 C  CG  . ASN B 1 131 ? 64.983 80.283  -25.328 1.00 29.73  ? 131  ASN B CG  1 
ATOM   2631 O  OD1 . ASN B 1 131 ? 63.821 79.970  -25.058 1.00 33.94  ? 131  ASN B OD1 1 
ATOM   2632 N  ND2 . ASN B 1 131 ? 65.863 79.419  -25.847 1.00 33.30  ? 131  ASN B ND2 1 
ATOM   2633 N  N   . ASN B 1 132 ? 67.849 83.332  -22.846 1.00 21.91  ? 132  ASN B N   1 
ATOM   2634 C  CA  . ASN B 1 132 ? 68.263 84.655  -22.376 1.00 20.93  ? 132  ASN B CA  1 
ATOM   2635 C  C   . ASN B 1 132 ? 67.113 85.632  -22.325 1.00 18.76  ? 132  ASN B C   1 
ATOM   2636 O  O   . ASN B 1 132 ? 67.277 86.801  -22.604 1.00 18.57  ? 132  ASN B O   1 
ATOM   2637 C  CB  . ASN B 1 132 ? 69.405 85.253  -23.212 1.00 22.12  ? 132  ASN B CB  1 
ATOM   2638 C  CG  . ASN B 1 132 ? 70.741 84.598  -22.929 1.00 25.29  ? 132  ASN B CG  1 
ATOM   2639 O  OD1 . ASN B 1 132 ? 70.897 83.837  -21.963 1.00 29.41  ? 132  ASN B OD1 1 
ATOM   2640 N  ND2 . ASN B 1 132 ? 71.702 84.846  -23.807 1.00 29.47  ? 132  ASN B ND2 1 
ATOM   2641 N  N   . LYS B 1 133 ? 65.954 85.130  -21.949 1.00 16.97  ? 133  LYS B N   1 
ATOM   2642 C  CA  . LYS B 1 133 ? 64.802 85.966  -21.738 1.00 15.48  ? 133  LYS B CA  1 
ATOM   2643 C  C   . LYS B 1 133 ? 64.449 85.964  -20.264 1.00 14.06  ? 133  LYS B C   1 
ATOM   2644 O  O   . LYS B 1 133 ? 64.400 84.893  -19.633 1.00 12.70  ? 133  LYS B O   1 
ATOM   2645 C  CB  . LYS B 1 133 ? 63.623 85.427  -22.535 1.00 15.43  ? 133  LYS B CB  1 
ATOM   2646 C  CG  . LYS B 1 133 ? 62.424 86.332  -22.435 1.00 17.51  ? 133  LYS B CG  1 
ATOM   2647 C  CD  . LYS B 1 133 ? 61.173 85.751  -23.014 1.00 21.80  ? 133  LYS B CD  1 
ATOM   2648 C  CE  . LYS B 1 133 ? 60.179 86.873  -23.276 1.00 23.67  ? 133  LYS B CE  1 
ATOM   2649 N  NZ  . LYS B 1 133 ? 59.011 86.339  -24.018 1.00 27.03  ? 133  LYS B NZ  1 
ATOM   2650 N  N   . LEU B 1 134 ? 64.194 87.158  -19.736 1.00 12.98  ? 134  LEU B N   1 
ATOM   2651 C  CA  . LEU B 1 134 ? 63.608 87.309  -18.402 1.00 12.27  ? 134  LEU B CA  1 
ATOM   2652 C  C   . LEU B 1 134 ? 62.176 86.788  -18.360 1.00 12.14  ? 134  LEU B C   1 
ATOM   2653 O  O   . LEU B 1 134 ? 61.371 87.064  -19.266 1.00 11.89  ? 134  LEU B O   1 
ATOM   2654 C  CB  . LEU B 1 134 ? 63.624 88.760  -17.935 1.00 11.76  ? 134  LEU B CB  1 
ATOM   2655 C  CG  . LEU B 1 134 ? 64.996 89.388  -17.640 1.00 9.95   ? 134  LEU B CG  1 
ATOM   2656 C  CD1 . LEU B 1 134 ? 64.797 90.843  -17.372 1.00 9.41   ? 134  LEU B CD1 1 
ATOM   2657 C  CD2 . LEU B 1 134 ? 65.736 88.709  -16.483 1.00 8.09   ? 134  LEU B CD2 1 
ATOM   2658 N  N   . VAL B 1 135 ? 61.870 86.053  -17.299 1.00 11.44  ? 135  VAL B N   1 
ATOM   2659 C  CA  . VAL B 1 135 ? 60.522 85.510  -17.068 1.00 10.90  ? 135  VAL B CA  1 
ATOM   2660 C  C   . VAL B 1 135 ? 60.172 85.568  -15.588 1.00 10.09  ? 135  VAL B C   1 
ATOM   2661 O  O   . VAL B 1 135 ? 61.050 85.467  -14.729 1.00 9.99   ? 135  VAL B O   1 
ATOM   2662 C  CB  . VAL B 1 135 ? 60.352 84.044  -17.605 1.00 12.35  ? 135  VAL B CB  1 
ATOM   2663 C  CG1 . VAL B 1 135 ? 60.623 83.978  -19.118 1.00 11.62  ? 135  VAL B CG1 1 
ATOM   2664 C  CG2 . VAL B 1 135 ? 61.251 83.066  -16.892 1.00 13.18  ? 135  VAL B CG2 1 
ATOM   2665 N  N   . ILE B 1 136 ? 58.880 85.695  -15.294 1.00 9.32   ? 136  ILE B N   1 
ATOM   2666 C  CA  . ILE B 1 136 ? 58.412 85.659  -13.921 1.00 8.59   ? 136  ILE B CA  1 
ATOM   2667 C  C   . ILE B 1 136 ? 58.003 84.222  -13.562 1.00 9.24   ? 136  ILE B C   1 
ATOM   2668 O  O   . ILE B 1 136 ? 57.199 83.612  -14.269 1.00 9.68   ? 136  ILE B O   1 
ATOM   2669 C  CB  . ILE B 1 136 ? 57.265 86.688  -13.692 1.00 9.37   ? 136  ILE B CB  1 
ATOM   2670 C  CG1 . ILE B 1 136 ? 57.808 88.146  -13.797 1.00 6.46   ? 136  ILE B CG1 1 
ATOM   2671 C  CG2 . ILE B 1 136 ? 56.555 86.418  -12.325 1.00 6.91   ? 136  ILE B CG2 1 
ATOM   2672 C  CD1 . ILE B 1 136 ? 56.612 89.208  -14.003 1.00 6.76   ? 136  ILE B CD1 1 
ATOM   2673 N  N   . LEU B 1 137 ? 58.572 83.685  -12.484 1.00 9.58   ? 137  LEU B N   1 
ATOM   2674 C  CA  . LEU B 1 137 ? 58.124 82.399  -11.920 1.00 9.76   ? 137  LEU B CA  1 
ATOM   2675 C  C   . LEU B 1 137 ? 57.619 82.538  -10.484 1.00 9.74   ? 137  LEU B C   1 
ATOM   2676 O  O   . LEU B 1 137 ? 57.907 83.524  -9.782  1.00 9.30   ? 137  LEU B O   1 
ATOM   2677 C  CB  . LEU B 1 137 ? 59.223 81.314  -12.005 1.00 9.24   ? 137  LEU B CB  1 
ATOM   2678 C  CG  . LEU B 1 137 ? 59.990 81.063  -13.317 1.00 10.08  ? 137  LEU B CG  1 
ATOM   2679 C  CD1 . LEU B 1 137 ? 61.160 80.084  -13.024 1.00 8.19   ? 137  LEU B CD1 1 
ATOM   2680 C  CD2 . LEU B 1 137 ? 59.070 80.505  -14.416 1.00 9.76   ? 137  LEU B CD2 1 
ATOM   2681 N  N   . GLN B 1 138 ? 56.818 81.568  -10.072 1.00 9.86   ? 138  GLN B N   1 
ATOM   2682 C  CA  . GLN B 1 138 ? 56.495 81.372  -8.662  1.00 9.53   ? 138  GLN B CA  1 
ATOM   2683 C  C   . GLN B 1 138 ? 56.808 79.940  -8.259  1.00 9.06   ? 138  GLN B C   1 
ATOM   2684 O  O   . GLN B 1 138 ? 56.703 78.977  -9.069  1.00 8.51   ? 138  GLN B O   1 
ATOM   2685 C  CB  . GLN B 1 138 ? 55.037 81.749  -8.345  1.00 9.71   ? 138  GLN B CB  1 
ATOM   2686 C  CG  . GLN B 1 138 ? 54.003 80.868  -9.042  1.00 12.10  ? 138  GLN B CG  1 
ATOM   2687 C  CD  . GLN B 1 138 ? 52.590 81.357  -8.896  1.00 11.68  ? 138  GLN B CD  1 
ATOM   2688 O  OE1 . GLN B 1 138 ? 52.125 81.668  -7.789  1.00 13.78  ? 138  GLN B OE1 1 
ATOM   2689 N  NE2 . GLN B 1 138 ? 51.879 81.429  -10.025 1.00 13.21  ? 138  GLN B NE2 1 
ATOM   2690 N  N   . THR B 1 139 ? 57.217 79.785  -7.012  1.00 8.86   ? 139  THR B N   1 
ATOM   2691 C  CA  . THR B 1 139 ? 57.448 78.450  -6.472  1.00 9.16   ? 139  THR B CA  1 
ATOM   2692 C  C   . THR B 1 139 ? 56.757 78.349  -5.125  1.00 9.60   ? 139  THR B C   1 
ATOM   2693 O  O   . THR B 1 139 ? 56.443 79.364  -4.493  1.00 10.28  ? 139  THR B O   1 
ATOM   2694 C  CB  . THR B 1 139 ? 58.959 78.113  -6.320  1.00 9.22   ? 139  THR B CB  1 
ATOM   2695 O  OG1 . THR B 1 139 ? 59.539 79.001  -5.346  1.00 8.77   ? 139  THR B OG1 1 
ATOM   2696 C  CG2 . THR B 1 139 ? 59.690 78.244  -7.658  1.00 6.05   ? 139  THR B CG2 1 
ATOM   2697 N  N   . HIS B 1 140 ? 56.522 77.113  -4.692  1.00 9.39   ? 140  HIS B N   1 
ATOM   2698 C  CA  . HIS B 1 140 ? 55.784 76.842  -3.474  1.00 9.94   ? 140  HIS B CA  1 
ATOM   2699 C  C   . HIS B 1 140 ? 56.771 76.408  -2.391  1.00 9.78   ? 140  HIS B C   1 
ATOM   2700 O  O   . HIS B 1 140 ? 57.788 75.768  -2.684  1.00 10.36  ? 140  HIS B O   1 
ATOM   2701 C  CB  . HIS B 1 140 ? 54.731 75.766  -3.768  1.00 10.22  ? 140  HIS B CB  1 
ATOM   2702 C  CG  . HIS B 1 140 ? 53.621 75.713  -2.777  1.00 13.46  ? 140  HIS B CG  1 
ATOM   2703 N  ND1 . HIS B 1 140 ? 52.837 76.812  -2.471  1.00 13.97  ? 140  HIS B ND1 1 
ATOM   2704 C  CD2 . HIS B 1 140 ? 53.141 74.685  -2.038  1.00 11.43  ? 140  HIS B CD2 1 
ATOM   2705 C  CE1 . HIS B 1 140 ? 51.945 76.467  -1.560  1.00 15.15  ? 140  HIS B CE1 1 
ATOM   2706 N  NE2 . HIS B 1 140 ? 52.104 75.183  -1.286  1.00 14.76  ? 140  HIS B NE2 1 
ATOM   2707 N  N   . ASP B 1 141 ? 56.480 76.788  -1.147  1.00 8.76   ? 141  ASP B N   1 
ATOM   2708 C  CA  . ASP B 1 141 ? 57.234 76.367  0.031   1.00 8.54   ? 141  ASP B CA  1 
ATOM   2709 C  C   . ASP B 1 141 ? 58.717 76.725  -0.084  1.00 8.97   ? 141  ASP B C   1 
ATOM   2710 O  O   . ASP B 1 141 ? 59.021 77.929  -0.140  1.00 9.84   ? 141  ASP B O   1 
ATOM   2711 C  CB  . ASP B 1 141 ? 56.987 74.882  0.354   1.00 7.86   ? 141  ASP B CB  1 
ATOM   2712 C  CG  . ASP B 1 141 ? 55.522 74.597  0.615   1.00 9.59   ? 141  ASP B CG  1 
ATOM   2713 O  OD1 . ASP B 1 141 ? 54.888 75.435  1.256   1.00 11.53  ? 141  ASP B OD1 1 
ATOM   2714 O  OD2 . ASP B 1 141 ? 54.994 73.551  0.172   1.00 12.73  ? 141  ASP B OD2 1 
ATOM   2715 N  N   . ALA B 1 142 ? 59.616 75.725  -0.132  1.00 8.20   ? 142  ALA B N   1 
ATOM   2716 C  CA  . ALA B 1 142 ? 61.093 75.967  -0.295  1.00 9.14   ? 142  ALA B CA  1 
ATOM   2717 C  C   . ALA B 1 142 ? 61.606 75.862  -1.754  1.00 9.07   ? 142  ALA B C   1 
ATOM   2718 O  O   . ALA B 1 142 ? 62.812 76.076  -2.039  1.00 9.22   ? 142  ALA B O   1 
ATOM   2719 C  CB  . ALA B 1 142 ? 61.891 75.046  0.627   1.00 8.40   ? 142  ALA B CB  1 
ATOM   2720 N  N   . GLY B 1 143 ? 60.694 75.542  -2.681  1.00 9.22   ? 143  GLY B N   1 
ATOM   2721 C  CA  . GLY B 1 143 ? 61.035 75.394  -4.112  1.00 9.09   ? 143  GLY B CA  1 
ATOM   2722 C  C   . GLY B 1 143 ? 61.772 76.571  -4.737  1.00 10.18  ? 143  GLY B C   1 
ATOM   2723 O  O   . GLY B 1 143 ? 61.608 77.733  -4.325  1.00 10.82  ? 143  GLY B O   1 
ATOM   2724 N  N   . ASN B 1 144 ? 62.614 76.309  -5.722  1.00 9.88   ? 144  ASN B N   1 
ATOM   2725 C  CA  . ASN B 1 144 ? 63.291 77.429  -6.399  1.00 10.50  ? 144  ASN B CA  1 
ATOM   2726 C  C   . ASN B 1 144 ? 63.717 77.044  -7.806  1.00 10.00  ? 144  ASN B C   1 
ATOM   2727 O  O   . ASN B 1 144 ? 63.679 75.852  -8.152  1.00 10.54  ? 144  ASN B O   1 
ATOM   2728 C  CB  . ASN B 1 144 ? 64.440 78.053  -5.542  1.00 10.67  ? 144  ASN B CB  1 
ATOM   2729 C  CG  . ASN B 1 144 ? 65.644 77.103  -5.292  1.00 10.40  ? 144  ASN B CG  1 
ATOM   2730 O  OD1 . ASN B 1 144 ? 66.119 76.393  -6.190  1.00 9.24   ? 144  ASN B OD1 1 
ATOM   2731 N  ND2 . ASN B 1 144 ? 66.153 77.122  -4.047  1.00 8.88   ? 144  ASN B ND2 1 
ATOM   2732 N  N   . PRO B 1 145 ? 64.047 78.043  -8.653  1.00 9.92   ? 145  PRO B N   1 
ATOM   2733 C  CA  . PRO B 1 145 ? 64.396 77.735  -10.040 1.00 9.28   ? 145  PRO B CA  1 
ATOM   2734 C  C   . PRO B 1 145 ? 65.670 76.906  -10.256 1.00 9.75   ? 145  PRO B C   1 
ATOM   2735 O  O   . PRO B 1 145 ? 65.793 76.243  -11.297 1.00 9.10   ? 145  PRO B O   1 
ATOM   2736 C  CB  . PRO B 1 145 ? 64.494 79.133  -10.704 1.00 9.22   ? 145  PRO B CB  1 
ATOM   2737 C  CG  . PRO B 1 145 ? 63.636 80.008  -9.813  1.00 11.51  ? 145  PRO B CG  1 
ATOM   2738 C  CD  . PRO B 1 145 ? 63.997 79.496  -8.429  1.00 8.00   ? 145  PRO B CD  1 
ATOM   2739 N  N   . ILE B 1 146 ? 66.606 76.949  -9.310  1.00 10.24  ? 146  ILE B N   1 
ATOM   2740 C  CA  . ILE B 1 146 ? 67.793 76.095  -9.370  1.00 11.17  ? 146  ILE B CA  1 
ATOM   2741 C  C   . ILE B 1 146 ? 67.427 74.620  -9.194  1.00 11.31  ? 146  ILE B C   1 
ATOM   2742 O  O   . ILE B 1 146 ? 67.844 73.769  -10.004 1.00 10.27  ? 146  ILE B O   1 
ATOM   2743 C  CB  . ILE B 1 146 ? 68.851 76.521  -8.309  1.00 12.67  ? 146  ILE B CB  1 
ATOM   2744 C  CG1 . ILE B 1 146 ? 69.257 77.982  -8.532  1.00 13.21  ? 146  ILE B CG1 1 
ATOM   2745 C  CG2 . ILE B 1 146 ? 70.039 75.609  -8.340  1.00 12.89  ? 146  ILE B CG2 1 
ATOM   2746 C  CD1 . ILE B 1 146 ? 70.244 78.487  -7.512  1.00 16.74  ? 146  ILE B CD1 1 
ATOM   2747 N  N   . LYS B 1 147 ? 66.605 74.334  -8.183  1.00 10.09  ? 147  LYS B N   1 
ATOM   2748 C  CA  . LYS B 1 147 ? 66.091 72.996  -7.980  1.00 9.67   ? 147  LYS B CA  1 
ATOM   2749 C  C   . LYS B 1 147 ? 65.330 72.547  -9.226  1.00 10.57  ? 147  LYS B C   1 
ATOM   2750 O  O   . LYS B 1 147 ? 65.482 71.404  -9.663  1.00 9.81   ? 147  LYS B O   1 
ATOM   2751 C  CB  . LYS B 1 147 ? 65.168 72.914  -6.747  1.00 8.66   ? 147  LYS B CB  1 
ATOM   2752 C  CG  . LYS B 1 147 ? 64.685 71.510  -6.423  1.00 6.59   ? 147  LYS B CG  1 
ATOM   2753 C  CD  . LYS B 1 147 ? 65.847 70.528  -6.208  1.00 7.71   ? 147  LYS B CD  1 
ATOM   2754 C  CE  . LYS B 1 147 ? 65.385 69.357  -5.295  1.00 6.29   ? 147  LYS B CE  1 
ATOM   2755 N  NZ  . LYS B 1 147 ? 66.588 68.545  -4.918  1.00 9.37   ? 147  LYS B NZ  1 
ATOM   2756 N  N   . ASP B 1 148 ? 64.563 73.472  -9.810  1.00 10.89  ? 148  ASP B N   1 
ATOM   2757 C  CA  . ASP B 1 148 ? 63.632 73.154  -10.899 1.00 11.29  ? 148  ASP B CA  1 
ATOM   2758 C  C   . ASP B 1 148 ? 64.207 73.215  -12.300 1.00 11.69  ? 148  ASP B C   1 
ATOM   2759 O  O   . ASP B 1 148 ? 63.554 72.749  -13.235 1.00 12.13  ? 148  ASP B O   1 
ATOM   2760 C  CB  . ASP B 1 148 ? 62.431 74.083  -10.852 1.00 10.81  ? 148  ASP B CB  1 
ATOM   2761 C  CG  . ASP B 1 148 ? 61.588 73.879  -9.638  1.00 11.22  ? 148  ASP B CG  1 
ATOM   2762 O  OD1 . ASP B 1 148 ? 61.730 72.836  -8.989  1.00 11.65  ? 148  ASP B OD1 1 
ATOM   2763 O  OD2 . ASP B 1 148 ? 60.798 74.783  -9.316  1.00 12.70  ? 148  ASP B OD2 1 
ATOM   2764 N  N   . ASN B 1 149 ? 65.392 73.799  -12.444 1.00 11.58  ? 149  ASN B N   1 
ATOM   2765 C  CA  . ASN B 1 149 ? 66.042 74.010  -13.757 1.00 12.32  ? 149  ASN B CA  1 
ATOM   2766 C  C   . ASN B 1 149 ? 65.185 74.887  -14.676 1.00 12.72  ? 149  ASN B C   1 
ATOM   2767 O  O   . ASN B 1 149 ? 65.099 74.655  -15.885 1.00 12.95  ? 149  ASN B O   1 
ATOM   2768 C  CB  . ASN B 1 149 ? 66.355 72.677  -14.463 1.00 12.69  ? 149  ASN B CB  1 
ATOM   2769 C  CG  . ASN B 1 149 ? 67.024 71.655  -13.550 1.00 12.09  ? 149  ASN B CG  1 
ATOM   2770 O  OD1 . ASN B 1 149 ? 68.093 71.916  -12.954 1.00 12.04  ? 149  ASN B OD1 1 
ATOM   2771 N  ND2 . ASN B 1 149 ? 66.414 70.469  -13.459 1.00 10.16  ? 149  ASN B ND2 1 
ATOM   2772 N  N   . THR B 1 150 ? 64.551 75.900  -14.096 1.00 12.22  ? 150  THR B N   1 
ATOM   2773 C  CA  . THR B 1 150 ? 63.690 76.774  -14.851 1.00 13.51  ? 150  THR B CA  1 
ATOM   2774 C  C   . THR B 1 150 ? 64.359 78.117  -15.178 1.00 13.90  ? 150  THR B C   1 
ATOM   2775 O  O   . THR B 1 150 ? 63.732 78.973  -15.798 1.00 15.29  ? 150  THR B O   1 
ATOM   2776 C  CB  . THR B 1 150 ? 62.355 76.970  -14.122 1.00 13.09  ? 150  THR B CB  1 
ATOM   2777 O  OG1 . THR B 1 150 ? 62.633 77.321  -12.766 1.00 11.77  ? 150  THR B OG1 1 
ATOM   2778 C  CG2 . THR B 1 150 ? 61.557 75.671  -14.137 1.00 13.59  ? 150  THR B CG2 1 
ATOM   2779 N  N   . GLY B 1 151 ? 65.627 78.303  -14.792 1.00 13.55  ? 151  GLY B N   1 
ATOM   2780 C  CA  . GLY B 1 151 ? 66.335 79.550  -15.164 1.00 13.55  ? 151  GLY B CA  1 
ATOM   2781 C  C   . GLY B 1 151 ? 67.287 80.036  -14.084 1.00 12.99  ? 151  GLY B C   1 
ATOM   2782 O  O   . GLY B 1 151 ? 67.344 79.455  -13.006 1.00 12.70  ? 151  GLY B O   1 
ATOM   2783 N  N   . ILE B 1 152 ? 68.058 81.078  -14.386 1.00 12.23  ? 152  ILE B N   1 
ATOM   2784 C  CA  . ILE B 1 152 ? 69.010 81.634  -13.417 1.00 11.64  ? 152  ILE B CA  1 
ATOM   2785 C  C   . ILE B 1 152 ? 68.337 82.775  -12.642 1.00 11.21  ? 152  ILE B C   1 
ATOM   2786 O  O   . ILE B 1 152 ? 67.910 83.780  -13.257 1.00 10.83  ? 152  ILE B O   1 
ATOM   2787 C  CB  . ILE B 1 152 ? 70.308 82.112  -14.138 1.00 11.84  ? 152  ILE B CB  1 
ATOM   2788 C  CG1 . ILE B 1 152 ? 71.031 80.907  -14.740 1.00 12.54  ? 152  ILE B CG1 1 
ATOM   2789 C  CG2 . ILE B 1 152 ? 71.248 82.806  -13.190 1.00 10.25  ? 152  ILE B CG2 1 
ATOM   2790 C  CD1 . ILE B 1 152 ? 72.004 81.307  -15.876 1.00 13.71  ? 152  ILE B CD1 1 
ATOM   2791 N  N   . PRO B 1 153 ? 68.183 82.613  -11.305 1.00 11.76  ? 153  PRO B N   1 
ATOM   2792 C  CA  . PRO B 1 153 ? 67.497 83.649  -10.531 1.00 11.71  ? 153  PRO B CA  1 
ATOM   2793 C  C   . PRO B 1 153 ? 68.184 85.008  -10.626 1.00 11.54  ? 153  PRO B C   1 
ATOM   2794 O  O   . PRO B 1 153 ? 69.417 85.085  -10.672 1.00 11.48  ? 153  PRO B O   1 
ATOM   2795 C  CB  . PRO B 1 153 ? 67.548 83.108  -9.096  1.00 11.86  ? 153  PRO B CB  1 
ATOM   2796 C  CG  . PRO B 1 153 ? 67.601 81.603  -9.275  1.00 11.47  ? 153  PRO B CG  1 
ATOM   2797 C  CD  . PRO B 1 153 ? 68.570 81.481  -10.435 1.00 11.57  ? 153  PRO B CD  1 
ATOM   2798 N  N   . ILE B 1 154 ? 67.368 86.065  -10.655 1.00 11.20  ? 154  ILE B N   1 
ATOM   2799 C  CA  . ILE B 1 154 ? 67.855 87.452  -10.775 1.00 10.60  ? 154  ILE B CA  1 
ATOM   2800 C  C   . ILE B 1 154 ? 67.445 88.243  -9.522  1.00 10.24  ? 154  ILE B C   1 
ATOM   2801 O  O   . ILE B 1 154 ? 68.290 88.918  -8.895  1.00 9.19   ? 154  ILE B O   1 
ATOM   2802 C  CB  . ILE B 1 154 ? 67.301 88.129  -12.066 1.00 11.63  ? 154  ILE B CB  1 
ATOM   2803 C  CG1 . ILE B 1 154 ? 67.779 87.387  -13.329 1.00 10.95  ? 154  ILE B CG1 1 
ATOM   2804 C  CG2 . ILE B 1 154 ? 67.649 89.644  -12.123 1.00 9.58   ? 154  ILE B CG2 1 
ATOM   2805 C  CD1 . ILE B 1 154 ? 69.316 87.275  -13.476 1.00 10.09  ? 154  ILE B CD1 1 
ATOM   2806 N  N   . LEU B 1 155 ? 66.155 88.130  -9.172  1.00 9.02   ? 155  LEU B N   1 
ATOM   2807 C  CA  . LEU B 1 155 ? 65.606 88.647  -7.905  1.00 9.83   ? 155  LEU B CA  1 
ATOM   2808 C  C   . LEU B 1 155 ? 64.583 87.665  -7.317  1.00 9.51   ? 155  LEU B C   1 
ATOM   2809 O  O   . LEU B 1 155 ? 63.994 86.886  -8.045  1.00 9.64   ? 155  LEU B O   1 
ATOM   2810 C  CB  . LEU B 1 155 ? 64.906 89.981  -8.121  1.00 9.70   ? 155  LEU B CB  1 
ATOM   2811 C  CG  . LEU B 1 155 ? 65.713 91.205  -8.537  1.00 9.02   ? 155  LEU B CG  1 
ATOM   2812 C  CD1 . LEU B 1 155 ? 64.780 92.293  -9.134  1.00 7.37   ? 155  LEU B CD1 1 
ATOM   2813 C  CD2 . LEU B 1 155 ? 66.514 91.744  -7.340  1.00 10.26  ? 155  LEU B CD2 1 
ATOM   2814 N  N   . THR B 1 156 ? 64.347 87.743  -6.014  1.00 9.16   ? 156  THR B N   1 
ATOM   2815 C  CA  . THR B 1 156 ? 63.210 87.031  -5.422  1.00 8.56   ? 156  THR B CA  1 
ATOM   2816 C  C   . THR B 1 156 ? 62.485 87.871  -4.397  1.00 8.61   ? 156  THR B C   1 
ATOM   2817 O  O   . THR B 1 156 ? 63.060 88.814  -3.797  1.00 8.18   ? 156  THR B O   1 
ATOM   2818 C  CB  . THR B 1 156 ? 63.627 85.666  -4.737  1.00 9.15   ? 156  THR B CB  1 
ATOM   2819 O  OG1 . THR B 1 156 ? 62.467 84.846  -4.556  1.00 8.63   ? 156  THR B OG1 1 
ATOM   2820 C  CG2 . THR B 1 156 ? 64.309 85.908  -3.358  1.00 6.21   ? 156  THR B CG2 1 
ATOM   2821 N  N   . CYS B 1 157 ? 61.230 87.497  -4.157  1.00 8.46   ? 157  CYS B N   1 
ATOM   2822 C  CA  . CYS B 1 157 ? 60.469 88.094  -3.052  1.00 8.12   ? 157  CYS B CA  1 
ATOM   2823 C  C   . CYS B 1 157 ? 59.730 86.974  -2.313  1.00 7.57   ? 157  CYS B C   1 
ATOM   2824 O  O   . CYS B 1 157 ? 58.976 86.198  -2.924  1.00 7.20   ? 157  CYS B O   1 
ATOM   2825 C  CB  . CYS B 1 157 ? 59.504 89.186  -3.558  1.00 7.39   ? 157  CYS B CB  1 
ATOM   2826 S  SG  . CYS B 1 157 ? 58.502 89.910  -2.243  1.00 9.44   ? 157  CYS B SG  1 
ATOM   2827 N  N   . ASP B 1 158 ? 59.996 86.886  -1.006  1.00 7.20   ? 158  ASP B N   1 
ATOM   2828 C  CA  . ASP B 1 158 ? 59.342 85.954  -0.102  1.00 7.29   ? 158  ASP B CA  1 
ATOM   2829 C  C   . ASP B 1 158 ? 57.898 86.365  0.206   1.00 7.76   ? 158  ASP B C   1 
ATOM   2830 O  O   . ASP B 1 158 ? 57.652 87.516  0.626   1.00 7.97   ? 158  ASP B O   1 
ATOM   2831 C  CB  . ASP B 1 158 ? 60.183 85.951  1.158   1.00 9.01   ? 158  ASP B CB  1 
ATOM   2832 C  CG  . ASP B 1 158 ? 59.800 84.888  2.128   1.00 7.71   ? 158  ASP B CG  1 
ATOM   2833 O  OD1 . ASP B 1 158 ? 59.030 83.968  1.853   1.00 7.27   ? 158  ASP B OD1 1 
ATOM   2834 O  OD2 . ASP B 1 158 ? 60.309 85.022  3.205   1.00 7.44   ? 158  ASP B OD2 1 
ATOM   2835 N  N   . ILE B 1 159 ? 56.943 85.445  -0.016  1.00 6.43   ? 159  ILE B N   1 
ATOM   2836 C  CA  . ILE B 1 159 ? 55.557 85.681  0.381   1.00 6.78   ? 159  ILE B CA  1 
ATOM   2837 C  C   . ILE B 1 159 ? 55.003 84.718  1.453   1.00 6.80   ? 159  ILE B C   1 
ATOM   2838 O  O   . ILE B 1 159 ? 53.820 84.706  1.710   1.00 7.96   ? 159  ILE B O   1 
ATOM   2839 C  CB  . ILE B 1 159 ? 54.559 85.906  -0.836  1.00 7.05   ? 159  ILE B CB  1 
ATOM   2840 C  CG1 . ILE B 1 159 ? 54.645 84.787  -1.883  1.00 7.38   ? 159  ILE B CG1 1 
ATOM   2841 C  CG2 . ILE B 1 159 ? 54.792 87.295  -1.472  1.00 7.00   ? 159  ILE B CG2 1 
ATOM   2842 C  CD1 . ILE B 1 159 ? 53.853 83.524  -1.496  1.00 7.63   ? 159  ILE B CD1 1 
ATOM   2843 N  N   . TRP B 1 160 ? 55.875 83.954  2.099   1.00 6.48   ? 160  TRP B N   1 
ATOM   2844 C  CA  . TRP B 1 160 ? 55.503 83.330  3.359   1.00 7.21   ? 160  TRP B CA  1 
ATOM   2845 C  C   . TRP B 1 160 ? 54.933 84.404  4.275   1.00 8.16   ? 160  TRP B C   1 
ATOM   2846 O  O   . TRP B 1 160 ? 55.426 85.534  4.294   1.00 7.96   ? 160  TRP B O   1 
ATOM   2847 C  CB  . TRP B 1 160 ? 56.739 82.754  4.019   1.00 6.61   ? 160  TRP B CB  1 
ATOM   2848 C  CG  . TRP B 1 160 ? 57.213 81.444  3.457   1.00 5.04   ? 160  TRP B CG  1 
ATOM   2849 C  CD1 . TRP B 1 160 ? 57.695 81.210  2.209   1.00 5.59   ? 160  TRP B CD1 1 
ATOM   2850 C  CD2 . TRP B 1 160 ? 57.325 80.194  4.177   1.00 7.64   ? 160  TRP B CD2 1 
ATOM   2851 N  NE1 . TRP B 1 160 ? 58.078 79.872  2.085   1.00 7.66   ? 160  TRP B NE1 1 
ATOM   2852 C  CE2 . TRP B 1 160 ? 57.864 79.231  3.279   1.00 6.08   ? 160  TRP B CE2 1 
ATOM   2853 C  CE3 . TRP B 1 160 ? 57.012 79.792  5.493   1.00 7.90   ? 160  TRP B CE3 1 
ATOM   2854 C  CZ2 . TRP B 1 160 ? 58.084 77.884  3.651   1.00 3.76   ? 160  TRP B CZ2 1 
ATOM   2855 C  CZ3 . TRP B 1 160 ? 57.229 78.448  5.861   1.00 7.83   ? 160  TRP B CZ3 1 
ATOM   2856 C  CH2 . TRP B 1 160 ? 57.765 77.520  4.944   1.00 5.80   ? 160  TRP B CH2 1 
ATOM   2857 N  N   . GLU B 1 161 ? 53.932 84.021  5.065   1.00 8.63   ? 161  GLU B N   1 
ATOM   2858 C  CA  . GLU B 1 161 ? 53.285 84.939  5.992   1.00 9.40   ? 161  GLU B CA  1 
ATOM   2859 C  C   . GLU B 1 161 ? 54.212 85.590  6.996   1.00 9.30   ? 161  GLU B C   1 
ATOM   2860 O  O   . GLU B 1 161 ? 54.033 86.760  7.275   1.00 10.18  ? 161  GLU B O   1 
ATOM   2861 C  CB  . GLU B 1 161 ? 52.087 84.274  6.677   1.00 10.07  ? 161  GLU B CB  1 
ATOM   2862 C  CG  . GLU B 1 161 ? 50.960 84.072  5.686   1.00 10.88  ? 161  GLU B CG  1 
ATOM   2863 C  CD  . GLU B 1 161 ? 49.751 83.363  6.267   1.00 11.46  ? 161  GLU B CD  1 
ATOM   2864 O  OE1 . GLU B 1 161 ? 49.918 82.481  7.132   1.00 8.81   ? 161  GLU B OE1 1 
ATOM   2865 O  OE2 . GLU B 1 161 ? 48.642 83.676  5.809   1.00 8.77   ? 161  GLU B OE2 1 
ATOM   2866 N  N   . HIS B 1 162 ? 55.196 84.853  7.524   1.00 9.04   ? 162  HIS B N   1 
ATOM   2867 C  CA  . HIS B 1 162 ? 56.173 85.459  8.419   1.00 8.22   ? 162  HIS B CA  1 
ATOM   2868 C  C   . HIS B 1 162 ? 56.974 86.636  7.821   1.00 8.41   ? 162  HIS B C   1 
ATOM   2869 O  O   . HIS B 1 162 ? 57.461 87.450  8.589   1.00 9.45   ? 162  HIS B O   1 
ATOM   2870 C  CB  . HIS B 1 162 ? 57.117 84.421  9.021   1.00 7.63   ? 162  HIS B CB  1 
ATOM   2871 C  CG  . HIS B 1 162 ? 58.049 83.800  8.039   1.00 6.54   ? 162  HIS B CG  1 
ATOM   2872 N  ND1 . HIS B 1 162 ? 58.048 82.451  7.766   1.00 8.01   ? 162  HIS B ND1 1 
ATOM   2873 C  CD2 . HIS B 1 162 ? 58.998 84.343  7.237   1.00 7.97   ? 162  HIS B CD2 1 
ATOM   2874 C  CE1 . HIS B 1 162 ? 58.978 82.183  6.869   1.00 6.22   ? 162  HIS B CE1 1 
ATOM   2875 N  NE2 . HIS B 1 162 ? 59.560 83.315  6.534   1.00 7.86   ? 162  HIS B NE2 1 
ATOM   2876 N  N   . ALA B 1 163 ? 57.081 86.732  6.490   1.00 8.28   ? 163  ALA B N   1 
ATOM   2877 C  CA  . ALA B 1 163 ? 57.728 87.879  5.811   1.00 7.98   ? 163  ALA B CA  1 
ATOM   2878 C  C   . ALA B 1 163 ? 57.049 89.226  6.069   1.00 9.02   ? 163  ALA B C   1 
ATOM   2879 O  O   . ALA B 1 163 ? 57.713 90.290  6.066   1.00 9.28   ? 163  ALA B O   1 
ATOM   2880 C  CB  . ALA B 1 163 ? 57.829 87.638  4.281   1.00 7.52   ? 163  ALA B CB  1 
ATOM   2881 N  N   . TYR B 1 164 ? 55.735 89.195  6.298   1.00 8.78   ? 164  TYR B N   1 
ATOM   2882 C  CA  . TYR B 1 164 ? 54.969 90.441  6.340   1.00 8.75   ? 164  TYR B CA  1 
ATOM   2883 C  C   . TYR B 1 164 ? 53.986 90.563  7.511   1.00 9.39   ? 164  TYR B C   1 
ATOM   2884 O  O   . TYR B 1 164 ? 53.533 91.694  7.830   1.00 9.03   ? 164  TYR B O   1 
ATOM   2885 C  CB  . TYR B 1 164 ? 54.273 90.677  4.995   1.00 8.47   ? 164  TYR B CB  1 
ATOM   2886 C  CG  . TYR B 1 164 ? 53.306 89.585  4.548   1.00 8.32   ? 164  TYR B CG  1 
ATOM   2887 C  CD1 . TYR B 1 164 ? 51.958 89.613  4.940   1.00 6.81   ? 164  TYR B CD1 1 
ATOM   2888 C  CD2 . TYR B 1 164 ? 53.738 88.537  3.725   1.00 8.84   ? 164  TYR B CD2 1 
ATOM   2889 C  CE1 . TYR B 1 164 ? 51.053 88.612  4.533   1.00 8.77   ? 164  TYR B CE1 1 
ATOM   2890 C  CE2 . TYR B 1 164 ? 52.842 87.544  3.267   1.00 8.18   ? 164  TYR B CE2 1 
ATOM   2891 C  CZ  . TYR B 1 164 ? 51.499 87.578  3.692   1.00 9.44   ? 164  TYR B CZ  1 
ATOM   2892 O  OH  . TYR B 1 164 ? 50.607 86.591  3.265   1.00 8.95   ? 164  TYR B OH  1 
ATOM   2893 N  N   . TYR B 1 165 ? 53.697 89.437  8.181   1.00 8.44   ? 165  TYR B N   1 
ATOM   2894 C  CA  . TYR B 1 165 ? 52.555 89.408  9.084   1.00 7.87   ? 165  TYR B CA  1 
ATOM   2895 C  C   . TYR B 1 165 ? 52.671 90.420  10.231  1.00 8.07   ? 165  TYR B C   1 
ATOM   2896 O  O   . TYR B 1 165 ? 51.646 90.931  10.725  1.00 6.87   ? 165  TYR B O   1 
ATOM   2897 C  CB  . TYR B 1 165 ? 52.225 87.996  9.612   1.00 8.54   ? 165  TYR B CB  1 
ATOM   2898 C  CG  . TYR B 1 165 ? 50.733 87.812  9.719   1.00 8.13   ? 165  TYR B CG  1 
ATOM   2899 C  CD1 . TYR B 1 165 ? 49.981 87.563  8.572   1.00 6.22   ? 165  TYR B CD1 1 
ATOM   2900 C  CD2 . TYR B 1 165 ? 50.065 87.930  10.947  1.00 10.03  ? 165  TYR B CD2 1 
ATOM   2901 C  CE1 . TYR B 1 165 ? 48.598 87.454  8.604   1.00 6.43   ? 165  TYR B CE1 1 
ATOM   2902 C  CE2 . TYR B 1 165 ? 48.646 87.789  11.004  1.00 9.55   ? 165  TYR B CE2 1 
ATOM   2903 C  CZ  . TYR B 1 165 ? 47.938 87.566  9.818   1.00 7.98   ? 165  TYR B CZ  1 
ATOM   2904 O  OH  . TYR B 1 165 ? 46.582 87.464  9.817   1.00 9.13   ? 165  TYR B OH  1 
ATOM   2905 N  N   . ILE B 1 166 ? 53.906 90.702  10.672  1.00 7.82   ? 166  ILE B N   1 
ATOM   2906 C  CA  . ILE B 1 166 ? 54.107 91.611  11.800  1.00 8.24   ? 166  ILE B CA  1 
ATOM   2907 C  C   . ILE B 1 166 ? 53.704 93.021  11.384  1.00 8.64   ? 166  ILE B C   1 
ATOM   2908 O  O   . ILE B 1 166 ? 53.141 93.790  12.185  1.00 8.95   ? 166  ILE B O   1 
ATOM   2909 C  CB  . ILE B 1 166 ? 55.571 91.622  12.327  1.00 8.29   ? 166  ILE B CB  1 
ATOM   2910 C  CG1 . ILE B 1 166 ? 55.942 90.247  12.912  1.00 8.00   ? 166  ILE B CG1 1 
ATOM   2911 C  CG2 . ILE B 1 166 ? 55.752 92.722  13.407  1.00 8.42   ? 166  ILE B CG2 1 
ATOM   2912 C  CD1 . ILE B 1 166 ? 57.489 90.026  13.053  1.00 6.89   ? 166  ILE B CD1 1 
ATOM   2913 N  N   . ASP B 1 167 ? 54.017 93.348  10.141  1.00 8.25   ? 167  ASP B N   1 
ATOM   2914 C  CA  . ASP B 1 167 ? 53.887 94.717  9.660   1.00 9.31   ? 167  ASP B CA  1 
ATOM   2915 C  C   . ASP B 1 167 ? 52.573 94.963  8.939   1.00 8.88   ? 167  ASP B C   1 
ATOM   2916 O  O   . ASP B 1 167 ? 52.045 96.086  8.984   1.00 8.63   ? 167  ASP B O   1 
ATOM   2917 C  CB  . ASP B 1 167 ? 55.048 95.049  8.733   1.00 8.81   ? 167  ASP B CB  1 
ATOM   2918 C  CG  . ASP B 1 167 ? 56.406 94.836  9.400   1.00 9.83   ? 167  ASP B CG  1 
ATOM   2919 O  OD1 . ASP B 1 167 ? 56.499 95.080  10.627  1.00 7.70   ? 167  ASP B OD1 1 
ATOM   2920 O  OD2 . ASP B 1 167 ? 57.363 94.416  8.699   1.00 8.70   ? 167  ASP B OD2 1 
ATOM   2921 N  N   . TYR B 1 168 ? 52.047 93.930  8.281   1.00 8.37   ? 168  TYR B N   1 
ATOM   2922 C  CA  . TYR B 1 168 ? 50.884 94.128  7.374   1.00 8.25   ? 168  TYR B CA  1 
ATOM   2923 C  C   . TYR B 1 168 ? 49.735 93.199  7.684   1.00 7.99   ? 168  TYR B C   1 
ATOM   2924 O  O   . TYR B 1 168 ? 48.683 93.310  7.059   1.00 8.77   ? 168  TYR B O   1 
ATOM   2925 C  CB  . TYR B 1 168 ? 51.304 94.008  5.898   1.00 9.09   ? 168  TYR B CB  1 
ATOM   2926 C  CG  . TYR B 1 168 ? 52.363 95.031  5.498   1.00 8.14   ? 168  TYR B CG  1 
ATOM   2927 C  CD1 . TYR B 1 168 ? 51.999 96.329  5.130   1.00 10.36  ? 168  TYR B CD1 1 
ATOM   2928 C  CD2 . TYR B 1 168 ? 53.718 94.709  5.526   1.00 9.06   ? 168  TYR B CD2 1 
ATOM   2929 C  CE1 . TYR B 1 168 ? 52.972 97.301  4.793   1.00 7.97   ? 168  TYR B CE1 1 
ATOM   2930 C  CE2 . TYR B 1 168 ? 54.693 95.651  5.183   1.00 5.84   ? 168  TYR B CE2 1 
ATOM   2931 C  CZ  . TYR B 1 168 ? 54.302 96.957  4.819   1.00 10.44  ? 168  TYR B CZ  1 
ATOM   2932 O  OH  . TYR B 1 168 ? 55.260 97.907  4.464   1.00 8.29   ? 168  TYR B OH  1 
ATOM   2933 N  N   . ARG B 1 169 ? 49.931 92.312  8.665   1.00 8.28   ? 169  ARG B N   1 
ATOM   2934 C  CA  . ARG B 1 169 ? 48.959 91.261  8.971   1.00 7.92   ? 169  ARG B CA  1 
ATOM   2935 C  C   . ARG B 1 169 ? 48.530 90.541  7.676   1.00 9.27   ? 169  ARG B C   1 
ATOM   2936 O  O   . ARG B 1 169 ? 49.380 90.026  6.931   1.00 9.90   ? 169  ARG B O   1 
ATOM   2937 C  CB  . ARG B 1 169 ? 47.764 91.816  9.764   1.00 8.09   ? 169  ARG B CB  1 
ATOM   2938 C  CG  . ARG B 1 169 ? 48.133 92.468  11.107  1.00 6.83   ? 169  ARG B CG  1 
ATOM   2939 C  CD  . ARG B 1 169 ? 48.264 91.469  12.247  1.00 8.08   ? 169  ARG B CD  1 
ATOM   2940 N  NE  . ARG B 1 169 ? 48.467 92.103  13.551  1.00 6.86   ? 169  ARG B NE  1 
ATOM   2941 C  CZ  . ARG B 1 169 ? 49.640 92.516  14.026  1.00 9.10   ? 169  ARG B CZ  1 
ATOM   2942 N  NH1 . ARG B 1 169 ? 50.744 92.376  13.307  1.00 9.98   ? 169  ARG B NH1 1 
ATOM   2943 N  NH2 . ARG B 1 169 ? 49.707 93.059  15.233  1.00 11.00  ? 169  ARG B NH2 1 
ATOM   2944 N  N   . ASN B 1 170 ? 47.234 90.494  7.409   1.00 8.53   ? 170  ASN B N   1 
ATOM   2945 C  CA  . ASN B 1 170 ? 46.708 89.762  6.261   1.00 9.78   ? 170  ASN B CA  1 
ATOM   2946 C  C   . ASN B 1 170 ? 46.914 90.506  4.927   1.00 9.12   ? 170  ASN B C   1 
ATOM   2947 O  O   . ASN B 1 170 ? 46.670 89.948  3.853   1.00 9.26   ? 170  ASN B O   1 
ATOM   2948 C  CB  . ASN B 1 170 ? 45.208 89.515  6.465   1.00 8.30   ? 170  ASN B CB  1 
ATOM   2949 C  CG  . ASN B 1 170 ? 44.408 90.808  6.520   1.00 8.99   ? 170  ASN B CG  1 
ATOM   2950 O  OD1 . ASN B 1 170 ? 44.502 91.566  7.465   1.00 9.97   ? 170  ASN B OD1 1 
ATOM   2951 N  ND2 . ASN B 1 170 ? 43.626 91.064  5.487   1.00 10.08  ? 170  ASN B ND2 1 
ATOM   2952 N  N   . ASP B 1 171 ? 47.347 91.766  5.006   1.00 9.55   ? 171  ASP B N   1 
ATOM   2953 C  CA  . ASP B 1 171 ? 47.395 92.653  3.818   1.00 9.04   ? 171  ASP B CA  1 
ATOM   2954 C  C   . ASP B 1 171 ? 48.690 92.443  3.049   1.00 8.89   ? 171  ASP B C   1 
ATOM   2955 O  O   . ASP B 1 171 ? 49.551 93.331  2.993   1.00 8.73   ? 171  ASP B O   1 
ATOM   2956 C  CB  . ASP B 1 171 ? 47.212 94.122  4.251   1.00 8.68   ? 171  ASP B CB  1 
ATOM   2957 C  CG  . ASP B 1 171 ? 47.013 95.072  3.078   1.00 9.62   ? 171  ASP B CG  1 
ATOM   2958 O  OD1 . ASP B 1 171 ? 46.847 94.622  1.904   1.00 9.06   ? 171  ASP B OD1 1 
ATOM   2959 O  OD2 . ASP B 1 171 ? 47.046 96.280  3.352   1.00 8.21   ? 171  ASP B OD2 1 
ATOM   2960 N  N   . ARG B 1 172 ? 48.832 91.242  2.470   1.00 9.19   ? 172  ARG B N   1 
ATOM   2961 C  CA  . ARG B 1 172 ? 49.975 90.944  1.628   1.00 8.81   ? 172  ARG B CA  1 
ATOM   2962 C  C   . ARG B 1 172 ? 50.188 91.978  0.496   1.00 8.65   ? 172  ARG B C   1 
ATOM   2963 O  O   . ARG B 1 172 ? 51.352 92.281  0.158   1.00 9.75   ? 172  ARG B O   1 
ATOM   2964 C  CB  . ARG B 1 172 ? 49.899 89.527  1.042   1.00 7.34   ? 172  ARG B CB  1 
ATOM   2965 C  CG  . ARG B 1 172 ? 51.232 89.097  0.393   1.00 8.01   ? 172  ARG B CG  1 
ATOM   2966 C  CD  . ARG B 1 172 ? 51.082 87.915  -0.544  1.00 6.79   ? 172  ARG B CD  1 
ATOM   2967 N  NE  . ARG B 1 172 ? 50.751 86.690  0.175   1.00 8.04   ? 172  ARG B NE  1 
ATOM   2968 C  CZ  . ARG B 1 172 ? 50.492 85.525  -0.407  1.00 8.01   ? 172  ARG B CZ  1 
ATOM   2969 N  NH1 . ARG B 1 172 ? 50.540 85.429  -1.727  1.00 6.48   ? 172  ARG B NH1 1 
ATOM   2970 N  NH2 . ARG B 1 172 ? 50.187 84.462  0.331   1.00 8.23   ? 172  ARG B NH2 1 
ATOM   2971 N  N   . PRO B 1 173 ? 49.094 92.462  -0.146  1.00 8.46   ? 173  PRO B N   1 
ATOM   2972 C  CA  . PRO B 1 173 ? 49.343 93.445  -1.211  1.00 8.44   ? 173  PRO B CA  1 
ATOM   2973 C  C   . PRO B 1 173 ? 50.064 94.737  -0.802  1.00 8.59   ? 173  PRO B C   1 
ATOM   2974 O  O   . PRO B 1 173 ? 50.807 95.260  -1.600  1.00 9.37   ? 173  PRO B O   1 
ATOM   2975 C  CB  . PRO B 1 173 ? 47.942 93.693  -1.821  1.00 8.18   ? 173  PRO B CB  1 
ATOM   2976 C  CG  . PRO B 1 173 ? 47.136 92.410  -1.441  1.00 8.06   ? 173  PRO B CG  1 
ATOM   2977 C  CD  . PRO B 1 173 ? 47.667 92.079  -0.060  1.00 7.61   ? 173  PRO B CD  1 
ATOM   2978 N  N   . SER B 1 174 ? 49.870 95.234  0.426   1.00 8.72   ? 174  SER B N   1 
ATOM   2979 C  CA  . SER B 1 174 ? 50.646 96.375  0.918   1.00 9.10   ? 174  SER B CA  1 
ATOM   2980 C  C   . SER B 1 174 ? 52.111 96.068  1.181   1.00 8.93   ? 174  SER B C   1 
ATOM   2981 O  O   . SER B 1 174 ? 52.958 96.960  1.091   1.00 9.13   ? 174  SER B O   1 
ATOM   2982 C  CB  . SER B 1 174 ? 50.032 96.971  2.193   1.00 9.27   ? 174  SER B CB  1 
ATOM   2983 O  OG  . SER B 1 174 ? 48.759 97.514  1.894   1.00 9.13   ? 174  SER B OG  1 
ATOM   2984 N  N   . TYR B 1 175 ? 52.400 94.828  1.566   1.00 8.61   ? 175  TYR B N   1 
ATOM   2985 C  CA  . TYR B 1 175 ? 53.764 94.375  1.695   1.00 8.42   ? 175  TYR B CA  1 
ATOM   2986 C  C   . TYR B 1 175 ? 54.435 94.389  0.321   1.00 8.66   ? 175  TYR B C   1 
ATOM   2987 O  O   . TYR B 1 175 ? 55.528 94.898  0.168   1.00 8.87   ? 175  TYR B O   1 
ATOM   2988 C  CB  . TYR B 1 175 ? 53.789 92.962  2.276   1.00 8.18   ? 175  TYR B CB  1 
ATOM   2989 C  CG  . TYR B 1 175 ? 55.074 92.187  2.054   1.00 9.80   ? 175  TYR B CG  1 
ATOM   2990 C  CD1 . TYR B 1 175 ? 56.265 92.524  2.734   1.00 6.80   ? 175  TYR B CD1 1 
ATOM   2991 C  CD2 . TYR B 1 175 ? 55.095 91.093  1.187   1.00 9.36   ? 175  TYR B CD2 1 
ATOM   2992 C  CE1 . TYR B 1 175 ? 57.430 91.777  2.541   1.00 8.64   ? 175  TYR B CE1 1 
ATOM   2993 C  CE2 . TYR B 1 175 ? 56.248 90.361  0.987   1.00 9.39   ? 175  TYR B CE2 1 
ATOM   2994 C  CZ  . TYR B 1 175 ? 57.403 90.696  1.650   1.00 8.35   ? 175  TYR B CZ  1 
ATOM   2995 O  OH  . TYR B 1 175 ? 58.520 89.920  1.447   1.00 9.66   ? 175  TYR B OH  1 
ATOM   2996 N  N   . VAL B 1 176 ? 53.766 93.798  -0.655  1.00 9.37   ? 176  VAL B N   1 
ATOM   2997 C  CA  . VAL B 1 176 ? 54.249 93.753  -2.041  1.00 9.43   ? 176  VAL B CA  1 
ATOM   2998 C  C   . VAL B 1 176 ? 54.461 95.171  -2.606  1.00 8.96   ? 176  VAL B C   1 
ATOM   2999 O  O   . VAL B 1 176 ? 55.507 95.479  -3.193  1.00 9.25   ? 176  VAL B O   1 
ATOM   3000 C  CB  . VAL B 1 176 ? 53.320 92.906  -2.940  1.00 9.04   ? 176  VAL B CB  1 
ATOM   3001 C  CG1 . VAL B 1 176 ? 53.721 93.050  -4.422  1.00 10.06  ? 176  VAL B CG1 1 
ATOM   3002 C  CG2 . VAL B 1 176 ? 53.358 91.385  -2.519  1.00 8.71   ? 176  VAL B CG2 1 
ATOM   3003 N  N   . LYS B 1 177 ? 53.485 96.036  -2.400  1.00 9.47   ? 177  LYS B N   1 
ATOM   3004 C  CA  . LYS B 1 177 ? 53.630 97.431  -2.788  1.00 9.55   ? 177  LYS B CA  1 
ATOM   3005 C  C   . LYS B 1 177 ? 54.904 98.031  -2.156  1.00 9.45   ? 177  LYS B C   1 
ATOM   3006 O  O   . LYS B 1 177 ? 55.710 98.659  -2.830  1.00 9.27   ? 177  LYS B O   1 
ATOM   3007 C  CB  . LYS B 1 177 ? 52.375 98.206  -2.383  1.00 9.08   ? 177  LYS B CB  1 
ATOM   3008 C  CG  . LYS B 1 177 ? 52.410 99.687  -2.717  1.00 11.90  ? 177  LYS B CG  1 
ATOM   3009 C  CD  . LYS B 1 177 ? 51.038 100.367 -2.475  1.00 11.53  ? 177  LYS B CD  1 
ATOM   3010 C  CE  . LYS B 1 177 ? 50.877 101.556 -3.406  1.00 19.44  ? 177  LYS B CE  1 
ATOM   3011 N  NZ  . LYS B 1 177 ? 50.152 102.680 -2.753  1.00 21.61  ? 177  LYS B NZ  1 
ATOM   3012 N  N   . ALA B 1 178 ? 55.083 97.796  -0.861  1.00 9.31   ? 178  ALA B N   1 
ATOM   3013 C  CA  . ALA B 1 178 ? 56.212 98.331  -0.135  1.00 10.45  ? 178  ALA B CA  1 
ATOM   3014 C  C   . ALA B 1 178 ? 57.522 97.776  -0.613  1.00 9.50   ? 178  ALA B C   1 
ATOM   3015 O  O   . ALA B 1 178 ? 58.525 98.452  -0.590  1.00 10.79  ? 178  ALA B O   1 
ATOM   3016 C  CB  . ALA B 1 178 ? 56.064 98.108  1.389   1.00 8.48   ? 178  ALA B CB  1 
ATOM   3017 N  N   . TRP B 1 179 ? 57.509 96.518  -1.003  1.00 10.51  ? 179  TRP B N   1 
ATOM   3018 C  CA  . TRP B 1 179 ? 58.720 95.840  -1.462  1.00 9.99   ? 179  TRP B CA  1 
ATOM   3019 C  C   . TRP B 1 179 ? 59.367 96.560  -2.662  1.00 9.55   ? 179  TRP B C   1 
ATOM   3020 O  O   . TRP B 1 179 ? 60.588 96.501  -2.851  1.00 9.43   ? 179  TRP B O   1 
ATOM   3021 C  CB  . TRP B 1 179 ? 58.383 94.364  -1.774  1.00 9.59   ? 179  TRP B CB  1 
ATOM   3022 C  CG  . TRP B 1 179 ? 59.582 93.587  -2.160  1.00 11.03  ? 179  TRP B CG  1 
ATOM   3023 C  CD1 . TRP B 1 179 ? 60.487 93.011  -1.322  1.00 9.67   ? 179  TRP B CD1 1 
ATOM   3024 C  CD2 . TRP B 1 179 ? 60.003 93.283  -3.489  1.00 11.32  ? 179  TRP B CD2 1 
ATOM   3025 N  NE1 . TRP B 1 179 ? 61.480 92.384  -2.047  1.00 9.68   ? 179  TRP B NE1 1 
ATOM   3026 C  CE2 . TRP B 1 179 ? 61.204 92.536  -3.384  1.00 11.36  ? 179  TRP B CE2 1 
ATOM   3027 C  CE3 . TRP B 1 179 ? 59.500 93.593  -4.766  1.00 11.41  ? 179  TRP B CE3 1 
ATOM   3028 C  CZ2 . TRP B 1 179 ? 61.911 92.082  -4.511  1.00 10.44  ? 179  TRP B CZ2 1 
ATOM   3029 C  CZ3 . TRP B 1 179 ? 60.202 93.115  -5.893  1.00 9.92   ? 179  TRP B CZ3 1 
ATOM   3030 C  CH2 . TRP B 1 179 ? 61.391 92.381  -5.754  1.00 9.76   ? 179  TRP B CH2 1 
ATOM   3031 N  N   . TRP B 1 180 ? 58.556 97.236  -3.476  1.00 10.15  ? 180  TRP B N   1 
ATOM   3032 C  CA  . TRP B 1 180 ? 59.106 98.001  -4.623  1.00 10.14  ? 180  TRP B CA  1 
ATOM   3033 C  C   . TRP B 1 180 ? 60.046 99.160  -4.231  1.00 10.24  ? 180  TRP B C   1 
ATOM   3034 O  O   . TRP B 1 180 ? 60.848 99.608  -5.053  1.00 10.92  ? 180  TRP B O   1 
ATOM   3035 C  CB  . TRP B 1 180 ? 57.986 98.449  -5.582  1.00 9.69   ? 180  TRP B CB  1 
ATOM   3036 C  CG  . TRP B 1 180 ? 57.319 97.248  -6.213  1.00 9.34   ? 180  TRP B CG  1 
ATOM   3037 C  CD1 . TRP B 1 180 ? 56.123 96.683  -5.866  1.00 9.00   ? 180  TRP B CD1 1 
ATOM   3038 C  CD2 . TRP B 1 180 ? 57.873 96.419  -7.227  1.00 8.41   ? 180  TRP B CD2 1 
ATOM   3039 N  NE1 . TRP B 1 180 ? 55.893 95.566  -6.631  1.00 8.66   ? 180  TRP B NE1 1 
ATOM   3040 C  CE2 . TRP B 1 180 ? 56.950 95.379  -7.472  1.00 10.29  ? 180  TRP B CE2 1 
ATOM   3041 C  CE3 . TRP B 1 180 ? 59.063 96.467  -7.982  1.00 8.71   ? 180  TRP B CE3 1 
ATOM   3042 C  CZ2 . TRP B 1 180 ? 57.169 94.373  -8.463  1.00 9.09   ? 180  TRP B CZ2 1 
ATOM   3043 C  CZ3 . TRP B 1 180 ? 59.296 95.458  -8.957  1.00 8.78   ? 180  TRP B CZ3 1 
ATOM   3044 C  CH2 . TRP B 1 180 ? 58.337 94.438  -9.189  1.00 9.97   ? 180  TRP B CH2 1 
ATOM   3045 N  N   . ASN B 1 181 ? 59.977 99.612  -2.975  1.00 10.25  ? 181  ASN B N   1 
ATOM   3046 C  CA  . ASN B 1 181 ? 60.902 100.637 -2.436  1.00 9.79   ? 181  ASN B CA  1 
ATOM   3047 C  C   . ASN B 1 181 ? 62.238 100.035 -1.983  1.00 9.38   ? 181  ASN B C   1 
ATOM   3048 O  O   . ASN B 1 181 ? 63.162 100.754 -1.601  1.00 9.38   ? 181  ASN B O   1 
ATOM   3049 C  CB  . ASN B 1 181 ? 60.262 101.329 -1.232  1.00 10.06  ? 181  ASN B CB  1 
ATOM   3050 C  CG  . ASN B 1 181 ? 58.954 101.986 -1.558  1.00 11.81  ? 181  ASN B CG  1 
ATOM   3051 O  OD1 . ASN B 1 181 ? 57.905 101.681 -0.957  1.00 16.38  ? 181  ASN B OD1 1 
ATOM   3052 N  ND2 . ASN B 1 181 ? 58.999 102.919 -2.462  1.00 10.94  ? 181  ASN B ND2 1 
ATOM   3053 N  N   . LEU B 1 182 ? 62.319 98.710  -2.027  1.00 7.90   ? 182  LEU B N   1 
ATOM   3054 C  CA  . LEU B 1 182 ? 63.467 97.955  -1.501  1.00 8.37   ? 182  LEU B CA  1 
ATOM   3055 C  C   . LEU B 1 182 ? 64.227 97.191  -2.547  1.00 7.90   ? 182  LEU B C   1 
ATOM   3056 O  O   . LEU B 1 182 ? 65.369 96.832  -2.327  1.00 8.19   ? 182  LEU B O   1 
ATOM   3057 C  CB  . LEU B 1 182 ? 62.990 96.981  -0.410  1.00 7.28   ? 182  LEU B CB  1 
ATOM   3058 C  CG  . LEU B 1 182 ? 62.320 97.606  0.820   1.00 7.66   ? 182  LEU B CG  1 
ATOM   3059 C  CD1 . LEU B 1 182 ? 61.862 96.491  1.738   1.00 9.04   ? 182  LEU B CD1 1 
ATOM   3060 C  CD2 . LEU B 1 182 ? 63.272 98.590  1.555   1.00 8.33   ? 182  LEU B CD2 1 
ATOM   3061 N  N   . VAL B 1 183 ? 63.601 96.936  -3.698  1.00 8.44   ? 183  VAL B N   1 
ATOM   3062 C  CA  . VAL B 1 183 ? 64.212 96.054  -4.709  1.00 8.69   ? 183  VAL B CA  1 
ATOM   3063 C  C   . VAL B 1 183 ? 65.614 96.535  -5.169  1.00 9.85   ? 183  VAL B C   1 
ATOM   3064 O  O   . VAL B 1 183 ? 65.810 97.711  -5.511  1.00 9.59   ? 183  VAL B O   1 
ATOM   3065 C  CB  . VAL B 1 183 ? 63.218 95.769  -5.883  1.00 9.29   ? 183  VAL B CB  1 
ATOM   3066 C  CG1 . VAL B 1 183 ? 62.699 97.060  -6.490  1.00 7.44   ? 183  VAL B CG1 1 
ATOM   3067 C  CG2 . VAL B 1 183 ? 63.869 94.857  -6.939  1.00 10.89  ? 183  VAL B CG2 1 
ATOM   3068 N  N   . ASN B 1 184 ? 66.590 95.626  -5.127  1.00 9.51   ? 184  ASN B N   1 
ATOM   3069 C  CA  . ASN B 1 184 ? 67.987 95.985  -5.324  1.00 9.85   ? 184  ASN B CA  1 
ATOM   3070 C  C   . ASN B 1 184 ? 68.346 95.703  -6.773  1.00 9.86   ? 184  ASN B C   1 
ATOM   3071 O  O   . ASN B 1 184 ? 68.703 94.566  -7.134  1.00 9.03   ? 184  ASN B O   1 
ATOM   3072 C  CB  . ASN B 1 184 ? 68.881 95.202  -4.342  1.00 9.68   ? 184  ASN B CB  1 
ATOM   3073 C  CG  . ASN B 1 184 ? 70.313 95.698  -4.305  1.00 10.43  ? 184  ASN B CG  1 
ATOM   3074 O  OD1 . ASN B 1 184 ? 70.791 96.323  -5.239  1.00 13.13  ? 184  ASN B OD1 1 
ATOM   3075 N  ND2 . ASN B 1 184 ? 71.005 95.398  -3.221  1.00 9.68   ? 184  ASN B ND2 1 
ATOM   3076 N  N   . TRP B 1 185 ? 68.226 96.759  -7.590  1.00 9.79   ? 185  TRP B N   1 
ATOM   3077 C  CA  . TRP B 1 185 ? 68.583 96.723  -9.012  1.00 9.36   ? 185  TRP B CA  1 
ATOM   3078 C  C   . TRP B 1 185 ? 70.049 96.450  -9.264  1.00 9.97   ? 185  TRP B C   1 
ATOM   3079 O  O   . TRP B 1 185 ? 70.392 95.848  -10.278 1.00 10.05  ? 185  TRP B O   1 
ATOM   3080 C  CB  . TRP B 1 185 ? 68.152 98.005  -9.731  1.00 8.91   ? 185  TRP B CB  1 
ATOM   3081 C  CG  . TRP B 1 185 ? 66.672 98.257  -9.645  1.00 9.31   ? 185  TRP B CG  1 
ATOM   3082 C  CD1 . TRP B 1 185 ? 66.072 99.309  -9.038  1.00 8.67   ? 185  TRP B CD1 1 
ATOM   3083 C  CD2 . TRP B 1 185 ? 65.611 97.408  -10.121 1.00 10.39  ? 185  TRP B CD2 1 
ATOM   3084 N  NE1 . TRP B 1 185 ? 64.704 99.206  -9.138  1.00 10.50  ? 185  TRP B NE1 1 
ATOM   3085 C  CE2 . TRP B 1 185 ? 64.393 98.051  -9.806  1.00 10.55  ? 185  TRP B CE2 1 
ATOM   3086 C  CE3 . TRP B 1 185 ? 65.576 96.177  -10.808 1.00 11.42  ? 185  TRP B CE3 1 
ATOM   3087 C  CZ2 . TRP B 1 185 ? 63.136 97.501  -10.139 1.00 11.02  ? 185  TRP B CZ2 1 
ATOM   3088 C  CZ3 . TRP B 1 185 ? 64.342 95.627  -11.137 1.00 9.99   ? 185  TRP B CZ3 1 
ATOM   3089 C  CH2 . TRP B 1 185 ? 63.132 96.288  -10.800 1.00 10.20  ? 185  TRP B CH2 1 
ATOM   3090 N  N   . ASN B 1 186 ? 70.917 96.896  -8.360  1.00 10.51  ? 186  ASN B N   1 
ATOM   3091 C  CA  . ASN B 1 186 ? 72.342 96.502  -8.408  1.00 10.86  ? 186  ASN B CA  1 
ATOM   3092 C  C   . ASN B 1 186 ? 72.556 94.988  -8.381  1.00 10.25  ? 186  ASN B C   1 
ATOM   3093 O  O   . ASN B 1 186 ? 73.316 94.452  -9.200  1.00 10.36  ? 186  ASN B O   1 
ATOM   3094 C  CB  . ASN B 1 186 ? 73.127 97.135  -7.258  1.00 11.28  ? 186  ASN B CB  1 
ATOM   3095 C  CG  . ASN B 1 186 ? 73.120 98.642  -7.302  1.00 13.87  ? 186  ASN B CG  1 
ATOM   3096 O  OD1 . ASN B 1 186 ? 73.263 99.259  -8.359  1.00 17.87  ? 186  ASN B OD1 1 
ATOM   3097 N  ND2 . ASN B 1 186 ? 72.953 99.242  -6.153  1.00 18.82  ? 186  ASN B ND2 1 
ATOM   3098 N  N   . PHE B 1 187 ? 71.886 94.306  -7.450  1.00 10.26  ? 187  PHE B N   1 
ATOM   3099 C  CA  . PHE B 1 187 ? 71.970 92.832  -7.350  1.00 9.81   ? 187  PHE B CA  1 
ATOM   3100 C  C   . PHE B 1 187 ? 71.422 92.193  -8.642  1.00 9.93   ? 187  PHE B C   1 
ATOM   3101 O  O   . PHE B 1 187 ? 72.039 91.282  -9.201  1.00 10.80  ? 187  PHE B O   1 
ATOM   3102 C  CB  . PHE B 1 187 ? 71.231 92.345  -6.078  1.00 9.29   ? 187  PHE B CB  1 
ATOM   3103 C  CG  . PHE B 1 187 ? 71.399 90.863  -5.771  1.00 8.98   ? 187  PHE B CG  1 
ATOM   3104 C  CD1 . PHE B 1 187 ? 72.652 90.322  -5.532  1.00 8.74   ? 187  PHE B CD1 1 
ATOM   3105 C  CD2 . PHE B 1 187 ? 70.288 90.031  -5.686  1.00 9.28   ? 187  PHE B CD2 1 
ATOM   3106 C  CE1 . PHE B 1 187 ? 72.813 88.932  -5.209  1.00 8.82   ? 187  PHE B CE1 1 
ATOM   3107 C  CE2 . PHE B 1 187 ? 70.431 88.648  -5.338  1.00 11.21  ? 187  PHE B CE2 1 
ATOM   3108 C  CZ  . PHE B 1 187 ? 71.694 88.115  -5.113  1.00 9.85   ? 187  PHE B CZ  1 
ATOM   3109 N  N   . ALA B 1 188 ? 70.302 92.708  -9.155  1.00 9.80   ? 188  ALA B N   1 
ATOM   3110 C  CA  . ALA B 1 188 ? 69.747 92.265  -10.442 1.00 10.05  ? 188  ALA B CA  1 
ATOM   3111 C  C   . ALA B 1 188 ? 70.734 92.412  -11.614 1.00 10.97  ? 188  ALA B C   1 
ATOM   3112 O  O   . ALA B 1 188 ? 70.844 91.538  -12.481 1.00 9.82   ? 188  ALA B O   1 
ATOM   3113 C  CB  . ALA B 1 188 ? 68.445 93.007  -10.749 1.00 9.71   ? 188  ALA B CB  1 
ATOM   3114 N  N   . ASN B 1 189 ? 71.449 93.529  -11.636 1.00 12.06  ? 189  ASN B N   1 
ATOM   3115 C  CA  . ASN B 1 189 ? 72.458 93.769  -12.663 1.00 12.99  ? 189  ASN B CA  1 
ATOM   3116 C  C   . ASN B 1 189 ? 73.674 92.838  -12.544 1.00 13.89  ? 189  ASN B C   1 
ATOM   3117 O  O   . ASN B 1 189 ? 74.134 92.326  -13.558 1.00 14.44  ? 189  ASN B O   1 
ATOM   3118 C  CB  . ASN B 1 189 ? 72.874 95.227  -12.638 1.00 12.93  ? 189  ASN B CB  1 
ATOM   3119 C  CG  . ASN B 1 189 ? 71.856 96.122  -13.290 1.00 13.53  ? 189  ASN B CG  1 
ATOM   3120 O  OD1 . ASN B 1 189 ? 71.200 95.729  -14.254 1.00 14.83  ? 189  ASN B OD1 1 
ATOM   3121 N  ND2 . ASN B 1 189 ? 71.754 97.355  -12.807 1.00 13.79  ? 189  ASN B ND2 1 
ATOM   3122 N  N   . GLU B 1 190 ? 74.186 92.624  -11.324 1.00 14.57  ? 190  GLU B N   1 
ATOM   3123 C  CA  . GLU B 1 190 ? 75.237 91.622  -11.070 1.00 16.50  ? 190  GLU B CA  1 
ATOM   3124 C  C   . GLU B 1 190 ? 74.803 90.230  -11.545 1.00 15.02  ? 190  GLU B C   1 
ATOM   3125 O  O   . GLU B 1 190 ? 75.551 89.507  -12.246 1.00 14.56  ? 190  GLU B O   1 
ATOM   3126 C  CB  . GLU B 1 190 ? 75.572 91.528  -9.567  1.00 16.54  ? 190  GLU B CB  1 
ATOM   3127 C  CG  . GLU B 1 190 ? 76.172 92.781  -8.896  1.00 20.76  ? 190  GLU B CG  1 
ATOM   3128 C  CD  . GLU B 1 190 ? 76.127 92.685  -7.332  1.00 22.59  ? 190  GLU B CD  1 
ATOM   3129 O  OE1 . GLU B 1 190 ? 76.053 91.543  -6.773  1.00 28.13  ? 190  GLU B OE1 1 
ATOM   3130 O  OE2 . GLU B 1 190 ? 76.176 93.748  -6.664  1.00 29.52  ? 190  GLU B OE2 1 
ATOM   3131 N  N   . ASN B 1 191 ? 73.603 89.828  -11.143 1.00 14.00  ? 191  ASN B N   1 
ATOM   3132 C  CA  . ASN B 1 191 ? 73.082 88.519  -11.546 1.00 13.49  ? 191  ASN B CA  1 
ATOM   3133 C  C   . ASN B 1 191 ? 72.899 88.377  -13.045 1.00 14.04  ? 191  ASN B C   1 
ATOM   3134 O  O   . ASN B 1 191 ? 73.265 87.353  -13.640 1.00 13.59  ? 191  ASN B O   1 
ATOM   3135 C  CB  . ASN B 1 191 ? 71.777 88.195  -10.802 1.00 12.87  ? 191  ASN B CB  1 
ATOM   3136 C  CG  . ASN B 1 191 ? 72.000 88.025  -9.327  1.00 12.26  ? 191  ASN B CG  1 
ATOM   3137 O  OD1 . ASN B 1 191 ? 73.110 87.673  -8.897  1.00 9.02   ? 191  ASN B OD1 1 
ATOM   3138 N  ND2 . ASN B 1 191 ? 70.976 88.312  -8.534  1.00 9.35   ? 191  ASN B ND2 1 
ATOM   3139 N  N   . LEU B 1 192 ? 72.348 89.418  -13.654 1.00 15.09  ? 192  LEU B N   1 
ATOM   3140 C  CA  . LEU B 1 192 ? 72.102 89.423  -15.087 1.00 16.35  ? 192  LEU B CA  1 
ATOM   3141 C  C   . LEU B 1 192 ? 73.411 89.351  -15.869 1.00 17.33  ? 192  LEU B C   1 
ATOM   3142 O  O   . LEU B 1 192 ? 73.505 88.599  -16.811 1.00 17.35  ? 192  LEU B O   1 
ATOM   3143 C  CB  . LEU B 1 192 ? 71.278 90.654  -15.481 1.00 15.75  ? 192  LEU B CB  1 
ATOM   3144 C  CG  . LEU B 1 192 ? 70.791 90.717  -16.924 1.00 17.33  ? 192  LEU B CG  1 
ATOM   3145 C  CD1 . LEU B 1 192 ? 69.858 89.563  -17.275 1.00 16.40  ? 192  LEU B CD1 1 
ATOM   3146 C  CD2 . LEU B 1 192 ? 70.120 92.063  -17.183 1.00 17.29  ? 192  LEU B CD2 1 
ATOM   3147 N  N   . LYS B 1 193 ? 74.410 90.130  -15.466 1.00 19.19  ? 193  LYS B N   1 
ATOM   3148 C  CA  . LYS B 1 193 ? 75.733 90.096  -16.109 1.00 21.72  ? 193  LYS B CA  1 
ATOM   3149 C  C   . LYS B 1 193 ? 76.315 88.678  -16.123 1.00 22.63  ? 193  LYS B C   1 
ATOM   3150 O  O   . LYS B 1 193 ? 76.815 88.216  -17.164 1.00 23.11  ? 193  LYS B O   1 
ATOM   3151 C  CB  . LYS B 1 193 ? 76.690 91.100  -15.441 1.00 21.66  ? 193  LYS B CB  1 
ATOM   3152 C  CG  . LYS B 1 193 ? 78.188 90.863  -15.724 1.00 25.71  ? 193  LYS B CG  1 
ATOM   3153 C  CD  . LYS B 1 193 ? 79.001 92.124  -15.470 1.00 32.00  ? 193  LYS B CD  1 
ATOM   3154 C  CE  . LYS B 1 193 ? 80.504 91.862  -15.439 1.00 33.31  ? 193  LYS B CE  1 
ATOM   3155 N  NZ  . LYS B 1 193 ? 81.204 93.183  -15.357 1.00 35.06  ? 193  LYS B NZ  1 
ATOM   3156 N  N   . LYS B 1 194 ? 76.233 87.985  -14.983 1.00 23.70  ? 194  LYS B N   1 
ATOM   3157 C  CA  . LYS B 1 194 ? 76.684 86.586  -14.887 1.00 24.76  ? 194  LYS B CA  1 
ATOM   3158 C  C   . LYS B 1 194 ? 75.822 85.595  -15.677 1.00 24.59  ? 194  LYS B C   1 
ATOM   3159 O  O   . LYS B 1 194 ? 76.344 84.673  -16.265 1.00 24.65  ? 194  LYS B O   1 
ATOM   3160 C  CB  . LYS B 1 194 ? 76.779 86.150  -13.417 1.00 24.49  ? 194  LYS B CB  1 
ATOM   3161 C  CG  . LYS B 1 194 ? 77.707 87.014  -12.594 1.00 26.44  ? 194  LYS B CG  1 
ATOM   3162 C  CD  . LYS B 1 194 ? 78.019 86.452  -11.200 1.00 27.30  ? 194  LYS B CD  1 
ATOM   3163 C  CE  . LYS B 1 194 ? 76.913 86.725  -10.162 1.00 31.68  ? 194  LYS B CE  1 
ATOM   3164 N  NZ  . LYS B 1 194 ? 77.485 87.098  -8.834  1.00 31.49  ? 194  LYS B NZ  1 
ATOM   3165 N  N   . ALA B 1 195 ? 74.499 85.771  -15.662 1.00 25.00  ? 195  ALA B N   1 
ATOM   3166 C  CA  . ALA B 1 195 ? 73.571 84.845  -16.302 1.00 24.69  ? 195  ALA B CA  1 
ATOM   3167 C  C   . ALA B 1 195 ? 73.590 84.928  -17.837 1.00 25.09  ? 195  ALA B C   1 
ATOM   3168 O  O   . ALA B 1 195 ? 73.425 83.918  -18.513 1.00 24.02  ? 195  ALA B O   1 
ATOM   3169 C  CB  . ALA B 1 195 ? 72.151 85.059  -15.761 1.00 24.44  ? 195  ALA B CB  1 
ATOM   3170 N  N   . LEU B 1 196 ? 73.792 86.136  -18.372 1.00 25.97  ? 196  LEU B N   1 
ATOM   3171 C  CA  . LEU B 1 196 ? 73.842 86.380  -19.830 1.00 26.75  ? 196  LEU B CA  1 
ATOM   3172 C  C   . LEU B 1 196 ? 75.199 86.032  -20.421 1.00 26.89  ? 196  LEU B C   1 
ATOM   3173 O  O   . LEU B 1 196 ? 75.567 84.867  -20.512 1.00 27.90  ? 196  LEU B O   1 
ATOM   3174 C  CB  . LEU B 1 196 ? 73.580 87.849  -20.142 1.00 26.45  ? 196  LEU B CB  1 
ATOM   3175 C  CG  . LEU B 1 196 ? 72.153 88.368  -20.157 1.00 27.18  ? 196  LEU B CG  1 
ATOM   3176 C  CD1 . LEU B 1 196 ? 72.213 89.887  -20.139 1.00 28.91  ? 196  LEU B CD1 1 
ATOM   3177 C  CD2 . LEU B 1 196 ? 71.426 87.876  -21.395 1.00 29.13  ? 196  LEU B CD2 1 
HETATM 3178 CL CL  . CL  C 2 .   ? 42.253 93.843  16.244  1.00 14.03  ? 2002 CL  A CL  1 
HETATM 3179 X  UNK . UNX D 3 .   ? 43.973 79.733  9.055   1.00 49.72  ? 1000 UNX A UNK 1 
HETATM 3180 CL CL  . CL  E 2 .   ? 69.165 99.783  -6.683  1.00 13.43  ? 2001 CL  B CL  1 
HETATM 3181 X  UNK . UNX F 3 .   ? 60.927 83.686  4.791   1.00 49.60  ? 1001 UNX B UNK 1 
HETATM 3182 X  UNK . UNX G 3 .   ? 48.777 96.427  10.354  1.00 321.95 ? 3001 UNX B UNK 1 
HETATM 3183 O  O   . HOH H 4 .   ? 51.273 80.164  6.492   1.00 5.29   ? 2003 HOH A O   1 
HETATM 3184 O  O   . HOH H 4 .   ? 52.506 76.271  2.085   1.00 5.86   ? 2004 HOH A O   1 
HETATM 3185 O  O   . HOH H 4 .   ? 45.059 85.869  11.824  1.00 6.83   ? 2005 HOH A O   1 
HETATM 3186 O  O   . HOH H 4 .   ? 55.770 77.990  9.289   1.00 8.61   ? 2006 HOH A O   1 
HETATM 3187 O  O   . HOH H 4 .   ? 42.448 54.975  6.363   1.00 6.78   ? 2007 HOH A O   1 
HETATM 3188 O  O   . HOH H 4 .   ? 47.757 82.417  18.315  1.00 7.85   ? 2008 HOH A O   1 
HETATM 3189 O  O   . HOH H 4 .   ? 44.159 81.230  15.254  1.00 7.56   ? 2009 HOH A O   1 
HETATM 3190 O  O   . HOH H 4 .   ? 39.450 51.400  19.140  1.00 7.99   ? 2010 HOH A O   1 
HETATM 3191 O  O   . HOH H 4 .   ? 57.244 76.023  8.277   1.00 6.82   ? 2011 HOH A O   1 
HETATM 3192 O  O   . HOH H 4 .   ? 48.158 85.210  14.947  1.00 7.87   ? 2012 HOH A O   1 
HETATM 3193 O  O   . HOH H 4 .   ? 59.610 87.233  10.540  1.00 8.98   ? 2013 HOH A O   1 
HETATM 3194 O  O   . HOH H 4 .   ? 45.530 73.465  -1.172  1.00 9.56   ? 2014 HOH A O   1 
HETATM 3195 O  O   . HOH H 4 .   ? 44.654 78.413  7.267   1.00 6.80   ? 2015 HOH A O   1 
HETATM 3196 O  O   . HOH H 4 .   ? 49.574 62.508  7.379   1.00 9.78   ? 2016 HOH A O   1 
HETATM 3197 O  O   . HOH H 4 .   ? 44.664 63.267  4.755   1.00 10.27  ? 2017 HOH A O   1 
HETATM 3198 O  O   . HOH H 4 .   ? 45.432 55.612  8.955   1.00 9.28   ? 2018 HOH A O   1 
HETATM 3199 O  O   . HOH H 4 .   ? 52.965 77.476  8.677   1.00 10.64  ? 2019 HOH A O   1 
HETATM 3200 O  O   . HOH H 4 .   ? 50.349 57.923  29.884  1.00 11.64  ? 2020 HOH A O   1 
HETATM 3201 O  O   . HOH H 4 .   ? 40.094 84.983  21.831  1.00 10.33  ? 2021 HOH A O   1 
HETATM 3202 O  O   . HOH H 4 .   ? 52.115 70.727  23.241  1.00 10.15  ? 2022 HOH A O   1 
HETATM 3203 O  O   . HOH H 4 .   ? 33.001 78.039  16.767  1.00 10.61  ? 2023 HOH A O   1 
HETATM 3204 O  O   . HOH H 4 .   ? 55.286 70.206  4.215   1.00 12.61  ? 2024 HOH A O   1 
HETATM 3205 O  O   . HOH H 4 .   ? 54.781 67.273  11.058  1.00 11.90  ? 2025 HOH A O   1 
HETATM 3206 O  O   . HOH H 4 .   ? 46.300 57.993  5.595   1.00 13.84  ? 2026 HOH A O   1 
HETATM 3207 O  O   . HOH H 4 .   ? 48.713 58.341  14.466  1.00 11.38  ? 2027 HOH A O   1 
HETATM 3208 O  O   . HOH H 4 .   ? 42.772 57.664  0.587   1.00 12.09  ? 2028 HOH A O   1 
HETATM 3209 O  O   . HOH H 4 .   ? 56.390 80.195  11.795  1.00 11.24  ? 2029 HOH A O   1 
HETATM 3210 O  O   . HOH H 4 .   ? 57.307 74.372  14.968  1.00 13.11  ? 2030 HOH A O   1 
HETATM 3211 O  O   . HOH H 4 .   ? 43.007 67.383  0.196   1.00 10.80  ? 2031 HOH A O   1 
HETATM 3212 O  O   . HOH H 4 .   ? 39.048 76.501  27.029  1.00 14.04  ? 2032 HOH A O   1 
HETATM 3213 O  O   . HOH H 4 .   ? 41.033 56.619  -1.167  1.00 11.82  ? 2033 HOH A O   1 
HETATM 3214 O  O   . HOH H 4 .   ? 52.213 78.314  25.485  1.00 12.46  ? 2034 HOH A O   1 
HETATM 3215 O  O   . HOH H 4 .   ? 45.104 82.372  1.922   1.00 14.41  ? 2035 HOH A O   1 
HETATM 3216 O  O   . HOH H 4 .   ? 54.278 72.455  21.877  1.00 13.42  ? 2036 HOH A O   1 
HETATM 3217 O  O   . HOH H 4 .   ? 44.108 69.213  26.524  1.00 12.34  ? 2037 HOH A O   1 
HETATM 3218 O  O   . HOH H 4 .   ? 44.103 91.020  21.332  1.00 12.67  ? 2038 HOH A O   1 
HETATM 3219 O  O   . HOH H 4 .   ? 32.927 79.200  11.142  1.00 13.91  ? 2039 HOH A O   1 
HETATM 3220 O  O   . HOH H 4 .   ? 36.047 56.506  9.331   1.00 14.42  ? 2040 HOH A O   1 
HETATM 3221 O  O   . HOH H 4 .   ? 44.058 57.050  6.899   1.00 13.40  ? 2041 HOH A O   1 
HETATM 3222 O  O   . HOH H 4 .   ? 48.630 89.206  21.142  1.00 13.77  ? 2042 HOH A O   1 
HETATM 3223 O  O   . HOH H 4 .   ? 48.437 56.022  15.405  1.00 14.99  ? 2043 HOH A O   1 
HETATM 3224 O  O   . HOH H 4 .   ? 28.447 85.357  2.154   1.00 14.27  ? 2044 HOH A O   1 
HETATM 3225 O  O   . HOH H 4 .   ? 35.445 70.072  26.267  1.00 14.31  ? 2045 HOH A O   1 
HETATM 3226 O  O   . HOH H 4 .   ? 55.993 68.774  6.667   1.00 13.85  ? 2046 HOH A O   1 
HETATM 3227 O  O   . HOH H 4 .   ? 46.169 55.025  16.501  1.00 13.63  ? 2047 HOH A O   1 
HETATM 3228 O  O   . HOH H 4 .   ? 32.015 73.386  18.600  1.00 17.07  ? 2048 HOH A O   1 
HETATM 3229 O  O   . HOH H 4 .   ? 25.894 80.625  11.370  1.00 16.96  ? 2049 HOH A O   1 
HETATM 3230 O  O   . HOH H 4 .   ? 30.844 65.545  25.072  1.00 14.90  ? 2050 HOH A O   1 
HETATM 3231 O  O   . HOH H 4 .   ? 32.629 72.429  11.448  1.00 16.63  ? 2051 HOH A O   1 
HETATM 3232 O  O   . HOH H 4 .   ? 46.143 69.217  28.158  1.00 15.29  ? 2052 HOH A O   1 
HETATM 3233 O  O   . HOH H 4 .   ? 31.261 64.289  27.501  1.00 16.08  ? 2053 HOH A O   1 
HETATM 3234 O  O   . HOH H 4 .   ? 39.671 52.511  27.770  1.00 15.45  ? 2054 HOH A O   1 
HETATM 3235 O  O   . HOH H 4 .   ? 41.267 84.855  2.965   1.00 15.45  ? 2055 HOH A O   1 
HETATM 3236 O  O   . HOH H 4 .   ? 43.819 79.882  -4.710  1.00 16.83  ? 2056 HOH A O   1 
HETATM 3237 O  O   . HOH H 4 .   ? 37.476 58.391  4.389   1.00 16.79  ? 2057 HOH A O   1 
HETATM 3238 O  O   . HOH H 4 .   ? 31.824 83.391  24.359  1.00 16.92  ? 2058 HOH A O   1 
HETATM 3239 O  O   . HOH H 4 .   ? 30.482 86.466  0.663   1.00 15.94  ? 2059 HOH A O   1 
HETATM 3240 O  O   . HOH H 4 .   ? 45.606 70.722  -1.435  1.00 16.10  ? 2060 HOH A O   1 
HETATM 3241 O  O   . HOH H 4 .   ? 33.368 72.829  8.810   1.00 16.08  ? 2061 HOH A O   1 
HETATM 3242 O  O   . HOH H 4 .   ? 23.506 62.881  18.345  1.00 15.55  ? 2062 HOH A O   1 
HETATM 3243 O  O   . HOH H 4 .   ? 36.171 61.257  2.089   1.00 16.99  ? 2063 HOH A O   1 
HETATM 3244 O  O   . HOH H 4 .   ? 50.849 59.316  15.925  1.00 15.94  ? 2064 HOH A O   1 
HETATM 3245 O  O   . HOH H 4 .   ? 48.964 58.396  11.636  1.00 16.75  ? 2065 HOH A O   1 
HETATM 3246 O  O   . HOH H 4 .   ? 26.868 63.425  16.356  1.00 17.70  ? 2066 HOH A O   1 
HETATM 3247 O  O   . HOH H 4 .   ? 44.067 72.257  29.619  1.00 16.79  ? 2067 HOH A O   1 
HETATM 3248 O  O   . HOH H 4 .   ? 28.076 86.625  6.727   1.00 17.59  ? 2068 HOH A O   1 
HETATM 3249 O  O   . HOH H 4 .   ? 42.946 89.033  23.730  1.00 16.80  ? 2069 HOH A O   1 
HETATM 3250 O  O   . HOH H 4 .   ? 30.519 75.790  12.041  1.00 16.79  ? 2070 HOH A O   1 
HETATM 3251 O  O   . HOH H 4 .   ? 51.605 91.252  17.424  1.00 16.95  ? 2071 HOH A O   1 
HETATM 3252 O  O   . HOH H 4 .   ? 48.294 67.338  2.030   1.00 17.67  ? 2072 HOH A O   1 
HETATM 3253 O  O   . HOH H 4 .   ? 32.931 75.752  19.812  1.00 15.75  ? 2073 HOH A O   1 
HETATM 3254 O  O   . HOH H 4 .   ? 31.851 78.056  13.481  1.00 16.29  ? 2074 HOH A O   1 
HETATM 3255 O  O   . HOH H 4 .   ? 25.931 86.532  2.038   1.00 17.16  ? 2075 HOH A O   1 
HETATM 3256 O  O   . HOH H 4 .   ? 33.744 65.083  10.913  1.00 19.76  ? 2076 HOH A O   1 
HETATM 3257 O  O   . HOH H 4 .   ? 44.130 84.329  3.631   1.00 19.84  ? 2077 HOH A O   1 
HETATM 3258 O  O   . HOH H 4 .   ? 46.954 91.457  20.688  1.00 19.57  ? 2078 HOH A O   1 
HETATM 3259 O  O   . HOH H 4 .   ? 41.128 73.899  16.771  1.00 18.49  ? 2079 HOH A O   1 
HETATM 3260 O  O   . HOH H 4 .   ? 31.487 85.730  18.010  1.00 16.77  ? 2080 HOH A O   1 
HETATM 3261 O  O   . HOH H 4 .   ? 29.344 85.398  4.805   1.00 18.03  ? 2081 HOH A O   1 
HETATM 3262 O  O   . HOH H 4 .   ? 45.696 66.939  1.694   1.00 18.73  ? 2082 HOH A O   1 
HETATM 3263 O  O   . HOH H 4 .   ? 30.176 60.496  21.081  1.00 19.47  ? 2083 HOH A O   1 
HETATM 3264 O  O   . HOH H 4 .   ? 43.074 50.154  18.647  1.00 19.82  ? 2084 HOH A O   1 
HETATM 3265 O  O   . HOH H 4 .   ? 37.692 65.488  31.501  1.00 19.33  ? 2085 HOH A O   1 
HETATM 3266 O  O   . HOH H 4 .   ? 30.687 85.044  14.806  1.00 18.49  ? 2086 HOH A O   1 
HETATM 3267 O  O   . HOH H 4 .   ? 29.431 72.523  14.041  1.00 19.23  ? 2087 HOH A O   1 
HETATM 3268 O  O   . HOH H 4 .   ? 26.970 75.125  1.662   1.00 17.25  ? 2088 HOH A O   1 
HETATM 3269 O  O   . HOH H 4 .   ? 26.162 65.446  -0.924  1.00 21.37  ? 2089 HOH A O   1 
HETATM 3270 O  O   . HOH H 4 .   ? 58.026 68.146  15.659  1.00 18.17  ? 2090 HOH A O   1 
HETATM 3271 O  O   . HOH H 4 .   ? 42.347 61.045  29.522  1.00 22.73  ? 2091 HOH A O   1 
HETATM 3272 O  O   . HOH H 4 .   ? 60.371 83.902  19.319  1.00 19.74  ? 2092 HOH A O   1 
HETATM 3273 O  O   . HOH H 4 .   ? 58.180 74.367  10.472  1.00 21.24  ? 2093 HOH A O   1 
HETATM 3274 O  O   . HOH H 4 .   ? 47.694 75.698  -4.533  1.00 20.91  ? 2094 HOH A O   1 
HETATM 3275 O  O   . HOH H 4 .   ? 31.771 76.571  6.649   1.00 19.32  ? 2095 HOH A O   1 
HETATM 3276 O  O   . HOH H 4 .   ? 47.257 63.133  5.338   1.00 20.33  ? 2096 HOH A O   1 
HETATM 3277 O  O   . HOH H 4 .   ? 39.249 76.671  -9.732  1.00 21.75  ? 2097 HOH A O   1 
HETATM 3278 O  O   . HOH H 4 .   ? 34.953 52.150  18.232  1.00 21.30  ? 2098 HOH A O   1 
HETATM 3279 O  O   . HOH H 4 .   ? 28.330 71.299  16.612  1.00 22.14  ? 2099 HOH A O   1 
HETATM 3280 O  O   . HOH H 4 .   ? 36.256 92.878  15.640  1.00 20.37  ? 2100 HOH A O   1 
HETATM 3281 O  O   . HOH H 4 .   ? 57.585 84.418  20.508  1.00 21.31  ? 2101 HOH A O   1 
HETATM 3282 O  O   . HOH H 4 .   ? 31.264 74.051  7.654   1.00 19.64  ? 2102 HOH A O   1 
HETATM 3283 O  O   . HOH H 4 .   ? 28.160 85.165  8.957   1.00 22.55  ? 2103 HOH A O   1 
HETATM 3284 O  O   . HOH H 4 .   ? 37.980 62.912  32.623  1.00 24.79  ? 2104 HOH A O   1 
HETATM 3285 O  O   . HOH H 4 .   ? 39.975 95.280  7.020   1.00 22.62  ? 2105 HOH A O   1 
HETATM 3286 O  O   . HOH H 4 .   ? 41.084 68.072  32.801  1.00 22.54  ? 2106 HOH A O   1 
HETATM 3287 O  O   . HOH H 4 .   ? 44.187 51.263  11.263  1.00 24.61  ? 2107 HOH A O   1 
HETATM 3288 O  O   . HOH H 4 .   ? 32.665 88.738  20.077  1.00 20.83  ? 2108 HOH A O   1 
HETATM 3289 O  O   . HOH H 4 .   ? 47.935 73.953  -2.752  1.00 20.59  ? 2109 HOH A O   1 
HETATM 3290 O  O   . HOH H 4 .   ? 31.780 63.005  11.736  1.00 22.21  ? 2110 HOH A O   1 
HETATM 3291 O  O   . HOH H 4 .   ? 49.069 72.886  27.323  1.00 19.90  ? 2111 HOH A O   1 
HETATM 3292 O  O   . HOH H 4 .   ? 53.366 68.674  3.030   1.00 20.24  ? 2112 HOH A O   1 
HETATM 3293 O  O   . HOH H 4 .   ? 30.658 65.536  -3.591  1.00 23.04  ? 2113 HOH A O   1 
HETATM 3294 O  O   . HOH H 4 .   ? 36.830 70.087  28.541  1.00 20.58  ? 2114 HOH A O   1 
HETATM 3295 O  O   . HOH H 4 .   ? 58.403 79.006  12.979  1.00 24.07  ? 2115 HOH A O   1 
HETATM 3296 O  O   . HOH H 4 .   ? 48.007 56.720  9.802   1.00 23.80  ? 2116 HOH A O   1 
HETATM 3297 O  O   . HOH H 4 .   ? 33.535 89.743  15.186  1.00 20.75  ? 2117 HOH A O   1 
HETATM 3298 O  O   . HOH H 4 .   ? 44.312 73.228  -5.044  1.00 21.84  ? 2118 HOH A O   1 
HETATM 3299 O  O   . HOH H 4 .   ? 32.090 63.668  -4.383  1.00 22.16  ? 2119 HOH A O   1 
HETATM 3300 O  O   . HOH H 4 .   ? 31.944 86.225  4.694   1.00 22.30  ? 2120 HOH A O   1 
HETATM 3301 O  O   . HOH H 4 .   ? 38.245 89.371  4.116   1.00 25.43  ? 2121 HOH A O   1 
HETATM 3302 O  O   . HOH H 4 .   ? 43.761 68.511  -1.912  1.00 23.58  ? 2122 HOH A O   1 
HETATM 3303 O  O   . HOH H 4 .   ? 36.187 61.092  5.025   1.00 23.74  ? 2123 HOH A O   1 
HETATM 3304 O  O   . HOH H 4 .   ? 49.623 93.244  18.207  1.00 22.63  ? 2124 HOH A O   1 
HETATM 3305 O  O   . HOH H 4 .   ? 30.556 68.822  7.022   1.00 25.03  ? 2125 HOH A O   1 
HETATM 3306 O  O   . HOH H 4 .   ? 38.286 87.730  -0.561  1.00 21.02  ? 2126 HOH A O   1 
HETATM 3307 O  O   . HOH H 4 .   ? 40.124 81.032  26.943  1.00 25.85  ? 2127 HOH A O   1 
HETATM 3308 O  O   . HOH H 4 .   ? 27.871 56.079  16.552  1.00 23.99  ? 2128 HOH A O   1 
HETATM 3309 O  O   . HOH H 4 .   ? 32.062 88.842  13.087  1.00 24.26  ? 2129 HOH A O   1 
HETATM 3310 O  O   . HOH H 4 .   ? 23.995 66.154  -4.020  1.00 24.08  ? 2130 HOH A O   1 
HETATM 3311 O  O   . HOH H 4 .   ? 52.184 60.628  13.773  1.00 22.59  ? 2131 HOH A O   1 
HETATM 3312 O  O   . HOH H 4 .   ? 30.145 77.906  4.843   1.00 19.99  ? 2132 HOH A O   1 
HETATM 3313 O  O   . HOH H 4 .   ? 30.738 61.669  9.411   1.00 25.72  ? 2133 HOH A O   1 
HETATM 3314 O  O   . HOH H 4 .   ? 50.925 61.036  33.574  1.00 22.43  ? 2134 HOH A O   1 
HETATM 3315 O  O   . HOH H 4 .   ? 34.756 58.567  5.012   1.00 24.97  ? 2135 HOH A O   1 
HETATM 3316 O  O   . HOH H 4 .   ? 48.601 57.210  7.217   1.00 25.74  ? 2136 HOH A O   1 
HETATM 3317 O  O   . HOH H 4 .   ? 40.521 90.659  24.470  1.00 27.59  ? 2137 HOH A O   1 
HETATM 3318 O  O   . HOH H 4 .   ? 47.375 59.973  4.259   1.00 24.27  ? 2138 HOH A O   1 
HETATM 3319 O  O   . HOH H 4 .   ? 59.765 75.002  15.857  1.00 24.39  ? 2139 HOH A O   1 
HETATM 3320 O  O   . HOH H 4 .   ? 33.559 89.909  4.705   1.00 25.03  ? 2140 HOH A O   1 
HETATM 3321 O  O   . HOH H 4 .   ? 32.483 80.410  -16.711 1.00 25.01  ? 2141 HOH A O   1 
HETATM 3322 O  O   . HOH H 4 .   ? 52.859 81.007  26.199  1.00 28.94  ? 2142 HOH A O   1 
HETATM 3323 O  O   . HOH H 4 .   ? 26.301 77.750  11.767  1.00 29.83  ? 2143 HOH A O   1 
HETATM 3324 O  O   . HOH H 4 .   ? 42.420 77.564  -10.237 1.00 29.82  ? 2144 HOH A O   1 
HETATM 3325 O  O   . HOH H 4 .   ? 28.710 66.243  21.903  1.00 27.19  ? 2145 HOH A O   1 
HETATM 3326 O  O   . HOH H 4 .   ? 57.968 76.433  12.825  1.00 24.27  ? 2146 HOH A O   1 
HETATM 3327 O  O   . HOH H 4 .   ? 48.523 79.967  27.177  1.00 27.74  ? 2147 HOH A O   1 
HETATM 3328 O  O   . HOH H 4 .   ? 32.016 87.484  -3.517  1.00 25.65  ? 2148 HOH A O   1 
HETATM 3329 O  O   . HOH H 4 .   ? 36.353 85.690  -6.386  1.00 24.32  ? 2149 HOH A O   1 
HETATM 3330 O  O   . HOH H 4 .   ? 45.303 68.024  30.822  1.00 25.22  ? 2150 HOH A O   1 
HETATM 3331 O  O   . HOH H 4 .   ? 41.872 59.598  26.657  1.00 24.61  ? 2151 HOH A O   1 
HETATM 3332 O  O   . HOH H 4 .   ? 35.031 53.398  10.928  1.00 28.67  ? 2152 HOH A O   1 
HETATM 3333 O  O   . HOH H 4 .   ? 25.707 78.728  3.176   1.00 26.14  ? 2153 HOH A O   1 
HETATM 3334 O  O   . HOH H 4 .   ? 60.023 77.470  16.857  1.00 27.51  ? 2154 HOH A O   1 
HETATM 3335 O  O   . HOH H 4 .   ? 58.836 77.061  22.483  1.00 25.19  ? 2155 HOH A O   1 
HETATM 3336 O  O   . HOH H 4 .   ? 37.081 89.584  1.197   1.00 30.78  ? 2156 HOH A O   1 
HETATM 3337 O  O   . HOH H 4 .   ? 61.732 86.350  20.330  1.00 26.85  ? 2157 HOH A O   1 
HETATM 3338 O  O   . HOH H 4 .   ? 46.306 95.147  15.396  1.00 25.70  ? 2158 HOH A O   1 
HETATM 3339 O  O   . HOH H 4 .   ? 53.046 59.254  28.004  1.00 24.29  ? 2159 HOH A O   1 
HETATM 3340 O  O   . HOH H 4 .   ? 28.262 71.867  3.079   1.00 23.10  ? 2160 HOH A O   1 
HETATM 3341 O  O   . HOH H 4 .   ? 28.836 64.891  -0.933  1.00 25.97  ? 2161 HOH A O   1 
HETATM 3342 O  O   . HOH H 4 .   ? 37.000 92.746  6.144   1.00 28.51  ? 2162 HOH A O   1 
HETATM 3343 O  O   . HOH H 4 .   ? 29.723 74.562  9.855   1.00 27.60  ? 2163 HOH A O   1 
HETATM 3344 O  O   . HOH H 4 .   ? 49.248 76.130  29.355  1.00 28.80  ? 2164 HOH A O   1 
HETATM 3345 O  O   . HOH H 4 .   ? 27.254 66.413  -5.775  1.00 28.52  ? 2165 HOH A O   1 
HETATM 3346 O  O   . HOH H 4 .   ? 47.718 86.066  23.641  1.00 28.71  ? 2166 HOH A O   1 
HETATM 3347 O  O   . HOH H 4 .   ? 27.924 78.339  13.947  1.00 27.80  ? 2167 HOH A O   1 
HETATM 3348 O  O   . HOH H 4 .   ? 35.573 56.207  6.774   1.00 27.21  ? 2168 HOH A O   1 
HETATM 3349 O  O   . HOH H 4 .   ? 46.806 71.917  28.672  1.00 29.24  ? 2169 HOH A O   1 
HETATM 3350 O  O   . HOH H 4 .   ? 25.235 76.731  -3.622  1.00 28.79  ? 2170 HOH A O   1 
HETATM 3351 O  O   . HOH H 4 .   ? 22.499 83.477  1.075   1.00 27.25  ? 2171 HOH A O   1 
HETATM 3352 O  O   . HOH H 4 .   ? 44.894 87.595  24.917  1.00 26.60  ? 2172 HOH A O   1 
HETATM 3353 O  O   . HOH H 4 .   ? 42.497 93.095  21.159  1.00 26.54  ? 2173 HOH A O   1 
HETATM 3354 O  O   . HOH H 4 .   ? 33.117 64.224  8.017   1.00 29.91  ? 2174 HOH A O   1 
HETATM 3355 O  O   . HOH H 4 .   ? 41.113 84.022  -0.617  1.00 28.60  ? 2175 HOH A O   1 
HETATM 3356 O  O   . HOH H 4 .   ? 32.964 88.577  9.192   1.00 28.35  ? 2176 HOH A O   1 
HETATM 3357 O  O   . HOH H 4 .   ? 29.603 72.877  5.563   1.00 31.75  ? 2177 HOH A O   1 
HETATM 3358 O  O   . HOH H 4 .   ? 25.033 61.707  15.074  1.00 26.48  ? 2178 HOH A O   1 
HETATM 3359 O  O   . HOH H 4 .   ? 36.337 63.117  -1.470  1.00 29.80  ? 2179 HOH A O   1 
HETATM 3360 O  O   . HOH H 4 .   ? 35.095 89.752  22.332  1.00 29.08  ? 2180 HOH A O   1 
HETATM 3361 O  O   . HOH H 4 .   ? 43.175 71.102  -5.915  1.00 33.45  ? 2181 HOH A O   1 
HETATM 3362 O  O   . HOH H 4 .   ? 50.834 85.601  23.366  1.00 32.36  ? 2182 HOH A O   1 
HETATM 3363 O  O   . HOH H 4 .   ? 31.008 77.380  26.980  1.00 31.02  ? 2183 HOH A O   1 
HETATM 3364 O  O   . HOH H 4 .   ? 45.623 52.635  15.634  1.00 30.46  ? 2184 HOH A O   1 
HETATM 3365 O  O   . HOH H 4 .   ? 31.152 91.725  -3.361  1.00 34.04  ? 2185 HOH A O   1 
HETATM 3366 O  O   . HOH H 4 .   ? 45.918 51.663  13.304  1.00 33.59  ? 2186 HOH A O   1 
HETATM 3367 O  O   . HOH H 4 .   ? 46.658 63.051  30.955  1.00 30.21  ? 2187 HOH A O   1 
HETATM 3368 O  O   . HOH H 4 .   ? 32.220 88.349  6.580   1.00 31.58  ? 2188 HOH A O   1 
HETATM 3369 O  O   . HOH H 4 .   ? 37.025 82.861  28.158  1.00 30.93  ? 2189 HOH A O   1 
HETATM 3370 O  O   . HOH H 4 .   ? 45.026 72.573  -8.744  1.00 35.81  ? 2190 HOH A O   1 
HETATM 3371 O  O   . HOH H 4 .   ? 50.662 56.029  21.410  1.00 32.16  ? 2191 HOH A O   1 
HETATM 3372 O  O   . HOH H 4 .   ? 50.026 81.842  25.692  1.00 35.38  ? 2192 HOH A O   1 
HETATM 3373 O  O   . HOH H 4 .   ? 30.274 87.309  13.632  1.00 29.92  ? 2193 HOH A O   1 
HETATM 3374 O  O   . HOH H 4 .   ? 30.481 68.097  13.065  1.00 35.78  ? 2194 HOH A O   1 
HETATM 3375 O  O   . HOH H 4 .   ? 43.782 83.314  -0.272  1.00 31.38  ? 2195 HOH A O   1 
HETATM 3376 O  O   . HOH H 4 .   ? 35.687 62.195  31.843  1.00 31.83  ? 2196 HOH A O   1 
HETATM 3377 O  O   . HOH H 4 .   ? 43.140 82.062  -3.401  1.00 30.31  ? 2197 HOH A O   1 
HETATM 3378 O  O   . HOH H 4 .   ? 35.631 53.376  22.251  1.00 32.23  ? 2198 HOH A O   1 
HETATM 3379 O  O   . HOH H 4 .   ? 29.568 89.023  6.858   1.00 30.80  ? 2199 HOH A O   1 
HETATM 3380 O  O   . HOH H 4 .   ? 38.523 75.307  30.818  1.00 37.06  ? 2200 HOH A O   1 
HETATM 3381 O  O   . HOH H 4 .   ? 30.357 88.474  21.501  1.00 32.52  ? 2201 HOH A O   1 
HETATM 3382 O  O   . HOH H 4 .   ? 36.336 88.652  -2.511  1.00 36.56  ? 2202 HOH A O   1 
HETATM 3383 O  O   . HOH H 4 .   ? 37.307 72.590  -10.292 1.00 35.82  ? 2203 HOH A O   1 
HETATM 3384 O  O   . HOH H 4 .   ? 38.248 68.532  30.306  1.00 29.74  ? 2204 HOH A O   1 
HETATM 3385 O  O   . HOH H 4 .   ? 50.156 56.284  17.697  1.00 31.87  ? 2205 HOH A O   1 
HETATM 3386 O  O   . HOH H 4 .   ? 37.936 51.244  26.488  1.00 31.93  ? 2206 HOH A O   1 
HETATM 3387 O  O   . HOH H 4 .   ? 30.306 87.197  -5.617  1.00 27.18  ? 2207 HOH A O   1 
HETATM 3388 O  O   . HOH H 4 .   ? 53.652 59.312  22.233  1.00 31.18  ? 2208 HOH A O   1 
HETATM 3389 O  O   . HOH H 4 .   ? 32.741 90.258  -1.733  1.00 30.21  ? 2209 HOH A O   1 
HETATM 3390 O  O   . HOH H 4 .   ? 48.422 52.239  21.543  1.00 40.37  ? 2210 HOH A O   1 
HETATM 3391 O  O   . HOH H 4 .   ? 43.705 64.277  -2.670  1.00 27.72  ? 2211 HOH A O   1 
HETATM 3392 O  O   . HOH H 4 .   ? 30.365 78.661  23.118  1.00 34.72  ? 2212 HOH A O   1 
HETATM 3393 O  O   . HOH H 4 .   ? 52.629 67.275  24.540  1.00 30.34  ? 2213 HOH A O   1 
HETATM 3394 O  O   . HOH H 4 .   ? 34.435 55.151  23.106  1.00 35.33  ? 2214 HOH A O   1 
HETATM 3395 O  O   . HOH H 4 .   ? 46.360 75.257  31.704  1.00 26.44  ? 2215 HOH A O   1 
HETATM 3396 O  O   . HOH H 4 .   ? 56.651 75.924  24.178  1.00 36.95  ? 2216 HOH A O   1 
HETATM 3397 O  O   . HOH H 4 .   ? 27.734 82.335  -4.906  1.00 30.07  ? 2217 HOH A O   1 
HETATM 3398 O  O   . HOH H 4 .   ? 51.753 62.263  9.692   1.00 38.36  ? 2218 HOH A O   1 
HETATM 3399 O  O   . HOH H 4 .   ? 26.131 81.293  -11.353 1.00 35.14  ? 2219 HOH A O   1 
HETATM 3400 O  O   . HOH H 4 .   ? 28.958 56.269  18.944  1.00 32.06  ? 2220 HOH A O   1 
HETATM 3401 O  O   . HOH H 4 .   ? 50.461 63.850  33.415  1.00 33.22  ? 2221 HOH A O   1 
HETATM 3402 O  O   . HOH H 4 .   ? 49.180 54.503  19.037  1.00 35.71  ? 2222 HOH A O   1 
HETATM 3403 O  O   . HOH H 4 .   ? 30.135 86.117  10.618  1.00 35.87  ? 2223 HOH A O   1 
HETATM 3404 O  O   . HOH H 4 .   ? 54.640 63.140  28.186  1.00 34.86  ? 2224 HOH A O   1 
HETATM 3405 O  O   . HOH H 4 .   ? 22.390 87.787  -0.532  1.00 35.19  ? 2225 HOH A O   1 
HETATM 3406 O  O   . HOH H 4 .   ? 42.992 80.447  -10.661 1.00 36.12  ? 2226 HOH A O   1 
HETATM 3407 O  O   . HOH H 4 .   ? 60.045 72.407  17.307  1.00 33.74  ? 2227 HOH A O   1 
HETATM 3408 O  O   . HOH H 4 .   ? 60.119 77.891  19.397  1.00 31.81  ? 2228 HOH A O   1 
HETATM 3409 O  O   . HOH H 4 .   ? 30.229 56.601  9.014   1.00 35.33  ? 2229 HOH A O   1 
HETATM 3410 O  O   . HOH H 4 .   ? 25.020 76.208  -0.043  1.00 33.35  ? 2230 HOH A O   1 
HETATM 3411 O  O   . HOH H 4 .   ? 35.966 85.828  -9.167  1.00 35.92  ? 2231 HOH A O   1 
HETATM 3412 O  O   . HOH H 4 .   ? 43.027 86.896  28.633  1.00 38.75  ? 2232 HOH A O   1 
HETATM 3413 O  O   . HOH H 4 .   ? 59.752 70.818  14.924  1.00 39.12  ? 2233 HOH A O   1 
HETATM 3414 O  O   . HOH H 4 .   ? 60.041 73.195  11.725  1.00 40.83  ? 2234 HOH A O   1 
HETATM 3415 O  O   . HOH H 4 .   ? 56.501 65.455  12.041  1.00 37.27  ? 2235 HOH A O   1 
HETATM 3416 O  O   . HOH H 4 .   ? 55.620 61.653  17.900  1.00 31.49  ? 2236 HOH A O   1 
HETATM 3417 O  O   . HOH H 4 .   ? 29.573 72.598  18.249  1.00 34.11  ? 2237 HOH A O   1 
HETATM 3418 O  O   . HOH H 4 .   ? 30.259 80.665  25.086  1.00 44.73  ? 2238 HOH A O   1 
HETATM 3419 O  O   . HOH H 4 .   ? 30.995 63.324  -6.863  1.00 37.18  ? 2239 HOH A O   1 
HETATM 3420 O  O   . HOH H 4 .   ? 53.527 88.847  20.058  1.00 35.50  ? 2240 HOH A O   1 
HETATM 3421 O  O   . HOH H 4 .   ? 38.995 49.200  17.620  1.00 36.23  ? 2241 HOH A O   1 
HETATM 3422 O  O   . HOH H 4 .   ? 26.722 80.766  -6.914  1.00 31.45  ? 2242 HOH A O   1 
HETATM 3423 O  O   . HOH H 4 .   ? 42.076 79.043  30.286  1.00 38.69  ? 2243 HOH A O   1 
HETATM 3424 O  O   . HOH H 4 .   ? 26.846 51.291  12.406  1.00 46.06  ? 2244 HOH A O   1 
HETATM 3425 O  O   . HOH H 4 .   ? 54.412 60.038  24.523  1.00 32.74  ? 2245 HOH A O   1 
HETATM 3426 O  O   . HOH H 4 .   ? 27.041 73.898  13.246  1.00 37.11  ? 2246 HOH A O   1 
HETATM 3427 O  O   . HOH H 4 .   ? 30.651 73.069  23.534  1.00 38.48  ? 2247 HOH A O   1 
HETATM 3428 O  O   . HOH H 4 .   ? 59.494 71.752  19.853  1.00 49.85  ? 2248 HOH A O   1 
HETATM 3429 O  O   . HOH H 4 .   ? 31.799 76.610  22.343  1.00 36.96  ? 2249 HOH A O   1 
HETATM 3430 O  O   . HOH H 4 .   ? 48.091 52.598  11.330  1.00 35.98  ? 2250 HOH A O   1 
HETATM 3431 O  O   . HOH H 4 .   ? 40.062 58.661  -2.865  1.00 40.50  ? 2251 HOH A O   1 
HETATM 3432 O  O   . HOH H 4 .   ? 52.207 69.682  25.403  1.00 36.01  ? 2252 HOH A O   1 
HETATM 3433 O  O   . HOH H 4 .   ? 35.302 93.013  22.197  1.00 41.24  ? 2253 HOH A O   1 
HETATM 3434 O  O   . HOH H 4 .   ? 49.315 51.362  17.003  1.00 46.38  ? 2254 HOH A O   1 
HETATM 3435 O  O   . HOH H 4 .   ? 28.807 83.988  21.089  1.00 43.13  ? 2255 HOH A O   1 
HETATM 3436 O  O   . HOH H 4 .   ? 62.063 81.176  19.530  1.00 41.44  ? 2256 HOH A O   1 
HETATM 3437 O  O   . HOH H 4 .   ? 32.024 88.297  17.534  1.00 40.25  ? 2257 HOH A O   1 
HETATM 3438 O  O   . HOH H 4 .   ? 35.914 87.729  -4.871  1.00 42.78  ? 2258 HOH A O   1 
HETATM 3439 O  O   . HOH H 4 .   ? 22.516 80.192  0.654   1.00 38.49  ? 2259 HOH A O   1 
HETATM 3440 O  O   . HOH H 4 .   ? 32.354 86.717  -9.685  1.00 44.76  ? 2260 HOH A O   1 
HETATM 3441 O  O   . HOH H 4 .   ? 44.164 69.565  32.680  1.00 48.22  ? 2261 HOH A O   1 
HETATM 3442 O  O   . HOH H 4 .   ? 27.732 72.750  9.763   1.00 46.98  ? 2262 HOH A O   1 
HETATM 3443 O  O   . HOH H 4 .   ? 30.404 88.236  -1.362  1.00 38.64  ? 2263 HOH A O   1 
HETATM 3444 O  O   . HOH H 4 .   ? 36.018 90.332  5.212   1.00 35.67  ? 2264 HOH A O   1 
HETATM 3445 O  O   . HOH H 4 .   ? 51.588 62.939  5.737   1.00 39.89  ? 2265 HOH A O   1 
HETATM 3446 O  O   . HOH H 4 .   ? 55.041 67.603  23.598  1.00 44.99  ? 2266 HOH A O   1 
HETATM 3447 O  O   . HOH H 4 .   ? 30.473 71.139  20.580  1.00 42.61  ? 2267 HOH A O   1 
HETATM 3448 O  O   . HOH H 4 .   ? 61.369 79.132  14.439  1.00 43.99  ? 2268 HOH A O   1 
HETATM 3449 O  O   . HOH H 4 .   ? 45.960 50.573  24.096  1.00 41.81  ? 2269 HOH A O   1 
HETATM 3450 O  O   . HOH H 4 .   ? 26.019 72.779  15.505  1.00 53.75  ? 2270 HOH A O   1 
HETATM 3451 O  O   . HOH H 4 .   ? 52.629 56.662  14.558  1.00 40.99  ? 2271 HOH A O   1 
HETATM 3452 O  O   . HOH H 4 .   ? 41.731 74.543  30.095  1.00 43.92  ? 2272 HOH A O   1 
HETATM 3453 O  O   . HOH H 4 .   ? 42.356 68.751  -4.171  1.00 47.48  ? 2273 HOH A O   1 
HETATM 3454 O  O   . HOH H 4 .   ? 64.044 87.941  19.180  1.00 34.44  ? 2274 HOH A O   1 
HETATM 3455 O  O   . HOH H 4 .   ? 37.206 71.852  -13.070 1.00 41.97  ? 2275 HOH A O   1 
HETATM 3456 O  O   . HOH I 4 .   ? 49.136 83.358  2.941   1.00 5.48   ? 3002 HOH B O   1 
HETATM 3457 O  O   . HOH I 4 .   ? 51.981 82.811  2.522   1.00 6.88   ? 3003 HOH B O   1 
HETATM 3458 O  O   . HOH I 4 .   ? 60.203 81.769  3.728   1.00 6.02   ? 3004 HOH B O   1 
HETATM 3459 O  O   . HOH I 4 .   ? 52.561 96.347  -5.876  1.00 9.63   ? 3005 HOH B O   1 
HETATM 3460 O  O   . HOH I 4 .   ? 47.651 82.288  0.989   1.00 8.21   ? 3006 HOH B O   1 
HETATM 3461 O  O   . HOH I 4 .   ? 72.322 85.508  -2.480  1.00 9.57   ? 3007 HOH B O   1 
HETATM 3462 O  O   . HOH I 4 .   ? 52.422 99.597  1.071   1.00 9.53   ? 3008 HOH B O   1 
HETATM 3463 O  O   . HOH I 4 .   ? 60.471 90.054  5.479   1.00 9.25   ? 3009 HOH B O   1 
HETATM 3464 O  O   . HOH I 4 .   ? 72.074 85.805  4.085   1.00 7.76   ? 3010 HOH B O   1 
HETATM 3465 O  O   . HOH I 4 .   ? 50.311 83.761  -7.981  1.00 10.46  ? 3011 HOH B O   1 
HETATM 3466 O  O   . HOH I 4 .   ? 56.897 93.081  6.248   1.00 10.12  ? 3012 HOH B O   1 
HETATM 3467 O  O   . HOH I 4 .   ? 61.001 70.133  6.837   1.00 11.05  ? 3013 HOH B O   1 
HETATM 3468 O  O   . HOH I 4 .   ? 56.498 90.134  9.544   1.00 10.09  ? 3014 HOH B O   1 
HETATM 3469 O  O   . HOH I 4 .   ? 48.455 86.311  4.696   1.00 8.66   ? 3015 HOH B O   1 
HETATM 3470 O  O   . HOH I 4 .   ? 67.394 64.402  1.310   1.00 9.32   ? 3016 HOH B O   1 
HETATM 3471 O  O   . HOH I 4 .   ? 60.571 99.488  -7.727  1.00 11.41  ? 3017 HOH B O   1 
HETATM 3472 O  O   . HOH I 4 .   ? 72.981 80.897  1.928   1.00 10.83  ? 3018 HOH B O   1 
HETATM 3473 O  O   . HOH I 4 .   ? 64.349 97.073  8.092   1.00 10.91  ? 3019 HOH B O   1 
HETATM 3474 O  O   . HOH I 4 .   ? 55.883 79.812  -12.256 1.00 10.23  ? 3020 HOH B O   1 
HETATM 3475 O  O   . HOH I 4 .   ? 72.559 99.478  6.792   1.00 12.14  ? 3021 HOH B O   1 
HETATM 3476 O  O   . HOH I 4 .   ? 71.749 82.767  -2.033  1.00 13.35  ? 3022 HOH B O   1 
HETATM 3477 O  O   . HOH I 4 .   ? 57.156 74.941  -6.507  1.00 11.96  ? 3023 HOH B O   1 
HETATM 3478 O  O   . HOH I 4 .   ? 71.868 94.004  -0.413  1.00 10.76  ? 3024 HOH B O   1 
HETATM 3479 O  O   . HOH I 4 .   ? 48.543 97.011  5.624   1.00 12.50  ? 3025 HOH B O   1 
HETATM 3480 O  O   . HOH I 4 .   ? 45.969 96.175  0.050   1.00 11.87  ? 3026 HOH B O   1 
HETATM 3481 O  O   . HOH I 4 .   ? 71.826 91.423  2.133   1.00 13.05  ? 3027 HOH B O   1 
HETATM 3482 O  O   . HOH I 4 .   ? 72.776 92.603  -2.468  1.00 13.67  ? 3028 HOH B O   1 
HETATM 3483 O  O   . HOH I 4 .   ? 59.721 76.931  8.286   1.00 13.49  ? 3029 HOH B O   1 
HETATM 3484 O  O   . HOH I 4 .   ? 48.872 79.619  -5.946  1.00 14.38  ? 3030 HOH B O   1 
HETATM 3485 O  O   . HOH I 4 .   ? 73.677 62.559  -3.587  1.00 14.49  ? 3031 HOH B O   1 
HETATM 3486 O  O   . HOH I 4 .   ? 53.603 81.120  5.419   1.00 13.23  ? 3032 HOH B O   1 
HETATM 3487 O  O   . HOH I 4 .   ? 71.846 84.284  -9.987  1.00 12.28  ? 3033 HOH B O   1 
HETATM 3488 O  O   . HOH I 4 .   ? 58.109 101.456 -8.111  1.00 13.15  ? 3034 HOH B O   1 
HETATM 3489 O  O   . HOH I 4 .   ? 59.472 72.779  -0.303  1.00 13.16  ? 3035 HOH B O   1 
HETATM 3490 O  O   . HOH I 4 .   ? 74.871 79.557  3.407   1.00 14.50  ? 3036 HOH B O   1 
HETATM 3491 O  O   . HOH I 4 .   ? 65.629 100.881 -0.529  1.00 15.05  ? 3037 HOH B O   1 
HETATM 3492 O  O   . HOH I 4 .   ? 60.753 77.256  -10.869 1.00 13.38  ? 3038 HOH B O   1 
HETATM 3493 O  O   . HOH I 4 .   ? 49.900 77.605  -4.344  1.00 13.00  ? 3039 HOH B O   1 
HETATM 3494 O  O   . HOH I 4 .   ? 70.933 62.240  -2.985  1.00 13.07  ? 3040 HOH B O   1 
HETATM 3495 O  O   . HOH I 4 .   ? 67.813 105.039 -18.304 1.00 13.87  ? 3041 HOH B O   1 
HETATM 3496 O  O   . HOH I 4 .   ? 61.360 99.205  12.573  1.00 14.27  ? 3042 HOH B O   1 
HETATM 3497 O  O   . HOH I 4 .   ? 73.773 85.042  -12.106 1.00 14.41  ? 3043 HOH B O   1 
HETATM 3498 O  O   . HOH I 4 .   ? 74.300 86.315  0.883   1.00 14.09  ? 3044 HOH B O   1 
HETATM 3499 O  O   . HOH I 4 .   ? 73.093 93.055  9.650   1.00 14.28  ? 3045 HOH B O   1 
HETATM 3500 O  O   . HOH I 4 .   ? 71.737 95.654  12.655  1.00 13.57  ? 3046 HOH B O   1 
HETATM 3501 O  O   . HOH I 4 .   ? 72.438 88.538  13.600  1.00 15.71  ? 3047 HOH B O   1 
HETATM 3502 O  O   . HOH I 4 .   ? 57.174 86.051  -17.520 1.00 15.37  ? 3048 HOH B O   1 
HETATM 3503 O  O   . HOH I 4 .   ? 56.016 101.525 2.631   1.00 15.65  ? 3049 HOH B O   1 
HETATM 3504 O  O   . HOH I 4 .   ? 47.517 88.790  -1.501  1.00 16.49  ? 3050 HOH B O   1 
HETATM 3505 O  O   . HOH I 4 .   ? 75.338 88.117  -2.693  1.00 15.13  ? 3051 HOH B O   1 
HETATM 3506 O  O   . HOH I 4 .   ? 73.572 85.446  -7.622  1.00 16.01  ? 3052 HOH B O   1 
HETATM 3507 O  O   . HOH I 4 .   ? 69.082 104.550 -5.238  1.00 16.37  ? 3053 HOH B O   1 
HETATM 3508 O  O   . HOH I 4 .   ? 64.425 101.464 3.962   1.00 15.80  ? 3054 HOH B O   1 
HETATM 3509 O  O   . HOH I 4 .   ? 74.574 69.045  -7.518  1.00 17.22  ? 3055 HOH B O   1 
HETATM 3510 O  O   . HOH I 4 .   ? 57.409 101.925 -16.971 1.00 16.07  ? 3056 HOH B O   1 
HETATM 3511 O  O   . HOH I 4 .   ? 68.354 90.608  17.929  1.00 15.44  ? 3057 HOH B O   1 
HETATM 3512 O  O   . HOH I 4 .   ? 50.635 95.222  -4.353  1.00 15.88  ? 3058 HOH B O   1 
HETATM 3513 O  O   . HOH I 4 .   ? 74.090 90.353  9.357   1.00 16.38  ? 3059 HOH B O   1 
HETATM 3514 O  O   . HOH I 4 .   ? 71.355 101.540 -5.382  1.00 16.67  ? 3060 HOH B O   1 
HETATM 3515 O  O   . HOH I 4 .   ? 76.378 77.688  11.326  1.00 16.60  ? 3061 HOH B O   1 
HETATM 3516 O  O   . HOH I 4 .   ? 59.508 74.695  -7.103  1.00 15.95  ? 3062 HOH B O   1 
HETATM 3517 O  O   . HOH I 4 .   ? 72.838 67.416  -8.790  1.00 18.59  ? 3063 HOH B O   1 
HETATM 3518 O  O   . HOH I 4 .   ? 63.143 100.141 14.371  1.00 16.51  ? 3064 HOH B O   1 
HETATM 3519 O  O   . HOH I 4 .   ? 74.511 76.257  12.563  1.00 18.14  ? 3065 HOH B O   1 
HETATM 3520 O  O   . HOH I 4 .   ? 78.754 77.948  4.480   1.00 16.27  ? 3066 HOH B O   1 
HETATM 3521 O  O   . HOH I 4 .   ? 46.346 87.195  3.322   1.00 18.34  ? 3067 HOH B O   1 
HETATM 3522 O  O   . HOH I 4 .   ? 74.005 98.245  -10.905 1.00 17.35  ? 3068 HOH B O   1 
HETATM 3523 O  O   . HOH I 4 .   ? 58.257 77.518  -11.459 1.00 18.95  ? 3069 HOH B O   1 
HETATM 3524 O  O   . HOH I 4 .   ? 63.566 78.035  10.667  1.00 16.73  ? 3070 HOH B O   1 
HETATM 3525 O  O   . HOH I 4 .   ? 54.826 94.723  -23.636 1.00 17.64  ? 3071 HOH B O   1 
HETATM 3526 O  O   . HOH I 4 .   ? 62.581 105.880 -9.018  1.00 19.54  ? 3072 HOH B O   1 
HETATM 3527 O  O   . HOH I 4 .   ? 55.730 96.805  12.564  1.00 17.80  ? 3073 HOH B O   1 
HETATM 3528 O  O   . HOH I 4 .   ? 78.686 71.576  -7.762  1.00 17.84  ? 3074 HOH B O   1 
HETATM 3529 O  O   . HOH I 4 .   ? 76.573 76.836  -2.182  1.00 16.84  ? 3075 HOH B O   1 
HETATM 3530 O  O   . HOH I 4 .   ? 54.178 101.263 0.355   1.00 18.59  ? 3076 HOH B O   1 
HETATM 3531 O  O   . HOH I 4 .   ? 44.590 94.152  7.464   1.00 16.87  ? 3077 HOH B O   1 
HETATM 3532 O  O   . HOH I 4 .   ? 73.799 81.735  -0.424  1.00 18.39  ? 3078 HOH B O   1 
HETATM 3533 O  O   . HOH I 4 .   ? 58.814 86.791  -19.669 1.00 17.41  ? 3079 HOH B O   1 
HETATM 3534 O  O   . HOH I 4 .   ? 61.951 73.371  -6.164  1.00 17.69  ? 3080 HOH B O   1 
HETATM 3535 O  O   . HOH I 4 .   ? 72.368 103.552 3.897   1.00 18.92  ? 3081 HOH B O   1 
HETATM 3536 O  O   . HOH I 4 .   ? 57.411 69.833  2.598   1.00 18.32  ? 3082 HOH B O   1 
HETATM 3537 O  O   . HOH I 4 .   ? 73.108 101.132 -13.040 1.00 21.38  ? 3083 HOH B O   1 
HETATM 3538 O  O   . HOH I 4 .   ? 70.417 65.981  -7.852  1.00 15.70  ? 3084 HOH B O   1 
HETATM 3539 O  O   . HOH I 4 .   ? 71.380 71.290  -12.636 1.00 18.94  ? 3085 HOH B O   1 
HETATM 3540 O  O   . HOH I 4 .   ? 62.184 64.416  5.326   1.00 20.28  ? 3086 HOH B O   1 
HETATM 3541 O  O   . HOH I 4 .   ? 81.091 68.380  -6.775  1.00 18.43  ? 3087 HOH B O   1 
HETATM 3542 O  O   . HOH I 4 .   ? 60.957 78.643  10.194  1.00 19.78  ? 3088 HOH B O   1 
HETATM 3543 O  O   . HOH I 4 .   ? 47.939 97.864  -1.358  1.00 18.85  ? 3089 HOH B O   1 
HETATM 3544 O  O   . HOH I 4 .   ? 56.966 107.127 -3.539  1.00 21.59  ? 3090 HOH B O   1 
HETATM 3545 O  O   . HOH I 4 .   ? 74.392 65.362  -8.676  1.00 19.56  ? 3091 HOH B O   1 
HETATM 3546 O  O   . HOH I 4 .   ? 74.850 86.102  10.971  1.00 18.83  ? 3092 HOH B O   1 
HETATM 3547 O  O   . HOH I 4 .   ? 61.438 67.329  -1.597  1.00 20.99  ? 3093 HOH B O   1 
HETATM 3548 O  O   . HOH I 4 .   ? 54.756 100.359 4.838   1.00 18.19  ? 3094 HOH B O   1 
HETATM 3549 O  O   . HOH I 4 .   ? 71.393 84.686  14.096  1.00 19.91  ? 3095 HOH B O   1 
HETATM 3550 O  O   . HOH I 4 .   ? 63.720 90.626  -1.885  1.00 18.44  ? 3096 HOH B O   1 
HETATM 3551 O  O   . HOH I 4 .   ? 71.074 90.960  14.151  1.00 19.96  ? 3097 HOH B O   1 
HETATM 3552 O  O   . HOH I 4 .   ? 64.871 102.690 1.627   1.00 19.83  ? 3098 HOH B O   1 
HETATM 3553 O  O   . HOH I 4 .   ? 46.998 88.180  -7.897  1.00 21.80  ? 3099 HOH B O   1 
HETATM 3554 O  O   . HOH I 4 .   ? 46.773 95.515  7.755   1.00 21.34  ? 3100 HOH B O   1 
HETATM 3555 O  O   . HOH I 4 .   ? 57.716 96.638  15.161  1.00 21.00  ? 3101 HOH B O   1 
HETATM 3556 O  O   . HOH I 4 .   ? 61.782 78.895  -17.174 1.00 19.78  ? 3102 HOH B O   1 
HETATM 3557 O  O   . HOH I 4 .   ? 46.898 84.049  -0.931  1.00 20.84  ? 3103 HOH B O   1 
HETATM 3558 O  O   . HOH I 4 .   ? 75.450 84.055  -0.030  1.00 22.06  ? 3104 HOH B O   1 
HETATM 3559 O  O   . HOH I 4 .   ? 53.871 101.001 -6.230  1.00 21.69  ? 3105 HOH B O   1 
HETATM 3560 O  O   . HOH I 4 .   ? 55.559 100.960 -4.212  1.00 20.50  ? 3106 HOH B O   1 
HETATM 3561 O  O   . HOH I 4 .   ? 76.749 84.258  10.329  1.00 20.80  ? 3107 HOH B O   1 
HETATM 3562 O  O   . HOH I 4 .   ? 77.968 75.884  0.939   1.00 19.18  ? 3108 HOH B O   1 
HETATM 3563 O  O   . HOH I 4 .   ? 72.973 87.884  2.763   1.00 21.96  ? 3109 HOH B O   1 
HETATM 3564 O  O   . HOH I 4 .   ? 55.825 94.567  18.337  1.00 23.15  ? 3110 HOH B O   1 
HETATM 3565 O  O   . HOH I 4 .   ? 60.709 101.344 -18.348 1.00 22.45  ? 3111 HOH B O   1 
HETATM 3566 O  O   . HOH I 4 .   ? 61.110 80.135  -19.814 1.00 23.50  ? 3112 HOH B O   1 
HETATM 3567 O  O   . HOH I 4 .   ? 69.435 74.370  -12.040 1.00 20.79  ? 3113 HOH B O   1 
HETATM 3568 O  O   . HOH I 4 .   ? 55.140 98.533  -22.560 1.00 24.42  ? 3114 HOH B O   1 
HETATM 3569 O  O   . HOH I 4 .   ? 75.787 80.267  11.123  1.00 20.81  ? 3115 HOH B O   1 
HETATM 3570 O  O   . HOH I 4 .   ? 47.401 86.668  0.704   1.00 23.56  ? 3116 HOH B O   1 
HETATM 3571 O  O   . HOH I 4 .   ? 64.297 69.709  -15.231 1.00 21.08  ? 3117 HOH B O   1 
HETATM 3572 O  O   . HOH I 4 .   ? 82.190 76.119  9.215   1.00 23.55  ? 3118 HOH B O   1 
HETATM 3573 O  O   . HOH I 4 .   ? 74.130 96.838  12.086  1.00 22.99  ? 3119 HOH B O   1 
HETATM 3574 O  O   . HOH I 4 .   ? 56.826 94.148  -25.427 1.00 26.07  ? 3120 HOH B O   1 
HETATM 3575 O  O   . HOH I 4 .   ? 60.141 103.140 -4.761  1.00 21.99  ? 3121 HOH B O   1 
HETATM 3576 O  O   . HOH I 4 .   ? 75.781 79.537  -1.293  1.00 21.47  ? 3122 HOH B O   1 
HETATM 3577 O  O   . HOH I 4 .   ? 74.259 97.465  -15.530 1.00 22.46  ? 3123 HOH B O   1 
HETATM 3578 O  O   . HOH I 4 .   ? 68.961 63.531  8.247   1.00 23.81  ? 3124 HOH B O   1 
HETATM 3579 O  O   . HOH I 4 .   ? 65.467 64.827  4.325   1.00 21.83  ? 3125 HOH B O   1 
HETATM 3580 O  O   . HOH I 4 .   ? 59.441 71.758  -2.813  1.00 24.88  ? 3126 HOH B O   1 
HETATM 3581 O  O   . HOH I 4 .   ? 56.285 98.575  8.754   1.00 21.01  ? 3127 HOH B O   1 
HETATM 3582 O  O   . HOH I 4 .   ? 60.697 68.918  0.346   1.00 24.21  ? 3128 HOH B O   1 
HETATM 3583 O  O   . HOH I 4 .   ? 63.822 69.284  -10.202 1.00 23.01  ? 3129 HOH B O   1 
HETATM 3584 O  O   . HOH I 4 .   ? 57.597 73.127  -3.876  1.00 24.60  ? 3130 HOH B O   1 
HETATM 3585 O  O   . HOH I 4 .   ? 73.763 97.039  -3.121  1.00 24.73  ? 3131 HOH B O   1 
HETATM 3586 O  O   . HOH I 4 .   ? 61.262 74.908  9.134   1.00 24.78  ? 3132 HOH B O   1 
HETATM 3587 O  O   . HOH I 4 .   ? 54.468 92.438  -20.185 1.00 23.23  ? 3133 HOH B O   1 
HETATM 3588 O  O   . HOH I 4 .   ? 75.780 96.147  -10.283 1.00 22.98  ? 3134 HOH B O   1 
HETATM 3589 O  O   . HOH I 4 .   ? 54.982 102.574 -1.769  1.00 22.54  ? 3135 HOH B O   1 
HETATM 3590 O  O   . HOH I 4 .   ? 78.829 86.274  5.713   1.00 24.87  ? 3136 HOH B O   1 
HETATM 3591 O  O   . HOH I 4 .   ? 67.802 77.205  15.592  1.00 27.39  ? 3137 HOH B O   1 
HETATM 3592 O  O   . HOH I 4 .   ? 57.426 88.434  -20.955 1.00 23.27  ? 3138 HOH B O   1 
HETATM 3593 O  O   . HOH I 4 .   ? 74.696 61.795  -1.087  1.00 22.45  ? 3139 HOH B O   1 
HETATM 3594 O  O   . HOH I 4 .   ? 52.071 98.998  -6.587  1.00 24.94  ? 3140 HOH B O   1 
HETATM 3595 O  O   . HOH I 4 .   ? 60.265 105.910 -8.423  1.00 28.22  ? 3141 HOH B O   1 
HETATM 3596 O  O   . HOH I 4 .   ? 75.196 88.535  -7.603  1.00 29.30  ? 3142 HOH B O   1 
HETATM 3597 O  O   . HOH I 4 .   ? 63.915 75.105  10.150  1.00 25.11  ? 3143 HOH B O   1 
HETATM 3598 O  O   . HOH I 4 .   ? 72.838 60.566  0.405   1.00 25.45  ? 3144 HOH B O   1 
HETATM 3599 O  O   . HOH I 4 .   ? 66.201 63.978  7.063   1.00 23.27  ? 3145 HOH B O   1 
HETATM 3600 O  O   . HOH I 4 .   ? 51.664 76.043  -5.472  1.00 26.81  ? 3146 HOH B O   1 
HETATM 3601 O  O   . HOH I 4 .   ? 74.476 70.317  14.624  1.00 25.59  ? 3147 HOH B O   1 
HETATM 3602 O  O   . HOH I 4 .   ? 49.623 99.550  5.481   1.00 30.40  ? 3148 HOH B O   1 
HETATM 3603 O  O   . HOH I 4 .   ? 52.672 93.519  15.349  1.00 28.57  ? 3149 HOH B O   1 
HETATM 3604 O  O   . HOH I 4 .   ? 53.726 98.516  8.550   1.00 26.86  ? 3150 HOH B O   1 
HETATM 3605 O  O   . HOH I 4 .   ? 78.932 77.606  12.940  1.00 26.12  ? 3151 HOH B O   1 
HETATM 3606 O  O   . HOH I 4 .   ? 51.665 100.649 3.764   1.00 28.11  ? 3152 HOH B O   1 
HETATM 3607 O  O   . HOH I 4 .   ? 49.414 96.071  -8.604  1.00 26.63  ? 3153 HOH B O   1 
HETATM 3608 O  O   . HOH I 4 .   ? 55.984 100.979 -23.574 1.00 23.49  ? 3154 HOH B O   1 
HETATM 3609 O  O   . HOH I 4 .   ? 45.433 98.482  3.466   1.00 25.22  ? 3155 HOH B O   1 
HETATM 3610 O  O   . HOH I 4 .   ? 71.902 99.413  -0.889  1.00 24.77  ? 3156 HOH B O   1 
HETATM 3611 O  O   . HOH I 4 .   ? 76.613 69.326  10.149  1.00 26.74  ? 3157 HOH B O   1 
HETATM 3612 O  O   . HOH I 4 .   ? 61.052 71.008  -4.949  1.00 26.23  ? 3158 HOH B O   1 
HETATM 3613 O  O   . HOH I 4 .   ? 72.504 96.627  0.074   1.00 27.39  ? 3159 HOH B O   1 
HETATM 3614 O  O   . HOH I 4 .   ? 69.965 83.709  15.719  1.00 26.97  ? 3160 HOH B O   1 
HETATM 3615 O  O   . HOH I 4 .   ? 57.875 102.257 -5.519  1.00 29.21  ? 3161 HOH B O   1 
HETATM 3616 O  O   . HOH I 4 .   ? 59.096 103.825 -9.571  1.00 28.48  ? 3162 HOH B O   1 
HETATM 3617 O  O   . HOH I 4 .   ? 73.403 105.934 4.674   1.00 29.84  ? 3163 HOH B O   1 
HETATM 3618 O  O   . HOH I 4 .   ? 66.421 75.153  13.797  1.00 28.48  ? 3164 HOH B O   1 
HETATM 3619 O  O   . HOH I 4 .   ? 57.100 99.733  10.896  1.00 25.67  ? 3165 HOH B O   1 
HETATM 3620 O  O   . HOH I 4 .   ? 72.862 80.145  12.241  1.00 28.21  ? 3166 HOH B O   1 
HETATM 3621 O  O   . HOH I 4 .   ? 72.443 72.516  14.411  1.00 25.29  ? 3167 HOH B O   1 
HETATM 3622 O  O   . HOH I 4 .   ? 57.898 103.435 -15.113 1.00 28.47  ? 3168 HOH B O   1 
HETATM 3623 O  O   . HOH I 4 .   ? 74.080 97.588  1.983   1.00 30.31  ? 3169 HOH B O   1 
HETATM 3624 O  O   . HOH I 4 .   ? 67.481 102.809 5.267   1.00 29.59  ? 3170 HOH B O   1 
HETATM 3625 O  O   . HOH I 4 .   ? 66.046 104.430 -2.016  1.00 25.18  ? 3171 HOH B O   1 
HETATM 3626 O  O   . HOH I 4 .   ? 57.713 91.139  19.648  1.00 29.37  ? 3172 HOH B O   1 
HETATM 3627 O  O   . HOH I 4 .   ? 78.765 84.751  8.210   1.00 27.10  ? 3173 HOH B O   1 
HETATM 3628 O  O   . HOH I 4 .   ? 51.896 96.874  -9.178  1.00 26.58  ? 3174 HOH B O   1 
HETATM 3629 O  O   . HOH I 4 .   ? 45.062 89.616  -0.915  1.00 28.36  ? 3175 HOH B O   1 
HETATM 3630 O  O   . HOH I 4 .   ? 67.191 86.339  18.291  1.00 33.39  ? 3176 HOH B O   1 
HETATM 3631 O  O   . HOH I 4 .   ? 72.727 65.625  14.193  1.00 31.29  ? 3177 HOH B O   1 
HETATM 3632 O  O   . HOH I 4 .   ? 78.156 90.221  -11.961 1.00 27.53  ? 3178 HOH B O   1 
HETATM 3633 O  O   . HOH I 4 .   ? 73.704 85.230  -4.961  1.00 28.79  ? 3179 HOH B O   1 
HETATM 3634 O  O   . HOH I 4 .   ? 61.794 82.383  -24.197 1.00 30.68  ? 3180 HOH B O   1 
HETATM 3635 O  O   . HOH I 4 .   ? 71.375 102.679 -18.828 1.00 27.64  ? 3181 HOH B O   1 
HETATM 3636 O  O   . HOH I 4 .   ? 70.334 103.088 5.908   1.00 32.16  ? 3182 HOH B O   1 
HETATM 3637 O  O   . HOH I 4 .   ? 70.199 94.769  -20.746 1.00 29.07  ? 3183 HOH B O   1 
HETATM 3638 O  O   . HOH I 4 .   ? 53.557 77.273  -7.634  1.00 30.76  ? 3184 HOH B O   1 
HETATM 3639 O  O   . HOH I 4 .   ? 78.521 85.413  2.521   1.00 30.43  ? 3185 HOH B O   1 
HETATM 3640 O  O   . HOH I 4 .   ? 45.265 88.115  -5.672  1.00 30.85  ? 3186 HOH B O   1 
HETATM 3641 O  O   . HOH I 4 .   ? 72.234 92.759  12.593  1.00 30.32  ? 3187 HOH B O   1 
HETATM 3642 O  O   . HOH I 4 .   ? 74.787 82.800  -12.877 1.00 29.25  ? 3188 HOH B O   1 
HETATM 3643 O  O   . HOH I 4 .   ? 65.044 88.395  -25.040 1.00 38.10  ? 3189 HOH B O   1 
HETATM 3644 O  O   . HOH I 4 .   ? 79.506 63.679  -0.365  1.00 27.34  ? 3190 HOH B O   1 
HETATM 3645 O  O   . HOH I 4 .   ? 76.925 88.459  2.938   1.00 27.57  ? 3191 HOH B O   1 
HETATM 3646 O  O   . HOH I 4 .   ? 70.439 73.130  -14.549 1.00 30.34  ? 3192 HOH B O   1 
HETATM 3647 O  O   . HOH I 4 .   ? 48.616 94.577  -6.005  1.00 28.54  ? 3193 HOH B O   1 
HETATM 3648 O  O   . HOH I 4 .   ? 72.163 81.712  -9.362  1.00 28.38  ? 3194 HOH B O   1 
HETATM 3649 O  O   . HOH I 4 .   ? 59.473 77.788  -16.914 1.00 29.18  ? 3195 HOH B O   1 
HETATM 3650 O  O   . HOH I 4 .   ? 68.653 69.289  13.112  1.00 31.23  ? 3196 HOH B O   1 
HETATM 3651 O  O   . HOH I 4 .   ? 78.085 61.875  -3.209  1.00 31.17  ? 3197 HOH B O   1 
HETATM 3652 O  O   . HOH I 4 .   ? 48.230 88.657  -13.713 1.00 30.97  ? 3198 HOH B O   1 
HETATM 3653 O  O   . HOH I 4 .   ? 67.241 103.787 1.921   1.00 33.76  ? 3199 HOH B O   1 
HETATM 3654 O  O   . HOH I 4 .   ? 77.225 63.684  -6.434  1.00 35.68  ? 3200 HOH B O   1 
HETATM 3655 O  O   . HOH I 4 .   ? 42.142 90.801  1.858   1.00 33.19  ? 3201 HOH B O   1 
HETATM 3656 O  O   . HOH I 4 .   ? 48.285 92.448  -7.569  1.00 27.49  ? 3202 HOH B O   1 
HETATM 3657 O  O   . HOH I 4 .   ? 68.335 76.568  -15.428 1.00 33.11  ? 3203 HOH B O   1 
HETATM 3658 O  O   . HOH I 4 .   ? 55.781 102.903 -21.342 1.00 31.54  ? 3204 HOH B O   1 
HETATM 3659 O  O   . HOH I 4 .   ? 53.367 85.940  -15.361 1.00 36.18  ? 3205 HOH B O   1 
HETATM 3660 O  O   . HOH I 4 .   ? 65.973 103.259 9.347   1.00 29.96  ? 3206 HOH B O   1 
HETATM 3661 O  O   . HOH I 4 .   ? 74.231 89.055  11.810  1.00 34.22  ? 3207 HOH B O   1 
HETATM 3662 O  O   . HOH I 4 .   ? 61.907 89.357  -25.442 1.00 30.48  ? 3208 HOH B O   1 
HETATM 3663 O  O   . HOH I 4 .   ? 69.560 100.887 -19.086 1.00 33.52  ? 3209 HOH B O   1 
HETATM 3664 O  O   . HOH I 4 .   ? 78.829 67.051  -8.174  1.00 35.73  ? 3210 HOH B O   1 
HETATM 3665 O  O   . HOH I 4 .   ? 68.737 88.370  19.278  1.00 35.83  ? 3211 HOH B O   1 
HETATM 3666 O  O   . HOH I 4 .   ? 49.346 84.405  -10.364 1.00 35.41  ? 3212 HOH B O   1 
HETATM 3667 O  O   . HOH I 4 .   ? 68.966 94.102  -23.240 1.00 33.32  ? 3213 HOH B O   1 
HETATM 3668 O  O   . HOH I 4 .   ? 73.963 82.493  -4.807  1.00 46.43  ? 3214 HOH B O   1 
HETATM 3669 O  O   . HOH I 4 .   ? 76.974 78.062  2.342   1.00 31.19  ? 3215 HOH B O   1 
HETATM 3670 O  O   . HOH I 4 .   ? 48.744 97.519  -3.727  1.00 28.48  ? 3216 HOH B O   1 
HETATM 3671 O  O   . HOH I 4 .   ? 73.236 92.970  -20.456 1.00 29.66  ? 3217 HOH B O   1 
HETATM 3672 O  O   . HOH I 4 .   ? 77.518 86.586  -19.119 1.00 38.67  ? 3218 HOH B O   1 
HETATM 3673 O  O   . HOH I 4 .   ? 72.206 75.685  -11.567 1.00 34.92  ? 3219 HOH B O   1 
HETATM 3674 O  O   . HOH I 4 .   ? 74.506 93.840  -4.737  1.00 33.37  ? 3220 HOH B O   1 
HETATM 3675 O  O   . HOH I 4 .   ? 70.508 101.331 7.847   1.00 37.73  ? 3221 HOH B O   1 
HETATM 3676 O  O   . HOH I 4 .   ? 58.132 106.647 -11.596 1.00 36.86  ? 3222 HOH B O   1 
HETATM 3677 O  O   . HOH I 4 .   ? 71.278 80.441  15.655  1.00 33.78  ? 3223 HOH B O   1 
HETATM 3678 O  O   . HOH I 4 .   ? 67.412 81.145  16.247  1.00 33.21  ? 3224 HOH B O   1 
HETATM 3679 O  O   . HOH I 4 .   ? 71.541 60.692  9.860   1.00 33.38  ? 3225 HOH B O   1 
HETATM 3680 O  O   . HOH I 4 .   ? 64.623 63.046  2.794   1.00 32.33  ? 3226 HOH B O   1 
HETATM 3681 O  O   . HOH I 4 .   ? 72.286 74.581  15.739  1.00 32.50  ? 3227 HOH B O   1 
HETATM 3682 O  O   . HOH I 4 .   ? 49.471 99.772  0.700   1.00 35.94  ? 3228 HOH B O   1 
HETATM 3683 O  O   . HOH I 4 .   ? 74.085 81.266  -7.385  1.00 40.68  ? 3229 HOH B O   1 
HETATM 3684 O  O   . HOH I 4 .   ? 76.103 90.656  13.681  1.00 33.54  ? 3230 HOH B O   1 
HETATM 3685 O  O   . HOH I 4 .   ? 49.021 94.674  -10.871 1.00 31.52  ? 3231 HOH B O   1 
HETATM 3686 O  O   . HOH I 4 .   ? 54.925 101.656 6.940   1.00 36.66  ? 3232 HOH B O   1 
HETATM 3687 O  O   . HOH I 4 .   ? 56.813 71.517  0.421   1.00 38.52  ? 3233 HOH B O   1 
HETATM 3688 O  O   . HOH I 4 .   ? 74.702 80.008  -5.198  1.00 33.69  ? 3234 HOH B O   1 
HETATM 3689 O  O   . HOH I 4 .   ? 42.504 88.703  3.631   1.00 34.60  ? 3235 HOH B O   1 
HETATM 3690 O  O   . HOH I 4 .   ? 75.943 86.146  -23.914 1.00 35.26  ? 3236 HOH B O   1 
HETATM 3691 O  O   . HOH I 4 .   ? 65.695 77.762  -18.967 1.00 37.68  ? 3237 HOH B O   1 
HETATM 3692 O  O   . HOH I 4 .   ? 61.906 64.317  8.206   1.00 37.29  ? 3238 HOH B O   1 
HETATM 3693 O  O   . HOH I 4 .   ? 59.206 102.164 -21.103 1.00 34.59  ? 3239 HOH B O   1 
HETATM 3694 O  O   . HOH I 4 .   ? 59.118 66.394  4.309   1.00 35.59  ? 3240 HOH B O   1 
HETATM 3695 O  O   . HOH I 4 .   ? 44.984 90.677  1.650   1.00 40.17  ? 3241 HOH B O   1 
HETATM 3696 O  O   . HOH I 4 .   ? 68.536 66.454  13.319  1.00 39.55  ? 3242 HOH B O   1 
HETATM 3697 O  O   . HOH I 4 .   ? 78.196 75.128  14.019  1.00 42.94  ? 3243 HOH B O   1 
HETATM 3698 O  O   . HOH I 4 .   ? 74.423 78.447  15.460  1.00 37.87  ? 3244 HOH B O   1 
HETATM 3699 O  O   . HOH I 4 .   ? 80.966 87.439  5.660   1.00 35.04  ? 3245 HOH B O   1 
HETATM 3700 O  O   . HOH I 4 .   ? 77.966 66.639  -5.665  1.00 36.18  ? 3246 HOH B O   1 
HETATM 3701 O  O   . HOH I 4 .   ? 78.451 92.867  -11.782 1.00 43.32  ? 3247 HOH B O   1 
HETATM 3702 O  O   . HOH I 4 .   ? 61.003 105.032 -0.332  1.00 36.44  ? 3248 HOH B O   1 
HETATM 3703 O  O   . HOH I 4 .   ? 76.956 82.410  12.292  1.00 34.96  ? 3249 HOH B O   1 
HETATM 3704 O  O   . HOH I 4 .   ? 76.464 79.179  16.244  1.00 41.59  ? 3250 HOH B O   1 
HETATM 3705 O  O   . HOH I 4 .   ? 73.491 88.429  16.623  1.00 46.32  ? 3251 HOH B O   1 
HETATM 3706 O  O   . HOH I 4 .   ? 74.670 92.889  13.698  1.00 32.30  ? 3252 HOH B O   1 
HETATM 3707 O  O   . HOH I 4 .   ? 75.644 95.194  -15.205 1.00 38.95  ? 3253 HOH B O   1 
HETATM 3708 O  O   . HOH I 4 .   ? 75.395 80.812  -15.217 1.00 35.48  ? 3254 HOH B O   1 
HETATM 3709 O  O   . HOH I 4 .   ? 78.259 59.764  5.263   1.00 44.27  ? 3255 HOH B O   1 
HETATM 3710 O  O   . HOH I 4 .   ? 62.157 68.389  -3.720  1.00 38.00  ? 3256 HOH B O   1 
HETATM 3711 O  O   . HOH I 4 .   ? 58.550 67.398  1.736   1.00 38.51  ? 3257 HOH B O   1 
HETATM 3712 O  O   . HOH I 4 .   ? 53.552 82.091  -12.982 1.00 42.45  ? 3258 HOH B O   1 
HETATM 3713 O  O   . HOH I 4 .   ? 51.630 99.699  -9.166  1.00 38.12  ? 3259 HOH B O   1 
HETATM 3714 O  O   . HOH I 4 .   ? 72.329 63.413  11.079  1.00 34.37  ? 3260 HOH B O   1 
HETATM 3715 O  O   . HOH I 4 .   ? 48.182 101.748 -8.189  1.00 42.53  ? 3261 HOH B O   1 
HETATM 3716 O  O   . HOH I 4 .   ? 74.681 84.106  -22.888 1.00 42.80  ? 3262 HOH B O   1 
HETATM 3717 O  O   . HOH I 4 .   ? 62.554 104.400 1.861   1.00 40.29  ? 3263 HOH B O   1 
HETATM 3718 O  O   . HOH I 4 .   ? 80.468 84.430  9.734   1.00 39.82  ? 3264 HOH B O   1 
HETATM 3719 O  O   . HOH I 4 .   ? 74.167 70.480  -12.298 1.00 48.84  ? 3265 HOH B O   1 
HETATM 3720 O  O   . HOH I 4 .   ? 62.289 103.967 10.239  1.00 39.47  ? 3266 HOH B O   1 
HETATM 3721 O  O   . HOH I 4 .   ? 63.534 76.440  -18.906 1.00 40.79  ? 3267 HOH B O   1 
HETATM 3722 O  O   . HOH I 4 .   ? 62.851 83.929  -26.303 1.00 39.30  ? 3268 HOH B O   1 
HETATM 3723 O  O   . HOH I 4 .   ? 50.027 82.792  -12.440 1.00 36.06  ? 3269 HOH B O   1 
HETATM 3724 O  O   . HOH I 4 .   ? 55.205 76.001  -9.118  1.00 39.79  ? 3270 HOH B O   1 
HETATM 3725 O  O   . HOH I 4 .   ? 65.196 103.013 -22.237 1.00 37.45  ? 3271 HOH B O   1 
HETATM 3726 O  O   . HOH I 4 .   ? 76.037 70.689  -8.576  1.00 41.47  ? 3272 HOH B O   1 
HETATM 3727 O  O   . HOH I 4 .   ? 45.235 84.788  -2.419  1.00 41.07  ? 3273 HOH B O   1 
HETATM 3728 O  O   . HOH I 4 .   ? 54.065 104.839 -2.813  1.00 52.37  ? 3274 HOH B O   1 
HETATM 3729 O  O   . HOH I 4 .   ? 79.735 94.270  -4.704  1.00 46.17  ? 3275 HOH B O   1 
HETATM 3730 O  O   . HOH I 4 .   ? 69.344 80.567  -18.022 1.00 43.28  ? 3276 HOH B O   1 
HETATM 3731 O  O   . HOH I 4 .   ? 49.434 102.961 -6.064  1.00 43.43  ? 3277 HOH B O   1 
HETATM 3732 O  O   . HOH I 4 .   ? 67.699 83.144  -27.264 1.00 39.44  ? 3278 HOH B O   1 
HETATM 3733 O  O   . HOH I 4 .   ? 71.754 60.423  3.676   1.00 44.26  ? 3279 HOH B O   1 
HETATM 3734 O  O   . HOH I 4 .   ? 74.209 81.747  -22.109 1.00 50.66  ? 3280 HOH B O   1 
HETATM 3735 O  O   . HOH I 4 .   ? 77.768 92.931  -2.665  1.00 49.20  ? 3281 HOH B O   1 
HETATM 3736 O  O   . HOH I 4 .   ? 62.104 62.681  1.806   1.00 51.77  ? 3282 HOH B O   1 
HETATM 3737 O  O   . HOH I 4 .   ? 77.472 83.459  -19.519 1.00 61.70  ? 3283 HOH B O   1 
HETATM 3738 O  O   . HOH I 4 .   ? 80.129 83.947  -12.241 1.00 44.89  ? 3284 HOH B O   1 
HETATM 3739 O  O   . HOH I 4 .   ? 58.203 105.711 -1.752  1.00 51.11  ? 3285 HOH B O   1 
HETATM 3740 O  O   . HOH I 4 .   ? 64.719 76.295  -25.057 1.00 54.95  ? 3286 HOH B O   1 
HETATM 3741 O  O   . HOH I 4 .   ? 74.741 63.046  16.713  1.00 51.92  ? 3287 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  TRP 78  78  78  TRP TRP A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  MET 81  81  81  MET MET A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  CYS 85  85  85  CYS CYS A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 CYS 116 116 116 CYS CYS A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 HIS 118 118 118 HIS HIS A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 TRP 125 125 125 TRP TRP A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 GLN 138 138 138 GLN GLN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 TRP 160 160 160 TRP TRP A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 TRP 180 180 180 TRP TRP A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 TRP 185 185 185 TRP TRP A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 LYS 198 198 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   ILE 3   3   3   ILE ILE B . n 
B 1 4   ILE 4   4   4   ILE ILE B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   LYS 7   7   7   LYS LYS B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LYS 9   9   9   LYS LYS B . n 
B 1 10  TYR 10  10  10  TYR TYR B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  HIS 18  18  18  HIS HIS B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  ASN 29  29  29  ASN ASN B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  HIS 32  32  32  HIS HIS B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  SER 52  52  52  SER SER B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  ILE 56  56  56  ILE ILE B . n 
B 1 57  MET 57  57  57  MET MET B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  ILE 71  71  71  ILE ILE B . n 
B 1 72  TRP 72  72  72  TRP TRP B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  HIS 74  74  74  HIS HIS B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  TRP 78  78  78  TRP TRP B . n 
B 1 79  ASP 79  79  79  ASP ASP B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  MET 81  81  81  MET MET B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  PRO 83  83  83  PRO PRO B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  CYS 85  85  85  CYS CYS B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  GLN 98  98  98  GLN GLN B . n 
B 1 99  GLU 99  99  99  GLU GLU B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 PHE 104 104 104 PHE PHE B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 PHE 107 107 107 PHE PHE B . n 
B 1 108 LYS 108 108 108 LYS LYS B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 CYS 116 116 116 CYS CYS B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 HIS 118 118 118 HIS HIS B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 TRP 123 123 123 TRP TRP B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 TRP 125 125 125 TRP TRP B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ASN 129 129 129 ASN ASN B . n 
B 1 130 ASN 130 130 130 ASN ASN B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 ASN 132 132 132 ASN ASN B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 GLN 138 138 138 GLN GLN B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 HIS 140 140 140 HIS HIS B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ASN 144 144 144 ASN ASN B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 CYS 157 157 157 CYS CYS B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 ILE 159 159 159 ILE ILE B . n 
B 1 160 TRP 160 160 160 TRP TRP B . n 
B 1 161 GLU 161 161 161 GLU GLU B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 TYR 165 165 165 TYR TYR B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 TYR 168 168 168 TYR TYR B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 ARG 172 172 172 ARG ARG B . n 
B 1 173 PRO 173 173 173 PRO PRO B . n 
B 1 174 SER 174 174 174 SER SER B . n 
B 1 175 TYR 175 175 175 TYR TYR B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 TRP 179 179 179 TRP TRP B . n 
B 1 180 TRP 180 180 180 TRP TRP B . n 
B 1 181 ASN 181 181 181 ASN ASN B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 TRP 185 185 185 TRP TRP B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ASN 189 189 189 ASN ASN B . n 
B 1 190 GLU 190 190 190 GLU GLU B . n 
B 1 191 ASN 191 191 191 ASN ASN B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 LYS 193 193 193 LYS LYS B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 GLN 197 197 ?   ?   ?   B . n 
B 1 198 LYS 198 198 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CL  1   2002 2002 CL  CL  A . 
D 3 UNX 1   1000 1000 UNX UNX A . 
E 2 CL  1   2001 2001 CL  CL  B . 
F 3 UNX 1   1001 1001 UNX UNX B . 
G 3 UNX 1   3001 3001 UNX UNX B . 
H 4 HOH 1   2003 1    HOH HOH A . 
H 4 HOH 2   2004 2    HOH HOH A . 
H 4 HOH 3   2005 5    HOH HOH A . 
H 4 HOH 4   2006 6    HOH HOH A . 
H 4 HOH 5   2007 7    HOH HOH A . 
H 4 HOH 6   2008 8    HOH HOH A . 
H 4 HOH 7   2009 10   HOH HOH A . 
H 4 HOH 8   2010 11   HOH HOH A . 
H 4 HOH 9   2011 12   HOH HOH A . 
H 4 HOH 10  2012 13   HOH HOH A . 
H 4 HOH 11  2013 15   HOH HOH A . 
H 4 HOH 12  2014 18   HOH HOH A . 
H 4 HOH 13  2015 22   HOH HOH A . 
H 4 HOH 14  2016 25   HOH HOH A . 
H 4 HOH 15  2017 26   HOH HOH A . 
H 4 HOH 16  2018 28   HOH HOH A . 
H 4 HOH 17  2019 32   HOH HOH A . 
H 4 HOH 18  2020 34   HOH HOH A . 
H 4 HOH 19  2021 35   HOH HOH A . 
H 4 HOH 20  2022 37   HOH HOH A . 
H 4 HOH 21  2023 38   HOH HOH A . 
H 4 HOH 22  2024 41   HOH HOH A . 
H 4 HOH 23  2025 42   HOH HOH A . 
H 4 HOH 24  2026 43   HOH HOH A . 
H 4 HOH 25  2027 46   HOH HOH A . 
H 4 HOH 26  2028 47   HOH HOH A . 
H 4 HOH 27  2029 50   HOH HOH A . 
H 4 HOH 28  2030 52   HOH HOH A . 
H 4 HOH 29  2031 55   HOH HOH A . 
H 4 HOH 30  2032 56   HOH HOH A . 
H 4 HOH 31  2033 57   HOH HOH A . 
H 4 HOH 32  2034 65   HOH HOH A . 
H 4 HOH 33  2035 66   HOH HOH A . 
H 4 HOH 34  2036 68   HOH HOH A . 
H 4 HOH 35  2037 69   HOH HOH A . 
H 4 HOH 36  2038 70   HOH HOH A . 
H 4 HOH 37  2039 71   HOH HOH A . 
H 4 HOH 38  2040 74   HOH HOH A . 
H 4 HOH 39  2041 75   HOH HOH A . 
H 4 HOH 40  2042 76   HOH HOH A . 
H 4 HOH 41  2043 77   HOH HOH A . 
H 4 HOH 42  2044 78   HOH HOH A . 
H 4 HOH 43  2045 79   HOH HOH A . 
H 4 HOH 44  2046 81   HOH HOH A . 
H 4 HOH 45  2047 82   HOH HOH A . 
H 4 HOH 46  2048 88   HOH HOH A . 
H 4 HOH 47  2049 94   HOH HOH A . 
H 4 HOH 48  2050 95   HOH HOH A . 
H 4 HOH 49  2051 96   HOH HOH A . 
H 4 HOH 50  2052 97   HOH HOH A . 
H 4 HOH 51  2053 100  HOH HOH A . 
H 4 HOH 52  2054 102  HOH HOH A . 
H 4 HOH 53  2055 103  HOH HOH A . 
H 4 HOH 54  2056 105  HOH HOH A . 
H 4 HOH 55  2057 107  HOH HOH A . 
H 4 HOH 56  2058 110  HOH HOH A . 
H 4 HOH 57  2059 114  HOH HOH A . 
H 4 HOH 58  2060 116  HOH HOH A . 
H 4 HOH 59  2061 117  HOH HOH A . 
H 4 HOH 60  2062 123  HOH HOH A . 
H 4 HOH 61  2063 124  HOH HOH A . 
H 4 HOH 62  2064 125  HOH HOH A . 
H 4 HOH 63  2065 127  HOH HOH A . 
H 4 HOH 64  2066 129  HOH HOH A . 
H 4 HOH 65  2067 131  HOH HOH A . 
H 4 HOH 66  2068 135  HOH HOH A . 
H 4 HOH 67  2069 136  HOH HOH A . 
H 4 HOH 68  2070 137  HOH HOH A . 
H 4 HOH 69  2071 143  HOH HOH A . 
H 4 HOH 70  2072 144  HOH HOH A . 
H 4 HOH 71  2073 145  HOH HOH A . 
H 4 HOH 72  2074 148  HOH HOH A . 
H 4 HOH 73  2075 150  HOH HOH A . 
H 4 HOH 74  2076 152  HOH HOH A . 
H 4 HOH 75  2077 153  HOH HOH A . 
H 4 HOH 76  2078 155  HOH HOH A . 
H 4 HOH 77  2079 158  HOH HOH A . 
H 4 HOH 78  2080 159  HOH HOH A . 
H 4 HOH 79  2081 160  HOH HOH A . 
H 4 HOH 80  2082 162  HOH HOH A . 
H 4 HOH 81  2083 166  HOH HOH A . 
H 4 HOH 82  2084 167  HOH HOH A . 
H 4 HOH 83  2085 169  HOH HOH A . 
H 4 HOH 84  2086 171  HOH HOH A . 
H 4 HOH 85  2087 172  HOH HOH A . 
H 4 HOH 86  2088 173  HOH HOH A . 
H 4 HOH 87  2089 182  HOH HOH A . 
H 4 HOH 88  2090 186  HOH HOH A . 
H 4 HOH 89  2091 187  HOH HOH A . 
H 4 HOH 90  2092 188  HOH HOH A . 
H 4 HOH 91  2093 190  HOH HOH A . 
H 4 HOH 92  2094 193  HOH HOH A . 
H 4 HOH 93  2095 195  HOH HOH A . 
H 4 HOH 94  2096 196  HOH HOH A . 
H 4 HOH 95  2097 197  HOH HOH A . 
H 4 HOH 96  2098 198  HOH HOH A . 
H 4 HOH 97  2099 200  HOH HOH A . 
H 4 HOH 98  2100 203  HOH HOH A . 
H 4 HOH 99  2101 205  HOH HOH A . 
H 4 HOH 100 2102 207  HOH HOH A . 
H 4 HOH 101 2103 208  HOH HOH A . 
H 4 HOH 102 2104 209  HOH HOH A . 
H 4 HOH 103 2105 210  HOH HOH A . 
H 4 HOH 104 2106 212  HOH HOH A . 
H 4 HOH 105 2107 214  HOH HOH A . 
H 4 HOH 106 2108 216  HOH HOH A . 
H 4 HOH 107 2109 218  HOH HOH A . 
H 4 HOH 108 2110 220  HOH HOH A . 
H 4 HOH 109 2111 221  HOH HOH A . 
H 4 HOH 110 2112 222  HOH HOH A . 
H 4 HOH 111 2113 223  HOH HOH A . 
H 4 HOH 112 2114 232  HOH HOH A . 
H 4 HOH 113 2115 233  HOH HOH A . 
H 4 HOH 114 2116 235  HOH HOH A . 
H 4 HOH 115 2117 238  HOH HOH A . 
H 4 HOH 116 2118 239  HOH HOH A . 
H 4 HOH 117 2119 241  HOH HOH A . 
H 4 HOH 118 2120 244  HOH HOH A . 
H 4 HOH 119 2121 245  HOH HOH A . 
H 4 HOH 120 2122 249  HOH HOH A . 
H 4 HOH 121 2123 250  HOH HOH A . 
H 4 HOH 122 2124 251  HOH HOH A . 
H 4 HOH 123 2125 252  HOH HOH A . 
H 4 HOH 124 2126 253  HOH HOH A . 
H 4 HOH 125 2127 258  HOH HOH A . 
H 4 HOH 126 2128 259  HOH HOH A . 
H 4 HOH 127 2129 261  HOH HOH A . 
H 4 HOH 128 2130 262  HOH HOH A . 
H 4 HOH 129 2131 263  HOH HOH A . 
H 4 HOH 130 2132 268  HOH HOH A . 
H 4 HOH 131 2133 269  HOH HOH A . 
H 4 HOH 132 2134 271  HOH HOH A . 
H 4 HOH 133 2135 273  HOH HOH A . 
H 4 HOH 134 2136 274  HOH HOH A . 
H 4 HOH 135 2137 276  HOH HOH A . 
H 4 HOH 136 2138 277  HOH HOH A . 
H 4 HOH 137 2139 282  HOH HOH A . 
H 4 HOH 138 2140 284  HOH HOH A . 
H 4 HOH 139 2141 286  HOH HOH A . 
H 4 HOH 140 2142 287  HOH HOH A . 
H 4 HOH 141 2143 288  HOH HOH A . 
H 4 HOH 142 2144 289  HOH HOH A . 
H 4 HOH 143 2145 290  HOH HOH A . 
H 4 HOH 144 2146 292  HOH HOH A . 
H 4 HOH 145 2147 293  HOH HOH A . 
H 4 HOH 146 2148 295  HOH HOH A . 
H 4 HOH 147 2149 296  HOH HOH A . 
H 4 HOH 148 2150 297  HOH HOH A . 
H 4 HOH 149 2151 300  HOH HOH A . 
H 4 HOH 150 2152 303  HOH HOH A . 
H 4 HOH 151 2153 305  HOH HOH A . 
H 4 HOH 152 2154 308  HOH HOH A . 
H 4 HOH 153 2155 309  HOH HOH A . 
H 4 HOH 154 2156 311  HOH HOH A . 
H 4 HOH 155 2157 312  HOH HOH A . 
H 4 HOH 156 2158 314  HOH HOH A . 
H 4 HOH 157 2159 317  HOH HOH A . 
H 4 HOH 158 2160 318  HOH HOH A . 
H 4 HOH 159 2161 322  HOH HOH A . 
H 4 HOH 160 2162 323  HOH HOH A . 
H 4 HOH 161 2163 324  HOH HOH A . 
H 4 HOH 162 2164 325  HOH HOH A . 
H 4 HOH 163 2165 326  HOH HOH A . 
H 4 HOH 164 2166 327  HOH HOH A . 
H 4 HOH 165 2167 329  HOH HOH A . 
H 4 HOH 166 2168 332  HOH HOH A . 
H 4 HOH 167 2169 335  HOH HOH A . 
H 4 HOH 168 2170 338  HOH HOH A . 
H 4 HOH 169 2171 343  HOH HOH A . 
H 4 HOH 170 2172 346  HOH HOH A . 
H 4 HOH 171 2173 348  HOH HOH A . 
H 4 HOH 172 2174 350  HOH HOH A . 
H 4 HOH 173 2175 352  HOH HOH A . 
H 4 HOH 174 2176 353  HOH HOH A . 
H 4 HOH 175 2177 360  HOH HOH A . 
H 4 HOH 176 2178 361  HOH HOH A . 
H 4 HOH 177 2179 362  HOH HOH A . 
H 4 HOH 178 2180 365  HOH HOH A . 
H 4 HOH 179 2181 366  HOH HOH A . 
H 4 HOH 180 2182 368  HOH HOH A . 
H 4 HOH 181 2183 370  HOH HOH A . 
H 4 HOH 182 2184 372  HOH HOH A . 
H 4 HOH 183 2185 373  HOH HOH A . 
H 4 HOH 184 2186 374  HOH HOH A . 
H 4 HOH 185 2187 375  HOH HOH A . 
H 4 HOH 186 2188 377  HOH HOH A . 
H 4 HOH 187 2189 378  HOH HOH A . 
H 4 HOH 188 2190 379  HOH HOH A . 
H 4 HOH 189 2191 380  HOH HOH A . 
H 4 HOH 190 2192 381  HOH HOH A . 
H 4 HOH 191 2193 383  HOH HOH A . 
H 4 HOH 192 2194 386  HOH HOH A . 
H 4 HOH 193 2195 387  HOH HOH A . 
H 4 HOH 194 2196 389  HOH HOH A . 
H 4 HOH 195 2197 390  HOH HOH A . 
H 4 HOH 196 2198 391  HOH HOH A . 
H 4 HOH 197 2199 393  HOH HOH A . 
H 4 HOH 198 2200 394  HOH HOH A . 
H 4 HOH 199 2201 396  HOH HOH A . 
H 4 HOH 200 2202 397  HOH HOH A . 
H 4 HOH 201 2203 398  HOH HOH A . 
H 4 HOH 202 2204 400  HOH HOH A . 
H 4 HOH 203 2205 401  HOH HOH A . 
H 4 HOH 204 2206 404  HOH HOH A . 
H 4 HOH 205 2207 408  HOH HOH A . 
H 4 HOH 206 2208 410  HOH HOH A . 
H 4 HOH 207 2209 412  HOH HOH A . 
H 4 HOH 208 2210 420  HOH HOH A . 
H 4 HOH 209 2211 421  HOH HOH A . 
H 4 HOH 210 2212 422  HOH HOH A . 
H 4 HOH 211 2213 428  HOH HOH A . 
H 4 HOH 212 2214 429  HOH HOH A . 
H 4 HOH 213 2215 430  HOH HOH A . 
H 4 HOH 214 2216 431  HOH HOH A . 
H 4 HOH 215 2217 433  HOH HOH A . 
H 4 HOH 216 2218 434  HOH HOH A . 
H 4 HOH 217 2219 435  HOH HOH A . 
H 4 HOH 218 2220 437  HOH HOH A . 
H 4 HOH 219 2221 439  HOH HOH A . 
H 4 HOH 220 2222 441  HOH HOH A . 
H 4 HOH 221 2223 443  HOH HOH A . 
H 4 HOH 222 2224 445  HOH HOH A . 
H 4 HOH 223 2225 446  HOH HOH A . 
H 4 HOH 224 2226 449  HOH HOH A . 
H 4 HOH 225 2227 450  HOH HOH A . 
H 4 HOH 226 2228 453  HOH HOH A . 
H 4 HOH 227 2229 456  HOH HOH A . 
H 4 HOH 228 2230 457  HOH HOH A . 
H 4 HOH 229 2231 459  HOH HOH A . 
H 4 HOH 230 2232 465  HOH HOH A . 
H 4 HOH 231 2233 466  HOH HOH A . 
H 4 HOH 232 2234 470  HOH HOH A . 
H 4 HOH 233 2235 471  HOH HOH A . 
H 4 HOH 234 2236 472  HOH HOH A . 
H 4 HOH 235 2237 473  HOH HOH A . 
H 4 HOH 236 2238 474  HOH HOH A . 
H 4 HOH 237 2239 479  HOH HOH A . 
H 4 HOH 238 2240 480  HOH HOH A . 
H 4 HOH 239 2241 483  HOH HOH A . 
H 4 HOH 240 2242 484  HOH HOH A . 
H 4 HOH 241 2243 489  HOH HOH A . 
H 4 HOH 242 2244 491  HOH HOH A . 
H 4 HOH 243 2245 492  HOH HOH A . 
H 4 HOH 244 2246 493  HOH HOH A . 
H 4 HOH 245 2247 495  HOH HOH A . 
H 4 HOH 246 2248 497  HOH HOH A . 
H 4 HOH 247 2249 499  HOH HOH A . 
H 4 HOH 248 2250 500  HOH HOH A . 
H 4 HOH 249 2251 502  HOH HOH A . 
H 4 HOH 250 2252 503  HOH HOH A . 
H 4 HOH 251 2253 504  HOH HOH A . 
H 4 HOH 252 2254 505  HOH HOH A . 
H 4 HOH 253 2255 506  HOH HOH A . 
H 4 HOH 254 2256 513  HOH HOH A . 
H 4 HOH 255 2257 523  HOH HOH A . 
H 4 HOH 256 2258 524  HOH HOH A . 
H 4 HOH 257 2259 527  HOH HOH A . 
H 4 HOH 258 2260 528  HOH HOH A . 
H 4 HOH 259 2261 529  HOH HOH A . 
H 4 HOH 260 2262 532  HOH HOH A . 
H 4 HOH 261 2263 533  HOH HOH A . 
H 4 HOH 262 2264 535  HOH HOH A . 
H 4 HOH 263 2265 537  HOH HOH A . 
H 4 HOH 264 2266 538  HOH HOH A . 
H 4 HOH 265 2267 540  HOH HOH A . 
H 4 HOH 266 2268 542  HOH HOH A . 
H 4 HOH 267 2269 543  HOH HOH A . 
H 4 HOH 268 2270 544  HOH HOH A . 
H 4 HOH 269 2271 548  HOH HOH A . 
H 4 HOH 270 2272 549  HOH HOH A . 
H 4 HOH 271 2273 552  HOH HOH A . 
H 4 HOH 272 2274 557  HOH HOH A . 
H 4 HOH 273 2275 558  HOH HOH A . 
I 4 HOH 1   3002 3    HOH HOH B . 
I 4 HOH 2   3003 4    HOH HOH B . 
I 4 HOH 3   3004 9    HOH HOH B . 
I 4 HOH 4   3005 14   HOH HOH B . 
I 4 HOH 5   3006 16   HOH HOH B . 
I 4 HOH 6   3007 17   HOH HOH B . 
I 4 HOH 7   3008 19   HOH HOH B . 
I 4 HOH 8   3009 20   HOH HOH B . 
I 4 HOH 9   3010 21   HOH HOH B . 
I 4 HOH 10  3011 23   HOH HOH B . 
I 4 HOH 11  3012 24   HOH HOH B . 
I 4 HOH 12  3013 27   HOH HOH B . 
I 4 HOH 13  3014 29   HOH HOH B . 
I 4 HOH 14  3015 30   HOH HOH B . 
I 4 HOH 15  3016 31   HOH HOH B . 
I 4 HOH 16  3017 33   HOH HOH B . 
I 4 HOH 17  3018 36   HOH HOH B . 
I 4 HOH 18  3019 39   HOH HOH B . 
I 4 HOH 19  3020 40   HOH HOH B . 
I 4 HOH 20  3021 44   HOH HOH B . 
I 4 HOH 21  3022 45   HOH HOH B . 
I 4 HOH 22  3023 48   HOH HOH B . 
I 4 HOH 23  3024 49   HOH HOH B . 
I 4 HOH 24  3025 51   HOH HOH B . 
I 4 HOH 25  3026 53   HOH HOH B . 
I 4 HOH 26  3027 54   HOH HOH B . 
I 4 HOH 27  3028 58   HOH HOH B . 
I 4 HOH 28  3029 59   HOH HOH B . 
I 4 HOH 29  3030 60   HOH HOH B . 
I 4 HOH 30  3031 61   HOH HOH B . 
I 4 HOH 31  3032 62   HOH HOH B . 
I 4 HOH 32  3033 63   HOH HOH B . 
I 4 HOH 33  3034 64   HOH HOH B . 
I 4 HOH 34  3035 67   HOH HOH B . 
I 4 HOH 35  3036 72   HOH HOH B . 
I 4 HOH 36  3037 73   HOH HOH B . 
I 4 HOH 37  3038 80   HOH HOH B . 
I 4 HOH 38  3039 83   HOH HOH B . 
I 4 HOH 39  3040 84   HOH HOH B . 
I 4 HOH 40  3041 85   HOH HOH B . 
I 4 HOH 41  3042 86   HOH HOH B . 
I 4 HOH 42  3043 87   HOH HOH B . 
I 4 HOH 43  3044 89   HOH HOH B . 
I 4 HOH 44  3045 90   HOH HOH B . 
I 4 HOH 45  3046 91   HOH HOH B . 
I 4 HOH 46  3047 92   HOH HOH B . 
I 4 HOH 47  3048 93   HOH HOH B . 
I 4 HOH 48  3049 98   HOH HOH B . 
I 4 HOH 49  3050 99   HOH HOH B . 
I 4 HOH 50  3051 101  HOH HOH B . 
I 4 HOH 51  3052 104  HOH HOH B . 
I 4 HOH 52  3053 106  HOH HOH B . 
I 4 HOH 53  3054 108  HOH HOH B . 
I 4 HOH 54  3055 109  HOH HOH B . 
I 4 HOH 55  3056 111  HOH HOH B . 
I 4 HOH 56  3057 112  HOH HOH B . 
I 4 HOH 57  3058 113  HOH HOH B . 
I 4 HOH 58  3059 115  HOH HOH B . 
I 4 HOH 59  3060 118  HOH HOH B . 
I 4 HOH 60  3061 119  HOH HOH B . 
I 4 HOH 61  3062 120  HOH HOH B . 
I 4 HOH 62  3063 121  HOH HOH B . 
I 4 HOH 63  3064 122  HOH HOH B . 
I 4 HOH 64  3065 126  HOH HOH B . 
I 4 HOH 65  3066 128  HOH HOH B . 
I 4 HOH 66  3067 130  HOH HOH B . 
I 4 HOH 67  3068 132  HOH HOH B . 
I 4 HOH 68  3069 133  HOH HOH B . 
I 4 HOH 69  3070 134  HOH HOH B . 
I 4 HOH 70  3071 138  HOH HOH B . 
I 4 HOH 71  3072 139  HOH HOH B . 
I 4 HOH 72  3073 140  HOH HOH B . 
I 4 HOH 73  3074 141  HOH HOH B . 
I 4 HOH 74  3075 142  HOH HOH B . 
I 4 HOH 75  3076 146  HOH HOH B . 
I 4 HOH 76  3077 147  HOH HOH B . 
I 4 HOH 77  3078 149  HOH HOH B . 
I 4 HOH 78  3079 151  HOH HOH B . 
I 4 HOH 79  3080 154  HOH HOH B . 
I 4 HOH 80  3081 156  HOH HOH B . 
I 4 HOH 81  3082 157  HOH HOH B . 
I 4 HOH 82  3083 161  HOH HOH B . 
I 4 HOH 83  3084 163  HOH HOH B . 
I 4 HOH 84  3085 164  HOH HOH B . 
I 4 HOH 85  3086 165  HOH HOH B . 
I 4 HOH 86  3087 168  HOH HOH B . 
I 4 HOH 87  3088 170  HOH HOH B . 
I 4 HOH 88  3089 174  HOH HOH B . 
I 4 HOH 89  3090 175  HOH HOH B . 
I 4 HOH 90  3091 176  HOH HOH B . 
I 4 HOH 91  3092 177  HOH HOH B . 
I 4 HOH 92  3093 178  HOH HOH B . 
I 4 HOH 93  3094 179  HOH HOH B . 
I 4 HOH 94  3095 180  HOH HOH B . 
I 4 HOH 95  3096 181  HOH HOH B . 
I 4 HOH 96  3097 183  HOH HOH B . 
I 4 HOH 97  3098 184  HOH HOH B . 
I 4 HOH 98  3099 185  HOH HOH B . 
I 4 HOH 99  3100 189  HOH HOH B . 
I 4 HOH 100 3101 191  HOH HOH B . 
I 4 HOH 101 3102 192  HOH HOH B . 
I 4 HOH 102 3103 194  HOH HOH B . 
I 4 HOH 103 3104 199  HOH HOH B . 
I 4 HOH 104 3105 201  HOH HOH B . 
I 4 HOH 105 3106 202  HOH HOH B . 
I 4 HOH 106 3107 204  HOH HOH B . 
I 4 HOH 107 3108 206  HOH HOH B . 
I 4 HOH 108 3109 211  HOH HOH B . 
I 4 HOH 109 3110 213  HOH HOH B . 
I 4 HOH 110 3111 215  HOH HOH B . 
I 4 HOH 111 3112 217  HOH HOH B . 
I 4 HOH 112 3113 219  HOH HOH B . 
I 4 HOH 113 3114 224  HOH HOH B . 
I 4 HOH 114 3115 225  HOH HOH B . 
I 4 HOH 115 3116 226  HOH HOH B . 
I 4 HOH 116 3117 227  HOH HOH B . 
I 4 HOH 117 3118 228  HOH HOH B . 
I 4 HOH 118 3119 229  HOH HOH B . 
I 4 HOH 119 3120 230  HOH HOH B . 
I 4 HOH 120 3121 231  HOH HOH B . 
I 4 HOH 121 3122 234  HOH HOH B . 
I 4 HOH 122 3123 236  HOH HOH B . 
I 4 HOH 123 3124 237  HOH HOH B . 
I 4 HOH 124 3125 240  HOH HOH B . 
I 4 HOH 125 3126 242  HOH HOH B . 
I 4 HOH 126 3127 243  HOH HOH B . 
I 4 HOH 127 3128 246  HOH HOH B . 
I 4 HOH 128 3129 247  HOH HOH B . 
I 4 HOH 129 3130 248  HOH HOH B . 
I 4 HOH 130 3131 254  HOH HOH B . 
I 4 HOH 131 3132 255  HOH HOH B . 
I 4 HOH 132 3133 256  HOH HOH B . 
I 4 HOH 133 3134 257  HOH HOH B . 
I 4 HOH 134 3135 260  HOH HOH B . 
I 4 HOH 135 3136 264  HOH HOH B . 
I 4 HOH 136 3137 265  HOH HOH B . 
I 4 HOH 137 3138 266  HOH HOH B . 
I 4 HOH 138 3139 267  HOH HOH B . 
I 4 HOH 139 3140 270  HOH HOH B . 
I 4 HOH 140 3141 272  HOH HOH B . 
I 4 HOH 141 3142 275  HOH HOH B . 
I 4 HOH 142 3143 278  HOH HOH B . 
I 4 HOH 143 3144 279  HOH HOH B . 
I 4 HOH 144 3145 280  HOH HOH B . 
I 4 HOH 145 3146 281  HOH HOH B . 
I 4 HOH 146 3147 283  HOH HOH B . 
I 4 HOH 147 3148 285  HOH HOH B . 
I 4 HOH 148 3149 291  HOH HOH B . 
I 4 HOH 149 3150 294  HOH HOH B . 
I 4 HOH 150 3151 298  HOH HOH B . 
I 4 HOH 151 3152 299  HOH HOH B . 
I 4 HOH 152 3153 301  HOH HOH B . 
I 4 HOH 153 3154 302  HOH HOH B . 
I 4 HOH 154 3155 304  HOH HOH B . 
I 4 HOH 155 3156 306  HOH HOH B . 
I 4 HOH 156 3157 307  HOH HOH B . 
I 4 HOH 157 3158 310  HOH HOH B . 
I 4 HOH 158 3159 313  HOH HOH B . 
I 4 HOH 159 3160 315  HOH HOH B . 
I 4 HOH 160 3161 316  HOH HOH B . 
I 4 HOH 161 3162 319  HOH HOH B . 
I 4 HOH 162 3163 320  HOH HOH B . 
I 4 HOH 163 3164 321  HOH HOH B . 
I 4 HOH 164 3165 328  HOH HOH B . 
I 4 HOH 165 3166 330  HOH HOH B . 
I 4 HOH 166 3167 331  HOH HOH B . 
I 4 HOH 167 3168 333  HOH HOH B . 
I 4 HOH 168 3169 334  HOH HOH B . 
I 4 HOH 169 3170 336  HOH HOH B . 
I 4 HOH 170 3171 337  HOH HOH B . 
I 4 HOH 171 3172 339  HOH HOH B . 
I 4 HOH 172 3173 340  HOH HOH B . 
I 4 HOH 173 3174 341  HOH HOH B . 
I 4 HOH 174 3175 342  HOH HOH B . 
I 4 HOH 175 3176 344  HOH HOH B . 
I 4 HOH 176 3177 345  HOH HOH B . 
I 4 HOH 177 3178 347  HOH HOH B . 
I 4 HOH 178 3179 349  HOH HOH B . 
I 4 HOH 179 3180 351  HOH HOH B . 
I 4 HOH 180 3181 354  HOH HOH B . 
I 4 HOH 181 3182 355  HOH HOH B . 
I 4 HOH 182 3183 356  HOH HOH B . 
I 4 HOH 183 3184 357  HOH HOH B . 
I 4 HOH 184 3185 358  HOH HOH B . 
I 4 HOH 185 3186 359  HOH HOH B . 
I 4 HOH 186 3187 363  HOH HOH B . 
I 4 HOH 187 3188 364  HOH HOH B . 
I 4 HOH 188 3189 367  HOH HOH B . 
I 4 HOH 189 3190 369  HOH HOH B . 
I 4 HOH 190 3191 371  HOH HOH B . 
I 4 HOH 191 3192 376  HOH HOH B . 
I 4 HOH 192 3193 382  HOH HOH B . 
I 4 HOH 193 3194 384  HOH HOH B . 
I 4 HOH 194 3195 385  HOH HOH B . 
I 4 HOH 195 3196 388  HOH HOH B . 
I 4 HOH 196 3197 392  HOH HOH B . 
I 4 HOH 197 3198 395  HOH HOH B . 
I 4 HOH 198 3199 399  HOH HOH B . 
I 4 HOH 199 3200 402  HOH HOH B . 
I 4 HOH 200 3201 403  HOH HOH B . 
I 4 HOH 201 3202 405  HOH HOH B . 
I 4 HOH 202 3203 406  HOH HOH B . 
I 4 HOH 203 3204 407  HOH HOH B . 
I 4 HOH 204 3205 409  HOH HOH B . 
I 4 HOH 205 3206 411  HOH HOH B . 
I 4 HOH 206 3207 413  HOH HOH B . 
I 4 HOH 207 3208 414  HOH HOH B . 
I 4 HOH 208 3209 415  HOH HOH B . 
I 4 HOH 209 3210 416  HOH HOH B . 
I 4 HOH 210 3211 417  HOH HOH B . 
I 4 HOH 211 3212 418  HOH HOH B . 
I 4 HOH 212 3213 419  HOH HOH B . 
I 4 HOH 213 3214 423  HOH HOH B . 
I 4 HOH 214 3215 424  HOH HOH B . 
I 4 HOH 215 3216 425  HOH HOH B . 
I 4 HOH 216 3217 426  HOH HOH B . 
I 4 HOH 217 3218 427  HOH HOH B . 
I 4 HOH 218 3219 432  HOH HOH B . 
I 4 HOH 219 3220 436  HOH HOH B . 
I 4 HOH 220 3221 438  HOH HOH B . 
I 4 HOH 221 3222 440  HOH HOH B . 
I 4 HOH 222 3223 442  HOH HOH B . 
I 4 HOH 223 3224 444  HOH HOH B . 
I 4 HOH 224 3225 447  HOH HOH B . 
I 4 HOH 225 3226 448  HOH HOH B . 
I 4 HOH 226 3227 451  HOH HOH B . 
I 4 HOH 227 3228 452  HOH HOH B . 
I 4 HOH 228 3229 454  HOH HOH B . 
I 4 HOH 229 3230 455  HOH HOH B . 
I 4 HOH 230 3231 458  HOH HOH B . 
I 4 HOH 231 3232 460  HOH HOH B . 
I 4 HOH 232 3233 461  HOH HOH B . 
I 4 HOH 233 3234 462  HOH HOH B . 
I 4 HOH 234 3235 463  HOH HOH B . 
I 4 HOH 235 3236 464  HOH HOH B . 
I 4 HOH 236 3237 467  HOH HOH B . 
I 4 HOH 237 3238 468  HOH HOH B . 
I 4 HOH 238 3239 469  HOH HOH B . 
I 4 HOH 239 3240 475  HOH HOH B . 
I 4 HOH 240 3241 476  HOH HOH B . 
I 4 HOH 241 3242 477  HOH HOH B . 
I 4 HOH 242 3243 478  HOH HOH B . 
I 4 HOH 243 3244 481  HOH HOH B . 
I 4 HOH 244 3245 482  HOH HOH B . 
I 4 HOH 245 3246 485  HOH HOH B . 
I 4 HOH 246 3247 486  HOH HOH B . 
I 4 HOH 247 3248 487  HOH HOH B . 
I 4 HOH 248 3249 488  HOH HOH B . 
I 4 HOH 249 3250 490  HOH HOH B . 
I 4 HOH 250 3251 494  HOH HOH B . 
I 4 HOH 251 3252 496  HOH HOH B . 
I 4 HOH 252 3253 498  HOH HOH B . 
I 4 HOH 253 3254 501  HOH HOH B . 
I 4 HOH 254 3255 507  HOH HOH B . 
I 4 HOH 255 3256 508  HOH HOH B . 
I 4 HOH 256 3257 509  HOH HOH B . 
I 4 HOH 257 3258 510  HOH HOH B . 
I 4 HOH 258 3259 511  HOH HOH B . 
I 4 HOH 259 3260 512  HOH HOH B . 
I 4 HOH 260 3261 514  HOH HOH B . 
I 4 HOH 261 3262 515  HOH HOH B . 
I 4 HOH 262 3263 516  HOH HOH B . 
I 4 HOH 263 3264 517  HOH HOH B . 
I 4 HOH 264 3265 518  HOH HOH B . 
I 4 HOH 265 3266 519  HOH HOH B . 
I 4 HOH 266 3267 520  HOH HOH B . 
I 4 HOH 267 3268 521  HOH HOH B . 
I 4 HOH 268 3269 522  HOH HOH B . 
I 4 HOH 269 3270 525  HOH HOH B . 
I 4 HOH 270 3271 526  HOH HOH B . 
I 4 HOH 271 3272 530  HOH HOH B . 
I 4 HOH 272 3273 531  HOH HOH B . 
I 4 HOH 273 3274 534  HOH HOH B . 
I 4 HOH 274 3275 536  HOH HOH B . 
I 4 HOH 275 3276 539  HOH HOH B . 
I 4 HOH 276 3277 541  HOH HOH B . 
I 4 HOH 277 3278 545  HOH HOH B . 
I 4 HOH 278 3279 546  HOH HOH B . 
I 4 HOH 279 3280 547  HOH HOH B . 
I 4 HOH 280 3281 550  HOH HOH B . 
I 4 HOH 281 3282 551  HOH HOH B . 
I 4 HOH 282 3283 553  HOH HOH B . 
I 4 HOH 283 3284 554  HOH HOH B . 
I 4 HOH 284 3285 555  HOH HOH B . 
I 4 HOH 285 3286 556  HOH HOH B . 
I 4 HOH 286 3287 559  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2110  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  16910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement       5.2.0005       ? 1 
CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 
HKL-2000     'data scaling'   .              ? 3 
MOLREP       phasing          .              ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
300 
;
BIOMOLECULE:
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 2 CHAIN(S).  THE AUTHORS STATE THE 
BIOLOGICAL UNIT IS UNKNOWN.
;
999 
;
SEQEUNCE
THE PLASMODIUM KNOWLESI IRON SUPEROXIDE DISMUTASE SEQUENCE
COMES FROM THE SANGER INSTITUTE WEBSITE.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 B ASP 158 ? ? UNK B UNX 1001 ? ? 2.16 
2 1 OD2 A ASP 158 ? ? UNK A UNX 1000 ? ? 2.17 
3 1 OE1 A GLU 110 ? ? O   A HOH 2064 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2130 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     3246 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_455 
_pdbx_validate_symm_contact.dist              2.13 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              158 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              158 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              158 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.80 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.50 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 30  ? ? -103.30 -66.96  
2 1 CYS A 85  ? ? -122.91 -148.22 
3 1 ASP A 141 ? ? 59.96   -112.40 
4 1 ARG A 169 ? ? 52.73   -130.20 
5 1 LYS B 30  ? ? -98.83  -62.87  
6 1 CYS B 85  ? ? -118.00 -154.02 
7 1 ASP B 141 ? ? 56.71   -115.63 
8 1 ARG B 169 ? ? 48.14   -124.74 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 198 ? A LYS 198 
2 1 Y 1 B MET 1   ? B MET 1   
3 1 Y 1 B GLN 197 ? B GLN 197 
4 1 Y 1 B LYS 198 ? B LYS 198 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'        CL  
3 'UNKNOWN ATOM OR ION' UNX 
4 water                 HOH 
#