data_2AXI
# 
_entry.id   2AXI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AXI         
RCSB  RCSB034431   
WWPDB D_1000034431 
# 
_pdbx_database_status.entry_id                        2AXI 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-05 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mittl, P.R.E.'  1 
'Fasan, R.'      2 
'Robinson, J.'   3 
'Gruetter, M.G.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Structure-Activity Studies in a Family of beta-Hairpin Protein Epitope Mimetic Inhibitors of the p53-HDM2 Protein-Protein Interaction.
;
_citation.journal_abbrev            Chembiochem 
_citation.journal_volume            7 
_citation.page_first                515 
_citation.page_last                 526 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1439-4227 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16511824 
_citation.pdbx_database_id_DOI      10.1002/cbic.200500452 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fasan, R.'      1 
primary 'Dias, R.L.'     2 
primary 'Moehle, K.'     3 
primary 'Zerbe, O.'      4 
primary 'Obrecht, D.'    5 
primary 'Mittl, P.R.'    6 
primary 'Robinson, J.A.' 7 
# 
_cell.length_a           45.180 
_cell.length_b           77.749 
_cell.length_c           61.257 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.entry_id           2AXI 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         2AXI 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ubiquitin-protein ligase E3 Mdm2'     13364.231 1  6.3.2.- ? HDM2 ? 
2 polymer     syn 'cyclic 8-mer peptide'                 1399.930  1  ?       ? ?    ? 
3 non-polymer syn 'SULFATE ION'                          96.063    2  ?       ? ?    ? 
4 non-polymer syn '3[N-MORPHOLINO]PROPANE SULFONIC ACID' 209.263   1  ?       ? ?    ? 
5 water       nat water                                  18.015    96 ?       ? ?    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'p53-binding protein Mdm2, Oncoprotein Mdm2, Double minute 2 protein, Hdm2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH
RKIYTMIYRNLVVVNQQESSDSGTSVSENHHHHHH
;
;SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH
RKIYTMIYRNLVVVNQQESSDSGTSVSENHHHHHH
;
A ? 
2 'polypeptide(L)' no yes 'PFE(6CW)LDWEF(DPR)' PFEWLDWEFP B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLN n 
1 3   ILE n 
1 4   PRO n 
1 5   ALA n 
1 6   SER n 
1 7   GLU n 
1 8   GLN n 
1 9   GLU n 
1 10  THR n 
1 11  LEU n 
1 12  VAL n 
1 13  ARG n 
1 14  PRO n 
1 15  LYS n 
1 16  PRO n 
1 17  LEU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  LEU n 
1 22  LEU n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  GLY n 
1 27  ALA n 
1 28  GLN n 
1 29  LYS n 
1 30  ASP n 
1 31  THR n 
1 32  TYR n 
1 33  THR n 
1 34  MET n 
1 35  LYS n 
1 36  GLU n 
1 37  VAL n 
1 38  LEU n 
1 39  PHE n 
1 40  TYR n 
1 41  LEU n 
1 42  GLY n 
1 43  GLN n 
1 44  TYR n 
1 45  ILE n 
1 46  MET n 
1 47  THR n 
1 48  LYS n 
1 49  ARG n 
1 50  LEU n 
1 51  TYR n 
1 52  ASP n 
1 53  GLU n 
1 54  LYS n 
1 55  GLN n 
1 56  GLN n 
1 57  HIS n 
1 58  ILE n 
1 59  VAL n 
1 60  TYR n 
1 61  CYS n 
1 62  SER n 
1 63  ASN n 
1 64  ASP n 
1 65  LEU n 
1 66  LEU n 
1 67  GLY n 
1 68  ASP n 
1 69  LEU n 
1 70  PHE n 
1 71  GLY n 
1 72  VAL n 
1 73  PRO n 
1 74  SER n 
1 75  PHE n 
1 76  SER n 
1 77  VAL n 
1 78  LYS n 
1 79  GLU n 
1 80  HIS n 
1 81  ARG n 
1 82  LYS n 
1 83  ILE n 
1 84  TYR n 
1 85  THR n 
1 86  MET n 
1 87  ILE n 
1 88  TYR n 
1 89  ARG n 
1 90  ASN n 
1 91  LEU n 
1 92  VAL n 
1 93  VAL n 
1 94  VAL n 
1 95  ASN n 
1 96  GLN n 
1 97  GLN n 
1 98  GLU n 
1 99  SER n 
1 100 SER n 
1 101 ASP n 
1 102 SER n 
1 103 GLY n 
1 104 THR n 
1 105 SER n 
1 106 VAL n 
1 107 SER n 
1 108 GLU n 
1 109 ASN n 
1 110 HIS n 
1 111 HIS n 
1 112 HIS n 
1 113 HIS n 
1 114 HIS n 
1 115 HIS n 
2 1   PRO n 
2 2   PHE n 
2 3   GLU n 
2 4   6CW n 
2 5   LEU n 
2 6   ASP n 
2 7   TRP n 
2 8   GLU n 
2 9   PHE n 
2 10  DPR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 MDM2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET14b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MDM2_HUMAN Q9UMT8 1 
;SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH
RKIYTMIYRNLVVVNQQESSDSGTSVSEN
;
17 ? 
2 PDB 2AXI       2AXI   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AXI A 1 ? 109 ? Q9UMT8 17 ? 125 ? 17 125 
2 2 2AXI B 1 ? 10  ? 2AXI   20 ? 29  ? 20 29  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2AXI HIS A 110 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 126 1 
1 2AXI HIS A 111 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 127 2 
1 2AXI HIS A 112 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 128 3 
1 2AXI HIS A 113 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 129 4 
1 2AXI HIS A 114 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 130 5 
1 2AXI HIS A 115 ? UNP Q9UMT8 ? ? 'EXPRESSION TAG' 131 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6CW 'L-peptide linking' n 6-CHLORO-L-TRYPTOPHAN                  ? 'C11 H11 Cl N2 O2' 238.670 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'     121.158 
DPR 'D-peptide linking' . D-PROLINE                              ? 'C5 H9 N O2'       115.130 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'    149.211 
MPO non-polymer         . '3[N-MORPHOLINO]PROPANE SULFONIC ACID' ? 'C7 H15 N O4 S'    209.263 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                          ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2AXI 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.821150 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   32.460266 
_exptl_crystal.description           'Data was collected in-house and at the synchrotron' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'MES, ammonium sulfate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-10-01 
_diffrn_detector.details                'Osmic Mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR571' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2AXI 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.400 
_reflns.number_obs                   21288 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.19 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.18 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.41 
_reflns_shell.percent_possible_all   90.8 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.910 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2AXI 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     21512 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          4.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.40 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.149 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2336 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2223 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1YCR 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        864 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               983 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        10.00 
# 
_pdbx_refine.entry_id                                    2AXI 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.149 
_pdbx_refine.free_R_factor_no_cutoff                     0.2336 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            2223 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1376 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2237 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1834 
_pdbx_refine.number_reflns_obs_4sig_cutoff               17593 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  2AXI 
_struct.title                     'HDM2 in complex with a beta-hairpin' 
_struct.pdbx_descriptor           'Ubiquitin-protein ligase E3 Mdm2 (E.C.6.3.2.-), cyclic 8-mer peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AXI 
_struct_keywords.pdbx_keywords   'LIGASE/LIGASE INHIBITOR' 
_struct_keywords.text            'P53, DRUG DESIGN, PROTEIN-PROTEIN INTERACTIONS, LIGASE, LIGASE-LIGASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 15 ? VAL A 25 ? LYS A 31 VAL A 41  1 ? 11 
HELX_P HELX_P2 2 MET A 34 ? ARG A 49 ? MET A 50 ARG A 65  1 ? 16 
HELX_P HELX_P3 3 ASP A 64 ? GLY A 71 ? ASP A 80 GLY A 87  1 ? 8  
HELX_P HELX_P4 4 GLU A 79 ? ARG A 89 ? GLU A 95 ARG A 105 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B PRO 1 N ? ? ? 1_555 B DPR 10 C ? ? B PRO 20 B DPR 29 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale2 covale ? ? B GLU 3 C ? ? ? 1_555 B 6CW 4  N ? ? B GLU 22 B 6CW 23 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3 covale ? ? B 6CW 4 C ? ? ? 1_555 B LEU 5  N ? ? B 6CW 23 B LEU 24 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale4 covale ? ? B PHE 9 C ? ? ? 1_555 B DPR 10 N ? ? B PHE 28 B DPR 29 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 32 ? THR A 33 ? TYR A 48  THR A 49  
A 2 LEU A 11 ? PRO A 14 ? LEU A 27  PRO A 30  
A 3 LEU A 91 ? VAL A 93 ? LEU A 107 VAL A 109 
B 1 TYR A 51 ? ASP A 52 ? TYR A 67  ASP A 68  
B 2 GLN A 55 ? TYR A 60 ? GLN A 71  TYR A 76  
B 3 SER A 74 ? SER A 76 ? SER A 90  SER A 92  
C 1 PHE B 2  ? 6CW B 4  ? PHE B 21  6CW B 23  
C 2 TRP B 7  ? PHE B 9  ? TRP B 26  PHE B 28  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 32 ? O TYR A 48 N VAL A 12 ? N VAL A 28  
A 2 3 N ARG A 13 ? N ARG A 29 O VAL A 92 ? O VAL A 108 
B 1 2 N ASP A 52 ? N ASP A 68 O ILE A 58 ? O ILE A 74  
B 2 3 N VAL A 59 ? N VAL A 75 O PHE A 75 ? O PHE A 91  
C 1 2 N PHE B 2  ? N PHE B 21 O PHE B 9  ? O PHE B 28  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 301'               
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 302'               
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE MPO A 201'               
AC4 Software ? ? ? ? 26 'BINDING SITE FOR CHAIN B OF CYCLIC 8-MER PEPTIDE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  LYS A 29 ? LYS A 45  . ? 1_555 ? 
2  AC1 3  LYS A 35 ? LYS A 51  . ? 4_555 ? 
3  AC1 3  MPO E .  ? MPO A 201 . ? 1_555 ? 
4  AC2 6  ARG A 13 ? ARG A 29  . ? 3_655 ? 
5  AC2 6  ARG A 13 ? ARG A 29  . ? 1_555 ? 
6  AC2 6  VAL A 94 ? VAL A 110 . ? 3_655 ? 
7  AC2 6  ASN A 95 ? ASN A 111 . ? 1_555 ? 
8  AC2 6  ASN A 95 ? ASN A 111 . ? 3_655 ? 
9  AC2 6  GLN A 96 ? GLN A 112 . ? 1_555 ? 
10 AC3 11 GLY A 26 ? GLY A 42  . ? 1_555 ? 
11 AC3 11 ALA A 27 ? ALA A 43  . ? 1_555 ? 
12 AC3 11 GLN A 28 ? GLN A 44  . ? 1_555 ? 
13 AC3 11 LYS A 29 ? LYS A 45  . ? 1_555 ? 
14 AC3 11 LYS A 35 ? LYS A 51  . ? 4_555 ? 
15 AC3 11 GLU A 36 ? GLU A 52  . ? 4_555 ? 
16 AC3 11 PHE A 39 ? PHE A 55  . ? 4_555 ? 
17 AC3 11 TYR A 40 ? TYR A 56  . ? 1_555 ? 
18 AC3 11 SO4 C .  ? SO4 A 301 . ? 1_555 ? 
19 AC3 11 HOH F .  ? HOH A 341 . ? 1_555 ? 
20 AC3 11 TRP B 7  ? TRP B 26  . ? 4_555 ? 
21 AC4 26 LYS A 23 ? LYS A 39  . ? 4_555 ? 
22 AC4 26 VAL A 25 ? VAL A 41  . ? 4_555 ? 
23 AC4 26 GLY A 26 ? GLY A 42  . ? 4_555 ? 
24 AC4 26 GLN A 28 ? GLN A 44  . ? 4_555 ? 
25 AC4 26 LYS A 35 ? LYS A 51  . ? 1_555 ? 
26 AC4 26 LEU A 38 ? LEU A 54  . ? 1_555 ? 
27 AC4 26 PHE A 39 ? PHE A 55  . ? 1_555 ? 
28 AC4 26 GLY A 42 ? GLY A 58  . ? 1_555 ? 
29 AC4 26 GLN A 43 ? GLN A 59  . ? 1_555 ? 
30 AC4 26 ILE A 45 ? ILE A 61  . ? 1_555 ? 
31 AC4 26 MET A 46 ? MET A 62  . ? 1_555 ? 
32 AC4 26 TYR A 51 ? TYR A 67  . ? 1_555 ? 
33 AC4 26 GLN A 56 ? GLN A 72  . ? 1_555 ? 
34 AC4 26 PHE A 70 ? PHE A 86  . ? 1_555 ? 
35 AC4 26 VAL A 77 ? VAL A 93  . ? 1_555 ? 
36 AC4 26 ILE A 83 ? ILE A 99  . ? 1_555 ? 
37 AC4 26 MPO E .  ? MPO A 201 . ? 4_555 ? 
38 AC4 26 HOH F .  ? HOH A 321 . ? 4_555 ? 
39 AC4 26 HOH F .  ? HOH A 330 . ? 4_555 ? 
40 AC4 26 HOH G .  ? HOH B 108 . ? 1_555 ? 
41 AC4 26 HOH G .  ? HOH B 113 . ? 1_555 ? 
42 AC4 26 HOH G .  ? HOH B 136 . ? 1_555 ? 
43 AC4 26 HOH G .  ? HOH B 143 . ? 1_555 ? 
44 AC4 26 HOH G .  ? HOH B 144 . ? 1_555 ? 
45 AC4 26 HOH G .  ? HOH B 153 . ? 1_555 ? 
46 AC4 26 HOH G .  ? HOH B 170 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2AXI 
_atom_sites.fract_transf_matrix[1][1]   0.022134 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012862 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016325 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 7  ? 18.272  11.146 -5.992  1.00 55.00  ? 23  GLU A N   1 
ATOM   2    C  CA  . GLU A 1 7  ? 19.564  11.538 -5.450  1.00 45.62  ? 23  GLU A CA  1 
ATOM   3    C  C   . GLU A 1 7  ? 19.361  12.224 -4.110  1.00 40.02  ? 23  GLU A C   1 
ATOM   4    O  O   . GLU A 1 7  ? 20.239  12.895 -3.597  1.00 35.08  ? 23  GLU A O   1 
ATOM   5    C  CB  . GLU A 1 7  ? 20.288  12.468 -6.427  1.00 46.64  ? 23  GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 7  ? 19.344  13.210 -7.354  1.00 49.42  ? 23  GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 7  ? 19.995  13.760 -8.606  1.00 57.11  ? 23  GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 7  ? 21.245  13.768 -8.699  1.00 61.03  ? 23  GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 7  ? 19.238  14.211 -9.509  1.00 73.25  ? 23  GLU A OE2 1 
ATOM   10   N  N   . GLN A 1 8  ? 18.174  12.050 -3.544  1.00 34.23  ? 24  GLN A N   1 
ATOM   11   C  CA  . GLN A 1 8  ? 17.879  12.710 -2.273  1.00 28.83  ? 24  GLN A CA  1 
ATOM   12   C  C   . GLN A 1 8  ? 18.286  11.848 -1.115  1.00 27.83  ? 24  GLN A C   1 
ATOM   13   O  O   . GLN A 1 8  ? 17.540  11.036 -0.564  1.00 29.48  ? 24  GLN A O   1 
ATOM   14   C  CB  . GLN A 1 8  ? 16.384  13.048 -2.308  1.00 34.65  ? 24  GLN A CB  1 
ATOM   15   C  CG  . GLN A 1 8  ? 16.354  14.381 -3.087  1.00 38.18  ? 24  GLN A CG  1 
ATOM   16   C  CD  . GLN A 1 8  ? 15.228  15.271 -2.570  1.00 38.36  ? 24  GLN A CD  1 
ATOM   17   O  OE1 . GLN A 1 8  ? 15.549  16.318 -1.981  1.00 35.58  ? 24  GLN A OE1 1 
ATOM   18   N  NE2 . GLN A 1 8  ? 14.043  14.729 -2.895  1.00 29.88  ? 24  GLN A NE2 1 
ATOM   19   N  N   . GLU A 1 9  ? 19.559  12.022 -0.748  1.00 27.96  ? 25  GLU A N   1 
ATOM   20   C  CA  . GLU A 1 9  ? 20.223  11.035 0.080   1.00 33.50  ? 25  GLU A CA  1 
ATOM   21   C  C   . GLU A 1 9  ? 20.304  11.535 1.521   1.00 26.60  ? 25  GLU A C   1 
ATOM   22   O  O   . GLU A 1 9  ? 20.843  10.785 2.310   1.00 28.39  ? 25  GLU A O   1 
ATOM   23   C  CB  . GLU A 1 9  ? 21.621  10.687 -0.431  1.00 38.95  ? 25  GLU A CB  1 
ATOM   24   C  CG  . GLU A 1 9  ? 22.656  11.786 -0.207  1.00 50.00  ? 25  GLU A CG  1 
ATOM   25   C  CD  . GLU A 1 9  ? 24.053  11.311 -0.554  1.00 50.80  ? 25  GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1 9  ? 24.142  10.121 -0.917  1.00 68.40  ? 25  GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1 9  ? 25.051  12.080 -0.487  1.00 47.00  ? 25  GLU A OE2 1 
ATOM   28   N  N   . THR A 1 10 ? 19.760  12.729 1.807   1.00 25.34  ? 26  THR A N   1 
ATOM   29   C  CA  . THR A 1 10 ? 19.719  13.245 3.154   1.00 23.24  ? 26  THR A CA  1 
ATOM   30   C  C   . THR A 1 10 ? 19.328  12.185 4.195   1.00 23.19  ? 26  THR A C   1 
ATOM   31   O  O   . THR A 1 10 ? 18.267  11.593 4.044   1.00 28.21  ? 26  THR A O   1 
ATOM   32   C  CB  . THR A 1 10 ? 18.731  14.441 3.198   1.00 23.46  ? 26  THR A CB  1 
ATOM   33   O  OG1 . THR A 1 10 ? 18.964  15.319 2.061   1.00 26.18  ? 26  THR A OG1 1 
ATOM   34   C  CG2 . THR A 1 10 ? 18.932  15.201 4.488   1.00 26.14  ? 26  THR A CG2 1 
ATOM   35   N  N   . LEU A 1 11 ? 20.167  11.963 5.211   1.00 23.91  ? 27  LEU A N   1 
ATOM   36   C  CA  . LEU A 1 11 ? 19.881  10.940 6.231   1.00 26.08  ? 27  LEU A CA  1 
ATOM   37   C  C   . LEU A 1 11 ? 19.036  11.597 7.297   1.00 25.73  ? 27  LEU A C   1 
ATOM   38   O  O   . LEU A 1 11 ? 19.351  12.707 7.744   1.00 26.13  ? 27  LEU A O   1 
ATOM   39   C  CB  . LEU A 1 11 ? 21.152  10.323 6.822   1.00 27.24  ? 27  LEU A CB  1 
ATOM   40   C  CG  . LEU A 1 11 ? 21.930  9.366  5.927   1.00 29.73  ? 27  LEU A CG  1 
ATOM   41   C  CD1 . LEU A 1 11 ? 23.162  8.838  6.686   1.00 41.40  ? 27  LEU A CD1 1 
ATOM   42   C  CD2 . LEU A 1 11 ? 21.063  8.215  5.443   1.00 31.43  ? 27  LEU A CD2 1 
ATOM   43   N  N   . VAL A 1 12 ? 17.908  10.946 7.619   1.00 23.75  ? 28  VAL A N   1 
ATOM   44   C  CA  . VAL A 1 12 ? 16.921  11.575 8.478   1.00 22.21  ? 28  VAL A CA  1 
ATOM   45   C  C   . VAL A 1 12 ? 16.328  10.562 9.470   1.00 20.73  ? 28  VAL A C   1 
ATOM   46   O  O   . VAL A 1 12 ? 16.241  9.359  9.245   1.00 21.03  ? 28  VAL A O   1 
ATOM   47   C  CB  . VAL A 1 12 ? 15.774  12.205 7.672   1.00 23.15  ? 28  VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 12 ? 16.285  13.258 6.683   1.00 24.27  ? 28  VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 12 ? 14.975  11.125 6.935   1.00 22.13  ? 28  VAL A CG2 1 
ATOM   50   N  N   . ARG A 1 13 ? 15.905  11.139 10.579  1.00 21.42  ? 29  ARG A N   1 
ATOM   51   C  CA  . ARG A 1 13 ? 15.234  10.416 11.641  1.00 20.68  ? 29  ARG A CA  1 
ATOM   52   C  C   . ARG A 1 13 ? 13.844  11.021 11.841  1.00 19.14  ? 29  ARG A C   1 
ATOM   53   O  O   . ARG A 1 13 ? 13.686  12.089 12.412  1.00 21.04  ? 29  ARG A O   1 
ATOM   54   C  CB  A ARG A 1 13 ? 16.042  10.432 12.940  0.50 25.68  ? 29  ARG A CB  1 
ATOM   55   C  CB  B ARG A 1 13 ? 16.026  10.412 12.948  0.50 26.43  ? 29  ARG A CB  1 
ATOM   56   C  CG  A ARG A 1 13 ? 17.340  9.643  12.864  0.50 26.85  ? 29  ARG A CG  1 
ATOM   57   C  CG  B ARG A 1 13 ? 16.533  9.013  13.282  0.50 30.17  ? 29  ARG A CG  1 
ATOM   58   C  CD  A ARG A 1 13 ? 18.123  9.658  14.162  0.50 33.62  ? 29  ARG A CD  1 
ATOM   59   C  CD  B ARG A 1 13 ? 17.463  9.015  14.473  0.50 35.11  ? 29  ARG A CD  1 
ATOM   60   N  NE  A ARG A 1 13 ? 17.507  8.920  15.252  0.50 35.60  ? 29  ARG A NE  1 
ATOM   61   N  NE  B ARG A 1 13 ? 18.682  8.221  14.230  0.50 39.58  ? 29  ARG A NE  1 
ATOM   62   C  CZ  A ARG A 1 13 ? 17.790  7.705  15.704  0.50 38.64  ? 29  ARG A CZ  1 
ATOM   63   C  CZ  B ARG A 1 13 ? 19.750  8.845  13.730  0.50 41.24  ? 29  ARG A CZ  1 
ATOM   64   N  NH1 A ARG A 1 13 ? 18.744  6.936  15.192  0.50 43.93  ? 29  ARG A NH1 1 
ATOM   65   N  NH1 B ARG A 1 13 ? 20.883  8.220  13.484  0.50 37.85  ? 29  ARG A NH1 1 
ATOM   66   N  NH2 A ARG A 1 13 ? 17.092  7.218  16.725  0.50 38.22  ? 29  ARG A NH2 1 
ATOM   67   N  NH2 B ARG A 1 13 ? 19.550  10.138 13.512  0.50 44.02  ? 29  ARG A NH2 1 
ATOM   68   N  N   . PRO A 1 14 ? 12.814  10.360 11.349  1.00 17.76  ? 30  PRO A N   1 
ATOM   69   C  CA  . PRO A 1 14 ? 11.460  10.877 11.535  1.00 17.78  ? 30  PRO A CA  1 
ATOM   70   C  C   . PRO A 1 14 ? 11.069  11.058 12.992  1.00 17.43  ? 30  PRO A C   1 
ATOM   71   O  O   . PRO A 1 14 ? 11.434  10.268 13.863  1.00 18.92  ? 30  PRO A O   1 
ATOM   72   C  CB  . PRO A 1 14 ? 10.574  9.797  10.875  1.00 18.50  ? 30  PRO A CB  1 
ATOM   73   C  CG  . PRO A 1 14 ? 11.509  9.323  9.782   1.00 19.01  ? 30  PRO A CG  1 
ATOM   74   C  CD  . PRO A 1 14 ? 12.864  9.157  10.478  1.00 18.58  ? 30  PRO A CD  1 
ATOM   75   N  N   . LYS A 1 15 ? 10.321  12.127 13.207  1.00 17.90  ? 31  LYS A N   1 
ATOM   76   C  CA  . LYS A 1 15 ? 9.727   12.380 14.547  1.00 17.44  ? 31  LYS A CA  1 
ATOM   77   C  C   . LYS A 1 15 ? 8.566   11.435 14.775  1.00 16.47  ? 31  LYS A C   1 
ATOM   78   O  O   . LYS A 1 15 ? 8.171   10.729 13.849  1.00 17.33  ? 31  LYS A O   1 
ATOM   79   C  CB  . LYS A 1 15 ? 9.353   13.850 14.631  1.00 19.94  ? 31  LYS A CB  1 
ATOM   80   C  CG  . LYS A 1 15 ? 10.564  14.767 14.640  1.00 23.07  ? 31  LYS A CG  1 
ATOM   81   C  CD  . LYS A 1 15 ? 10.055  16.217 14.738  1.00 25.69  ? 31  LYS A CD  1 
ATOM   82   C  CE  . LYS A 1 15 ? 11.230  17.149 14.563  1.00 33.09  ? 31  LYS A CE  1 
ATOM   83   N  NZ  . LYS A 1 15 ? 10.787  18.589 14.670  1.00 40.47  ? 31  LYS A NZ  1 
ATOM   84   N  N   . PRO A 1 16 ? 7.992   11.363 15.964  1.00 18.57  ? 32  PRO A N   1 
ATOM   85   C  CA  . PRO A 1 16 ? 7.014   10.304 16.243  1.00 18.66  ? 32  PRO A CA  1 
ATOM   86   C  C   . PRO A 1 16 ? 5.839   10.240 15.297  1.00 18.19  ? 32  PRO A C   1 
ATOM   87   O  O   . PRO A 1 16 ? 5.457   9.113  14.934  1.00 18.91  ? 32  PRO A O   1 
ATOM   88   C  CB  . PRO A 1 16 ? 6.565   10.599 17.684  1.00 19.43  ? 32  PRO A CB  1 
ATOM   89   C  CG  . PRO A 1 16 ? 7.811   11.215 18.281  1.00 21.07  ? 32  PRO A CG  1 
ATOM   90   C  CD  . PRO A 1 16 ? 8.304   12.127 17.191  1.00 20.84  ? 32  PRO A CD  1 
ATOM   91   N  N   . LEU A 1 17 ? 5.229   11.362 14.926  1.00 18.27  ? 33  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 17 ? 4.084   11.314 14.029  1.00 18.27  ? 33  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 17 ? 4.454   10.705 12.676  1.00 17.30  ? 33  LEU A C   1 
ATOM   94   O  O   . LEU A 1 17 ? 3.770   9.782  12.205  1.00 18.47  ? 33  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 17 ? 3.532   12.726 13.863  1.00 23.72  ? 33  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 17 ? 2.245   12.827 13.050  1.00 29.40  ? 33  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 17 ? 1.387   11.648 13.403  1.00 32.10  ? 33  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 17 ? 1.482   14.115 13.336  1.00 42.09  ? 33  LEU A CD2 1 
ATOM   99   N  N   . LEU A 1 18 ? 5.498   11.260 12.073  1.00 16.73  ? 34  LEU A N   1 
ATOM   100  C  CA  . LEU A 1 18 ? 5.940   10.713 10.772  1.00 15.85  ? 34  LEU A CA  1 
ATOM   101  C  C   . LEU A 1 18 ? 6.301   9.233  10.877  1.00 17.95  ? 34  LEU A C   1 
ATOM   102  O  O   . LEU A 1 18 ? 5.968   8.400  10.021  1.00 16.36  ? 34  LEU A O   1 
ATOM   103  C  CB  . LEU A 1 18 ? 7.086   11.553 10.230  1.00 17.16  ? 34  LEU A CB  1 
ATOM   104  C  CG  . LEU A 1 18 ? 7.650   11.139 8.872   1.00 17.03  ? 34  LEU A CG  1 
ATOM   105  C  CD1 . LEU A 1 18 ? 6.581   10.945 7.806   1.00 17.99  ? 34  LEU A CD1 1 
ATOM   106  C  CD2 . LEU A 1 18 ? 8.716   12.188 8.478   1.00 18.77  ? 34  LEU A CD2 1 
ATOM   107  N  N   . LEU A 1 19 ? 6.967   8.866  11.969  1.00 16.32  ? 35  LEU A N   1 
ATOM   108  C  CA  . LEU A 1 19 ? 7.322   7.458  12.139  1.00 18.12  ? 35  LEU A CA  1 
ATOM   109  C  C   . LEU A 1 19 ? 6.067   6.603  12.176  1.00 20.01  ? 35  LEU A C   1 
ATOM   110  O  O   . LEU A 1 19 ? 6.056   5.481  11.675  1.00 19.91  ? 35  LEU A O   1 
ATOM   111  C  CB  A LEU A 1 19 ? 8.088   7.314  13.458  0.50 20.71  ? 35  LEU A CB  1 
ATOM   112  C  CB  B LEU A 1 19 ? 8.180   7.269  13.399  0.50 20.19  ? 35  LEU A CB  1 
ATOM   113  C  CG  A LEU A 1 19 ? 9.589   7.094  13.335  0.50 20.92  ? 35  LEU A CG  1 
ATOM   114  C  CG  B LEU A 1 19 ? 9.003   5.980  13.475  0.50 18.42  ? 35  LEU A CG  1 
ATOM   115  C  CD1 A LEU A 1 19 ? 10.131  6.466  14.616  0.50 22.81  ? 35  LEU A CD1 1 
ATOM   116  C  CD1 B LEU A 1 19 ? 10.189  6.034  12.521  0.50 20.37  ? 35  LEU A CD1 1 
ATOM   117  C  CD2 A LEU A 1 19 ? 9.933   6.238  12.127  0.50 25.70  ? 35  LEU A CD2 1 
ATOM   118  C  CD2 B LEU A 1 19 ? 9.492   5.725  14.893  0.50 23.13  ? 35  LEU A CD2 1 
ATOM   119  N  N   . LYS A 1 20 ? 5.001   7.081  12.819  1.00 18.49  ? 36  LYS A N   1 
ATOM   120  C  CA  . LYS A 1 20 ? 3.753   6.299  12.845  1.00 20.26  ? 36  LYS A CA  1 
ATOM   121  C  C   . LYS A 1 20 ? 3.233   6.064  11.443  1.00 20.08  ? 36  LYS A C   1 
ATOM   122  O  O   . LYS A 1 20 ? 2.723   4.996  11.118  1.00 23.32  ? 36  LYS A O   1 
ATOM   123  C  CB  . LYS A 1 20 ? 2.644   6.978  13.665  1.00 26.76  ? 36  LYS A CB  1 
ATOM   124  C  CG  . LYS A 1 20 ? 2.760   6.720  15.141  1.00 36.75  ? 36  LYS A CG  1 
ATOM   125  C  CD  . LYS A 1 20 ? 2.982   5.253  15.469  1.00 44.00  ? 36  LYS A CD  1 
ATOM   126  C  CE  . LYS A 1 20 ? 3.425   5.082  16.913  1.00 49.85  ? 36  LYS A CE  1 
ATOM   127  N  NZ  . LYS A 1 20 ? 3.669   3.653  17.276  1.00 51.80  ? 36  LYS A NZ  1 
ATOM   128  N  N   . LEU A 1 21 ? 3.295   7.066  10.588  1.00 19.28  ? 37  LEU A N   1 
ATOM   129  C  CA  . LEU A 1 21 ? 2.846   6.913  9.203   1.00 18.39  ? 37  LEU A CA  1 
ATOM   130  C  C   . LEU A 1 21 ? 3.655   5.851  8.469   1.00 18.21  ? 37  LEU A C   1 
ATOM   131  O  O   . LEU A 1 21 ? 3.131   5.006  7.729   1.00 19.90  ? 37  LEU A O   1 
ATOM   132  C  CB  . LEU A 1 21 ? 2.929   8.248  8.449   1.00 19.88  ? 37  LEU A CB  1 
ATOM   133  C  CG  . LEU A 1 21 ? 2.075   9.382  9.053   1.00 22.02  ? 37  LEU A CG  1 
ATOM   134  C  CD1 . LEU A 1 21 ? 2.403   10.695 8.338   1.00 26.34  ? 37  LEU A CD1 1 
ATOM   135  C  CD2 . LEU A 1 21 ? 0.615   9.048  8.975   1.00 25.51  ? 37  LEU A CD2 1 
ATOM   136  N  N   . LEU A 1 22 ? 4.965   5.915  8.677   1.00 15.75  ? 38  LEU A N   1 
ATOM   137  C  CA  . LEU A 1 22 ? 5.841   4.975  7.981   1.00 17.11  ? 38  LEU A CA  1 
ATOM   138  C  C   . LEU A 1 22 ? 5.523   3.546  8.425   1.00 17.12  ? 38  LEU A C   1 
ATOM   139  O  O   . LEU A 1 22 ? 5.571   2.611  7.611   1.00 17.08  ? 38  LEU A O   1 
ATOM   140  C  CB  . LEU A 1 22 ? 7.296   5.377  8.213   1.00 18.04  ? 38  LEU A CB  1 
ATOM   141  C  CG  . LEU A 1 22 ? 7.701   6.772  7.685   1.00 21.36  ? 38  LEU A CG  1 
ATOM   142  C  CD1 . LEU A 1 22 ? 9.134   7.045  8.017   1.00 21.37  ? 38  LEU A CD1 1 
ATOM   143  C  CD2 . LEU A 1 22 ? 7.474   6.888  6.200   1.00 24.69  ? 38  LEU A CD2 1 
ATOM   144  N  N   . LYS A 1 23 ? 5.198   3.370  9.710   1.00 17.76  ? 39  LYS A N   1 
ATOM   145  C  CA  . LYS A 1 23 ? 4.892   2.028  10.198  1.00 18.61  ? 39  LYS A CA  1 
ATOM   146  C  C   . LYS A 1 23 ? 3.709   1.431  9.490   1.00 18.66  ? 39  LYS A C   1 
ATOM   147  O  O   . LYS A 1 23 ? 3.664   0.216  9.310   1.00 19.66  ? 39  LYS A O   1 
ATOM   148  C  CB  A LYS A 1 23 ? 4.656   2.071  11.719  0.50 24.21  ? 39  LYS A CB  1 
ATOM   149  C  CB  B LYS A 1 23 ? 4.677   2.161  11.713  0.50 22.94  ? 39  LYS A CB  1 
ATOM   150  C  CG  A LYS A 1 23 ? 5.552   0.995  12.332  0.50 26.83  ? 39  LYS A CG  1 
ATOM   151  C  CG  B LYS A 1 23 ? 5.969   2.163  12.488  0.50 25.91  ? 39  LYS A CG  1 
ATOM   152  C  CD  A LYS A 1 23 ? 6.975   1.543  12.435  0.50 30.45  ? 39  LYS A CD  1 
ATOM   153  C  CD  B LYS A 1 23 ? 7.140   2.921  11.933  0.50 29.49  ? 39  LYS A CD  1 
ATOM   154  C  CE  A LYS A 1 23 ? 7.145   3.019  12.392  0.50 31.80  ? 39  LYS A CE  1 
ATOM   155  C  CE  B LYS A 1 23 ? 8.366   2.808  12.824  0.50 33.01  ? 39  LYS A CE  1 
ATOM   156  N  NZ  A LYS A 1 23 ? 8.213   3.641  11.572  0.50 15.15  ? 39  LYS A NZ  1 
ATOM   157  N  NZ  B LYS A 1 23 ? 7.955   2.784  14.254  0.50 29.19  ? 39  LYS A NZ  1 
ATOM   158  N  N   . SER A 1 24 ? 2.768   2.285  9.098   1.00 17.47  ? 40  SER A N   1 
ATOM   159  C  CA  . SER A 1 24 ? 1.588   1.839  8.395   1.00 18.05  ? 40  SER A CA  1 
ATOM   160  C  C   . SER A 1 24 ? 1.920   1.101  7.118   1.00 16.99  ? 40  SER A C   1 
ATOM   161  O  O   . SER A 1 24 ? 1.135   0.208  6.727   1.00 22.34  ? 40  SER A O   1 
ATOM   162  C  CB  . SER A 1 24 ? 0.627   3.012  8.062   1.00 20.31  ? 40  SER A CB  1 
ATOM   163  O  OG  . SER A 1 24 ? -0.042  3.430  9.246   1.00 26.00  ? 40  SER A OG  1 
ATOM   164  N  N   . VAL A 1 25 ? 3.045   1.424  6.491   1.00 15.70  ? 41  VAL A N   1 
ATOM   165  C  CA  . VAL A 1 25 ? 3.371   0.690  5.264   1.00 14.30  ? 41  VAL A CA  1 
ATOM   166  C  C   . VAL A 1 25 ? 4.478   -0.318 5.453   1.00 14.79  ? 41  VAL A C   1 
ATOM   167  O  O   . VAL A 1 25 ? 4.979   -0.816 4.454   1.00 17.13  ? 41  VAL A O   1 
ATOM   168  C  CB  . VAL A 1 25 ? 3.664   1.665  4.114   1.00 14.63  ? 41  VAL A CB  1 
ATOM   169  C  CG1 . VAL A 1 25 ? 2.384   2.478  3.936   1.00 17.80  ? 41  VAL A CG1 1 
ATOM   170  C  CG2 . VAL A 1 25 ? 4.886   2.519  4.393   1.00 16.53  ? 41  VAL A CG2 1 
ATOM   171  N  N   . GLY A 1 26 ? 4.817   -0.626 6.711   1.00 14.21  ? 42  GLY A N   1 
ATOM   172  C  CA  . GLY A 1 26 ? 5.765   -1.646 7.025   1.00 14.84  ? 42  GLY A CA  1 
ATOM   173  C  C   . GLY A 1 26 ? 7.165   -1.239 7.393   1.00 16.42  ? 42  GLY A C   1 
ATOM   174  O  O   . GLY A 1 26 ? 8.018   -2.113 7.641   1.00 17.76  ? 42  GLY A O   1 
ATOM   175  N  N   . ALA A 1 27 ? 7.387   0.070  7.387   1.00 15.62  ? 43  ALA A N   1 
ATOM   176  C  CA  . ALA A 1 27 ? 8.704   0.615  7.672   1.00 17.15  ? 43  ALA A CA  1 
ATOM   177  C  C   . ALA A 1 27 ? 8.821   0.891  9.163   1.00 18.95  ? 43  ALA A C   1 
ATOM   178  O  O   . ALA A 1 27 ? 8.091   1.789  9.592   1.00 20.28  ? 43  ALA A O   1 
ATOM   179  C  CB  . ALA A 1 27 ? 8.949   1.861  6.842   1.00 19.80  ? 43  ALA A CB  1 
ATOM   180  N  N   . GLN A 1 28 ? 9.665   0.157  9.834   1.00 22.03  ? 44  GLN A N   1 
ATOM   181  C  CA  . GLN A 1 28 ? 9.780   0.258  11.291  1.00 24.53  ? 44  GLN A CA  1 
ATOM   182  C  C   . GLN A 1 28 ? 11.159  0.696  11.760  1.00 25.32  ? 44  GLN A C   1 
ATOM   183  O  O   . GLN A 1 28 ? 11.322  0.721  12.984  1.00 33.80  ? 44  GLN A O   1 
ATOM   184  C  CB  . GLN A 1 28 ? 9.399   -1.077 11.978  1.00 27.04  ? 44  GLN A CB  1 
ATOM   185  C  CG  . GLN A 1 28 ? 7.961   -1.484 11.607  1.00 30.47  ? 44  GLN A CG  1 
ATOM   186  C  CD  . GLN A 1 28 ? 7.497   -2.651 12.456  1.00 30.90  ? 44  GLN A CD  1 
ATOM   187  O  OE1 . GLN A 1 28 ? 7.154   -3.698 11.908  1.00 39.92  ? 44  GLN A OE1 1 
ATOM   188  N  NE2 . GLN A 1 28 ? 7.516   -2.468 13.775  1.00 45.76  ? 44  GLN A NE2 1 
ATOM   189  N  N   . LYS A 1 29 ? 12.061  1.004  10.843  1.00 26.96  ? 45  LYS A N   1 
ATOM   190  C  CA  . LYS A 1 29 ? 13.392  1.454  11.267  1.00 26.41  ? 45  LYS A CA  1 
ATOM   191  C  C   . LYS A 1 29 ? 13.338  2.890  11.781  1.00 25.56  ? 45  LYS A C   1 
ATOM   192  O  O   . LYS A 1 29 ? 12.301  3.544  11.655  1.00 25.89  ? 45  LYS A O   1 
ATOM   193  C  CB  . LYS A 1 29 ? 14.399  1.253  10.128  1.00 27.30  ? 45  LYS A CB  1 
ATOM   194  C  CG  . LYS A 1 29 ? 14.282  2.202  8.949   1.00 31.15  ? 45  LYS A CG  1 
ATOM   195  C  CD  . LYS A 1 29 ? 15.262  1.742  7.853   1.00 34.18  ? 45  LYS A CD  1 
ATOM   196  C  CE  . LYS A 1 29 ? 15.204  2.667  6.659   1.00 35.37  ? 45  LYS A CE  1 
ATOM   197  N  NZ  . LYS A 1 29 ? 16.111  2.274  5.551   1.00 36.26  ? 45  LYS A NZ  1 
ATOM   198  N  N   . ASP A 1 30 ? 14.426  3.379  12.387  1.00 25.03  ? 46  ASP A N   1 
ATOM   199  C  CA  . ASP A 1 30 ? 14.386  4.761  12.876  1.00 24.09  ? 46  ASP A CA  1 
ATOM   200  C  C   . ASP A 1 30 ? 15.065  5.794  11.972  1.00 23.26  ? 46  ASP A C   1 
ATOM   201  O  O   . ASP A 1 30 ? 14.695  6.981  12.072  1.00 21.71  ? 46  ASP A O   1 
ATOM   202  C  CB  A ASP A 1 30 ? 15.055  4.808  14.254  0.50 28.62  ? 46  ASP A CB  1 
ATOM   203  C  CB  B ASP A 1 30 ? 14.997  4.837  14.271  0.50 29.50  ? 46  ASP A CB  1 
ATOM   204  C  CG  A ASP A 1 30 ? 14.243  4.060  15.298  0.50 28.16  ? 46  ASP A CG  1 
ATOM   205  C  CG  B ASP A 1 30 ? 16.480  4.629  14.373  0.50 31.49  ? 46  ASP A CG  1 
ATOM   206  O  OD1 A ASP A 1 30 ? 13.000  4.162  15.303  0.50 29.24  ? 46  ASP A OD1 1 
ATOM   207  O  OD1 B ASP A 1 30 ? 17.173  4.314  13.390  0.50 42.33  ? 46  ASP A OD1 1 
ATOM   208  O  OD2 A ASP A 1 30 ? 14.887  3.381  16.127  0.50 34.82  ? 46  ASP A OD2 1 
ATOM   209  O  OD2 B ASP A 1 30 ? 16.999  4.783  15.513  0.50 48.55  ? 46  ASP A OD2 1 
ATOM   210  N  N   . THR A 1 31 ? 15.988  5.344  11.152  1.00 22.56  ? 47  THR A N   1 
ATOM   211  C  CA  . THR A 1 31 ? 16.756  6.166  10.233  1.00 22.87  ? 47  THR A CA  1 
ATOM   212  C  C   . THR A 1 31 ? 16.543  5.732  8.786   1.00 22.07  ? 47  THR A C   1 
ATOM   213  O  O   . THR A 1 31 ? 16.545  4.562  8.430   1.00 26.22  ? 47  THR A O   1 
ATOM   214  C  CB  . THR A 1 31 ? 18.252  6.137  10.622  1.00 26.76  ? 47  THR A CB  1 
ATOM   215  O  OG1 . THR A 1 31 ? 18.335  6.455  12.029  1.00 30.29  ? 47  THR A OG1 1 
ATOM   216  C  CG2 . THR A 1 31 ? 19.015  7.193  9.870   1.00 35.18  ? 47  THR A CG2 1 
ATOM   217  N  N   . TYR A 1 32 ? 16.307  6.769  7.963   1.00 21.75  ? 48  TYR A N   1 
ATOM   218  C  CA  . TYR A 1 32 ? 15.993  6.653  6.573   1.00 22.53  ? 48  TYR A CA  1 
ATOM   219  C  C   . TYR A 1 32 ? 16.757  7.627  5.698   1.00 24.20  ? 48  TYR A C   1 
ATOM   220  O  O   . TYR A 1 32 ? 17.268  8.632  6.164   1.00 26.12  ? 48  TYR A O   1 
ATOM   221  C  CB  . TYR A 1 32 ? 14.496  7.018  6.317   1.00 20.25  ? 48  TYR A CB  1 
ATOM   222  C  CG  . TYR A 1 32 ? 13.577  6.096  7.069   1.00 19.77  ? 48  TYR A CG  1 
ATOM   223  C  CD1 . TYR A 1 32 ? 13.318  6.264  8.430   1.00 18.24  ? 48  TYR A CD1 1 
ATOM   224  C  CD2 . TYR A 1 32 ? 12.934  5.038  6.433   1.00 22.53  ? 48  TYR A CD2 1 
ATOM   225  C  CE1 . TYR A 1 32 ? 12.484  5.435  9.142   1.00 18.42  ? 48  TYR A CE1 1 
ATOM   226  C  CE2 . TYR A 1 32 ? 12.101  4.201  7.140   1.00 22.98  ? 48  TYR A CE2 1 
ATOM   227  C  CZ  . TYR A 1 32 ? 11.873  4.405  8.484   1.00 21.41  ? 48  TYR A CZ  1 
ATOM   228  O  OH  . TYR A 1 32 ? 11.045  3.558  9.193   1.00 22.12  ? 48  TYR A OH  1 
ATOM   229  N  N   . THR A 1 33 ? 16.773  7.374  4.385   1.00 23.88  ? 49  THR A N   1 
ATOM   230  C  CA  . THR A 1 33 ? 17.115  8.475  3.490   1.00 23.45  ? 49  THR A CA  1 
ATOM   231  C  C   . THR A 1 33 ? 15.849  9.283  3.203   1.00 20.01  ? 49  THR A C   1 
ATOM   232  O  O   . THR A 1 33 ? 14.745  8.750  3.309   1.00 19.27  ? 49  THR A O   1 
ATOM   233  C  CB  . THR A 1 33 ? 17.692  8.053  2.136   1.00 23.24  ? 49  THR A CB  1 
ATOM   234  O  OG1 . THR A 1 33 ? 16.696  7.209  1.535   1.00 23.43  ? 49  THR A OG1 1 
ATOM   235  C  CG2 . THR A 1 33 ? 18.952  7.221  2.276   1.00 32.98  ? 49  THR A CG2 1 
ATOM   236  N  N   . MET A 1 34 ? 16.058  10.536 2.800   1.00 21.20  ? 50  MET A N   1 
ATOM   237  C  CA  . MET A 1 34 ? 14.889  11.309 2.425   1.00 19.94  ? 50  MET A CA  1 
ATOM   238  C  C   . MET A 1 34 ? 14.119  10.610 1.312   1.00 18.64  ? 50  MET A C   1 
ATOM   239  O  O   . MET A 1 34 ? 12.905  10.591 1.356   1.00 17.53  ? 50  MET A O   1 
ATOM   240  C  CB  . MET A 1 34 ? 15.289  12.726 1.990   1.00 23.51  ? 50  MET A CB  1 
ATOM   241  C  CG  . MET A 1 34 ? 14.073  13.596 1.802   1.00 26.27  ? 50  MET A CG  1 
ATOM   242  S  SD  . MET A 1 34 ? 13.136  13.931 3.314   1.00 27.83  ? 50  MET A SD  1 
ATOM   243  C  CE  . MET A 1 34 ? 12.208  15.331 2.689   1.00 28.22  ? 50  MET A CE  1 
ATOM   244  N  N   . LYS A 1 35 ? 14.851  10.062 0.355   1.00 18.20  ? 51  LYS A N   1 
ATOM   245  C  CA  . LYS A 1 35 ? 14.170  9.340  -0.726  1.00 16.53  ? 51  LYS A CA  1 
ATOM   246  C  C   . LYS A 1 35 ? 13.213  8.265  -0.231  1.00 15.79  ? 51  LYS A C   1 
ATOM   247  O  O   . LYS A 1 35 ? 12.105  8.111  -0.717  1.00 16.14  ? 51  LYS A O   1 
ATOM   248  C  CB  . LYS A 1 35 ? 15.206  8.690  -1.662  1.00 21.13  ? 51  LYS A CB  1 
ATOM   249  C  CG  . LYS A 1 35 ? 14.591  8.083  -2.909  1.00 27.32  ? 51  LYS A CG  1 
ATOM   250  C  CD  . LYS A 1 35 ? 15.548  7.672  -3.991  1.00 38.59  ? 51  LYS A CD  1 
ATOM   251  C  CE  . LYS A 1 35 ? 15.113  6.567  -4.901  1.00 42.56  ? 51  LYS A CE  1 
ATOM   252  N  NZ  . LYS A 1 35 ? 14.111  6.656  -5.980  1.00 47.03  ? 51  LYS A NZ  1 
ATOM   253  N  N   . GLU A 1 36 ? 13.700  7.483  0.745   1.00 16.61  ? 52  GLU A N   1 
ATOM   254  C  CA  . GLU A 1 36 ? 12.849  6.469  1.356   1.00 15.57  ? 52  GLU A CA  1 
ATOM   255  C  C   . GLU A 1 36 ? 11.624  7.113  2.026   1.00 15.73  ? 52  GLU A C   1 
ATOM   256  O  O   . GLU A 1 36 ? 10.511  6.589  1.872   1.00 15.16  ? 52  GLU A O   1 
ATOM   257  C  CB  . GLU A 1 36 ? 13.584  5.614  2.400   1.00 16.66  ? 52  GLU A CB  1 
ATOM   258  C  CG  . GLU A 1 36 ? 14.582  4.650  1.768   1.00 20.25  ? 52  GLU A CG  1 
ATOM   259  C  CD  . GLU A 1 36 ? 15.468  3.983  2.795   1.00 26.03  ? 52  GLU A CD  1 
ATOM   260  O  OE1 . GLU A 1 36 ? 15.724  4.575  3.870   1.00 28.58  ? 52  GLU A OE1 1 
ATOM   261  O  OE2 . GLU A 1 36 ? 15.948  2.852  2.550   1.00 28.80  ? 52  GLU A OE2 1 
ATOM   262  N  N   . VAL A 1 37 ? 11.835  8.164  2.810   1.00 15.13  ? 53  VAL A N   1 
ATOM   263  C  CA  . VAL A 1 37 ? 10.654  8.752  3.457   1.00 14.92  ? 53  VAL A CA  1 
ATOM   264  C  C   . VAL A 1 37 ? 9.634   9.189  2.428   1.00 13.64  ? 53  VAL A C   1 
ATOM   265  O  O   . VAL A 1 37 ? 8.423   8.975  2.536   1.00 16.38  ? 53  VAL A O   1 
ATOM   266  C  CB  . VAL A 1 37 ? 11.081  9.916  4.346   1.00 15.73  ? 53  VAL A CB  1 
ATOM   267  C  CG1 . VAL A 1 37 ? 9.865   10.656 4.897   1.00 18.00  ? 53  VAL A CG1 1 
ATOM   268  C  CG2 . VAL A 1 37 ? 11.991  9.374  5.468   1.00 20.01  ? 53  VAL A CG2 1 
ATOM   269  N  N   . LEU A 1 38 ? 10.148  9.821  1.361   1.00 14.84  ? 54  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 38 ? 9.209   10.317 0.352   1.00 14.62  ? 54  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 38 ? 8.466   9.167  -0.321  1.00 14.28  ? 54  LEU A C   1 
ATOM   272  O  O   . LEU A 1 38 ? 7.258   9.258  -0.543  1.00 15.05  ? 54  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 38 ? 9.963   11.145 -0.678  1.00 17.19  ? 54  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 38 ? 10.540  12.476 -0.142  1.00 19.79  ? 54  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 38 ? 11.526  13.058 -1.146  1.00 23.24  ? 54  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 38 ? 9.399   13.457 0.153   1.00 22.91  ? 54  LEU A CD2 1 
ATOM   277  N  N   . PHE A 1 39 ? 9.245   8.111  -0.634  1.00 14.14  ? 55  PHE A N   1 
ATOM   278  C  CA  . PHE A 1 39 ? 8.591   6.982  -1.300  1.00 13.20  ? 55  PHE A CA  1 
ATOM   279  C  C   . PHE A 1 39 ? 7.542   6.334  -0.411  1.00 13.38  ? 55  PHE A C   1 
ATOM   280  O  O   . PHE A 1 39 ? 6.421   6.037  -0.829  1.00 14.23  ? 55  PHE A O   1 
ATOM   281  C  CB  . PHE A 1 39 ? 9.684   5.983  -1.672  1.00 13.23  ? 55  PHE A CB  1 
ATOM   282  C  CG  . PHE A 1 39 ? 9.142   4.737  -2.329  1.00 14.04  ? 55  PHE A CG  1 
ATOM   283  C  CD1 . PHE A 1 39 ? 8.825   4.768  -3.692  1.00 14.41  ? 55  PHE A CD1 1 
ATOM   284  C  CD2 . PHE A 1 39 ? 9.014   3.585  -1.564  1.00 14.83  ? 55  PHE A CD2 1 
ATOM   285  C  CE1 . PHE A 1 39 ? 8.362   3.613  -4.339  1.00 15.05  ? 55  PHE A CE1 1 
ATOM   286  C  CE2 . PHE A 1 39 ? 8.543   2.450  -2.228  1.00 16.29  ? 55  PHE A CE2 1 
ATOM   287  C  CZ  . PHE A 1 39 ? 8.256   2.459  -3.584  1.00 16.49  ? 55  PHE A CZ  1 
ATOM   288  N  N   . TYR A 1 40 ? 7.901   6.081  0.852   1.00 12.88  ? 56  TYR A N   1 
ATOM   289  C  CA  . TYR A 1 40 ? 6.956   5.454  1.774   1.00 12.40  ? 56  TYR A CA  1 
ATOM   290  C  C   . TYR A 1 40 ? 5.716   6.326  2.031   1.00 13.73  ? 56  TYR A C   1 
ATOM   291  O  O   . TYR A 1 40 ? 4.626   5.776  2.191   1.00 13.78  ? 56  TYR A O   1 
ATOM   292  C  CB  . TYR A 1 40 ? 7.583   5.144  3.118   1.00 13.80  ? 56  TYR A CB  1 
ATOM   293  C  CG  . TYR A 1 40 ? 8.581   4.008  3.046   1.00 13.78  ? 56  TYR A CG  1 
ATOM   294  C  CD1 . TYR A 1 40 ? 9.828   4.100  3.646   1.00 17.80  ? 56  TYR A CD1 1 
ATOM   295  C  CD2 . TYR A 1 40 ? 8.220   2.813  2.385   1.00 17.06  ? 56  TYR A CD2 1 
ATOM   296  C  CE1 . TYR A 1 40 ? 10.751  3.057  3.601   1.00 19.78  ? 56  TYR A CE1 1 
ATOM   297  C  CE2 . TYR A 1 40 ? 9.153   1.789  2.343   1.00 20.61  ? 56  TYR A CE2 1 
ATOM   298  C  CZ  . TYR A 1 40 ? 10.390  1.904  2.924   1.00 21.69  ? 56  TYR A CZ  1 
ATOM   299  O  OH  . TYR A 1 40 ? 11.273  0.850  2.857   1.00 27.92  ? 56  TYR A OH  1 
ATOM   300  N  N   . LEU A 1 41 ? 5.892   7.639  2.073   1.00 13.68  ? 57  LEU A N   1 
ATOM   301  C  CA  . LEU A 1 41 ? 4.674   8.468  2.188   1.00 14.23  ? 57  LEU A CA  1 
ATOM   302  C  C   . LEU A 1 41 ? 3.765   8.367  0.971   1.00 14.11  ? 57  LEU A C   1 
ATOM   303  O  O   . LEU A 1 41 ? 2.550   8.429  1.093   1.00 14.80  ? 57  LEU A O   1 
ATOM   304  C  CB  A LEU A 1 41 ? 5.102   9.905  2.420   0.70 16.32  ? 57  LEU A CB  1 
ATOM   305  C  CB  B LEU A 1 41 ? 5.066   9.925  2.424   0.30 15.96  ? 57  LEU A CB  1 
ATOM   306  C  CG  A LEU A 1 41 ? 5.455   10.176 3.884   0.70 16.68  ? 57  LEU A CG  1 
ATOM   307  C  CG  B LEU A 1 41 ? 4.092   10.799 3.219   0.30 17.30  ? 57  LEU A CG  1 
ATOM   308  C  CD1 A LEU A 1 41 ? 5.881   11.648 3.982   0.70 19.74  ? 57  LEU A CD1 1 
ATOM   309  C  CD1 B LEU A 1 41 ? 3.640   10.096 4.489   0.30 17.66  ? 57  LEU A CD1 1 
ATOM   310  C  CD2 A LEU A 1 41 ? 4.304   9.887  4.826   0.70 16.96  ? 57  LEU A CD2 1 
ATOM   311  C  CD2 B LEU A 1 41 ? 4.727   12.142 3.547   0.30 18.18  ? 57  LEU A CD2 1 
ATOM   312  N  N   . GLY A 1 42 ? 4.346   8.247  -0.220  1.00 14.88  ? 58  GLY A N   1 
ATOM   313  C  CA  . GLY A 1 42 ? 3.534   8.009  -1.411  1.00 15.08  ? 58  GLY A CA  1 
ATOM   314  C  C   . GLY A 1 42 ? 2.790   6.688  -1.272  1.00 14.38  ? 58  GLY A C   1 
ATOM   315  O  O   . GLY A 1 42 ? 1.601   6.633  -1.619  1.00 14.78  ? 58  GLY A O   1 
ATOM   316  N  N   . GLN A 1 43 ? 3.480   5.647  -0.785  1.00 14.40  ? 59  GLN A N   1 
ATOM   317  C  CA  . GLN A 1 43 ? 2.793   4.361  -0.614  1.00 14.37  ? 59  GLN A CA  1 
ATOM   318  C  C   . GLN A 1 43 ? 1.714   4.507  0.443   1.00 13.90  ? 59  GLN A C   1 
ATOM   319  O  O   . GLN A 1 43 ? 0.658   3.859  0.381   1.00 15.30  ? 59  GLN A O   1 
ATOM   320  C  CB  . GLN A 1 43 ? 3.764   3.278  -0.185  1.00 13.46  ? 59  GLN A CB  1 
ATOM   321  C  CG  . GLN A 1 43 ? 4.833   2.992  -1.261  1.00 13.05  ? 59  GLN A CG  1 
ATOM   322  C  CD  . GLN A 1 43 ? 5.606   1.755  -0.809  1.00 12.84  ? 59  GLN A CD  1 
ATOM   323  O  OE1 . GLN A 1 43 ? 6.126   1.778  0.316   1.00 14.14  ? 59  GLN A OE1 1 
ATOM   324  N  NE2 . GLN A 1 43 ? 5.585   0.703  -1.654  1.00 13.03  ? 59  GLN A NE2 1 
ATOM   325  N  N   . TYR A 1 44 ? 1.964   5.306  1.476   1.00 14.67  ? 60  TYR A N   1 
ATOM   326  C  CA  . TYR A 1 44 ? 0.951   5.516  2.515   1.00 14.26  ? 60  TYR A CA  1 
ATOM   327  C  C   . TYR A 1 44 ? -0.335  6.049  1.914   1.00 13.92  ? 60  TYR A C   1 
ATOM   328  O  O   . TYR A 1 44 ? -1.427  5.575  2.213   1.00 15.48  ? 60  TYR A O   1 
ATOM   329  C  CB  . TYR A 1 44 ? 1.517   6.487  3.587   1.00 14.67  ? 60  TYR A CB  1 
ATOM   330  C  CG  . TYR A 1 44 ? 0.552   6.741  4.702   1.00 14.99  ? 60  TYR A CG  1 
ATOM   331  C  CD1 . TYR A 1 44 ? 0.577   5.917  5.832   1.00 15.94  ? 60  TYR A CD1 1 
ATOM   332  C  CD2 . TYR A 1 44 ? -0.386  7.777  4.668   1.00 15.33  ? 60  TYR A CD2 1 
ATOM   333  C  CE1 . TYR A 1 44 ? -0.334  6.162  6.868   1.00 16.72  ? 60  TYR A CE1 1 
ATOM   334  C  CE2 . TYR A 1 44 ? -1.290  8.018  5.667   1.00 16.56  ? 60  TYR A CE2 1 
ATOM   335  C  CZ  . TYR A 1 44 ? -1.252  7.193  6.773   1.00 17.28  ? 60  TYR A CZ  1 
ATOM   336  O  OH  . TYR A 1 44 ? -2.138  7.440  7.789   1.00 17.72  ? 60  TYR A OH  1 
ATOM   337  N  N   . ILE A 1 45 ? -0.204  7.103  1.102   1.00 14.01  ? 61  ILE A N   1 
ATOM   338  C  CA  . ILE A 1 45 ? -1.375  7.722  0.470   1.00 13.59  ? 61  ILE A CA  1 
ATOM   339  C  C   . ILE A 1 45 ? -2.108  6.734  -0.421  1.00 15.22  ? 61  ILE A C   1 
ATOM   340  O  O   . ILE A 1 45 ? -3.327  6.679  -0.466  1.00 16.88  ? 61  ILE A O   1 
ATOM   341  C  CB  . ILE A 1 45 ? -0.944  8.988  -0.270  1.00 14.70  ? 61  ILE A CB  1 
ATOM   342  C  CG1 . ILE A 1 45 ? -0.458  10.074 0.711   1.00 15.26  ? 61  ILE A CG1 1 
ATOM   343  C  CG2 . ILE A 1 45 ? -2.086  9.466  -1.160  1.00 17.90  ? 61  ILE A CG2 1 
ATOM   344  C  CD1 . ILE A 1 45 ? 0.328   11.202 0.058   1.00 15.46  ? 61  ILE A CD1 1 
ATOM   345  N  N   . MET A 1 46 ? -1.308  5.922  -1.140  1.00 15.10  ? 62  MET A N   1 
ATOM   346  C  CA  . MET A 1 46 ? -1.898  4.881  -1.977  1.00 17.18  ? 62  MET A CA  1 
ATOM   347  C  C   . MET A 1 46 ? -2.705  3.890  -1.152  1.00 16.01  ? 62  MET A C   1 
ATOM   348  O  O   . MET A 1 46 ? -3.832  3.537  -1.439  1.00 20.21  ? 62  MET A O   1 
ATOM   349  C  CB  . MET A 1 46 ? -0.789  4.088  -2.678  1.00 19.42  ? 62  MET A CB  1 
ATOM   350  C  CG  . MET A 1 46 ? -1.235  2.727  -3.316  1.00 24.83  ? 62  MET A CG  1 
ATOM   351  S  SD  . MET A 1 46 ? 0.183   1.795  -3.920  1.00 26.04  ? 62  MET A SD  1 
ATOM   352  C  CE  . MET A 1 46 ? 0.977   1.305  -2.384  1.00 28.59  ? 62  MET A CE  1 
ATOM   353  N  N   . THR A 1 47 ? -2.083  3.391  -0.080  1.00 15.63  ? 63  THR A N   1 
ATOM   354  C  CA  . THR A 1 47 ? -2.772  2.297  0.598   1.00 17.62  ? 63  THR A CA  1 
ATOM   355  C  C   . THR A 1 47 ? -3.968  2.776  1.422   1.00 18.48  ? 63  THR A C   1 
ATOM   356  O  O   . THR A 1 47 ? -4.946  2.047  1.594   1.00 21.12  ? 63  THR A O   1 
ATOM   357  C  CB  A THR A 1 47 ? -1.847  1.631  1.637   0.50 22.88  ? 63  THR A CB  1 
ATOM   358  C  CB  B THR A 1 47 ? -1.781  1.446  1.407   0.50 19.33  ? 63  THR A CB  1 
ATOM   359  O  OG1 A THR A 1 47 ? -0.567  1.373  1.088   0.50 24.94  ? 63  THR A OG1 1 
ATOM   360  O  OG1 B THR A 1 47 ? -2.490  0.273  1.867   0.50 23.14  ? 63  THR A OG1 1 
ATOM   361  C  CG2 A THR A 1 47 ? -2.457  0.284  2.027   0.50 27.34  ? 63  THR A CG2 1 
ATOM   362  C  CG2 B THR A 1 47 ? -1.280  2.224  2.595   0.50 16.90  ? 63  THR A CG2 1 
ATOM   363  N  N   . LYS A 1 48 ? -3.880  3.976  1.953   1.00 17.94  ? 64  LYS A N   1 
ATOM   364  C  CA  . LYS A 1 48 ? -4.994  4.589  2.698   1.00 17.49  ? 64  LYS A CA  1 
ATOM   365  C  C   . LYS A 1 48 ? -6.040  5.150  1.750   1.00 17.30  ? 64  LYS A C   1 
ATOM   366  O  O   . LYS A 1 48 ? -7.101  5.571  2.187   1.00 20.01  ? 64  LYS A O   1 
ATOM   367  C  CB  . LYS A 1 48 ? -4.447  5.651  3.653   1.00 19.93  ? 64  LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 48 ? -3.549  5.056  4.733   1.00 25.62  ? 64  LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 48 ? -4.325  4.612  5.937   1.00 31.93  ? 64  LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 48 ? -3.353  4.148  7.024   1.00 31.91  ? 64  LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 48 ? -4.033  3.242  7.987   1.00 38.81  ? 64  LYS A NZ  1 
ATOM   372  N  N   . ARG A 1 49 ? -5.792  5.156  0.444   1.00 17.28  ? 65  ARG A N   1 
ATOM   373  C  CA  . ARG A 1 49 ? -6.763  5.622  -0.538  1.00 18.07  ? 65  ARG A CA  1 
ATOM   374  C  C   . ARG A 1 49 ? -7.208  7.056  -0.268  1.00 16.40  ? 65  ARG A C   1 
ATOM   375  O  O   . ARG A 1 49 ? -8.380  7.453  -0.279  1.00 20.31  ? 65  ARG A O   1 
ATOM   376  C  CB  . ARG A 1 49 ? -7.949  4.658  -0.653  1.00 19.96  ? 65  ARG A CB  1 
ATOM   377  C  CG  . ARG A 1 49 ? -7.447  3.254  -1.027  1.00 24.68  ? 65  ARG A CG  1 
ATOM   378  C  CD  . ARG A 1 49 ? -8.505  2.213  -1.284  1.00 31.42  ? 65  ARG A CD  1 
ATOM   379  N  NE  . ARG A 1 49 ? -7.918  0.916  -1.651  1.00 35.29  ? 65  ARG A NE  1 
ATOM   380  C  CZ  . ARG A 1 49 ? -8.595  -0.184 -1.939  1.00 36.41  ? 65  ARG A CZ  1 
ATOM   381  N  NH1 . ARG A 1 49 ? -9.927  -0.171 -1.904  1.00 42.38  ? 65  ARG A NH1 1 
ATOM   382  N  NH2 . ARG A 1 49 ? -7.973  -1.333 -2.268  1.00 39.93  ? 65  ARG A NH2 1 
ATOM   383  N  N   . LEU A 1 50 ? -6.171  7.903  -0.023  1.00 16.52  ? 66  LEU A N   1 
ATOM   384  C  CA  . LEU A 1 50 ? -6.496  9.277  0.332   1.00 16.84  ? 66  LEU A CA  1 
ATOM   385  C  C   . LEU A 1 50 ? -6.516  10.176 -0.883  1.00 17.95  ? 66  LEU A C   1 
ATOM   386  O  O   . LEU A 1 50 ? -6.889  11.330 -0.737  1.00 19.72  ? 66  LEU A O   1 
ATOM   387  C  CB  . LEU A 1 50 ? -5.466  9.875  1.323   1.00 18.01  ? 66  LEU A CB  1 
ATOM   388  C  CG  . LEU A 1 50 ? -5.334  9.088  2.631   1.00 16.44  ? 66  LEU A CG  1 
ATOM   389  C  CD1 . LEU A 1 50 ? -4.181  9.644  3.487   1.00 17.99  ? 66  LEU A CD1 1 
ATOM   390  C  CD2 . LEU A 1 50 ? -6.639  9.096  3.392   1.00 19.12  ? 66  LEU A CD2 1 
ATOM   391  N  N   . TYR A 1 51 ? -6.105  9.682  -2.053  1.00 17.77  ? 67  TYR A N   1 
ATOM   392  C  CA  . TYR A 1 51 ? -6.201  10.478 -3.282  1.00 18.70  ? 67  TYR A CA  1 
ATOM   393  C  C   . TYR A 1 51 ? -7.605  10.297 -3.856  1.00 19.94  ? 67  TYR A C   1 
ATOM   394  O  O   . TYR A 1 51 ? -8.306  9.291  -3.696  1.00 20.75  ? 67  TYR A O   1 
ATOM   395  C  CB  . TYR A 1 51 ? -5.071  10.124 -4.264  1.00 18.19  ? 67  TYR A CB  1 
ATOM   396  C  CG  . TYR A 1 51 ? -5.186  8.706  -4.785  1.00 20.41  ? 67  TYR A CG  1 
ATOM   397  C  CD1 . TYR A 1 51 ? -5.841  8.458  -5.997  1.00 21.51  ? 67  TYR A CD1 1 
ATOM   398  C  CD2 . TYR A 1 51 ? -4.654  7.649  -4.079  1.00 19.55  ? 67  TYR A CD2 1 
ATOM   399  C  CE1 . TYR A 1 51 ? -5.938  7.150  -6.462  1.00 26.15  ? 67  TYR A CE1 1 
ATOM   400  C  CE2 . TYR A 1 51 ? -4.740  6.336  -4.518  1.00 22.87  ? 67  TYR A CE2 1 
ATOM   401  C  CZ  . TYR A 1 51 ? -5.396  6.121  -5.719  1.00 27.04  ? 67  TYR A CZ  1 
ATOM   402  O  OH  . TYR A 1 51 ? -5.499  4.847  -6.195  1.00 34.18  ? 67  TYR A OH  1 
ATOM   403  N  N   . ASP A 1 52 ? -8.037  11.303 -4.578  1.00 19.91  ? 68  ASP A N   1 
ATOM   404  C  CA  . ASP A 1 52 ? -9.286  11.287 -5.341  1.00 20.70  ? 68  ASP A CA  1 
ATOM   405  C  C   . ASP A 1 52 ? -9.123  10.402 -6.577  1.00 22.77  ? 68  ASP A C   1 
ATOM   406  O  O   . ASP A 1 52 ? -8.292  10.716 -7.422  1.00 25.18  ? 68  ASP A O   1 
ATOM   407  C  CB  . ASP A 1 52 ? -9.667  12.708 -5.747  1.00 22.51  ? 68  ASP A CB  1 
ATOM   408  C  CG  . ASP A 1 52 ? -11.024 12.857 -6.412  1.00 30.52  ? 68  ASP A CG  1 
ATOM   409  O  OD1 . ASP A 1 52 ? -11.620 11.865 -6.881  1.00 34.53  ? 68  ASP A OD1 1 
ATOM   410  O  OD2 . ASP A 1 52 ? -11.500 14.006 -6.499  1.00 41.78  ? 68  ASP A OD2 1 
ATOM   411  N  N   . GLU A 1 53 ? -9.932  9.353  -6.626  1.00 22.96  ? 69  GLU A N   1 
ATOM   412  C  CA  . GLU A 1 53 ? -10.025 8.437  -7.726  1.00 28.93  ? 69  GLU A CA  1 
ATOM   413  C  C   . GLU A 1 53 ? -10.269 9.118  -9.063  1.00 27.56  ? 69  GLU A C   1 
ATOM   414  O  O   . GLU A 1 53 ? -9.882  8.541  -10.080 1.00 31.33  ? 69  GLU A O   1 
ATOM   415  C  CB  . GLU A 1 53 ? -11.144 7.417  -7.439  1.00 36.90  ? 69  GLU A CB  1 
ATOM   416  C  CG  . GLU A 1 53 ? -10.642 6.324  -6.481  1.00 42.83  ? 69  GLU A CG  1 
ATOM   417  C  CD  . GLU A 1 53 ? -11.691 5.224  -6.445  1.00 49.71  ? 69  GLU A CD  1 
ATOM   418  O  OE1 . GLU A 1 53 ? -11.582 4.310  -5.600  1.00 61.30  ? 69  GLU A OE1 1 
ATOM   419  O  OE2 . GLU A 1 53 ? -12.620 5.324  -7.290  1.00 56.86  ? 69  GLU A OE2 1 
ATOM   420  N  N   . LYS A 1 54 ? -10.885 10.292 -9.089  1.00 26.62  ? 70  LYS A N   1 
ATOM   421  C  CA  . LYS A 1 54 ? -11.122 10.972 -10.351 1.00 25.03  ? 70  LYS A CA  1 
ATOM   422  C  C   . LYS A 1 54 ? -10.194 12.138 -10.633 1.00 28.61  ? 70  LYS A C   1 
ATOM   423  O  O   . LYS A 1 54 ? -10.140 12.623 -11.756 1.00 43.99  ? 70  LYS A O   1 
ATOM   424  C  CB  . LYS A 1 54 ? -12.549 11.551 -10.364 1.00 28.89  ? 70  LYS A CB  1 
ATOM   425  C  CG  . LYS A 1 54 ? -13.596 10.444 -10.504 1.00 32.99  ? 70  LYS A CG  1 
ATOM   426  C  CD  . LYS A 1 54 ? -14.955 11.089 -10.778 1.00 37.80  ? 70  LYS A CD  1 
ATOM   427  C  CE  . LYS A 1 54 ? -15.989 10.489 -9.835  1.00 45.55  ? 70  LYS A CE  1 
ATOM   428  N  NZ  . LYS A 1 54 ? -17.256 10.090 -10.507 1.00 48.38  ? 70  LYS A NZ  1 
ATOM   429  N  N   . GLN A 1 55 ? -9.476  12.609 -9.626  1.00 23.54  ? 71  GLN A N   1 
ATOM   430  C  CA  . GLN A 1 55 ? -8.491  13.675 -9.757  1.00 22.56  ? 71  GLN A CA  1 
ATOM   431  C  C   . GLN A 1 55 ? -7.333  13.342 -8.831  1.00 20.59  ? 71  GLN A C   1 
ATOM   432  O  O   . GLN A 1 55 ? -7.240  13.801 -7.685  1.00 20.72  ? 71  GLN A O   1 
ATOM   433  C  CB  . GLN A 1 55 ? -9.144  15.000 -9.423  1.00 23.78  ? 71  GLN A CB  1 
ATOM   434  C  CG  . GLN A 1 55 ? -8.324  16.263 -9.563  1.00 25.24  ? 71  GLN A CG  1 
ATOM   435  C  CD  . GLN A 1 55 ? -9.182  17.504 -9.350  1.00 27.18  ? 71  GLN A CD  1 
ATOM   436  O  OE1 . GLN A 1 55 ? -10.136 17.382 -8.579  1.00 36.86  ? 71  GLN A OE1 1 
ATOM   437  N  NE2 . GLN A 1 55 ? -8.910  18.617 -10.001 1.00 37.84  ? 71  GLN A NE2 1 
ATOM   438  N  N   . GLN A 1 56 ? -6.466  12.474 -9.347  1.00 23.44  ? 72  GLN A N   1 
ATOM   439  C  CA  . GLN A 1 56 ? -5.568  11.709 -8.473  1.00 21.23  ? 72  GLN A CA  1 
ATOM   440  C  C   . GLN A 1 56 ? -4.489  12.543 -7.842  1.00 21.74  ? 72  GLN A C   1 
ATOM   441  O  O   . GLN A 1 56 ? -3.822  12.068 -6.904  1.00 21.06  ? 72  GLN A O   1 
ATOM   442  C  CB  . GLN A 1 56 ? -4.942  10.510 -9.235  1.00 25.32  ? 72  GLN A CB  1 
ATOM   443  C  CG  . GLN A 1 56 ? -6.026  9.502  -9.652  1.00 29.04  ? 72  GLN A CG  1 
ATOM   444  C  CD  . GLN A 1 56 ? -6.355  9.764  -11.133 1.00 34.78  ? 72  GLN A CD  1 
ATOM   445  O  OE1 . GLN A 1 56 ? -6.231  10.920 -11.572 1.00 39.91  ? 72  GLN A OE1 1 
ATOM   446  N  NE2 . GLN A 1 56 ? -6.748  8.770  -11.924 1.00 37.84  ? 72  GLN A NE2 1 
ATOM   447  N  N   . HIS A 1 57 ? -4.280  13.773 -8.300  1.00 20.85  ? 73  HIS A N   1 
ATOM   448  C  CA  . HIS A 1 57 ? -3.282  14.590 -7.613  1.00 21.98  ? 73  HIS A CA  1 
ATOM   449  C  C   . HIS A 1 57 ? -3.834  15.254 -6.357  1.00 19.23  ? 73  HIS A C   1 
ATOM   450  O  O   . HIS A 1 57 ? -3.071  15.911 -5.646  1.00 22.27  ? 73  HIS A O   1 
ATOM   451  C  CB  . HIS A 1 57 ? -2.741  15.668 -8.527  1.00 25.58  ? 73  HIS A CB  1 
ATOM   452  C  CG  . HIS A 1 57 ? -3.707  16.674 -9.003  1.00 26.70  ? 73  HIS A CG  1 
ATOM   453  N  ND1 . HIS A 1 57 ? -3.920  17.903 -8.384  1.00 28.77  ? 73  HIS A ND1 1 
ATOM   454  C  CD2 . HIS A 1 57 ? -4.528  16.637 -10.080 1.00 31.99  ? 73  HIS A CD2 1 
ATOM   455  C  CE1 . HIS A 1 57 ? -4.832  18.580 -9.051  1.00 30.66  ? 73  HIS A CE1 1 
ATOM   456  N  NE2 . HIS A 1 57 ? -5.226  17.835 -10.091 1.00 33.18  ? 73  HIS A NE2 1 
ATOM   457  N  N   . ILE A 1 58 ? -5.132  15.098 -6.136  1.00 18.02  ? 74  ILE A N   1 
ATOM   458  C  CA  . ILE A 1 58 ? -5.709  15.682 -4.930  1.00 18.87  ? 74  ILE A CA  1 
ATOM   459  C  C   . ILE A 1 58 ? -5.722  14.708 -3.791  1.00 17.27  ? 74  ILE A C   1 
ATOM   460  O  O   . ILE A 1 58 ? -6.303  13.618 -3.923  1.00 20.35  ? 74  ILE A O   1 
ATOM   461  C  CB  . ILE A 1 58 ? -7.130  16.145 -5.212  1.00 21.76  ? 74  ILE A CB  1 
ATOM   462  C  CG1 . ILE A 1 58 ? -7.130  17.153 -6.366  1.00 25.17  ? 74  ILE A CG1 1 
ATOM   463  C  CG2 . ILE A 1 58 ? -7.715  16.761 -3.979  1.00 26.11  ? 74  ILE A CG2 1 
ATOM   464  C  CD1 . ILE A 1 58 ? -6.359  18.427 -6.004  1.00 32.75  ? 74  ILE A CD1 1 
ATOM   465  N  N   . VAL A 1 59 ? -5.103  15.081 -2.689  1.00 16.62  ? 75  VAL A N   1 
ATOM   466  C  CA  . VAL A 1 59 ? -5.130  14.258 -1.488  1.00 17.29  ? 75  VAL A CA  1 
ATOM   467  C  C   . VAL A 1 59 ? -6.041  14.881 -0.442  1.00 17.64  ? 75  VAL A C   1 
ATOM   468  O  O   . VAL A 1 59 ? -5.908  16.063 -0.134  1.00 19.45  ? 75  VAL A O   1 
ATOM   469  C  CB  . VAL A 1 59 ? -3.711  14.129 -0.924  1.00 16.80  ? 75  VAL A CB  1 
ATOM   470  C  CG1 . VAL A 1 59 ? -3.755  13.267 0.343   1.00 18.87  ? 75  VAL A CG1 1 
ATOM   471  C  CG2 . VAL A 1 59 ? -2.742  13.552 -1.938  1.00 18.11  ? 75  VAL A CG2 1 
ATOM   472  N  N   . TYR A 1 60 ? -6.964  14.070 0.058   1.00 17.64  ? 76  TYR A N   1 
ATOM   473  C  CA  . TYR A 1 60 ? -7.894  14.541 1.083   1.00 19.78  ? 76  TYR A CA  1 
ATOM   474  C  C   . TYR A 1 60 ? -7.534  13.855 2.392   1.00 18.82  ? 76  TYR A C   1 
ATOM   475  O  O   . TYR A 1 60 ? -7.824  12.672 2.556   1.00 20.48  ? 76  TYR A O   1 
ATOM   476  C  CB  A TYR A 1 60 ? -9.317  14.170 0.675   0.30 22.45  ? 76  TYR A CB  1 
ATOM   477  C  CB  B TYR A 1 60 ? -9.374  14.390 0.695   0.70 21.25  ? 76  TYR A CB  1 
ATOM   478  C  CG  A TYR A 1 60 ? -9.786  14.687 -0.661  0.30 24.90  ? 76  TYR A CG  1 
ATOM   479  C  CG  B TYR A 1 60 ? -10.234 15.155 1.697   0.70 19.83  ? 76  TYR A CG  1 
ATOM   480  C  CD1 A TYR A 1 60 ? -9.566  13.986 -1.851  0.30 26.18  ? 76  TYR A CD1 1 
ATOM   481  C  CD1 B TYR A 1 60 ? -10.511 16.524 1.624   0.70 19.00  ? 76  TYR A CD1 1 
ATOM   482  C  CD2 A TYR A 1 60 ? -10.468 15.895 -0.745  0.30 27.62  ? 76  TYR A CD2 1 
ATOM   483  C  CD2 B TYR A 1 60 ? -10.758 14.423 2.751   0.70 20.87  ? 76  TYR A CD2 1 
ATOM   484  C  CE1 A TYR A 1 60 ? -10.023 14.517 -3.027  0.30 28.80  ? 76  TYR A CE1 1 
ATOM   485  C  CE1 B TYR A 1 60 ? -11.298 17.102 2.606   0.70 19.76  ? 76  TYR A CE1 1 
ATOM   486  C  CE2 A TYR A 1 60 ? -10.918 16.410 -1.944  0.30 25.69  ? 76  TYR A CE2 1 
ATOM   487  C  CE2 B TYR A 1 60 ? -11.537 15.011 3.724   0.70 21.84  ? 76  TYR A CE2 1 
ATOM   488  C  CZ  A TYR A 1 60 ? -10.698 15.711 -3.101  0.30 28.94  ? 76  TYR A CZ  1 
ATOM   489  C  CZ  B TYR A 1 60 ? -11.806 16.350 3.637   0.70 21.59  ? 76  TYR A CZ  1 
ATOM   490  O  OH  A TYR A 1 60 ? -11.104 16.152 -4.339  0.30 31.54  ? 76  TYR A OH  1 
ATOM   491  O  OH  B TYR A 1 60 ? -12.599 16.920 4.616   0.70 25.69  ? 76  TYR A OH  1 
ATOM   492  N  N   . CYS A 1 61 ? -6.860  14.576 3.288   1.00 18.16  ? 77  CYS A N   1 
ATOM   493  C  CA  . CYS A 1 61 ? -6.263  13.990 4.476   1.00 17.52  ? 77  CYS A CA  1 
ATOM   494  C  C   . CYS A 1 61 ? -6.884  14.453 5.775   1.00 16.67  ? 77  CYS A C   1 
ATOM   495  O  O   . CYS A 1 61 ? -6.372  14.123 6.836   1.00 20.09  ? 77  CYS A O   1 
ATOM   496  C  CB  . CYS A 1 61 ? -4.752  14.285 4.433   1.00 18.96  ? 77  CYS A CB  1 
ATOM   497  S  SG  . CYS A 1 61 ? -4.307  16.020 4.162   1.00 20.28  ? 77  CYS A SG  1 
ATOM   498  N  N   . SER A 1 62 ? -7.999  15.202 5.701   1.00 20.90  ? 78  SER A N   1 
ATOM   499  C  CA  . SER A 1 62 ? -8.556  15.726 6.926   1.00 23.47  ? 78  SER A CA  1 
ATOM   500  C  C   . SER A 1 62 ? -8.862  14.690 7.981   1.00 22.55  ? 78  SER A C   1 
ATOM   501  O  O   . SER A 1 62 ? -8.791  15.001 9.182   1.00 28.32  ? 78  SER A O   1 
ATOM   502  C  CB  . SER A 1 62 ? -9.852  16.499 6.544   1.00 27.15  ? 78  SER A CB  1 
ATOM   503  O  OG  . SER A 1 62 ? -10.095 17.386 7.633   1.00 32.05  ? 78  SER A OG  1 
ATOM   504  N  N   . ASN A 1 63 ? -9.232  13.477 7.582   1.00 21.64  ? 79  ASN A N   1 
ATOM   505  C  CA  . ASN A 1 63 ? -9.683  12.459 8.523   1.00 22.97  ? 79  ASN A CA  1 
ATOM   506  C  C   . ASN A 1 63 ? -8.672  11.332 8.731   1.00 21.10  ? 79  ASN A C   1 
ATOM   507  O  O   . ASN A 1 63 ? -9.011  10.236 9.151   1.00 24.05  ? 79  ASN A O   1 
ATOM   508  C  CB  . ASN A 1 63 ? -11.002 11.818 8.057   1.00 26.50  ? 79  ASN A CB  1 
ATOM   509  C  CG  . ASN A 1 63 ? -12.136 12.815 7.941   1.00 32.53  ? 79  ASN A CG  1 
ATOM   510  O  OD1 . ASN A 1 63 ? -12.755 12.950 6.865   1.00 43.41  ? 79  ASN A OD1 1 
ATOM   511  N  ND2 . ASN A 1 63 ? -12.434 13.492 9.022   1.00 42.40  ? 79  ASN A ND2 1 
ATOM   512  N  N   . ASP A 1 64 ? -7.438  11.691 8.432   1.00 18.06  ? 80  ASP A N   1 
ATOM   513  C  CA  . ASP A 1 64 ? -6.333  10.782 8.536   1.00 16.25  ? 80  ASP A CA  1 
ATOM   514  C  C   . ASP A 1 64 ? -5.212  11.438 9.334   1.00 17.14  ? 80  ASP A C   1 
ATOM   515  O  O   . ASP A 1 64 ? -5.100  12.649 9.355   1.00 18.65  ? 80  ASP A O   1 
ATOM   516  C  CB  . ASP A 1 64 ? -5.817  10.408 7.138   1.00 15.77  ? 80  ASP A CB  1 
ATOM   517  C  CG  . ASP A 1 64 ? -4.881  9.229  7.133   1.00 15.95  ? 80  ASP A CG  1 
ATOM   518  O  OD1 . ASP A 1 64 ? -5.350  8.050  7.026   1.00 19.46  ? 80  ASP A OD1 1 
ATOM   519  O  OD2 . ASP A 1 64 ? -3.651  9.517  7.263   1.00 17.16  ? 80  ASP A OD2 1 
ATOM   520  N  N   . LEU A 1 65 ? -4.378  10.599 9.959   1.00 17.76  ? 81  LEU A N   1 
ATOM   521  C  CA  . LEU A 1 65 ? -3.206  11.134 10.633  1.00 17.53  ? 81  LEU A CA  1 
ATOM   522  C  C   . LEU A 1 65 ? -2.350  11.996 9.728   1.00 15.74  ? 81  LEU A C   1 
ATOM   523  O  O   . LEU A 1 65 ? -1.635  12.927 10.142  1.00 19.81  ? 81  LEU A O   1 
ATOM   524  C  CB  A LEU A 1 65 ? -2.274  10.016 11.123  0.50 21.30  ? 81  LEU A CB  1 
ATOM   525  C  CB  B LEU A 1 65 ? -2.460  9.940  11.249  0.50 21.21  ? 81  LEU A CB  1 
ATOM   526  C  CG  A LEU A 1 65 ? -2.774  9.188  12.301  0.50 23.95  ? 81  LEU A CG  1 
ATOM   527  C  CG  B LEU A 1 65 ? -1.341  10.303 12.200  0.50 18.92  ? 81  LEU A CG  1 
ATOM   528  C  CD1 A LEU A 1 65 ? -1.683  8.231  12.742  0.50 26.37  ? 81  LEU A CD1 1 
ATOM   529  C  CD1 B LEU A 1 65 ? -1.860  11.097 13.393  0.50 20.16  ? 81  LEU A CD1 1 
ATOM   530  C  CD2 A LEU A 1 65 ? -3.194  10.148 13.395  0.50 25.68  ? 81  LEU A CD2 1 
ATOM   531  C  CD2 B LEU A 1 65 ? -0.572  9.070  12.674  0.50 17.74  ? 81  LEU A CD2 1 
ATOM   532  N  N   . LEU A 1 66 ? -2.375  11.716 8.423   1.00 16.48  ? 82  LEU A N   1 
ATOM   533  C  CA  . LEU A 1 66 ? -1.564  12.536 7.513   1.00 16.49  ? 82  LEU A CA  1 
ATOM   534  C  C   . LEU A 1 66 ? -1.927  14.011 7.582   1.00 16.73  ? 82  LEU A C   1 
ATOM   535  O  O   . LEU A 1 66 ? -1.083  14.903 7.435   1.00 19.03  ? 82  LEU A O   1 
ATOM   536  C  CB  . LEU A 1 66 ? -1.725  11.968 6.088   1.00 16.09  ? 82  LEU A CB  1 
ATOM   537  C  CG  . LEU A 1 66 ? -0.880  12.728 5.056   1.00 16.61  ? 82  LEU A CG  1 
ATOM   538  C  CD1 . LEU A 1 66 ? 0.607   12.494 5.289   1.00 22.70  ? 82  LEU A CD1 1 
ATOM   539  C  CD2 . LEU A 1 66 ? -1.266  12.320 3.634   1.00 18.06  ? 82  LEU A CD2 1 
ATOM   540  N  N   . GLY A 1 67 ? -3.221  14.259 7.821   1.00 18.45  ? 83  GLY A N   1 
ATOM   541  C  CA  . GLY A 1 67 ? -3.690  15.631 7.951   1.00 19.93  ? 83  GLY A CA  1 
ATOM   542  C  C   . GLY A 1 67 ? -3.057  16.339 9.138   1.00 22.23  ? 83  GLY A C   1 
ATOM   543  O  O   . GLY A 1 67 ? -2.876  17.570 9.158   1.00 23.40  ? 83  GLY A O   1 
ATOM   544  N  N   . ASP A 1 68 ? -2.686  15.623 10.181  1.00 23.07  ? 84  ASP A N   1 
ATOM   545  C  CA  . ASP A 1 68 ? -2.001  16.258 11.317  1.00 23.69  ? 84  ASP A CA  1 
ATOM   546  C  C   . ASP A 1 68 ? -0.581  16.658 10.899  1.00 23.46  ? 84  ASP A C   1 
ATOM   547  O  O   . ASP A 1 68 ? -0.104  17.678 11.358  1.00 30.99  ? 84  ASP A O   1 
ATOM   548  C  CB  . ASP A 1 68 ? -2.017  15.338 12.515  1.00 27.15  ? 84  ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 68 ? -3.340  15.248 13.234  1.00 35.68  ? 84  ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 68 ? -3.775  16.217 13.901  1.00 53.12  ? 84  ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 68 ? -4.002  14.185 13.139  1.00 39.64  ? 84  ASP A OD2 1 
ATOM   552  N  N   . LEU A 1 69 ? 0.060   15.853 10.040  1.00 24.75  ? 85  LEU A N   1 
ATOM   553  C  CA  . LEU A 1 69 ? 1.406   16.172 9.552   1.00 25.27  ? 85  LEU A CA  1 
ATOM   554  C  C   . LEU A 1 69 ? 1.443   17.435 8.699   1.00 27.31  ? 85  LEU A C   1 
ATOM   555  O  O   . LEU A 1 69 ? 2.297   18.340 8.848   1.00 30.30  ? 85  LEU A O   1 
ATOM   556  C  CB  . LEU A 1 69 ? 1.947   14.947 8.796   1.00 28.09  ? 85  LEU A CB  1 
ATOM   557  C  CG  . LEU A 1 69 ? 3.413   14.983 8.340   1.00 32.86  ? 85  LEU A CG  1 
ATOM   558  C  CD1 . LEU A 1 69 ? 4.327   14.308 9.345   1.00 37.38  ? 85  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A 1 69 ? 3.592   14.308 6.983   1.00 34.30  ? 85  LEU A CD2 1 
ATOM   560  N  N   . PHE A 1 70 ? 0.492   17.506 7.788   1.00 22.17  ? 86  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 70 ? 0.446   18.592 6.817   1.00 25.31  ? 86  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 70 ? -0.253  19.827 7.345   1.00 26.93  ? 86  PHE A C   1 
ATOM   563  O  O   . PHE A 1 70 ? 0.009   20.915 6.796   1.00 31.53  ? 86  PHE A O   1 
ATOM   564  C  CB  A PHE A 1 70 ? -0.319  18.116 5.568   0.50 26.71  ? 86  PHE A CB  1 
ATOM   565  C  CB  B PHE A 1 70 ? -0.185  18.086 5.503   0.50 26.24  ? 86  PHE A CB  1 
ATOM   566  C  CG  A PHE A 1 70 ? 0.668   17.658 4.510   0.50 26.02  ? 86  PHE A CG  1 
ATOM   567  C  CG  B PHE A 1 70 ? 0.870   17.296 4.732   0.50 25.64  ? 86  PHE A CG  1 
ATOM   568  C  CD1 A PHE A 1 70 ? 1.031   18.489 3.463   0.50 26.72  ? 86  PHE A CD1 1 
ATOM   569  C  CD1 B PHE A 1 70 ? 2.000   17.943 4.254   0.50 27.08  ? 86  PHE A CD1 1 
ATOM   570  C  CD2 A PHE A 1 70 ? 1.207   16.395 4.622   0.50 24.58  ? 86  PHE A CD2 1 
ATOM   571  C  CD2 B PHE A 1 70 ? 0.722   15.947 4.513   0.50 26.01  ? 86  PHE A CD2 1 
ATOM   572  C  CE1 A PHE A 1 70 ? 1.942   18.045 2.532   0.50 22.19  ? 86  PHE A CE1 1 
ATOM   573  C  CE1 B PHE A 1 70 ? 2.957   17.240 3.564   0.50 24.65  ? 86  PHE A CE1 1 
ATOM   574  C  CE2 A PHE A 1 70 ? 2.107   15.940 3.690   0.50 22.27  ? 86  PHE A CE2 1 
ATOM   575  C  CE2 B PHE A 1 70 ? 1.698   15.240 3.833   0.50 24.19  ? 86  PHE A CE2 1 
ATOM   576  C  CZ  A PHE A 1 70 ? 2.458   16.772 2.645   0.50 22.16  ? 86  PHE A CZ  1 
ATOM   577  C  CZ  B PHE A 1 70 ? 2.826   15.884 3.388   0.50 24.70  ? 86  PHE A CZ  1 
ATOM   578  N  N   . GLY A 1 71 ? -1.075  19.612 8.361   1.00 24.39  ? 87  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 71 ? -1.811  20.760 8.923   1.00 26.73  ? 87  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 71 ? -2.903  21.342 8.050   1.00 25.91  ? 87  GLY A C   1 
ATOM   581  O  O   . GLY A 1 71 ? -3.386  22.460 8.244   1.00 26.16  ? 87  GLY A O   1 
ATOM   582  N  N   . VAL A 1 72 ? -3.329  20.589 7.035   1.00 24.03  ? 88  VAL A N   1 
ATOM   583  C  CA  . VAL A 1 72 ? -4.395  21.057 6.166   1.00 25.41  ? 88  VAL A CA  1 
ATOM   584  C  C   . VAL A 1 72 ? -5.292  19.856 5.864   1.00 20.57  ? 88  VAL A C   1 
ATOM   585  O  O   . VAL A 1 72 ? -4.824  18.728 5.973   1.00 21.86  ? 88  VAL A O   1 
ATOM   586  C  CB  . VAL A 1 72 ? -3.955  21.643 4.817   1.00 25.15  ? 88  VAL A CB  1 
ATOM   587  C  CG1 . VAL A 1 72 ? -3.361  23.039 4.999   1.00 35.56  ? 88  VAL A CG1 1 
ATOM   588  C  CG2 . VAL A 1 72 ? -2.997  20.670 4.120   1.00 31.08  ? 88  VAL A CG2 1 
ATOM   589  N  N   . PRO A 1 73 ? -6.546  20.092 5.533   1.00 21.62  ? 89  PRO A N   1 
ATOM   590  C  CA  . PRO A 1 73 ? -7.463  19.016 5.196   1.00 19.91  ? 89  PRO A CA  1 
ATOM   591  C  C   . PRO A 1 73 ? -7.185  18.411 3.831   1.00 18.82  ? 89  PRO A C   1 
ATOM   592  O  O   . PRO A 1 73 ? -7.681  17.309 3.608   1.00 20.25  ? 89  PRO A O   1 
ATOM   593  C  CB  . PRO A 1 73 ? -8.852  19.678 5.153   1.00 22.85  ? 89  PRO A CB  1 
ATOM   594  C  CG  . PRO A 1 73 ? -8.539  21.103 4.912   1.00 27.23  ? 89  PRO A CG  1 
ATOM   595  C  CD  . PRO A 1 73 ? -7.219  21.401 5.551   1.00 24.79  ? 89  PRO A CD  1 
ATOM   596  N  N   . SER A 1 74 ? -6.450  19.106 2.964   1.00 19.71  ? 90  SER A N   1 
ATOM   597  C  CA  . SER A 1 74 ? -6.300  18.610 1.598   1.00 19.27  ? 90  SER A CA  1 
ATOM   598  C  C   . SER A 1 74 ? -5.091  19.326 0.985   1.00 17.76  ? 90  SER A C   1 
ATOM   599  O  O   . SER A 1 74 ? -4.691  20.403 1.450   1.00 21.78  ? 90  SER A O   1 
ATOM   600  C  CB  . SER A 1 74 ? -7.549  18.869 0.724   1.00 20.72  ? 90  SER A CB  1 
ATOM   601  O  OG  . SER A 1 74 ? -7.627  20.264 0.448   1.00 25.73  ? 90  SER A OG  1 
ATOM   602  N  N   . PHE A 1 75 ? -4.562  18.704 -0.058  1.00 17.40  ? 91  PHE A N   1 
ATOM   603  C  CA  . PHE A 1 75 ? -3.475  19.359 -0.766  1.00 17.11  ? 91  PHE A CA  1 
ATOM   604  C  C   . PHE A 1 75 ? -3.301  18.659 -2.111  1.00 16.91  ? 91  PHE A C   1 
ATOM   605  O  O   . PHE A 1 75 ? -3.863  17.591 -2.296  1.00 18.28  ? 91  PHE A O   1 
ATOM   606  C  CB  . PHE A 1 75 ? -2.147  19.430 -0.010  1.00 18.53  ? 91  PHE A CB  1 
ATOM   607  C  CG  . PHE A 1 75 ? -1.570  18.045 0.276   1.00 18.70  ? 91  PHE A CG  1 
ATOM   608  C  CD1 . PHE A 1 75 ? -0.612  17.512 -0.574  1.00 19.21  ? 91  PHE A CD1 1 
ATOM   609  C  CD2 . PHE A 1 75 ? -1.999  17.308 1.384   1.00 19.31  ? 91  PHE A CD2 1 
ATOM   610  C  CE1 . PHE A 1 75 ? -0.072  16.264 -0.388  1.00 19.15  ? 91  PHE A CE1 1 
ATOM   611  C  CE2 . PHE A 1 75 ? -1.460  16.050 1.593   1.00 17.68  ? 91  PHE A CE2 1 
ATOM   612  C  CZ  . PHE A 1 75 ? -0.496  15.542 0.732   1.00 19.05  ? 91  PHE A CZ  1 
ATOM   613  N  N   . SER A 1 76 ? -2.548  19.323 -2.987  1.00 18.22  ? 92  SER A N   1 
ATOM   614  C  CA  . SER A 1 76 ? -2.268  18.714 -4.251  1.00 17.19  ? 92  SER A CA  1 
ATOM   615  C  C   . SER A 1 76 ? -0.846  18.164 -4.256  1.00 17.43  ? 92  SER A C   1 
ATOM   616  O  O   . SER A 1 76 ? 0.049   18.846 -3.744  1.00 18.12  ? 92  SER A O   1 
ATOM   617  C  CB  . SER A 1 76 ? -2.445  19.687 -5.409  1.00 19.19  ? 92  SER A CB  1 
ATOM   618  O  OG  . SER A 1 76 ? -2.039  19.055 -6.618  1.00 18.70  ? 92  SER A OG  1 
ATOM   619  N  N   . VAL A 1 77 ? -0.652  17.036 -4.940  1.00 17.93  ? 93  VAL A N   1 
ATOM   620  C  CA  . VAL A 1 77 ? 0.696   16.488 -5.092  1.00 18.16  ? 93  VAL A CA  1 
ATOM   621  C  C   . VAL A 1 77 ? 1.572   17.430 -5.901  1.00 17.76  ? 93  VAL A C   1 
ATOM   622  O  O   . VAL A 1 77 ? 2.789   17.263 -5.846  1.00 19.46  ? 93  VAL A O   1 
ATOM   623  C  CB  . VAL A 1 77 ? 0.750   15.066 -5.703  1.00 19.07  ? 93  VAL A CB  1 
ATOM   624  C  CG1 . VAL A 1 77 ? -0.147  14.143 -4.887  1.00 21.36  ? 93  VAL A CG1 1 
ATOM   625  C  CG2 . VAL A 1 77 ? 0.379   15.093 -7.184  1.00 24.76  ? 93  VAL A CG2 1 
ATOM   626  N  N   . LYS A 1 78 ? 0.993   18.408 -6.578  1.00 18.66  ? 94  LYS A N   1 
ATOM   627  C  CA  . LYS A 1 78 ? 1.751   19.408 -7.294  1.00 18.72  ? 94  LYS A CA  1 
ATOM   628  C  C   . LYS A 1 78 ? 2.458   20.403 -6.387  1.00 18.04  ? 94  LYS A C   1 
ATOM   629  O  O   . LYS A 1 78 ? 3.353   21.136 -6.871  1.00 19.99  ? 94  LYS A O   1 
ATOM   630  C  CB  . LYS A 1 78 ? 0.809   20.190 -8.271  1.00 20.06  ? 94  LYS A CB  1 
ATOM   631  C  CG  . LYS A 1 78 ? 0.339   19.276 -9.403  1.00 29.97  ? 94  LYS A CG  1 
ATOM   632  C  CD  . LYS A 1 78 ? -0.794  19.911 -10.211 1.00 33.28  ? 94  LYS A CD  1 
ATOM   633  C  CE  . LYS A 1 78 ? -0.296  20.721 -11.385 1.00 43.77  ? 94  LYS A CE  1 
ATOM   634  N  NZ  . LYS A 1 78 ? -1.270  20.880 -12.502 1.00 55.28  ? 94  LYS A NZ  1 
ATOM   635  N  N   . GLU A 1 79 ? 2.068   20.439 -5.126  1.00 17.51  ? 95  GLU A N   1 
ATOM   636  C  CA  . GLU A 1 79 ? 2.650   21.387 -4.177  1.00 17.83  ? 95  GLU A CA  1 
ATOM   637  C  C   . GLU A 1 79 ? 3.960   20.889 -3.604  1.00 18.00  ? 95  GLU A C   1 
ATOM   638  O  O   . GLU A 1 79 ? 4.066   20.582 -2.394  1.00 18.12  ? 95  GLU A O   1 
ATOM   639  C  CB  . GLU A 1 79 ? 1.640   21.649 -3.036  1.00 18.07  ? 95  GLU A CB  1 
ATOM   640  C  CG  . GLU A 1 79 ? 0.357   22.303 -3.583  1.00 21.06  ? 95  GLU A CG  1 
ATOM   641  C  CD  . GLU A 1 79 ? -0.631  22.577 -2.468  1.00 20.91  ? 95  GLU A CD  1 
ATOM   642  O  OE1 . GLU A 1 79 ? -1.704  21.930 -2.415  1.00 20.38  ? 95  GLU A OE1 1 
ATOM   643  O  OE2 . GLU A 1 79 ? -0.345  23.440 -1.619  1.00 23.13  ? 95  GLU A OE2 1 
ATOM   644  N  N   . HIS A 1 80 ? 4.970   20.767 -4.464  1.00 19.28  ? 96  HIS A N   1 
ATOM   645  C  CA  . HIS A 1 80 ? 6.235   20.146 -4.074  1.00 18.53  ? 96  HIS A CA  1 
ATOM   646  C  C   . HIS A 1 80 ? 6.907   20.858 -2.905  1.00 19.52  ? 96  HIS A C   1 
ATOM   647  O  O   . HIS A 1 80 ? 7.354   20.208 -1.946  1.00 19.42  ? 96  HIS A O   1 
ATOM   648  C  CB  . HIS A 1 80 ? 7.175   20.104 -5.287  1.00 19.79  ? 96  HIS A CB  1 
ATOM   649  C  CG  . HIS A 1 80 ? 6.769   19.127 -6.352  1.00 23.26  ? 96  HIS A CG  1 
ATOM   650  N  ND1 . HIS A 1 80 ? 5.616   18.379 -6.410  1.00 23.85  ? 96  HIS A ND1 1 
ATOM   651  C  CD2 . HIS A 1 80 ? 7.481   18.768 -7.452  1.00 31.21  ? 96  HIS A CD2 1 
ATOM   652  C  CE1 . HIS A 1 80 ? 5.605   17.616 -7.484  1.00 28.29  ? 96  HIS A CE1 1 
ATOM   653  N  NE2 . HIS A 1 80 ? 6.721   17.832 -8.133  1.00 36.88  ? 96  HIS A NE2 1 
ATOM   654  N  N   . ARG A 1 81 ? 6.977   22.185 -2.958  1.00 19.64  ? 97  ARG A N   1 
ATOM   655  C  CA  . ARG A 1 81 ? 7.639   22.896 -1.862  1.00 19.37  ? 97  ARG A CA  1 
ATOM   656  C  C   . ARG A 1 81 ? 6.939   22.634 -0.531  1.00 19.56  ? 97  ARG A C   1 
ATOM   657  O  O   . ARG A 1 81 ? 7.624   22.400 0.470   1.00 20.83  ? 97  ARG A O   1 
ATOM   658  C  CB  . ARG A 1 81 ? 7.709   24.407 -2.111  1.00 22.34  ? 97  ARG A CB  1 
ATOM   659  C  CG  . ARG A 1 81 ? 8.441   25.126 -0.946  1.00 25.53  ? 97  ARG A CG  1 
ATOM   660  C  CD  . ARG A 1 81 ? 8.332   26.625 -1.170  1.00 41.82  ? 97  ARG A CD  1 
ATOM   661  N  NE  . ARG A 1 81 ? 9.563   27.352 -0.879  1.00 55.14  ? 97  ARG A NE  1 
ATOM   662  C  CZ  . ARG A 1 81 ? 9.863   28.322 -1.759  1.00 61.74  ? 97  ARG A CZ  1 
ATOM   663  N  NH1 . ARG A 1 81 ? 9.011   28.488 -2.781  1.00 72.59  ? 97  ARG A NH1 1 
ATOM   664  N  NH2 . ARG A 1 81 ? 10.922  29.112 -1.688  1.00 70.91  ? 97  ARG A NH2 1 
ATOM   665  N  N   . LYS A 1 82 ? 5.615   22.695 -0.527  1.00 20.32  ? 98  LYS A N   1 
ATOM   666  C  CA  . LYS A 1 82 ? 4.881   22.434 0.712   1.00 19.85  ? 98  LYS A CA  1 
ATOM   667  C  C   . LYS A 1 82 ? 5.135   21.014 1.224   1.00 18.79  ? 98  LYS A C   1 
ATOM   668  O  O   . LYS A 1 82 ? 5.306   20.847 2.448   1.00 21.46  ? 98  LYS A O   1 
ATOM   669  C  CB  . LYS A 1 82 ? 3.378   22.619 0.500   1.00 24.94  ? 98  LYS A CB  1 
ATOM   670  C  CG  . LYS A 1 82 ? 2.585   22.402 1.785   1.00 31.03  ? 98  LYS A CG  1 
ATOM   671  C  CD  . LYS A 1 82 ? 1.541   23.488 1.932   1.00 34.51  ? 98  LYS A CD  1 
ATOM   672  C  CE  . LYS A 1 82 ? 0.846   23.288 3.280   1.00 37.31  ? 98  LYS A CE  1 
ATOM   673  N  NZ  . LYS A 1 82 ? -0.451  24.017 3.334   1.00 39.80  ? 98  LYS A NZ  1 
ATOM   674  N  N   . ILE A 1 83 ? 5.139   20.053 0.296   1.00 18.32  ? 99  ILE A N   1 
ATOM   675  C  CA  . ILE A 1 83 ? 5.323   18.648 0.698   1.00 18.48  ? 99  ILE A CA  1 
ATOM   676  C  C   . ILE A 1 83 ? 6.684   18.456 1.356   1.00 18.53  ? 99  ILE A C   1 
ATOM   677  O  O   . ILE A 1 83 ? 6.750   17.946 2.469   1.00 19.51  ? 99  ILE A O   1 
ATOM   678  C  CB  . ILE A 1 83 ? 5.105   17.725 -0.502  1.00 17.47  ? 99  ILE A CB  1 
ATOM   679  C  CG1 . ILE A 1 83 ? 3.605   17.766 -0.884  1.00 19.41  ? 99  ILE A CG1 1 
ATOM   680  C  CG2 . ILE A 1 83 ? 5.569   16.312 -0.220  1.00 20.70  ? 99  ILE A CG2 1 
ATOM   681  C  CD1 . ILE A 1 83 ? 3.340   17.091 -2.204  1.00 21.62  ? 99  ILE A CD1 1 
ATOM   682  N  N   . TYR A 1 84 ? 7.711   18.940 0.681   1.00 18.79  ? 100 TYR A N   1 
ATOM   683  C  CA  . TYR A 1 84 ? 9.046   18.828 1.241   1.00 19.24  ? 100 TYR A CA  1 
ATOM   684  C  C   . TYR A 1 84 ? 9.140   19.540 2.577   1.00 19.81  ? 100 TYR A C   1 
ATOM   685  O  O   . TYR A 1 84 ? 9.764   18.973 3.484   1.00 23.05  ? 100 TYR A O   1 
ATOM   686  C  CB  . TYR A 1 84 ? 10.098  19.426 0.287   1.00 19.38  ? 100 TYR A CB  1 
ATOM   687  C  CG  . TYR A 1 84 ? 10.508  18.395 -0.755  1.00 19.66  ? 100 TYR A CG  1 
ATOM   688  C  CD1 . TYR A 1 84 ? 9.729   18.172 -1.870  1.00 23.99  ? 100 TYR A CD1 1 
ATOM   689  C  CD2 . TYR A 1 84 ? 11.659  17.654 -0.633  1.00 22.03  ? 100 TYR A CD2 1 
ATOM   690  C  CE1 . TYR A 1 84 ? 10.117  17.222 -2.814  1.00 24.25  ? 100 TYR A CE1 1 
ATOM   691  C  CE2 . TYR A 1 84 ? 12.063  16.708 -1.555  1.00 22.23  ? 100 TYR A CE2 1 
ATOM   692  C  CZ  . TYR A 1 84 ? 11.275  16.481 -2.666  1.00 20.73  ? 100 TYR A CZ  1 
ATOM   693  O  OH  . TYR A 1 84 ? 11.647  15.562 -3.618  1.00 22.90  ? 100 TYR A OH  1 
ATOM   694  N  N   . THR A 1 85 ? 8.561   20.753 2.586   1.00 19.54  ? 101 THR A N   1 
ATOM   695  C  CA  . THR A 1 85 ? 8.669   21.530 3.811   1.00 22.70  ? 101 THR A CA  1 
ATOM   696  C  C   . THR A 1 85 ? 8.055   20.810 5.001   1.00 23.94  ? 101 THR A C   1 
ATOM   697  O  O   . THR A 1 85 ? 8.673   20.726 6.070   1.00 28.24  ? 101 THR A O   1 
ATOM   698  C  CB  . THR A 1 85 ? 8.002   22.919 3.600   1.00 24.31  ? 101 THR A CB  1 
ATOM   699  O  OG1 . THR A 1 85 ? 8.770   23.563 2.585   1.00 30.42  ? 101 THR A OG1 1 
ATOM   700  C  CG2 . THR A 1 85 ? 8.063   23.709 4.886   1.00 25.99  ? 101 THR A CG2 1 
ATOM   701  N  N   . MET A 1 86 ? 6.843   20.305 4.812   1.00 23.29  ? 102 MET A N   1 
ATOM   702  C  CA  . MET A 1 86 ? 6.110   19.684 5.915   1.00 24.57  ? 102 MET A CA  1 
ATOM   703  C  C   . MET A 1 86 ? 6.814   18.405 6.330   1.00 22.93  ? 102 MET A C   1 
ATOM   704  O  O   . MET A 1 86 ? 6.873   18.048 7.537   1.00 22.87  ? 102 MET A O   1 
ATOM   705  C  CB  . MET A 1 86 ? 4.628   19.541 5.538   1.00 25.70  ? 102 MET A CB  1 
ATOM   706  C  CG  . MET A 1 86 ? 3.902   20.876 5.309   1.00 26.19  ? 102 MET A CG  1 
ATOM   707  S  SD  . MET A 1 86 ? 4.323   22.089 6.594   1.00 31.38  ? 102 MET A SD  1 
ATOM   708  C  CE  . MET A 1 86 ? 3.246   21.500 7.911   1.00 31.13  ? 102 MET A CE  1 
ATOM   709  N  N   . ILE A 1 87 ? 7.366   17.640 5.397   1.00 19.63  ? 103 ILE A N   1 
ATOM   710  C  CA  . ILE A 1 87 ? 8.096   16.410 5.769   1.00 19.69  ? 103 ILE A CA  1 
ATOM   711  C  C   . ILE A 1 87 ? 9.352   16.785 6.517   1.00 20.30  ? 103 ILE A C   1 
ATOM   712  O  O   . ILE A 1 87 ? 9.639   16.213 7.568   1.00 21.46  ? 103 ILE A O   1 
ATOM   713  C  CB  . ILE A 1 87 ? 8.346   15.576 4.503   1.00 18.91  ? 103 ILE A CB  1 
ATOM   714  C  CG1 . ILE A 1 87 ? 7.025   15.153 3.893   1.00 19.59  ? 103 ILE A CG1 1 
ATOM   715  C  CG2 . ILE A 1 87 ? 9.294   14.413 4.860   1.00 20.21  ? 103 ILE A CG2 1 
ATOM   716  C  CD1 . ILE A 1 87 ? 7.144   14.546 2.507   1.00 24.08  ? 103 ILE A CD1 1 
ATOM   717  N  N   . TYR A 1 88 ? 10.135  17.752 6.049   1.00 23.16  ? 104 TYR A N   1 
ATOM   718  C  CA  . TYR A 1 88 ? 11.373  18.083 6.759   1.00 23.37  ? 104 TYR A CA  1 
ATOM   719  C  C   . TYR A 1 88 ? 11.098  18.574 8.163   1.00 27.13  ? 104 TYR A C   1 
ATOM   720  O  O   . TYR A 1 88 ? 11.860  18.365 9.116   1.00 28.52  ? 104 TYR A O   1 
ATOM   721  C  CB  . TYR A 1 88 ? 12.142  19.168 6.010   1.00 24.74  ? 104 TYR A CB  1 
ATOM   722  C  CG  . TYR A 1 88 ? 13.068  18.722 4.916   1.00 24.67  ? 104 TYR A CG  1 
ATOM   723  C  CD1 . TYR A 1 88 ? 12.897  19.181 3.615   1.00 24.53  ? 104 TYR A CD1 1 
ATOM   724  C  CD2 . TYR A 1 88 ? 14.118  17.855 5.148   1.00 27.94  ? 104 TYR A CD2 1 
ATOM   725  C  CE1 . TYR A 1 88 ? 13.741  18.784 2.577   1.00 26.76  ? 104 TYR A CE1 1 
ATOM   726  C  CE2 . TYR A 1 88 ? 14.960  17.470 4.126   1.00 32.72  ? 104 TYR A CE2 1 
ATOM   727  C  CZ  . TYR A 1 88 ? 14.787  17.925 2.835   1.00 29.32  ? 104 TYR A CZ  1 
ATOM   728  O  OH  . TYR A 1 88 ? 15.656  17.501 1.855   1.00 30.42  ? 104 TYR A OH  1 
ATOM   729  N  N   . ARG A 1 89 ? 9.943   19.242 8.327   1.00 23.92  ? 105 ARG A N   1 
ATOM   730  C  CA  . ARG A 1 89 ? 9.733   19.788 9.680   1.00 28.52  ? 105 ARG A CA  1 
ATOM   731  C  C   . ARG A 1 89 ? 9.372   18.656 10.632  1.00 27.28  ? 105 ARG A C   1 
ATOM   732  O  O   . ARG A 1 89 ? 9.343   18.886 11.848  1.00 30.03  ? 105 ARG A O   1 
ATOM   733  C  CB  . ARG A 1 89 ? 8.685   20.882 9.605   1.00 28.87  ? 105 ARG A CB  1 
ATOM   734  C  CG  . ARG A 1 89 ? 9.215   22.176 8.961   1.00 31.26  ? 105 ARG A CG  1 
ATOM   735  C  CD  . ARG A 1 89 ? 8.146   23.249 8.936   1.00 32.56  ? 105 ARG A CD  1 
ATOM   736  N  NE  . ARG A 1 89 ? 8.680   24.455 8.247   1.00 27.12  ? 105 ARG A NE  1 
ATOM   737  C  CZ  . ARG A 1 89 ? 7.759   25.370 7.924   1.00 27.95  ? 105 ARG A CZ  1 
ATOM   738  N  NH1 . ARG A 1 89 ? 6.477   25.100 8.254   1.00 33.98  ? 105 ARG A NH1 1 
ATOM   739  N  NH2 . ARG A 1 89 ? 8.089   26.489 7.303   1.00 29.60  ? 105 ARG A NH2 1 
ATOM   740  N  N   . ASN A 1 90 ? 9.123   17.462 10.097  1.00 23.46  ? 106 ASN A N   1 
ATOM   741  C  CA  . ASN A 1 90 ? 8.744   16.306 10.885  1.00 22.60  ? 106 ASN A CA  1 
ATOM   742  C  C   . ASN A 1 90 ? 9.851   15.267 10.959  1.00 20.42  ? 106 ASN A C   1 
ATOM   743  O  O   . ASN A 1 90 ? 9.563   14.100 11.242  1.00 20.40  ? 106 ASN A O   1 
ATOM   744  C  CB  . ASN A 1 90 ? 7.463   15.680 10.314  1.00 22.24  ? 106 ASN A CB  1 
ATOM   745  C  CG  . ASN A 1 90 ? 6.311   16.538 10.789  1.00 24.23  ? 106 ASN A CG  1 
ATOM   746  O  OD1 . ASN A 1 90 ? 5.889   17.466 10.090  1.00 29.92  ? 106 ASN A OD1 1 
ATOM   747  N  ND2 . ASN A 1 90 ? 5.800   16.243 11.974  1.00 25.60  ? 106 ASN A ND2 1 
ATOM   748  N  N   . LEU A 1 91 ? 11.078  15.747 10.730  1.00 21.93  ? 107 LEU A N   1 
ATOM   749  C  CA  . LEU A 1 91 ? 12.194  14.810 10.913  1.00 22.44  ? 107 LEU A CA  1 
ATOM   750  C  C   . LEU A 1 91 ? 13.402  15.597 11.427  1.00 25.15  ? 107 LEU A C   1 
ATOM   751  O  O   . LEU A 1 91 ? 13.337  16.802 11.420  1.00 27.23  ? 107 LEU A O   1 
ATOM   752  C  CB  . LEU A 1 91 ? 12.561  14.001 9.683   1.00 25.12  ? 107 LEU A CB  1 
ATOM   753  C  CG  . LEU A 1 91 ? 12.793  14.805 8.402   1.00 22.59  ? 107 LEU A CG  1 
ATOM   754  C  CD1 . LEU A 1 91 ? 14.230  15.294 8.270   1.00 27.33  ? 107 LEU A CD1 1 
ATOM   755  C  CD2 . LEU A 1 91 ? 12.501  13.968 7.167   1.00 23.81  ? 107 LEU A CD2 1 
ATOM   756  N  N   . VAL A 1 92 ? 14.389  14.790 11.831  1.00 22.63  ? 108 VAL A N   1 
ATOM   757  C  CA  . VAL A 1 92 ? 15.634  15.469 12.201  1.00 24.80  ? 108 VAL A CA  1 
ATOM   758  C  C   . VAL A 1 92 ? 16.668  14.979 11.188  1.00 23.24  ? 108 VAL A C   1 
ATOM   759  O  O   . VAL A 1 92 ? 16.839  13.778 10.923  1.00 26.72  ? 108 VAL A O   1 
ATOM   760  C  CB  . VAL A 1 92 ? 16.045  15.274 13.662  1.00 29.32  ? 108 VAL A CB  1 
ATOM   761  C  CG1 . VAL A 1 92 ? 14.845  15.364 14.585  1.00 33.43  ? 108 VAL A CG1 1 
ATOM   762  C  CG2 . VAL A 1 92 ? 16.809  13.963 13.829  1.00 51.90  ? 108 VAL A CG2 1 
ATOM   763  N  N   . VAL A 1 93 ? 17.301  15.957 10.564  1.00 24.91  ? 109 VAL A N   1 
ATOM   764  C  CA  . VAL A 1 93 ? 18.408  15.597 9.695   1.00 25.12  ? 109 VAL A CA  1 
ATOM   765  C  C   . VAL A 1 93 ? 19.609  15.172 10.556  1.00 27.63  ? 109 VAL A C   1 
ATOM   766  O  O   . VAL A 1 93 ? 20.029  15.914 11.457  1.00 31.06  ? 109 VAL A O   1 
ATOM   767  C  CB  . VAL A 1 93 ? 18.785  16.759 8.766   1.00 27.95  ? 109 VAL A CB  1 
ATOM   768  C  CG1 . VAL A 1 93 ? 19.986  16.366 7.942   1.00 25.78  ? 109 VAL A CG1 1 
ATOM   769  C  CG2 . VAL A 1 93 ? 17.577  17.099 7.904   1.00 28.55  ? 109 VAL A CG2 1 
ATOM   770  N  N   . VAL A 1 94 ? 20.150  13.995 10.280  1.00 25.49  ? 110 VAL A N   1 
ATOM   771  C  CA  . VAL A 1 94 ? 21.254  13.330 10.954  1.00 26.11  ? 110 VAL A CA  1 
ATOM   772  C  C   . VAL A 1 94 ? 22.524  14.157 10.844  1.00 27.47  ? 110 VAL A C   1 
ATOM   773  O  O   . VAL A 1 94 ? 22.759  14.725 9.767   1.00 30.53  ? 110 VAL A O   1 
ATOM   774  C  CB  . VAL A 1 94 ? 21.456  11.919 10.348  1.00 30.07  ? 110 VAL A CB  1 
ATOM   775  C  CG1 . VAL A 1 94 ? 22.763  11.265 10.744  1.00 47.83  ? 110 VAL A CG1 1 
ATOM   776  C  CG2 . VAL A 1 94 ? 20.278  11.030 10.751  1.00 38.63  ? 110 VAL A CG2 1 
ATOM   777  N  N   . ASN A 1 95 ? 23.308  14.260 11.923  1.00 30.89  ? 111 ASN A N   1 
ATOM   778  C  CA  . ASN A 1 95 ? 24.541  15.061 11.943  1.00 32.78  ? 111 ASN A CA  1 
ATOM   779  C  C   . ASN A 1 95 ? 25.552  14.452 10.976  1.00 35.07  ? 111 ASN A C   1 
ATOM   780  O  O   . ASN A 1 95 ? 26.052  15.098 10.059  1.00 41.32  ? 111 ASN A O   1 
ATOM   781  C  CB  . ASN A 1 95 ? 25.116  15.121 13.350  1.00 39.20  ? 111 ASN A CB  1 
ATOM   782  C  CG  . ASN A 1 95 ? 24.527  16.153 14.287  1.00 51.55  ? 111 ASN A CG  1 
ATOM   783  O  OD1 . ASN A 1 95 ? 24.909  16.266 15.463  1.00 66.22  ? 111 ASN A OD1 1 
ATOM   784  N  ND2 . ASN A 1 95 ? 23.585  16.962 13.817  1.00 53.69  ? 111 ASN A ND2 1 
ATOM   785  N  N   . GLN A 1 96 ? 25.837  13.181 11.195  1.00 39.72  ? 112 GLN A N   1 
ATOM   786  C  CA  . GLN A 1 96 ? 26.756  12.464 10.333  1.00 44.06  ? 112 GLN A CA  1 
ATOM   787  C  C   . GLN A 1 96 ? 25.991  11.884 9.141   1.00 43.90  ? 112 GLN A C   1 
ATOM   788  O  O   . GLN A 1 96 ? 25.298  10.871 9.272   1.00 44.05  ? 112 GLN A O   1 
ATOM   789  C  CB  . GLN A 1 96 ? 27.502  11.384 11.120  1.00 51.45  ? 112 GLN A CB  1 
ATOM   790  C  CG  . GLN A 1 96 ? 28.816  10.955 10.500  1.00 59.25  ? 112 GLN A CG  1 
ATOM   791  C  CD  . GLN A 1 96 ? 29.585  12.022 9.748   1.00 61.60  ? 112 GLN A CD  1 
ATOM   792  O  OE1 . GLN A 1 96 ? 30.366  12.778 10.335  1.00 64.00  ? 112 GLN A OE1 1 
ATOM   793  N  NE2 . GLN A 1 96 ? 29.379  12.078 8.428   1.00 61.34  ? 112 GLN A NE2 1 
ATOM   794  N  N   . GLN A 1 97 ? 26.154  12.587 8.024   1.00 41.10  ? 113 GLN A N   1 
ATOM   795  C  CA  . GLN A 1 97 ? 25.566  12.235 6.732   1.00 40.00  ? 113 GLN A CA  1 
ATOM   796  C  C   . GLN A 1 97 ? 26.397  11.165 6.064   1.00 47.56  ? 113 GLN A C   1 
ATOM   797  O  O   . GLN A 1 97 ? 27.423  10.752 6.629   1.00 57.27  ? 113 GLN A O   1 
ATOM   798  C  CB  . GLN A 1 97 ? 25.394  13.549 5.951   1.00 33.26  ? 113 GLN A CB  1 
ATOM   799  C  CG  . GLN A 1 97 ? 24.296  14.422 6.579   1.00 26.33  ? 113 GLN A CG  1 
ATOM   800  C  CD  . GLN A 1 97 ? 22.902  13.870 6.361   1.00 24.57  ? 113 GLN A CD  1 
ATOM   801  O  OE1 . GLN A 1 97 ? 22.621  13.299 5.311   1.00 26.21  ? 113 GLN A OE1 1 
ATOM   802  N  NE2 . GLN A 1 97 ? 22.043  14.064 7.353   1.00 30.08  ? 113 GLN A NE2 1 
ATOM   803  N  N   . GLU A 1 98 ? 26.041  10.636 4.913   1.00 51.78  ? 114 GLU A N   1 
ATOM   804  C  CA  . GLU A 1 98 ? 26.647  9.460  4.298   1.00 57.68  ? 114 GLU A CA  1 
ATOM   805  C  C   . GLU A 1 98 ? 26.189  8.175  5.008   1.00 63.11  ? 114 GLU A C   1 
ATOM   806  O  O   . GLU A 1 98 ? 26.486  7.043  4.598   1.00 68.99  ? 114 GLU A O   1 
ATOM   807  C  CB  . GLU A 1 98 ? 28.173  9.469  4.270   1.00 60.95  ? 114 GLU A CB  1 
ATOM   808  C  CG  . GLU A 1 98 ? 28.849  10.773 3.905   1.00 65.17  ? 114 GLU A CG  1 
ATOM   809  C  CD  . GLU A 1 98 ? 29.785  11.224 5.017   1.00 67.38  ? 114 GLU A CD  1 
ATOM   810  O  OE1 . GLU A 1 98 ? 29.864  12.447 5.263   1.00 71.73  ? 114 GLU A OE1 1 
ATOM   811  O  OE2 . GLU A 1 98 ? 30.426  10.348 5.632   1.00 68.83  ? 114 GLU A OE2 1 
ATOM   812  N  N   . PRO B 2 1  ? -2.588  4.544  -10.379 1.00 26.35  ? 20  PRO B N   1 
ATOM   813  C  CA  . PRO B 2 1  ? -2.989  5.850  -10.900 1.00 26.64  ? 20  PRO B CA  1 
ATOM   814  C  C   . PRO B 2 1  ? -2.563  7.026  -10.038 1.00 26.58  ? 20  PRO B C   1 
ATOM   815  O  O   . PRO B 2 1  ? -2.785  8.197  -10.401 1.00 27.06  ? 20  PRO B O   1 
ATOM   816  C  CB  . PRO B 2 1  ? -4.509  5.742  -10.960 1.00 30.62  ? 20  PRO B CB  1 
ATOM   817  C  CG  . PRO B 2 1  ? -4.920  4.576  -10.159 1.00 32.17  ? 20  PRO B CG  1 
ATOM   818  C  CD  . PRO B 2 1  ? -3.706  3.774  -9.805  1.00 29.10  ? 20  PRO B CD  1 
ATOM   819  N  N   . PHE B 2 2  ? -1.927  6.756  -8.905  1.00 24.16  ? 21  PHE B N   1 
ATOM   820  C  CA  . PHE B 2 2  ? -1.493  7.830  -8.008  1.00 21.47  ? 21  PHE B CA  1 
ATOM   821  C  C   . PHE B 2 2  ? -0.040  8.169  -8.305  1.00 21.20  ? 21  PHE B C   1 
ATOM   822  O  O   . PHE B 2 2  ? 0.865   7.363  -8.084  1.00 21.73  ? 21  PHE B O   1 
ATOM   823  C  CB  . PHE B 2 2  ? -1.692  7.411  -6.544  1.00 20.29  ? 21  PHE B CB  1 
ATOM   824  C  CG  . PHE B 2 2  ? -1.239  8.496  -5.591  1.00 20.67  ? 21  PHE B CG  1 
ATOM   825  C  CD1 . PHE B 2 2  ? -1.865  9.738  -5.569  1.00 18.91  ? 21  PHE B CD1 1 
ATOM   826  C  CD2 . PHE B 2 2  ? -0.174  8.239  -4.723  1.00 17.92  ? 21  PHE B CD2 1 
ATOM   827  C  CE1 . PHE B 2 2  ? -1.434  10.718 -4.699  1.00 18.36  ? 21  PHE B CE1 1 
ATOM   828  C  CE2 . PHE B 2 2  ? 0.256   9.238  -3.861  1.00 17.57  ? 21  PHE B CE2 1 
ATOM   829  C  CZ  . PHE B 2 2  ? -0.370  10.473 -3.855  1.00 19.65  ? 21  PHE B CZ  1 
ATOM   830  N  N   . GLU B 2 3  ? 0.199   9.358  -8.855  1.00 22.57  ? 22  GLU B N   1 
ATOM   831  C  CA  . GLU B 2 3  ? 1.525   9.898  -9.136  1.00 22.67  ? 22  GLU B CA  1 
ATOM   832  C  C   . GLU B 2 3  ? 2.051   10.684 -7.942  1.00 19.64  ? 22  GLU B C   1 
ATOM   833  O  O   . GLU B 2 3  ? 1.282   11.453 -7.381  1.00 21.30  ? 22  GLU B O   1 
ATOM   834  C  CB  . GLU B 2 3  ? 1.477   10.822 -10.353 1.00 30.04  ? 22  GLU B CB  1 
ATOM   835  C  CG  . GLU B 2 3  ? 0.819   10.287 -11.593 1.00 43.20  ? 22  GLU B CG  1 
ATOM   836  C  CD  . GLU B 2 3  ? 1.570   10.753 -12.833 1.00 51.89  ? 22  GLU B CD  1 
ATOM   837  O  OE1 . GLU B 2 3  ? 1.911   11.957 -12.890 1.00 63.14  ? 22  GLU B OE1 1 
ATOM   838  O  OE2 . GLU B 2 3  ? 1.811   9.891  -13.707 1.00 68.62  ? 22  GLU B OE2 1 
HETATM 839  N  N   . 6CW B 2 4  ? 3.312   10.527 -7.564  1.00 18.79  ? 23  6CW B N   1 
HETATM 840  C  CA  . 6CW B 2 4  ? 3.824   11.232 -6.421  1.00 18.02  ? 23  6CW B CA  1 
HETATM 841  C  CB  . 6CW B 2 4  ? 3.683   10.322 -5.274  1.00 17.82  ? 23  6CW B CB  1 
HETATM 842  C  CG  . 6CW B 2 4  ? 4.247   10.724 -3.974  1.00 17.28  ? 23  6CW B CG  1 
HETATM 843  C  CD2 . 6CW B 2 4  ? 3.738   11.653 -2.990  1.00 17.22  ? 23  6CW B CD2 1 
HETATM 844  C  CE3 . 6CW B 2 4  ? 2.634   12.511 -2.916  1.00 16.67  ? 23  6CW B CE3 1 
HETATM 845  C  CE2 . 6CW B 2 4  ? 4.606   11.607 -1.886  1.00 16.31  ? 23  6CW B CE2 1 
HETATM 846  N  NE1 . 6CW B 2 4  ? 5.613   10.719 -2.179  1.00 16.38  ? 23  6CW B NE1 1 
HETATM 847  C  CD1 . 6CW B 2 4  ? 5.408   10.233 -3.384  1.00 16.55  ? 23  6CW B CD1 1 
HETATM 848  C  CZ2 . 6CW B 2 4  ? 4.398   12.337 -0.696  1.00 18.39  ? 23  6CW B CZ2 1 
HETATM 849  C  CH2 . 6CW B 2 4  ? 3.298   13.176 -0.715  1.00 16.78  ? 23  6CW B CH2 1 
HETATM 850  CL CLL . 6CW B 2 4  ? 2.908   14.009 0.699   1.00 21.14  ? 23  6CW B CLL 1 
HETATM 851  C  CZ3 . 6CW B 2 4  ? 2.418   13.211 -1.778  1.00 18.04  ? 23  6CW B CZ3 1 
HETATM 852  C  C   . 6CW B 2 4  ? 5.307   11.436 -6.619  1.00 18.52  ? 23  6CW B C   1 
HETATM 853  O  O   . 6CW B 2 4  ? 6.041   10.456 -6.639  1.00 18.09  ? 23  6CW B O   1 
ATOM   854  N  N   . LEU B 2 5  ? 5.689   12.693 -6.775  1.00 19.81  ? 24  LEU B N   1 
ATOM   855  C  CA  . LEU B 2 5  ? 7.086   13.055 -6.948  1.00 20.18  ? 24  LEU B CA  1 
ATOM   856  C  C   . LEU B 2 5  ? 7.687   12.188 -8.056  1.00 21.22  ? 24  LEU B C   1 
ATOM   857  O  O   . LEU B 2 5  ? 7.168   12.159 -9.178  1.00 23.29  ? 24  LEU B O   1 
ATOM   858  C  CB  . LEU B 2 5  ? 7.752   12.962 -5.578  1.00 19.98  ? 24  LEU B CB  1 
ATOM   859  C  CG  . LEU B 2 5  ? 7.133   13.832 -4.478  1.00 20.86  ? 24  LEU B CG  1 
ATOM   860  C  CD1 . LEU B 2 5  ? 7.850   13.645 -3.153  1.00 23.18  ? 24  LEU B CD1 1 
ATOM   861  C  CD2 . LEU B 2 5  ? 7.149   15.304 -4.924  1.00 23.98  ? 24  LEU B CD2 1 
ATOM   862  N  N   . ASP B 2 6  ? 8.743   11.460 -7.739  1.00 23.59  ? 25  ASP B N   1 
ATOM   863  C  CA  . ASP B 2 6  ? 9.453   10.636 -8.711  1.00 25.51  ? 25  ASP B CA  1 
ATOM   864  C  C   . ASP B 2 6  ? 8.837   9.293  -9.013  1.00 29.08  ? 25  ASP B C   1 
ATOM   865  O  O   . ASP B 2 6  ? 9.462   8.514  -9.738  1.00 33.15  ? 25  ASP B O   1 
ATOM   866  C  CB  . ASP B 2 6  ? 10.870  10.324 -8.174  1.00 31.05  ? 25  ASP B CB  1 
ATOM   867  C  CG  . ASP B 2 6  ? 11.753  11.516 -8.466  1.00 39.84  ? 25  ASP B CG  1 
ATOM   868  O  OD1 . ASP B 2 6  ? 11.202  12.618 -8.307  1.00 42.46  ? 25  ASP B OD1 1 
ATOM   869  O  OD2 . ASP B 2 6  ? 12.926  11.314 -8.840  1.00 62.49  ? 25  ASP B OD2 1 
ATOM   870  N  N   . TRP B 2 7  ? 7.664   9.011  -8.464  1.00 22.35  ? 26  TRP B N   1 
ATOM   871  C  CA  . TRP B 2 7  ? 7.149   7.668  -8.488  1.00 19.62  ? 26  TRP B CA  1 
ATOM   872  C  C   . TRP B 2 7  ? 5.714   7.558  -8.947  1.00 18.69  ? 26  TRP B C   1 
ATOM   873  O  O   . TRP B 2 7  ? 4.996   8.552  -8.982  1.00 20.11  ? 26  TRP B O   1 
ATOM   874  C  CB  . TRP B 2 7  ? 7.275   7.047  -7.073  1.00 20.67  ? 26  TRP B CB  1 
ATOM   875  C  CG  . TRP B 2 7  ? 8.694   7.042  -6.587  1.00 18.21  ? 26  TRP B CG  1 
ATOM   876  C  CD1 . TRP B 2 7  ? 9.651   6.141  -6.964  1.00 20.56  ? 26  TRP B CD1 1 
ATOM   877  C  CD2 . TRP B 2 7  ? 9.297   7.962  -5.679  1.00 17.27  ? 26  TRP B CD2 1 
ATOM   878  N  NE1 . TRP B 2 7  ? 10.833  6.459  -6.317  1.00 21.12  ? 26  TRP B NE1 1 
ATOM   879  C  CE2 . TRP B 2 7  ? 10.642  7.559  -5.526  1.00 19.38  ? 26  TRP B CE2 1 
ATOM   880  C  CE3 . TRP B 2 7  ? 8.844   9.085  -4.962  1.00 19.39  ? 26  TRP B CE3 1 
ATOM   881  C  CZ2 . TRP B 2 7  ? 11.565  8.212  -4.704  1.00 21.63  ? 26  TRP B CZ2 1 
ATOM   882  C  CZ3 . TRP B 2 7  ? 9.775   9.728  -4.142  1.00 20.58  ? 26  TRP B CZ3 1 
ATOM   883  C  CH2 . TRP B 2 7  ? 11.100  9.300  -4.020  1.00 23.17  ? 26  TRP B CH2 1 
ATOM   884  N  N   . GLU B 2 8  ? 5.330   6.316  -9.271  1.00 19.63  ? 27  GLU B N   1 
ATOM   885  C  CA  . GLU B 2 8  ? 3.949   6.076  -9.665  1.00 19.85  ? 27  GLU B CA  1 
ATOM   886  C  C   . GLU B 2 8  ? 3.446   4.868  -8.883  1.00 17.83  ? 27  GLU B C   1 
ATOM   887  O  O   . GLU B 2 8  ? 4.170   3.867  -8.826  1.00 18.61  ? 27  GLU B O   1 
ATOM   888  C  CB  . GLU B 2 8  ? 3.754   5.758  -11.153 1.00 27.01  ? 27  GLU B CB  1 
ATOM   889  C  CG  . GLU B 2 8  ? 4.394   6.793  -12.052 1.00 33.06  ? 27  GLU B CG  1 
ATOM   890  C  CD  . GLU B 2 8  ? 4.428   6.383  -13.504 1.00 42.96  ? 27  GLU B CD  1 
ATOM   891  O  OE1 . GLU B 2 8  ? 4.459   5.150  -13.745 1.00 58.45  ? 27  GLU B OE1 1 
ATOM   892  O  OE2 . GLU B 2 8  ? 4.434   7.227  -14.406 1.00 55.27  ? 27  GLU B OE2 1 
ATOM   893  N  N   . PHE B 2 9  ? 2.278   5.053  -8.316  1.00 18.67  ? 28  PHE B N   1 
ATOM   894  C  CA  . PHE B 2 9  ? 1.617   4.032  -7.509  1.00 19.00  ? 28  PHE B CA  1 
ATOM   895  C  C   . PHE B 2 9  ? 0.278   3.717  -8.148  1.00 20.63  ? 28  PHE B C   1 
ATOM   896  O  O   . PHE B 2 9  ? -0.736  4.246  -7.709  1.00 23.47  ? 28  PHE B O   1 
ATOM   897  C  CB  . PHE B 2 9  ? 1.449   4.519  -6.076  1.00 18.22  ? 28  PHE B CB  1 
ATOM   898  C  CG  . PHE B 2 9  ? 2.765   4.920  -5.441  1.00 17.72  ? 28  PHE B CG  1 
ATOM   899  C  CD1 . PHE B 2 9  ? 3.619   3.920  -4.967  1.00 16.39  ? 28  PHE B CD1 1 
ATOM   900  C  CD2 . PHE B 2 9  ? 3.189   6.217  -5.338  1.00 18.89  ? 28  PHE B CD2 1 
ATOM   901  C  CE1 . PHE B 2 9  ? 4.823   4.282  -4.403  1.00 15.67  ? 28  PHE B CE1 1 
ATOM   902  C  CE2 . PHE B 2 9  ? 4.379   6.568  -4.738  1.00 18.79  ? 28  PHE B CE2 1 
ATOM   903  C  CZ  . PHE B 2 9  ? 5.233   5.580  -4.269  1.00 16.24  ? 28  PHE B CZ  1 
HETATM 904  N  N   . DPR B 2 10 ? 0.281   2.920  -9.206  1.00 24.85  ? 29  DPR B N   1 
HETATM 905  C  CA  . DPR B 2 10 ? -0.951  2.804  -10.013 1.00 24.62  ? 29  DPR B CA  1 
HETATM 906  C  CB  . DPR B 2 10 ? -0.672  1.901  -11.131 1.00 28.31  ? 29  DPR B CB  1 
HETATM 907  C  CG  . DPR B 2 10 ? 0.714   1.317  -10.887 1.00 28.78  ? 29  DPR B CG  1 
HETATM 908  C  CD  . DPR B 2 10 ? 1.360   2.158  -9.811  1.00 26.80  ? 29  DPR B CD  1 
HETATM 909  C  C   . DPR B 2 10 ? -1.320  4.200  -10.518 1.00 24.28  ? 29  DPR B C   1 
HETATM 910  O  O   . DPR B 2 10 ? -0.474  4.959  -11.017 1.00 25.95  ? 29  DPR B O   1 
HETATM 911  S  S   . SO4 C 3 .  ? 16.062  -2.168 3.764   1.00 68.11  ? 301 SO4 A S   1 
HETATM 912  O  O1  . SO4 C 3 .  ? 16.254  -1.379 4.994   1.00 67.21  ? 301 SO4 A O1  1 
HETATM 913  O  O2  . SO4 C 3 .  ? 15.075  -1.457 2.953   1.00 60.36  ? 301 SO4 A O2  1 
HETATM 914  O  O3  . SO4 C 3 .  ? 17.346  -2.257 3.048   1.00 80.99  ? 301 SO4 A O3  1 
HETATM 915  O  O4  . SO4 C 3 .  ? 15.648  -3.514 4.090   1.00 55.96  ? 301 SO4 A O4  1 
HETATM 916  S  S   . SO4 D 3 .  ? 22.590  12.424 15.314  0.50 106.25 ? 302 SO4 A S   1 
HETATM 917  O  O1  . SO4 D 3 .  ? 22.805  12.417 17.279  0.50 88.00  ? 302 SO4 A O1  1 
HETATM 918  O  O2  . SO4 D 3 .  ? 21.583  14.036 14.766  0.50 69.31  ? 302 SO4 A O2  1 
HETATM 919  O  O3  . SO4 D 3 .  ? 24.379  12.426 14.446  0.50 71.29  ? 302 SO4 A O3  1 
HETATM 920  O  O4  . SO4 D 3 .  ? 21.581  10.809 14.776  0.50 70.32  ? 302 SO4 A O4  1 
HETATM 921  S  S1  . MPO E 4 .  ? 12.160  -1.676 8.027   1.00 27.96  ? 201 MPO A S1  1 
HETATM 922  O  O1  . MPO E 4 .  ? 13.600  -1.986 7.994   1.00 33.40  ? 201 MPO A O1  1 
HETATM 923  O  O2  . MPO E 4 .  ? 11.596  -1.773 9.415   1.00 33.38  ? 201 MPO A O2  1 
HETATM 924  O  O4  . MPO E 4 .  ? 12.449  -4.280 1.206   1.00 22.21  ? 201 MPO A O4  1 
HETATM 925  N  N1  . MPO E 4 .  ? 13.145  -3.296 3.740   1.00 23.11  ? 201 MPO A N1  1 
HETATM 926  C  C1  . MPO E 4 .  ? 11.294  -2.941 7.009   1.00 26.37  ? 201 MPO A C1  1 
HETATM 927  O  O3  . MPO E 4 .  ? 11.915  -0.341 7.461   1.00 28.25  ? 201 MPO A O3  1 
HETATM 928  C  C2  . MPO E 4 .  ? 11.566  -2.573 5.540   1.00 26.62  ? 201 MPO A C2  1 
HETATM 929  C  C3  . MPO E 4 .  ? 12.964  -2.984 5.210   1.00 26.70  ? 201 MPO A C3  1 
HETATM 930  C  C4  . MPO E 4 .  ? 12.272  -2.473 2.808   1.00 23.46  ? 201 MPO A C4  1 
HETATM 931  C  C5  . MPO E 4 .  ? 12.676  -2.911 1.405   1.00 24.01  ? 201 MPO A C5  1 
HETATM 932  C  C6  . MPO E 4 .  ? 13.162  -5.134 2.106   1.00 23.53  ? 201 MPO A C6  1 
HETATM 933  C  C7  . MPO E 4 .  ? 12.753  -4.740 3.516   1.00 22.30  ? 201 MPO A C7  1 
HETATM 934  O  O   . HOH F 5 .  ? 13.238  8.292  14.143  1.00 26.78  ? 303 HOH A O   1 
HETATM 935  O  O   . HOH F 5 .  ? -1.581  -0.099 6.971   1.00 35.35  ? 304 HOH A O   1 
HETATM 936  O  O   . HOH F 5 .  ? -10.076 11.284 -1.371  1.00 40.06  ? 305 HOH A O   1 
HETATM 937  O  O   . HOH F 5 .  ? -5.204  1.009  5.782   1.00 51.60  ? 306 HOH A O   1 
HETATM 938  O  O   . HOH F 5 .  ? 6.382   13.839 13.091  1.00 24.49  ? 307 HOH A O   1 
HETATM 939  O  O   . HOH F 5 .  ? -9.062  11.930 5.071   1.00 25.76  ? 308 HOH A O   1 
HETATM 940  O  O   . HOH F 5 .  ? -5.727  13.992 14.816  1.00 26.22  ? 309 HOH A O   1 
HETATM 941  O  O   . HOH F 5 .  ? -7.951  7.490  6.624   1.00 24.65  ? 310 HOH A O   1 
HETATM 942  O  O   . HOH F 5 .  ? -5.197  7.923  10.231  1.00 29.71  ? 311 HOH A O   1 
HETATM 943  O  O   . HOH F 5 .  ? -5.412  20.247 -11.824 1.00 44.90  ? 312 HOH A O   1 
HETATM 944  O  O   . HOH F 5 .  ? 18.723  4.303  4.592   1.00 40.12  ? 313 HOH A O   1 
HETATM 945  O  O   . HOH F 5 .  ? 13.665  12.334 15.358  1.00 37.27  ? 314 HOH A O   1 
HETATM 946  O  O   . HOH F 5 .  ? 10.559  9.547  16.528  1.00 32.20  ? 315 HOH A O   1 
HETATM 947  O  O   . HOH F 5 .  ? 23.621  11.722 3.341   1.00 35.44  ? 316 HOH A O   1 
HETATM 948  O  O   . HOH F 5 .  ? 4.201   24.027 -2.685  1.00 20.44  ? 317 HOH A O   1 
HETATM 949  O  O   . HOH F 5 .  ? -2.728  1.536  10.341  1.00 37.24  ? 318 HOH A O   1 
HETATM 950  O  O   . HOH F 5 .  ? -5.271  5.702  8.326   1.00 42.45  ? 319 HOH A O   1 
HETATM 951  O  O   . HOH F 5 .  ? -0.100  4.989  11.448  1.00 36.46  ? 320 HOH A O   1 
HETATM 952  O  O   . HOH F 5 .  ? 4.819   -1.803 10.595  1.00 23.28  ? 321 HOH A O   1 
HETATM 953  O  O   . HOH F 5 .  ? 10.311  19.276 -6.938  1.00 42.79  ? 322 HOH A O   1 
HETATM 954  O  O   . HOH F 5 .  ? -8.076  5.347  4.665   1.00 28.33  ? 323 HOH A O   1 
HETATM 955  O  O   . HOH F 5 .  ? -1.631  24.006 0.728   1.00 29.33  ? 324 HOH A O   1 
HETATM 956  O  O   . HOH F 5 .  ? 10.319  -4.572 10.042  1.00 41.74  ? 325 HOH A O   1 
HETATM 957  O  O   . HOH F 5 .  ? -2.410  6.245  10.199  1.00 36.29  ? 326 HOH A O   1 
HETATM 958  O  O   . HOH F 5 .  ? -11.222 -3.387 -2.595  1.00 51.27  ? 327 HOH A O   1 
HETATM 959  O  O   . HOH F 5 .  ? 3.550   19.353 10.954  1.00 34.58  ? 328 HOH A O   1 
HETATM 960  O  O   . HOH F 5 .  ? -6.244  14.680 10.927  1.00 40.12  ? 329 HOH A O   1 
HETATM 961  O  O   . HOH F 5 .  ? 7.561   -4.311 9.323   1.00 23.41  ? 330 HOH A O   1 
HETATM 962  O  O   . HOH F 5 .  ? 13.081  29.572 -5.542  1.00 32.66  ? 331 HOH A O   1 
HETATM 963  O  O   . HOH F 5 .  ? 6.143   7.019  16.557  1.00 28.44  ? 332 HOH A O   1 
HETATM 964  O  O   . HOH F 5 .  ? 9.256   7.646  18.024  1.00 45.25  ? 333 HOH A O   1 
HETATM 965  O  O   . HOH F 5 .  ? -4.462  23.046 0.804   1.00 36.56  ? 334 HOH A O   1 
HETATM 966  O  O   . HOH F 5 .  ? 1.708   25.193 -1.831  1.00 31.60  ? 335 HOH A O   1 
HETATM 967  O  O   . HOH F 5 .  ? -11.641 8.681  -4.475  1.00 40.55  ? 336 HOH A O   1 
HETATM 968  O  O   . HOH F 5 .  ? 1.208   3.078  12.466  1.00 46.97  ? 337 HOH A O   1 
HETATM 969  O  O   . HOH F 5 .  ? 5.099   23.824 10.141  1.00 43.64  ? 338 HOH A O   1 
HETATM 970  O  O   . HOH F 5 .  ? -9.045  15.329 11.929  1.00 52.77  ? 339 HOH A O   1 
HETATM 971  O  O   . HOH F 5 .  ? 12.135  11.566 17.315  1.00 43.10  ? 340 HOH A O   1 
HETATM 972  O  O   . HOH F 5 .  ? 12.873  0.754  5.177   1.00 29.85  ? 341 HOH A O   1 
HETATM 973  O  O   . HOH F 5 .  ? -9.515  10.943 1.305   1.00 30.29  ? 342 HOH A O   1 
HETATM 974  O  O   . HOH F 5 .  ? -8.007  6.653  -3.366  1.00 29.14  ? 343 HOH A O   1 
HETATM 975  O  O   . HOH F 5 .  ? -7.964  6.382  -10.048 1.00 31.74  ? 344 HOH A O   1 
HETATM 976  O  O   . HOH F 5 .  ? 7.451   0.398  15.009  1.00 51.42  ? 345 HOH A O   1 
HETATM 977  O  O   . HOH F 5 .  ? 6.212   4.576  15.266  1.00 39.26  ? 346 HOH A O   1 
HETATM 978  O  O   . HOH F 5 .  ? -7.436  4.501  -8.034  1.00 41.38  ? 347 HOH A O   1 
HETATM 979  O  O   . HOH F 5 .  ? -1.648  13.153 -10.487 1.00 41.44  ? 348 HOH A O   1 
HETATM 980  O  O   . HOH F 5 .  ? 17.517  5.678  -0.655  1.00 33.25  ? 349 HOH A O   1 
HETATM 981  O  O   . HOH F 5 .  ? -3.675  -0.132 4.506   1.00 49.98  ? 350 HOH A O   1 
HETATM 982  O  O   . HOH F 5 .  ? -9.998  6.319  2.079   1.00 36.96  ? 351 HOH A O   1 
HETATM 983  O  O   . HOH F 5 .  ? 0.000   17.526 15.314  0.50 50.57  ? 352 HOH A O   1 
HETATM 984  O  O   . HOH F 5 .  ? -4.691  2.739  -3.703  1.00 46.34  ? 353 HOH A O   1 
HETATM 985  O  O   . HOH F 5 .  ? 31.246  15.448 6.203   1.00 35.15  ? 354 HOH A O   1 
HETATM 986  O  O   . HOH F 5 .  ? -8.434  19.230 9.121   1.00 49.14  ? 355 HOH A O   1 
HETATM 987  O  O   . HOH F 5 .  ? -11.779 -4.168 -0.050  1.00 52.38  ? 356 HOH A O   1 
HETATM 988  O  O   . HOH F 5 .  ? -7.175  15.583 13.235  1.00 38.97  ? 357 HOH A O   1 
HETATM 989  O  O   . HOH F 5 .  ? 15.627  11.068 -4.988  1.00 54.87  ? 358 HOH A O   1 
HETATM 990  O  O   . HOH F 5 .  ? -1.197  19.714 11.914  1.00 53.67  ? 359 HOH A O   1 
HETATM 991  O  O   . HOH F 5 .  ? 11.004  16.383 -6.636  1.00 44.26  ? 360 HOH A O   1 
HETATM 992  O  O   . HOH F 5 .  ? 4.688   26.184 1.295   1.00 63.17  ? 361 HOH A O   1 
HETATM 993  O  O   . HOH F 5 .  ? -11.226 13.921 11.913  1.00 47.09  ? 362 HOH A O   1 
HETATM 994  O  O   . HOH F 5 .  ? 15.795  14.375 -7.220  1.00 53.66  ? 363 HOH A O   1 
HETATM 995  O  O   . HOH F 5 .  ? 3.988   -0.504 14.992  1.00 51.48  ? 364 HOH A O   1 
HETATM 996  O  O   . HOH F 5 .  ? 22.461  8.530  2.350   1.00 44.13  ? 365 HOH A O   1 
HETATM 997  O  O   . HOH F 5 .  ? 28.887  15.086 5.466   1.00 30.60  ? 366 HOH A O   1 
HETATM 998  O  O   . HOH F 5 .  ? 12.693  19.093 13.154  1.00 44.49  ? 367 HOH A O   1 
HETATM 999  O  O   . HOH F 5 .  ? 6.939   4.226  19.815  1.00 47.66  ? 368 HOH A O   1 
HETATM 1000 O  O   . HOH F 5 .  ? 28.283  15.631 7.616   1.00 45.55  ? 369 HOH A O   1 
HETATM 1001 O  O   . HOH F 5 .  ? -0.470  23.563 6.190   1.00 48.92  ? 370 HOH A O   1 
HETATM 1002 O  O   . HOH F 5 .  ? 9.963   18.073 17.355  1.00 57.14  ? 371 HOH A O   1 
HETATM 1003 O  O   . HOH F 5 .  ? 11.898  30.559 -3.465  1.00 59.24  ? 372 HOH A O   1 
HETATM 1004 O  O   . HOH F 5 .  ? 18.927  3.710  6.833   1.00 52.90  ? 373 HOH A O   1 
HETATM 1005 O  O   . HOH F 5 .  ? 3.253   17.073 12.760  1.00 56.32  ? 374 HOH A O   1 
HETATM 1006 O  O   . HOH F 5 .  ? 11.736  13.267 -5.128  1.00 44.32  ? 375 HOH A O   1 
HETATM 1007 O  O   . HOH F 5 .  ? 3.952   25.127 4.923   1.00 48.93  ? 376 HOH A O   1 
HETATM 1008 O  O   . HOH F 5 .  ? -12.187 11.670 4.632   1.00 40.91  ? 377 HOH A O   1 
HETATM 1009 O  O   . HOH F 5 .  ? 23.528  15.473 -10.147 1.00 48.92  ? 378 HOH A O   1 
HETATM 1010 O  O   . HOH F 5 .  ? -9.909  1.155  -4.496  1.00 54.04  ? 379 HOH A O   1 
HETATM 1011 O  O   . HOH F 5 .  ? 12.144  0.000  0.000   0.50 44.24  ? 380 HOH A O   1 
HETATM 1012 O  O   . HOH F 5 .  ? 18.347  2.741  9.630   1.00 52.60  ? 381 HOH A O   1 
HETATM 1013 O  O   . HOH F 5 .  ? 10.784  21.626 12.574  1.00 53.59  ? 382 HOH A O   1 
HETATM 1014 O  O   . HOH F 5 .  ? 16.853  2.052  13.158  1.00 53.83  ? 383 HOH A O   1 
HETATM 1015 O  O   . HOH F 5 .  ? 8.330   23.882 13.132  1.00 57.54  ? 384 HOH A O   1 
HETATM 1016 O  O   . HOH F 5 .  ? 9.914   23.948 11.467  1.00 49.20  ? 385 HOH A O   1 
HETATM 1017 O  O   . HOH F 5 .  ? -8.162  7.987  10.369  1.00 35.87  ? 386 HOH A O   1 
HETATM 1018 O  O   . HOH F 5 .  ? 14.002  12.853 -4.535  1.00 55.49  ? 387 HOH A O   1 
HETATM 1019 O  O   . HOH G 5 .  ? 4.056   14.997 -7.136  1.00 24.15  ? 108 HOH B O   1 
HETATM 1020 O  O   . HOH G 5 .  ? -1.322  11.802 -8.260  1.00 21.79  ? 113 HOH B O   1 
HETATM 1021 O  O   . HOH G 5 .  ? -0.004  -0.895 -13.039 1.00 44.88  ? 133 HOH B O   1 
HETATM 1022 O  O   . HOH G 5 .  ? 3.899   2.356  -13.053 1.00 33.45  ? 136 HOH B O   1 
HETATM 1023 O  O   . HOH G 5 .  ? -2.594  3.094  -6.368  1.00 41.34  ? 143 HOH B O   1 
HETATM 1024 O  O   . HOH G 5 .  ? 5.786   10.519 -10.973 1.00 46.08  ? 144 HOH B O   1 
HETATM 1025 O  O   . HOH G 5 .  ? 9.630   14.728 -8.091  1.00 35.76  ? 153 HOH B O   1 
HETATM 1026 O  O   . HOH G 5 .  ? -4.034  1.765  -12.815 1.00 43.42  ? 158 HOH B O   1 
HETATM 1027 O  O   . HOH G 5 .  ? 2.898   14.483 -9.548  1.00 49.79  ? 167 HOH B O   1 
HETATM 1028 O  O   . HOH G 5 .  ? 4.877   13.139 -10.115 1.00 56.01  ? 170 HOH B O   1 
HETATM 1029 O  O   . HOH G 5 .  ? -2.998  4.175  -13.828 1.00 45.77  ? 172 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   17  ?   ?   ?   A . n 
A 1 2   GLN 2   18  ?   ?   ?   A . n 
A 1 3   ILE 3   19  ?   ?   ?   A . n 
A 1 4   PRO 4   20  ?   ?   ?   A . n 
A 1 5   ALA 5   21  ?   ?   ?   A . n 
A 1 6   SER 6   22  ?   ?   ?   A . n 
A 1 7   GLU 7   23  23  GLU GLU A . n 
A 1 8   GLN 8   24  24  GLN GLN A . n 
A 1 9   GLU 9   25  25  GLU GLU A . n 
A 1 10  THR 10  26  26  THR THR A . n 
A 1 11  LEU 11  27  27  LEU LEU A . n 
A 1 12  VAL 12  28  28  VAL VAL A . n 
A 1 13  ARG 13  29  29  ARG ARG A . n 
A 1 14  PRO 14  30  30  PRO PRO A . n 
A 1 15  LYS 15  31  31  LYS LYS A . n 
A 1 16  PRO 16  32  32  PRO PRO A . n 
A 1 17  LEU 17  33  33  LEU LEU A . n 
A 1 18  LEU 18  34  34  LEU LEU A . n 
A 1 19  LEU 19  35  35  LEU LEU A . n 
A 1 20  LYS 20  36  36  LYS LYS A . n 
A 1 21  LEU 21  37  37  LEU LEU A . n 
A 1 22  LEU 22  38  38  LEU LEU A . n 
A 1 23  LYS 23  39  39  LYS LYS A . n 
A 1 24  SER 24  40  40  SER SER A . n 
A 1 25  VAL 25  41  41  VAL VAL A . n 
A 1 26  GLY 26  42  42  GLY GLY A . n 
A 1 27  ALA 27  43  43  ALA ALA A . n 
A 1 28  GLN 28  44  44  GLN GLN A . n 
A 1 29  LYS 29  45  45  LYS LYS A . n 
A 1 30  ASP 30  46  46  ASP ASP A . n 
A 1 31  THR 31  47  47  THR THR A . n 
A 1 32  TYR 32  48  48  TYR TYR A . n 
A 1 33  THR 33  49  49  THR THR A . n 
A 1 34  MET 34  50  50  MET MET A . n 
A 1 35  LYS 35  51  51  LYS LYS A . n 
A 1 36  GLU 36  52  52  GLU GLU A . n 
A 1 37  VAL 37  53  53  VAL VAL A . n 
A 1 38  LEU 38  54  54  LEU LEU A . n 
A 1 39  PHE 39  55  55  PHE PHE A . n 
A 1 40  TYR 40  56  56  TYR TYR A . n 
A 1 41  LEU 41  57  57  LEU LEU A . n 
A 1 42  GLY 42  58  58  GLY GLY A . n 
A 1 43  GLN 43  59  59  GLN GLN A . n 
A 1 44  TYR 44  60  60  TYR TYR A . n 
A 1 45  ILE 45  61  61  ILE ILE A . n 
A 1 46  MET 46  62  62  MET MET A . n 
A 1 47  THR 47  63  63  THR THR A . n 
A 1 48  LYS 48  64  64  LYS LYS A . n 
A 1 49  ARG 49  65  65  ARG ARG A . n 
A 1 50  LEU 50  66  66  LEU LEU A . n 
A 1 51  TYR 51  67  67  TYR TYR A . n 
A 1 52  ASP 52  68  68  ASP ASP A . n 
A 1 53  GLU 53  69  69  GLU GLU A . n 
A 1 54  LYS 54  70  70  LYS LYS A . n 
A 1 55  GLN 55  71  71  GLN GLN A . n 
A 1 56  GLN 56  72  72  GLN GLN A . n 
A 1 57  HIS 57  73  73  HIS HIS A . n 
A 1 58  ILE 58  74  74  ILE ILE A . n 
A 1 59  VAL 59  75  75  VAL VAL A . n 
A 1 60  TYR 60  76  76  TYR TYR A . n 
A 1 61  CYS 61  77  77  CYS CYS A . n 
A 1 62  SER 62  78  78  SER SER A . n 
A 1 63  ASN 63  79  79  ASN ASN A . n 
A 1 64  ASP 64  80  80  ASP ASP A . n 
A 1 65  LEU 65  81  81  LEU LEU A . n 
A 1 66  LEU 66  82  82  LEU LEU A . n 
A 1 67  GLY 67  83  83  GLY GLY A . n 
A 1 68  ASP 68  84  84  ASP ASP A . n 
A 1 69  LEU 69  85  85  LEU LEU A . n 
A 1 70  PHE 70  86  86  PHE PHE A . n 
A 1 71  GLY 71  87  87  GLY GLY A . n 
A 1 72  VAL 72  88  88  VAL VAL A . n 
A 1 73  PRO 73  89  89  PRO PRO A . n 
A 1 74  SER 74  90  90  SER SER A . n 
A 1 75  PHE 75  91  91  PHE PHE A . n 
A 1 76  SER 76  92  92  SER SER A . n 
A 1 77  VAL 77  93  93  VAL VAL A . n 
A 1 78  LYS 78  94  94  LYS LYS A . n 
A 1 79  GLU 79  95  95  GLU GLU A . n 
A 1 80  HIS 80  96  96  HIS HIS A . n 
A 1 81  ARG 81  97  97  ARG ARG A . n 
A 1 82  LYS 82  98  98  LYS LYS A . n 
A 1 83  ILE 83  99  99  ILE ILE A . n 
A 1 84  TYR 84  100 100 TYR TYR A . n 
A 1 85  THR 85  101 101 THR THR A . n 
A 1 86  MET 86  102 102 MET MET A . n 
A 1 87  ILE 87  103 103 ILE ILE A . n 
A 1 88  TYR 88  104 104 TYR TYR A . n 
A 1 89  ARG 89  105 105 ARG ARG A . n 
A 1 90  ASN 90  106 106 ASN ASN A . n 
A 1 91  LEU 91  107 107 LEU LEU A . n 
A 1 92  VAL 92  108 108 VAL VAL A . n 
A 1 93  VAL 93  109 109 VAL VAL A . n 
A 1 94  VAL 94  110 110 VAL VAL A . n 
A 1 95  ASN 95  111 111 ASN ASN A . n 
A 1 96  GLN 96  112 112 GLN GLN A . n 
A 1 97  GLN 97  113 113 GLN GLN A . n 
A 1 98  GLU 98  114 114 GLU GLU A . n 
A 1 99  SER 99  115 ?   ?   ?   A . n 
A 1 100 SER 100 116 ?   ?   ?   A . n 
A 1 101 ASP 101 117 ?   ?   ?   A . n 
A 1 102 SER 102 118 ?   ?   ?   A . n 
A 1 103 GLY 103 119 ?   ?   ?   A . n 
A 1 104 THR 104 120 ?   ?   ?   A . n 
A 1 105 SER 105 121 ?   ?   ?   A . n 
A 1 106 VAL 106 122 ?   ?   ?   A . n 
A 1 107 SER 107 123 ?   ?   ?   A . n 
A 1 108 GLU 108 124 ?   ?   ?   A . n 
A 1 109 ASN 109 125 ?   ?   ?   A . n 
A 1 110 HIS 110 126 ?   ?   ?   A . n 
A 1 111 HIS 111 127 ?   ?   ?   A . n 
A 1 112 HIS 112 128 ?   ?   ?   A . n 
A 1 113 HIS 113 129 ?   ?   ?   A . n 
A 1 114 HIS 114 130 ?   ?   ?   A . n 
A 1 115 HIS 115 131 ?   ?   ?   A . n 
B 2 1   PRO 1   20  20  PRO PRO B . n 
B 2 2   PHE 2   21  21  PHE PHE B . n 
B 2 3   GLU 3   22  22  GLU GLU B . n 
B 2 4   6CW 4   23  23  6CW 6CW B . n 
B 2 5   LEU 5   24  24  LEU LEU B . n 
B 2 6   ASP 6   25  25  ASP ASP B . n 
B 2 7   TRP 7   26  26  TRP TRP B . n 
B 2 8   GLU 8   27  27  GLU GLU B . n 
B 2 9   PHE 9   28  28  PHE PHE B . n 
B 2 10  DPR 10  29  29  DPR DPR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  301 301 SO4 SO4 A . 
D 3 SO4 1  302 302 SO4 SO4 A . 
E 4 MPO 1  201 201 MPO MPO A . 
F 5 HOH 1  303 100 HOH HOH A . 
F 5 HOH 2  304 101 HOH HOH A . 
F 5 HOH 3  305 102 HOH HOH A . 
F 5 HOH 4  306 103 HOH HOH A . 
F 5 HOH 5  307 104 HOH HOH A . 
F 5 HOH 6  308 105 HOH HOH A . 
F 5 HOH 7  309 106 HOH HOH A . 
F 5 HOH 8  310 107 HOH HOH A . 
F 5 HOH 9  311 109 HOH HOH A . 
F 5 HOH 10 312 110 HOH HOH A . 
F 5 HOH 11 313 111 HOH HOH A . 
F 5 HOH 12 314 112 HOH HOH A . 
F 5 HOH 13 315 114 HOH HOH A . 
F 5 HOH 14 316 115 HOH HOH A . 
F 5 HOH 15 317 116 HOH HOH A . 
F 5 HOH 16 318 117 HOH HOH A . 
F 5 HOH 17 319 118 HOH HOH A . 
F 5 HOH 18 320 119 HOH HOH A . 
F 5 HOH 19 321 120 HOH HOH A . 
F 5 HOH 20 322 121 HOH HOH A . 
F 5 HOH 21 323 122 HOH HOH A . 
F 5 HOH 22 324 123 HOH HOH A . 
F 5 HOH 23 325 124 HOH HOH A . 
F 5 HOH 24 326 125 HOH HOH A . 
F 5 HOH 25 327 126 HOH HOH A . 
F 5 HOH 26 328 127 HOH HOH A . 
F 5 HOH 27 329 128 HOH HOH A . 
F 5 HOH 28 330 129 HOH HOH A . 
F 5 HOH 29 331 130 HOH HOH A . 
F 5 HOH 30 332 131 HOH HOH A . 
F 5 HOH 31 333 132 HOH HOH A . 
F 5 HOH 32 334 134 HOH HOH A . 
F 5 HOH 33 335 135 HOH HOH A . 
F 5 HOH 34 336 137 HOH HOH A . 
F 5 HOH 35 337 138 HOH HOH A . 
F 5 HOH 36 338 139 HOH HOH A . 
F 5 HOH 37 339 140 HOH HOH A . 
F 5 HOH 38 340 141 HOH HOH A . 
F 5 HOH 39 341 142 HOH HOH A . 
F 5 HOH 40 342 145 HOH HOH A . 
F 5 HOH 41 343 146 HOH HOH A . 
F 5 HOH 42 344 147 HOH HOH A . 
F 5 HOH 43 345 148 HOH HOH A . 
F 5 HOH 44 346 149 HOH HOH A . 
F 5 HOH 45 347 150 HOH HOH A . 
F 5 HOH 46 348 151 HOH HOH A . 
F 5 HOH 47 349 152 HOH HOH A . 
F 5 HOH 48 350 154 HOH HOH A . 
F 5 HOH 49 351 155 HOH HOH A . 
F 5 HOH 50 352 156 HOH HOH A . 
F 5 HOH 51 353 157 HOH HOH A . 
F 5 HOH 52 354 159 HOH HOH A . 
F 5 HOH 53 355 160 HOH HOH A . 
F 5 HOH 54 356 161 HOH HOH A . 
F 5 HOH 55 357 162 HOH HOH A . 
F 5 HOH 56 358 163 HOH HOH A . 
F 5 HOH 57 359 164 HOH HOH A . 
F 5 HOH 58 360 165 HOH HOH A . 
F 5 HOH 59 361 166 HOH HOH A . 
F 5 HOH 60 362 168 HOH HOH A . 
F 5 HOH 61 363 169 HOH HOH A . 
F 5 HOH 62 364 171 HOH HOH A . 
F 5 HOH 63 365 173 HOH HOH A . 
F 5 HOH 64 366 174 HOH HOH A . 
F 5 HOH 65 367 175 HOH HOH A . 
F 5 HOH 66 368 176 HOH HOH A . 
F 5 HOH 67 369 177 HOH HOH A . 
F 5 HOH 68 370 178 HOH HOH A . 
F 5 HOH 69 371 179 HOH HOH A . 
F 5 HOH 70 372 180 HOH HOH A . 
F 5 HOH 71 373 181 HOH HOH A . 
F 5 HOH 72 374 182 HOH HOH A . 
F 5 HOH 73 375 183 HOH HOH A . 
F 5 HOH 74 376 184 HOH HOH A . 
F 5 HOH 75 377 185 HOH HOH A . 
F 5 HOH 76 378 186 HOH HOH A . 
F 5 HOH 77 379 187 HOH HOH A . 
F 5 HOH 78 380 188 HOH HOH A . 
F 5 HOH 79 381 189 HOH HOH A . 
F 5 HOH 80 382 190 HOH HOH A . 
F 5 HOH 81 383 191 HOH HOH A . 
F 5 HOH 82 384 192 HOH HOH A . 
F 5 HOH 83 385 193 HOH HOH A . 
F 5 HOH 84 386 194 HOH HOH A . 
F 5 HOH 85 387 195 HOH HOH A . 
G 5 HOH 1  108 108 HOH HOH B . 
G 5 HOH 2  113 113 HOH HOH B . 
G 5 HOH 3  133 133 HOH HOH B . 
G 5 HOH 4  136 136 HOH HOH B . 
G 5 HOH 5  143 143 HOH HOH B . 
G 5 HOH 6  144 144 HOH HOH B . 
G 5 HOH 7  153 153 HOH HOH B . 
G 5 HOH 8  158 158 HOH HOH B . 
G 5 HOH 9  167 167 HOH HOH B . 
G 5 HOH 10 170 170 HOH HOH B . 
G 5 HOH 11 172 172 HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_000326 
_pdbx_molecule_features.name      
;cyclo(L-alpha-aspartyl-L-tryptophyl-L-alpha-glutamyl-L-phenylalanyl-D-prolyl-L-prolyl-L-phenylalanyl-L-alpha-glutamyl-6-chloro-L-tryptophyl-L-leucyl)
;
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000326 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    6CW 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     6CW 
_pdbx_struct_mod_residue.auth_seq_id      23 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TRP 
_pdbx_struct_mod_residue.details          6-CHLORO-L-TRYPTOPHAN 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
3 software_defined_assembly            PISA tetrameric 4 
4 software_defined_assembly            PISA tetrameric 4 
5 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G 
2 1,2 A,B,C,D,E,F,G 
3 1,3 A,B,C,D,E,F,G 
4 1,2 A,C,D,E,F     
4 4,3 B,G           
5 1,5 A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1500  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  6450  ? 
2 'ABSA (A^2)' 3960  ? 
2 MORE         -105  ? 
2 'SSA (A^2)'  12390 ? 
3 'ABSA (A^2)' 5100  ? 
3 MORE         -59   ? 
3 'SSA (A^2)'  10820 ? 
4 'ABSA (A^2)' 2450  ? 
4 MORE         -66   ? 
4 'SSA (A^2)'  13910 ? 
5 'ABSA (A^2)' 3240  ? 
5 MORE         -68   ? 
5 'SSA (A^2)'  13110 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 45.1800000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 30.6285000000  
3 'crystal symmetry operation' 4_555 x,-y,-z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
-1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000   
4 'crystal symmetry operation' 2_655 -x+1,-y,z+1/2 -1.0000000000 0.0000000000 0.0000000000 45.1800000000 0.0000000000 
-1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  30.6285000000  
5 'crystal symmetry operation' 3_554 -x,y,-z-1/2   -1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -30.6285000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A SO4 302 ? D SO4 . 
2 1 A HOH 352 ? F HOH . 
3 1 A HOH 380 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
5 'Structure model' 1 4 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
9 5 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SHELX       .     ?               package 'George Sheldrick' gsheldr@shelx.uni-ac.gwdg.de refinement        
http://shelx.uni-ac.gwdg.de/SHELX/ Fortran ? 1 
PDB_EXTRACT 1.700 'May. 30, 2005' package PDB                sw-help@rcsb.rutgers.edu     'data extraction' 
http://pdb.rutgers.edu/software/   C++     ? 2 
XDS         .     ?               ?       ?                  ?                            'data reduction'  ? ?       ? 3 
XDS         .     ?               ?       ?                  ?                            'data scaling'    ? ?       ? 4 
AMoRE       .     ?               ?       ?                  ?                            phasing           ? ?       ? 5 
SHELXL      .     ?               ?       ?                  ?                            refinement        ? ?       ? 6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 29  ? A CZ A ARG 29  ? A NH1 A ARG 29  ? A 123.51 120.30 3.21  0.50 N 
2  1 NE A ARG 29  ? B CZ A ARG 29  ? B NH2 A ARG 29  ? B 113.38 120.30 -6.92 0.50 N 
3  1 CD A LYS 51  ? ? CE A LYS 51  ? ? NZ  A LYS 51  ? ? 126.71 111.70 15.01 2.30 N 
4  1 CB A TYR 76  ? B CG A TYR 76  ? B CD2 A TYR 76  ? B 116.59 121.00 -4.41 0.60 N 
5  1 CB A TYR 76  ? B CG A TYR 76  ? B CD1 A TYR 76  ? B 124.61 121.00 3.61  0.60 N 
6  1 CD A ARG 97  ? ? NE A ARG 97  ? ? CZ  A ARG 97  ? ? 114.68 123.60 -8.92 1.40 N 
7  1 NE A ARG 97  ? ? CZ A ARG 97  ? ? NH1 A ARG 97  ? ? 116.53 120.30 -3.77 0.50 N 
8  1 NE A ARG 97  ? ? CZ A ARG 97  ? ? NH2 A ARG 97  ? ? 125.07 120.30 4.77  0.50 N 
9  1 CD A ARG 105 ? ? NE A ARG 105 ? ? CZ  A ARG 105 ? ? 114.77 123.60 -8.83 1.40 N 
10 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 117.23 120.30 -3.07 0.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LEU 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     24 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             50.61 
_pdbx_validate_torsion.psi             -122.73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 17  ? A SER 1   
2  1 Y 1 A GLN 18  ? A GLN 2   
3  1 Y 1 A ILE 19  ? A ILE 3   
4  1 Y 1 A PRO 20  ? A PRO 4   
5  1 Y 1 A ALA 21  ? A ALA 5   
6  1 Y 1 A SER 22  ? A SER 6   
7  1 Y 1 A SER 115 ? A SER 99  
8  1 Y 1 A SER 116 ? A SER 100 
9  1 Y 1 A ASP 117 ? A ASP 101 
10 1 Y 1 A SER 118 ? A SER 102 
11 1 Y 1 A GLY 119 ? A GLY 103 
12 1 Y 1 A THR 120 ? A THR 104 
13 1 Y 1 A SER 121 ? A SER 105 
14 1 Y 1 A VAL 122 ? A VAL 106 
15 1 Y 1 A SER 123 ? A SER 107 
16 1 Y 1 A GLU 124 ? A GLU 108 
17 1 Y 1 A ASN 125 ? A ASN 109 
18 1 Y 1 A HIS 126 ? A HIS 110 
19 1 Y 1 A HIS 127 ? A HIS 111 
20 1 Y 1 A HIS 128 ? A HIS 112 
21 1 Y 1 A HIS 129 ? A HIS 113 
22 1 Y 1 A HIS 130 ? A HIS 114 
23 1 Y 1 A HIS 131 ? A HIS 115 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                          SO4 
4 '3[N-MORPHOLINO]PROPANE SULFONIC ACID' MPO 
5 water                                  HOH 
#