data_2AXT
# 
_entry.id   2AXT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AXT         
RCSB  RCSB034441   
WWPDB D_1000034441 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AXT 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Loll, B.'      1 
'Kern, J.'      2 
'Saenger, W.'   3 
'Zouni, A.'     4 
'Biesiadka, J.' 5 
# 
_citation.id                        primary 
_citation.title                     'Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II' 
_citation.journal_abbrev            NATURE 
_citation.journal_volume            438 
_citation.page_first                1040 
_citation.page_last                 1044 
_citation.year                      2005 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16355230 
_citation.pdbx_database_id_DOI      10.1038/nature04224 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Loll, B.'      1 
primary 'Kern, J.'      2 
primary 'Saenger, W.'   3 
primary 'Zouni, A.'     4 
primary 'Biesiadka, J.' 5 
# 
_cell.entry_id           2AXT 
_cell.length_a           127.692 
_cell.length_b           225.403 
_cell.length_c           306.106 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2AXT 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Photosystem Q(B) protein' 38265.625 2  ? ? 'residues 1-344' ? 
2  polymer     nat 'CP47 protein' 56656.457 2  ? ? ?                ? 
3  polymer     nat 'photosystem II CP43 protein' 51666.094 2  ? ? ?                ? 
4  polymer     nat 'photosystem II reaction center D2 protein' 39388.156 2  ? ? ?                ? 
5  polymer     nat 'Cytochrome b559 alpha subunit' 9580.840  2  ? ? ?                ? 
6  polymer     nat 'Cytochrome b559 beta subunit' 5067.900  2  ? ? ?                ? 
7  polymer     nat 'Photosystem II reaction center H protein' 7358.754  2  ? ? ?                ? 
8  polymer     nat 'Photosystem II reaction center I protein' 4410.245  2  ? ? ?                ? 
9  polymer     nat 'Photosystem II reaction center J protein' 4105.908  2  ? ? ?                ? 
10 polymer     nat 'Photosystem II reaction center protein K' 4101.911  2  ? ? ?                ? 
11 polymer     nat 'Photosystem II reaction center L protein' 4299.044  2  ? ? ?                ? 
12 polymer     nat 'Photosystem II reaction center M protein' 3981.673  2  ? ? ?                ? 
13 polymer     nat 'Photosystem II manganese-stabilizing polypeptide' 26923.045 2  ? ? ?                ? 
14 polymer     nat 'Photosystem II reaction center T protein' 3878.728  2  ? ? ?                ? 
15 polymer     nat 'Photosystem II 12 kDa extrinsic protein' 11655.986 2  ? ? ?                ? 
16 polymer     nat 'Cytochrome c-550' 15148.255 2  ? ? ?                ? 
17 polymer     nat 'Unassigned subunits' 10996.547 2  ? ? ?                ? 
18 polymer     nat 'Photosystem II reaction center Z protein' 6766.187  2  ? ? ?                ? 
19 non-polymer syn 'FE (II) ION' 55.845    2  ? ? ?                ? 
20 non-polymer syn 'CHLOROPHYLL A' 893.489   70 ? ? ?                ? 
21 non-polymer syn 'PHEOPHYTIN A' 871.200   4  ? ? ?                ? 
22 non-polymer syn 
'5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE' 
612.967   4  ? ? ?                ? 
23 non-polymer syn 'OXYGEN EVOLVING SYSTEM' 323.828   2  ? ? ?                ? 
24 non-polymer syn BETA-CAROTENE 536.873   22 ? ? ?                ? 
25 non-polymer syn 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE 722.970   2  ? ? ?                ? 
26 non-polymer syn '1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL' 795.116   6  ? ? ?                ? 
27 non-polymer syn DODECYL-BETA-D-MALTOSIDE 510.615   6  ? ? ?                ? 
28 non-polymer syn '(1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE' 688.972   12 ? ? ?                
? 
29 non-polymer syn UNKNOWN 103.120   34 ? ? ?                ? 
30 non-polymer syn 'DIGALACTOSYL DIACYL GLYCEROL (DGDG)' 949.299   8  ? ? ?                ? 
31 non-polymer syn 'BICARBONATE ION' 61.017    2  ? ? ?                ? 
32 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4  ? ? ?                ? 
33 non-polymer syn 'CALCIUM ION' 40.078    2  ? ? ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Reaction centre subunit D1, 32 kDa thylakoid membrane protein, Photosystem II protein D1' 
2  'Antenna subunit CP47'                                                                     
3  'Antenna subunit CP43'                                                                     
4  'Reaction centre subunit D2'                                                               
5  'Cyt b-559 subunit alpha, PSII reaction center subunit V'                                  
6  'Cyt b-559 subunit beta, PSII reaction center subunit VI'                                  
7  'Subunit PsbH, PSII-H'                                                                     
8  'Subunit PsbI, PSII 4.4 kDa protein'                                                       
9  'Subunit PsbJ'                                                                             
10 'Subunit PsbK, PSII-K'                                                                     
11 'Subunit PsbL, PSII-L, PSII 5 kDa protein'                                                 
12 'Subunit PsbM, PSII-M'                                                                     
13 'Subunit PsbO, MSP'                                                                        
14 'Subunit PsbT, PSII-T, PSII-Tc'                                                            
15 'Subunit PsbU, PS II complex 12 kDa extrinsic protein, PSII-U'                             
16 'Cyt c-550, subunit PsbV, Cytochrome c550, Low potential cytochrome c'                     
18 'Subunit PsbZ'                                                                             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLA
;
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLA
;
A,a ? 
2  'polypeptide(L)' no no 
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPA
KGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVS
FYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRRKEAV
;
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPA
KGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVS
FYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRRKEAV
;
B,b ? 
3  'polypeptide(L)' no no 
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIR
DQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAP
LGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIR
DQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAP
LGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
C,c ? 
4  'polypeptide(L)' no no 
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
D,d ? 
5  'polypeptide(L)' no no 
;MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFL
EQLK
;
;MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFL
EQLK
;
E,e ? 
6  'polypeptide(L)' no no MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR F,f ? 
7  'polypeptide(L)' no no MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG 
MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG H,h ? 
8  'polypeptide(L)' no no METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE I,i ? 
9  'polypeptide(L)' no no MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL J,j ? 
10 'polypeptide(L)' no no KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR K,k ? 
11 'polypeptide(L)' no no MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN L,l ? 
12 'polypeptide(L)' no no MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS M,m ? 
13 'polypeptide(L)' no no 
;AAKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLD
QIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDP
KGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVF
YASIEPA
;
;AAKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLD
QIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDP
KGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVF
YASIEPA
;
O,o ? 
14 'polypeptide(L)' no no METITYVFIFACIIALFFFAIFFREPPRITKK METITYVFIFACIIALFFFAIFFREPPRITKK T,t ? 
15 'polypeptide(L)' no no 
;ATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLE
HFTVTEVETALVEGGDRYNNGLYK
;
;ATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLE
HFTVTEVETALVEGGDRYNNGLYK
;
U,u ? 
16 'polypeptide(L)' no no 
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
V,v ? 
17 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
X,x ? 
18 'polypeptide(L)' no no MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV 
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV Z,z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   THR n 
1  4   THR n 
1  5   LEU n 
1  6   GLN n 
1  7   ARG n 
1  8   ARG n 
1  9   GLU n 
1  10  SER n 
1  11  ALA n 
1  12  ASN n 
1  13  LEU n 
1  14  TRP n 
1  15  GLU n 
1  16  ARG n 
1  17  PHE n 
1  18  CYS n 
1  19  ASN n 
1  20  TRP n 
1  21  VAL n 
1  22  THR n 
1  23  SER n 
1  24  THR n 
1  25  ASP n 
1  26  ASN n 
1  27  ARG n 
1  28  LEU n 
1  29  TYR n 
1  30  VAL n 
1  31  GLY n 
1  32  TRP n 
1  33  PHE n 
1  34  GLY n 
1  35  VAL n 
1  36  ILE n 
1  37  MET n 
1  38  ILE n 
1  39  PRO n 
1  40  THR n 
1  41  LEU n 
1  42  LEU n 
1  43  ALA n 
1  44  ALA n 
1  45  THR n 
1  46  ILE n 
1  47  CYS n 
1  48  PHE n 
1  49  VAL n 
1  50  ILE n 
1  51  ALA n 
1  52  PHE n 
1  53  ILE n 
1  54  ALA n 
1  55  ALA n 
1  56  PRO n 
1  57  PRO n 
1  58  VAL n 
1  59  ASP n 
1  60  ILE n 
1  61  ASP n 
1  62  GLY n 
1  63  ILE n 
1  64  ARG n 
1  65  GLU n 
1  66  PRO n 
1  67  VAL n 
1  68  SER n 
1  69  GLY n 
1  70  SER n 
1  71  LEU n 
1  72  LEU n 
1  73  TYR n 
1  74  GLY n 
1  75  ASN n 
1  76  ASN n 
1  77  ILE n 
1  78  ILE n 
1  79  THR n 
1  80  GLY n 
1  81  ALA n 
1  82  VAL n 
1  83  VAL n 
1  84  PRO n 
1  85  SER n 
1  86  SER n 
1  87  ASN n 
1  88  ALA n 
1  89  ILE n 
1  90  GLY n 
1  91  LEU n 
1  92  HIS n 
1  93  PHE n 
1  94  TYR n 
1  95  PRO n 
1  96  ILE n 
1  97  TRP n 
1  98  GLU n 
1  99  ALA n 
1  100 ALA n 
1  101 SER n 
1  102 LEU n 
1  103 ASP n 
1  104 GLU n 
1  105 TRP n 
1  106 LEU n 
1  107 TYR n 
1  108 ASN n 
1  109 GLY n 
1  110 GLY n 
1  111 PRO n 
1  112 TYR n 
1  113 GLN n 
1  114 LEU n 
1  115 ILE n 
1  116 ILE n 
1  117 PHE n 
1  118 HIS n 
1  119 PHE n 
1  120 LEU n 
1  121 LEU n 
1  122 GLY n 
1  123 ALA n 
1  124 SER n 
1  125 CYS n 
1  126 TYR n 
1  127 MET n 
1  128 GLY n 
1  129 ARG n 
1  130 GLN n 
1  131 TRP n 
1  132 GLU n 
1  133 LEU n 
1  134 SER n 
1  135 TYR n 
1  136 ARG n 
1  137 LEU n 
1  138 GLY n 
1  139 MET n 
1  140 ARG n 
1  141 PRO n 
1  142 TRP n 
1  143 ILE n 
1  144 CYS n 
1  145 VAL n 
1  146 ALA n 
1  147 TYR n 
1  148 SER n 
1  149 ALA n 
1  150 PRO n 
1  151 LEU n 
1  152 ALA n 
1  153 SER n 
1  154 ALA n 
1  155 PHE n 
1  156 ALA n 
1  157 VAL n 
1  158 PHE n 
1  159 LEU n 
1  160 ILE n 
1  161 TYR n 
1  162 PRO n 
1  163 ILE n 
1  164 GLY n 
1  165 GLN n 
1  166 GLY n 
1  167 SER n 
1  168 PHE n 
1  169 SER n 
1  170 ASP n 
1  171 GLY n 
1  172 MET n 
1  173 PRO n 
1  174 LEU n 
1  175 GLY n 
1  176 ILE n 
1  177 SER n 
1  178 GLY n 
1  179 THR n 
1  180 PHE n 
1  181 ASN n 
1  182 PHE n 
1  183 MET n 
1  184 ILE n 
1  185 VAL n 
1  186 PHE n 
1  187 GLN n 
1  188 ALA n 
1  189 GLU n 
1  190 HIS n 
1  191 ASN n 
1  192 ILE n 
1  193 LEU n 
1  194 MET n 
1  195 HIS n 
1  196 PRO n 
1  197 PHE n 
1  198 HIS n 
1  199 GLN n 
1  200 LEU n 
1  201 GLY n 
1  202 VAL n 
1  203 ALA n 
1  204 GLY n 
1  205 VAL n 
1  206 PHE n 
1  207 GLY n 
1  208 GLY n 
1  209 ALA n 
1  210 LEU n 
1  211 PHE n 
1  212 CYS n 
1  213 ALA n 
1  214 MET n 
1  215 HIS n 
1  216 GLY n 
1  217 SER n 
1  218 LEU n 
1  219 VAL n 
1  220 THR n 
1  221 SER n 
1  222 SER n 
1  223 LEU n 
1  224 ILE n 
1  225 ARG n 
1  226 GLU n 
1  227 THR n 
1  228 THR n 
1  229 GLU n 
1  230 THR n 
1  231 GLU n 
1  232 SER n 
1  233 ALA n 
1  234 ASN n 
1  235 TYR n 
1  236 GLY n 
1  237 TYR n 
1  238 LYS n 
1  239 PHE n 
1  240 GLY n 
1  241 GLN n 
1  242 GLU n 
1  243 GLU n 
1  244 GLU n 
1  245 THR n 
1  246 TYR n 
1  247 ASN n 
1  248 ILE n 
1  249 VAL n 
1  250 ALA n 
1  251 ALA n 
1  252 HIS n 
1  253 GLY n 
1  254 TYR n 
1  255 PHE n 
1  256 GLY n 
1  257 ARG n 
1  258 LEU n 
1  259 ILE n 
1  260 PHE n 
1  261 GLN n 
1  262 TYR n 
1  263 ALA n 
1  264 SER n 
1  265 PHE n 
1  266 ASN n 
1  267 ASN n 
1  268 SER n 
1  269 ARG n 
1  270 SER n 
1  271 LEU n 
1  272 HIS n 
1  273 PHE n 
1  274 PHE n 
1  275 LEU n 
1  276 ALA n 
1  277 ALA n 
1  278 TRP n 
1  279 PRO n 
1  280 VAL n 
1  281 VAL n 
1  282 GLY n 
1  283 VAL n 
1  284 TRP n 
1  285 PHE n 
1  286 THR n 
1  287 ALA n 
1  288 LEU n 
1  289 GLY n 
1  290 ILE n 
1  291 SER n 
1  292 THR n 
1  293 MET n 
1  294 ALA n 
1  295 PHE n 
1  296 ASN n 
1  297 LEU n 
1  298 ASN n 
1  299 GLY n 
1  300 PHE n 
1  301 ASN n 
1  302 PHE n 
1  303 ASN n 
1  304 HIS n 
1  305 SER n 
1  306 VAL n 
1  307 ILE n 
1  308 ASP n 
1  309 ALA n 
1  310 LYS n 
1  311 GLY n 
1  312 ASN n 
1  313 VAL n 
1  314 ILE n 
1  315 ASN n 
1  316 THR n 
1  317 TRP n 
1  318 ALA n 
1  319 ASP n 
1  320 ILE n 
1  321 ILE n 
1  322 ASN n 
1  323 ARG n 
1  324 ALA n 
1  325 ASN n 
1  326 LEU n 
1  327 GLY n 
1  328 MET n 
1  329 GLU n 
1  330 VAL n 
1  331 MET n 
1  332 HIS n 
1  333 GLU n 
1  334 ARG n 
1  335 ASN n 
1  336 ALA n 
1  337 HIS n 
1  338 ASN n 
1  339 PHE n 
1  340 PRO n 
1  341 LEU n 
1  342 ASP n 
1  343 LEU n 
1  344 ALA n 
2  1   MET n 
2  2   GLY n 
2  3   LEU n 
2  4   PRO n 
2  5   TRP n 
2  6   TYR n 
2  7   ARG n 
2  8   VAL n 
2  9   HIS n 
2  10  THR n 
2  11  VAL n 
2  12  LEU n 
2  13  ILE n 
2  14  ASN n 
2  15  ASP n 
2  16  PRO n 
2  17  GLY n 
2  18  ARG n 
2  19  LEU n 
2  20  ILE n 
2  21  ALA n 
2  22  ALA n 
2  23  HIS n 
2  24  LEU n 
2  25  MET n 
2  26  HIS n 
2  27  THR n 
2  28  ALA n 
2  29  LEU n 
2  30  VAL n 
2  31  ALA n 
2  32  GLY n 
2  33  TRP n 
2  34  ALA n 
2  35  GLY n 
2  36  SER n 
2  37  MET n 
2  38  ALA n 
2  39  LEU n 
2  40  TYR n 
2  41  GLU n 
2  42  LEU n 
2  43  ALA n 
2  44  THR n 
2  45  PHE n 
2  46  ASP n 
2  47  PRO n 
2  48  SER n 
2  49  ASP n 
2  50  PRO n 
2  51  VAL n 
2  52  LEU n 
2  53  ASN n 
2  54  PRO n 
2  55  MET n 
2  56  TRP n 
2  57  ARG n 
2  58  GLN n 
2  59  GLY n 
2  60  MET n 
2  61  PHE n 
2  62  VAL n 
2  63  LEU n 
2  64  PRO n 
2  65  PHE n 
2  66  MET n 
2  67  ALA n 
2  68  ARG n 
2  69  LEU n 
2  70  GLY n 
2  71  VAL n 
2  72  THR n 
2  73  GLY n 
2  74  SER n 
2  75  TRP n 
2  76  SER n 
2  77  GLY n 
2  78  TRP n 
2  79  SER n 
2  80  ILE n 
2  81  THR n 
2  82  GLY n 
2  83  GLU n 
2  84  THR n 
2  85  GLY n 
2  86  ILE n 
2  87  ASP n 
2  88  PRO n 
2  89  GLY n 
2  90  PHE n 
2  91  TRP n 
2  92  SER n 
2  93  PHE n 
2  94  GLU n 
2  95  GLY n 
2  96  VAL n 
2  97  ALA n 
2  98  LEU n 
2  99  ALA n 
2  100 HIS n 
2  101 ILE n 
2  102 VAL n 
2  103 LEU n 
2  104 SER n 
2  105 GLY n 
2  106 LEU n 
2  107 LEU n 
2  108 PHE n 
2  109 LEU n 
2  110 ALA n 
2  111 ALA n 
2  112 CYS n 
2  113 TRP n 
2  114 HIS n 
2  115 TRP n 
2  116 VAL n 
2  117 TYR n 
2  118 TRP n 
2  119 ASP n 
2  120 LEU n 
2  121 GLU n 
2  122 LEU n 
2  123 PHE n 
2  124 ARG n 
2  125 ASP n 
2  126 PRO n 
2  127 ARG n 
2  128 THR n 
2  129 GLY n 
2  130 GLU n 
2  131 PRO n 
2  132 ALA n 
2  133 LEU n 
2  134 ASP n 
2  135 LEU n 
2  136 PRO n 
2  137 LYS n 
2  138 MET n 
2  139 PHE n 
2  140 GLY n 
2  141 ILE n 
2  142 HIS n 
2  143 LEU n 
2  144 PHE n 
2  145 LEU n 
2  146 ALA n 
2  147 GLY n 
2  148 LEU n 
2  149 LEU n 
2  150 CYS n 
2  151 PHE n 
2  152 GLY n 
2  153 PHE n 
2  154 GLY n 
2  155 ALA n 
2  156 PHE n 
2  157 HIS n 
2  158 LEU n 
2  159 THR n 
2  160 GLY n 
2  161 LEU n 
2  162 PHE n 
2  163 GLY n 
2  164 PRO n 
2  165 GLY n 
2  166 MET n 
2  167 TRP n 
2  168 VAL n 
2  169 SER n 
2  170 ASP n 
2  171 PRO n 
2  172 TYR n 
2  173 GLY n 
2  174 LEU n 
2  175 THR n 
2  176 GLY n 
2  177 SER n 
2  178 VAL n 
2  179 GLN n 
2  180 PRO n 
2  181 VAL n 
2  182 ALA n 
2  183 PRO n 
2  184 GLU n 
2  185 TRP n 
2  186 GLY n 
2  187 PRO n 
2  188 ASP n 
2  189 GLY n 
2  190 PHE n 
2  191 ASN n 
2  192 PRO n 
2  193 TYR n 
2  194 ASN n 
2  195 PRO n 
2  196 GLY n 
2  197 GLY n 
2  198 VAL n 
2  199 VAL n 
2  200 ALA n 
2  201 HIS n 
2  202 HIS n 
2  203 ILE n 
2  204 ALA n 
2  205 ALA n 
2  206 GLY n 
2  207 ILE n 
2  208 VAL n 
2  209 GLY n 
2  210 ILE n 
2  211 ILE n 
2  212 ALA n 
2  213 GLY n 
2  214 LEU n 
2  215 PHE n 
2  216 HIS n 
2  217 ILE n 
2  218 LEU n 
2  219 VAL n 
2  220 ARG n 
2  221 PRO n 
2  222 PRO n 
2  223 GLN n 
2  224 ARG n 
2  225 LEU n 
2  226 TYR n 
2  227 LYS n 
2  228 ALA n 
2  229 LEU n 
2  230 ARG n 
2  231 MET n 
2  232 GLY n 
2  233 ASN n 
2  234 ILE n 
2  235 GLU n 
2  236 THR n 
2  237 VAL n 
2  238 LEU n 
2  239 SER n 
2  240 SER n 
2  241 SER n 
2  242 ILE n 
2  243 ALA n 
2  244 ALA n 
2  245 VAL n 
2  246 PHE n 
2  247 PHE n 
2  248 ALA n 
2  249 ALA n 
2  250 PHE n 
2  251 VAL n 
2  252 VAL n 
2  253 ALA n 
2  254 GLY n 
2  255 THR n 
2  256 MET n 
2  257 TRP n 
2  258 TYR n 
2  259 GLY n 
2  260 SER n 
2  261 ALA n 
2  262 THR n 
2  263 THR n 
2  264 PRO n 
2  265 ILE n 
2  266 GLU n 
2  267 LEU n 
2  268 PHE n 
2  269 GLY n 
2  270 PRO n 
2  271 THR n 
2  272 ARG n 
2  273 TYR n 
2  274 GLN n 
2  275 TRP n 
2  276 ASP n 
2  277 SER n 
2  278 SER n 
2  279 TYR n 
2  280 PHE n 
2  281 GLN n 
2  282 GLN n 
2  283 GLU n 
2  284 ILE n 
2  285 ASN n 
2  286 ARG n 
2  287 ARG n 
2  288 VAL n 
2  289 GLN n 
2  290 ALA n 
2  291 SER n 
2  292 LEU n 
2  293 ALA n 
2  294 SER n 
2  295 GLY n 
2  296 ALA n 
2  297 THR n 
2  298 LEU n 
2  299 GLU n 
2  300 GLU n 
2  301 ALA n 
2  302 TRP n 
2  303 SER n 
2  304 ALA n 
2  305 ILE n 
2  306 PRO n 
2  307 GLU n 
2  308 LYS n 
2  309 LEU n 
2  310 ALA n 
2  311 PHE n 
2  312 TYR n 
2  313 ASP n 
2  314 TYR n 
2  315 ILE n 
2  316 GLY n 
2  317 ASN n 
2  318 ASN n 
2  319 PRO n 
2  320 ALA n 
2  321 LYS n 
2  322 GLY n 
2  323 GLY n 
2  324 LEU n 
2  325 PHE n 
2  326 ARG n 
2  327 THR n 
2  328 GLY n 
2  329 PRO n 
2  330 MET n 
2  331 ASN n 
2  332 LYS n 
2  333 GLY n 
2  334 ASP n 
2  335 GLY n 
2  336 ILE n 
2  337 ALA n 
2  338 GLN n 
2  339 ALA n 
2  340 TRP n 
2  341 LYS n 
2  342 GLY n 
2  343 HIS n 
2  344 ALA n 
2  345 VAL n 
2  346 PHE n 
2  347 ARG n 
2  348 ASN n 
2  349 LYS n 
2  350 GLU n 
2  351 GLY n 
2  352 GLU n 
2  353 GLU n 
2  354 LEU n 
2  355 PHE n 
2  356 VAL n 
2  357 ARG n 
2  358 ARG n 
2  359 MET n 
2  360 PRO n 
2  361 ALA n 
2  362 PHE n 
2  363 PHE n 
2  364 GLU n 
2  365 SER n 
2  366 PHE n 
2  367 PRO n 
2  368 VAL n 
2  369 ILE n 
2  370 LEU n 
2  371 THR n 
2  372 ASP n 
2  373 LYS n 
2  374 ASN n 
2  375 GLY n 
2  376 VAL n 
2  377 VAL n 
2  378 LYS n 
2  379 ALA n 
2  380 ASP n 
2  381 ILE n 
2  382 PRO n 
2  383 PHE n 
2  384 ARG n 
2  385 ARG n 
2  386 ALA n 
2  387 GLU n 
2  388 SER n 
2  389 LYS n 
2  390 TYR n 
2  391 SER n 
2  392 PHE n 
2  393 GLU n 
2  394 GLN n 
2  395 GLN n 
2  396 GLY n 
2  397 VAL n 
2  398 THR n 
2  399 VAL n 
2  400 SER n 
2  401 PHE n 
2  402 TYR n 
2  403 GLY n 
2  404 GLY n 
2  405 GLU n 
2  406 LEU n 
2  407 ASN n 
2  408 GLY n 
2  409 GLN n 
2  410 THR n 
2  411 PHE n 
2  412 THR n 
2  413 ASP n 
2  414 PRO n 
2  415 PRO n 
2  416 THR n 
2  417 VAL n 
2  418 LYS n 
2  419 SER n 
2  420 TYR n 
2  421 ALA n 
2  422 ARG n 
2  423 LYS n 
2  424 ALA n 
2  425 ILE n 
2  426 PHE n 
2  427 GLY n 
2  428 GLU n 
2  429 ILE n 
2  430 PHE n 
2  431 GLU n 
2  432 PHE n 
2  433 ASP n 
2  434 THR n 
2  435 GLU n 
2  436 THR n 
2  437 LEU n 
2  438 ASN n 
2  439 SER n 
2  440 ASP n 
2  441 GLY n 
2  442 ILE n 
2  443 PHE n 
2  444 ARG n 
2  445 THR n 
2  446 SER n 
2  447 PRO n 
2  448 ARG n 
2  449 GLY n 
2  450 TRP n 
2  451 PHE n 
2  452 THR n 
2  453 PHE n 
2  454 ALA n 
2  455 HIS n 
2  456 ALA n 
2  457 VAL n 
2  458 PHE n 
2  459 ALA n 
2  460 LEU n 
2  461 LEU n 
2  462 PHE n 
2  463 PHE n 
2  464 PHE n 
2  465 GLY n 
2  466 HIS n 
2  467 ILE n 
2  468 TRP n 
2  469 HIS n 
2  470 GLY n 
2  471 ALA n 
2  472 ARG n 
2  473 THR n 
2  474 LEU n 
2  475 PHE n 
2  476 ARG n 
2  477 ASP n 
2  478 VAL n 
2  479 PHE n 
2  480 SER n 
2  481 GLY n 
2  482 ILE n 
2  483 ASP n 
2  484 PRO n 
2  485 GLU n 
2  486 LEU n 
2  487 SER n 
2  488 PRO n 
2  489 GLU n 
2  490 GLN n 
2  491 VAL n 
2  492 GLU n 
2  493 TRP n 
2  494 GLY n 
2  495 PHE n 
2  496 TYR n 
2  497 GLN n 
2  498 LYS n 
2  499 VAL n 
2  500 GLY n 
2  501 ASP n 
2  502 VAL n 
2  503 THR n 
2  504 THR n 
2  505 ARG n 
2  506 ARG n 
2  507 LYS n 
2  508 GLU n 
2  509 ALA n 
2  510 VAL n 
3  1   MET n 
3  2   LYS n 
3  3   THR n 
3  4   LEU n 
3  5   SER n 
3  6   SER n 
3  7   GLN n 
3  8   LYS n 
3  9   ARG n 
3  10  TYR n 
3  11  SER n 
3  12  PRO n 
3  13  VAL n 
3  14  VAL n 
3  15  THR n 
3  16  LEU n 
3  17  SER n 
3  18  SER n 
3  19  ASN n 
3  20  SER n 
3  21  ILE n 
3  22  PHE n 
3  23  ALA n 
3  24  THR n 
3  25  ASN n 
3  26  ARG n 
3  27  ASP n 
3  28  GLN n 
3  29  GLU n 
3  30  SER n 
3  31  SER n 
3  32  GLY n 
3  33  PHE n 
3  34  ALA n 
3  35  TRP n 
3  36  TRP n 
3  37  ALA n 
3  38  GLY n 
3  39  ASN n 
3  40  ALA n 
3  41  ARG n 
3  42  LEU n 
3  43  ILE n 
3  44  ASN n 
3  45  LEU n 
3  46  SER n 
3  47  GLY n 
3  48  LYS n 
3  49  LEU n 
3  50  LEU n 
3  51  GLY n 
3  52  ALA n 
3  53  HIS n 
3  54  VAL n 
3  55  ALA n 
3  56  HIS n 
3  57  ALA n 
3  58  GLY n 
3  59  LEU n 
3  60  ILE n 
3  61  VAL n 
3  62  PHE n 
3  63  TRP n 
3  64  ALA n 
3  65  GLY n 
3  66  ALA n 
3  67  MET n 
3  68  THR n 
3  69  LEU n 
3  70  PHE n 
3  71  GLU n 
3  72  LEU n 
3  73  ALA n 
3  74  HIS n 
3  75  PHE n 
3  76  ILE n 
3  77  PRO n 
3  78  GLU n 
3  79  LYS n 
3  80  PRO n 
3  81  MET n 
3  82  TYR n 
3  83  GLU n 
3  84  GLN n 
3  85  GLY n 
3  86  LEU n 
3  87  ILE n 
3  88  LEU n 
3  89  ILE n 
3  90  PRO n 
3  91  HIS n 
3  92  ILE n 
3  93  ALA n 
3  94  THR n 
3  95  LEU n 
3  96  GLY n 
3  97  TRP n 
3  98  GLY n 
3  99  VAL n 
3  100 GLY n 
3  101 PRO n 
3  102 GLY n 
3  103 GLY n 
3  104 GLU n 
3  105 VAL n 
3  106 VAL n 
3  107 ASP n 
3  108 THR n 
3  109 PHE n 
3  110 PRO n 
3  111 PHE n 
3  112 PHE n 
3  113 VAL n 
3  114 VAL n 
3  115 GLY n 
3  116 VAL n 
3  117 VAL n 
3  118 HIS n 
3  119 LEU n 
3  120 ILE n 
3  121 SER n 
3  122 SER n 
3  123 ALA n 
3  124 VAL n 
3  125 LEU n 
3  126 GLY n 
3  127 PHE n 
3  128 GLY n 
3  129 GLY n 
3  130 VAL n 
3  131 TYR n 
3  132 HIS n 
3  133 ALA n 
3  134 ILE n 
3  135 ARG n 
3  136 GLY n 
3  137 PRO n 
3  138 GLU n 
3  139 THR n 
3  140 LEU n 
3  141 GLU n 
3  142 GLU n 
3  143 TYR n 
3  144 SER n 
3  145 SER n 
3  146 PHE n 
3  147 PHE n 
3  148 GLY n 
3  149 TYR n 
3  150 ASP n 
3  151 TRP n 
3  152 LYS n 
3  153 ASP n 
3  154 LYS n 
3  155 ASN n 
3  156 LYS n 
3  157 MET n 
3  158 THR n 
3  159 THR n 
3  160 ILE n 
3  161 LEU n 
3  162 GLY n 
3  163 PHE n 
3  164 HIS n 
3  165 LEU n 
3  166 ILE n 
3  167 VAL n 
3  168 LEU n 
3  169 GLY n 
3  170 ILE n 
3  171 GLY n 
3  172 ALA n 
3  173 LEU n 
3  174 LEU n 
3  175 LEU n 
3  176 VAL n 
3  177 ALA n 
3  178 LYS n 
3  179 ALA n 
3  180 MET n 
3  181 PHE n 
3  182 PHE n 
3  183 GLY n 
3  184 GLY n 
3  185 LEU n 
3  186 TYR n 
3  187 ASP n 
3  188 THR n 
3  189 TRP n 
3  190 ALA n 
3  191 PRO n 
3  192 GLY n 
3  193 GLY n 
3  194 GLY n 
3  195 ASP n 
3  196 VAL n 
3  197 ARG n 
3  198 VAL n 
3  199 ILE n 
3  200 THR n 
3  201 ASN n 
3  202 PRO n 
3  203 THR n 
3  204 LEU n 
3  205 ASP n 
3  206 PRO n 
3  207 ARG n 
3  208 VAL n 
3  209 ILE n 
3  210 PHE n 
3  211 GLY n 
3  212 TYR n 
3  213 LEU n 
3  214 LEU n 
3  215 LYS n 
3  216 SER n 
3  217 PRO n 
3  218 PHE n 
3  219 GLY n 
3  220 GLY n 
3  221 GLU n 
3  222 GLY n 
3  223 TRP n 
3  224 ILE n 
3  225 VAL n 
3  226 SER n 
3  227 VAL n 
3  228 ASN n 
3  229 ASN n 
3  230 LEU n 
3  231 GLU n 
3  232 ASP n 
3  233 VAL n 
3  234 VAL n 
3  235 GLY n 
3  236 GLY n 
3  237 HIS n 
3  238 ILE n 
3  239 TRP n 
3  240 ILE n 
3  241 GLY n 
3  242 LEU n 
3  243 ILE n 
3  244 CYS n 
3  245 ILE n 
3  246 ALA n 
3  247 GLY n 
3  248 GLY n 
3  249 ILE n 
3  250 TRP n 
3  251 HIS n 
3  252 ILE n 
3  253 LEU n 
3  254 THR n 
3  255 THR n 
3  256 PRO n 
3  257 PHE n 
3  258 GLY n 
3  259 TRP n 
3  260 ALA n 
3  261 ARG n 
3  262 ARG n 
3  263 ALA n 
3  264 PHE n 
3  265 ILE n 
3  266 TRP n 
3  267 SER n 
3  268 GLY n 
3  269 GLU n 
3  270 ALA n 
3  271 TYR n 
3  272 LEU n 
3  273 SER n 
3  274 TYR n 
3  275 SER n 
3  276 LEU n 
3  277 GLY n 
3  278 ALA n 
3  279 LEU n 
3  280 SER n 
3  281 MET n 
3  282 MET n 
3  283 GLY n 
3  284 PHE n 
3  285 ILE n 
3  286 ALA n 
3  287 THR n 
3  288 CYS n 
3  289 PHE n 
3  290 VAL n 
3  291 TRP n 
3  292 PHE n 
3  293 ASN n 
3  294 ASN n 
3  295 THR n 
3  296 VAL n 
3  297 TYR n 
3  298 PRO n 
3  299 SER n 
3  300 GLU n 
3  301 PHE n 
3  302 TYR n 
3  303 GLY n 
3  304 PRO n 
3  305 THR n 
3  306 GLY n 
3  307 PRO n 
3  308 GLU n 
3  309 ALA n 
3  310 SER n 
3  311 GLN n 
3  312 ALA n 
3  313 GLN n 
3  314 ALA n 
3  315 MET n 
3  316 THR n 
3  317 PHE n 
3  318 LEU n 
3  319 ILE n 
3  320 ARG n 
3  321 ASP n 
3  322 GLN n 
3  323 LYS n 
3  324 LEU n 
3  325 GLY n 
3  326 ALA n 
3  327 ASN n 
3  328 VAL n 
3  329 GLY n 
3  330 SER n 
3  331 ALA n 
3  332 GLN n 
3  333 GLY n 
3  334 PRO n 
3  335 THR n 
3  336 GLY n 
3  337 LEU n 
3  338 GLY n 
3  339 LYS n 
3  340 TYR n 
3  341 LEU n 
3  342 MET n 
3  343 ARG n 
3  344 SER n 
3  345 PRO n 
3  346 THR n 
3  347 GLY n 
3  348 GLU n 
3  349 ILE n 
3  350 ILE n 
3  351 PHE n 
3  352 GLY n 
3  353 GLY n 
3  354 GLU n 
3  355 THR n 
3  356 MET n 
3  357 ARG n 
3  358 PHE n 
3  359 TRP n 
3  360 ASP n 
3  361 PHE n 
3  362 ARG n 
3  363 GLY n 
3  364 PRO n 
3  365 TRP n 
3  366 LEU n 
3  367 GLU n 
3  368 PRO n 
3  369 LEU n 
3  370 ARG n 
3  371 GLY n 
3  372 PRO n 
3  373 ASN n 
3  374 GLY n 
3  375 LEU n 
3  376 ASP n 
3  377 LEU n 
3  378 ASN n 
3  379 LYS n 
3  380 ILE n 
3  381 LYS n 
3  382 ASN n 
3  383 ASP n 
3  384 ILE n 
3  385 GLN n 
3  386 PRO n 
3  387 TRP n 
3  388 GLN n 
3  389 GLU n 
3  390 ARG n 
3  391 ARG n 
3  392 ALA n 
3  393 ALA n 
3  394 GLU n 
3  395 TYR n 
3  396 MET n 
3  397 THR n 
3  398 HIS n 
3  399 ALA n 
3  400 PRO n 
3  401 LEU n 
3  402 GLY n 
3  403 SER n 
3  404 LEU n 
3  405 ASN n 
3  406 SER n 
3  407 VAL n 
3  408 GLY n 
3  409 GLY n 
3  410 VAL n 
3  411 ALA n 
3  412 THR n 
3  413 GLU n 
3  414 ILE n 
3  415 ASN n 
3  416 SER n 
3  417 VAL n 
3  418 ASN n 
3  419 PHE n 
3  420 VAL n 
3  421 SER n 
3  422 PRO n 
3  423 ARG n 
3  424 SER n 
3  425 TRP n 
3  426 LEU n 
3  427 ALA n 
3  428 THR n 
3  429 SER n 
3  430 HIS n 
3  431 PHE n 
3  432 VAL n 
3  433 LEU n 
3  434 ALA n 
3  435 PHE n 
3  436 PHE n 
3  437 PHE n 
3  438 LEU n 
3  439 VAL n 
3  440 GLY n 
3  441 HIS n 
3  442 LEU n 
3  443 TRP n 
3  444 HIS n 
3  445 ALA n 
3  446 GLY n 
3  447 ARG n 
3  448 ALA n 
3  449 ARG n 
3  450 ALA n 
3  451 ALA n 
3  452 ALA n 
3  453 ALA n 
3  454 GLY n 
3  455 PHE n 
3  456 GLU n 
3  457 LYS n 
3  458 GLY n 
3  459 ILE n 
3  460 ASP n 
3  461 ARG n 
3  462 GLU n 
3  463 SER n 
3  464 GLU n 
3  465 PRO n 
3  466 VAL n 
3  467 LEU n 
3  468 SER n 
3  469 MET n 
3  470 PRO n 
3  471 SER n 
3  472 LEU n 
3  473 ASP n 
4  1   MET n 
4  2   THR n 
4  3   ILE n 
4  4   ALA n 
4  5   ILE n 
4  6   GLY n 
4  7   ARG n 
4  8   ALA n 
4  9   PRO n 
4  10  ALA n 
4  11  GLU n 
4  12  ARG n 
4  13  GLY n 
4  14  TRP n 
4  15  PHE n 
4  16  ASP n 
4  17  ILE n 
4  18  LEU n 
4  19  ASP n 
4  20  ASP n 
4  21  TRP n 
4  22  LEU n 
4  23  LYS n 
4  24  ARG n 
4  25  ASP n 
4  26  ARG n 
4  27  PHE n 
4  28  VAL n 
4  29  PHE n 
4  30  VAL n 
4  31  GLY n 
4  32  TRP n 
4  33  SER n 
4  34  GLY n 
4  35  ILE n 
4  36  LEU n 
4  37  LEU n 
4  38  PHE n 
4  39  PRO n 
4  40  CYS n 
4  41  ALA n 
4  42  TYR n 
4  43  LEU n 
4  44  ALA n 
4  45  LEU n 
4  46  GLY n 
4  47  GLY n 
4  48  TRP n 
4  49  LEU n 
4  50  THR n 
4  51  GLY n 
4  52  THR n 
4  53  THR n 
4  54  PHE n 
4  55  VAL n 
4  56  THR n 
4  57  SER n 
4  58  TRP n 
4  59  TYR n 
4  60  THR n 
4  61  HIS n 
4  62  GLY n 
4  63  LEU n 
4  64  ALA n 
4  65  SER n 
4  66  SER n 
4  67  TYR n 
4  68  LEU n 
4  69  GLU n 
4  70  GLY n 
4  71  CYS n 
4  72  ASN n 
4  73  PHE n 
4  74  LEU n 
4  75  THR n 
4  76  VAL n 
4  77  ALA n 
4  78  VAL n 
4  79  SER n 
4  80  THR n 
4  81  PRO n 
4  82  ALA n 
4  83  ASN n 
4  84  SER n 
4  85  MET n 
4  86  GLY n 
4  87  HIS n 
4  88  SER n 
4  89  LEU n 
4  90  LEU n 
4  91  LEU n 
4  92  LEU n 
4  93  TRP n 
4  94  GLY n 
4  95  PRO n 
4  96  GLU n 
4  97  ALA n 
4  98  GLN n 
4  99  GLY n 
4  100 ASP n 
4  101 PHE n 
4  102 THR n 
4  103 ARG n 
4  104 TRP n 
4  105 CYS n 
4  106 GLN n 
4  107 LEU n 
4  108 GLY n 
4  109 GLY n 
4  110 LEU n 
4  111 TRP n 
4  112 THR n 
4  113 PHE n 
4  114 ILE n 
4  115 ALA n 
4  116 LEU n 
4  117 HIS n 
4  118 GLY n 
4  119 ALA n 
4  120 PHE n 
4  121 GLY n 
4  122 LEU n 
4  123 ILE n 
4  124 GLY n 
4  125 PHE n 
4  126 MET n 
4  127 LEU n 
4  128 ARG n 
4  129 GLN n 
4  130 PHE n 
4  131 GLU n 
4  132 ILE n 
4  133 ALA n 
4  134 ARG n 
4  135 LEU n 
4  136 VAL n 
4  137 GLY n 
4  138 VAL n 
4  139 ARG n 
4  140 PRO n 
4  141 TYR n 
4  142 ASN n 
4  143 ALA n 
4  144 ILE n 
4  145 ALA n 
4  146 PHE n 
4  147 SER n 
4  148 ALA n 
4  149 PRO n 
4  150 ILE n 
4  151 ALA n 
4  152 VAL n 
4  153 PHE n 
4  154 VAL n 
4  155 SER n 
4  156 VAL n 
4  157 PHE n 
4  158 LEU n 
4  159 ILE n 
4  160 TYR n 
4  161 PRO n 
4  162 LEU n 
4  163 GLY n 
4  164 GLN n 
4  165 SER n 
4  166 SER n 
4  167 TRP n 
4  168 PHE n 
4  169 PHE n 
4  170 ALA n 
4  171 PRO n 
4  172 SER n 
4  173 PHE n 
4  174 GLY n 
4  175 VAL n 
4  176 ALA n 
4  177 ALA n 
4  178 ILE n 
4  179 PHE n 
4  180 ARG n 
4  181 PHE n 
4  182 LEU n 
4  183 LEU n 
4  184 PHE n 
4  185 PHE n 
4  186 GLN n 
4  187 GLY n 
4  188 PHE n 
4  189 HIS n 
4  190 ASN n 
4  191 TRP n 
4  192 THR n 
4  193 LEU n 
4  194 ASN n 
4  195 PRO n 
4  196 PHE n 
4  197 HIS n 
4  198 MET n 
4  199 MET n 
4  200 GLY n 
4  201 VAL n 
4  202 ALA n 
4  203 GLY n 
4  204 VAL n 
4  205 LEU n 
4  206 GLY n 
4  207 GLY n 
4  208 ALA n 
4  209 LEU n 
4  210 LEU n 
4  211 CYS n 
4  212 ALA n 
4  213 ILE n 
4  214 HIS n 
4  215 GLY n 
4  216 ALA n 
4  217 THR n 
4  218 VAL n 
4  219 GLU n 
4  220 ASN n 
4  221 THR n 
4  222 LEU n 
4  223 PHE n 
4  224 GLN n 
4  225 ASP n 
4  226 GLY n 
4  227 GLU n 
4  228 GLY n 
4  229 ALA n 
4  230 SER n 
4  231 THR n 
4  232 PHE n 
4  233 ARG n 
4  234 ALA n 
4  235 PHE n 
4  236 ASN n 
4  237 PRO n 
4  238 THR n 
4  239 GLN n 
4  240 ALA n 
4  241 GLU n 
4  242 GLU n 
4  243 THR n 
4  244 TYR n 
4  245 SER n 
4  246 MET n 
4  247 VAL n 
4  248 THR n 
4  249 ALA n 
4  250 ASN n 
4  251 ARG n 
4  252 PHE n 
4  253 TRP n 
4  254 SER n 
4  255 GLN n 
4  256 ILE n 
4  257 PHE n 
4  258 GLY n 
4  259 ILE n 
4  260 ALA n 
4  261 PHE n 
4  262 SER n 
4  263 ASN n 
4  264 LYS n 
4  265 ARG n 
4  266 TRP n 
4  267 LEU n 
4  268 HIS n 
4  269 PHE n 
4  270 PHE n 
4  271 MET n 
4  272 LEU n 
4  273 PHE n 
4  274 VAL n 
4  275 PRO n 
4  276 VAL n 
4  277 THR n 
4  278 GLY n 
4  279 LEU n 
4  280 TRP n 
4  281 MET n 
4  282 SER n 
4  283 ALA n 
4  284 ILE n 
4  285 GLY n 
4  286 VAL n 
4  287 VAL n 
4  288 GLY n 
4  289 LEU n 
4  290 ALA n 
4  291 LEU n 
4  292 ASN n 
4  293 LEU n 
4  294 ARG n 
4  295 SER n 
4  296 TYR n 
4  297 ASP n 
4  298 PHE n 
4  299 ILE n 
4  300 SER n 
4  301 GLN n 
4  302 GLU n 
4  303 ILE n 
4  304 ARG n 
4  305 ALA n 
4  306 ALA n 
4  307 GLU n 
4  308 ASP n 
4  309 PRO n 
4  310 GLU n 
4  311 PHE n 
4  312 GLU n 
4  313 THR n 
4  314 PHE n 
4  315 TYR n 
4  316 THR n 
4  317 LYS n 
4  318 ASN n 
4  319 LEU n 
4  320 LEU n 
4  321 LEU n 
4  322 ASN n 
4  323 GLU n 
4  324 GLY n 
4  325 ILE n 
4  326 ARG n 
4  327 ALA n 
4  328 TRP n 
4  329 MET n 
4  330 ALA n 
4  331 PRO n 
4  332 GLN n 
4  333 ASP n 
4  334 GLN n 
4  335 PRO n 
4  336 HIS n 
4  337 GLU n 
4  338 ASN n 
4  339 PHE n 
4  340 VAL n 
4  341 PHE n 
4  342 PRO n 
4  343 GLU n 
4  344 GLU n 
4  345 VAL n 
4  346 LEU n 
4  347 PRO n 
4  348 ARG n 
4  349 GLY n 
4  350 ASN n 
4  351 ALA n 
4  352 LEU n 
5  1   MET n 
5  2   ALA n 
5  3   GLY n 
5  4   THR n 
5  5   THR n 
5  6   GLY n 
5  7   GLU n 
5  8   ARG n 
5  9   PRO n 
5  10  PHE n 
5  11  SER n 
5  12  ASP n 
5  13  ILE n 
5  14  ILE n 
5  15  THR n 
5  16  SER n 
5  17  VAL n 
5  18  ARG n 
5  19  TYR n 
5  20  TRP n 
5  21  VAL n 
5  22  ILE n 
5  23  HIS n 
5  24  SER n 
5  25  ILE n 
5  26  THR n 
5  27  ILE n 
5  28  PRO n 
5  29  ALA n 
5  30  LEU n 
5  31  PHE n 
5  32  ILE n 
5  33  ALA n 
5  34  GLY n 
5  35  TRP n 
5  36  LEU n 
5  37  PHE n 
5  38  VAL n 
5  39  SER n 
5  40  THR n 
5  41  GLY n 
5  42  LEU n 
5  43  ALA n 
5  44  TYR n 
5  45  ASP n 
5  46  VAL n 
5  47  PHE n 
5  48  GLY n 
5  49  THR n 
5  50  PRO n 
5  51  ARG n 
5  52  PRO n 
5  53  ASP n 
5  54  SER n 
5  55  TYR n 
5  56  TYR n 
5  57  ALA n 
5  58  GLN n 
5  59  GLU n 
5  60  GLN n 
5  61  ARG n 
5  62  SER n 
5  63  ILE n 
5  64  PRO n 
5  65  LEU n 
5  66  VAL n 
5  67  THR n 
5  68  ASP n 
5  69  ARG n 
5  70  PHE n 
5  71  GLU n 
5  72  ALA n 
5  73  LYS n 
5  74  GLN n 
5  75  GLN n 
5  76  VAL n 
5  77  GLU n 
5  78  THR n 
5  79  PHE n 
5  80  LEU n 
5  81  GLU n 
5  82  GLN n 
5  83  LEU n 
5  84  LYS n 
6  1   MET n 
6  2   THR n 
6  3   SER n 
6  4   ASN n 
6  5   THR n 
6  6   PRO n 
6  7   ASN n 
6  8   GLN n 
6  9   GLU n 
6  10  PRO n 
6  11  VAL n 
6  12  SER n 
6  13  TYR n 
6  14  PRO n 
6  15  ILE n 
6  16  PHE n 
6  17  THR n 
6  18  VAL n 
6  19  ARG n 
6  20  TRP n 
6  21  VAL n 
6  22  ALA n 
6  23  VAL n 
6  24  HIS n 
6  25  THR n 
6  26  LEU n 
6  27  ALA n 
6  28  VAL n 
6  29  PRO n 
6  30  THR n 
6  31  ILE n 
6  32  PHE n 
6  33  PHE n 
6  34  LEU n 
6  35  GLY n 
6  36  ALA n 
6  37  ILE n 
6  38  ALA n 
6  39  ALA n 
6  40  MET n 
6  41  GLN n 
6  42  PHE n 
6  43  ILE n 
6  44  GLN n 
6  45  ARG n 
7  1   MET n 
7  2   ALA n 
7  3   ARG n 
7  4   ARG n 
7  5   THR n 
7  6   TRP n 
7  7   LEU n 
7  8   GLY n 
7  9   ASP n 
7  10  ILE n 
7  11  LEU n 
7  12  ARG n 
7  13  PRO n 
7  14  LEU n 
7  15  ASN n 
7  16  SER n 
7  17  GLU n 
7  18  TYR n 
7  19  GLY n 
7  20  LYS n 
7  21  VAL n 
7  22  ALA n 
7  23  PRO n 
7  24  GLY n 
7  25  TRP n 
7  26  GLY n 
7  27  THR n 
7  28  THR n 
7  29  PRO n 
7  30  LEU n 
7  31  MET n 
7  32  ALA n 
7  33  VAL n 
7  34  PHE n 
7  35  MET n 
7  36  GLY n 
7  37  LEU n 
7  38  PHE n 
7  39  LEU n 
7  40  VAL n 
7  41  PHE n 
7  42  LEU n 
7  43  LEU n 
7  44  ILE n 
7  45  ILE n 
7  46  LEU n 
7  47  GLU n 
7  48  ILE n 
7  49  TYR n 
7  50  ASN n 
7  51  SER n 
7  52  THR n 
7  53  LEU n 
7  54  ILE n 
7  55  LEU n 
7  56  ASP n 
7  57  GLY n 
7  58  VAL n 
7  59  ASN n 
7  60  VAL n 
7  61  SER n 
7  62  TRP n 
7  63  LYS n 
7  64  ALA n 
7  65  LEU n 
7  66  GLY n 
8  1   MET n 
8  2   GLU n 
8  3   THR n 
8  4   LEU n 
8  5   LYS n 
8  6   ILE n 
8  7   THR n 
8  8   VAL n 
8  9   TYR n 
8  10  ILE n 
8  11  VAL n 
8  12  VAL n 
8  13  THR n 
8  14  PHE n 
8  15  PHE n 
8  16  VAL n 
8  17  LEU n 
8  18  LEU n 
8  19  PHE n 
8  20  VAL n 
8  21  PHE n 
8  22  GLY n 
8  23  PHE n 
8  24  LEU n 
8  25  SER n 
8  26  GLY n 
8  27  ASP n 
8  28  PRO n 
8  29  ALA n 
8  30  ARG n 
8  31  ASN n 
8  32  PRO n 
8  33  LYS n 
8  34  ARG n 
8  35  LYS n 
8  36  ASP n 
8  37  LEU n 
8  38  GLU n 
9  1   MET n 
9  2   MET n 
9  3   SER n 
9  4   GLU n 
9  5   GLY n 
9  6   GLY n 
9  7   ARG n 
9  8   ILE n 
9  9   PRO n 
9  10  LEU n 
9  11  TRP n 
9  12  ILE n 
9  13  VAL n 
9  14  ALA n 
9  15  THR n 
9  16  VAL n 
9  17  ALA n 
9  18  GLY n 
9  19  MET n 
9  20  GLY n 
9  21  VAL n 
9  22  ILE n 
9  23  VAL n 
9  24  ILE n 
9  25  VAL n 
9  26  GLY n 
9  27  LEU n 
9  28  PHE n 
9  29  PHE n 
9  30  TYR n 
9  31  GLY n 
9  32  ALA n 
9  33  TYR n 
9  34  ALA n 
9  35  GLY n 
9  36  LEU n 
9  37  GLY n 
9  38  SER n 
9  39  SER n 
9  40  LEU n 
10 1   LYS n 
10 2   LEU n 
10 3   PRO n 
10 4   GLU n 
10 5   ALA n 
10 6   TYR n 
10 7   ALA n 
10 8   ILE n 
10 9   PHE n 
10 10  ASP n 
10 11  PRO n 
10 12  LEU n 
10 13  VAL n 
10 14  ASP n 
10 15  VAL n 
10 16  LEU n 
10 17  PRO n 
10 18  VAL n 
10 19  ILE n 
10 20  PRO n 
10 21  VAL n 
10 22  LEU n 
10 23  PHE n 
10 24  LEU n 
10 25  ALA n 
10 26  LEU n 
10 27  ALA n 
10 28  PHE n 
10 29  VAL n 
10 30  TRP n 
10 31  GLN n 
10 32  ALA n 
10 33  ALA n 
10 34  VAL n 
10 35  GLY n 
10 36  PHE n 
10 37  ARG n 
11 1   MET n 
11 2   GLU n 
11 3   PRO n 
11 4   ASN n 
11 5   PRO n 
11 6   ASN n 
11 7   ARG n 
11 8   GLN n 
11 9   PRO n 
11 10  VAL n 
11 11  GLU n 
11 12  LEU n 
11 13  ASN n 
11 14  ARG n 
11 15  THR n 
11 16  SER n 
11 17  LEU n 
11 18  TYR n 
11 19  LEU n 
11 20  GLY n 
11 21  LEU n 
11 22  LEU n 
11 23  LEU n 
11 24  ILE n 
11 25  LEU n 
11 26  VAL n 
11 27  LEU n 
11 28  ALA n 
11 29  LEU n 
11 30  LEU n 
11 31  PHE n 
11 32  SER n 
11 33  SER n 
11 34  TYR n 
11 35  PHE n 
11 36  PHE n 
11 37  ASN n 
12 1   MET n 
12 2   GLU n 
12 3   VAL n 
12 4   ASN n 
12 5   GLN n 
12 6   LEU n 
12 7   GLY n 
12 8   LEU n 
12 9   ILE n 
12 10  ALA n 
12 11  THR n 
12 12  ALA n 
12 13  LEU n 
12 14  PHE n 
12 15  VAL n 
12 16  LEU n 
12 17  VAL n 
12 18  PRO n 
12 19  SER n 
12 20  VAL n 
12 21  PHE n 
12 22  LEU n 
12 23  ILE n 
12 24  ILE n 
12 25  LEU n 
12 26  TYR n 
12 27  VAL n 
12 28  GLN n 
12 29  THR n 
12 30  GLU n 
12 31  SER n 
12 32  GLN n 
12 33  GLN n 
12 34  LYS n 
12 35  SER n 
12 36  SER n 
13 1   ALA n 
13 2   ALA n 
13 3   LYS n 
13 4   GLN n 
13 5   THR n 
13 6   LEU n 
13 7   THR n 
13 8   TYR n 
13 9   ASP n 
13 10  ASP n 
13 11  ILE n 
13 12  VAL n 
13 13  GLY n 
13 14  THR n 
13 15  GLY n 
13 16  LEU n 
13 17  ALA n 
13 18  ASN n 
13 19  LYS n 
13 20  CYS n 
13 21  PRO n 
13 22  THR n 
13 23  LEU n 
13 24  ASP n 
13 25  ASP n 
13 26  THR n 
13 27  ALA n 
13 28  ARG n 
13 29  GLY n 
13 30  ALA n 
13 31  TYR n 
13 32  PRO n 
13 33  ILE n 
13 34  ASP n 
13 35  SER n 
13 36  SER n 
13 37  GLN n 
13 38  THR n 
13 39  TYR n 
13 40  ARG n 
13 41  ILE n 
13 42  ALA n 
13 43  ARG n 
13 44  LEU n 
13 45  CYS n 
13 46  LEU n 
13 47  GLN n 
13 48  PRO n 
13 49  THR n 
13 50  THR n 
13 51  PHE n 
13 52  LEU n 
13 53  VAL n 
13 54  LYS n 
13 55  GLU n 
13 56  GLU n 
13 57  PRO n 
13 58  LYS n 
13 59  ASN n 
13 60  LYS n 
13 61  ARG n 
13 62  GLN n 
13 63  GLU n 
13 64  ALA n 
13 65  GLU n 
13 66  PHE n 
13 67  VAL n 
13 68  PRO n 
13 69  THR n 
13 70  LYS n 
13 71  LEU n 
13 72  VAL n 
13 73  THR n 
13 74  ARG n 
13 75  GLU n 
13 76  THR n 
13 77  THR n 
13 78  SER n 
13 79  LEU n 
13 80  ASP n 
13 81  GLN n 
13 82  ILE n 
13 83  GLN n 
13 84  GLY n 
13 85  GLU n 
13 86  LEU n 
13 87  LYS n 
13 88  VAL n 
13 89  ASN n 
13 90  SER n 
13 91  ASP n 
13 92  GLY n 
13 93  SER n 
13 94  LEU n 
13 95  THR n 
13 96  PHE n 
13 97  VAL n 
13 98  GLU n 
13 99  GLU n 
13 100 ASP n 
13 101 GLY n 
13 102 ILE n 
13 103 ASP n 
13 104 PHE n 
13 105 GLN n 
13 106 PRO n 
13 107 VAL n 
13 108 THR n 
13 109 VAL n 
13 110 GLN n 
13 111 MET n 
13 112 ALA n 
13 113 GLY n 
13 114 GLY n 
13 115 GLU n 
13 116 ARG n 
13 117 ILE n 
13 118 PRO n 
13 119 LEU n 
13 120 LEU n 
13 121 PHE n 
13 122 THR n 
13 123 VAL n 
13 124 LYS n 
13 125 ASN n 
13 126 LEU n 
13 127 VAL n 
13 128 ALA n 
13 129 SER n 
13 130 THR n 
13 131 GLN n 
13 132 PRO n 
13 133 ASN n 
13 134 VAL n 
13 135 THR n 
13 136 SER n 
13 137 ILE n 
13 138 THR n 
13 139 THR n 
13 140 SER n 
13 141 THR n 
13 142 ASP n 
13 143 PHE n 
13 144 LYS n 
13 145 GLY n 
13 146 GLU n 
13 147 PHE n 
13 148 ASN n 
13 149 VAL n 
13 150 PRO n 
13 151 SER n 
13 152 TYR n 
13 153 ARG n 
13 154 THR n 
13 155 ALA n 
13 156 ASN n 
13 157 PHE n 
13 158 LEU n 
13 159 ASP n 
13 160 PRO n 
13 161 LYS n 
13 162 GLY n 
13 163 ARG n 
13 164 GLY n 
13 165 LEU n 
13 166 ALA n 
13 167 SER n 
13 168 GLY n 
13 169 TYR n 
13 170 ASP n 
13 171 SER n 
13 172 ALA n 
13 173 ILE n 
13 174 ALA n 
13 175 LEU n 
13 176 PRO n 
13 177 GLN n 
13 178 ALA n 
13 179 LYS n 
13 180 GLU n 
13 181 GLU n 
13 182 GLU n 
13 183 LEU n 
13 184 ALA n 
13 185 ARG n 
13 186 ALA n 
13 187 ASN n 
13 188 VAL n 
13 189 LYS n 
13 190 ARG n 
13 191 PHE n 
13 192 SER n 
13 193 LEU n 
13 194 THR n 
13 195 LYS n 
13 196 GLY n 
13 197 GLN n 
13 198 ILE n 
13 199 SER n 
13 200 LEU n 
13 201 ASN n 
13 202 VAL n 
13 203 ALA n 
13 204 LYS n 
13 205 VAL n 
13 206 ASP n 
13 207 GLY n 
13 208 ARG n 
13 209 THR n 
13 210 GLY n 
13 211 GLU n 
13 212 ILE n 
13 213 ALA n 
13 214 GLY n 
13 215 THR n 
13 216 PHE n 
13 217 GLU n 
13 218 SER n 
13 219 GLU n 
13 220 GLN n 
13 221 LEU n 
13 222 SER n 
13 223 ASP n 
13 224 ASP n 
13 225 ASP n 
13 226 MET n 
13 227 GLY n 
13 228 ALA n 
13 229 HIS n 
13 230 GLU n 
13 231 PRO n 
13 232 HIS n 
13 233 GLU n 
13 234 VAL n 
13 235 LYS n 
13 236 ILE n 
13 237 GLN n 
13 238 GLY n 
13 239 VAL n 
13 240 PHE n 
13 241 TYR n 
13 242 ALA n 
13 243 SER n 
13 244 ILE n 
13 245 GLU n 
13 246 PRO n 
13 247 ALA n 
14 1   MET n 
14 2   GLU n 
14 3   THR n 
14 4   ILE n 
14 5   THR n 
14 6   TYR n 
14 7   VAL n 
14 8   PHE n 
14 9   ILE n 
14 10  PHE n 
14 11  ALA n 
14 12  CYS n 
14 13  ILE n 
14 14  ILE n 
14 15  ALA n 
14 16  LEU n 
14 17  PHE n 
14 18  PHE n 
14 19  PHE n 
14 20  ALA n 
14 21  ILE n 
14 22  PHE n 
14 23  PHE n 
14 24  ARG n 
14 25  GLU n 
14 26  PRO n 
14 27  PRO n 
14 28  ARG n 
14 29  ILE n 
14 30  THR n 
14 31  LYS n 
14 32  LYS n 
15 1   ALA n 
15 2   THR n 
15 3   ALA n 
15 4   SER n 
15 5   THR n 
15 6   GLU n 
15 7   GLU n 
15 8   GLU n 
15 9   LEU n 
15 10  VAL n 
15 11  ASN n 
15 12  VAL n 
15 13  VAL n 
15 14  ASP n 
15 15  GLU n 
15 16  LYS n 
15 17  LEU n 
15 18  GLY n 
15 19  THR n 
15 20  ALA n 
15 21  TYR n 
15 22  GLY n 
15 23  GLU n 
15 24  LYS n 
15 25  ILE n 
15 26  ASP n 
15 27  LEU n 
15 28  ASN n 
15 29  ASN n 
15 30  THR n 
15 31  ASN n 
15 32  ILE n 
15 33  ALA n 
15 34  ALA n 
15 35  PHE n 
15 36  ILE n 
15 37  GLN n 
15 38  TYR n 
15 39  ARG n 
15 40  GLY n 
15 41  LEU n 
15 42  TYR n 
15 43  PRO n 
15 44  THR n 
15 45  LEU n 
15 46  ALA n 
15 47  LYS n 
15 48  LEU n 
15 49  ILE n 
15 50  VAL n 
15 51  LYS n 
15 52  ASN n 
15 53  ALA n 
15 54  PRO n 
15 55  TYR n 
15 56  GLU n 
15 57  SER n 
15 58  VAL n 
15 59  GLU n 
15 60  ASP n 
15 61  VAL n 
15 62  LEU n 
15 63  ASN n 
15 64  ILE n 
15 65  PRO n 
15 66  GLY n 
15 67  LEU n 
15 68  THR n 
15 69  GLU n 
15 70  ARG n 
15 71  GLN n 
15 72  LYS n 
15 73  GLN n 
15 74  ILE n 
15 75  LEU n 
15 76  ARG n 
15 77  GLU n 
15 78  ASN n 
15 79  LEU n 
15 80  GLU n 
15 81  HIS n 
15 82  PHE n 
15 83  THR n 
15 84  VAL n 
15 85  THR n 
15 86  GLU n 
15 87  VAL n 
15 88  GLU n 
15 89  THR n 
15 90  ALA n 
15 91  LEU n 
15 92  VAL n 
15 93  GLU n 
15 94  GLY n 
15 95  GLY n 
15 96  ASP n 
15 97  ARG n 
15 98  TYR n 
15 99  ASN n 
15 100 ASN n 
15 101 GLY n 
15 102 LEU n 
15 103 TYR n 
15 104 LYS n 
16 1   ALA n 
16 2   GLU n 
16 3   LEU n 
16 4   THR n 
16 5   PRO n 
16 6   GLU n 
16 7   VAL n 
16 8   LEU n 
16 9   THR n 
16 10  VAL n 
16 11  PRO n 
16 12  LEU n 
16 13  ASN n 
16 14  SER n 
16 15  GLU n 
16 16  GLY n 
16 17  LYS n 
16 18  THR n 
16 19  ILE n 
16 20  THR n 
16 21  LEU n 
16 22  THR n 
16 23  GLU n 
16 24  LYS n 
16 25  GLN n 
16 26  TYR n 
16 27  LEU n 
16 28  GLU n 
16 29  GLY n 
16 30  LYS n 
16 31  ARG n 
16 32  LEU n 
16 33  PHE n 
16 34  GLN n 
16 35  TYR n 
16 36  ALA n 
16 37  CYS n 
16 38  ALA n 
16 39  SER n 
16 40  CYS n 
16 41  HIS n 
16 42  VAL n 
16 43  GLY n 
16 44  GLY n 
16 45  ILE n 
16 46  THR n 
16 47  LYS n 
16 48  THR n 
16 49  ASN n 
16 50  PRO n 
16 51  SER n 
16 52  LEU n 
16 53  ASP n 
16 54  LEU n 
16 55  ARG n 
16 56  THR n 
16 57  GLU n 
16 58  THR n 
16 59  LEU n 
16 60  ALA n 
16 61  LEU n 
16 62  ALA n 
16 63  THR n 
16 64  PRO n 
16 65  PRO n 
16 66  ARG n 
16 67  ASP n 
16 68  ASN n 
16 69  ILE n 
16 70  GLU n 
16 71  GLY n 
16 72  LEU n 
16 73  VAL n 
16 74  ASP n 
16 75  TYR n 
16 76  MET n 
16 77  LYS n 
16 78  ASN n 
16 79  PRO n 
16 80  THR n 
16 81  THR n 
16 82  TYR n 
16 83  ASP n 
16 84  GLY n 
16 85  GLU n 
16 86  GLN n 
16 87  GLU n 
16 88  ILE n 
16 89  ALA n 
16 90  GLU n 
16 91  VAL n 
16 92  HIS n 
16 93  PRO n 
16 94  SER n 
16 95  LEU n 
16 96  ARG n 
16 97  SER n 
16 98  ALA n 
16 99  ASP n 
16 100 ILE n 
16 101 PHE n 
16 102 PRO n 
16 103 LYS n 
16 104 MET n 
16 105 ARG n 
16 106 ASN n 
16 107 LEU n 
16 108 THR n 
16 109 GLU n 
16 110 LYS n 
16 111 ASP n 
16 112 LEU n 
16 113 VAL n 
16 114 ALA n 
16 115 ILE n 
16 116 ALA n 
16 117 GLY n 
16 118 HIS n 
16 119 ILE n 
16 120 LEU n 
16 121 VAL n 
16 122 GLU n 
16 123 PRO n 
16 124 LYS n 
16 125 ILE n 
16 126 LEU n 
16 127 GLY n 
16 128 ASP n 
16 129 LYS n 
16 130 TRP n 
16 131 GLY n 
16 132 GLY n 
16 133 GLY n 
16 134 LYS n 
16 135 VAL n 
16 136 TYR n 
16 137 TYR n 
17 1   UNK n 
17 2   UNK n 
17 3   UNK n 
17 4   UNK n 
17 5   UNK n 
17 6   UNK n 
17 7   UNK n 
17 8   UNK n 
17 9   UNK n 
17 10  UNK n 
17 11  UNK n 
17 12  UNK n 
17 13  UNK n 
17 14  UNK n 
17 15  UNK n 
17 16  UNK n 
17 17  UNK n 
17 18  UNK n 
17 19  UNK n 
17 20  UNK n 
17 21  UNK n 
17 22  UNK n 
17 23  UNK n 
17 24  UNK n 
17 25  UNK n 
17 26  UNK n 
17 27  UNK n 
17 28  UNK n 
17 29  UNK n 
17 30  UNK n 
17 31  UNK n 
17 32  UNK n 
17 33  UNK n 
17 34  UNK n 
17 35  UNK n 
17 36  UNK n 
17 37  UNK n 
17 38  UNK n 
17 39  UNK n 
17 40  UNK n 
17 41  UNK n 
17 42  UNK n 
17 43  UNK n 
17 44  UNK n 
17 45  UNK n 
17 46  UNK n 
17 47  UNK n 
17 48  UNK n 
17 49  UNK n 
17 50  UNK n 
17 51  UNK n 
17 52  UNK n 
17 53  UNK n 
17 54  UNK n 
17 55  UNK n 
17 56  UNK n 
17 57  UNK n 
17 58  UNK n 
17 59  UNK n 
17 60  UNK n 
17 61  UNK n 
17 62  UNK n 
17 63  UNK n 
17 64  UNK n 
17 65  UNK n 
17 66  UNK n 
17 67  UNK n 
17 68  UNK n 
17 69  UNK n 
17 70  UNK n 
17 71  UNK n 
17 72  UNK n 
17 73  UNK n 
17 74  UNK n 
17 75  UNK n 
17 76  UNK n 
17 77  UNK n 
17 78  UNK n 
17 79  UNK n 
17 80  UNK n 
17 81  UNK n 
17 82  UNK n 
17 83  UNK n 
17 84  UNK n 
17 85  UNK n 
17 86  UNK n 
17 87  UNK n 
17 88  UNK n 
17 89  UNK n 
17 90  UNK n 
17 91  UNK n 
17 92  UNK n 
17 93  UNK n 
17 94  UNK n 
17 95  UNK n 
17 96  UNK n 
17 97  UNK n 
17 98  UNK n 
17 99  UNK n 
17 100 UNK n 
17 101 UNK n 
17 102 UNK n 
17 103 UNK n 
17 104 UNK n 
17 105 UNK n 
17 106 UNK n 
17 107 UNK n 
17 108 UNK n 
17 109 UNK n 
17 110 UNK n 
17 111 UNK n 
17 112 UNK n 
17 113 UNK n 
17 114 UNK n 
17 115 UNK n 
17 116 UNK n 
17 117 UNK n 
17 118 UNK n 
17 119 UNK n 
17 120 UNK n 
17 121 UNK n 
17 122 UNK n 
17 123 UNK n 
17 124 UNK n 
17 125 UNK n 
17 126 UNK n 
17 127 UNK n 
17 128 UNK n 
17 129 UNK n 
18 1   MET n 
18 2   THR n 
18 3   ILE n 
18 4   LEU n 
18 5   PHE n 
18 6   GLN n 
18 7   LEU n 
18 8   ALA n 
18 9   LEU n 
18 10  ALA n 
18 11  ALA n 
18 12  LEU n 
18 13  VAL n 
18 14  ILE n 
18 15  LEU n 
18 16  SER n 
18 17  PHE n 
18 18  VAL n 
18 19  MET n 
18 20  VAL n 
18 21  ILE n 
18 22  GLY n 
18 23  VAL n 
18 24  PRO n 
18 25  VAL n 
18 26  ALA n 
18 27  TYR n 
18 28  ALA n 
18 29  SER n 
18 30  PRO n 
18 31  GLN n 
18 32  ASP n 
18 33  TRP n 
18 34  ASP n 
18 35  ARG n 
18 36  SER n 
18 37  LYS n 
18 38  GLN n 
18 39  LEU n 
18 40  ILE n 
18 41  PHE n 
18 42  LEU n 
18 43  GLY n 
18 44  SER n 
18 45  GLY n 
18 46  LEU n 
18 47  TRP n 
18 48  ILE n 
18 49  ALA n 
18 50  LEU n 
18 51  VAL n 
18 52  LEU n 
18 53  VAL n 
18 54  VAL n 
18 55  GLY n 
18 56  VAL n 
18 57  LEU n 
18 58  ASN n 
18 59  PHE n 
18 60  PHE n 
18 61  VAL n 
18 62  VAL n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
2  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
3  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
4  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
5  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
6  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
7  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
8  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
9  1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
10 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
11 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
12 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
13 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
14 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
15 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
16 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
17 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
18 1 sample ? ? ? 'Thermosynechococcus elongatus' 146786 Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP PSBA1_SYNEN P0A445   1  
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLA
;
1  ? 
2  GB  BAB19261    11761354 2  
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPA
KGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVS
FYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRRKEAV
;
1  ? 
3  GB  BAC09183    22295356 3  
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIR
DQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAP
LGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
1  ? 
4  GB  BAC09182    22295355 4  
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
1  ? 
5  UNP PSBE_SYNEL  Q8DIP0   5  
;MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFL
EQLK
;
0  ? 
6  UNP PSBF_SYNEL  Q8DIN9   6  MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 1  ? 
7  UNP PSBH_SYNEL  Q8DJ43   7  MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG 1  ? 
8  UNP PSBI_SYNEL  Q8DJZ6   8  METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE 1  ? 
9  UNP PSBJ_SYNEL  P59087   9  MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL 1  ? 
10 UNP PSBK_SYNEL  Q9F1K9   10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR 10 ? 
11 UNP PSBL_SYNEL  Q8DIN8   11 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN 1  ? 
12 UNP PSBM_SYNEL  Q8DHA7   12 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS 1  ? 
13 UNP PSBO_SYNEL  P0A431   13 
;AAKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLD
QIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDP
KGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVF
YASIEPA
;
26 ? 
14 UNP PSBT_SYNEL  Q8DIQ0   14 METITYVFIFACIIALFFFAIFFREPPRITKK 1  ? 
15 UNP PSBU_SYNEL  Q9F1L5   15 
;ATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLE
HFTVTEVETALVEGGDRYNNGLYK
;
31 ? 
16 UNP CY550_SYNEL P0A386   16 
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
27 ? 
17 UNP PSBZ_SYNEL  Q8DHJ2   18 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV 1  ? 
18 PDB 2AXT        2AXT     17 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  2AXT A 1 ? 344 ? P0A445   1    ? 344  ? 1    344  
2  2  2AXT B 1 ? 510 ? 11761354 1    ? 510  ? 1    510  
3  3  2AXT C 1 ? 473 ? 22295356 1    ? 473  ? 1    473  
4  4  2AXT D 1 ? 352 ? 22295355 1    ? 352  ? 1    352  
5  5  2AXT E 1 ? 84  ? Q8DIP0   0    ? 83   ? 1    84   
6  6  2AXT F 1 ? 45  ? Q8DIN9   1    ? 45   ? 1    45   
7  7  2AXT H 1 ? 66  ? Q8DJ43   1    ? 66   ? 1    66   
8  8  2AXT I 1 ? 38  ? Q8DJZ6   1    ? 38   ? 1    38   
9  9  2AXT J 1 ? 40  ? P59087   1    ? 40   ? 1    40   
10 10 2AXT K 1 ? 37  ? Q9F1K9   10   ? 46   ? 10   46   
11 11 2AXT L 1 ? 37  ? Q8DIN8   1    ? 37   ? 1    37   
12 12 2AXT M 1 ? 36  ? Q8DHA7   1    ? 36   ? 1    36   
13 13 2AXT O 1 ? 247 ? P0A431   26   ? 272  ? 26   272  
14 14 2AXT T 1 ? 32  ? Q8DIQ0   1    ? 32   ? 1    32   
15 15 2AXT U 1 ? 104 ? Q9F1L5   31   ? 134  ? 31   134  
16 16 2AXT V 1 ? 137 ? P0A386   27   ? 163  ? 27   163  
17 17 2AXT Z 1 ? 62  ? Q8DHJ2   1    ? 62   ? 1    62   
18 1  2AXT a 1 ? 344 ? P0A445   1    ? 344  ? 5001 5344 
19 2  2AXT b 1 ? 510 ? 11761354 1    ? 510  ? 5001 5510 
20 3  2AXT c 1 ? 473 ? 22295356 1    ? 473  ? 5001 5473 
21 4  2AXT d 1 ? 352 ? 22295355 1    ? 352  ? 5001 5352 
22 5  2AXT e 1 ? 84  ? Q8DIP0   0    ? 83   ? 5001 5084 
23 6  2AXT f 1 ? 45  ? Q8DIN9   1    ? 45   ? 5001 5045 
24 7  2AXT h 1 ? 66  ? Q8DJ43   1    ? 66   ? 5001 5066 
25 8  2AXT i 1 ? 38  ? Q8DJZ6   1    ? 38   ? 5001 5038 
26 9  2AXT j 1 ? 40  ? P59087   1    ? 40   ? 5001 5040 
27 10 2AXT k 1 ? 37  ? Q9F1K9   10   ? 46   ? 5010 5046 
28 11 2AXT l 1 ? 37  ? Q8DIN8   1    ? 37   ? 5001 5037 
29 12 2AXT m 1 ? 36  ? Q8DHA7   1    ? 36   ? 5001 5036 
30 13 2AXT o 1 ? 247 ? P0A431   26   ? 272  ? 5026 5272 
31 14 2AXT t 1 ? 32  ? Q8DIQ0   1    ? 32   ? 5001 5032 
32 15 2AXT u 1 ? 104 ? Q9F1L5   31   ? 134  ? 5031 5134 
33 16 2AXT v 1 ? 137 ? P0A386   27   ? 163  ? 5027 5163 
34 17 2AXT z 1 ? 62  ? Q8DHJ2   1    ? 62   ? 5001 5062 
35 18 2AXT X 1 ? 129 ? 2AXT     1    ? 129  ? 1    129  
36 18 2AXT x 1 ? 129 ? 2AXT     5001 ? 5129 ? 5001 5129 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                             'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                             'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                             'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                             'C4 H7 N O4'         133.103 
BCR non-polymer         . BETA-CAROTENE ?                             'C40 H56'            536.873 
BCT non-polymer         . 'BICARBONATE ION' ?                             'C H O3 -1'          61.017  
CA  non-polymer         . 'CALCIUM ION' ?                             'Ca 2'               40.078  
CLA non-polymer         . 'CHLOROPHYLL A' ?                             'C55 H72 Mg N4 O5 2' 893.489 
CYS 'L-peptide linking' y CYSTEINE ?                             'C3 H7 N O2 S'       121.158 
DGD saccharide          . 'DIGALACTOSYL DIACYL GLYCEROL (DGDG)' ?                             'C51 H96 O15'        949.299 
FE2 non-polymer         . 'FE (II) ION' ?                             'Fe 2'               55.845  
GLN 'L-peptide linking' y GLUTAMINE ?                             'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                             'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                             'C2 H5 N O2'         75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                          'C34 H32 Fe N4 O4'   616.487 
HIS 'L-peptide linking' y HISTIDINE ?                             'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?                             'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                             'C6 H13 N O2'        131.173 
LHG non-polymer         . 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE ?                             'C38 H75 O10 P'      722.970 
LMT D-saccharide        . DODECYL-BETA-D-MALTOSIDE ?                             'C24 H46 O11'        510.615 
LYS 'L-peptide linking' y LYSINE ?                             'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                             'C5 H11 N O2 S'      149.211 
MGE non-polymer         . '(1S)-2-(ALPHA-L-ALLOPYRANOSYLOXY)-1-[(TRIDECANOYLOXY)METHYL]ETHYL PALMITATE' 
MONOGALACTOSYL-DIACYLGLYCEROL 'C38 H72 O10'        688.972 
OEC non-polymer         . 'OXYGEN EVOLVING SYSTEM' ?                             'Ca Mn4 O4'          323.828 
PHE 'L-peptide linking' y PHENYLALANINE ?                             'C9 H11 N O2'        165.189 
PHO non-polymer         . 'PHEOPHYTIN A' ?                             'C55 H74 N4 O5'      871.200 
PQ9 non-polymer         . 
'5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE' ? 
'C43 H64 O2'         612.967 
PRO 'L-peptide linking' y PROLINE ?                             'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                             'C3 H7 N O3'         105.093 
SQD non-polymer         . '1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL' SULFOQUINOVOSYLDIACYLGLYCEROL 
'C41 H78 O12 S'      795.116 
THR 'L-peptide linking' y THREONINE ?                             'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                             'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                             'C9 H11 N O3'        181.189 
UNK 'L-peptide linking' . UNKNOWN ?                             'C4 H9 N O2'         103.120 
VAL 'L-peptide linking' y VALINE ?                             'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          2AXT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.76 
_exptl_crystal.density_percent_sol   67.32 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          batch 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG 2000, PIPES, magnesium chloride, pH 7.0, batch, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-02-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     2AXT 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   155380 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.103 
_reflns.pdbx_netI_over_sigmaI        14.83 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   73.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.466 
_reflns_shell.meanI_over_sigI_obs    2.17 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2AXT 
_refine.ls_number_reflns_obs                     129965 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               4628278.02 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    75.6 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.2 
_refine.ls_number_reflns_R_free                  1620 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               71.3 
_refine.aniso_B[1][1]                            27.02 
_refine.aniso_B[2][2]                            -2.46 
_refine.aniso_B[3][3]                            -24.56 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.303343 
_refine.solvent_model_param_bsol                 39.6527 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2AXT 
_refine_analyze.Luzzati_coordinate_error_obs    0.43 
_refine_analyze.Luzzati_sigma_a_obs             0.65 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.52 
_refine_analyze.Luzzati_sigma_a_free            0.78 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        40684 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7570 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               48254 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 18.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.07  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.82  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.75  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.52  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.18 
_refine_ls_shell.number_reflns_R_work             14106 
_refine_ls_shell.R_factor_R_work                  0.343 
_refine_ls_shell.percent_reflns_obs               50.3 
_refine_ls_shell.R_factor_R_free                  0.383 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            1.3 
_refine_ls_shell.number_reflns_R_free             182 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 ion.param         ?           'X-RAY DIFFRACTION' 
3 cof-new2.param    ?           'X-RAY DIFFRACTION' 
4 water_rep.param   ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2AXT 
_struct.title                     'Crystal Structure of Photosystem II from Thermosynechococcus elongatus' 
_struct.pdbx_descriptor           Photosystem 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AXT 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'photosystem, ps ii, ps2, membrane complex, transmembrane alpha-helix, ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 1  ? 
T  N N 2  ? 
U  N N 3  ? 
V  N N 4  ? 
W  N N 5  ? 
X  N N 6  ? 
Y  N N 7  ? 
Z  N N 8  ? 
AA N N 9  ? 
BA N N 10 ? 
CA N N 11 ? 
DA N N 12 ? 
EA N N 13 ? 
FA N N 14 ? 
GA N N 15 ? 
HA N N 16 ? 
IA N N 17 ? 
JA N N 18 ? 
KA N N 19 ? 
LA N N 20 ? 
MA N N 20 ? 
NA N N 20 ? 
OA N N 21 ? 
PA N N 21 ? 
QA N N 20 ? 
RA N N 22 ? 
SA N N 23 ? 
TA N N 24 ? 
UA N N 25 ? 
VA N N 26 ? 
WA N N 27 ? 
XA N N 26 ? 
YA N N 20 ? 
ZA N N 20 ? 
AB N N 20 ? 
BB N N 20 ? 
CB N N 20 ? 
DB N N 20 ? 
EB N N 20 ? 
FB N N 20 ? 
GB N N 20 ? 
HB N N 20 ? 
IB N N 20 ? 
JB N N 20 ? 
KB N N 20 ? 
LB N N 20 ? 
MB N N 20 ? 
NB N N 20 ? 
OB N N 24 ? 
PB N N 24 ? 
QB N N 24 ? 
RB N N 28 ? 
SB N N 29 ? 
TB N N 29 ? 
UB N N 29 ? 
VB N N 29 ? 
WB N N 29 ? 
XB N N 29 ? 
YB N N 29 ? 
ZB N N 29 ? 
AC N N 29 ? 
BC N N 29 ? 
CC N N 29 ? 
DC N N 29 ? 
EC N N 29 ? 
FC N N 29 ? 
GC N N 29 ? 
HC N N 29 ? 
IC N N 29 ? 
JC N N 20 ? 
KC N N 20 ? 
LC N N 20 ? 
MC N N 20 ? 
NC N N 20 ? 
OC N N 20 ? 
PC N N 20 ? 
QC N N 20 ? 
RC N N 20 ? 
SC N N 20 ? 
TC N N 20 ? 
UC N N 20 ? 
VC N N 20 ? 
WC N N 24 ? 
XC N N 24 ? 
YC N N 24 ? 
ZC N N 30 ? 
AD N N 30 ? 
BD N N 30 ? 
CD N N 31 ? 
DD N N 20 ? 
ED N N 20 ? 
FD N N 22 ? 
GD N N 24 ? 
HD N N 28 ? 
ID N N 28 ? 
JD N N 28 ? 
KD N N 32 ? 
LD N N 24 ? 
MD N N 30 ? 
ND N N 28 ? 
OD N N 33 ? 
PD N N 28 ? 
QD N N 26 ? 
RD N N 27 ? 
SD N N 27 ? 
TD N N 24 ? 
UD N N 32 ? 
VD N N 24 ? 
WD N N 19 ? 
XD N N 26 ? 
YD N N 20 ? 
ZD N N 20 ? 
AE N N 20 ? 
BE N N 21 ? 
CE N N 21 ? 
DE N N 20 ? 
EE N N 22 ? 
FE N N 23 ? 
GE N N 24 ? 
HE N N 25 ? 
IE N N 27 ? 
JE N N 20 ? 
KE N N 20 ? 
LE N N 20 ? 
ME N N 20 ? 
NE N N 20 ? 
OE N N 20 ? 
PE N N 20 ? 
QE N N 20 ? 
RE N N 20 ? 
SE N N 20 ? 
TE N N 20 ? 
UE N N 20 ? 
VE N N 20 ? 
WE N N 20 ? 
XE N N 20 ? 
YE N N 20 ? 
ZE N N 24 ? 
AF N N 24 ? 
BF N N 24 ? 
CF N N 28 ? 
DF N N 29 ? 
EF N N 29 ? 
FF N N 29 ? 
GF N N 29 ? 
HF N N 29 ? 
IF N N 29 ? 
JF N N 29 ? 
KF N N 29 ? 
LF N N 29 ? 
MF N N 29 ? 
NF N N 29 ? 
OF N N 29 ? 
PF N N 29 ? 
QF N N 29 ? 
RF N N 29 ? 
SF N N 29 ? 
TF N N 29 ? 
UF N N 20 ? 
VF N N 20 ? 
WF N N 20 ? 
XF N N 20 ? 
YF N N 20 ? 
ZF N N 20 ? 
AG N N 20 ? 
BG N N 20 ? 
CG N N 20 ? 
DG N N 20 ? 
EG N N 20 ? 
FG N N 20 ? 
GG N N 20 ? 
HG N N 24 ? 
IG N N 24 ? 
JG N N 24 ? 
KG N N 30 ? 
LG N N 30 ? 
MG N N 30 ? 
NG N N 31 ? 
OG N N 20 ? 
PG N N 20 ? 
QG N N 22 ? 
RG N N 24 ? 
SG N N 26 ? 
TG N N 28 ? 
UG N N 28 ? 
VG N N 28 ? 
WG N N 32 ? 
XG N N 24 ? 
YG N N 30 ? 
ZG N N 28 ? 
AH N N 33 ? 
BH N N 28 ? 
CH N N 27 ? 
DH N N 24 ? 
EH N N 26 ? 
FH N N 27 ? 
GH N N 32 ? 
HH N N 24 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASN A  12  ? THR A  22  ? ASN A 12   THR A 22   1 ? 11 
HELX_P HELX_P2   2   PHE A  33  ? ALA A  54  ? PHE A 33   ALA A 54   1 ? 22 
HELX_P HELX_P3   3   SER A  70  ? GLY A  74  ? SER A 70   GLY A 74   5 ? 5  
HELX_P HELX_P4   4   PRO A  95  ? ALA A  99  ? PRO A 95   ALA A 99   5 ? 5  
HELX_P HELX_P5   5   SER A  101 ? ASN A  108 ? SER A 101  ASN A 108  1 ? 8  
HELX_P HELX_P6   6   GLY A  109 ? LEU A  137 ? GLY A 109  LEU A 137  1 ? 29 
HELX_P HELX_P7   7   TRP A  142 ? TYR A  147 ? TRP A 142  TYR A 147  1 ? 6  
HELX_P HELX_P8   8   TYR A  147 ? LEU A  159 ? TYR A 147  LEU A 159  1 ? 13 
HELX_P HELX_P9   9   LEU A  159 ? GLY A  166 ? LEU A 159  GLY A 166  1 ? 8  
HELX_P HELX_P10  10  GLY A  175 ? ASN A  191 ? GLY A 175  ASN A 191  1 ? 17 
HELX_P HELX_P11  11  ILE A  192 ? MET A  194 ? ILE A 192  MET A 194  5 ? 3  
HELX_P HELX_P12  12  HIS A  195 ? SER A  222 ? HIS A 195  SER A 222  1 ? 28 
HELX_P HELX_P13  13  ALA A  233 ? TYR A  237 ? ALA A 233  TYR A 237  5 ? 5  
HELX_P HELX_P14  14  ASN A  247 ? ILE A  259 ? ASN A 247  ILE A 259  1 ? 13 
HELX_P HELX_P15  15  ASN A  267 ? MET A  293 ? ASN A 267  MET A 293  1 ? 27 
HELX_P HELX_P16  16  THR A  316 ? HIS A  332 ? THR A 316  HIS A 332  1 ? 17 
HELX_P HELX_P17  17  PRO B  4   ? VAL B  11  ? PRO B 4    VAL B 11   5 ? 8  
HELX_P HELX_P18  18  ASP B  15  ? ALA B  43  ? ASP B 15   ALA B 43   1 ? 29 
HELX_P HELX_P19  19  PRO B  54  ? GLY B  59  ? PRO B 54   GLY B 59   5 ? 6  
HELX_P HELX_P20  20  VAL B  62  ? LEU B  69  ? VAL B 62   LEU B 69   1 ? 8  
HELX_P HELX_P21  21  SER B  92  ? TYR B  117 ? SER B 92   TYR B 117  1 ? 26 
HELX_P HELX_P22  22  LEU B  120 ? ARG B  124 ? LEU B 120  ARG B 124  5 ? 5  
HELX_P HELX_P23  23  ASP B  134 ? HIS B  157 ? ASP B 134  HIS B 157  1 ? 24 
HELX_P HELX_P24  24  GLY B  186 ? ASN B  191 ? GLY B 186  ASN B 191  5 ? 6  
HELX_P HELX_P25  25  ASN B  194 ? VAL B  219 ? ASN B 194  VAL B 219  1 ? 26 
HELX_P HELX_P26  26  PRO B  222 ? LEU B  229 ? PRO B 222  LEU B 229  1 ? 8  
HELX_P HELX_P27  27  ILE B  234 ? TYR B  258 ? ILE B 234  TYR B 258  1 ? 25 
HELX_P HELX_P28  28  ARG B  272 ? SER B  277 ? ARG B 272  SER B 277  1 ? 6  
HELX_P HELX_P29  29  SER B  278 ? SER B  294 ? SER B 278  SER B 294  1 ? 17 
HELX_P HELX_P30  30  THR B  297 ? SER B  303 ? THR B 297  SER B 303  1 ? 7  
HELX_P HELX_P31  31  PRO B  306 ? ASP B  313 ? PRO B 306  ASP B 313  1 ? 8  
HELX_P HELX_P32  32  TYR B  314 ? ASN B  318 ? TYR B 314  ASN B 318  5 ? 5  
HELX_P HELX_P33  33  PRO B  329 ? GLY B  333 ? PRO B 329  GLY B 333  5 ? 5  
HELX_P HELX_P34  34  ARG B  384 ? SER B  388 ? ARG B 384  SER B 388  5 ? 5  
HELX_P HELX_P35  35  ASP B  413 ? ILE B  425 ? ASP B 413  ILE B 425  1 ? 13 
HELX_P HELX_P36  36  SER B  446 ? LEU B  474 ? SER B 446  LEU B 474  1 ? 29 
HELX_P HELX_P37  37  PHE B  475 ? PHE B  479 ? PHE B 475  PHE B 479  5 ? 5  
HELX_P HELX_P38  38  ALA C  34  ? ARG C  41  ? ALA C 34   ARG C 41   5 ? 8  
HELX_P HELX_P39  39  LEU C  45  ? PHE C  75  ? LEU C 45   PHE C 75   1 ? 31 
HELX_P HELX_P40  40  MET C  81  ? GLY C  85  ? MET C 81   GLY C 85   5 ? 5  
HELX_P HELX_P41  41  LEU C  88  ? LEU C  95  ? LEU C 88   LEU C 95   1 ? 8  
HELX_P HELX_P42  42  GLY C  100 ? GLU C  104 ? GLY C 100  GLU C 104  5 ? 5  
HELX_P HELX_P43  43  THR C  108 ? ALA C  133 ? THR C 108  ALA C 133  1 ? 26 
HELX_P HELX_P44  44  ASN C  155 ? PHE C  181 ? ASN C 155  PHE C 181  1 ? 27 
HELX_P HELX_P45  45  ASP C  205 ? TYR C  212 ? ASP C 205  TYR C 212  1 ? 8  
HELX_P HELX_P46  46  LEU C  213 ? LYS C  215 ? LEU C 213  LYS C 215  5 ? 3  
HELX_P HELX_P47  47  ASN C  229 ? LEU C  253 ? ASN C 229  LEU C 253  1 ? 25 
HELX_P HELX_P48  48  PHE C  257 ? ARG C  262 ? PHE C 257  ARG C 262  1 ? 6  
HELX_P HELX_P49  49  SER C  267 ? ASN C  293 ? SER C 267  ASN C 293  1 ? 27 
HELX_P HELX_P50  50  THR C  305 ? LYS C  323 ? THR C 305  LYS C 323  1 ? 19 
HELX_P HELX_P51  51  GLY C  353 ? TRP C  359 ? GLY C 353  TRP C 359  5 ? 7  
HELX_P HELX_P52  52  LEU C  366 ? ARG C  370 ? LEU C 366  ARG C 370  5 ? 5  
HELX_P HELX_P53  53  ASP C  376 ? ASP C  383 ? ASP C 376  ASP C 383  1 ? 8  
HELX_P HELX_P54  54  GLN C  385 ? THR C  397 ? GLN C 385  THR C 397  1 ? 13 
HELX_P HELX_P55  55  SER C  421 ? ALA C  452 ? SER C 421  ALA C 452  1 ? 32 
HELX_P HELX_P56  56  ASP C  460 ? MET C  469 ? ASP C 460  MET C 469  5 ? 10 
HELX_P HELX_P57  57  TRP D  14  ? LYS D  23  ? TRP D 14   LYS D 23   1 ? 10 
HELX_P HELX_P58  58  SER D  33  ? PHE D  54  ? SER D 33   PHE D 54   1 ? 22 
HELX_P HELX_P59  59  ALA D  82  ? GLY D  86  ? ALA D 82   GLY D 86   5 ? 5  
HELX_P HELX_P60  60  ASP D  100 ? GLY D  108 ? ASP D 100  GLY D 108  1 ? 9  
HELX_P HELX_P61  61  GLY D  108 ? GLY D  137 ? GLY D 108  GLY D 137  1 ? 30 
HELX_P HELX_P62  62  PHE D  146 ? PHE D  157 ? PHE D 146  PHE D 157  1 ? 12 
HELX_P HELX_P63  63  LEU D  158 ? GLN D  164 ? LEU D 158  GLN D 164  1 ? 7  
HELX_P HELX_P64  64  SER D  166 ? ALA D  170 ? SER D 166  ALA D 170  5 ? 5  
HELX_P HELX_P65  65  VAL D  175 ? HIS D  189 ? VAL D 175  HIS D 189  1 ? 15 
HELX_P HELX_P66  66  ASN D  190 ? LEU D  193 ? ASN D 190  LEU D 193  5 ? 4  
HELX_P HELX_P67  67  ASN D  194 ? ASN D  220 ? ASN D 194  ASN D 220  1 ? 27 
HELX_P HELX_P68  68  SER D  245 ? PHE D  257 ? SER D 245  PHE D 257  1 ? 13 
HELX_P HELX_P69  69  ASN D  263 ? ALA D  290 ? ASN D 263  ALA D 290  1 ? 28 
HELX_P HELX_P70  70  PHE D  298 ? ASP D  308 ? PHE D 298  ASP D 308  1 ? 11 
HELX_P HELX_P71  71  THR D  313 ? GLN D  334 ? THR D 313  GLN D 334  1 ? 22 
HELX_P HELX_P72  72  PRO D  335 ? ASN D  338 ? PRO D 335  ASN D 338  5 ? 4  
HELX_P HELX_P73  73  PRO E  9   ? SER E  16  ? PRO E 9    SER E 16   1 ? 8  
HELX_P HELX_P74  74  SER E  16  ? THR E  40  ? SER E 16   THR E 40   1 ? 25 
HELX_P HELX_P75  75  GLY E  41  ? PHE E  47  ? GLY E 41   PHE E 47   1 ? 7  
HELX_P HELX_P76  76  GLU E  71  ? LEU E  83  ? GLU E 71   LEU E 83   1 ? 13 
HELX_P HELX_P77  77  THR F  17  ? GLN F  41  ? THR F 17   GLN F 41   1 ? 25 
HELX_P HELX_P78  78  THR G  5   ? ARG G  12  ? THR H 5    ARG H 12   1 ? 8  
HELX_P HELX_P79  79  THR G  27  ? ASN G  50  ? THR H 27   ASN H 50   1 ? 24 
HELX_P HELX_P80  80  GLU H  2   ? SER H  25  ? GLU I 2    SER I 25   1 ? 24 
HELX_P HELX_P81  81  PRO I  9   ? ALA I  32  ? PRO J 9    ALA J 32   1 ? 24 
HELX_P HELX_P82  82  PRO J  3   ? ILE J  8   ? PRO K 12   ILE K 17   5 ? 6  
HELX_P HELX_P83  83  PHE J  9   ? LEU J  16  ? PHE K 18   LEU K 25   1 ? 8  
HELX_P HELX_P84  84  VAL J  18  ? VAL J  34  ? VAL K 27   VAL K 43   1 ? 17 
HELX_P HELX_P85  85  ASN K  13  ? ASN K  37  ? ASN L 13   ASN L 37   1 ? 25 
HELX_P HELX_P86  86  LEU L  6   ? SER L  31  ? LEU M 6    SER M 31   1 ? 26 
HELX_P HELX_P87  87  GLN L  32  ? LYS L  34  ? GLN M 32   LYS M 34   5 ? 3  
HELX_P HELX_P88  88  THR M  7   ? VAL M  12  ? THR O 32   VAL O 37   1 ? 6  
HELX_P HELX_P89  89  GLU M  180 ? GLU M  182 ? GLU O 205  GLU O 207  5 ? 3  
HELX_P HELX_P90  90  LEU M  183 ? VAL M  188 ? LEU O 208  VAL O 213  1 ? 6  
HELX_P HELX_P91  91  MET N  1   ? PHE N  23  ? MET T 1    PHE T 23   1 ? 23 
HELX_P HELX_P92  92  ASN O  11  ? LEU O  17  ? ASN U 41   LEU U 47   1 ? 7  
HELX_P HELX_P93  93  ASN O  31  ? ILE O  36  ? ASN U 61   ILE U 66   5 ? 6  
HELX_P HELX_P94  94  TYR O  42  ? ASN O  52  ? TYR U 72   ASN U 82   1 ? 11 
HELX_P HELX_P95  95  SER O  57  ? ILE O  64  ? SER U 87   ILE U 94   5 ? 8  
HELX_P HELX_P96  96  ARG O  70  ? LEU O  79  ? ARG U 100  LEU U 109  1 ? 10 
HELX_P HELX_P97  97  GLU O  88  ? GLU O  93  ? GLU U 118  GLU U 123  1 ? 6  
HELX_P HELX_P98  98  GLY O  94  ? ASP O  96  ? GLY U 124  ASP U 126  5 ? 3  
HELX_P HELX_P99  99  THR P  22  ? CYS P  37  ? THR V 48   CYS V 63   1 ? 16 
HELX_P HELX_P100 100 CYS P  37  ? VAL P  42  ? CYS V 63   VAL V 68   1 ? 6  
HELX_P HELX_P101 101 GLY P  43  ? ILE P  45  ? GLY V 69   ILE V 71   5 ? 3  
HELX_P HELX_P102 102 ARG P  55  ? LEU P  61  ? ARG V 81   LEU V 87   1 ? 7  
HELX_P HELX_P103 103 ASN P  68  ? ASN P  78  ? ASN V 94   ASN V 104  1 ? 11 
HELX_P HELX_P104 104 SER P  94  ? ALA P  98  ? SER V 120  ALA V 124  5 ? 5  
HELX_P HELX_P105 105 PRO P  102 ? LEU P  107 ? PRO V 128  LEU V 133  1 ? 6  
HELX_P HELX_P106 106 THR P  108 ? GLY P  127 ? THR V 134  GLY V 153  1 ? 20 
HELX_P HELX_P107 107 GLY P  127 ? GLY P  132 ? GLY V 153  GLY V 158  1 ? 6  
HELX_P HELX_P108 108 GLY P  133 ? TYR P  137 ? GLY V 159  TYR V 163  5 ? 5  
HELX_P HELX_P109 109 UNK Q  4   ? UNK Q  27  ? UNK X 4    UNK X 27   1 ? 24 
HELX_P HELX_P110 110 UNK Q  54  ? UNK Q  85  ? UNK X 54   UNK X 85   1 ? 32 
HELX_P HELX_P111 111 UNK Q  100 ? UNK Q  111 ? UNK X 100  UNK X 111  1 ? 12 
HELX_P HELX_P112 112 UNK Q  113 ? UNK Q  123 ? UNK X 113  UNK X 123  1 ? 11 
HELX_P HELX_P113 113 MET R  1   ? SER R  29  ? MET Z 1    SER Z 29   1 ? 29 
HELX_P HELX_P114 114 ASP R  34  ? VAL R  62  ? ASP Z 34   VAL Z 62   1 ? 29 
HELX_P HELX_P115 115 ASN S  12  ? THR S  22  ? ASN a 5012 THR a 5022 1 ? 11 
HELX_P HELX_P116 116 PHE S  33  ? ALA S  54  ? PHE a 5033 ALA a 5054 1 ? 22 
HELX_P HELX_P117 117 SER S  70  ? GLY S  74  ? SER a 5070 GLY a 5074 5 ? 5  
HELX_P HELX_P118 118 PRO S  95  ? ALA S  99  ? PRO a 5095 ALA a 5099 5 ? 5  
HELX_P HELX_P119 119 SER S  101 ? ASN S  108 ? SER a 5101 ASN a 5108 1 ? 8  
HELX_P HELX_P120 120 GLY S  109 ? LEU S  137 ? GLY a 5109 LEU a 5137 1 ? 29 
HELX_P HELX_P121 121 TRP S  142 ? TYR S  147 ? TRP a 5142 TYR a 5147 1 ? 6  
HELX_P HELX_P122 122 TYR S  147 ? LEU S  159 ? TYR a 5147 LEU a 5159 1 ? 13 
HELX_P HELX_P123 123 LEU S  159 ? GLY S  166 ? LEU a 5159 GLY a 5166 1 ? 8  
HELX_P HELX_P124 124 ILE S  176 ? ASN S  191 ? ILE a 5176 ASN a 5191 1 ? 16 
HELX_P HELX_P125 125 ILE S  192 ? MET S  194 ? ILE a 5192 MET a 5194 5 ? 3  
HELX_P HELX_P126 126 HIS S  195 ? SER S  222 ? HIS a 5195 SER a 5222 1 ? 28 
HELX_P HELX_P127 127 SER S  232 ? TYR S  237 ? SER a 5232 TYR a 5237 5 ? 6  
HELX_P HELX_P128 128 ASN S  247 ? PHE S  260 ? ASN a 5247 PHE a 5260 1 ? 14 
HELX_P HELX_P129 129 ASN S  267 ? MET S  293 ? ASN a 5267 MET a 5293 1 ? 27 
HELX_P HELX_P130 130 THR S  316 ? HIS S  332 ? THR a 5316 HIS a 5332 1 ? 17 
HELX_P HELX_P131 131 PRO T  4   ? ILE T  13  ? PRO b 5004 ILE b 5013 5 ? 10 
HELX_P HELX_P132 132 ASP T  15  ? ALA T  43  ? ASP b 5015 ALA b 5043 1 ? 29 
HELX_P HELX_P133 133 PRO T  54  ? GLY T  59  ? PRO b 5054 GLY b 5059 5 ? 6  
HELX_P HELX_P134 134 VAL T  62  ? LEU T  69  ? VAL b 5062 LEU b 5069 1 ? 8  
HELX_P HELX_P135 135 SER T  92  ? TYR T  117 ? SER b 5092 TYR b 5117 1 ? 26 
HELX_P HELX_P136 136 LEU T  120 ? ARG T  124 ? LEU b 5120 ARG b 5124 5 ? 5  
HELX_P HELX_P137 137 ASP T  134 ? HIS T  157 ? ASP b 5134 HIS b 5157 1 ? 24 
HELX_P HELX_P138 138 GLY T  186 ? ASN T  191 ? GLY b 5186 ASN b 5191 5 ? 6  
HELX_P HELX_P139 139 ASN T  194 ? VAL T  219 ? ASN b 5194 VAL b 5219 1 ? 26 
HELX_P HELX_P140 140 PRO T  222 ? LEU T  229 ? PRO b 5222 LEU b 5229 1 ? 8  
HELX_P HELX_P141 141 ASN T  233 ? GLU T  235 ? ASN b 5233 GLU b 5235 5 ? 3  
HELX_P HELX_P142 142 THR T  236 ? TYR T  258 ? THR b 5236 TYR b 5258 1 ? 23 
HELX_P HELX_P143 143 THR T  271 ? SER T  277 ? THR b 5271 SER b 5277 1 ? 7  
HELX_P HELX_P144 144 SER T  278 ? SER T  294 ? SER b 5278 SER b 5294 1 ? 17 
HELX_P HELX_P145 145 THR T  297 ? SER T  303 ? THR b 5297 SER b 5303 1 ? 7  
HELX_P HELX_P146 146 PRO T  306 ? ASP T  313 ? PRO b 5306 ASP b 5313 1 ? 8  
HELX_P HELX_P147 147 TYR T  314 ? ASN T  318 ? TYR b 5314 ASN b 5318 5 ? 5  
HELX_P HELX_P148 148 PRO T  329 ? ASP T  334 ? PRO b 5329 ASP b 5334 1 ? 6  
HELX_P HELX_P149 149 ARG T  384 ? SER T  388 ? ARG b 5384 SER b 5388 5 ? 5  
HELX_P HELX_P150 150 ASP T  413 ? ILE T  425 ? ASP b 5413 ILE b 5425 1 ? 13 
HELX_P HELX_P151 151 SER T  446 ? LEU T  474 ? SER b 5446 LEU b 5474 1 ? 29 
HELX_P HELX_P152 152 PHE T  475 ? PHE T  479 ? PHE b 5475 PHE b 5479 5 ? 5  
HELX_P HELX_P153 153 ALA U  34  ? ARG U  41  ? ALA c 5034 ARG c 5041 5 ? 8  
HELX_P HELX_P154 154 LEU U  45  ? ALA U  73  ? LEU c 5045 ALA c 5073 1 ? 29 
HELX_P HELX_P155 155 MET U  81  ? GLY U  85  ? MET c 5081 GLY c 5085 5 ? 5  
HELX_P HELX_P156 156 LEU U  88  ? LEU U  95  ? LEU c 5088 LEU c 5095 1 ? 8  
HELX_P HELX_P157 157 GLY U  100 ? GLU U  104 ? GLY c 5100 GLU c 5104 5 ? 5  
HELX_P HELX_P158 158 THR U  108 ? ALA U  133 ? THR c 5108 ALA c 5133 1 ? 26 
HELX_P HELX_P159 159 ASN U  155 ? PHE U  181 ? ASN c 5155 PHE c 5181 1 ? 27 
HELX_P HELX_P160 160 ASP U  205 ? TYR U  212 ? ASP c 5205 TYR c 5212 1 ? 8  
HELX_P HELX_P161 161 LEU U  213 ? LYS U  215 ? LEU c 5213 LYS c 5215 5 ? 3  
HELX_P HELX_P162 162 ASN U  229 ? LEU U  253 ? ASN c 5229 LEU c 5253 1 ? 25 
HELX_P HELX_P163 163 PHE U  257 ? ARG U  262 ? PHE c 5257 ARG c 5262 1 ? 6  
HELX_P HELX_P164 164 SER U  267 ? ASN U  293 ? SER c 5267 ASN c 5293 1 ? 27 
HELX_P HELX_P165 165 THR U  305 ? LYS U  323 ? THR c 5305 LYS c 5323 1 ? 19 
HELX_P HELX_P166 166 GLY U  353 ? TRP U  359 ? GLY c 5353 TRP c 5359 5 ? 7  
HELX_P HELX_P167 167 LEU U  366 ? ARG U  370 ? LEU c 5366 ARG c 5370 5 ? 5  
HELX_P HELX_P168 168 ASP U  376 ? ASP U  383 ? ASP c 5376 ASP c 5383 1 ? 8  
HELX_P HELX_P169 169 GLN U  385 ? THR U  397 ? GLN c 5385 THR c 5397 1 ? 13 
HELX_P HELX_P170 170 SER U  421 ? ALA U  452 ? SER c 5421 ALA c 5452 1 ? 32 
HELX_P HELX_P171 171 ASP U  460 ? MET U  469 ? ASP c 5460 MET c 5469 5 ? 10 
HELX_P HELX_P172 172 TRP V  14  ? LYS V  23  ? TRP d 5014 LYS d 5023 1 ? 10 
HELX_P HELX_P173 173 SER V  33  ? PHE V  54  ? SER d 5033 PHE d 5054 1 ? 22 
HELX_P HELX_P174 174 ALA V  82  ? GLY V  86  ? ALA d 5082 GLY d 5086 5 ? 5  
HELX_P HELX_P175 175 ASP V  100 ? GLY V  108 ? ASP d 5100 GLY d 5108 1 ? 9  
HELX_P HELX_P176 176 GLY V  108 ? GLY V  137 ? GLY d 5108 GLY d 5137 1 ? 30 
HELX_P HELX_P177 177 PHE V  146 ? PHE V  157 ? PHE d 5146 PHE d 5157 1 ? 12 
HELX_P HELX_P178 178 LEU V  158 ? GLN V  164 ? LEU d 5158 GLN d 5164 1 ? 7  
HELX_P HELX_P179 179 SER V  166 ? ALA V  170 ? SER d 5166 ALA d 5170 5 ? 5  
HELX_P HELX_P180 180 VAL V  175 ? HIS V  189 ? VAL d 5175 HIS d 5189 1 ? 15 
HELX_P HELX_P181 181 ASN V  190 ? LEU V  193 ? ASN d 5190 LEU d 5193 5 ? 4  
HELX_P HELX_P182 182 ASN V  194 ? ASN V  220 ? ASN d 5194 ASN d 5220 1 ? 27 
HELX_P HELX_P183 183 SER V  245 ? PHE V  257 ? SER d 5245 PHE d 5257 1 ? 13 
HELX_P HELX_P184 184 ASN V  263 ? ALA V  290 ? ASN d 5263 ALA d 5290 1 ? 28 
HELX_P HELX_P185 185 PHE V  298 ? ASP V  308 ? PHE d 5298 ASP d 5308 1 ? 11 
HELX_P HELX_P186 186 THR V  313 ? GLN V  334 ? THR d 5313 GLN d 5334 1 ? 22 
HELX_P HELX_P187 187 PRO V  335 ? ASN V  338 ? PRO d 5335 ASN d 5338 5 ? 4  
HELX_P HELX_P188 188 PRO W  9   ? SER W  16  ? PRO e 5009 SER e 5016 1 ? 8  
HELX_P HELX_P189 189 SER W  16  ? THR W  40  ? SER e 5016 THR e 5040 1 ? 25 
HELX_P HELX_P190 190 GLY W  41  ? PHE W  47  ? GLY e 5041 PHE e 5047 1 ? 7  
HELX_P HELX_P191 191 GLU W  71  ? LEU W  83  ? GLU e 5071 LEU e 5083 1 ? 13 
HELX_P HELX_P192 192 THR X  17  ? GLN X  41  ? THR f 5017 GLN f 5041 1 ? 25 
HELX_P HELX_P193 193 THR Y  5   ? ARG Y  12  ? THR h 5005 ARG h 5012 1 ? 8  
HELX_P HELX_P194 194 THR Y  27  ? ASN Y  50  ? THR h 5027 ASN h 5050 1 ? 24 
HELX_P HELX_P195 195 GLU Z  2   ? SER Z  25  ? GLU i 5002 SER i 5025 1 ? 24 
HELX_P HELX_P196 196 PRO AA 9   ? ALA AA 32  ? PRO j 5009 ALA j 5032 1 ? 24 
HELX_P HELX_P197 197 PRO BA 3   ? ILE BA 8   ? PRO k 5012 ILE k 5017 5 ? 6  
HELX_P HELX_P198 198 PHE BA 9   ? LEU BA 16  ? PHE k 5018 LEU k 5025 1 ? 8  
HELX_P HELX_P199 199 VAL BA 18  ? VAL BA 34  ? VAL k 5027 VAL k 5043 1 ? 17 
HELX_P HELX_P200 200 ASN CA 13  ? ASN CA 37  ? ASN l 5013 ASN l 5037 1 ? 25 
HELX_P HELX_P201 201 LEU DA 6   ? SER DA 31  ? LEU m 5006 SER m 5031 1 ? 26 
HELX_P HELX_P202 202 GLN DA 32  ? LYS DA 34  ? GLN m 5032 LYS m 5034 5 ? 3  
HELX_P HELX_P203 203 THR EA 7   ? VAL EA 12  ? THR o 5032 VAL o 5037 1 ? 6  
HELX_P HELX_P204 204 GLU EA 180 ? GLU EA 182 ? GLU o 5205 GLU o 5207 5 ? 3  
HELX_P HELX_P205 205 LEU EA 183 ? VAL EA 188 ? LEU o 5208 VAL o 5213 1 ? 6  
HELX_P HELX_P206 206 MET FA 1   ? PHE FA 23  ? MET t 5001 PHE t 5023 1 ? 23 
HELX_P HELX_P207 207 ASN GA 11  ? LEU GA 17  ? ASN u 5041 LEU u 5047 1 ? 7  
HELX_P HELX_P208 208 ASN GA 31  ? ILE GA 36  ? ASN u 5061 ILE u 5066 5 ? 6  
HELX_P HELX_P209 209 TYR GA 42  ? ASN GA 52  ? TYR u 5072 ASN u 5082 1 ? 11 
HELX_P HELX_P210 210 SER GA 57  ? ILE GA 64  ? SER u 5087 ILE u 5094 5 ? 8  
HELX_P HELX_P211 211 ARG GA 70  ? LEU GA 79  ? ARG u 5100 LEU u 5109 1 ? 10 
HELX_P HELX_P212 212 GLU GA 88  ? GLU GA 93  ? GLU u 5118 GLU u 5123 1 ? 6  
HELX_P HELX_P213 213 GLY GA 94  ? ASP GA 96  ? GLY u 5124 ASP u 5126 5 ? 3  
HELX_P HELX_P214 214 THR HA 22  ? CYS HA 37  ? THR v 5048 CYS v 5063 1 ? 16 
HELX_P HELX_P215 215 CYS HA 37  ? VAL HA 42  ? CYS v 5063 VAL v 5068 1 ? 6  
HELX_P HELX_P216 216 GLY HA 43  ? ILE HA 45  ? GLY v 5069 ILE v 5071 5 ? 3  
HELX_P HELX_P217 217 ARG HA 55  ? LEU HA 61  ? ARG v 5081 LEU v 5087 1 ? 7  
HELX_P HELX_P218 218 ASN HA 68  ? ASN HA 78  ? ASN v 5094 ASN v 5104 1 ? 11 
HELX_P HELX_P219 219 SER HA 94  ? ALA HA 98  ? SER v 5120 ALA v 5124 5 ? 5  
HELX_P HELX_P220 220 PRO HA 102 ? LEU HA 107 ? PRO v 5128 LEU v 5133 1 ? 6  
HELX_P HELX_P221 221 THR HA 108 ? GLY HA 127 ? THR v 5134 GLY v 5153 1 ? 20 
HELX_P HELX_P222 222 GLY HA 127 ? GLY HA 132 ? GLY v 5153 GLY v 5158 1 ? 6  
HELX_P HELX_P223 223 GLY HA 133 ? TYR HA 137 ? GLY v 5159 TYR v 5163 5 ? 5  
HELX_P HELX_P224 224 UNK IA 4   ? UNK IA 27  ? UNK x 5004 UNK x 5027 1 ? 24 
HELX_P HELX_P225 225 UNK IA 54  ? UNK IA 85  ? UNK x 5054 UNK x 5085 1 ? 32 
HELX_P HELX_P226 226 UNK IA 100 ? UNK IA 111 ? UNK x 5100 UNK x 5111 1 ? 12 
HELX_P HELX_P227 227 UNK IA 113 ? UNK IA 123 ? UNK x 5113 UNK x 5123 1 ? 11 
HELX_P HELX_P228 228 MET JA 1   ? SER JA 29  ? MET z 5001 SER z 5029 1 ? 29 
HELX_P HELX_P229 229 ASP JA 34  ? VAL JA 62  ? ASP z 5034 VAL z 5062 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? M  CYS 20  SG  ? ? ? 1_555 M  CYS 45  SG  ? ? O CYS 45   O CYS 70   1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf2  disulf ? ? EA CYS 20  SG  ? ? ? 1_555 EA CYS 45  SG  ? ? o CYS 5045 o CYS 5070 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc1  metalc ? ? KD HEM .   FE  ? ? ? 1_555 E  HIS 23  NE2 ? ? F HEM 51   E HIS 23   1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc2  metalc ? ? KD HEM .   FE  ? ? ? 1_555 F  HIS 24  NE2 ? ? F HEM 51   F HIS 24   1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc3  metalc ? ? UD HEM .   FE  ? ? ? 1_555 P  HIS 41  NE2 ? ? V HEM 552  V HIS 67   1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc4  metalc ? ? UD HEM .   FE  ? ? ? 1_555 P  HIS 92  NE2 ? ? V HEM 552  V HIS 118  1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc5  metalc ? ? KA FE2 .   FE  ? ? ? 1_555 A  HIS 215 NE2 ? ? A FE2 557  A HIS 215  1_555 ? ? ? ? ? ? ? 1.865 ? 
metalc6  metalc ? ? KA FE2 .   FE  ? ? ? 1_555 A  HIS 272 NE2 ? ? A FE2 557  A HIS 272  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc7  metalc ? ? WG HEM .   FE  ? ? ? 1_555 W  HIS 23  NE2 ? ? f HEM 5051 e HIS 5023 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc8  metalc ? ? WG HEM .   FE  ? ? ? 1_555 X  HIS 24  NE2 ? ? f HEM 5051 f HIS 5024 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc9  metalc ? ? GH HEM .   FE  ? ? ? 1_555 HA HIS 41  NE2 ? ? v HEM 5552 v HIS 5067 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc10 metalc ? ? GH HEM .   FE  ? ? ? 1_555 HA HIS 92  NE2 ? ? v HEM 5552 v HIS 5118 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc11 metalc ? ? WD FE2 .   FE  ? ? ? 1_555 S  HIS 215 NE2 ? ? a FE2 5557 a HIS 5215 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc12 metalc ? ? WD FE2 .   FE  ? ? ? 1_555 S  HIS 272 NE2 ? ? a FE2 5557 a HIS 5272 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc13 metalc ? ? A  ASP 170 OD1 ? ? ? 1_555 SA OEC .   MN4 ? ? A ASP 170  A OEC 565  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc14 metalc ? ? A  GLU 189 OE1 ? ? ? 1_555 SA OEC .   CA1 ? ? A GLU 189  A OEC 565  1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc15 metalc ? ? A  GLU 189 OE2 ? ? ? 1_555 SA OEC .   MN1 ? ? A GLU 189  A OEC 565  1_555 ? ? ? ? ? ? ? 1.814 ? 
metalc16 metalc ? ? A  HIS 198 NE2 ? ? ? 1_555 LA CLA .   MG  ? ? A HIS 198  A CLA 558  1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc17 metalc ? ? A  GLU 333 OE1 ? ? ? 1_555 SA OEC .   MN3 ? ? A GLU 333  A OEC 565  1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc18 metalc ? ? A  ASP 342 OD1 ? ? ? 1_555 SA OEC .   MN2 ? ? A ASP 342  A OEC 565  1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc19 metalc ? ? A  ASP 342 OD2 ? ? ? 1_555 SA OEC .   MN1 ? ? A ASP 342  A OEC 565  1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc20 metalc ? ? A  ALA 344 O   ? ? ? 1_555 SA OEC .   CA1 ? ? A ALA 344  A OEC 565  1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc21 metalc ? ? A  ALA 344 OXT ? ? ? 1_555 SA OEC .   MN2 ? ? A ALA 344  A OEC 565  1_555 ? ? ? ? ? ? ? 1.768 ? 
metalc22 metalc ? ? B  HIS 9   NE2 ? ? ? 1_555 LB CLA .   MG  ? ? B HIS 9    B CLA 524  1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc23 metalc ? ? B  HIS 201 ND1 ? ? ? 1_555 ZA CLA .   MG  ? ? B HIS 201  B CLA 512  1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc24 metalc ? ? B  HIS 202 NE2 ? ? ? 1_555 AB CLA .   MG  ? ? B HIS 202  B CLA 513  1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc25 metalc ? ? B  HIS 455 NE2 ? ? ? 1_555 BB CLA .   MG  ? ? B HIS 455  B CLA 514  1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc26 metalc ? ? B  HIS 466 NE2 ? ? ? 1_555 FB CLA .   MG  ? ? B HIS 466  B CLA 518  1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc27 metalc ? ? B  HIS 469 NE2 ? ? ? 1_555 IB CLA .   MG  ? ? B HIS 469  B CLA 521  1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc28 metalc ? ? C  ASN 39  OD1 ? ? ? 1_555 TC CLA .   MG  ? ? C ASN 39   C CLA 501  1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc29 metalc ? ? C  HIS 118 NE2 ? ? ? 1_555 LC CLA .   MG  ? ? C HIS 118  C CLA 493  1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc30 metalc ? ? C  HIS 132 NE2 ? ? ? 1_555 VC CLA .   MG  ? ? C HIS 132  C CLA 503  1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc31 metalc ? ? C  HIS 237 NE2 ? ? ? 1_555 JC CLA .   MG  ? ? C HIS 237  C CLA 491  1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc32 metalc ? ? C  HIS 251 NE2 ? ? ? 1_555 OC CLA .   MG  ? ? C HIS 251  C CLA 496  1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc33 metalc ? ? C  GLU 354 OE1 ? ? ? 1_555 SA OEC .   MN2 ? ? C GLU 354  A OEC 565  1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc34 metalc ? ? C  GLU 354 OE2 ? ? ? 1_555 SA OEC .   MN3 ? ? C GLU 354  A OEC 565  1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc35 metalc ? ? C  HIS 430 NE2 ? ? ? 1_555 KC CLA .   MG  ? ? C HIS 430  C CLA 492  1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc36 metalc ? ? C  HIS 444 NE2 ? ? ? 1_555 QC CLA .   MG  ? ? C HIS 444  C CLA 498  1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc37 metalc ? ? D  HIS 197 NE2 ? ? ? 1_555 DD CLA .   MG  ? ? D HIS 197  D CLA 354  1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc38 metalc ? ? D  HIS 214 NE2 ? ? ? 1_555 KA FE2 .   FE  ? ? D HIS 214  A FE2 557  1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc39 metalc ? ? D  HIS 268 NE2 ? ? ? 1_555 KA FE2 .   FE  ? ? D HIS 268  A FE2 557  1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc40 metalc ? ? J  ASP 10  OD1 ? ? ? 1_555 OD CA  .   CA  ? ? K ASP 19   K CA  56   1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc41 metalc ? ? J  ASP 14  OD2 ? ? ? 1_555 OD CA  .   CA  ? ? K ASP 23   K CA  56   1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc42 metalc ? ? S  GLU 189 OE1 ? ? ? 1_555 FE OEC .   CA1 ? ? a GLU 5189 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc43 metalc ? ? S  GLU 189 OE2 ? ? ? 1_555 FE OEC .   MN1 ? ? a GLU 5189 a OEC 5565 1_555 ? ? ? ? ? ? ? 1.844 ? 
metalc44 metalc ? ? S  HIS 198 NE2 ? ? ? 1_555 YD CLA .   MG  ? ? a HIS 5198 a CLA 5558 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc45 metalc ? ? S  GLU 333 OE1 ? ? ? 1_555 FE OEC .   MN3 ? ? a GLU 5333 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc46 metalc ? ? S  GLU 333 OE2 ? ? ? 1_555 FE OEC .   MN4 ? ? a GLU 5333 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc47 metalc ? ? S  ASP 342 OD1 ? ? ? 1_555 FE OEC .   MN2 ? ? a ASP 5342 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc48 metalc ? ? S  ASP 342 OD2 ? ? ? 1_555 FE OEC .   MN1 ? ? a ASP 5342 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc49 metalc ? ? S  ALA 344 O   ? ? ? 1_555 FE OEC .   CA1 ? ? a ALA 5344 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc50 metalc ? ? S  ALA 344 OXT ? ? ? 1_555 FE OEC .   MN2 ? ? a ALA 5344 a OEC 5565 1_555 ? ? ? ? ? ? ? 1.689 ? 
metalc51 metalc ? ? T  HIS 9   NE2 ? ? ? 1_555 WE CLA .   MG  ? ? b HIS 5009 b CLA 5524 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc52 metalc ? ? T  HIS 201 ND1 ? ? ? 1_555 KE CLA .   MG  ? ? b HIS 5201 b CLA 5512 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc53 metalc ? ? T  HIS 202 NE2 ? ? ? 1_555 LE CLA .   MG  ? ? b HIS 5202 b CLA 5513 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc54 metalc ? ? T  HIS 455 NE2 ? ? ? 1_555 ME CLA .   MG  ? ? b HIS 5455 b CLA 5514 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc55 metalc ? ? T  HIS 466 NE2 ? ? ? 1_555 QE CLA .   MG  ? ? b HIS 5466 b CLA 5518 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc56 metalc ? ? T  HIS 469 NE2 ? ? ? 1_555 TE CLA .   MG  ? ? b HIS 5469 b CLA 5521 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc57 metalc ? ? U  ASN 39  OD1 ? ? ? 1_555 EG CLA .   MG  ? ? c ASN 5039 c CLA 5501 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc58 metalc ? ? U  HIS 118 NE2 ? ? ? 1_555 WF CLA .   MG  ? ? c HIS 5118 c CLA 5493 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc59 metalc ? ? U  HIS 132 NE2 ? ? ? 1_555 GG CLA .   MG  ? ? c HIS 5132 c CLA 5503 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc60 metalc ? ? U  HIS 237 NE2 ? ? ? 1_555 UF CLA .   MG  ? ? c HIS 5237 c CLA 5491 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc61 metalc ? ? U  GLU 354 OE1 ? ? ? 1_555 FE OEC .   MN2 ? ? c GLU 5354 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc62 metalc ? ? U  GLU 354 OE2 ? ? ? 1_555 FE OEC .   MN3 ? ? c GLU 5354 a OEC 5565 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc63 metalc ? ? U  HIS 430 NE2 ? ? ? 1_555 VF CLA .   MG  ? ? c HIS 5430 c CLA 5492 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc64 metalc ? ? U  HIS 444 NE2 ? ? ? 1_555 BG CLA .   MG  ? ? c HIS 5444 c CLA 5498 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc65 metalc ? ? V  HIS 197 NE2 ? ? ? 1_555 OG CLA .   MG  ? ? d HIS 5197 d CLA 5354 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc66 metalc ? ? V  HIS 214 NE2 ? ? ? 1_555 WD FE2 .   FE  ? ? d HIS 5214 a FE2 5557 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc67 metalc ? ? V  HIS 268 NE2 ? ? ? 1_555 WD FE2 .   FE  ? ? d HIS 5268 a FE2 5557 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc68 metalc ? ? BA ASP 10  OD1 ? ? ? 1_555 AH CA  .   CA  ? ? k ASP 5019 k CA  5056 1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc69 metalc ? ? BA ASP 10  OD2 ? ? ? 1_555 AH CA  .   CA  ? ? k ASP 5019 k CA  5056 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc70 metalc ? ? BA ASP 14  OD2 ? ? ? 1_555 AH CA  .   CA  ? ? k ASP 5023 k CA  5056 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc71 metalc ? ? KA FE2 .   FE  ? ? ? 1_555 CD BCT .   O3  ? ? A FE2 557  D BCT 353  1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc72 metalc ? ? KA FE2 .   FE  ? ? ? 1_555 CD BCT .   O2  ? ? A FE2 557  D BCT 353  1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc73 metalc ? ? WD FE2 .   FE  ? ? ? 1_555 NG BCT .   O3  ? ? a FE2 5557 d BCT 5353 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc74 metalc ? ? WD FE2 .   FE  ? ? ? 1_555 NG BCT .   O2  ? ? a FE2 5557 d BCT 5353 1_555 ? ? ? ? ? ? ? 2.344 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 63 P  . ? THR 89   V PRO 64 P  ? PRO 90   V 1 -0.27 
2 THR 63 HA . ? THR 5089 v PRO 64 HA ? PRO 5090 v 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 2  ? 
C ? 2  ? 
D ? 6  ? 
E ? 2  ? 
F ? 6  ? 
G ? 12 ? 
H ? 2  ? 
I ? 2  ? 
J ? 2  ? 
K ? 2  ? 
L ? 2  ? 
M ? 2  ? 
N ? 6  ? 
O ? 2  ? 
P ? 6  ? 
Q ? 12 ? 
R ? 2  ? 
S ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
B 1  2  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
E 1  2  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? anti-parallel 
G 11 12 ? anti-parallel 
H 1  2  ? parallel      
I 1  2  ? anti-parallel 
J 1  2  ? anti-parallel 
K 1  2  ? parallel      
L 1  2  ? anti-parallel 
M 1  2  ? anti-parallel 
N 1  2  ? anti-parallel 
N 2  3  ? anti-parallel 
N 3  4  ? anti-parallel 
N 4  5  ? anti-parallel 
N 5  6  ? anti-parallel 
O 1  2  ? anti-parallel 
P 1  2  ? anti-parallel 
P 2  3  ? anti-parallel 
P 3  4  ? anti-parallel 
P 4  5  ? anti-parallel 
P 5  6  ? anti-parallel 
Q 1  2  ? anti-parallel 
Q 2  3  ? anti-parallel 
Q 3  4  ? anti-parallel 
Q 4  5  ? anti-parallel 
Q 5  6  ? anti-parallel 
Q 6  7  ? anti-parallel 
Q 7  8  ? anti-parallel 
Q 8  9  ? anti-parallel 
Q 9  10 ? anti-parallel 
Q 10 11 ? anti-parallel 
Q 11 12 ? anti-parallel 
R 1  2  ? parallel      
S 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A  297 ? ASN A  298 ? LEU A 297  ASN A 298  
A 2  GLY C  402 ? SER C  403 ? GLY C 402  SER C 403  
B 1  MET B  166 ? VAL B  168 ? MET B 166  VAL B 168  
B 2  SER B  177 ? GLN B  179 ? SER B 177  GLN B 179  
C 1  ILE B  336 ? TRP B  340 ? ILE B 336  TRP B 340  
C 2  PHE B  430 ? ASP B  433 ? PHE B 430  ASP B 433  
D 1  VAL B  377 ? ASP B  380 ? VAL B 377  ASP B 380  
D 2  ILE B  369 ? THR B  371 ? ILE B 369  THR B 371  
D 3  GLU B  353 ? VAL B  356 ? GLU B 353  VAL B 356  
D 4  HIS B  343 ? ARG B  347 ? HIS B 343  ARG B 347  
D 5  THR B  398 ? TYR B  402 ? THR B 398  TYR B 402  
D 6  THR B  410 ? PHE B  411 ? THR B 410  PHE B 411  
E 1  LEU C  341 ? ARG C  343 ? LEU C 341  ARG C 343  
E 2  ILE C  349 ? PHE C  351 ? ILE C 349  PHE C 351  
F 1  ASP M  100 ? ILE M  102 ? ASP O 125  ILE O 127  
F 2  LEU M  79  ? VAL M  88  ? LEU O 104  VAL O 113  
F 3  TYR M  39  ? LYS M  54  ? TYR O 64   LYS O 79   
F 4  PHE M  66  ? LEU M  71  ? PHE O 91   LEU O 96   
F 5  PHE M  104 ? MET M  111 ? PHE O 129  MET O 136  
F 6  ARG M  116 ? THR M  122 ? ARG O 141  THR O 147  
G 1  ASP M  100 ? ILE M  102 ? ASP O 125  ILE O 127  
G 2  LEU M  79  ? VAL M  88  ? LEU O 104  VAL O 113  
G 3  LEU M  94  ? VAL M  97  ? LEU O 119  VAL O 122  
G 4  LYS M  124 ? THR M  130 ? LYS O 149  THR O 155  
G 5  ASP M  142 ? VAL M  149 ? ASP O 167  VAL O 174  
G 6  THR M  194 ? LYS M  204 ? THR O 219  LYS O 229  
G 7  GLU M  211 ? LEU M  221 ? GLU O 236  LEU O 246  
G 8  GLU M  233 ? GLU M  245 ? GLU O 258  GLU O 270  
G 9  TYR M  39  ? LYS M  54  ? TYR O 64   LYS O 79   
G 10 PHE M  66  ? LEU M  71  ? PHE O 91   LEU O 96   
G 11 PHE M  104 ? MET M  111 ? PHE O 129  MET O 136  
G 12 ARG M  116 ? THR M  122 ? ARG O 141  THR O 147  
H 1  ILE O  25  ? ASP O  26  ? ILE U 55   ASP U 56   
H 2  PHE O  82  ? THR O  83  ? PHE U 112  THR U 113  
I 1  THR P  9   ? PRO P  11  ? THR V 35   PRO V 37   
I 2  THR P  18  ? THR P  20  ? THR V 44   THR V 46   
J 1  ALA S  81  ? VAL S  82  ? ALA a 5081 VAL a 5082 
J 2  LEU S  174 ? GLY S  175 ? LEU a 5174 GLY a 5175 
K 1  LEU S  297 ? ASN S  298 ? LEU a 5297 ASN a 5298 
K 2  GLY U  402 ? SER U  403 ? GLY c 5402 SER c 5403 
L 1  MET T  166 ? VAL T  168 ? MET b 5166 VAL b 5168 
L 2  SER T  177 ? GLN T  179 ? SER b 5177 GLN b 5179 
M 1  ILE T  336 ? TRP T  340 ? ILE b 5336 TRP b 5340 
M 2  PHE T  430 ? ASP T  433 ? PHE b 5430 ASP b 5433 
N 1  VAL T  377 ? ASP T  380 ? VAL b 5377 ASP b 5380 
N 2  ILE T  369 ? THR T  371 ? ILE b 5369 THR b 5371 
N 3  GLU T  353 ? VAL T  356 ? GLU b 5353 VAL b 5356 
N 4  HIS T  343 ? ARG T  347 ? HIS b 5343 ARG b 5347 
N 5  THR T  398 ? TYR T  402 ? THR b 5398 TYR b 5402 
N 6  THR T  410 ? PHE T  411 ? THR b 5410 PHE b 5411 
O 1  LEU U  341 ? ARG U  343 ? LEU c 5341 ARG c 5343 
O 2  ILE U  349 ? PHE U  351 ? ILE c 5349 PHE c 5351 
P 1  ASP EA 100 ? ILE EA 102 ? ASP o 5125 ILE o 5127 
P 2  LEU EA 79  ? VAL EA 88  ? LEU o 5104 VAL o 5113 
P 3  TYR EA 39  ? LYS EA 54  ? TYR o 5064 LYS o 5079 
P 4  PHE EA 66  ? LEU EA 71  ? PHE o 5091 LEU o 5096 
P 5  PHE EA 104 ? MET EA 111 ? PHE o 5129 MET o 5136 
P 6  ARG EA 116 ? THR EA 122 ? ARG o 5141 THR o 5147 
Q 1  ASP EA 100 ? ILE EA 102 ? ASP o 5125 ILE o 5127 
Q 2  LEU EA 79  ? VAL EA 88  ? LEU o 5104 VAL o 5113 
Q 3  LEU EA 94  ? VAL EA 97  ? LEU o 5119 VAL o 5122 
Q 4  LYS EA 124 ? SER EA 129 ? LYS o 5149 SER o 5154 
Q 5  ASP EA 142 ? VAL EA 149 ? ASP o 5167 VAL o 5174 
Q 6  THR EA 194 ? LYS EA 204 ? THR o 5219 LYS o 5229 
Q 7  GLU EA 211 ? LEU EA 221 ? GLU o 5236 LEU o 5246 
Q 8  GLU EA 233 ? GLU EA 245 ? GLU o 5258 GLU o 5270 
Q 9  TYR EA 39  ? LYS EA 54  ? TYR o 5064 LYS o 5079 
Q 10 PHE EA 66  ? LEU EA 71  ? PHE o 5091 LEU o 5096 
Q 11 PHE EA 104 ? MET EA 111 ? PHE o 5129 MET o 5136 
Q 12 ARG EA 116 ? THR EA 122 ? ARG o 5141 THR o 5147 
R 1  ILE GA 25  ? ASP GA 26  ? ILE u 5055 ASP u 5056 
R 2  PHE GA 82  ? THR GA 83  ? PHE u 5112 THR u 5113 
S 1  THR HA 9   ? PRO HA 11  ? THR v 5035 PRO v 5037 
S 2  THR HA 18  ? THR HA 20  ? THR v 5044 THR v 5046 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N ASN A  298 ? N ASN A 298  O GLY C  402 ? O GLY C 402  
B 1  2  N VAL B  168 ? N VAL B 168  O SER B  177 ? O SER B 177  
C 1  2  N ILE B  336 ? N ILE B 336  O ASP B  433 ? O ASP B 433  
D 1  2  O ALA B  379 ? O ALA B 379  N LEU B  370 ? N LEU B 370  
D 2  3  O THR B  371 ? O THR B 371  N PHE B  355 ? N PHE B 355  
D 3  4  O LEU B  354 ? O LEU B 354  N PHE B  346 ? N PHE B 346  
D 4  5  N HIS B  343 ? N HIS B 343  O TYR B  402 ? O TYR B 402  
D 5  6  N VAL B  399 ? N VAL B 399  O PHE B  411 ? O PHE B 411  
E 1  2  N MET C  342 ? N MET C 342  O ILE C  350 ? O ILE C 350  
F 1  2  O ILE M  102 ? O ILE O 127  N ASP M  80  ? N ASP O 105  
F 2  3  O LEU M  79  ? O LEU O 104  N LEU M  46  ? N LEU O 71   
F 3  4  N VAL M  53  ? N VAL O 78   O VAL M  67  ? O VAL O 92   
F 4  5  N LYS M  70  ? N LYS O 95   O GLN M  110 ? O GLN O 135  
F 5  6  N VAL M  109 ? N VAL O 134  O ILE M  117 ? O ILE O 142  
G 1  2  O ILE M  102 ? O ILE O 127  N ASP M  80  ? N ASP O 105  
G 2  3  N LYS M  87  ? N LYS O 112  O THR M  95  ? O THR O 120  
G 3  4  N PHE M  96  ? N PHE O 121  O ALA M  128 ? O ALA O 153  
G 4  5  N SER M  129 ? N SER O 154  O LYS M  144 ? O LYS O 169  
G 5  6  N VAL M  149 ? N VAL O 174  O THR M  194 ? O THR O 219  
G 6  7  N ALA M  203 ? N ALA O 228  O ALA M  213 ? O ALA O 238  
G 7  8  N SER M  218 ? N SER O 243  O ILE M  236 ? O ILE O 261  
G 8  9  O GLU M  245 ? O GLU O 270  N ARG M  40  ? N ARG O 65   
G 9  10 N VAL M  53  ? N VAL O 78   O VAL M  67  ? O VAL O 92   
G 10 11 N LYS M  70  ? N LYS O 95   O GLN M  110 ? O GLN O 135  
G 11 12 N VAL M  109 ? N VAL O 134  O ILE M  117 ? O ILE O 142  
H 1  2  N ILE O  25  ? N ILE U 55   O THR O  83  ? O THR U 113  
I 1  2  N VAL P  10  ? N VAL V 36   O ILE P  19  ? O ILE V 45   
J 1  2  N VAL S  82  ? N VAL a 5082 O LEU S  174 ? O LEU a 5174 
K 1  2  N ASN S  298 ? N ASN a 5298 O GLY U  402 ? O GLY c 5402 
L 1  2  N VAL T  168 ? N VAL b 5168 O SER T  177 ? O SER b 5177 
M 1  2  N GLN T  338 ? N GLN b 5338 O GLU T  431 ? O GLU b 5431 
N 1  2  O ALA T  379 ? O ALA b 5379 N LEU T  370 ? N LEU b 5370 
N 2  3  O THR T  371 ? O THR b 5371 N PHE T  355 ? N PHE b 5355 
N 3  4  O LEU T  354 ? O LEU b 5354 N PHE T  346 ? N PHE b 5346 
N 4  5  N HIS T  343 ? N HIS b 5343 O TYR T  402 ? O TYR b 5402 
N 5  6  N VAL T  399 ? N VAL b 5399 O PHE T  411 ? O PHE b 5411 
O 1  2  N MET U  342 ? N MET c 5342 O ILE U  350 ? O ILE c 5350 
P 1  2  O ILE EA 102 ? O ILE o 5127 N ASP EA 80  ? N ASP o 5105 
P 2  3  O LEU EA 79  ? O LEU o 5104 N LEU EA 46  ? N LEU o 5071 
P 3  4  N VAL EA 53  ? N VAL o 5078 O VAL EA 67  ? O VAL o 5092 
P 4  5  N LYS EA 70  ? N LYS o 5095 O GLN EA 110 ? O GLN o 5135 
P 5  6  N VAL EA 109 ? N VAL o 5134 O ILE EA 117 ? O ILE o 5142 
Q 1  2  O ILE EA 102 ? O ILE o 5127 N ASP EA 80  ? N ASP o 5105 
Q 2  3  N LYS EA 87  ? N LYS o 5112 O THR EA 95  ? O THR o 5120 
Q 3  4  N PHE EA 96  ? N PHE o 5121 O ALA EA 128 ? O ALA o 5153 
Q 4  5  N SER EA 129 ? N SER o 5154 O LYS EA 144 ? O LYS o 5169 
Q 5  6  N VAL EA 149 ? N VAL o 5174 O THR EA 194 ? O THR o 5219 
Q 6  7  N ALA EA 203 ? N ALA o 5228 O ALA EA 213 ? O ALA o 5238 
Q 7  8  N SER EA 218 ? N SER o 5243 O ILE EA 236 ? O ILE o 5261 
Q 8  9  O VAL EA 239 ? O VAL o 5264 N GLN EA 47  ? N GLN o 5072 
Q 9  10 N VAL EA 53  ? N VAL o 5078 O VAL EA 67  ? O VAL o 5092 
Q 10 11 N LYS EA 70  ? N LYS o 5095 O GLN EA 110 ? O GLN o 5135 
Q 11 12 N VAL EA 109 ? N VAL o 5134 O ILE EA 117 ? O ILE o 5142 
R 1  2  N ILE GA 25  ? N ILE u 5055 O THR GA 83  ? O THR u 5113 
S 1  2  N VAL HA 10  ? N VAL v 5036 O ILE HA 19  ? O ILE v 5045 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA K 56'    
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 A 557'  
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCT D 353'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA k 5056'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 a 5557' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCT d 5353' 
AC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA A 558'  
AC8 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CLA D 354'  
AC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA A 559'  
BC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA A 560'  
BC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE PHO A 561'  
BC3 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE PHO A 562'  
BC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA A 563'  
BC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA D 355'  
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CLA B 511'  
BC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA B 512'  
BC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA B 513'  
BC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA B 514'  
CC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA B 515'  
CC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 516'  
CC3 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA B 517'  
CC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA B 518'  
CC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 519'  
CC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 520'  
CC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA B 521'  
CC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 522'  
CC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA B 523'  
DC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA B 524'  
DC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA B 525'  
DC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA B 526'  
DC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA C 491'  
DC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA C 492'  
DC6 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA C 493'  
DC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA C 494'  
DC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA C 495'  
DC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA C 496'  
EC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA C 497'  
EC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA C 498'  
EC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA C 499'  
EC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA C 500'  
EC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA C 501'  
EC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA C 502'  
EC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA C 503'  
EC8 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM F 51'   
EC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM V 552'  
FC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PQ9 D 356'  
FC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PQ9 A 564'  
FC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE OEC A 565'  
FC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR A 566'  
FC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR B 527'  
FC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR t 104'  
FC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR B 528'  
FC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR B 529'  
FC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR H 107'  
GC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR D 357'  
GC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR X 130'  
GC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE BCR C 504'  
GC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR C 505'  
GC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR C 506'  
GC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE MGE I 201'  
GC7 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DGD C 507'  
GC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LHG A 567'  
GC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SQD A 568'  
HC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE DGD C 508'  
HC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DGD C 509'  
HC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MGE D 358'  
HC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE DGD H 208'  
HC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE MGE D 359'  
HC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE MGE L 210'  
HC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE MGE D 360'  
HC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SQD a 212'  
HC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SQD t 213'  
IC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MGE B 530'  
IC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE LMT A 569'  
IC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE LMT m 216'  
IC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE LMT T 217'  
IC5 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA a 5558' 
IC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CLA d 5354' 
IC7 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 5559' 
IC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 5560' 
IC9 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE PHO a 5561' 
JC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE PHO a 5562' 
JC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 5563' 
JC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA d 5355' 
JC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CLA b 5511' 
JC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA b 5512' 
JC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 5513' 
JC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 5514' 
JC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA b 5515' 
JC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA b 5516' 
KC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA b 5517' 
KC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA b 5518' 
KC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 5519' 
KC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 5520' 
KC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 5521' 
KC6 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA b 5522' 
KC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA b 5523' 
KC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA b 5524' 
KC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA b 5525' 
LC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA b 5526' 
LC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA c 5491' 
LC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA c 5492' 
LC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA c 5493' 
LC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA c 5494' 
LC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA c 5495' 
LC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA c 5496' 
LC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA c 5497' 
LC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA c 5498' 
MC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA c 5499' 
MC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA c 5500' 
MC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA c 5501' 
MC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA c 5502' 
MC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA c 5503' 
MC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM f 5051' 
MC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM v 5552' 
MC8 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PQ9 d 5356' 
MC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PQ9 a 5564' 
NC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE OEC a 5565' 
NC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR a 5566' 
NC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR b 5527' 
NC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE BCR T 5104' 
NC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR b 5528' 
NC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR b 5529' 
NC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR h 5107' 
NC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE BCR d 5357' 
NC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR x 5130' 
OC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR c 5504' 
OC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR c 5505' 
OC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BCR c 5506' 
OC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE MGE i 5201' 
OC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DGD c 5507' 
OC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LHG a 5567' 
OC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SQD d 5358' 
OC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE DGD c 5508' 
OC9 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DGD c 5509' 
PC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MGE d 5359' 
PC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE DGD h 5208' 
PC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MGE d 5360' 
PC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE MGE l 5210' 
PC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE MGE d 5361' 
PC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SQD A 5212' 
PC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SQD L 5213' 
PC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE MGE b 5530' 
PC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE LMT a 5568' 
QC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE LMT M 5216' 
QC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE LMT t 5217' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 3  ASP J  10  ? ASP K 19   . ? 1_555 ? 
2    AC1 3  ASP J  14  ? ASP K 23   . ? 1_555 ? 
3    AC1 3  UNK Q  2   ? UNK X 2    . ? 1_555 ? 
4    AC2 5  HIS A  215 ? HIS A 215  . ? 1_555 ? 
5    AC2 5  HIS A  272 ? HIS A 272  . ? 1_555 ? 
6    AC2 5  HIS D  214 ? HIS D 214  . ? 1_555 ? 
7    AC2 5  HIS D  268 ? HIS D 268  . ? 1_555 ? 
8    AC2 5  BCT CD .   ? BCT D 353  . ? 1_555 ? 
9    AC3 9  HIS A  215 ? HIS A 215  . ? 1_555 ? 
10   AC3 9  GLU A  244 ? GLU A 244  . ? 1_555 ? 
11   AC3 9  TYR A  246 ? TYR A 246  . ? 1_555 ? 
12   AC3 9  HIS A  272 ? HIS A 272  . ? 1_555 ? 
13   AC3 9  FE2 KA .   ? FE2 A 557  . ? 1_555 ? 
14   AC3 9  HIS D  214 ? HIS D 214  . ? 1_555 ? 
15   AC3 9  TYR D  244 ? TYR D 244  . ? 1_555 ? 
16   AC3 9  LYS D  264 ? LYS D 264  . ? 1_555 ? 
17   AC3 9  HIS D  268 ? HIS D 268  . ? 1_555 ? 
18   AC4 3  ASP BA 10  ? ASP k 5019 . ? 1_555 ? 
19   AC4 3  ASP BA 14  ? ASP k 5023 . ? 1_555 ? 
20   AC4 3  UNK IA 2   ? UNK x 5002 . ? 1_555 ? 
21   AC5 5  HIS S  215 ? HIS a 5215 . ? 1_555 ? 
22   AC5 5  HIS S  272 ? HIS a 5272 . ? 1_555 ? 
23   AC5 5  HIS V  214 ? HIS d 5214 . ? 1_555 ? 
24   AC5 5  HIS V  268 ? HIS d 5268 . ? 1_555 ? 
25   AC5 5  BCT NG .   ? BCT d 5353 . ? 1_555 ? 
26   AC6 9  HIS S  215 ? HIS a 5215 . ? 1_555 ? 
27   AC6 9  GLU S  244 ? GLU a 5244 . ? 1_555 ? 
28   AC6 9  TYR S  246 ? TYR a 5246 . ? 1_555 ? 
29   AC6 9  HIS S  272 ? HIS a 5272 . ? 1_555 ? 
30   AC6 9  FE2 WD .   ? FE2 a 5557 . ? 1_555 ? 
31   AC6 9  HIS V  214 ? HIS d 5214 . ? 1_555 ? 
32   AC6 9  TYR V  244 ? TYR d 5244 . ? 1_555 ? 
33   AC6 9  LYS V  264 ? LYS d 5264 . ? 1_555 ? 
34   AC6 9  HIS V  268 ? HIS d 5268 . ? 1_555 ? 
35   AC7 20 PHE A  119 ? PHE A 119  . ? 1_555 ? 
36   AC7 20 TYR A  147 ? TYR A 147  . ? 1_555 ? 
37   AC7 20 PRO A  150 ? PRO A 150  . ? 1_555 ? 
38   AC7 20 SER A  153 ? SER A 153  . ? 1_555 ? 
39   AC7 20 VAL A  157 ? VAL A 157  . ? 1_555 ? 
40   AC7 20 MET A  183 ? MET A 183  . ? 1_555 ? 
41   AC7 20 ILE A  184 ? ILE A 184  . ? 1_555 ? 
42   AC7 20 PHE A  186 ? PHE A 186  . ? 1_555 ? 
43   AC7 20 GLN A  187 ? GLN A 187  . ? 1_555 ? 
44   AC7 20 LEU A  193 ? LEU A 193  . ? 1_555 ? 
45   AC7 20 HIS A  198 ? HIS A 198  . ? 1_555 ? 
46   AC7 20 GLY A  201 ? GLY A 201  . ? 1_555 ? 
47   AC7 20 VAL A  205 ? VAL A 205  . ? 1_555 ? 
48   AC7 20 THR A  286 ? THR A 286  . ? 1_555 ? 
49   AC7 20 ILE A  290 ? ILE A 290  . ? 1_555 ? 
50   AC7 20 CLA MA .   ? CLA A 559  . ? 1_555 ? 
51   AC7 20 CLA NA .   ? CLA A 560  . ? 1_555 ? 
52   AC7 20 PHO OA .   ? PHO A 561  . ? 1_555 ? 
53   AC7 20 CLA DD .   ? CLA D 354  . ? 1_555 ? 
54   AC7 20 MGE JD .   ? MGE D 360  . ? 1_555 ? 
55   AC8 23 MET A  183 ? MET A 183  . ? 1_555 ? 
56   AC8 23 PHE A  206 ? PHE A 206  . ? 1_555 ? 
57   AC8 23 CLA LA .   ? CLA A 558  . ? 1_555 ? 
58   AC8 23 CLA MA .   ? CLA A 559  . ? 1_555 ? 
59   AC8 23 CLA NA .   ? CLA A 560  . ? 1_555 ? 
60   AC8 23 PHO PA .   ? PHO A 562  . ? 1_555 ? 
61   AC8 23 VAL D  152 ? VAL D 152  . ? 1_555 ? 
62   AC8 23 VAL D  156 ? VAL D 156  . ? 1_555 ? 
63   AC8 23 PHE D  181 ? PHE D 181  . ? 1_555 ? 
64   AC8 23 LEU D  182 ? LEU D 182  . ? 1_555 ? 
65   AC8 23 PHE D  185 ? PHE D 185  . ? 1_555 ? 
66   AC8 23 GLN D  186 ? GLN D 186  . ? 1_555 ? 
67   AC8 23 TRP D  191 ? TRP D 191  . ? 1_555 ? 
68   AC8 23 THR D  192 ? THR D 192  . ? 1_555 ? 
69   AC8 23 HIS D  197 ? HIS D 197  . ? 1_555 ? 
70   AC8 23 GLY D  200 ? GLY D 200  . ? 1_555 ? 
71   AC8 23 VAL D  201 ? VAL D 201  . ? 1_555 ? 
72   AC8 23 VAL D  204 ? VAL D 204  . ? 1_555 ? 
73   AC8 23 LEU D  279 ? LEU D 279  . ? 1_555 ? 
74   AC8 23 SER D  282 ? SER D 282  . ? 1_555 ? 
75   AC8 23 ALA D  283 ? ALA D 283  . ? 1_555 ? 
76   AC8 23 VAL D  286 ? VAL D 286  . ? 1_555 ? 
77   AC8 23 MGE HD .   ? MGE D 358  . ? 1_555 ? 
78   AC9 18 THR A  45  ? THR A 45   . ? 1_555 ? 
79   AC9 18 VAL A  157 ? VAL A 157  . ? 1_555 ? 
80   AC9 18 PHE A  158 ? PHE A 158  . ? 1_555 ? 
81   AC9 18 MET A  172 ? MET A 172  . ? 1_555 ? 
82   AC9 18 ILE A  176 ? ILE A 176  . ? 1_555 ? 
83   AC9 18 THR A  179 ? THR A 179  . ? 1_555 ? 
84   AC9 18 PHE A  180 ? PHE A 180  . ? 1_555 ? 
85   AC9 18 MET A  183 ? MET A 183  . ? 1_555 ? 
86   AC9 18 CLA LA .   ? CLA A 558  . ? 1_555 ? 
87   AC9 18 PHO OA .   ? PHO A 561  . ? 1_555 ? 
88   AC9 18 UNK SB .   ? UNK C 474  . ? 1_555 ? 
89   AC9 18 MET D  198 ? MET D 198  . ? 1_555 ? 
90   AC9 18 VAL D  201 ? VAL D 201  . ? 1_555 ? 
91   AC9 18 ALA D  202 ? ALA D 202  . ? 1_555 ? 
92   AC9 18 GLY D  206 ? GLY D 206  . ? 1_555 ? 
93   AC9 18 LEU D  209 ? LEU D 209  . ? 1_555 ? 
94   AC9 18 CLA DD .   ? CLA D 354  . ? 1_555 ? 
95   AC9 18 MGE PD .   ? MGE L 210  . ? 1_555 ? 
96   BC1 14 GLN A  199 ? GLN A 199  . ? 1_555 ? 
97   BC1 14 VAL A  202 ? VAL A 202  . ? 1_555 ? 
98   BC1 14 ALA A  203 ? ALA A 203  . ? 1_555 ? 
99   BC1 14 GLY A  207 ? GLY A 207  . ? 1_555 ? 
100  BC1 14 LEU A  210 ? LEU A 210  . ? 1_555 ? 
101  BC1 14 TRP A  278 ? TRP A 278  . ? 1_555 ? 
102  BC1 14 CLA LA .   ? CLA A 558  . ? 1_555 ? 
103  BC1 14 PHO PA .   ? PHO A 562  . ? 1_555 ? 
104  BC1 14 DGD BD .   ? DGD C 509  . ? 1_555 ? 
105  BC1 14 PHE D  157 ? PHE D 157  . ? 1_555 ? 
106  BC1 14 VAL D  175 ? VAL D 175  . ? 1_555 ? 
107  BC1 14 PHE D  179 ? PHE D 179  . ? 1_555 ? 
108  BC1 14 LEU D  182 ? LEU D 182  . ? 1_555 ? 
109  BC1 14 CLA DD .   ? CLA D 354  . ? 1_555 ? 
110  BC2 21 LEU A  41  ? LEU A 41   . ? 1_555 ? 
111  BC2 21 ALA A  44  ? ALA A 44   . ? 1_555 ? 
112  BC2 21 THR A  45  ? THR A 45   . ? 1_555 ? 
113  BC2 21 ILE A  115 ? ILE A 115  . ? 1_555 ? 
114  BC2 21 PHE A  119 ? PHE A 119  . ? 1_555 ? 
115  BC2 21 TYR A  126 ? TYR A 126  . ? 1_555 ? 
116  BC2 21 GLN A  130 ? GLN A 130  . ? 1_555 ? 
117  BC2 21 TYR A  147 ? TYR A 147  . ? 1_555 ? 
118  BC2 21 PRO A  150 ? PRO A 150  . ? 1_555 ? 
119  BC2 21 PHE A  158 ? PHE A 158  . ? 1_555 ? 
120  BC2 21 LEU A  174 ? LEU A 174  . ? 1_555 ? 
121  BC2 21 PRO A  279 ? PRO A 279  . ? 1_555 ? 
122  BC2 21 VAL A  283 ? VAL A 283  . ? 1_555 ? 
123  BC2 21 CLA LA .   ? CLA A 558  . ? 1_555 ? 
124  BC2 21 CLA MA .   ? CLA A 559  . ? 1_555 ? 
125  BC2 21 LEU D  205 ? LEU D 205  . ? 1_555 ? 
126  BC2 21 ALA D  208 ? ALA D 208  . ? 1_555 ? 
127  BC2 21 LEU D  209 ? LEU D 209  . ? 1_555 ? 
128  BC2 21 ILE D  213 ? ILE D 213  . ? 1_555 ? 
129  BC2 21 TRP D  253 ? TRP D 253  . ? 1_555 ? 
130  BC2 21 PHE D  257 ? PHE D 257  . ? 1_555 ? 
131  BC3 21 PHE A  206 ? PHE A 206  . ? 1_555 ? 
132  BC3 21 ALA A  209 ? ALA A 209  . ? 1_555 ? 
133  BC3 21 LEU A  210 ? LEU A 210  . ? 1_555 ? 
134  BC3 21 ALA A  213 ? ALA A 213  . ? 1_555 ? 
135  BC3 21 MET A  214 ? MET A 214  . ? 1_555 ? 
136  BC3 21 LEU A  258 ? LEU A 258  . ? 1_555 ? 
137  BC3 21 CLA NA .   ? CLA A 560  . ? 1_555 ? 
138  BC3 21 LEU D  37  ? LEU D 37   . ? 1_555 ? 
139  BC3 21 ALA D  41  ? ALA D 41   . ? 1_555 ? 
140  BC3 21 LEU D  45  ? LEU D 45   . ? 1_555 ? 
141  BC3 21 TRP D  48  ? TRP D 48   . ? 1_555 ? 
142  BC3 21 LEU D  122 ? LEU D 122  . ? 1_555 ? 
143  BC3 21 PHE D  125 ? PHE D 125  . ? 1_555 ? 
144  BC3 21 GLN D  129 ? GLN D 129  . ? 1_555 ? 
145  BC3 21 ASN D  142 ? ASN D 142  . ? 1_555 ? 
146  BC3 21 PHE D  146 ? PHE D 146  . ? 1_555 ? 
147  BC3 21 PRO D  149 ? PRO D 149  . ? 1_555 ? 
148  BC3 21 PHE D  153 ? PHE D 153  . ? 1_555 ? 
149  BC3 21 PRO D  275 ? PRO D 275  . ? 1_555 ? 
150  BC3 21 LEU D  279 ? LEU D 279  . ? 1_555 ? 
151  BC3 21 CLA DD .   ? CLA D 354  . ? 1_555 ? 
152  BC4 14 ILE A  36  ? ILE A 36   . ? 1_555 ? 
153  BC4 14 PRO A  39  ? PRO A 39   . ? 1_555 ? 
154  BC4 14 PHE A  93  ? PHE A 93   . ? 1_555 ? 
155  BC4 14 PRO A  95  ? PRO A 95   . ? 1_555 ? 
156  BC4 14 ILE A  96  ? ILE A 96   . ? 1_555 ? 
157  BC4 14 TRP A  97  ? TRP A 97   . ? 1_555 ? 
158  BC4 14 LEU A  114 ? LEU A 114  . ? 1_555 ? 
159  BC4 14 PHE A  117 ? PHE A 117  . ? 1_555 ? 
160  BC4 14 HIS A  118 ? HIS A 118  . ? 1_555 ? 
161  BC4 14 TYR H  9   ? TYR I 9    . ? 1_555 ? 
162  BC4 14 VAL H  12  ? VAL I 12   . ? 1_555 ? 
163  BC4 14 THR H  13  ? THR I 13   . ? 1_555 ? 
164  BC4 14 PHE H  15  ? PHE I 15   . ? 1_555 ? 
165  BC4 14 MGE ND .   ? MGE I 201  . ? 1_555 ? 
166  BC5 17 UNK YB .   ? UNK C 480  . ? 1_555 ? 
167  BC5 17 LEU D  36  ? LEU D 36   . ? 1_555 ? 
168  BC5 17 PRO D  39  ? PRO D 39   . ? 1_555 ? 
169  BC5 17 LEU D  43  ? LEU D 43   . ? 1_555 ? 
170  BC5 17 LEU D  89  ? LEU D 89   . ? 1_555 ? 
171  BC5 17 LEU D  90  ? LEU D 90   . ? 1_555 ? 
172  BC5 17 LEU D  91  ? LEU D 91   . ? 1_555 ? 
173  BC5 17 LEU D  92  ? LEU D 92   . ? 1_555 ? 
174  BC5 17 TRP D  93  ? TRP D 93   . ? 1_555 ? 
175  BC5 17 THR D  112 ? THR D 112  . ? 1_555 ? 
176  BC5 17 PHE D  113 ? PHE D 113  . ? 1_555 ? 
177  BC5 17 HIS D  117 ? HIS D 117  . ? 1_555 ? 
178  BC5 17 PHE D  120 ? PHE D 120  . ? 1_555 ? 
179  BC5 17 BCR GD .   ? BCR D 357  . ? 1_555 ? 
180  BC5 17 UNK Q  63  ? UNK X 63   . ? 1_555 ? 
181  BC5 17 UNK Q  64  ? UNK X 64   . ? 1_555 ? 
182  BC5 17 UNK Q  67  ? UNK X 67   . ? 1_555 ? 
183  BC6 5  TRP B  185 ? TRP B 185  . ? 1_555 ? 
184  BC6 5  PHE B  190 ? PHE B 190  . ? 1_555 ? 
185  BC6 5  CLA ZA .   ? CLA B 512  . ? 1_555 ? 
186  BC6 5  PHE G  41  ? PHE H 41   . ? 1_555 ? 
187  BC6 5  BCR LD .   ? BCR H 107  . ? 1_555 ? 
188  BC7 19 GLY B  189 ? GLY B 189  . ? 1_555 ? 
189  BC7 19 PHE B  190 ? PHE B 190  . ? 1_555 ? 
190  BC7 19 GLY B  197 ? GLY B 197  . ? 1_555 ? 
191  BC7 19 ALA B  200 ? ALA B 200  . ? 1_555 ? 
192  BC7 19 HIS B  201 ? HIS B 201  . ? 1_555 ? 
193  BC7 19 ALA B  204 ? ALA B 204  . ? 1_555 ? 
194  BC7 19 ALA B  205 ? ALA B 205  . ? 1_555 ? 
195  BC7 19 VAL B  208 ? VAL B 208  . ? 1_555 ? 
196  BC7 19 PHE B  247 ? PHE B 247  . ? 1_555 ? 
197  BC7 19 PHE B  250 ? PHE B 250  . ? 1_555 ? 
198  BC7 19 CLA YA .   ? CLA B 511  . ? 1_555 ? 
199  BC7 19 CLA AB .   ? CLA B 513  . ? 1_555 ? 
200  BC7 19 CLA FB .   ? CLA B 518  . ? 1_555 ? 
201  BC7 19 LEU D  158 ? LEU D 158  . ? 1_555 ? 
202  BC7 19 ILE D  159 ? ILE D 159  . ? 1_555 ? 
203  BC7 19 PHE G  38  ? PHE H 38   . ? 1_555 ? 
204  BC7 19 ILE G  45  ? ILE H 45   . ? 1_555 ? 
205  BC7 19 LEU G  46  ? LEU H 46   . ? 1_555 ? 
206  BC7 19 TYR G  49  ? TYR H 49   . ? 1_555 ? 
207  BC8 18 ARG B  68  ? ARG B 68   . ? 1_555 ? 
208  BC8 18 LEU B  69  ? LEU B 69   . ? 1_555 ? 
209  BC8 18 ALA B  146 ? ALA B 146  . ? 1_555 ? 
210  BC8 18 LEU B  149 ? LEU B 149  . ? 1_555 ? 
211  BC8 18 CYS B  150 ? CYS B 150  . ? 1_555 ? 
212  BC8 18 PHE B  153 ? PHE B 153  . ? 1_555 ? 
213  BC8 18 LEU B  158 ? LEU B 158  . ? 1_555 ? 
214  BC8 18 HIS B  201 ? HIS B 201  . ? 1_555 ? 
215  BC8 18 HIS B  202 ? HIS B 202  . ? 1_555 ? 
216  BC8 18 PHE B  247 ? PHE B 247  . ? 1_555 ? 
217  BC8 18 VAL B  252 ? VAL B 252  . ? 1_555 ? 
218  BC8 18 THR B  262 ? THR B 262  . ? 1_555 ? 
219  BC8 18 CLA ZA .   ? CLA B 512  . ? 1_555 ? 
220  BC8 18 CLA BB .   ? CLA B 514  . ? 1_555 ? 
221  BC8 18 CLA CB .   ? CLA B 515  . ? 1_555 ? 
222  BC8 18 CLA DB .   ? CLA B 516  . ? 1_555 ? 
223  BC8 18 PHE G  38  ? PHE H 38   . ? 1_555 ? 
224  BC8 18 LEU G  39  ? LEU H 39   . ? 1_555 ? 
225  BC9 19 TRP B  33  ? TRP B 33   . ? 1_555 ? 
226  BC9 19 PHE B  61  ? PHE B 61   . ? 1_555 ? 
227  BC9 19 PHE B  65  ? PHE B 65   . ? 1_555 ? 
228  BC9 19 ARG B  68  ? ARG B 68   . ? 1_555 ? 
229  BC9 19 LEU B  149 ? LEU B 149  . ? 1_555 ? 
230  BC9 19 VAL B  245 ? VAL B 245  . ? 1_555 ? 
231  BC9 19 ALA B  248 ? ALA B 248  . ? 1_555 ? 
232  BC9 19 ALA B  249 ? ALA B 249  . ? 1_555 ? 
233  BC9 19 VAL B  252 ? VAL B 252  . ? 1_555 ? 
234  BC9 19 PHE B  451 ? PHE B 451  . ? 1_555 ? 
235  BC9 19 HIS B  455 ? HIS B 455  . ? 1_555 ? 
236  BC9 19 PHE B  458 ? PHE B 458  . ? 1_555 ? 
237  BC9 19 PHE B  462 ? PHE B 462  . ? 1_555 ? 
238  BC9 19 CLA AB .   ? CLA B 513  . ? 1_555 ? 
239  BC9 19 CLA CB .   ? CLA B 515  . ? 1_555 ? 
240  BC9 19 CLA EB .   ? CLA B 517  . ? 1_555 ? 
241  BC9 19 CLA JB .   ? CLA B 522  . ? 1_555 ? 
242  BC9 19 CLA KB .   ? CLA B 523  . ? 1_555 ? 
243  BC9 19 CLA MB .   ? CLA B 525  . ? 1_555 ? 
244  CC1 18 THR B  27  ? THR B 27   . ? 1_555 ? 
245  CC1 18 VAL B  30  ? VAL B 30   . ? 1_555 ? 
246  CC1 18 ALA B  31  ? ALA B 31   . ? 1_555 ? 
247  CC1 18 TRP B  33  ? TRP B 33   . ? 1_555 ? 
248  CC1 18 ALA B  34  ? ALA B 34   . ? 1_555 ? 
249  CC1 18 VAL B  62  ? VAL B 62   . ? 1_555 ? 
250  CC1 18 PHE B  65  ? PHE B 65   . ? 1_555 ? 
251  CC1 18 MET B  66  ? MET B 66   . ? 1_555 ? 
252  CC1 18 ARG B  68  ? ARG B 68   . ? 1_555 ? 
253  CC1 18 LEU B  69  ? LEU B 69   . ? 1_555 ? 
254  CC1 18 VAL B  96  ? VAL B 96   . ? 1_555 ? 
255  CC1 18 HIS B  100 ? HIS B 100  . ? 1_555 ? 
256  CC1 18 GLY B  147 ? GLY B 147  . ? 1_555 ? 
257  CC1 18 ALA B  205 ? ALA B 205  . ? 1_555 ? 
258  CC1 18 CLA AB .   ? CLA B 513  . ? 1_555 ? 
259  CC1 18 CLA BB .   ? CLA B 514  . ? 1_555 ? 
260  CC1 18 CLA DB .   ? CLA B 516  . ? 1_555 ? 
261  CC1 18 CLA HB .   ? CLA B 520  . ? 1_555 ? 
262  CC2 16 LEU B  69  ? LEU B 69   . ? 1_555 ? 
263  CC2 16 GLY B  70  ? GLY B 70   . ? 1_555 ? 
264  CC2 16 TRP B  91  ? TRP B 91   . ? 1_555 ? 
265  CC2 16 ALA B  99  ? ALA B 99   . ? 1_555 ? 
266  CC2 16 HIS B  100 ? HIS B 100  . ? 1_555 ? 
267  CC2 16 LEU B  103 ? LEU B 103  . ? 1_555 ? 
268  CC2 16 GLY B  152 ? GLY B 152  . ? 1_555 ? 
269  CC2 16 PHE B  153 ? PHE B 153  . ? 1_555 ? 
270  CC2 16 PHE B  156 ? PHE B 156  . ? 1_555 ? 
271  CC2 16 HIS B  157 ? HIS B 157  . ? 1_555 ? 
272  CC2 16 PHE B  162 ? PHE B 162  . ? 1_555 ? 
273  CC2 16 GLY B  163 ? GLY B 163  . ? 1_555 ? 
274  CC2 16 PRO B  164 ? PRO B 164  . ? 1_555 ? 
275  CC2 16 CLA AB .   ? CLA B 513  . ? 1_555 ? 
276  CC2 16 CLA CB .   ? CLA B 515  . ? 1_555 ? 
277  CC2 16 BCR QB .   ? BCR B 529  . ? 1_555 ? 
278  CC3 20 TRP B  33  ? TRP B 33   . ? 1_555 ? 
279  CC3 20 TYR B  40  ? TYR B 40   . ? 1_555 ? 
280  CC3 20 GLN B  58  ? GLN B 58   . ? 1_555 ? 
281  CC3 20 GLY B  59  ? GLY B 59   . ? 1_555 ? 
282  CC3 20 PHE B  61  ? PHE B 61   . ? 1_555 ? 
283  CC3 20 LEU B  324 ? LEU B 324  . ? 1_555 ? 
284  CC3 20 PHE B  325 ? PHE B 325  . ? 1_555 ? 
285  CC3 20 THR B  327 ? THR B 327  . ? 1_555 ? 
286  CC3 20 GLY B  328 ? GLY B 328  . ? 1_555 ? 
287  CC3 20 PRO B  329 ? PRO B 329  . ? 1_555 ? 
288  CC3 20 TRP B  450 ? TRP B 450  . ? 1_555 ? 
289  CC3 20 PHE B  451 ? PHE B 451  . ? 1_555 ? 
290  CC3 20 HIS B  455 ? HIS B 455  . ? 1_555 ? 
291  CC3 20 CLA BB .   ? CLA B 514  . ? 1_555 ? 
292  CC3 20 MGE RB .   ? MGE B 530  . ? 1_555 ? 
293  CC3 20 PHE D  196 ? PHE D 196  . ? 1_555 ? 
294  CC3 20 MET D  281 ? MET D 281  . ? 1_555 ? 
295  CC3 20 LEU K  27  ? LEU L 27   . ? 1_555 ? 
296  CC3 20 PHE L  14  ? PHE M 14   . ? 1_555 ? 
297  CC3 20 BCR DH .   ? BCR t 104  . ? 1_555 ? 
298  CC4 18 THR B  236 ? THR B 236  . ? 1_555 ? 
299  CC4 18 SER B  239 ? SER B 239  . ? 1_555 ? 
300  CC4 18 ALA B  243 ? ALA B 243  . ? 1_555 ? 
301  CC4 18 PHE B  246 ? PHE B 246  . ? 1_555 ? 
302  CC4 18 PHE B  463 ? PHE B 463  . ? 1_555 ? 
303  CC4 18 HIS B  466 ? HIS B 466  . ? 1_555 ? 
304  CC4 18 LEU B  474 ? LEU B 474  . ? 1_555 ? 
305  CC4 18 CLA ZA .   ? CLA B 512  . ? 1_555 ? 
306  CC4 18 CLA GB .   ? CLA B 519  . ? 1_555 ? 
307  CC4 18 CLA HB .   ? CLA B 520  . ? 1_555 ? 
308  CC4 18 UNK ZB .   ? UNK C 481  . ? 1_555 ? 
309  CC4 18 UNK AC .   ? UNK C 482  . ? 1_555 ? 
310  CC4 18 ILE D  123 ? ILE D 123  . ? 1_555 ? 
311  CC4 18 MET D  126 ? MET D 126  . ? 1_555 ? 
312  CC4 18 LEU D  127 ? LEU D 127  . ? 1_555 ? 
313  CC4 18 PHE D  130 ? PHE D 130  . ? 1_555 ? 
314  CC4 18 LEU G  43  ? LEU H 43   . ? 1_555 ? 
315  CC4 18 LEU G  46  ? LEU H 46   . ? 1_555 ? 
316  CC5 13 PHE B  139 ? PHE B 139  . ? 1_555 ? 
317  CC5 13 ALA B  212 ? ALA B 212  . ? 1_555 ? 
318  CC5 13 PHE B  215 ? PHE B 215  . ? 1_555 ? 
319  CC5 13 HIS B  216 ? HIS B 216  . ? 1_555 ? 
320  CC5 13 PRO B  221 ? PRO B 221  . ? 1_555 ? 
321  CC5 13 LEU B  229 ? LEU B 229  . ? 1_555 ? 
322  CC5 13 CLA FB .   ? CLA B 518  . ? 1_555 ? 
323  CC5 13 CLA HB .   ? CLA B 520  . ? 1_555 ? 
324  CC5 13 THR G  27  ? THR H 27   . ? 1_555 ? 
325  CC5 13 THR G  28  ? THR H 28   . ? 1_555 ? 
326  CC5 13 MET G  31  ? MET H 31   . ? 1_555 ? 
327  CC5 13 PHE G  34  ? PHE H 34   . ? 1_555 ? 
328  CC5 13 BCR LD .   ? BCR H 107  . ? 1_555 ? 
329  CC6 13 LEU B  135 ? LEU B 135  . ? 1_555 ? 
330  CC6 13 PRO B  136 ? PRO B 136  . ? 1_555 ? 
331  CC6 13 PHE B  139 ? PHE B 139  . ? 1_555 ? 
332  CC6 13 HIS B  142 ? HIS B 142  . ? 1_555 ? 
333  CC6 13 MET B  231 ? MET B 231  . ? 1_555 ? 
334  CC6 13 VAL B  237 ? VAL B 237  . ? 1_555 ? 
335  CC6 13 SER B  240 ? SER B 240  . ? 1_555 ? 
336  CC6 13 SER B  241 ? SER B 241  . ? 1_555 ? 
337  CC6 13 CLA CB .   ? CLA B 515  . ? 1_555 ? 
338  CC6 13 CLA FB .   ? CLA B 518  . ? 1_555 ? 
339  CC6 13 CLA GB .   ? CLA B 519  . ? 1_555 ? 
340  CC6 13 CLA JB .   ? CLA B 522  . ? 1_555 ? 
341  CC6 13 CLA MB .   ? CLA B 525  . ? 1_555 ? 
342  CC7 19 TRP B  5   ? TRP B 5    . ? 1_555 ? 
343  CC7 19 TYR B  6   ? TYR B 6    . ? 1_555 ? 
344  CC7 19 ARG B  7   ? ARG B 7    . ? 1_555 ? 
345  CC7 19 VAL B  8   ? VAL B 8    . ? 1_555 ? 
346  CC7 19 HIS B  9   ? HIS B 9    . ? 1_555 ? 
347  CC7 19 LEU B  238 ? LEU B 238  . ? 1_555 ? 
348  CC7 19 ILE B  242 ? ILE B 242  . ? 1_555 ? 
349  CC7 19 LEU B  461 ? LEU B 461  . ? 1_555 ? 
350  CC7 19 PHE B  462 ? PHE B 462  . ? 1_555 ? 
351  CC7 19 PHE B  464 ? PHE B 464  . ? 1_555 ? 
352  CC7 19 GLY B  465 ? GLY B 465  . ? 1_555 ? 
353  CC7 19 TRP B  468 ? TRP B 468  . ? 1_555 ? 
354  CC7 19 HIS B  469 ? HIS B 469  . ? 1_555 ? 
355  CC7 19 ARG B  472 ? ARG B 472  . ? 1_555 ? 
356  CC7 19 PHE B  479 ? PHE B 479  . ? 1_555 ? 
357  CC7 19 CLA JB .   ? CLA B 522  . ? 1_555 ? 
358  CC7 19 CLA KB .   ? CLA B 523  . ? 1_555 ? 
359  CC7 19 CLA LB .   ? CLA B 524  . ? 1_555 ? 
360  CC7 19 MGE ID .   ? MGE D 359  . ? 1_555 ? 
361  CC8 16 HIS B  9   ? HIS B 9    . ? 1_555 ? 
362  CC8 16 LEU B  12  ? LEU B 12   . ? 1_555 ? 
363  CC8 16 LEU B  19  ? LEU B 19   . ? 1_555 ? 
364  CC8 16 ALA B  22  ? ALA B 22   . ? 1_555 ? 
365  CC8 16 HIS B  23  ? HIS B 23   . ? 1_555 ? 
366  CC8 16 HIS B  26  ? HIS B 26   . ? 1_555 ? 
367  CC8 16 THR B  27  ? THR B 27   . ? 1_555 ? 
368  CC8 16 VAL B  237 ? VAL B 237  . ? 1_555 ? 
369  CC8 16 LEU B  238 ? LEU B 238  . ? 1_555 ? 
370  CC8 16 SER B  241 ? SER B 241  . ? 1_555 ? 
371  CC8 16 VAL B  245 ? VAL B 245  . ? 1_555 ? 
372  CC8 16 CLA BB .   ? CLA B 514  . ? 1_555 ? 
373  CC8 16 CLA HB .   ? CLA B 520  . ? 1_555 ? 
374  CC8 16 CLA IB .   ? CLA B 521  . ? 1_555 ? 
375  CC8 16 CLA KB .   ? CLA B 523  . ? 1_555 ? 
376  CC8 16 CLA MB .   ? CLA B 525  . ? 1_555 ? 
377  CC9 11 HIS B  9   ? HIS B 9    . ? 1_555 ? 
378  CC9 11 HIS B  26  ? HIS B 26   . ? 1_555 ? 
379  CC9 11 VAL B  30  ? VAL B 30   . ? 1_555 ? 
380  CC9 11 PHE B  462 ? PHE B 462  . ? 1_555 ? 
381  CC9 11 CLA BB .   ? CLA B 514  . ? 1_555 ? 
382  CC9 11 CLA IB .   ? CLA B 521  . ? 1_555 ? 
383  CC9 11 CLA JB .   ? CLA B 522  . ? 1_555 ? 
384  CC9 11 CLA LB .   ? CLA B 524  . ? 1_555 ? 
385  CC9 11 BCR OB .   ? BCR B 527  . ? 1_555 ? 
386  CC9 11 BCR PB .   ? BCR B 528  . ? 1_555 ? 
387  CC9 11 MGE ID .   ? MGE D 359  . ? 1_555 ? 
388  DC1 15 VAL B  8   ? VAL B 8    . ? 1_555 ? 
389  DC1 15 HIS B  9   ? HIS B 9    . ? 1_555 ? 
390  DC1 15 LEU B  12  ? LEU B 12   . ? 1_555 ? 
391  DC1 15 ALA B  22  ? ALA B 22   . ? 1_555 ? 
392  DC1 15 MET B  25  ? MET B 25   . ? 1_555 ? 
393  DC1 15 LEU B  29  ? LEU B 29   . ? 1_555 ? 
394  DC1 15 TRP B  115 ? TRP B 115  . ? 1_555 ? 
395  DC1 15 CLA IB .   ? CLA B 521  . ? 1_555 ? 
396  DC1 15 CLA KB .   ? CLA B 523  . ? 1_555 ? 
397  DC1 15 BCR OB .   ? BCR B 527  . ? 1_555 ? 
398  DC1 15 ARG K  7   ? ARG L 7    . ? 1_555 ? 
399  DC1 15 VAL K  10  ? VAL L 10   . ? 1_555 ? 
400  DC1 15 MGE PD .   ? MGE L 210  . ? 1_555 ? 
401  DC1 15 UNK EF .   ? UNK c 5475 . ? 1_555 ? 
402  DC1 15 UNK FF .   ? UNK c 5476 . ? 1_555 ? 
403  DC2 11 ILE B  20  ? ILE B 20   . ? 1_555 ? 
404  DC2 11 HIS B  23  ? HIS B 23   . ? 1_555 ? 
405  DC2 11 MET B  138 ? MET B 138  . ? 1_555 ? 
406  DC2 11 ILE B  141 ? ILE B 141  . ? 1_555 ? 
407  DC2 11 HIS B  142 ? HIS B 142  . ? 1_555 ? 
408  DC2 11 LEU B  145 ? LEU B 145  . ? 1_555 ? 
409  DC2 11 CLA BB .   ? CLA B 514  . ? 1_555 ? 
410  DC2 11 CLA HB .   ? CLA B 520  . ? 1_555 ? 
411  DC2 11 CLA JB .   ? CLA B 522  . ? 1_555 ? 
412  DC2 11 CLA NB .   ? CLA B 526  . ? 1_555 ? 
413  DC2 11 LEU G  14  ? LEU H 14   . ? 1_555 ? 
414  DC3 9  ILE B  20  ? ILE B 20   . ? 1_555 ? 
415  DC3 9  LEU B  24  ? LEU B 24   . ? 1_555 ? 
416  DC3 9  ALA B  110 ? ALA B 110  . ? 1_555 ? 
417  DC3 9  TRP B  113 ? TRP B 113  . ? 1_555 ? 
418  DC3 9  HIS B  114 ? HIS B 114  . ? 1_555 ? 
419  DC3 9  LEU B  120 ? LEU B 120  . ? 1_555 ? 
420  DC3 9  CLA MB .   ? CLA B 525  . ? 1_555 ? 
421  DC3 9  THR G  5   ? THR H 5    . ? 1_555 ? 
422  DC3 9  LEU G  7   ? LEU H 7    . ? 1_555 ? 
423  DC4 16 LEU C  95  ? LEU C 95   . ? 1_555 ? 
424  DC4 16 LEU C  168 ? LEU C 168  . ? 1_555 ? 
425  DC4 16 GLY C  171 ? GLY C 171  . ? 1_555 ? 
426  DC4 16 ALA C  172 ? ALA C 172  . ? 1_555 ? 
427  DC4 16 ILE C  224 ? ILE C 224  . ? 1_555 ? 
428  DC4 16 VAL C  233 ? VAL C 233  . ? 1_555 ? 
429  DC4 16 HIS C  237 ? HIS C 237  . ? 1_555 ? 
430  DC4 16 ILE C  240 ? ILE C 240  . ? 1_555 ? 
431  DC4 16 ALA C  278 ? ALA C 278  . ? 1_555 ? 
432  DC4 16 MET C  281 ? MET C 281  . ? 1_555 ? 
433  DC4 16 MET C  282 ? MET C 282  . ? 1_555 ? 
434  DC4 16 VAL C  296 ? VAL C 296  . ? 1_555 ? 
435  DC4 16 TYR C  297 ? TYR C 297  . ? 1_555 ? 
436  DC4 16 CLA KC .   ? CLA C 492  . ? 1_555 ? 
437  DC4 16 CLA LC .   ? CLA C 493  . ? 1_555 ? 
438  DC4 16 BCR YC .   ? BCR C 506  . ? 1_555 ? 
439  DC5 14 TRP C  63  ? TRP C 63   . ? 1_555 ? 
440  DC5 14 HIS C  91  ? HIS C 91   . ? 1_555 ? 
441  DC5 14 GLY C  171 ? GLY C 171  . ? 1_555 ? 
442  DC5 14 LEU C  175 ? LEU C 175  . ? 1_555 ? 
443  DC5 14 LYS C  178 ? LYS C 178  . ? 1_555 ? 
444  DC5 14 ALA C  286 ? ALA C 286  . ? 1_555 ? 
445  DC5 14 TYR C  297 ? TYR C 297  . ? 1_555 ? 
446  DC5 14 HIS C  430 ? HIS C 430  . ? 1_555 ? 
447  DC5 14 LEU C  433 ? LEU C 433  . ? 1_555 ? 
448  DC5 14 PHE C  437 ? PHE C 437  . ? 1_555 ? 
449  DC5 14 CLA JC .   ? CLA C 491  . ? 1_555 ? 
450  DC5 14 CLA LC .   ? CLA C 493  . ? 1_555 ? 
451  DC5 14 CLA MC .   ? CLA C 494  . ? 1_555 ? 
452  DC5 14 CLA SC .   ? CLA C 500  . ? 1_555 ? 
453  DC6 16 ILE C  60  ? ILE C 60   . ? 1_555 ? 
454  DC6 16 VAL C  61  ? VAL C 61   . ? 1_555 ? 
455  DC6 16 ALA C  64  ? ALA C 64   . ? 1_555 ? 
456  DC6 16 THR C  68  ? THR C 68   . ? 1_555 ? 
457  DC6 16 LEU C  88  ? LEU C 88   . ? 1_555 ? 
458  DC6 16 HIS C  91  ? HIS C 91   . ? 1_555 ? 
459  DC6 16 ILE C  92  ? ILE C 92   . ? 1_555 ? 
460  DC6 16 LEU C  95  ? LEU C 95   . ? 1_555 ? 
461  DC6 16 VAL C  114 ? VAL C 114  . ? 1_555 ? 
462  DC6 16 HIS C  118 ? HIS C 118  . ? 1_555 ? 
463  DC6 16 LEU C  279 ? LEU C 279  . ? 1_555 ? 
464  DC6 16 UNK VB .   ? UNK C 477  . ? 1_555 ? 
465  DC6 16 CLA JC .   ? CLA C 491  . ? 1_555 ? 
466  DC6 16 CLA KC .   ? CLA C 492  . ? 1_555 ? 
467  DC6 16 CLA SC .   ? CLA C 500  . ? 1_555 ? 
468  DC6 16 CLA UC .   ? CLA C 502  . ? 1_555 ? 
469  DC7 14 TRP C  63  ? TRP C 63   . ? 1_555 ? 
470  DC7 14 MET C  67  ? MET C 67   . ? 1_555 ? 
471  DC7 14 PHE C  70  ? PHE C 70   . ? 1_555 ? 
472  DC7 14 GLY C  85  ? GLY C 85   . ? 1_555 ? 
473  DC7 14 ILE C  87  ? ILE C 87   . ? 1_555 ? 
474  DC7 14 SER C  406 ? SER C 406  . ? 1_555 ? 
475  DC7 14 TRP C  425 ? TRP C 425  . ? 1_555 ? 
476  DC7 14 SER C  429 ? SER C 429  . ? 1_555 ? 
477  DC7 14 HIS C  430 ? HIS C 430  . ? 1_555 ? 
478  DC7 14 UNK WB .   ? UNK C 478  . ? 1_555 ? 
479  DC7 14 CLA KC .   ? CLA C 492  . ? 1_555 ? 
480  DC7 14 CLA SC .   ? CLA C 500  . ? 1_555 ? 
481  DC7 14 DGD AD .   ? DGD C 508  . ? 1_555 ? 
482  DC7 14 PRO J  17  ? PRO K 26   . ? 1_555 ? 
483  DC8 15 ILE A  36  ? ILE A 36   . ? 1_555 ? 
484  DC8 15 SER A  124 ? SER A 124  . ? 1_555 ? 
485  DC8 15 MET A  127 ? MET A 127  . ? 1_555 ? 
486  DC8 15 TRP A  131 ? TRP A 131  . ? 1_555 ? 
487  DC8 15 ILE C  265 ? ILE C 265  . ? 1_555 ? 
488  DC8 15 TYR C  274 ? TYR C 274  . ? 1_555 ? 
489  DC8 15 GLY C  277 ? GLY C 277  . ? 1_555 ? 
490  DC8 15 ALA C  278 ? ALA C 278  . ? 1_555 ? 
491  DC8 15 LEU C  438 ? LEU C 438  . ? 1_555 ? 
492  DC8 15 HIS C  441 ? HIS C 441  . ? 1_555 ? 
493  DC8 15 LEU C  442 ? LEU C 442  . ? 1_555 ? 
494  DC8 15 ALA C  445 ? ALA C 445  . ? 1_555 ? 
495  DC8 15 ARG C  449 ? ARG C 449  . ? 1_555 ? 
496  DC8 15 CLA PC .   ? CLA C 497  . ? 1_555 ? 
497  DC8 15 PHE H  23  ? PHE I 23   . ? 1_555 ? 
498  DC9 12 LEU C  165 ? LEU C 165  . ? 1_555 ? 
499  DC9 12 ILE C  243 ? ILE C 243  . ? 1_555 ? 
500  DC9 12 GLY C  247 ? GLY C 247  . ? 1_555 ? 
501  DC9 12 TRP C  250 ? TRP C 250  . ? 1_555 ? 
502  DC9 12 HIS C  251 ? HIS C 251  . ? 1_555 ? 
503  DC9 12 PRO C  256 ? PRO C 256  . ? 1_555 ? 
504  DC9 12 PHE C  257 ? PHE C 257  . ? 1_555 ? 
505  DC9 12 TRP C  259 ? TRP C 259  . ? 1_555 ? 
506  DC9 12 PHE C  264 ? PHE C 264  . ? 1_555 ? 
507  DC9 12 CLA PC .   ? CLA C 497  . ? 1_555 ? 
508  DC9 12 BCR YC .   ? BCR C 506  . ? 1_555 ? 
509  DC9 12 LEU H  24  ? LEU I 24   . ? 1_555 ? 
510  EC1 14 MET C  157 ? MET C 157  . ? 1_555 ? 
511  EC1 14 LEU C  161 ? LEU C 161  . ? 1_555 ? 
512  EC1 14 HIS C  164 ? HIS C 164  . ? 1_555 ? 
513  EC1 14 LEU C  168 ? LEU C 168  . ? 1_555 ? 
514  EC1 14 PHE C  264 ? PHE C 264  . ? 1_555 ? 
515  EC1 14 TRP C  266 ? TRP C 266  . ? 1_555 ? 
516  EC1 14 TYR C  271 ? TYR C 271  . ? 1_555 ? 
517  EC1 14 TYR C  274 ? TYR C 274  . ? 1_555 ? 
518  EC1 14 SER C  275 ? SER C 275  . ? 1_555 ? 
519  EC1 14 LEU C  279 ? LEU C 279  . ? 1_555 ? 
520  EC1 14 MET C  282 ? MET C 282  . ? 1_555 ? 
521  EC1 14 CLA NC .   ? CLA C 495  . ? 1_555 ? 
522  EC1 14 CLA OC .   ? CLA C 496  . ? 1_555 ? 
523  EC1 14 CLA RC .   ? CLA C 499  . ? 1_555 ? 
524  EC2 15 LHG UA .   ? LHG A 567  . ? 1_555 ? 
525  EC2 15 TRP C  36  ? TRP C 36   . ? 1_555 ? 
526  EC2 15 ALA C  37  ? ALA C 37   . ? 1_555 ? 
527  EC2 15 ASN C  39  ? ASN C 39   . ? 1_555 ? 
528  EC2 15 ALA C  40  ? ALA C 40   . ? 1_555 ? 
529  EC2 15 GLU C  269 ? GLU C 269  . ? 1_555 ? 
530  EC2 15 LEU C  276 ? LEU C 276  . ? 1_555 ? 
531  EC2 15 PHE C  436 ? PHE C 436  . ? 1_555 ? 
532  EC2 15 PHE C  437 ? PHE C 437  . ? 1_555 ? 
533  EC2 15 GLY C  440 ? GLY C 440  . ? 1_555 ? 
534  EC2 15 TRP C  443 ? TRP C 443  . ? 1_555 ? 
535  EC2 15 HIS C  444 ? HIS C 444  . ? 1_555 ? 
536  EC2 15 ARG C  447 ? ARG C 447  . ? 1_555 ? 
537  EC2 15 CLA RC .   ? CLA C 499  . ? 1_555 ? 
538  EC2 15 CLA SC .   ? CLA C 500  . ? 1_555 ? 
539  EC3 11 ASN C  39  ? ASN C 39   . ? 1_555 ? 
540  EC3 11 LEU C  49  ? LEU C 49   . ? 1_555 ? 
541  EC3 11 ALA C  52  ? ALA C 52   . ? 1_555 ? 
542  EC3 11 HIS C  53  ? HIS C 53   . ? 1_555 ? 
543  EC3 11 HIS C  56  ? HIS C 56   . ? 1_555 ? 
544  EC3 11 GLY C  268 ? GLY C 268  . ? 1_555 ? 
545  EC3 11 GLU C  269 ? GLU C 269  . ? 1_555 ? 
546  EC3 11 SER C  275 ? SER C 275  . ? 1_555 ? 
547  EC3 11 CLA PC .   ? CLA C 497  . ? 1_555 ? 
548  EC3 11 CLA QC .   ? CLA C 498  . ? 1_555 ? 
549  EC3 11 CLA SC .   ? CLA C 500  . ? 1_555 ? 
550  EC4 15 ASN C  39  ? ASN C 39   . ? 1_555 ? 
551  EC4 15 HIS C  56  ? HIS C 56   . ? 1_555 ? 
552  EC4 15 LEU C  59  ? LEU C 59   . ? 1_555 ? 
553  EC4 15 LEU C  279 ? LEU C 279  . ? 1_555 ? 
554  EC4 15 PHE C  436 ? PHE C 436  . ? 1_555 ? 
555  EC4 15 PHE C  437 ? PHE C 437  . ? 1_555 ? 
556  EC4 15 CLA KC .   ? CLA C 492  . ? 1_555 ? 
557  EC4 15 CLA LC .   ? CLA C 493  . ? 1_555 ? 
558  EC4 15 CLA MC .   ? CLA C 494  . ? 1_555 ? 
559  EC4 15 CLA QC .   ? CLA C 498  . ? 1_555 ? 
560  EC4 15 CLA RC .   ? CLA C 499  . ? 1_555 ? 
561  EC4 15 CLA TC .   ? CLA C 501  . ? 1_555 ? 
562  EC4 15 PRO J  20  ? PRO K 29   . ? 1_555 ? 
563  EC4 15 VAL J  21  ? VAL K 30   . ? 1_555 ? 
564  EC4 15 LEU J  24  ? LEU K 33   . ? 1_555 ? 
565  EC5 19 ASP C  27  ? ASP C 27   . ? 1_555 ? 
566  EC5 19 TRP C  35  ? TRP C 35   . ? 1_555 ? 
567  EC5 19 GLY C  38  ? GLY C 38   . ? 1_555 ? 
568  EC5 19 ASN C  39  ? ASN C 39   . ? 1_555 ? 
569  EC5 19 ARG C  41  ? ARG C 41   . ? 1_555 ? 
570  EC5 19 LEU C  42  ? LEU C 42   . ? 1_555 ? 
571  EC5 19 LEU C  45  ? LEU C 45   . ? 1_555 ? 
572  EC5 19 LYS C  48  ? LYS C 48   . ? 1_555 ? 
573  EC5 19 ALA C  52  ? ALA C 52   . ? 1_555 ? 
574  EC5 19 PHE C  127 ? PHE C 127  . ? 1_555 ? 
575  EC5 19 ALA C  133 ? ALA C 133  . ? 1_555 ? 
576  EC5 19 ILE C  134 ? ILE C 134  . ? 1_555 ? 
577  EC5 19 CLA SC .   ? CLA C 500  . ? 1_555 ? 
578  EC5 19 BCR WC .   ? BCR C 504  . ? 1_555 ? 
579  EC5 19 TRP J  30  ? TRP K 39   . ? 1_555 ? 
580  EC5 19 GLN J  31  ? GLN K 40   . ? 1_555 ? 
581  EC5 19 UNK Q  31  ? UNK X 31   . ? 1_555 ? 
582  EC5 19 VAL R  20  ? VAL Z 20   . ? 1_555 ? 
583  EC5 19 PRO R  24  ? PRO Z 24   . ? 1_555 ? 
584  EC6 10 HIS C  53  ? HIS C 53   . ? 1_555 ? 
585  EC6 10 PHE C  147 ? PHE C 147  . ? 1_555 ? 
586  EC6 10 PHE C  163 ? PHE C 163  . ? 1_555 ? 
587  EC6 10 HIS C  164 ? HIS C 164  . ? 1_555 ? 
588  EC6 10 VAL C  167 ? VAL C 167  . ? 1_555 ? 
589  EC6 10 LEU C  168 ? LEU C 168  . ? 1_555 ? 
590  EC6 10 GLY C  171 ? GLY C 171  . ? 1_555 ? 
591  EC6 10 CLA LC .   ? CLA C 493  . ? 1_555 ? 
592  EC6 10 CLA VC .   ? CLA C 503  . ? 1_555 ? 
593  EC6 10 BCR XC .   ? BCR C 505  . ? 1_555 ? 
594  EC7 9  LEU C  50  ? LEU C 50   . ? 1_555 ? 
595  EC7 9  GLY C  128 ? GLY C 128  . ? 1_555 ? 
596  EC7 9  TYR C  131 ? TYR C 131  . ? 1_555 ? 
597  EC7 9  HIS C  132 ? HIS C 132  . ? 1_555 ? 
598  EC7 9  PRO C  137 ? PRO C 137  . ? 1_555 ? 
599  EC7 9  LEU C  140 ? LEU C 140  . ? 1_555 ? 
600  EC7 9  PHE C  147 ? PHE C 147  . ? 1_555 ? 
601  EC7 9  CLA UC .   ? CLA C 502  . ? 1_555 ? 
602  EC7 9  BCR XC .   ? BCR C 505  . ? 1_555 ? 
603  EC8 12 ILE E  13  ? ILE E 13   . ? 1_555 ? 
604  EC8 12 ARG E  18  ? ARG E 18   . ? 1_555 ? 
605  EC8 12 TYR E  19  ? TYR E 19   . ? 1_555 ? 
606  EC8 12 HIS E  23  ? HIS E 23   . ? 1_555 ? 
607  EC8 12 THR E  26  ? THR E 26   . ? 1_555 ? 
608  EC8 12 ILE E  27  ? ILE E 27   . ? 1_555 ? 
609  EC8 12 ARG F  19  ? ARG F 19   . ? 1_555 ? 
610  EC8 12 TRP F  20  ? TRP F 20   . ? 1_555 ? 
611  EC8 12 HIS F  24  ? HIS F 24   . ? 1_555 ? 
612  EC8 12 ALA F  27  ? ALA F 27   . ? 1_555 ? 
613  EC8 12 ILE F  31  ? ILE F 31   . ? 1_555 ? 
614  EC8 12 UNK Q  116 ? UNK X 116  . ? 1_555 ? 
615  EC9 12 ALA P  36  ? ALA V 62   . ? 1_555 ? 
616  EC9 12 CYS P  37  ? CYS V 63   . ? 1_555 ? 
617  EC9 12 CYS P  40  ? CYS V 66   . ? 1_555 ? 
618  EC9 12 HIS P  41  ? HIS V 67   . ? 1_555 ? 
619  EC9 12 THR P  48  ? THR V 74   . ? 1_555 ? 
620  EC9 12 LEU P  52  ? LEU V 78   . ? 1_555 ? 
621  EC9 12 ASP P  53  ? ASP V 79   . ? 1_555 ? 
622  EC9 12 LEU P  54  ? LEU V 80   . ? 1_555 ? 
623  EC9 12 THR P  58  ? THR V 84   . ? 1_555 ? 
624  EC9 12 TYR P  75  ? TYR V 101  . ? 1_555 ? 
625  EC9 12 TYR P  82  ? TYR V 108  . ? 1_555 ? 
626  EC9 12 HIS P  92  ? HIS V 118  . ? 1_555 ? 
627  FC1 12 UNK SB .   ? UNK C 474  . ? 1_555 ? 
628  FC1 12 LEU D  209 ? LEU D 209  . ? 1_555 ? 
629  FC1 12 LEU D  210 ? LEU D 210  . ? 1_555 ? 
630  FC1 12 HIS D  214 ? HIS D 214  . ? 1_555 ? 
631  FC1 12 THR D  217 ? THR D 217  . ? 1_555 ? 
632  FC1 12 ASN D  250 ? ASN D 250  . ? 1_555 ? 
633  FC1 12 TRP D  253 ? TRP D 253  . ? 1_555 ? 
634  FC1 12 ALA D  260 ? ALA D 260  . ? 1_555 ? 
635  FC1 12 PHE D  261 ? PHE D 261  . ? 1_555 ? 
636  FC1 12 LEU D  267 ? LEU D 267  . ? 1_555 ? 
637  FC1 12 PHE D  270 ? PHE D 270  . ? 1_555 ? 
638  FC1 12 VAL D  274 ? VAL D 274  . ? 1_555 ? 
639  FC2 9  HIS A  215 ? HIS A 215  . ? 1_555 ? 
640  FC2 9  LEU A  218 ? LEU A 218  . ? 1_555 ? 
641  FC2 9  ALA A  251 ? ALA A 251  . ? 1_555 ? 
642  FC2 9  HIS A  252 ? HIS A 252  . ? 1_555 ? 
643  FC2 9  PHE A  255 ? PHE A 255  . ? 1_555 ? 
644  FC2 9  SER A  264 ? SER A 264  . ? 1_555 ? 
645  FC2 9  PHE A  265 ? PHE A 265  . ? 1_555 ? 
646  FC2 9  LEU A  271 ? LEU A 271  . ? 1_555 ? 
647  FC2 9  PHE A  274 ? PHE A 274  . ? 1_555 ? 
648  FC3 7  ASP A  170 ? ASP A 170  . ? 1_555 ? 
649  FC3 7  GLU A  189 ? GLU A 189  . ? 1_555 ? 
650  FC3 7  HIS A  332 ? HIS A 332  . ? 1_555 ? 
651  FC3 7  GLU A  333 ? GLU A 333  . ? 1_555 ? 
652  FC3 7  ASP A  342 ? ASP A 342  . ? 1_555 ? 
653  FC3 7  ALA A  344 ? ALA A 344  . ? 1_555 ? 
654  FC3 7  GLU C  354 ? GLU C 354  . ? 1_555 ? 
655  FC4 6  ILE A  38  ? ILE A 38   . ? 1_555 ? 
656  FC4 6  ALA A  43  ? ALA A 43   . ? 1_555 ? 
657  FC4 6  ALA A  51  ? ALA A 51   . ? 1_555 ? 
658  FC4 6  ALA A  54  ? ALA A 54   . ? 1_555 ? 
659  FC4 6  TRP A  105 ? TRP A 105  . ? 1_555 ? 
660  FC4 6  PHE H  15  ? PHE I 15   . ? 1_555 ? 
661  FC5 10 MET B  25  ? MET B 25   . ? 1_555 ? 
662  FC5 10 LEU B  29  ? LEU B 29   . ? 1_555 ? 
663  FC5 10 TRP B  115 ? TRP B 115  . ? 1_555 ? 
664  FC5 10 CLA KB .   ? CLA B 523  . ? 1_555 ? 
665  FC5 10 CLA LB .   ? CLA B 524  . ? 1_555 ? 
666  FC5 10 BCR PB .   ? BCR B 528  . ? 1_555 ? 
667  FC5 10 MGE RB .   ? MGE B 530  . ? 1_555 ? 
668  FC5 10 ALA L  10  ? ALA M 10   . ? 1_555 ? 
669  FC5 10 BCR DH .   ? BCR t 104  . ? 1_555 ? 
670  FC5 10 PHE FA 19  ? PHE t 5019 . ? 1_555 ? 
671  FC6 13 TRP B  33  ? TRP B 33   . ? 1_555 ? 
672  FC6 13 SER B  36  ? SER B 36   . ? 1_555 ? 
673  FC6 13 MET B  37  ? MET B 37   . ? 1_555 ? 
674  FC6 13 LEU B  109 ? LEU B 109  . ? 1_555 ? 
675  FC6 13 CLA EB .   ? CLA B 517  . ? 1_555 ? 
676  FC6 13 BCR OB .   ? BCR B 527  . ? 1_555 ? 
677  FC6 13 BCR PB .   ? BCR B 528  . ? 1_555 ? 
678  FC6 13 SQD XD .   ? SQD a 212  . ? 1_555 ? 
679  FC6 13 ILE FA 4   ? ILE t 5004 . ? 1_555 ? 
680  FC6 13 PHE FA 8   ? PHE t 5008 . ? 1_555 ? 
681  FC6 13 ALA FA 11  ? ALA t 5011 . ? 1_555 ? 
682  FC6 13 PHE FA 18  ? PHE t 5018 . ? 1_555 ? 
683  FC6 13 PHE FA 22  ? PHE t 5022 . ? 1_555 ? 
684  FC7 9  LEU B  29  ? LEU B 29   . ? 1_555 ? 
685  FC7 9  GLY B  32  ? GLY B 32   . ? 1_555 ? 
686  FC7 9  TRP B  33  ? TRP B 33   . ? 1_555 ? 
687  FC7 9  SER B  36  ? SER B 36   . ? 1_555 ? 
688  FC7 9  ILE B  101 ? ILE B 101  . ? 1_555 ? 
689  FC7 9  VAL B  102 ? VAL B 102  . ? 1_555 ? 
690  FC7 9  CLA KB .   ? CLA B 523  . ? 1_555 ? 
691  FC7 9  BCR OB .   ? BCR B 527  . ? 1_555 ? 
692  FC7 9  BCR DH .   ? BCR t 104  . ? 1_555 ? 
693  FC8 6  LEU B  106 ? LEU B 106  . ? 1_555 ? 
694  FC8 6  CYS B  112 ? CYS B 112  . ? 1_555 ? 
695  FC8 6  VAL B  116 ? VAL B 116  . ? 1_555 ? 
696  FC8 6  TYR B  117 ? TYR B 117  . ? 1_555 ? 
697  FC8 6  CLA DB .   ? CLA B 516  . ? 1_555 ? 
698  FC8 6  SQD XD .   ? SQD a 212  . ? 1_555 ? 
699  FC9 7  CLA YA .   ? CLA B 511  . ? 1_555 ? 
700  FC9 7  CLA GB .   ? CLA B 519  . ? 1_555 ? 
701  FC9 7  MET G  35  ? MET H 35   . ? 1_555 ? 
702  FC9 7  PHE G  38  ? PHE H 38   . ? 1_555 ? 
703  FC9 7  PHE G  41  ? PHE H 41   . ? 1_555 ? 
704  FC9 7  UNK Q  52  ? UNK X 52   . ? 1_555 ? 
705  FC9 7  UNK Q  57  ? UNK X 57   . ? 1_555 ? 
706  GC1 14 TYR D  42  ? TYR D 42   . ? 1_555 ? 
707  GC1 14 LEU D  43  ? LEU D 43   . ? 1_555 ? 
708  GC1 14 GLY D  46  ? GLY D 46   . ? 1_555 ? 
709  GC1 14 GLY D  47  ? GLY D 47   . ? 1_555 ? 
710  GC1 14 LEU D  49  ? LEU D 49   . ? 1_555 ? 
711  GC1 14 THR D  50  ? THR D 50   . ? 1_555 ? 
712  GC1 14 PHE D  113 ? PHE D 113  . ? 1_555 ? 
713  GC1 14 CLA ED .   ? CLA D 355  . ? 1_555 ? 
714  GC1 14 PRO F  29  ? PRO F 29   . ? 1_555 ? 
715  GC1 14 THR F  30  ? THR F 30   . ? 1_555 ? 
716  GC1 14 PHE F  33  ? PHE F 33   . ? 1_555 ? 
717  GC1 14 ILE F  37  ? ILE F 37   . ? 1_555 ? 
718  GC1 14 VAL I  21  ? VAL J 21   . ? 1_555 ? 
719  GC1 14 VAL I  25  ? VAL J 25   . ? 1_555 ? 
720  GC2 14 BCR WC .   ? BCR C 504  . ? 1_555 ? 
721  GC2 14 ALA I  14  ? ALA J 14   . ? 1_555 ? 
722  GC2 14 THR I  15  ? THR J 15   . ? 1_555 ? 
723  GC2 14 GLY I  18  ? GLY J 18   . ? 1_555 ? 
724  GC2 14 MET I  19  ? MET J 19   . ? 1_555 ? 
725  GC2 14 LEU J  12  ? LEU K 21   . ? 1_555 ? 
726  GC2 14 LEU J  22  ? LEU K 31   . ? 1_555 ? 
727  GC2 14 ALA J  25  ? ALA K 34   . ? 1_555 ? 
728  GC2 14 PHE J  28  ? PHE K 37   . ? 1_555 ? 
729  GC2 14 VAL J  29  ? VAL K 38   . ? 1_555 ? 
730  GC2 14 UNK Q  13  ? UNK X 13   . ? 1_555 ? 
731  GC2 14 UNK Q  14  ? UNK X 14   . ? 1_555 ? 
732  GC2 14 UNK Q  17  ? UNK X 17   . ? 1_555 ? 
733  GC2 14 VAL R  13  ? VAL Z 13   . ? 1_555 ? 
734  GC3 15 ALA C  55  ? ALA C 55   . ? 1_555 ? 
735  GC3 15 GLY C  58  ? GLY C 58   . ? 1_555 ? 
736  GC3 15 LEU C  59  ? LEU C 59   . ? 1_555 ? 
737  GC3 15 VAL C  116 ? VAL C 116  . ? 1_555 ? 
738  GC3 15 LEU C  119 ? LEU C 119  . ? 1_555 ? 
739  GC3 15 SER C  122 ? SER C 122  . ? 1_555 ? 
740  GC3 15 ALA C  123 ? ALA C 123  . ? 1_555 ? 
741  GC3 15 GLY C  126 ? GLY C 126  . ? 1_555 ? 
742  GC3 15 CLA TC .   ? CLA C 501  . ? 1_555 ? 
743  GC3 15 BCR XC .   ? BCR C 505  . ? 1_555 ? 
744  GC3 15 TYR J  6   ? TYR K 15   . ? 1_555 ? 
745  GC3 15 PHE J  9   ? PHE K 18   . ? 1_555 ? 
746  GC3 15 PHE J  23  ? PHE K 32   . ? 1_555 ? 
747  GC3 15 ALA J  27  ? ALA K 36   . ? 1_555 ? 
748  GC3 15 BCR VD .   ? BCR X 130  . ? 1_555 ? 
749  GC4 11 PHE C  112 ? PHE C 112  . ? 1_555 ? 
750  GC4 11 VAL C  116 ? VAL C 116  . ? 1_555 ? 
751  GC4 11 ILE C  120 ? ILE C 120  . ? 1_555 ? 
752  GC4 11 SER C  121 ? SER C 121  . ? 1_555 ? 
753  GC4 11 VAL C  124 ? VAL C 124  . ? 1_555 ? 
754  GC4 11 LEU C  125 ? LEU C 125  . ? 1_555 ? 
755  GC4 11 CLA UC .   ? CLA C 502  . ? 1_555 ? 
756  GC4 11 CLA VC .   ? CLA C 503  . ? 1_555 ? 
757  GC4 11 BCR WC .   ? BCR C 504  . ? 1_555 ? 
758  GC4 11 TYR J  6   ? TYR K 15   . ? 1_555 ? 
759  GC4 11 GLY R  55  ? GLY Z 55   . ? 1_555 ? 
760  GC5 14 ILE C  209 ? ILE C 209  . ? 1_555 ? 
761  GC5 14 TYR C  212 ? TYR C 212  . ? 1_555 ? 
762  GC5 14 LEU C  213 ? LEU C 213  . ? 1_555 ? 
763  GC5 14 ILE C  224 ? ILE C 224  . ? 1_555 ? 
764  GC5 14 VAL C  227 ? VAL C 227  . ? 1_555 ? 
765  GC5 14 ASP C  232 ? ASP C 232  . ? 1_555 ? 
766  GC5 14 VAL C  233 ? VAL C 233  . ? 1_555 ? 
767  GC5 14 HIS C  237 ? HIS C 237  . ? 1_555 ? 
768  GC5 14 PHE C  264 ? PHE C 264  . ? 1_555 ? 
769  GC5 14 CLA JC .   ? CLA C 491  . ? 1_555 ? 
770  GC5 14 CLA OC .   ? CLA C 496  . ? 1_555 ? 
771  GC5 14 VAL H  20  ? VAL I 20   . ? 1_555 ? 
772  GC5 14 PHE H  23  ? PHE I 23   . ? 1_555 ? 
773  GC5 14 LEU H  24  ? LEU I 24   . ? 1_555 ? 
774  GC6 11 PHE A  93  ? PHE A 93   . ? 1_555 ? 
775  GC6 11 TRP A  97  ? TRP A 97   . ? 1_555 ? 
776  GC6 11 LEU A  121 ? LEU A 121  . ? 1_555 ? 
777  GC6 11 CLA QA .   ? CLA A 563  . ? 1_555 ? 
778  GC6 11 SER C  216 ? SER C 216  . ? 1_555 ? 
779  GC6 11 PHE C  218 ? PHE C 218  . ? 1_555 ? 
780  GC6 11 TRP C  223 ? TRP C 223  . ? 1_555 ? 
781  GC6 11 MET C  281 ? MET C 281  . ? 1_555 ? 
782  GC6 11 PHE C  284 ? PHE C 284  . ? 1_555 ? 
783  GC6 11 LYS H  5   ? LYS I 5    . ? 1_555 ? 
784  GC6 11 TYR H  9   ? TYR I 9    . ? 1_555 ? 
785  GC7 17 PHE A  155 ? PHE A 155  . ? 1_555 ? 
786  GC7 17 ILE A  160 ? ILE A 160  . ? 1_555 ? 
787  GC7 17 ILE A  163 ? ILE A 163  . ? 1_555 ? 
788  GC7 17 PRO C  217 ? PRO C 217  . ? 1_555 ? 
789  GC7 17 PHE C  218 ? PHE C 218  . ? 1_555 ? 
790  GC7 17 GLY C  219 ? GLY C 219  . ? 1_555 ? 
791  GC7 17 GLY C  220 ? GLY C 220  . ? 1_555 ? 
792  GC7 17 GLY C  222 ? GLY C 222  . ? 1_555 ? 
793  GC7 17 VAL C  225 ? VAL C 225  . ? 1_555 ? 
794  GC7 17 SER C  226 ? SER C 226  . ? 1_555 ? 
795  GC7 17 ASN C  228 ? ASN C 228  . ? 1_555 ? 
796  GC7 17 PHE C  284 ? PHE C 284  . ? 1_555 ? 
797  GC7 17 CYS C  288 ? CYS C 288  . ? 1_555 ? 
798  GC7 17 PHE C  292 ? PHE C 292  . ? 1_555 ? 
799  GC7 17 ASN C  294 ? ASN C 294  . ? 1_555 ? 
800  GC7 17 ARG C  362 ? ARG C 362  . ? 1_555 ? 
801  GC7 17 LEU C  438 ? LEU C 438  . ? 1_555 ? 
802  GC8 15 ARG A  140 ? ARG A 140  . ? 1_555 ? 
803  GC8 15 TRP A  142 ? TRP A 142  . ? 1_555 ? 
804  GC8 15 PHE A  273 ? PHE A 273  . ? 1_555 ? 
805  GC8 15 SQD VA .   ? SQD A 568  . ? 1_555 ? 
806  GC8 15 TRP C  36  ? TRP C 36   . ? 1_555 ? 
807  GC8 15 PHE C  436 ? PHE C 436  . ? 1_555 ? 
808  GC8 15 TRP C  443 ? TRP C 443  . ? 1_555 ? 
809  GC8 15 ARG C  447 ? ARG C 447  . ? 1_555 ? 
810  GC8 15 CLA QC .   ? CLA C 498  . ? 1_555 ? 
811  GC8 15 GLU D  219 ? GLU D 219  . ? 1_555 ? 
812  GC8 15 ASN D  220 ? ASN D 220  . ? 1_555 ? 
813  GC8 15 ALA D  229 ? ALA D 229  . ? 1_555 ? 
814  GC8 15 SER D  230 ? SER D 230  . ? 1_555 ? 
815  GC8 15 THR D  231 ? THR D 231  . ? 1_555 ? 
816  GC8 15 PHE D  232 ? PHE D 232  . ? 1_555 ? 
817  GC9 10 ASN A  267 ? ASN A 267  . ? 1_555 ? 
818  GC9 10 SER A  270 ? SER A 270  . ? 1_555 ? 
819  GC9 10 PHE A  273 ? PHE A 273  . ? 1_555 ? 
820  GC9 10 PHE A  274 ? PHE A 274  . ? 1_555 ? 
821  GC9 10 LHG UA .   ? LHG A 567  . ? 1_555 ? 
822  GC9 10 GLU C  29  ? GLU C 29   . ? 1_555 ? 
823  GC9 10 TRP C  36  ? TRP C 36   . ? 1_555 ? 
824  GC9 10 SER D  230 ? SER D 230  . ? 1_555 ? 
825  GC9 10 PHE D  232 ? PHE D 232  . ? 1_555 ? 
826  GC9 10 ARG D  233 ? ARG D 233  . ? 1_555 ? 
827  HC1 14 PHE A  197 ? PHE A 197  . ? 1_555 ? 
828  HC1 14 GLU C  83  ? GLU C 83   . ? 1_555 ? 
829  HC1 14 GLN C  84  ? GLN C 84   . ? 1_555 ? 
830  HC1 14 GLY C  85  ? GLY C 85   . ? 1_555 ? 
831  HC1 14 SER C  406 ? SER C 406  . ? 1_555 ? 
832  HC1 14 ASN C  418 ? ASN C 418  . ? 1_555 ? 
833  HC1 14 PHE C  419 ? PHE C 419  . ? 1_555 ? 
834  HC1 14 VAL C  420 ? VAL C 420  . ? 1_555 ? 
835  HC1 14 TRP C  425 ? TRP C 425  . ? 1_555 ? 
836  HC1 14 THR C  428 ? THR C 428  . ? 1_555 ? 
837  HC1 14 UNK XB .   ? UNK C 479  . ? 1_555 ? 
838  HC1 14 CLA MC .   ? CLA C 494  . ? 1_555 ? 
839  HC1 14 DGD BD .   ? DGD C 509  . ? 1_555 ? 
840  HC1 14 TYR I  33  ? TYR J 33   . ? 1_555 ? 
841  HC2 20 GLN A  199 ? GLN A 199  . ? 1_555 ? 
842  HC2 20 LEU A  200 ? LEU A 200  . ? 1_555 ? 
843  HC2 20 PHE A  300 ? PHE A 300  . ? 1_555 ? 
844  HC2 20 ASN A  301 ? ASN A 301  . ? 1_555 ? 
845  HC2 20 PHE A  302 ? PHE A 302  . ? 1_555 ? 
846  HC2 20 SER A  305 ? SER A 305  . ? 1_555 ? 
847  HC2 20 CLA NA .   ? CLA A 560  . ? 1_555 ? 
848  HC2 20 ASN C  405 ? ASN C 405  . ? 1_555 ? 
849  HC2 20 ASN C  415 ? ASN C 415  . ? 1_555 ? 
850  HC2 20 SER C  416 ? SER C 416  . ? 1_555 ? 
851  HC2 20 ASN C  418 ? ASN C 418  . ? 1_555 ? 
852  HC2 20 DGD AD .   ? DGD C 508  . ? 1_555 ? 
853  HC2 20 MGE HD .   ? MGE D 358  . ? 1_555 ? 
854  HC2 20 PHE I  29  ? PHE J 29   . ? 1_555 ? 
855  HC2 20 ALA I  32  ? ALA J 32   . ? 1_555 ? 
856  HC2 20 TYR I  33  ? TYR J 33   . ? 1_555 ? 
857  HC2 20 GLY I  37  ? GLY J 37   . ? 1_555 ? 
858  HC2 20 SER I  38  ? SER J 38   . ? 1_555 ? 
859  HC2 20 SER I  39  ? SER J 39   . ? 1_555 ? 
860  HC2 20 GLN P  34  ? GLN V 60   . ? 1_555 ? 
861  HC3 12 DGD BD .   ? DGD C 509  . ? 1_555 ? 
862  HC3 12 TYR D  67  ? TYR D 67   . ? 1_555 ? 
863  HC3 12 GLY D  70  ? GLY D 70   . ? 1_555 ? 
864  HC3 12 CYS D  71  ? CYS D 71   . ? 1_555 ? 
865  HC3 12 CLA DD .   ? CLA D 354  . ? 1_555 ? 
866  HC3 12 THR F  30  ? THR F 30   . ? 1_555 ? 
867  HC3 12 MET F  40  ? MET F 40   . ? 1_555 ? 
868  HC3 12 GLN F  41  ? GLN F 41   . ? 1_555 ? 
869  HC3 12 GLY I  31  ? GLY J 31   . ? 1_555 ? 
870  HC3 12 ALA I  32  ? ALA J 32   . ? 1_555 ? 
871  HC3 12 GLY I  35  ? GLY J 35   . ? 1_555 ? 
872  HC3 12 GLY I  37  ? GLY J 37   . ? 1_555 ? 
873  HC4 14 TYR B  193 ? TYR B 193  . ? 1_555 ? 
874  HC4 14 PHE B  250 ? PHE B 250  . ? 1_555 ? 
875  HC4 14 TYR B  258 ? TYR B 258  . ? 1_555 ? 
876  HC4 14 TYR B  273 ? TYR B 273  . ? 1_555 ? 
877  HC4 14 SER B  277 ? SER B 277  . ? 1_555 ? 
878  HC4 14 PHE B  463 ? PHE B 463  . ? 1_555 ? 
879  HC4 14 HIS D  87  ? HIS D 87   . ? 1_555 ? 
880  HC4 14 ILE D  123 ? ILE D 123  . ? 1_555 ? 
881  HC4 14 LEU D  162 ? LEU D 162  . ? 1_555 ? 
882  HC4 14 SER D  165 ? SER D 165  . ? 1_555 ? 
883  HC4 14 TYR G  49  ? TYR H 49   . ? 1_555 ? 
884  HC4 14 VAL G  60  ? VAL H 60   . ? 1_555 ? 
885  HC4 14 SER G  61  ? SER H 61   . ? 1_555 ? 
886  HC4 14 TRP G  62  ? TRP H 62   . ? 1_555 ? 
887  HC5 13 ASN A  234 ? ASN A 234  . ? 1_555 ? 
888  HC5 13 TRP B  5   ? TRP B 5    . ? 1_555 ? 
889  HC5 13 TYR B  6   ? TYR B 6    . ? 1_555 ? 
890  HC5 13 ARG B  7   ? ARG B 7    . ? 1_555 ? 
891  HC5 13 PHE B  464 ? PHE B 464  . ? 1_555 ? 
892  HC5 13 TRP B  468 ? TRP B 468  . ? 1_555 ? 
893  HC5 13 CLA IB .   ? CLA B 521  . ? 1_555 ? 
894  HC5 13 CLA KB .   ? CLA B 523  . ? 1_555 ? 
895  HC5 13 ARG D  139 ? ARG D 139  . ? 1_555 ? 
896  HC5 13 TYR D  141 ? TYR D 141  . ? 1_555 ? 
897  HC5 13 PHE D  269 ? PHE D 269  . ? 1_555 ? 
898  HC5 13 PHE D  273 ? PHE D 273  . ? 1_555 ? 
899  HC5 13 MGE PD .   ? MGE L 210  . ? 1_555 ? 
900  HC6 14 SER A  232 ? SER A 232  . ? 1_555 ? 
901  HC6 14 ASN A  234 ? ASN A 234  . ? 1_555 ? 
902  HC6 14 CLA MA .   ? CLA A 559  . ? 1_555 ? 
903  HC6 14 TRP B  5   ? TRP B 5    . ? 1_555 ? 
904  HC6 14 TYR B  6   ? TYR B 6    . ? 1_555 ? 
905  HC6 14 CLA LB .   ? CLA B 524  . ? 1_555 ? 
906  HC6 14 UNK SB .   ? UNK C 474  . ? 1_555 ? 
907  HC6 14 TRP D  266 ? TRP D 266  . ? 1_555 ? 
908  HC6 14 PHE D  270 ? PHE D 270  . ? 1_555 ? 
909  HC6 14 PHE D  273 ? PHE D 273  . ? 1_555 ? 
910  HC6 14 MGE ID .   ? MGE D 359  . ? 1_555 ? 
911  HC6 14 GLU K  11  ? GLU L 11   . ? 1_555 ? 
912  HC6 14 SER K  16  ? SER L 16   . ? 1_555 ? 
913  HC6 14 GLY K  20  ? GLY L 20   . ? 1_555 ? 
914  HC7 14 CLA LA .   ? CLA A 558  . ? 1_555 ? 
915  HC7 14 ILE D  259 ? ILE D 259  . ? 1_555 ? 
916  HC7 14 ALA D  260 ? ALA D 260  . ? 1_555 ? 
917  HC7 14 PHE D  261 ? PHE D 261  . ? 1_555 ? 
918  HC7 14 SER D  262 ? SER D 262  . ? 1_555 ? 
919  HC7 14 ASN D  263 ? ASN D 263  . ? 1_555 ? 
920  HC7 14 TRP D  266 ? TRP D 266  . ? 1_555 ? 
921  HC7 14 PHE D  270 ? PHE D 270  . ? 1_555 ? 
922  HC7 14 THR K  15  ? THR L 15   . ? 1_555 ? 
923  HC7 14 TYR K  18  ? TYR L 18   . ? 1_555 ? 
924  HC7 14 LEU K  19  ? LEU L 19   . ? 1_555 ? 
925  HC7 14 PHE N  10  ? PHE T 10   . ? 1_555 ? 
926  HC7 14 PHE N  17  ? PHE T 17   . ? 1_555 ? 
927  HC7 14 ALA N  20  ? ALA T 20   . ? 1_555 ? 
928  HC8 8  TRP B  113 ? TRP B 113  . ? 1_555 ? 
929  HC8 8  TYR B  117 ? TYR B 117  . ? 1_555 ? 
930  HC8 8  BCR QB .   ? BCR B 529  . ? 1_555 ? 
931  HC8 8  TRP S  20  ? TRP a 5020 . ? 1_555 ? 
932  HC8 8  ASN S  26  ? ASN a 5026 . ? 1_555 ? 
933  HC8 8  ARG S  27  ? ARG a 5027 . ? 1_555 ? 
934  HC8 8  LEU S  28  ? LEU a 5028 . ? 1_555 ? 
935  HC8 8  BCR DH .   ? BCR t 104  . ? 1_555 ? 
936  HC9 7  ARG B  18  ? ARG B 18   . ? 1_555 ? 
937  HC9 7  LEU B  29  ? LEU B 29   . ? 1_555 ? 
938  HC9 7  SER B  104 ? SER B 104  . ? 1_555 ? 
939  HC9 7  ARG CA 14  ? ARG l 5014 . ? 1_555 ? 
940  HC9 7  TYR CA 18  ? TYR l 5018 . ? 1_555 ? 
941  HC9 7  PHE FA 19  ? PHE t 5019 . ? 1_555 ? 
942  HC9 7  PHE FA 23  ? PHE t 5023 . ? 1_555 ? 
943  IC1 10 THR B  327 ? THR B 327  . ? 1_555 ? 
944  IC1 10 GLY B  328 ? GLY B 328  . ? 1_555 ? 
945  IC1 10 PRO B  329 ? PRO B 329  . ? 1_555 ? 
946  IC1 10 PHE B  453 ? PHE B 453  . ? 1_555 ? 
947  IC1 10 CLA EB .   ? CLA B 517  . ? 1_555 ? 
948  IC1 10 BCR OB .   ? BCR B 527  . ? 1_555 ? 
949  IC1 10 PHE K  35  ? PHE L 35   . ? 1_555 ? 
950  IC1 10 ASN L  4   ? ASN M 4    . ? 1_555 ? 
951  IC1 10 LEU L  6   ? LEU M 6    . ? 1_555 ? 
952  IC1 10 LMT RD .   ? LMT M 5216 . ? 1_555 ? 
953  IC2 11 ILE A  50  ? ILE A 50   . ? 1_555 ? 
954  IC2 11 LEU A  72  ? LEU A 72   . ? 1_555 ? 
955  IC2 11 TYR A  73  ? TYR A 73   . ? 1_555 ? 
956  IC2 11 UNK GC .   ? UNK C 488  . ? 1_555 ? 
957  IC2 11 UNK HC .   ? UNK C 489  . ? 1_555 ? 
958  IC2 11 ARG D  304 ? ARG D 304  . ? 1_555 ? 
959  IC2 11 GLY M  114 ? GLY O 139  . ? 1_555 ? 
960  IC2 11 GLU M  115 ? GLU O 140  . ? 1_555 ? 
961  IC2 11 LMT SD .   ? LMT T 217  . ? 1_555 ? 
962  IC2 11 ALA T  43  ? ALA b 5043 . ? 1_555 ? 
963  IC2 11 LEU T  98  ? LEU b 5098 . ? 1_555 ? 
964  IC3 9  MET L  1   ? MET M 1    . ? 1_555 ? 
965  IC3 9  LMT RD .   ? LMT M 5216 . ? 1_555 ? 
966  IC3 9  MET N  1   ? MET T 1    . ? 1_555 ? 
967  IC3 9  ILE N  4   ? ILE T 4    . ? 1_555 ? 
968  IC3 9  LMT SD .   ? LMT T 217  . ? 1_555 ? 
969  IC3 9  TYR T  40  ? TYR b 5040 . ? 1_555 ? 
970  IC3 9  MGE CF .   ? MGE b 5530 . ? 1_555 ? 
971  IC3 9  GLN DA 5   ? GLN m 5005 . ? 1_555 ? 
972  IC3 9  LEU DA 6   ? LEU m 5006 . ? 1_555 ? 
973  IC4 11 LEU A  72  ? LEU A 72   . ? 1_555 ? 
974  IC4 11 LMT WA .   ? LMT A 569  . ? 1_555 ? 
975  IC4 11 MET N  1   ? MET T 1    . ? 1_555 ? 
976  IC4 11 ILE N  4   ? ILE T 4    . ? 1_555 ? 
977  IC4 11 ALA N  11  ? ALA T 11   . ? 1_555 ? 
978  IC4 11 ILE N  14  ? ILE T 14   . ? 1_555 ? 
979  IC4 11 TYR T  40  ? TYR b 5040 . ? 1_555 ? 
980  IC4 11 ALA T  43  ? ALA b 5043 . ? 1_555 ? 
981  IC4 11 THR T  44  ? THR b 5044 . ? 1_555 ? 
982  IC4 11 BCR AF .   ? BCR b 5528 . ? 1_555 ? 
983  IC4 11 LMT CH .   ? LMT m 216  . ? 1_555 ? 
984  IC5 21 PHE S  119 ? PHE a 5119 . ? 1_555 ? 
985  IC5 21 TYR S  147 ? TYR a 5147 . ? 1_555 ? 
986  IC5 21 PRO S  150 ? PRO a 5150 . ? 1_555 ? 
987  IC5 21 SER S  153 ? SER a 5153 . ? 1_555 ? 
988  IC5 21 VAL S  157 ? VAL a 5157 . ? 1_555 ? 
989  IC5 21 MET S  183 ? MET a 5183 . ? 1_555 ? 
990  IC5 21 ILE S  184 ? ILE a 5184 . ? 1_555 ? 
991  IC5 21 PHE S  186 ? PHE a 5186 . ? 1_555 ? 
992  IC5 21 GLN S  187 ? GLN a 5187 . ? 1_555 ? 
993  IC5 21 LEU S  193 ? LEU a 5193 . ? 1_555 ? 
994  IC5 21 HIS S  198 ? HIS a 5198 . ? 1_555 ? 
995  IC5 21 GLY S  201 ? GLY a 5201 . ? 1_555 ? 
996  IC5 21 VAL S  205 ? VAL a 5205 . ? 1_555 ? 
997  IC5 21 THR S  286 ? THR a 5286 . ? 1_555 ? 
998  IC5 21 ILE S  290 ? ILE a 5290 . ? 1_555 ? 
999  IC5 21 CLA ZD .   ? CLA a 5559 . ? 1_555 ? 
1000 IC5 21 CLA AE .   ? CLA a 5560 . ? 1_555 ? 
1001 IC5 21 PHO BE .   ? PHO a 5561 . ? 1_555 ? 
1002 IC5 21 LEU V  182 ? LEU d 5182 . ? 1_555 ? 
1003 IC5 21 CLA OG .   ? CLA d 5354 . ? 1_555 ? 
1004 IC5 21 MGE VG .   ? MGE d 5361 . ? 1_555 ? 
1005 IC6 23 MET S  183 ? MET a 5183 . ? 1_555 ? 
1006 IC6 23 PHE S  206 ? PHE a 5206 . ? 1_555 ? 
1007 IC6 23 CLA YD .   ? CLA a 5558 . ? 1_555 ? 
1008 IC6 23 CLA ZD .   ? CLA a 5559 . ? 1_555 ? 
1009 IC6 23 CLA AE .   ? CLA a 5560 . ? 1_555 ? 
1010 IC6 23 PHO CE .   ? PHO a 5562 . ? 1_555 ? 
1011 IC6 23 VAL V  152 ? VAL d 5152 . ? 1_555 ? 
1012 IC6 23 VAL V  156 ? VAL d 5156 . ? 1_555 ? 
1013 IC6 23 PHE V  181 ? PHE d 5181 . ? 1_555 ? 
1014 IC6 23 LEU V  182 ? LEU d 5182 . ? 1_555 ? 
1015 IC6 23 PHE V  185 ? PHE d 5185 . ? 1_555 ? 
1016 IC6 23 GLN V  186 ? GLN d 5186 . ? 1_555 ? 
1017 IC6 23 TRP V  191 ? TRP d 5191 . ? 1_555 ? 
1018 IC6 23 THR V  192 ? THR d 5192 . ? 1_555 ? 
1019 IC6 23 HIS V  197 ? HIS d 5197 . ? 1_555 ? 
1020 IC6 23 GLY V  200 ? GLY d 5200 . ? 1_555 ? 
1021 IC6 23 VAL V  201 ? VAL d 5201 . ? 1_555 ? 
1022 IC6 23 VAL V  204 ? VAL d 5204 . ? 1_555 ? 
1023 IC6 23 LEU V  279 ? LEU d 5279 . ? 1_555 ? 
1024 IC6 23 SER V  282 ? SER d 5282 . ? 1_555 ? 
1025 IC6 23 ALA V  283 ? ALA d 5283 . ? 1_555 ? 
1026 IC6 23 VAL V  286 ? VAL d 5286 . ? 1_555 ? 
1027 IC6 23 MGE TG .   ? MGE d 5359 . ? 1_555 ? 
1028 IC7 18 THR S  45  ? THR a 5045 . ? 1_555 ? 
1029 IC7 18 VAL S  157 ? VAL a 5157 . ? 1_555 ? 
1030 IC7 18 PHE S  158 ? PHE a 5158 . ? 1_555 ? 
1031 IC7 18 MET S  172 ? MET a 5172 . ? 1_555 ? 
1032 IC7 18 ILE S  176 ? ILE a 5176 . ? 1_555 ? 
1033 IC7 18 THR S  179 ? THR a 5179 . ? 1_555 ? 
1034 IC7 18 PHE S  180 ? PHE a 5180 . ? 1_555 ? 
1035 IC7 18 MET S  183 ? MET a 5183 . ? 1_555 ? 
1036 IC7 18 CLA YD .   ? CLA a 5558 . ? 1_555 ? 
1037 IC7 18 UNK DF .   ? UNK c 5474 . ? 1_555 ? 
1038 IC7 18 MET V  198 ? MET d 5198 . ? 1_555 ? 
1039 IC7 18 VAL V  201 ? VAL d 5201 . ? 1_555 ? 
1040 IC7 18 ALA V  202 ? ALA d 5202 . ? 1_555 ? 
1041 IC7 18 GLY V  206 ? GLY d 5206 . ? 1_555 ? 
1042 IC7 18 LEU V  209 ? LEU d 5209 . ? 1_555 ? 
1043 IC7 18 CLA OG .   ? CLA d 5354 . ? 1_555 ? 
1044 IC7 18 MGE VG .   ? MGE d 5361 . ? 1_555 ? 
1045 IC7 18 MGE BH .   ? MGE l 5210 . ? 1_555 ? 
1046 IC8 15 GLN S  199 ? GLN a 5199 . ? 1_555 ? 
1047 IC8 15 VAL S  202 ? VAL a 5202 . ? 1_555 ? 
1048 IC8 15 ALA S  203 ? ALA a 5203 . ? 1_555 ? 
1049 IC8 15 GLY S  207 ? GLY a 5207 . ? 1_555 ? 
1050 IC8 15 LEU S  210 ? LEU a 5210 . ? 1_555 ? 
1051 IC8 15 TRP S  278 ? TRP a 5278 . ? 1_555 ? 
1052 IC8 15 CLA YD .   ? CLA a 5558 . ? 1_555 ? 
1053 IC8 15 PHO CE .   ? PHO a 5562 . ? 1_555 ? 
1054 IC8 15 DGD MG .   ? DGD c 5509 . ? 1_555 ? 
1055 IC8 15 PHE V  157 ? PHE d 5157 . ? 1_555 ? 
1056 IC8 15 VAL V  175 ? VAL d 5175 . ? 1_555 ? 
1057 IC8 15 PHE V  179 ? PHE d 5179 . ? 1_555 ? 
1058 IC8 15 LEU V  182 ? LEU d 5182 . ? 1_555 ? 
1059 IC8 15 CLA OG .   ? CLA d 5354 . ? 1_555 ? 
1060 IC8 15 MGE TG .   ? MGE d 5359 . ? 1_555 ? 
1061 IC9 20 LEU S  41  ? LEU a 5041 . ? 1_555 ? 
1062 IC9 20 ALA S  44  ? ALA a 5044 . ? 1_555 ? 
1063 IC9 20 THR S  45  ? THR a 5045 . ? 1_555 ? 
1064 IC9 20 ILE S  115 ? ILE a 5115 . ? 1_555 ? 
1065 IC9 20 PHE S  119 ? PHE a 5119 . ? 1_555 ? 
1066 IC9 20 TYR S  126 ? TYR a 5126 . ? 1_555 ? 
1067 IC9 20 GLN S  130 ? GLN a 5130 . ? 1_555 ? 
1068 IC9 20 TYR S  147 ? TYR a 5147 . ? 1_555 ? 
1069 IC9 20 PRO S  150 ? PRO a 5150 . ? 1_555 ? 
1070 IC9 20 PHE S  158 ? PHE a 5158 . ? 1_555 ? 
1071 IC9 20 LEU S  174 ? LEU a 5174 . ? 1_555 ? 
1072 IC9 20 PRO S  279 ? PRO a 5279 . ? 1_555 ? 
1073 IC9 20 VAL S  283 ? VAL a 5283 . ? 1_555 ? 
1074 IC9 20 CLA YD .   ? CLA a 5558 . ? 1_555 ? 
1075 IC9 20 LEU V  205 ? LEU d 5205 . ? 1_555 ? 
1076 IC9 20 ALA V  208 ? ALA d 5208 . ? 1_555 ? 
1077 IC9 20 LEU V  209 ? LEU d 5209 . ? 1_555 ? 
1078 IC9 20 ILE V  213 ? ILE d 5213 . ? 1_555 ? 
1079 IC9 20 TRP V  253 ? TRP d 5253 . ? 1_555 ? 
1080 IC9 20 PHE V  257 ? PHE d 5257 . ? 1_555 ? 
1081 JC1 22 PHE S  206 ? PHE a 5206 . ? 1_555 ? 
1082 JC1 22 ALA S  209 ? ALA a 5209 . ? 1_555 ? 
1083 JC1 22 LEU S  210 ? LEU a 5210 . ? 1_555 ? 
1084 JC1 22 ALA S  213 ? ALA a 5213 . ? 1_555 ? 
1085 JC1 22 MET S  214 ? MET a 5214 . ? 1_555 ? 
1086 JC1 22 LEU S  258 ? LEU a 5258 . ? 1_555 ? 
1087 JC1 22 CLA AE .   ? CLA a 5560 . ? 1_555 ? 
1088 JC1 22 LEU V  37  ? LEU d 5037 . ? 1_555 ? 
1089 JC1 22 ALA V  41  ? ALA d 5041 . ? 1_555 ? 
1090 JC1 22 LEU V  45  ? LEU d 5045 . ? 1_555 ? 
1091 JC1 22 TRP V  48  ? TRP d 5048 . ? 1_555 ? 
1092 JC1 22 GLY V  118 ? GLY d 5118 . ? 1_555 ? 
1093 JC1 22 LEU V  122 ? LEU d 5122 . ? 1_555 ? 
1094 JC1 22 PHE V  125 ? PHE d 5125 . ? 1_555 ? 
1095 JC1 22 GLN V  129 ? GLN d 5129 . ? 1_555 ? 
1096 JC1 22 ASN V  142 ? ASN d 5142 . ? 1_555 ? 
1097 JC1 22 PHE V  146 ? PHE d 5146 . ? 1_555 ? 
1098 JC1 22 PRO V  149 ? PRO d 5149 . ? 1_555 ? 
1099 JC1 22 PHE V  153 ? PHE d 5153 . ? 1_555 ? 
1100 JC1 22 PRO V  275 ? PRO d 5275 . ? 1_555 ? 
1101 JC1 22 LEU V  279 ? LEU d 5279 . ? 1_555 ? 
1102 JC1 22 CLA OG .   ? CLA d 5354 . ? 1_555 ? 
1103 JC2 15 ILE S  36  ? ILE a 5036 . ? 1_555 ? 
1104 JC2 15 PRO S  39  ? PRO a 5039 . ? 1_555 ? 
1105 JC2 15 THR S  40  ? THR a 5040 . ? 1_555 ? 
1106 JC2 15 PHE S  93  ? PHE a 5093 . ? 1_555 ? 
1107 JC2 15 PRO S  95  ? PRO a 5095 . ? 1_555 ? 
1108 JC2 15 ILE S  96  ? ILE a 5096 . ? 1_555 ? 
1109 JC2 15 TRP S  97  ? TRP a 5097 . ? 1_555 ? 
1110 JC2 15 LEU S  114 ? LEU a 5114 . ? 1_555 ? 
1111 JC2 15 PHE S  117 ? PHE a 5117 . ? 1_555 ? 
1112 JC2 15 HIS S  118 ? HIS a 5118 . ? 1_555 ? 
1113 JC2 15 LEU S  121 ? LEU a 5121 . ? 1_555 ? 
1114 JC2 15 TYR Z  9   ? TYR i 5009 . ? 1_555 ? 
1115 JC2 15 THR Z  13  ? THR i 5013 . ? 1_555 ? 
1116 JC2 15 PHE Z  15  ? PHE i 5015 . ? 1_555 ? 
1117 JC2 15 MGE ZG .   ? MGE i 5201 . ? 1_555 ? 
1118 JC3 16 UNK JF .   ? UNK c 5480 . ? 1_555 ? 
1119 JC3 16 LEU V  36  ? LEU d 5036 . ? 1_555 ? 
1120 JC3 16 PRO V  39  ? PRO d 5039 . ? 1_555 ? 
1121 JC3 16 LEU V  43  ? LEU d 5043 . ? 1_555 ? 
1122 JC3 16 LEU V  89  ? LEU d 5089 . ? 1_555 ? 
1123 JC3 16 LEU V  90  ? LEU d 5090 . ? 1_555 ? 
1124 JC3 16 LEU V  91  ? LEU d 5091 . ? 1_555 ? 
1125 JC3 16 LEU V  92  ? LEU d 5092 . ? 1_555 ? 
1126 JC3 16 TRP V  93  ? TRP d 5093 . ? 1_555 ? 
1127 JC3 16 THR V  112 ? THR d 5112 . ? 1_555 ? 
1128 JC3 16 PHE V  113 ? PHE d 5113 . ? 1_555 ? 
1129 JC3 16 HIS V  117 ? HIS d 5117 . ? 1_555 ? 
1130 JC3 16 PHE V  120 ? PHE d 5120 . ? 1_555 ? 
1131 JC3 16 BCR RG .   ? BCR d 5357 . ? 1_555 ? 
1132 JC3 16 UNK IA 63  ? UNK x 5063 . ? 1_555 ? 
1133 JC3 16 UNK IA 64  ? UNK x 5064 . ? 1_555 ? 
1134 JC4 5  TRP T  185 ? TRP b 5185 . ? 1_555 ? 
1135 JC4 5  PHE T  190 ? PHE b 5190 . ? 1_555 ? 
1136 JC4 5  CLA KE .   ? CLA b 5512 . ? 1_555 ? 
1137 JC4 5  PHE Y  41  ? PHE h 5041 . ? 1_555 ? 
1138 JC4 5  BCR XG .   ? BCR h 5107 . ? 1_555 ? 
1139 JC5 20 GLY T  189 ? GLY b 5189 . ? 1_555 ? 
1140 JC5 20 PHE T  190 ? PHE b 5190 . ? 1_555 ? 
1141 JC5 20 GLY T  197 ? GLY b 5197 . ? 1_555 ? 
1142 JC5 20 ALA T  200 ? ALA b 5200 . ? 1_555 ? 
1143 JC5 20 HIS T  201 ? HIS b 5201 . ? 1_555 ? 
1144 JC5 20 ALA T  204 ? ALA b 5204 . ? 1_555 ? 
1145 JC5 20 ALA T  205 ? ALA b 5205 . ? 1_555 ? 
1146 JC5 20 VAL T  208 ? VAL b 5208 . ? 1_555 ? 
1147 JC5 20 PHE T  247 ? PHE b 5247 . ? 1_555 ? 
1148 JC5 20 PHE T  250 ? PHE b 5250 . ? 1_555 ? 
1149 JC5 20 CLA JE .   ? CLA b 5511 . ? 1_555 ? 
1150 JC5 20 CLA LE .   ? CLA b 5513 . ? 1_555 ? 
1151 JC5 20 CLA QE .   ? CLA b 5518 . ? 1_555 ? 
1152 JC5 20 LEU V  158 ? LEU d 5158 . ? 1_555 ? 
1153 JC5 20 ILE V  159 ? ILE d 5159 . ? 1_555 ? 
1154 JC5 20 PHE Y  38  ? PHE h 5038 . ? 1_555 ? 
1155 JC5 20 PHE Y  41  ? PHE h 5041 . ? 1_555 ? 
1156 JC5 20 ILE Y  45  ? ILE h 5045 . ? 1_555 ? 
1157 JC5 20 LEU Y  46  ? LEU h 5046 . ? 1_555 ? 
1158 JC5 20 TYR Y  49  ? TYR h 5049 . ? 1_555 ? 
1159 JC6 19 ARG T  68  ? ARG b 5068 . ? 1_555 ? 
1160 JC6 19 LEU T  69  ? LEU b 5069 . ? 1_555 ? 
1161 JC6 19 ALA T  146 ? ALA b 5146 . ? 1_555 ? 
1162 JC6 19 LEU T  149 ? LEU b 5149 . ? 1_555 ? 
1163 JC6 19 CYS T  150 ? CYS b 5150 . ? 1_555 ? 
1164 JC6 19 PHE T  153 ? PHE b 5153 . ? 1_555 ? 
1165 JC6 19 LEU T  158 ? LEU b 5158 . ? 1_555 ? 
1166 JC6 19 HIS T  201 ? HIS b 5201 . ? 1_555 ? 
1167 JC6 19 HIS T  202 ? HIS b 5202 . ? 1_555 ? 
1168 JC6 19 PHE T  247 ? PHE b 5247 . ? 1_555 ? 
1169 JC6 19 VAL T  252 ? VAL b 5252 . ? 1_555 ? 
1170 JC6 19 THR T  262 ? THR b 5262 . ? 1_555 ? 
1171 JC6 19 CLA KE .   ? CLA b 5512 . ? 1_555 ? 
1172 JC6 19 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1173 JC6 19 CLA NE .   ? CLA b 5515 . ? 1_555 ? 
1174 JC6 19 CLA OE .   ? CLA b 5516 . ? 1_555 ? 
1175 JC6 19 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1176 JC6 19 PHE Y  38  ? PHE h 5038 . ? 1_555 ? 
1177 JC6 19 LEU Y  39  ? LEU h 5039 . ? 1_555 ? 
1178 JC7 19 TRP T  33  ? TRP b 5033 . ? 1_555 ? 
1179 JC7 19 PHE T  61  ? PHE b 5061 . ? 1_555 ? 
1180 JC7 19 PHE T  65  ? PHE b 5065 . ? 1_555 ? 
1181 JC7 19 ARG T  68  ? ARG b 5068 . ? 1_555 ? 
1182 JC7 19 LEU T  148 ? LEU b 5148 . ? 1_555 ? 
1183 JC7 19 VAL T  245 ? VAL b 5245 . ? 1_555 ? 
1184 JC7 19 ALA T  248 ? ALA b 5248 . ? 1_555 ? 
1185 JC7 19 ALA T  249 ? ALA b 5249 . ? 1_555 ? 
1186 JC7 19 VAL T  252 ? VAL b 5252 . ? 1_555 ? 
1187 JC7 19 PHE T  451 ? PHE b 5451 . ? 1_555 ? 
1188 JC7 19 HIS T  455 ? HIS b 5455 . ? 1_555 ? 
1189 JC7 19 PHE T  458 ? PHE b 5458 . ? 1_555 ? 
1190 JC7 19 PHE T  462 ? PHE b 5462 . ? 1_555 ? 
1191 JC7 19 CLA LE .   ? CLA b 5513 . ? 1_555 ? 
1192 JC7 19 CLA NE .   ? CLA b 5515 . ? 1_555 ? 
1193 JC7 19 CLA PE .   ? CLA b 5517 . ? 1_555 ? 
1194 JC7 19 CLA UE .   ? CLA b 5522 . ? 1_555 ? 
1195 JC7 19 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1196 JC7 19 CLA XE .   ? CLA b 5525 . ? 1_555 ? 
1197 JC8 17 THR T  27  ? THR b 5027 . ? 1_555 ? 
1198 JC8 17 VAL T  30  ? VAL b 5030 . ? 1_555 ? 
1199 JC8 17 ALA T  31  ? ALA b 5031 . ? 1_555 ? 
1200 JC8 17 TRP T  33  ? TRP b 5033 . ? 1_555 ? 
1201 JC8 17 ALA T  34  ? ALA b 5034 . ? 1_555 ? 
1202 JC8 17 VAL T  62  ? VAL b 5062 . ? 1_555 ? 
1203 JC8 17 PHE T  65  ? PHE b 5065 . ? 1_555 ? 
1204 JC8 17 MET T  66  ? MET b 5066 . ? 1_555 ? 
1205 JC8 17 ARG T  68  ? ARG b 5068 . ? 1_555 ? 
1206 JC8 17 LEU T  69  ? LEU b 5069 . ? 1_555 ? 
1207 JC8 17 HIS T  100 ? HIS b 5100 . ? 1_555 ? 
1208 JC8 17 GLY T  147 ? GLY b 5147 . ? 1_555 ? 
1209 JC8 17 ALA T  205 ? ALA b 5205 . ? 1_555 ? 
1210 JC8 17 CLA LE .   ? CLA b 5513 . ? 1_555 ? 
1211 JC8 17 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1212 JC8 17 CLA OE .   ? CLA b 5516 . ? 1_555 ? 
1213 JC8 17 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1214 JC9 16 LEU T  69  ? LEU b 5069 . ? 1_555 ? 
1215 JC9 16 GLY T  70  ? GLY b 5070 . ? 1_555 ? 
1216 JC9 16 TRP T  91  ? TRP b 5091 . ? 1_555 ? 
1217 JC9 16 ALA T  99  ? ALA b 5099 . ? 1_555 ? 
1218 JC9 16 HIS T  100 ? HIS b 5100 . ? 1_555 ? 
1219 JC9 16 LEU T  103 ? LEU b 5103 . ? 1_555 ? 
1220 JC9 16 GLY T  152 ? GLY b 5152 . ? 1_555 ? 
1221 JC9 16 PHE T  153 ? PHE b 5153 . ? 1_555 ? 
1222 JC9 16 PHE T  156 ? PHE b 5156 . ? 1_555 ? 
1223 JC9 16 HIS T  157 ? HIS b 5157 . ? 1_555 ? 
1224 JC9 16 PHE T  162 ? PHE b 5162 . ? 1_555 ? 
1225 JC9 16 GLY T  163 ? GLY b 5163 . ? 1_555 ? 
1226 JC9 16 PRO T  164 ? PRO b 5164 . ? 1_555 ? 
1227 JC9 16 CLA LE .   ? CLA b 5513 . ? 1_555 ? 
1228 JC9 16 CLA NE .   ? CLA b 5515 . ? 1_555 ? 
1229 JC9 16 BCR BF .   ? BCR b 5529 . ? 1_555 ? 
1230 KC1 20 BCR TD .   ? BCR T 5104 . ? 1_555 ? 
1231 KC1 20 TRP T  33  ? TRP b 5033 . ? 1_555 ? 
1232 KC1 20 TYR T  40  ? TYR b 5040 . ? 1_555 ? 
1233 KC1 20 GLN T  58  ? GLN b 5058 . ? 1_555 ? 
1234 KC1 20 GLY T  59  ? GLY b 5059 . ? 1_555 ? 
1235 KC1 20 PHE T  61  ? PHE b 5061 . ? 1_555 ? 
1236 KC1 20 LEU T  324 ? LEU b 5324 . ? 1_555 ? 
1237 KC1 20 PHE T  325 ? PHE b 5325 . ? 1_555 ? 
1238 KC1 20 THR T  327 ? THR b 5327 . ? 1_555 ? 
1239 KC1 20 GLY T  328 ? GLY b 5328 . ? 1_555 ? 
1240 KC1 20 PRO T  329 ? PRO b 5329 . ? 1_555 ? 
1241 KC1 20 TRP T  450 ? TRP b 5450 . ? 1_555 ? 
1242 KC1 20 PHE T  451 ? PHE b 5451 . ? 1_555 ? 
1243 KC1 20 HIS T  455 ? HIS b 5455 . ? 1_555 ? 
1244 KC1 20 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1245 KC1 20 MGE CF .   ? MGE b 5530 . ? 1_555 ? 
1246 KC1 20 PHE V  196 ? PHE d 5196 . ? 1_555 ? 
1247 KC1 20 MET V  281 ? MET d 5281 . ? 1_555 ? 
1248 KC1 20 LEU CA 27  ? LEU l 5027 . ? 1_555 ? 
1249 KC1 20 PHE DA 14  ? PHE m 5014 . ? 1_555 ? 
1250 KC2 18 THR T  236 ? THR b 5236 . ? 1_555 ? 
1251 KC2 18 SER T  239 ? SER b 5239 . ? 1_555 ? 
1252 KC2 18 ALA T  243 ? ALA b 5243 . ? 1_555 ? 
1253 KC2 18 PHE T  246 ? PHE b 5246 . ? 1_555 ? 
1254 KC2 18 PHE T  463 ? PHE b 5463 . ? 1_555 ? 
1255 KC2 18 HIS T  466 ? HIS b 5466 . ? 1_555 ? 
1256 KC2 18 LEU T  474 ? LEU b 5474 . ? 1_555 ? 
1257 KC2 18 CLA KE .   ? CLA b 5512 . ? 1_555 ? 
1258 KC2 18 CLA RE .   ? CLA b 5519 . ? 1_555 ? 
1259 KC2 18 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1260 KC2 18 UNK KF .   ? UNK c 5481 . ? 1_555 ? 
1261 KC2 18 UNK LF .   ? UNK c 5482 . ? 1_555 ? 
1262 KC2 18 ILE V  123 ? ILE d 5123 . ? 1_555 ? 
1263 KC2 18 MET V  126 ? MET d 5126 . ? 1_555 ? 
1264 KC2 18 LEU V  127 ? LEU d 5127 . ? 1_555 ? 
1265 KC2 18 PHE V  130 ? PHE d 5130 . ? 1_555 ? 
1266 KC2 18 LEU Y  43  ? LEU h 5043 . ? 1_555 ? 
1267 KC2 18 LEU Y  46  ? LEU h 5046 . ? 1_555 ? 
1268 KC3 13 PHE T  139 ? PHE b 5139 . ? 1_555 ? 
1269 KC3 13 ALA T  212 ? ALA b 5212 . ? 1_555 ? 
1270 KC3 13 PHE T  215 ? PHE b 5215 . ? 1_555 ? 
1271 KC3 13 HIS T  216 ? HIS b 5216 . ? 1_555 ? 
1272 KC3 13 PRO T  221 ? PRO b 5221 . ? 1_555 ? 
1273 KC3 13 LEU T  229 ? LEU b 5229 . ? 1_555 ? 
1274 KC3 13 CLA QE .   ? CLA b 5518 . ? 1_555 ? 
1275 KC3 13 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1276 KC3 13 THR Y  27  ? THR h 5027 . ? 1_555 ? 
1277 KC3 13 THR Y  28  ? THR h 5028 . ? 1_555 ? 
1278 KC3 13 MET Y  31  ? MET h 5031 . ? 1_555 ? 
1279 KC3 13 PHE Y  34  ? PHE h 5034 . ? 1_555 ? 
1280 KC3 13 BCR XG .   ? BCR h 5107 . ? 1_555 ? 
1281 KC4 13 LEU T  135 ? LEU b 5135 . ? 1_555 ? 
1282 KC4 13 PRO T  136 ? PRO b 5136 . ? 1_555 ? 
1283 KC4 13 PHE T  139 ? PHE b 5139 . ? 1_555 ? 
1284 KC4 13 HIS T  142 ? HIS b 5142 . ? 1_555 ? 
1285 KC4 13 MET T  231 ? MET b 5231 . ? 1_555 ? 
1286 KC4 13 VAL T  237 ? VAL b 5237 . ? 1_555 ? 
1287 KC4 13 SER T  240 ? SER b 5240 . ? 1_555 ? 
1288 KC4 13 CLA LE .   ? CLA b 5513 . ? 1_555 ? 
1289 KC4 13 CLA NE .   ? CLA b 5515 . ? 1_555 ? 
1290 KC4 13 CLA QE .   ? CLA b 5518 . ? 1_555 ? 
1291 KC4 13 CLA RE .   ? CLA b 5519 . ? 1_555 ? 
1292 KC4 13 CLA UE .   ? CLA b 5522 . ? 1_555 ? 
1293 KC4 13 CLA XE .   ? CLA b 5525 . ? 1_555 ? 
1294 KC5 19 TRP T  5   ? TRP b 5005 . ? 1_555 ? 
1295 KC5 19 TYR T  6   ? TYR b 5006 . ? 1_555 ? 
1296 KC5 19 ARG T  7   ? ARG b 5007 . ? 1_555 ? 
1297 KC5 19 VAL T  8   ? VAL b 5008 . ? 1_555 ? 
1298 KC5 19 HIS T  9   ? HIS b 5009 . ? 1_555 ? 
1299 KC5 19 LEU T  238 ? LEU b 5238 . ? 1_555 ? 
1300 KC5 19 ILE T  242 ? ILE b 5242 . ? 1_555 ? 
1301 KC5 19 LEU T  461 ? LEU b 5461 . ? 1_555 ? 
1302 KC5 19 PHE T  462 ? PHE b 5462 . ? 1_555 ? 
1303 KC5 19 PHE T  464 ? PHE b 5464 . ? 1_555 ? 
1304 KC5 19 GLY T  465 ? GLY b 5465 . ? 1_555 ? 
1305 KC5 19 TRP T  468 ? TRP b 5468 . ? 1_555 ? 
1306 KC5 19 HIS T  469 ? HIS b 5469 . ? 1_555 ? 
1307 KC5 19 ARG T  472 ? ARG b 5472 . ? 1_555 ? 
1308 KC5 19 PHE T  479 ? PHE b 5479 . ? 1_555 ? 
1309 KC5 19 CLA UE .   ? CLA b 5522 . ? 1_555 ? 
1310 KC5 19 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1311 KC5 19 CLA WE .   ? CLA b 5524 . ? 1_555 ? 
1312 KC5 19 MGE UG .   ? MGE d 5360 . ? 1_555 ? 
1313 KC6 16 HIS T  9   ? HIS b 5009 . ? 1_555 ? 
1314 KC6 16 LEU T  12  ? LEU b 5012 . ? 1_555 ? 
1315 KC6 16 LEU T  19  ? LEU b 5019 . ? 1_555 ? 
1316 KC6 16 ALA T  22  ? ALA b 5022 . ? 1_555 ? 
1317 KC6 16 HIS T  23  ? HIS b 5023 . ? 1_555 ? 
1318 KC6 16 HIS T  26  ? HIS b 5026 . ? 1_555 ? 
1319 KC6 16 THR T  27  ? THR b 5027 . ? 1_555 ? 
1320 KC6 16 VAL T  237 ? VAL b 5237 . ? 1_555 ? 
1321 KC6 16 LEU T  238 ? LEU b 5238 . ? 1_555 ? 
1322 KC6 16 SER T  241 ? SER b 5241 . ? 1_555 ? 
1323 KC6 16 VAL T  245 ? VAL b 5245 . ? 1_555 ? 
1324 KC6 16 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1325 KC6 16 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1326 KC6 16 CLA TE .   ? CLA b 5521 . ? 1_555 ? 
1327 KC6 16 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1328 KC6 16 CLA XE .   ? CLA b 5525 . ? 1_555 ? 
1329 KC7 11 HIS T  9   ? HIS b 5009 . ? 1_555 ? 
1330 KC7 11 HIS T  26  ? HIS b 5026 . ? 1_555 ? 
1331 KC7 11 VAL T  30  ? VAL b 5030 . ? 1_555 ? 
1332 KC7 11 PHE T  462 ? PHE b 5462 . ? 1_555 ? 
1333 KC7 11 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1334 KC7 11 CLA TE .   ? CLA b 5521 . ? 1_555 ? 
1335 KC7 11 CLA UE .   ? CLA b 5522 . ? 1_555 ? 
1336 KC7 11 CLA WE .   ? CLA b 5524 . ? 1_555 ? 
1337 KC7 11 BCR ZE .   ? BCR b 5527 . ? 1_555 ? 
1338 KC7 11 BCR AF .   ? BCR b 5528 . ? 1_555 ? 
1339 KC7 11 MGE UG .   ? MGE d 5360 . ? 1_555 ? 
1340 KC8 15 UNK TB .   ? UNK C 475  . ? 1_555 ? 
1341 KC8 15 UNK UB .   ? UNK C 476  . ? 1_555 ? 
1342 KC8 15 VAL T  8   ? VAL b 5008 . ? 1_555 ? 
1343 KC8 15 HIS T  9   ? HIS b 5009 . ? 1_555 ? 
1344 KC8 15 LEU T  12  ? LEU b 5012 . ? 1_555 ? 
1345 KC8 15 ALA T  22  ? ALA b 5022 . ? 1_555 ? 
1346 KC8 15 LEU T  29  ? LEU b 5029 . ? 1_555 ? 
1347 KC8 15 TRP T  115 ? TRP b 5115 . ? 1_555 ? 
1348 KC8 15 CLA TE .   ? CLA b 5521 . ? 1_555 ? 
1349 KC8 15 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1350 KC8 15 BCR ZE .   ? BCR b 5527 . ? 1_555 ? 
1351 KC8 15 ARG CA 7   ? ARG l 5007 . ? 1_555 ? 
1352 KC8 15 VAL CA 10  ? VAL l 5010 . ? 1_555 ? 
1353 KC8 15 MGE BH .   ? MGE l 5210 . ? 1_555 ? 
1354 KC8 15 PHE DA 21  ? PHE m 5021 . ? 1_555 ? 
1355 KC9 11 ILE T  20  ? ILE b 5020 . ? 1_555 ? 
1356 KC9 11 HIS T  23  ? HIS b 5023 . ? 1_555 ? 
1357 KC9 11 MET T  138 ? MET b 5138 . ? 1_555 ? 
1358 KC9 11 ILE T  141 ? ILE b 5141 . ? 1_555 ? 
1359 KC9 11 HIS T  142 ? HIS b 5142 . ? 1_555 ? 
1360 KC9 11 LEU T  145 ? LEU b 5145 . ? 1_555 ? 
1361 KC9 11 CLA ME .   ? CLA b 5514 . ? 1_555 ? 
1362 KC9 11 CLA SE .   ? CLA b 5520 . ? 1_555 ? 
1363 KC9 11 CLA UE .   ? CLA b 5522 . ? 1_555 ? 
1364 KC9 11 CLA YE .   ? CLA b 5526 . ? 1_555 ? 
1365 KC9 11 LEU Y  14  ? LEU h 5014 . ? 1_555 ? 
1366 LC1 9  ILE T  20  ? ILE b 5020 . ? 1_555 ? 
1367 LC1 9  LEU T  24  ? LEU b 5024 . ? 1_555 ? 
1368 LC1 9  ALA T  110 ? ALA b 5110 . ? 1_555 ? 
1369 LC1 9  TRP T  113 ? TRP b 5113 . ? 1_555 ? 
1370 LC1 9  HIS T  114 ? HIS b 5114 . ? 1_555 ? 
1371 LC1 9  LEU T  120 ? LEU b 5120 . ? 1_555 ? 
1372 LC1 9  CLA XE .   ? CLA b 5525 . ? 1_555 ? 
1373 LC1 9  THR Y  5   ? THR h 5005 . ? 1_555 ? 
1374 LC1 9  LEU Y  7   ? LEU h 5007 . ? 1_555 ? 
1375 LC2 14 LEU U  95  ? LEU c 5095 . ? 1_555 ? 
1376 LC2 14 LEU U  168 ? LEU c 5168 . ? 1_555 ? 
1377 LC2 14 GLY U  171 ? GLY c 5171 . ? 1_555 ? 
1378 LC2 14 ALA U  172 ? ALA c 5172 . ? 1_555 ? 
1379 LC2 14 VAL U  233 ? VAL c 5233 . ? 1_555 ? 
1380 LC2 14 HIS U  237 ? HIS c 5237 . ? 1_555 ? 
1381 LC2 14 ILE U  240 ? ILE c 5240 . ? 1_555 ? 
1382 LC2 14 ALA U  278 ? ALA c 5278 . ? 1_555 ? 
1383 LC2 14 MET U  281 ? MET c 5281 . ? 1_555 ? 
1384 LC2 14 VAL U  296 ? VAL c 5296 . ? 1_555 ? 
1385 LC2 14 TYR U  297 ? TYR c 5297 . ? 1_555 ? 
1386 LC2 14 CLA VF .   ? CLA c 5492 . ? 1_555 ? 
1387 LC2 14 CLA WF .   ? CLA c 5493 . ? 1_555 ? 
1388 LC2 14 BCR JG .   ? BCR c 5506 . ? 1_555 ? 
1389 LC3 14 TRP U  63  ? TRP c 5063 . ? 1_555 ? 
1390 LC3 14 HIS U  91  ? HIS c 5091 . ? 1_555 ? 
1391 LC3 14 TRP U  97  ? TRP c 5097 . ? 1_555 ? 
1392 LC3 14 GLY U  171 ? GLY c 5171 . ? 1_555 ? 
1393 LC3 14 LYS U  178 ? LYS c 5178 . ? 1_555 ? 
1394 LC3 14 ALA U  286 ? ALA c 5286 . ? 1_555 ? 
1395 LC3 14 TYR U  297 ? TYR c 5297 . ? 1_555 ? 
1396 LC3 14 HIS U  430 ? HIS c 5430 . ? 1_555 ? 
1397 LC3 14 LEU U  433 ? LEU c 5433 . ? 1_555 ? 
1398 LC3 14 PHE U  437 ? PHE c 5437 . ? 1_555 ? 
1399 LC3 14 CLA UF .   ? CLA c 5491 . ? 1_555 ? 
1400 LC3 14 CLA WF .   ? CLA c 5493 . ? 1_555 ? 
1401 LC3 14 CLA XF .   ? CLA c 5494 . ? 1_555 ? 
1402 LC3 14 CLA DG .   ? CLA c 5500 . ? 1_555 ? 
1403 LC4 16 ILE U  60  ? ILE c 5060 . ? 1_555 ? 
1404 LC4 16 VAL U  61  ? VAL c 5061 . ? 1_555 ? 
1405 LC4 16 ALA U  64  ? ALA c 5064 . ? 1_555 ? 
1406 LC4 16 THR U  68  ? THR c 5068 . ? 1_555 ? 
1407 LC4 16 LEU U  88  ? LEU c 5088 . ? 1_555 ? 
1408 LC4 16 HIS U  91  ? HIS c 5091 . ? 1_555 ? 
1409 LC4 16 ILE U  92  ? ILE c 5092 . ? 1_555 ? 
1410 LC4 16 LEU U  95  ? LEU c 5095 . ? 1_555 ? 
1411 LC4 16 VAL U  114 ? VAL c 5114 . ? 1_555 ? 
1412 LC4 16 HIS U  118 ? HIS c 5118 . ? 1_555 ? 
1413 LC4 16 LEU U  279 ? LEU c 5279 . ? 1_555 ? 
1414 LC4 16 UNK GF .   ? UNK c 5477 . ? 1_555 ? 
1415 LC4 16 CLA UF .   ? CLA c 5491 . ? 1_555 ? 
1416 LC4 16 CLA VF .   ? CLA c 5492 . ? 1_555 ? 
1417 LC4 16 CLA DG .   ? CLA c 5500 . ? 1_555 ? 
1418 LC4 16 CLA FG .   ? CLA c 5502 . ? 1_555 ? 
1419 LC5 14 TRP U  63  ? TRP c 5063 . ? 1_555 ? 
1420 LC5 14 MET U  67  ? MET c 5067 . ? 1_555 ? 
1421 LC5 14 PHE U  70  ? PHE c 5070 . ? 1_555 ? 
1422 LC5 14 GLY U  85  ? GLY c 5085 . ? 1_555 ? 
1423 LC5 14 ILE U  87  ? ILE c 5087 . ? 1_555 ? 
1424 LC5 14 SER U  406 ? SER c 5406 . ? 1_555 ? 
1425 LC5 14 TRP U  425 ? TRP c 5425 . ? 1_555 ? 
1426 LC5 14 SER U  429 ? SER c 5429 . ? 1_555 ? 
1427 LC5 14 HIS U  430 ? HIS c 5430 . ? 1_555 ? 
1428 LC5 14 UNK HF .   ? UNK c 5478 . ? 1_555 ? 
1429 LC5 14 CLA VF .   ? CLA c 5492 . ? 1_555 ? 
1430 LC5 14 CLA DG .   ? CLA c 5500 . ? 1_555 ? 
1431 LC5 14 DGD LG .   ? DGD c 5508 . ? 1_555 ? 
1432 LC5 14 PRO BA 17  ? PRO k 5026 . ? 1_555 ? 
1433 LC6 15 ILE S  36  ? ILE a 5036 . ? 1_555 ? 
1434 LC6 15 SER S  124 ? SER a 5124 . ? 1_555 ? 
1435 LC6 15 MET S  127 ? MET a 5127 . ? 1_555 ? 
1436 LC6 15 TRP S  131 ? TRP a 5131 . ? 1_555 ? 
1437 LC6 15 ILE U  265 ? ILE c 5265 . ? 1_555 ? 
1438 LC6 15 TYR U  274 ? TYR c 5274 . ? 1_555 ? 
1439 LC6 15 GLY U  277 ? GLY c 5277 . ? 1_555 ? 
1440 LC6 15 ALA U  278 ? ALA c 5278 . ? 1_555 ? 
1441 LC6 15 LEU U  438 ? LEU c 5438 . ? 1_555 ? 
1442 LC6 15 HIS U  441 ? HIS c 5441 . ? 1_555 ? 
1443 LC6 15 LEU U  442 ? LEU c 5442 . ? 1_555 ? 
1444 LC6 15 ALA U  445 ? ALA c 5445 . ? 1_555 ? 
1445 LC6 15 ARG U  449 ? ARG c 5449 . ? 1_555 ? 
1446 LC6 15 CLA AG .   ? CLA c 5497 . ? 1_555 ? 
1447 LC6 15 PHE Z  23  ? PHE i 5023 . ? 1_555 ? 
1448 LC7 12 LEU U  165 ? LEU c 5165 . ? 1_555 ? 
1449 LC7 12 ILE U  243 ? ILE c 5243 . ? 1_555 ? 
1450 LC7 12 GLY U  247 ? GLY c 5247 . ? 1_555 ? 
1451 LC7 12 TRP U  250 ? TRP c 5250 . ? 1_555 ? 
1452 LC7 12 HIS U  251 ? HIS c 5251 . ? 1_555 ? 
1453 LC7 12 PRO U  256 ? PRO c 5256 . ? 1_555 ? 
1454 LC7 12 PHE U  257 ? PHE c 5257 . ? 1_555 ? 
1455 LC7 12 TRP U  259 ? TRP c 5259 . ? 1_555 ? 
1456 LC7 12 PHE U  264 ? PHE c 5264 . ? 1_555 ? 
1457 LC7 12 CLA AG .   ? CLA c 5497 . ? 1_555 ? 
1458 LC7 12 BCR JG .   ? BCR c 5506 . ? 1_555 ? 
1459 LC7 12 LEU Z  24  ? LEU i 5024 . ? 1_555 ? 
1460 LC8 14 MET U  157 ? MET c 5157 . ? 1_555 ? 
1461 LC8 14 LEU U  161 ? LEU c 5161 . ? 1_555 ? 
1462 LC8 14 HIS U  164 ? HIS c 5164 . ? 1_555 ? 
1463 LC8 14 LEU U  168 ? LEU c 5168 . ? 1_555 ? 
1464 LC8 14 PHE U  264 ? PHE c 5264 . ? 1_555 ? 
1465 LC8 14 TRP U  266 ? TRP c 5266 . ? 1_555 ? 
1466 LC8 14 TYR U  271 ? TYR c 5271 . ? 1_555 ? 
1467 LC8 14 TYR U  274 ? TYR c 5274 . ? 1_555 ? 
1468 LC8 14 SER U  275 ? SER c 5275 . ? 1_555 ? 
1469 LC8 14 LEU U  279 ? LEU c 5279 . ? 1_555 ? 
1470 LC8 14 MET U  282 ? MET c 5282 . ? 1_555 ? 
1471 LC8 14 CLA YF .   ? CLA c 5495 . ? 1_555 ? 
1472 LC8 14 CLA ZF .   ? CLA c 5496 . ? 1_555 ? 
1473 LC8 14 CLA CG .   ? CLA c 5499 . ? 1_555 ? 
1474 LC9 16 LHG HE .   ? LHG a 5567 . ? 1_555 ? 
1475 LC9 16 TRP U  36  ? TRP c 5036 . ? 1_555 ? 
1476 LC9 16 ALA U  37  ? ALA c 5037 . ? 1_555 ? 
1477 LC9 16 ASN U  39  ? ASN c 5039 . ? 1_555 ? 
1478 LC9 16 ALA U  40  ? ALA c 5040 . ? 1_555 ? 
1479 LC9 16 GLU U  269 ? GLU c 5269 . ? 1_555 ? 
1480 LC9 16 LEU U  272 ? LEU c 5272 . ? 1_555 ? 
1481 LC9 16 LEU U  276 ? LEU c 5276 . ? 1_555 ? 
1482 LC9 16 PHE U  436 ? PHE c 5436 . ? 1_555 ? 
1483 LC9 16 PHE U  437 ? PHE c 5437 . ? 1_555 ? 
1484 LC9 16 GLY U  440 ? GLY c 5440 . ? 1_555 ? 
1485 LC9 16 TRP U  443 ? TRP c 5443 . ? 1_555 ? 
1486 LC9 16 HIS U  444 ? HIS c 5444 . ? 1_555 ? 
1487 LC9 16 ARG U  447 ? ARG c 5447 . ? 1_555 ? 
1488 LC9 16 CLA CG .   ? CLA c 5499 . ? 1_555 ? 
1489 LC9 16 CLA DG .   ? CLA c 5500 . ? 1_555 ? 
1490 MC1 11 ASN U  39  ? ASN c 5039 . ? 1_555 ? 
1491 MC1 11 LEU U  49  ? LEU c 5049 . ? 1_555 ? 
1492 MC1 11 ALA U  52  ? ALA c 5052 . ? 1_555 ? 
1493 MC1 11 HIS U  53  ? HIS c 5053 . ? 1_555 ? 
1494 MC1 11 HIS U  56  ? HIS c 5056 . ? 1_555 ? 
1495 MC1 11 GLU U  269 ? GLU c 5269 . ? 1_555 ? 
1496 MC1 11 LEU U  272 ? LEU c 5272 . ? 1_555 ? 
1497 MC1 11 SER U  275 ? SER c 5275 . ? 1_555 ? 
1498 MC1 11 CLA AG .   ? CLA c 5497 . ? 1_555 ? 
1499 MC1 11 CLA BG .   ? CLA c 5498 . ? 1_555 ? 
1500 MC1 11 CLA DG .   ? CLA c 5500 . ? 1_555 ? 
1501 MC2 14 ASN U  39  ? ASN c 5039 . ? 1_555 ? 
1502 MC2 14 HIS U  56  ? HIS c 5056 . ? 1_555 ? 
1503 MC2 14 LEU U  59  ? LEU c 5059 . ? 1_555 ? 
1504 MC2 14 LEU U  279 ? LEU c 5279 . ? 1_555 ? 
1505 MC2 14 PHE U  436 ? PHE c 5436 . ? 1_555 ? 
1506 MC2 14 PHE U  437 ? PHE c 5437 . ? 1_555 ? 
1507 MC2 14 CLA VF .   ? CLA c 5492 . ? 1_555 ? 
1508 MC2 14 CLA WF .   ? CLA c 5493 . ? 1_555 ? 
1509 MC2 14 CLA XF .   ? CLA c 5494 . ? 1_555 ? 
1510 MC2 14 CLA BG .   ? CLA c 5498 . ? 1_555 ? 
1511 MC2 14 CLA CG .   ? CLA c 5499 . ? 1_555 ? 
1512 MC2 14 PRO BA 20  ? PRO k 5029 . ? 1_555 ? 
1513 MC2 14 VAL BA 21  ? VAL k 5030 . ? 1_555 ? 
1514 MC2 14 LEU BA 24  ? LEU k 5033 . ? 1_555 ? 
1515 MC3 18 ASP U  27  ? ASP c 5027 . ? 1_555 ? 
1516 MC3 18 TRP U  35  ? TRP c 5035 . ? 1_555 ? 
1517 MC3 18 GLY U  38  ? GLY c 5038 . ? 1_555 ? 
1518 MC3 18 ASN U  39  ? ASN c 5039 . ? 1_555 ? 
1519 MC3 18 ARG U  41  ? ARG c 5041 . ? 1_555 ? 
1520 MC3 18 LEU U  42  ? LEU c 5042 . ? 1_555 ? 
1521 MC3 18 LEU U  45  ? LEU c 5045 . ? 1_555 ? 
1522 MC3 18 LYS U  48  ? LYS c 5048 . ? 1_555 ? 
1523 MC3 18 ALA U  52  ? ALA c 5052 . ? 1_555 ? 
1524 MC3 18 PHE U  127 ? PHE c 5127 . ? 1_555 ? 
1525 MC3 18 ALA U  133 ? ALA c 5133 . ? 1_555 ? 
1526 MC3 18 ILE U  134 ? ILE c 5134 . ? 1_555 ? 
1527 MC3 18 BCR HG .   ? BCR c 5504 . ? 1_555 ? 
1528 MC3 18 TRP BA 30  ? TRP k 5039 . ? 1_555 ? 
1529 MC3 18 GLN BA 31  ? GLN k 5040 . ? 1_555 ? 
1530 MC3 18 UNK IA 31  ? UNK x 5031 . ? 1_555 ? 
1531 MC3 18 VAL JA 20  ? VAL z 5020 . ? 1_555 ? 
1532 MC3 18 PRO JA 24  ? PRO z 5024 . ? 1_555 ? 
1533 MC4 10 HIS U  53  ? HIS c 5053 . ? 1_555 ? 
1534 MC4 10 PHE U  147 ? PHE c 5147 . ? 1_555 ? 
1535 MC4 10 PHE U  163 ? PHE c 5163 . ? 1_555 ? 
1536 MC4 10 HIS U  164 ? HIS c 5164 . ? 1_555 ? 
1537 MC4 10 VAL U  167 ? VAL c 5167 . ? 1_555 ? 
1538 MC4 10 LEU U  168 ? LEU c 5168 . ? 1_555 ? 
1539 MC4 10 GLY U  171 ? GLY c 5171 . ? 1_555 ? 
1540 MC4 10 CLA WF .   ? CLA c 5493 . ? 1_555 ? 
1541 MC4 10 CLA GG .   ? CLA c 5503 . ? 1_555 ? 
1542 MC4 10 BCR IG .   ? BCR c 5505 . ? 1_555 ? 
1543 MC5 10 LEU U  50  ? LEU c 5050 . ? 1_555 ? 
1544 MC5 10 VAL U  124 ? VAL c 5124 . ? 1_555 ? 
1545 MC5 10 GLY U  128 ? GLY c 5128 . ? 1_555 ? 
1546 MC5 10 TYR U  131 ? TYR c 5131 . ? 1_555 ? 
1547 MC5 10 HIS U  132 ? HIS c 5132 . ? 1_555 ? 
1548 MC5 10 PRO U  137 ? PRO c 5137 . ? 1_555 ? 
1549 MC5 10 LEU U  140 ? LEU c 5140 . ? 1_555 ? 
1550 MC5 10 PHE U  147 ? PHE c 5147 . ? 1_555 ? 
1551 MC5 10 CLA FG .   ? CLA c 5502 . ? 1_555 ? 
1552 MC5 10 BCR IG .   ? BCR c 5505 . ? 1_555 ? 
1553 MC6 12 ILE W  13  ? ILE e 5013 . ? 1_555 ? 
1554 MC6 12 ARG W  18  ? ARG e 5018 . ? 1_555 ? 
1555 MC6 12 TYR W  19  ? TYR e 5019 . ? 1_555 ? 
1556 MC6 12 HIS W  23  ? HIS e 5023 . ? 1_555 ? 
1557 MC6 12 THR W  26  ? THR e 5026 . ? 1_555 ? 
1558 MC6 12 ILE W  27  ? ILE e 5027 . ? 1_555 ? 
1559 MC6 12 ARG X  19  ? ARG f 5019 . ? 1_555 ? 
1560 MC6 12 TRP X  20  ? TRP f 5020 . ? 1_555 ? 
1561 MC6 12 HIS X  24  ? HIS f 5024 . ? 1_555 ? 
1562 MC6 12 ALA X  27  ? ALA f 5027 . ? 1_555 ? 
1563 MC6 12 ILE X  31  ? ILE f 5031 . ? 1_555 ? 
1564 MC6 12 UNK IA 116 ? UNK x 5116 . ? 1_555 ? 
1565 MC7 12 ALA HA 36  ? ALA v 5062 . ? 1_555 ? 
1566 MC7 12 CYS HA 37  ? CYS v 5063 . ? 1_555 ? 
1567 MC7 12 CYS HA 40  ? CYS v 5066 . ? 1_555 ? 
1568 MC7 12 HIS HA 41  ? HIS v 5067 . ? 1_555 ? 
1569 MC7 12 THR HA 48  ? THR v 5074 . ? 1_555 ? 
1570 MC7 12 LEU HA 52  ? LEU v 5078 . ? 1_555 ? 
1571 MC7 12 ASP HA 53  ? ASP v 5079 . ? 1_555 ? 
1572 MC7 12 LEU HA 54  ? LEU v 5080 . ? 1_555 ? 
1573 MC7 12 THR HA 58  ? THR v 5084 . ? 1_555 ? 
1574 MC7 12 TYR HA 75  ? TYR v 5101 . ? 1_555 ? 
1575 MC7 12 TYR HA 82  ? TYR v 5108 . ? 1_555 ? 
1576 MC7 12 HIS HA 92  ? HIS v 5118 . ? 1_555 ? 
1577 MC8 12 UNK DF .   ? UNK c 5474 . ? 1_555 ? 
1578 MC8 12 LEU V  209 ? LEU d 5209 . ? 1_555 ? 
1579 MC8 12 LEU V  210 ? LEU d 5210 . ? 1_555 ? 
1580 MC8 12 HIS V  214 ? HIS d 5214 . ? 1_555 ? 
1581 MC8 12 THR V  217 ? THR d 5217 . ? 1_555 ? 
1582 MC8 12 TRP V  253 ? TRP d 5253 . ? 1_555 ? 
1583 MC8 12 ALA V  260 ? ALA d 5260 . ? 1_555 ? 
1584 MC8 12 PHE V  261 ? PHE d 5261 . ? 1_555 ? 
1585 MC8 12 LEU V  267 ? LEU d 5267 . ? 1_555 ? 
1586 MC8 12 PHE V  270 ? PHE d 5270 . ? 1_555 ? 
1587 MC8 12 VAL V  274 ? VAL d 5274 . ? 1_555 ? 
1588 MC8 12 THR V  277 ? THR d 5277 . ? 1_555 ? 
1589 MC9 9  HIS S  215 ? HIS a 5215 . ? 1_555 ? 
1590 MC9 9  LEU S  218 ? LEU a 5218 . ? 1_555 ? 
1591 MC9 9  ALA S  251 ? ALA a 5251 . ? 1_555 ? 
1592 MC9 9  HIS S  252 ? HIS a 5252 . ? 1_555 ? 
1593 MC9 9  PHE S  255 ? PHE a 5255 . ? 1_555 ? 
1594 MC9 9  SER S  264 ? SER a 5264 . ? 1_555 ? 
1595 MC9 9  PHE S  265 ? PHE a 5265 . ? 1_555 ? 
1596 MC9 9  LEU S  271 ? LEU a 5271 . ? 1_555 ? 
1597 MC9 9  PHE S  274 ? PHE a 5274 . ? 1_555 ? 
1598 NC1 7  ASP S  170 ? ASP a 5170 . ? 1_555 ? 
1599 NC1 7  GLU S  189 ? GLU a 5189 . ? 1_555 ? 
1600 NC1 7  HIS S  332 ? HIS a 5332 . ? 1_555 ? 
1601 NC1 7  GLU S  333 ? GLU a 5333 . ? 1_555 ? 
1602 NC1 7  ASP S  342 ? ASP a 5342 . ? 1_555 ? 
1603 NC1 7  ALA S  344 ? ALA a 5344 . ? 1_555 ? 
1604 NC1 7  GLU U  354 ? GLU c 5354 . ? 1_555 ? 
1605 NC2 6  ILE S  38  ? ILE a 5038 . ? 1_555 ? 
1606 NC2 6  ALA S  43  ? ALA a 5043 . ? 1_555 ? 
1607 NC2 6  ALA S  51  ? ALA a 5051 . ? 1_555 ? 
1608 NC2 6  ALA S  54  ? ALA a 5054 . ? 1_555 ? 
1609 NC2 6  TRP S  105 ? TRP a 5105 . ? 1_555 ? 
1610 NC2 6  PHE Z  15  ? PHE i 5015 . ? 1_555 ? 
1611 NC3 9  PHE N  19  ? PHE T 19   . ? 1_555 ? 
1612 NC3 9  BCR TD .   ? BCR T 5104 . ? 1_555 ? 
1613 NC3 9  MET T  25  ? MET b 5025 . ? 1_555 ? 
1614 NC3 9  LEU T  29  ? LEU b 5029 . ? 1_555 ? 
1615 NC3 9  TRP T  115 ? TRP b 5115 . ? 1_555 ? 
1616 NC3 9  CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1617 NC3 9  CLA WE .   ? CLA b 5524 . ? 1_555 ? 
1618 NC3 9  BCR AF .   ? BCR b 5528 . ? 1_555 ? 
1619 NC3 9  MGE CF .   ? MGE b 5530 . ? 1_555 ? 
1620 NC4 16 SQD XA .   ? SQD A 5212 . ? 1_555 ? 
1621 NC4 16 ILE N  4   ? ILE T 4    . ? 1_555 ? 
1622 NC4 16 PHE N  8   ? PHE T 8    . ? 1_555 ? 
1623 NC4 16 ALA N  11  ? ALA T 11   . ? 1_555 ? 
1624 NC4 16 ALA N  15  ? ALA T 15   . ? 1_555 ? 
1625 NC4 16 PHE N  17  ? PHE T 17   . ? 1_555 ? 
1626 NC4 16 PHE N  18  ? PHE T 18   . ? 1_555 ? 
1627 NC4 16 ILE N  21  ? ILE T 21   . ? 1_555 ? 
1628 NC4 16 PHE N  22  ? PHE T 22   . ? 1_555 ? 
1629 NC4 16 TRP T  33  ? TRP b 5033 . ? 1_555 ? 
1630 NC4 16 SER T  36  ? SER b 5036 . ? 1_555 ? 
1631 NC4 16 MET T  37  ? MET b 5037 . ? 1_555 ? 
1632 NC4 16 LEU T  109 ? LEU b 5109 . ? 1_555 ? 
1633 NC4 16 CLA PE .   ? CLA b 5517 . ? 1_555 ? 
1634 NC4 16 BCR ZE .   ? BCR b 5527 . ? 1_555 ? 
1635 NC4 16 BCR AF .   ? BCR b 5528 . ? 1_555 ? 
1636 NC5 10 LMT SD .   ? LMT T 217  . ? 1_555 ? 
1637 NC5 10 BCR TD .   ? BCR T 5104 . ? 1_555 ? 
1638 NC5 10 LEU T  29  ? LEU b 5029 . ? 1_555 ? 
1639 NC5 10 GLY T  32  ? GLY b 5032 . ? 1_555 ? 
1640 NC5 10 TRP T  33  ? TRP b 5033 . ? 1_555 ? 
1641 NC5 10 SER T  36  ? SER b 5036 . ? 1_555 ? 
1642 NC5 10 ILE T  101 ? ILE b 5101 . ? 1_555 ? 
1643 NC5 10 VAL T  102 ? VAL b 5102 . ? 1_555 ? 
1644 NC5 10 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1645 NC5 10 BCR ZE .   ? BCR b 5527 . ? 1_555 ? 
1646 NC6 8  SQD XA .   ? SQD A 5212 . ? 1_555 ? 
1647 NC6 8  PHE N  18  ? PHE T 18   . ? 1_555 ? 
1648 NC6 8  PHE N  22  ? PHE T 22   . ? 1_555 ? 
1649 NC6 8  LEU T  106 ? LEU b 5106 . ? 1_555 ? 
1650 NC6 8  CYS T  112 ? CYS b 5112 . ? 1_555 ? 
1651 NC6 8  VAL T  116 ? VAL b 5116 . ? 1_555 ? 
1652 NC6 8  TYR T  117 ? TYR b 5117 . ? 1_555 ? 
1653 NC6 8  CLA OE .   ? CLA b 5516 . ? 1_555 ? 
1654 NC7 6  CLA JE .   ? CLA b 5511 . ? 1_555 ? 
1655 NC7 6  CLA RE .   ? CLA b 5519 . ? 1_555 ? 
1656 NC7 6  PHE Y  38  ? PHE h 5038 . ? 1_555 ? 
1657 NC7 6  PHE Y  41  ? PHE h 5041 . ? 1_555 ? 
1658 NC7 6  UNK IA 52  ? UNK x 5052 . ? 1_555 ? 
1659 NC7 6  UNK IA 57  ? UNK x 5057 . ? 1_555 ? 
1660 NC8 15 TYR V  42  ? TYR d 5042 . ? 1_555 ? 
1661 NC8 15 LEU V  43  ? LEU d 5043 . ? 1_555 ? 
1662 NC8 15 GLY V  46  ? GLY d 5046 . ? 1_555 ? 
1663 NC8 15 GLY V  47  ? GLY d 5047 . ? 1_555 ? 
1664 NC8 15 LEU V  49  ? LEU d 5049 . ? 1_555 ? 
1665 NC8 15 THR V  50  ? THR d 5050 . ? 1_555 ? 
1666 NC8 15 PHE V  101 ? PHE d 5101 . ? 1_555 ? 
1667 NC8 15 PHE V  113 ? PHE d 5113 . ? 1_555 ? 
1668 NC8 15 CLA PG .   ? CLA d 5355 . ? 1_555 ? 
1669 NC8 15 PRO X  29  ? PRO f 5029 . ? 1_555 ? 
1670 NC8 15 THR X  30  ? THR f 5030 . ? 1_555 ? 
1671 NC8 15 PHE X  33  ? PHE f 5033 . ? 1_555 ? 
1672 NC8 15 ILE X  37  ? ILE f 5037 . ? 1_555 ? 
1673 NC8 15 VAL AA 21  ? VAL j 5021 . ? 1_555 ? 
1674 NC8 15 VAL AA 25  ? VAL j 5025 . ? 1_555 ? 
1675 NC9 14 BCR HG .   ? BCR c 5504 . ? 1_555 ? 
1676 NC9 14 ALA AA 14  ? ALA j 5014 . ? 1_555 ? 
1677 NC9 14 THR AA 15  ? THR j 5015 . ? 1_555 ? 
1678 NC9 14 GLY AA 18  ? GLY j 5018 . ? 1_555 ? 
1679 NC9 14 MET AA 19  ? MET j 5019 . ? 1_555 ? 
1680 NC9 14 LEU BA 12  ? LEU k 5021 . ? 1_555 ? 
1681 NC9 14 LEU BA 22  ? LEU k 5031 . ? 1_555 ? 
1682 NC9 14 ALA BA 25  ? ALA k 5034 . ? 1_555 ? 
1683 NC9 14 PHE BA 28  ? PHE k 5037 . ? 1_555 ? 
1684 NC9 14 VAL BA 29  ? VAL k 5038 . ? 1_555 ? 
1685 NC9 14 UNK IA 13  ? UNK x 5013 . ? 1_555 ? 
1686 NC9 14 UNK IA 14  ? UNK x 5014 . ? 1_555 ? 
1687 NC9 14 UNK IA 17  ? UNK x 5017 . ? 1_555 ? 
1688 NC9 14 VAL JA 13  ? VAL z 5013 . ? 1_555 ? 
1689 OC1 14 ALA U  55  ? ALA c 5055 . ? 1_555 ? 
1690 OC1 14 GLY U  58  ? GLY c 5058 . ? 1_555 ? 
1691 OC1 14 LEU U  59  ? LEU c 5059 . ? 1_555 ? 
1692 OC1 14 VAL U  116 ? VAL c 5116 . ? 1_555 ? 
1693 OC1 14 LEU U  119 ? LEU c 5119 . ? 1_555 ? 
1694 OC1 14 SER U  122 ? SER c 5122 . ? 1_555 ? 
1695 OC1 14 ALA U  123 ? ALA c 5123 . ? 1_555 ? 
1696 OC1 14 CLA EG .   ? CLA c 5501 . ? 1_555 ? 
1697 OC1 14 BCR IG .   ? BCR c 5505 . ? 1_555 ? 
1698 OC1 14 TYR BA 6   ? TYR k 5015 . ? 1_555 ? 
1699 OC1 14 PHE BA 9   ? PHE k 5018 . ? 1_555 ? 
1700 OC1 14 PHE BA 23  ? PHE k 5032 . ? 1_555 ? 
1701 OC1 14 ALA BA 27  ? ALA k 5036 . ? 1_555 ? 
1702 OC1 14 BCR HH .   ? BCR x 5130 . ? 1_555 ? 
1703 OC2 11 PHE U  112 ? PHE c 5112 . ? 1_555 ? 
1704 OC2 11 VAL U  116 ? VAL c 5116 . ? 1_555 ? 
1705 OC2 11 ILE U  120 ? ILE c 5120 . ? 1_555 ? 
1706 OC2 11 SER U  121 ? SER c 5121 . ? 1_555 ? 
1707 OC2 11 VAL U  124 ? VAL c 5124 . ? 1_555 ? 
1708 OC2 11 LEU U  125 ? LEU c 5125 . ? 1_555 ? 
1709 OC2 11 CLA FG .   ? CLA c 5502 . ? 1_555 ? 
1710 OC2 11 CLA GG .   ? CLA c 5503 . ? 1_555 ? 
1711 OC2 11 BCR HG .   ? BCR c 5504 . ? 1_555 ? 
1712 OC2 11 TYR BA 6   ? TYR k 5015 . ? 1_555 ? 
1713 OC2 11 GLY JA 55  ? GLY z 5055 . ? 1_555 ? 
1714 OC3 12 ILE U  209 ? ILE c 5209 . ? 1_555 ? 
1715 OC3 12 TYR U  212 ? TYR c 5212 . ? 1_555 ? 
1716 OC3 12 ILE U  224 ? ILE c 5224 . ? 1_555 ? 
1717 OC3 12 VAL U  227 ? VAL c 5227 . ? 1_555 ? 
1718 OC3 12 ASP U  232 ? ASP c 5232 . ? 1_555 ? 
1719 OC3 12 HIS U  237 ? HIS c 5237 . ? 1_555 ? 
1720 OC3 12 PHE U  264 ? PHE c 5264 . ? 1_555 ? 
1721 OC3 12 CLA UF .   ? CLA c 5491 . ? 1_555 ? 
1722 OC3 12 CLA ZF .   ? CLA c 5496 . ? 1_555 ? 
1723 OC3 12 VAL Z  20  ? VAL i 5020 . ? 1_555 ? 
1724 OC3 12 PHE Z  23  ? PHE i 5023 . ? 1_555 ? 
1725 OC3 12 LEU Z  24  ? LEU i 5024 . ? 1_555 ? 
1726 OC4 11 PHE S  93  ? PHE a 5093 . ? 1_555 ? 
1727 OC4 11 TRP S  97  ? TRP a 5097 . ? 1_555 ? 
1728 OC4 11 LEU S  121 ? LEU a 5121 . ? 1_555 ? 
1729 OC4 11 CLA DE .   ? CLA a 5563 . ? 1_555 ? 
1730 OC4 11 SER U  216 ? SER c 5216 . ? 1_555 ? 
1731 OC4 11 PHE U  218 ? PHE c 5218 . ? 1_555 ? 
1732 OC4 11 TRP U  223 ? TRP c 5223 . ? 1_555 ? 
1733 OC4 11 MET U  281 ? MET c 5281 . ? 1_555 ? 
1734 OC4 11 PHE U  284 ? PHE c 5284 . ? 1_555 ? 
1735 OC4 11 LYS Z  5   ? LYS i 5005 . ? 1_555 ? 
1736 OC4 11 TYR Z  9   ? TYR i 5009 . ? 1_555 ? 
1737 OC5 17 PHE S  155 ? PHE a 5155 . ? 1_555 ? 
1738 OC5 17 ILE S  160 ? ILE a 5160 . ? 1_555 ? 
1739 OC5 17 ILE S  163 ? ILE a 5163 . ? 1_555 ? 
1740 OC5 17 PRO U  217 ? PRO c 5217 . ? 1_555 ? 
1741 OC5 17 PHE U  218 ? PHE c 5218 . ? 1_555 ? 
1742 OC5 17 GLY U  219 ? GLY c 5219 . ? 1_555 ? 
1743 OC5 17 GLY U  220 ? GLY c 5220 . ? 1_555 ? 
1744 OC5 17 GLY U  222 ? GLY c 5222 . ? 1_555 ? 
1745 OC5 17 VAL U  225 ? VAL c 5225 . ? 1_555 ? 
1746 OC5 17 SER U  226 ? SER c 5226 . ? 1_555 ? 
1747 OC5 17 ASN U  228 ? ASN c 5228 . ? 1_555 ? 
1748 OC5 17 PHE U  284 ? PHE c 5284 . ? 1_555 ? 
1749 OC5 17 CYS U  288 ? CYS c 5288 . ? 1_555 ? 
1750 OC5 17 PHE U  292 ? PHE c 5292 . ? 1_555 ? 
1751 OC5 17 ASN U  294 ? ASN c 5294 . ? 1_555 ? 
1752 OC5 17 ARG U  362 ? ARG c 5362 . ? 1_555 ? 
1753 OC5 17 LEU U  438 ? LEU c 5438 . ? 1_555 ? 
1754 OC6 15 ARG S  140 ? ARG a 5140 . ? 1_555 ? 
1755 OC6 15 TRP S  142 ? TRP a 5142 . ? 1_555 ? 
1756 OC6 15 PHE S  273 ? PHE a 5273 . ? 1_555 ? 
1757 OC6 15 TRP U  36  ? TRP c 5036 . ? 1_555 ? 
1758 OC6 15 PHE U  436 ? PHE c 5436 . ? 1_555 ? 
1759 OC6 15 TRP U  443 ? TRP c 5443 . ? 1_555 ? 
1760 OC6 15 ARG U  447 ? ARG c 5447 . ? 1_555 ? 
1761 OC6 15 CLA BG .   ? CLA c 5498 . ? 1_555 ? 
1762 OC6 15 GLU V  219 ? GLU d 5219 . ? 1_555 ? 
1763 OC6 15 ASN V  220 ? ASN d 5220 . ? 1_555 ? 
1764 OC6 15 ALA V  229 ? ALA d 5229 . ? 1_555 ? 
1765 OC6 15 SER V  230 ? SER d 5230 . ? 1_555 ? 
1766 OC6 15 THR V  231 ? THR d 5231 . ? 1_555 ? 
1767 OC6 15 PHE V  232 ? PHE d 5232 . ? 1_555 ? 
1768 OC6 15 SQD SG .   ? SQD d 5358 . ? 1_555 ? 
1769 OC7 9  ASN S  267 ? ASN a 5267 . ? 1_555 ? 
1770 OC7 9  SER S  270 ? SER a 5270 . ? 1_555 ? 
1771 OC7 9  PHE S  274 ? PHE a 5274 . ? 1_555 ? 
1772 OC7 9  LHG HE .   ? LHG a 5567 . ? 1_555 ? 
1773 OC7 9  GLU U  29  ? GLU c 5029 . ? 1_555 ? 
1774 OC7 9  TRP U  36  ? TRP c 5036 . ? 1_555 ? 
1775 OC7 9  SER V  230 ? SER d 5230 . ? 1_555 ? 
1776 OC7 9  PHE V  232 ? PHE d 5232 . ? 1_555 ? 
1777 OC7 9  ARG V  233 ? ARG d 5233 . ? 1_555 ? 
1778 OC8 14 PHE S  197 ? PHE a 5197 . ? 1_555 ? 
1779 OC8 14 GLU U  83  ? GLU c 5083 . ? 1_555 ? 
1780 OC8 14 GLN U  84  ? GLN c 5084 . ? 1_555 ? 
1781 OC8 14 GLY U  85  ? GLY c 5085 . ? 1_555 ? 
1782 OC8 14 SER U  406 ? SER c 5406 . ? 1_555 ? 
1783 OC8 14 ASN U  418 ? ASN c 5418 . ? 1_555 ? 
1784 OC8 14 PHE U  419 ? PHE c 5419 . ? 1_555 ? 
1785 OC8 14 VAL U  420 ? VAL c 5420 . ? 1_555 ? 
1786 OC8 14 TRP U  425 ? TRP c 5425 . ? 1_555 ? 
1787 OC8 14 THR U  428 ? THR c 5428 . ? 1_555 ? 
1788 OC8 14 UNK IF .   ? UNK c 5479 . ? 1_555 ? 
1789 OC8 14 CLA XF .   ? CLA c 5494 . ? 1_555 ? 
1790 OC8 14 DGD MG .   ? DGD c 5509 . ? 1_555 ? 
1791 OC8 14 TYR AA 33  ? TYR j 5033 . ? 1_555 ? 
1792 OC9 20 GLN S  199 ? GLN a 5199 . ? 1_555 ? 
1793 OC9 20 LEU S  200 ? LEU a 5200 . ? 1_555 ? 
1794 OC9 20 PHE S  300 ? PHE a 5300 . ? 1_555 ? 
1795 OC9 20 ASN S  301 ? ASN a 5301 . ? 1_555 ? 
1796 OC9 20 SER S  305 ? SER a 5305 . ? 1_555 ? 
1797 OC9 20 CLA AE .   ? CLA a 5560 . ? 1_555 ? 
1798 OC9 20 ASN U  405 ? ASN c 5405 . ? 1_555 ? 
1799 OC9 20 VAL U  407 ? VAL c 5407 . ? 1_555 ? 
1800 OC9 20 ASN U  415 ? ASN c 5415 . ? 1_555 ? 
1801 OC9 20 SER U  416 ? SER c 5416 . ? 1_555 ? 
1802 OC9 20 ASN U  418 ? ASN c 5418 . ? 1_555 ? 
1803 OC9 20 DGD LG .   ? DGD c 5508 . ? 1_555 ? 
1804 OC9 20 MGE TG .   ? MGE d 5359 . ? 1_555 ? 
1805 OC9 20 PHE AA 29  ? PHE j 5029 . ? 1_555 ? 
1806 OC9 20 ALA AA 32  ? ALA j 5032 . ? 1_555 ? 
1807 OC9 20 TYR AA 33  ? TYR j 5033 . ? 1_555 ? 
1808 OC9 20 GLY AA 37  ? GLY j 5037 . ? 1_555 ? 
1809 OC9 20 SER AA 38  ? SER j 5038 . ? 1_555 ? 
1810 OC9 20 SER AA 39  ? SER j 5039 . ? 1_555 ? 
1811 OC9 20 GLN HA 34  ? GLN v 5060 . ? 1_555 ? 
1812 PC1 12 CLA AE .   ? CLA a 5560 . ? 1_555 ? 
1813 PC1 12 DGD MG .   ? DGD c 5509 . ? 1_555 ? 
1814 PC1 12 TYR V  67  ? TYR d 5067 . ? 1_555 ? 
1815 PC1 12 GLY V  70  ? GLY d 5070 . ? 1_555 ? 
1816 PC1 12 CYS V  71  ? CYS d 5071 . ? 1_555 ? 
1817 PC1 12 PHE V  73  ? PHE d 5073 . ? 1_555 ? 
1818 PC1 12 CLA OG .   ? CLA d 5354 . ? 1_555 ? 
1819 PC1 12 THR X  30  ? THR f 5030 . ? 1_555 ? 
1820 PC1 12 GLN X  41  ? GLN f 5041 . ? 1_555 ? 
1821 PC1 12 GLY AA 31  ? GLY j 5031 . ? 1_555 ? 
1822 PC1 12 ALA AA 32  ? ALA j 5032 . ? 1_555 ? 
1823 PC1 12 GLY AA 37  ? GLY j 5037 . ? 1_555 ? 
1824 PC2 14 TYR T  193 ? TYR b 5193 . ? 1_555 ? 
1825 PC2 14 PHE T  250 ? PHE b 5250 . ? 1_555 ? 
1826 PC2 14 TYR T  258 ? TYR b 5258 . ? 1_555 ? 
1827 PC2 14 TYR T  273 ? TYR b 5273 . ? 1_555 ? 
1828 PC2 14 SER T  277 ? SER b 5277 . ? 1_555 ? 
1829 PC2 14 PHE T  463 ? PHE b 5463 . ? 1_555 ? 
1830 PC2 14 HIS V  87  ? HIS d 5087 . ? 1_555 ? 
1831 PC2 14 ILE V  123 ? ILE d 5123 . ? 1_555 ? 
1832 PC2 14 LEU V  162 ? LEU d 5162 . ? 1_555 ? 
1833 PC2 14 SER V  165 ? SER d 5165 . ? 1_555 ? 
1834 PC2 14 TYR Y  49  ? TYR h 5049 . ? 1_555 ? 
1835 PC2 14 VAL Y  60  ? VAL h 5060 . ? 1_555 ? 
1836 PC2 14 SER Y  61  ? SER h 5061 . ? 1_555 ? 
1837 PC2 14 TRP Y  62  ? TRP h 5062 . ? 1_555 ? 
1838 PC3 12 TRP T  5   ? TRP b 5005 . ? 1_555 ? 
1839 PC3 12 TYR T  6   ? TYR b 5006 . ? 1_555 ? 
1840 PC3 12 ARG T  7   ? ARG b 5007 . ? 1_555 ? 
1841 PC3 12 PHE T  464 ? PHE b 5464 . ? 1_555 ? 
1842 PC3 12 TRP T  468 ? TRP b 5468 . ? 1_555 ? 
1843 PC3 12 CLA TE .   ? CLA b 5521 . ? 1_555 ? 
1844 PC3 12 CLA VE .   ? CLA b 5523 . ? 1_555 ? 
1845 PC3 12 ARG V  139 ? ARG d 5139 . ? 1_555 ? 
1846 PC3 12 TYR V  141 ? TYR d 5141 . ? 1_555 ? 
1847 PC3 12 PHE V  269 ? PHE d 5269 . ? 1_555 ? 
1848 PC3 12 PHE V  273 ? PHE d 5273 . ? 1_555 ? 
1849 PC3 12 MGE BH .   ? MGE l 5210 . ? 1_555 ? 
1850 PC4 14 SER S  232 ? SER a 5232 . ? 1_555 ? 
1851 PC4 14 ASN S  234 ? ASN a 5234 . ? 1_555 ? 
1852 PC4 14 CLA ZD .   ? CLA a 5559 . ? 1_555 ? 
1853 PC4 14 TRP T  5   ? TRP b 5005 . ? 1_555 ? 
1854 PC4 14 TYR T  6   ? TYR b 5006 . ? 1_555 ? 
1855 PC4 14 CLA WE .   ? CLA b 5524 . ? 1_555 ? 
1856 PC4 14 UNK DF .   ? UNK c 5474 . ? 1_555 ? 
1857 PC4 14 TRP V  266 ? TRP d 5266 . ? 1_555 ? 
1858 PC4 14 PHE V  270 ? PHE d 5270 . ? 1_555 ? 
1859 PC4 14 PHE V  273 ? PHE d 5273 . ? 1_555 ? 
1860 PC4 14 MGE UG .   ? MGE d 5360 . ? 1_555 ? 
1861 PC4 14 GLU CA 11  ? GLU l 5011 . ? 1_555 ? 
1862 PC4 14 SER CA 16  ? SER l 5016 . ? 1_555 ? 
1863 PC4 14 GLY CA 20  ? GLY l 5020 . ? 1_555 ? 
1864 PC5 16 CLA YD .   ? CLA a 5558 . ? 1_555 ? 
1865 PC5 16 CLA ZD .   ? CLA a 5559 . ? 1_555 ? 
1866 PC5 16 ILE V  259 ? ILE d 5259 . ? 1_555 ? 
1867 PC5 16 ALA V  260 ? ALA d 5260 . ? 1_555 ? 
1868 PC5 16 PHE V  261 ? PHE d 5261 . ? 1_555 ? 
1869 PC5 16 SER V  262 ? SER d 5262 . ? 1_555 ? 
1870 PC5 16 ASN V  263 ? ASN d 5263 . ? 1_555 ? 
1871 PC5 16 TRP V  266 ? TRP d 5266 . ? 1_555 ? 
1872 PC5 16 PHE V  270 ? PHE d 5270 . ? 1_555 ? 
1873 PC5 16 ASN CA 13  ? ASN l 5013 . ? 1_555 ? 
1874 PC5 16 THR CA 15  ? THR l 5015 . ? 1_555 ? 
1875 PC5 16 TYR CA 18  ? TYR l 5018 . ? 1_555 ? 
1876 PC5 16 LEU CA 19  ? LEU l 5019 . ? 1_555 ? 
1877 PC5 16 PHE FA 10  ? PHE t 5010 . ? 1_555 ? 
1878 PC5 16 PHE FA 17  ? PHE t 5017 . ? 1_555 ? 
1879 PC5 16 ALA FA 20  ? ALA t 5020 . ? 1_555 ? 
1880 PC6 8  TRP A  20  ? TRP A 20   . ? 1_555 ? 
1881 PC6 8  ASN A  26  ? ASN A 26   . ? 1_555 ? 
1882 PC6 8  ARG A  27  ? ARG A 27   . ? 1_555 ? 
1883 PC6 8  LEU A  28  ? LEU A 28   . ? 1_555 ? 
1884 PC6 8  BCR TD .   ? BCR T 5104 . ? 1_555 ? 
1885 PC6 8  TRP T  113 ? TRP b 5113 . ? 1_555 ? 
1886 PC6 8  TYR T  117 ? TYR b 5117 . ? 1_555 ? 
1887 PC6 8  BCR BF .   ? BCR b 5529 . ? 1_555 ? 
1888 PC7 8  ARG K  14  ? ARG L 14   . ? 1_555 ? 
1889 PC7 8  TYR K  18  ? TYR L 18   . ? 1_555 ? 
1890 PC7 8  LEU K  21  ? LEU L 21   . ? 1_555 ? 
1891 PC7 8  PHE N  19  ? PHE T 19   . ? 1_555 ? 
1892 PC7 8  PHE N  23  ? PHE T 23   . ? 1_555 ? 
1893 PC7 8  ARG T  18  ? ARG b 5018 . ? 1_555 ? 
1894 PC7 8  LEU T  29  ? LEU b 5029 . ? 1_555 ? 
1895 PC7 8  SER T  104 ? SER b 5104 . ? 1_555 ? 
1896 PC8 11 THR T  327 ? THR b 5327 . ? 1_555 ? 
1897 PC8 11 GLY T  328 ? GLY b 5328 . ? 1_555 ? 
1898 PC8 11 PRO T  329 ? PRO b 5329 . ? 1_555 ? 
1899 PC8 11 LYS T  332 ? LYS b 5332 . ? 1_555 ? 
1900 PC8 11 PHE T  453 ? PHE b 5453 . ? 1_555 ? 
1901 PC8 11 CLA PE .   ? CLA b 5517 . ? 1_555 ? 
1902 PC8 11 BCR ZE .   ? BCR b 5527 . ? 1_555 ? 
1903 PC8 11 PHE CA 35  ? PHE l 5035 . ? 1_555 ? 
1904 PC8 11 LMT CH .   ? LMT m 216  . ? 1_555 ? 
1905 PC8 11 ASN DA 4   ? ASN m 5004 . ? 1_555 ? 
1906 PC8 11 LEU DA 6   ? LEU m 5006 . ? 1_555 ? 
1907 PC9 11 ALA B  43  ? ALA B 43   . ? 1_555 ? 
1908 PC9 11 LEU B  98  ? LEU B 98   . ? 1_555 ? 
1909 PC9 11 ILE S  50  ? ILE a 5050 . ? 1_555 ? 
1910 PC9 11 LEU S  72  ? LEU a 5072 . ? 1_555 ? 
1911 PC9 11 TYR S  73  ? TYR a 5073 . ? 1_555 ? 
1912 PC9 11 UNK RF .   ? UNK c 5488 . ? 1_555 ? 
1913 PC9 11 UNK SF .   ? UNK c 5489 . ? 1_555 ? 
1914 PC9 11 ARG V  304 ? ARG d 5304 . ? 1_555 ? 
1915 PC9 11 GLY EA 114 ? GLY o 5139 . ? 1_555 ? 
1916 PC9 11 GLU EA 115 ? GLU o 5140 . ? 1_555 ? 
1917 PC9 11 LMT FH .   ? LMT t 5217 . ? 1_555 ? 
1918 QC1 9  TYR B  40  ? TYR B 40   . ? 1_555 ? 
1919 QC1 9  MGE RB .   ? MGE B 530  . ? 1_555 ? 
1920 QC1 9  GLN L  5   ? GLN M 5    . ? 1_555 ? 
1921 QC1 9  LEU L  6   ? LEU M 6    . ? 1_555 ? 
1922 QC1 9  LMT CH .   ? LMT m 216  . ? 1_555 ? 
1923 QC1 9  MET DA 1   ? MET m 5001 . ? 1_555 ? 
1924 QC1 9  MET FA 1   ? MET t 5001 . ? 1_555 ? 
1925 QC1 9  ILE FA 4   ? ILE t 5004 . ? 1_555 ? 
1926 QC1 9  LMT FH .   ? LMT t 5217 . ? 1_555 ? 
1927 QC2 8  TYR B  40  ? TYR B 40   . ? 1_555 ? 
1928 QC2 8  ALA B  43  ? ALA B 43   . ? 1_555 ? 
1929 QC2 8  THR B  44  ? THR B 44   . ? 1_555 ? 
1930 QC2 8  LMT RD .   ? LMT M 5216 . ? 1_555 ? 
1931 QC2 8  LEU S  72  ? LEU a 5072 . ? 1_555 ? 
1932 QC2 8  LMT IE .   ? LMT a 5568 . ? 1_555 ? 
1933 QC2 8  MET FA 1   ? MET t 5001 . ? 1_555 ? 
1934 QC2 8  ILE FA 4   ? ILE t 5004 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AXT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AXT 
_atom_sites.fract_transf_matrix[1][1]   0.007831 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004436 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003267 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
MG 
MN 
N  
NE 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  10  ? 74.216  42.741  25.829  1.00 86.89  ? 10   SER A N     1 
ATOM   2     C  CA    . SER A  1  10  ? 72.918  43.144  26.472  1.00 87.49  ? 10   SER A CA    1 
ATOM   3     C  C     . SER A  1  10  ? 72.900  44.621  26.960  1.00 87.49  ? 10   SER A C     1 
ATOM   4     O  O     . SER A  1  10  ? 73.148  45.566  26.180  1.00 87.43  ? 10   SER A O     1 
ATOM   5     C  CB    . SER A  1  10  ? 72.612  42.200  27.652  1.00 87.00  ? 10   SER A CB    1 
ATOM   6     N  N     . ALA A  1  11  ? 72.585  44.794  28.247  1.00 87.27  ? 11   ALA A N     1 
ATOM   7     C  CA    . ALA A  1  11  ? 72.535  46.097  28.932  1.00 86.83  ? 11   ALA A CA    1 
ATOM   8     C  C     . ALA A  1  11  ? 71.938  45.737  30.297  1.00 86.56  ? 11   ALA A C     1 
ATOM   9     O  O     . ALA A  1  11  ? 71.096  46.452  30.849  1.00 88.11  ? 11   ALA A O     1 
ATOM   10    C  CB    . ALA A  1  11  ? 71.631  47.096  28.171  1.00 86.09  ? 11   ALA A CB    1 
ATOM   11    N  N     . ASN A  1  12  ? 72.420  44.619  30.834  1.00 86.07  ? 12   ASN A N     1 
ATOM   12    C  CA    . ASN A  1  12  ? 71.947  44.047  32.100  1.00 84.71  ? 12   ASN A CA    1 
ATOM   13    C  C     . ASN A  1  12  ? 70.428  43.892  32.098  1.00 83.23  ? 12   ASN A C     1 
ATOM   14    O  O     . ASN A  1  12  ? 69.664  44.851  32.215  1.00 82.15  ? 12   ASN A O     1 
ATOM   15    C  CB    . ASN A  1  12  ? 72.379  44.852  33.330  1.00 85.24  ? 12   ASN A CB    1 
ATOM   16    C  CG    . ASN A  1  12  ? 72.300  44.010  34.623  1.00 87.02  ? 12   ASN A CG    1 
ATOM   17    O  OD1   . ASN A  1  12  ? 72.538  44.506  35.738  1.00 87.45  ? 12   ASN A OD1   1 
ATOM   18    N  ND2   . ASN A  1  12  ? 71.962  42.725  34.467  1.00 86.67  ? 12   ASN A ND2   1 
ATOM   19    N  N     . LEU A  1  13  ? 70.025  42.646  31.957  1.00 82.11  ? 13   LEU A N     1 
ATOM   20    C  CA    . LEU A  1  13  ? 68.641  42.275  31.912  1.00 81.58  ? 13   LEU A CA    1 
ATOM   21    C  C     . LEU A  1  13  ? 67.783  43.082  32.867  1.00 80.67  ? 13   LEU A C     1 
ATOM   22    O  O     . LEU A  1  13  ? 66.691  43.517  32.504  1.00 81.10  ? 13   LEU A O     1 
ATOM   23    C  CB    . LEU A  1  13  ? 68.528  40.786  32.225  1.00 81.96  ? 13   LEU A CB    1 
ATOM   24    C  CG    . LEU A  1  13  ? 69.763  40.009  31.747  1.00 82.22  ? 13   LEU A CG    1 
ATOM   25    C  CD1   . LEU A  1  13  ? 69.499  38.500  31.913  1.00 82.19  ? 13   LEU A CD1   1 
ATOM   26    C  CD2   . LEU A  1  13  ? 70.101  40.374  30.269  1.00 81.67  ? 13   LEU A CD2   1 
ATOM   27    N  N     . TRP A  1  14  ? 68.255  43.288  34.085  1.00 80.21  ? 14   TRP A N     1 
ATOM   28    C  CA    . TRP A  1  14  ? 67.431  44.047  35.017  1.00 80.01  ? 14   TRP A CA    1 
ATOM   29    C  C     . TRP A  1  14  ? 66.978  45.350  34.380  1.00 78.71  ? 14   TRP A C     1 
ATOM   30    O  O     . TRP A  1  14  ? 65.794  45.689  34.416  1.00 78.59  ? 14   TRP A O     1 
ATOM   31    C  CB    . TRP A  1  14  ? 68.175  44.328  36.332  1.00 80.82  ? 14   TRP A CB    1 
ATOM   32    C  CG    . TRP A  1  14  ? 67.416  45.284  37.229  1.00 80.69  ? 14   TRP A CG    1 
ATOM   33    C  CD1   . TRP A  1  14  ? 67.543  46.649  37.273  1.00 80.91  ? 14   TRP A CD1   1 
ATOM   34    C  CD2   . TRP A  1  14  ? 66.373  44.956  38.149  1.00 80.69  ? 14   TRP A CD2   1 
ATOM   35    N  NE1   . TRP A  1  14  ? 66.646  47.189  38.159  1.00 80.33  ? 14   TRP A NE1   1 
ATOM   36    C  CE2   . TRP A  1  14  ? 65.914  46.173  38.715  1.00 81.50  ? 14   TRP A CE2   1 
ATOM   37    C  CE3   . TRP A  1  14  ? 65.778  43.756  38.554  1.00 79.98  ? 14   TRP A CE3   1 
ATOM   38    C  CZ2   . TRP A  1  14  ? 64.882  46.219  39.670  1.00 82.05  ? 14   TRP A CZ2   1 
ATOM   39    C  CZ3   . TRP A  1  14  ? 64.751  43.798  39.502  1.00 79.90  ? 14   TRP A CZ3   1 
ATOM   40    C  CH2   . TRP A  1  14  ? 64.315  45.020  40.049  1.00 80.66  ? 14   TRP A CH2   1 
ATOM   41    N  N     . GLU A  1  15  ? 67.920  46.074  33.793  1.00 77.58  ? 15   GLU A N     1 
ATOM   42    C  CA    . GLU A  1  15  ? 67.587  47.337  33.144  1.00 76.66  ? 15   GLU A CA    1 
ATOM   43    C  C     . GLU A  1  15  ? 66.433  47.094  32.179  1.00 75.15  ? 15   GLU A C     1 
ATOM   44    O  O     . GLU A  1  15  ? 65.453  47.819  32.145  1.00 73.69  ? 15   GLU A O     1 
ATOM   45    C  CB    . GLU A  1  15  ? 68.788  47.865  32.360  1.00 77.12  ? 15   GLU A CB    1 
ATOM   46    C  CG    . GLU A  1  15  ? 68.516  49.214  31.712  1.00 78.98  ? 15   GLU A CG    1 
ATOM   47    C  CD    . GLU A  1  15  ? 69.368  49.493  30.471  1.00 79.81  ? 15   GLU A CD    1 
ATOM   48    O  OE1   . GLU A  1  15  ? 69.345  50.663  29.998  1.00 80.46  ? 15   GLU A OE1   1 
ATOM   49    O  OE2   . GLU A  1  15  ? 70.039  48.556  29.965  1.00 80.47  ? 15   GLU A OE2   1 
ATOM   50    N  N     . ARG A  1  16  ? 66.601  46.051  31.388  1.00 75.29  ? 16   ARG A N     1 
ATOM   51    C  CA    . ARG A  1  16  ? 65.634  45.616  30.397  1.00 75.72  ? 16   ARG A CA    1 
ATOM   52    C  C     . ARG A  1  16  ? 64.325  45.154  31.071  1.00 75.59  ? 16   ARG A C     1 
ATOM   53    O  O     . ARG A  1  16  ? 63.224  45.590  30.688  1.00 75.60  ? 16   ARG A O     1 
ATOM   54    C  CB    . ARG A  1  16  ? 66.269  44.481  29.555  1.00 75.04  ? 16   ARG A CB    1 
ATOM   55    C  CG    . ARG A  1  16  ? 65.303  43.545  28.855  1.00 74.97  ? 16   ARG A CG    1 
ATOM   56    C  CD    . ARG A  1  16  ? 64.845  42.385  29.770  1.00 74.17  ? 16   ARG A CD    1 
ATOM   57    N  NE    . ARG A  1  16  ? 63.877  41.490  29.117  1.00 72.89  ? 16   ARG A NE    1 
ATOM   58    C  CZ    . ARG A  1  16  ? 63.585  40.266  29.546  1.00 71.01  ? 16   ARG A CZ    1 
ATOM   59    N  NH1   . ARG A  1  16  ? 64.184  39.783  30.627  1.00 71.46  ? 16   ARG A NH1   1 
ATOM   60    N  NH2   . ARG A  1  16  ? 62.696  39.530  28.899  1.00 69.84  ? 16   ARG A NH2   1 
ATOM   61    N  N     . PHE A  1  17  ? 64.450  44.280  32.070  1.00 74.88  ? 17   PHE A N     1 
ATOM   62    C  CA    . PHE A  1  17  ? 63.291  43.757  32.796  1.00 74.36  ? 17   PHE A CA    1 
ATOM   63    C  C     . PHE A  1  17  ? 62.383  44.925  33.171  1.00 73.39  ? 17   PHE A C     1 
ATOM   64    O  O     . PHE A  1  17  ? 61.183  44.941  32.849  1.00 73.27  ? 17   PHE A O     1 
ATOM   65    C  CB    . PHE A  1  17  ? 63.763  43.030  34.047  1.00 74.26  ? 17   PHE A CB    1 
ATOM   66    C  CG    . PHE A  1  17  ? 62.707  42.189  34.695  1.00 75.81  ? 17   PHE A CG    1 
ATOM   67    C  CD1   . PHE A  1  17  ? 61.583  42.777  35.259  1.00 76.11  ? 17   PHE A CD1   1 
ATOM   68    C  CD2   . PHE A  1  17  ? 62.850  40.798  34.773  1.00 76.89  ? 17   PHE A CD2   1 
ATOM   69    C  CE1   . PHE A  1  17  ? 60.606  41.994  35.905  1.00 76.46  ? 17   PHE A CE1   1 
ATOM   70    C  CE2   . PHE A  1  17  ? 61.879  40.003  35.416  1.00 76.27  ? 17   PHE A CE2   1 
ATOM   71    C  CZ    . PHE A  1  17  ? 60.753  40.609  35.984  1.00 76.18  ? 17   PHE A CZ    1 
ATOM   72    N  N     . CYS A  1  18  ? 62.986  45.908  33.831  1.00 72.28  ? 18   CYS A N     1 
ATOM   73    C  CA    . CYS A  1  18  ? 62.287  47.112  34.265  1.00 70.57  ? 18   CYS A CA    1 
ATOM   74    C  C     . CYS A  1  18  ? 61.594  47.842  33.102  1.00 70.92  ? 18   CYS A C     1 
ATOM   75    O  O     . CYS A  1  18  ? 60.680  48.645  33.306  1.00 70.82  ? 18   CYS A O     1 
ATOM   76    C  CB    . CYS A  1  18  ? 63.271  48.064  34.965  1.00 68.74  ? 18   CYS A CB    1 
ATOM   77    S  SG    . CYS A  1  18  ? 64.033  47.439  36.499  1.00 66.02  ? 18   CYS A SG    1 
ATOM   78    N  N     . ASN A  1  19  ? 62.010  47.562  31.882  1.00 70.76  ? 19   ASN A N     1 
ATOM   79    C  CA    . ASN A  1  19  ? 61.386  48.240  30.762  1.00 70.81  ? 19   ASN A CA    1 
ATOM   80    C  C     . ASN A  1  19  ? 60.150  47.464  30.320  1.00 70.79  ? 19   ASN A C     1 
ATOM   81    O  O     . ASN A  1  19  ? 59.165  48.063  29.863  1.00 70.50  ? 19   ASN A O     1 
ATOM   82    C  CB    . ASN A  1  19  ? 62.381  48.402  29.589  1.00 70.93  ? 19   ASN A CB    1 
ATOM   83    C  CG    . ASN A  1  19  ? 63.430  49.500  29.836  1.00 70.19  ? 19   ASN A CG    1 
ATOM   84    O  OD1   . ASN A  1  19  ? 64.274  49.397  30.733  1.00 71.05  ? 19   ASN A OD1   1 
ATOM   85    N  ND2   . ASN A  1  19  ? 63.377  50.548  29.031  1.00 69.37  ? 19   ASN A ND2   1 
ATOM   86    N  N     . TRP A  1  20  ? 60.195  46.138  30.462  1.00 70.55  ? 20   TRP A N     1 
ATOM   87    C  CA    . TRP A  1  20  ? 59.059  45.308  30.056  1.00 70.44  ? 20   TRP A CA    1 
ATOM   88    C  C     . TRP A  1  20  ? 57.977  45.484  31.082  1.00 70.26  ? 20   TRP A C     1 
ATOM   89    O  O     . TRP A  1  20  ? 56.812  45.789  30.762  1.00 70.10  ? 20   TRP A O     1 
ATOM   90    C  CB    . TRP A  1  20  ? 59.450  43.843  29.996  1.00 70.77  ? 20   TRP A CB    1 
ATOM   91    C  CG    . TRP A  1  20  ? 58.267  42.926  29.955  1.00 71.68  ? 20   TRP A CG    1 
ATOM   92    C  CD1   . TRP A  1  20  ? 57.426  42.695  28.899  1.00 71.43  ? 20   TRP A CD1   1 
ATOM   93    C  CD2   . TRP A  1  20  ? 57.789  42.120  31.034  1.00 72.90  ? 20   TRP A CD2   1 
ATOM   94    N  NE1   . TRP A  1  20  ? 56.456  41.788  29.258  1.00 71.48  ? 20   TRP A NE1   1 
ATOM   95    C  CE2   . TRP A  1  20  ? 56.655  41.418  30.563  1.00 73.08  ? 20   TRP A CE2   1 
ATOM   96    C  CE3   . TRP A  1  20  ? 58.212  41.920  32.363  1.00 74.16  ? 20   TRP A CE3   1 
ATOM   97    C  CZ2   . TRP A  1  20  ? 55.936  40.525  31.377  1.00 74.17  ? 20   TRP A CZ2   1 
ATOM   98    C  CZ3   . TRP A  1  20  ? 57.496  41.030  33.173  1.00 74.63  ? 20   TRP A CZ3   1 
ATOM   99    C  CH2   . TRP A  1  20  ? 56.372  40.345  32.673  1.00 74.26  ? 20   TRP A CH2   1 
ATOM   100   N  N     . VAL A  1  21  ? 58.379  45.268  32.327  1.00 69.91  ? 21   VAL A N     1 
ATOM   101   C  CA    . VAL A  1  21  ? 57.473  45.443  33.439  1.00 69.30  ? 21   VAL A CA    1 
ATOM   102   C  C     . VAL A  1  21  ? 56.735  46.760  33.198  1.00 69.59  ? 21   VAL A C     1 
ATOM   103   O  O     . VAL A  1  21  ? 55.527  46.852  33.379  1.00 70.49  ? 21   VAL A O     1 
ATOM   104   C  CB    . VAL A  1  21  ? 58.258  45.509  34.771  1.00 68.39  ? 21   VAL A CB    1 
ATOM   105   C  CG1   . VAL A  1  21  ? 57.503  46.313  35.790  1.00 68.49  ? 21   VAL A CG1   1 
ATOM   106   C  CG2   . VAL A  1  21  ? 58.480  44.111  35.295  1.00 67.59  ? 21   VAL A CG2   1 
ATOM   107   N  N     . THR A  1  22  ? 57.459  47.763  32.731  1.00 69.42  ? 22   THR A N     1 
ATOM   108   C  CA    . THR A  1  22  ? 56.853  49.057  32.510  1.00 69.48  ? 22   THR A CA    1 
ATOM   109   C  C     . THR A  1  22  ? 56.333  49.313  31.093  1.00 69.99  ? 22   THR A C     1 
ATOM   110   O  O     . THR A  1  22  ? 55.876  50.423  30.792  1.00 69.64  ? 22   THR A O     1 
ATOM   111   C  CB    . THR A  1  22  ? 57.852  50.142  32.902  1.00 69.78  ? 22   THR A CB    1 
ATOM   112   O  OG1   . THR A  1  22  ? 58.452  49.760  34.138  1.00 70.07  ? 22   THR A OG1   1 
ATOM   113   C  CG2   . THR A  1  22  ? 57.161  51.501  33.081  1.00 69.90  ? 22   THR A CG2   1 
ATOM   114   N  N     . SER A  1  23  ? 56.380  48.304  30.228  1.00 69.64  ? 23   SER A N     1 
ATOM   115   C  CA    . SER A  1  23  ? 55.912  48.502  28.871  1.00 69.75  ? 23   SER A CA    1 
ATOM   116   C  C     . SER A  1  23  ? 54.594  49.258  28.855  1.00 70.03  ? 23   SER A C     1 
ATOM   117   O  O     . SER A  1  23  ? 53.677  48.912  29.578  1.00 69.73  ? 23   SER A O     1 
ATOM   118   C  CB    . SER A  1  23  ? 55.720  47.173  28.175  1.00 71.32  ? 23   SER A CB    1 
ATOM   119   O  OG    . SER A  1  23  ? 55.170  47.373  26.878  1.00 73.32  ? 23   SER A OG    1 
ATOM   120   N  N     . THR A  1  24  ? 54.502  50.288  28.027  1.00 70.44  ? 24   THR A N     1 
ATOM   121   C  CA    . THR A  1  24  ? 53.283  51.065  27.945  1.00 70.88  ? 24   THR A CA    1 
ATOM   122   C  C     . THR A  1  24  ? 52.393  50.410  26.926  1.00 72.29  ? 24   THR A C     1 
ATOM   123   O  O     . THR A  1  24  ? 51.256  50.831  26.731  1.00 72.92  ? 24   THR A O     1 
ATOM   124   C  CB    . THR A  1  24  ? 53.528  52.475  27.456  1.00 71.62  ? 24   THR A CB    1 
ATOM   125   O  OG1   . THR A  1  24  ? 54.802  52.924  27.898  1.00 74.65  ? 24   THR A OG1   1 
ATOM   126   C  CG2   . THR A  1  24  ? 52.487  53.392  28.002  1.00 73.11  ? 24   THR A CG2   1 
ATOM   127   N  N     . ASP A  1  25  ? 52.914  49.398  26.246  1.00 72.74  ? 25   ASP A N     1 
ATOM   128   C  CA    . ASP A  1  25  ? 52.125  48.711  25.238  1.00 73.25  ? 25   ASP A CA    1 
ATOM   129   C  C     . ASP A  1  25  ? 52.158  47.215  25.369  1.00 72.83  ? 25   ASP A C     1 
ATOM   130   O  O     . ASP A  1  25  ? 52.615  46.500  24.486  1.00 72.36  ? 25   ASP A O     1 
ATOM   131   C  CB    . ASP A  1  25  ? 52.536  49.146  23.825  1.00 77.06  ? 25   ASP A CB    1 
ATOM   132   C  CG    . ASP A  1  25  ? 54.063  49.202  23.619  1.00 80.93  ? 25   ASP A CG    1 
ATOM   133   O  OD1   . ASP A  1  25  ? 54.700  48.119  23.629  1.00 82.65  ? 25   ASP A OD1   1 
ATOM   134   O  OD2   . ASP A  1  25  ? 54.620  50.333  23.430  1.00 82.17  ? 25   ASP A OD2   1 
ATOM   135   N  N     . ASN A  1  26  ? 51.664  46.757  26.509  1.00 72.94  ? 26   ASN A N     1 
ATOM   136   C  CA    . ASN A  1  26  ? 51.566  45.344  26.814  1.00 72.98  ? 26   ASN A CA    1 
ATOM   137   C  C     . ASN A  1  26  ? 50.076  45.118  26.947  1.00 72.90  ? 26   ASN A C     1 
ATOM   138   O  O     . ASN A  1  26  ? 49.436  45.808  27.744  1.00 74.78  ? 26   ASN A O     1 
ATOM   139   C  CB    . ASN A  1  26  ? 52.247  45.026  28.144  1.00 72.38  ? 26   ASN A CB    1 
ATOM   140   C  CG    . ASN A  1  26  ? 53.537  44.256  27.964  1.00 72.12  ? 26   ASN A CG    1 
ATOM   141   O  OD1   . ASN A  1  26  ? 53.717  43.550  26.960  1.00 71.61  ? 26   ASN A OD1   1 
ATOM   142   N  ND2   . ASN A  1  26  ? 54.442  44.368  28.945  1.00 70.79  ? 26   ASN A ND2   1 
ATOM   143   N  N     . ARG A  1  27  ? 49.525  44.178  26.179  1.00 71.02  ? 27   ARG A N     1 
ATOM   144   C  CA    . ARG A  1  27  ? 48.092  43.886  26.214  1.00 69.40  ? 27   ARG A CA    1 
ATOM   145   C  C     . ARG A  1  27  ? 47.439  44.258  27.544  1.00 69.17  ? 27   ARG A C     1 
ATOM   146   O  O     . ARG A  1  27  ? 46.468  45.030  27.585  1.00 68.54  ? 27   ARG A O     1 
ATOM   147   C  CB    . ARG A  1  27  ? 47.849  42.419  25.924  1.00 68.40  ? 27   ARG A CB    1 
ATOM   148   C  CG    . ARG A  1  27  ? 46.389  42.137  25.647  1.00 68.39  ? 27   ARG A CG    1 
ATOM   149   C  CD    . ARG A  1  27  ? 45.841  43.042  24.552  1.00 67.17  ? 27   ARG A CD    1 
ATOM   150   N  NE    . ARG A  1  27  ? 44.392  43.147  24.631  1.00 65.96  ? 27   ARG A NE    1 
ATOM   151   C  CZ    . ARG A  1  27  ? 43.756  43.578  25.708  1.00 66.66  ? 27   ARG A CZ    1 
ATOM   152   N  NH1   . ARG A  1  27  ? 44.452  43.935  26.779  1.00 65.27  ? 27   ARG A NH1   1 
ATOM   153   N  NH2   . ARG A  1  27  ? 42.431  43.650  25.717  1.00 67.30  ? 27   ARG A NH2   1 
ATOM   154   N  N     . LEU A  1  28  ? 47.982  43.695  28.626  1.00 68.69  ? 28   LEU A N     1 
ATOM   155   C  CA    . LEU A  1  28  ? 47.528  43.974  30.001  1.00 67.34  ? 28   LEU A CA    1 
ATOM   156   C  C     . LEU A  1  28  ? 48.723  44.623  30.705  1.00 66.65  ? 28   LEU A C     1 
ATOM   157   O  O     . LEU A  1  28  ? 49.808  44.051  30.751  1.00 66.80  ? 28   LEU A O     1 
ATOM   158   C  CB    . LEU A  1  28  ? 47.124  42.682  30.734  1.00 66.72  ? 28   LEU A CB    1 
ATOM   159   C  CG    . LEU A  1  28  ? 45.924  41.912  30.170  1.00 66.67  ? 28   LEU A CG    1 
ATOM   160   C  CD1   . LEU A  1  28  ? 45.658  40.704  31.033  1.00 67.64  ? 28   LEU A CD1   1 
ATOM   161   C  CD2   . LEU A  1  28  ? 44.686  42.795  30.124  1.00 66.70  ? 28   LEU A CD2   1 
ATOM   162   N  N     . TYR A  1  29  ? 48.530  45.806  31.258  1.00 64.92  ? 29   TYR A N     1 
ATOM   163   C  CA    . TYR A  1  29  ? 49.641  46.477  31.884  1.00 64.60  ? 29   TYR A CA    1 
ATOM   164   C  C     . TYR A  1  29  ? 50.154  45.920  33.202  1.00 64.78  ? 29   TYR A C     1 
ATOM   165   O  O     . TYR A  1  29  ? 49.684  46.298  34.265  1.00 65.94  ? 29   TYR A O     1 
ATOM   166   C  CB    . TYR A  1  29  ? 49.328  47.960  32.068  1.00 65.54  ? 29   TYR A CB    1 
ATOM   167   C  CG    . TYR A  1  29  ? 50.462  48.710  32.737  1.00 67.55  ? 29   TYR A CG    1 
ATOM   168   C  CD1   . TYR A  1  29  ? 50.213  49.718  33.658  1.00 68.68  ? 29   TYR A CD1   1 
ATOM   169   C  CD2   . TYR A  1  29  ? 51.784  48.344  32.516  1.00 68.74  ? 29   TYR A CD2   1 
ATOM   170   C  CE1   . TYR A  1  29  ? 51.260  50.324  34.354  1.00 69.61  ? 29   TYR A CE1   1 
ATOM   171   C  CE2   . TYR A  1  29  ? 52.832  48.946  33.198  1.00 68.70  ? 29   TYR A CE2   1 
ATOM   172   C  CZ    . TYR A  1  29  ? 52.569  49.924  34.114  1.00 69.03  ? 29   TYR A CZ    1 
ATOM   173   O  OH    . TYR A  1  29  ? 53.618  50.482  34.800  1.00 69.20  ? 29   TYR A OH    1 
ATOM   174   N  N     . VAL A  1  30  ? 51.125  45.028  33.152  1.00 64.31  ? 30   VAL A N     1 
ATOM   175   C  CA    . VAL A  1  30  ? 51.696  44.520  34.391  1.00 63.56  ? 30   VAL A CA    1 
ATOM   176   C  C     . VAL A  1  30  ? 52.527  45.706  34.803  1.00 64.59  ? 30   VAL A C     1 
ATOM   177   O  O     . VAL A  1  30  ? 53.192  46.280  33.957  1.00 66.42  ? 30   VAL A O     1 
ATOM   178   C  CB    . VAL A  1  30  ? 52.628  43.325  34.136  1.00 62.32  ? 30   VAL A CB    1 
ATOM   179   C  CG1   . VAL A  1  30  ? 53.369  43.522  32.832  1.00 62.43  ? 30   VAL A CG1   1 
ATOM   180   C  CG2   . VAL A  1  30  ? 53.611  43.176  35.274  1.00 61.68  ? 30   VAL A CG2   1 
ATOM   181   N  N     . GLY A  1  31  ? 52.495  46.111  36.062  1.00 64.64  ? 31   GLY A N     1 
ATOM   182   C  CA    . GLY A  1  31  ? 53.312  47.255  36.446  1.00 65.18  ? 31   GLY A CA    1 
ATOM   183   C  C     . GLY A  1  31  ? 54.212  46.869  37.601  1.00 66.31  ? 31   GLY A C     1 
ATOM   184   O  O     . GLY A  1  31  ? 54.551  45.691  37.726  1.00 67.05  ? 31   GLY A O     1 
ATOM   185   N  N     . TRP A  1  32  ? 54.618  47.826  38.430  1.00 65.98  ? 32   TRP A N     1 
ATOM   186   C  CA    . TRP A  1  32  ? 55.423  47.479  39.599  1.00 66.66  ? 32   TRP A CA    1 
ATOM   187   C  C     . TRP A  1  32  ? 54.438  46.976  40.661  1.00 66.39  ? 32   TRP A C     1 
ATOM   188   O  O     . TRP A  1  32  ? 54.719  46.038  41.419  1.00 66.42  ? 32   TRP A O     1 
ATOM   189   C  CB    . TRP A  1  32  ? 56.234  48.689  40.130  1.00 68.25  ? 32   TRP A CB    1 
ATOM   190   C  CG    . TRP A  1  32  ? 57.530  48.851  39.405  1.00 68.51  ? 32   TRP A CG    1 
ATOM   191   C  CD1   . TRP A  1  32  ? 57.924  49.928  38.686  1.00 68.94  ? 32   TRP A CD1   1 
ATOM   192   C  CD2   . TRP A  1  32  ? 58.492  47.819  39.144  1.00 68.32  ? 32   TRP A CD2   1 
ATOM   193   N  NE1   . TRP A  1  32  ? 59.052  49.632  37.973  1.00 68.91  ? 32   TRP A NE1   1 
ATOM   194   C  CE2   . TRP A  1  32  ? 59.420  48.341  38.234  1.00 68.31  ? 32   TRP A CE2   1 
ATOM   195   C  CE3   . TRP A  1  32  ? 58.650  46.498  39.587  1.00 67.91  ? 32   TRP A CE3   1 
ATOM   196   C  CZ2   . TRP A  1  32  ? 60.491  47.589  37.747  1.00 68.93  ? 32   TRP A CZ2   1 
ATOM   197   C  CZ3   . TRP A  1  32  ? 59.713  45.753  39.107  1.00 67.39  ? 32   TRP A CZ3   1 
ATOM   198   C  CH2   . TRP A  1  32  ? 60.617  46.297  38.197  1.00 68.35  ? 32   TRP A CH2   1 
ATOM   199   N  N     . PHE A  1  33  ? 53.277  47.618  40.694  1.00 66.08  ? 33   PHE A N     1 
ATOM   200   C  CA    . PHE A  1  33  ? 52.229  47.233  41.606  1.00 64.89  ? 33   PHE A CA    1 
ATOM   201   C  C     . PHE A  1  33  ? 51.728  45.883  41.125  1.00 65.66  ? 33   PHE A C     1 
ATOM   202   O  O     . PHE A  1  33  ? 51.590  44.944  41.909  1.00 65.42  ? 33   PHE A O     1 
ATOM   203   C  CB    . PHE A  1  33  ? 51.135  48.285  41.579  1.00 62.90  ? 33   PHE A CB    1 
ATOM   204   C  CG    . PHE A  1  33  ? 51.348  49.371  42.576  1.00 61.29  ? 33   PHE A CG    1 
ATOM   205   C  CD1   . PHE A  1  33  ? 51.071  50.683  42.263  1.00 59.67  ? 33   PHE A CD1   1 
ATOM   206   C  CD2   . PHE A  1  33  ? 51.804  49.069  43.852  1.00 60.37  ? 33   PHE A CD2   1 
ATOM   207   C  CE1   . PHE A  1  33  ? 51.238  51.675  43.195  1.00 58.21  ? 33   PHE A CE1   1 
ATOM   208   C  CE2   . PHE A  1  33  ? 51.974  50.059  44.793  1.00 60.27  ? 33   PHE A CE2   1 
ATOM   209   C  CZ    . PHE A  1  33  ? 51.687  51.365  44.463  1.00 60.19  ? 33   PHE A CZ    1 
ATOM   210   N  N     . GLY A  1  34  ? 51.504  45.778  39.822  1.00 66.33  ? 34   GLY A N     1 
ATOM   211   C  CA    . GLY A  1  34  ? 51.041  44.529  39.243  1.00 68.07  ? 34   GLY A CA    1 
ATOM   212   C  C     . GLY A  1  34  ? 51.903  43.303  39.519  1.00 68.45  ? 34   GLY A C     1 
ATOM   213   O  O     . GLY A  1  34  ? 51.412  42.182  39.440  1.00 69.75  ? 34   GLY A O     1 
ATOM   214   N  N     . VAL A  1  35  ? 53.178  43.504  39.827  1.00 68.16  ? 35   VAL A N     1 
ATOM   215   C  CA    . VAL A  1  35  ? 54.103  42.402  40.116  1.00 67.86  ? 35   VAL A CA    1 
ATOM   216   C  C     . VAL A  1  35  ? 53.685  41.638  41.377  1.00 66.72  ? 35   VAL A C     1 
ATOM   217   O  O     . VAL A  1  35  ? 54.157  40.537  41.661  1.00 66.12  ? 35   VAL A O     1 
ATOM   218   C  CB    . VAL A  1  35  ? 55.546  42.949  40.273  1.00 67.82  ? 35   VAL A CB    1 
ATOM   219   C  CG1   . VAL A  1  35  ? 56.327  42.140  41.306  1.00 67.09  ? 35   VAL A CG1   1 
ATOM   220   C  CG2   . VAL A  1  35  ? 56.235  42.915  38.931  1.00 66.81  ? 35   VAL A CG2   1 
ATOM   221   N  N     . ILE A  1  36  ? 52.782  42.252  42.120  1.00 65.85  ? 36   ILE A N     1 
ATOM   222   C  CA    . ILE A  1  36  ? 52.256  41.678  43.346  1.00 65.28  ? 36   ILE A CA    1 
ATOM   223   C  C     . ILE A  1  36  ? 50.788  41.317  43.088  1.00 64.63  ? 36   ILE A C     1 
ATOM   224   O  O     . ILE A  1  36  ? 50.322  40.214  43.373  1.00 64.14  ? 36   ILE A O     1 
ATOM   225   C  CB    . ILE A  1  36  ? 52.358  42.712  44.492  1.00 63.98  ? 36   ILE A CB    1 
ATOM   226   C  CG1   . ILE A  1  36  ? 53.826  43.093  44.691  1.00 63.84  ? 36   ILE A CG1   1 
ATOM   227   C  CG2   . ILE A  1  36  ? 51.754  42.169  45.749  1.00 62.19  ? 36   ILE A CG2   1 
ATOM   228   C  CD1   . ILE A  1  36  ? 54.060  43.994  45.837  1.00 62.91  ? 36   ILE A CD1   1 
ATOM   229   N  N     . MET A  1  37  ? 50.071  42.266  42.525  1.00 63.91  ? 37   MET A N     1 
ATOM   230   C  CA    . MET A  1  37  ? 48.675  42.067  42.229  1.00 63.41  ? 37   MET A CA    1 
ATOM   231   C  C     . MET A  1  37  ? 48.483  40.782  41.478  1.00 63.05  ? 37   MET A C     1 
ATOM   232   O  O     . MET A  1  37  ? 47.539  40.046  41.734  1.00 63.16  ? 37   MET A O     1 
ATOM   233   C  CB    . MET A  1  37  ? 48.151  43.227  41.388  1.00 63.30  ? 37   MET A CB    1 
ATOM   234   C  CG    . MET A  1  37  ? 46.707  43.098  41.040  1.00 63.22  ? 37   MET A CG    1 
ATOM   235   S  SD    . MET A  1  37  ? 46.261  44.223  39.759  1.00 65.05  ? 37   MET A SD    1 
ATOM   236   C  CE    . MET A  1  37  ? 46.470  43.246  38.378  1.00 63.35  ? 37   MET A CE    1 
ATOM   237   N  N     . ILE A  1  38  ? 49.391  40.512  40.554  1.00 63.52  ? 38   ILE A N     1 
ATOM   238   C  CA    . ILE A  1  38  ? 49.298  39.318  39.719  1.00 63.57  ? 38   ILE A CA    1 
ATOM   239   C  C     . ILE A  1  38  ? 49.395  37.989  40.437  1.00 63.61  ? 38   ILE A C     1 
ATOM   240   O  O     . ILE A  1  38  ? 48.592  37.094  40.186  1.00 63.85  ? 38   ILE A O     1 
ATOM   241   C  CB    . ILE A  1  38  ? 50.336  39.359  38.568  1.00 63.16  ? 38   ILE A CB    1 
ATOM   242   C  CG1   . ILE A  1  38  ? 49.895  40.400  37.540  1.00 62.31  ? 38   ILE A CG1   1 
ATOM   243   C  CG2   . ILE A  1  38  ? 50.469  37.994  37.920  1.00 61.19  ? 38   ILE A CG2   1 
ATOM   244   C  CD1   . ILE A  1  38  ? 50.821  40.525  36.387  1.00 62.95  ? 38   ILE A CD1   1 
ATOM   245   N  N     . PRO A  1  39  ? 50.376  37.831  41.338  1.00 64.96  ? 39   PRO A N     1 
ATOM   246   C  CA    . PRO A  1  39  ? 50.422  36.520  42.005  1.00 64.98  ? 39   PRO A CA    1 
ATOM   247   C  C     . PRO A  1  39  ? 49.436  36.412  43.168  1.00 64.61  ? 39   PRO A C     1 
ATOM   248   O  O     . PRO A  1  39  ? 48.868  35.348  43.444  1.00 64.86  ? 39   PRO A O     1 
ATOM   249   C  CB    . PRO A  1  39  ? 51.883  36.420  42.473  1.00 65.01  ? 39   PRO A CB    1 
ATOM   250   C  CG    . PRO A  1  39  ? 52.617  37.370  41.569  1.00 64.67  ? 39   PRO A CG    1 
ATOM   251   C  CD    . PRO A  1  39  ? 51.666  38.528  41.481  1.00 63.95  ? 39   PRO A CD    1 
ATOM   252   N  N     . THR A  1  40  ? 49.246  37.536  43.840  1.00 64.19  ? 40   THR A N     1 
ATOM   253   C  CA    . THR A  1  40  ? 48.363  37.593  44.980  1.00 63.68  ? 40   THR A CA    1 
ATOM   254   C  C     . THR A  1  40  ? 46.963  37.238  44.545  1.00 62.11  ? 40   THR A C     1 
ATOM   255   O  O     . THR A  1  40  ? 46.378  36.333  45.104  1.00 61.89  ? 40   THR A O     1 
ATOM   256   C  CB    . THR A  1  40  ? 48.408  38.977  45.612  1.00 64.95  ? 40   THR A CB    1 
ATOM   257   O  OG1   . THR A  1  40  ? 49.735  39.241  46.078  1.00 65.90  ? 40   THR A OG1   1 
ATOM   258   C  CG2   . THR A  1  40  ? 47.496  39.034  46.799  1.00 67.72  ? 40   THR A CG2   1 
ATOM   259   N  N     . LEU A  1  41  ? 46.441  37.931  43.541  1.00 60.97  ? 41   LEU A N     1 
ATOM   260   C  CA    . LEU A  1  41  ? 45.111  37.644  43.036  1.00 59.68  ? 41   LEU A CA    1 
ATOM   261   C  C     . LEU A  1  41  ? 44.962  36.232  42.465  1.00 58.69  ? 41   LEU A C     1 
ATOM   262   O  O     . LEU A  1  41  ? 43.865  35.668  42.495  1.00 59.42  ? 41   LEU A O     1 
ATOM   263   C  CB    . LEU A  1  41  ? 44.703  38.642  41.962  1.00 60.45  ? 41   LEU A CB    1 
ATOM   264   C  CG    . LEU A  1  41  ? 44.256  40.047  42.341  1.00 62.00  ? 41   LEU A CG    1 
ATOM   265   C  CD1   . LEU A  1  41  ? 43.789  40.783  41.115  1.00 61.43  ? 41   LEU A CD1   1 
ATOM   266   C  CD2   . LEU A  1  41  ? 43.126  39.962  43.306  1.00 63.50  ? 41   LEU A CD2   1 
ATOM   267   N  N     . LEU A  1  42  ? 46.042  35.665  41.936  1.00 56.12  ? 42   LEU A N     1 
ATOM   268   C  CA    . LEU A  1  42  ? 45.968  34.308  41.389  1.00 54.48  ? 42   LEU A CA    1 
ATOM   269   C  C     . LEU A  1  42  ? 45.969  33.243  42.476  1.00 53.60  ? 42   LEU A C     1 
ATOM   270   O  O     . LEU A  1  42  ? 45.518  32.122  42.256  1.00 52.96  ? 42   LEU A O     1 
ATOM   271   C  CB    . LEU A  1  42  ? 47.118  34.026  40.433  1.00 53.70  ? 42   LEU A CB    1 
ATOM   272   C  CG    . LEU A  1  42  ? 47.140  34.748  39.095  1.00 53.19  ? 42   LEU A CG    1 
ATOM   273   C  CD1   . LEU A  1  42  ? 48.013  33.921  38.192  1.00 52.48  ? 42   LEU A CD1   1 
ATOM   274   C  CD2   . LEU A  1  42  ? 45.749  34.902  38.497  1.00 51.53  ? 42   LEU A CD2   1 
ATOM   275   N  N     . ALA A  1  43  ? 46.502  33.589  43.639  1.00 52.74  ? 43   ALA A N     1 
ATOM   276   C  CA    . ALA A  1  43  ? 46.526  32.665  44.756  1.00 53.03  ? 43   ALA A CA    1 
ATOM   277   C  C     . ALA A  1  43  ? 45.122  32.682  45.349  1.00 53.00  ? 43   ALA A C     1 
ATOM   278   O  O     . ALA A  1  43  ? 44.511  31.644  45.587  1.00 52.29  ? 43   ALA A O     1 
ATOM   279   C  CB    . ALA A  1  43  ? 47.547  33.113  45.781  1.00 53.17  ? 43   ALA A CB    1 
ATOM   280   N  N     . ALA A  1  44  ? 44.621  33.883  45.577  1.00 52.97  ? 44   ALA A N     1 
ATOM   281   C  CA    . ALA A  1  44  ? 43.290  34.054  46.114  1.00 52.71  ? 44   ALA A CA    1 
ATOM   282   C  C     . ALA A  1  44  ? 42.300  33.445  45.138  1.00 53.10  ? 44   ALA A C     1 
ATOM   283   O  O     . ALA A  1  44  ? 41.691  32.423  45.426  1.00 53.59  ? 44   ALA A O     1 
ATOM   284   C  CB    . ALA A  1  44  ? 42.992  35.519  46.312  1.00 52.40  ? 44   ALA A CB    1 
ATOM   285   N  N     . THR A  1  45  ? 42.156  34.041  43.970  1.00 52.09  ? 45   THR A N     1 
ATOM   286   C  CA    . THR A  1  45  ? 41.204  33.498  43.032  1.00 52.58  ? 45   THR A CA    1 
ATOM   287   C  C     . THR A  1  45  ? 41.250  31.978  42.839  1.00 52.99  ? 45   THR A C     1 
ATOM   288   O  O     . THR A  1  45  ? 40.206  31.343  42.708  1.00 53.57  ? 45   THR A O     1 
ATOM   289   C  CB    . THR A  1  45  ? 41.334  34.151  41.685  1.00 52.38  ? 45   THR A CB    1 
ATOM   290   O  OG1   . THR A  1  45  ? 40.301  33.658  40.828  1.00 53.48  ? 45   THR A OG1   1 
ATOM   291   C  CG2   . THR A  1  45  ? 42.648  33.819  41.079  1.00 54.30  ? 45   THR A CG2   1 
ATOM   292   N  N     . ILE A  1  46  ? 42.432  31.386  42.821  1.00 52.97  ? 46   ILE A N     1 
ATOM   293   C  CA    . ILE A  1  46  ? 42.488  29.949  42.632  1.00 53.52  ? 46   ILE A CA    1 
ATOM   294   C  C     . ILE A  1  46  ? 42.055  29.187  43.866  1.00 54.59  ? 46   ILE A C     1 
ATOM   295   O  O     . ILE A  1  46  ? 41.389  28.172  43.761  1.00 57.04  ? 46   ILE A O     1 
ATOM   296   C  CB    . ILE A  1  46  ? 43.874  29.463  42.244  1.00 52.34  ? 46   ILE A CB    1 
ATOM   297   C  CG1   . ILE A  1  46  ? 44.219  29.918  40.833  1.00 52.15  ? 46   ILE A CG1   1 
ATOM   298   C  CG2   . ILE A  1  46  ? 43.902  27.965  42.293  1.00 51.23  ? 46   ILE A CG2   1 
ATOM   299   C  CD1   . ILE A  1  46  ? 45.523  29.344  40.312  1.00 53.12  ? 46   ILE A CD1   1 
ATOM   300   N  N     . CYS A  1  47  ? 42.438  29.653  45.039  1.00 55.74  ? 47   CYS A N     1 
ATOM   301   C  CA    . CYS A  1  47  ? 42.041  28.960  46.265  1.00 55.93  ? 47   CYS A CA    1 
ATOM   302   C  C     . CYS A  1  47  ? 40.520  29.114  46.488  1.00 56.17  ? 47   CYS A C     1 
ATOM   303   O  O     . CYS A  1  47  ? 39.843  28.201  46.954  1.00 57.10  ? 47   CYS A O     1 
ATOM   304   C  CB    . CYS A  1  47  ? 42.838  29.507  47.455  1.00 53.43  ? 47   CYS A CB    1 
ATOM   305   S  SG    . CYS A  1  47  ? 42.346  28.847  49.033  1.00 54.20  ? 47   CYS A SG    1 
ATOM   306   N  N     . PHE A  1  48  ? 39.984  30.263  46.132  1.00 55.58  ? 48   PHE A N     1 
ATOM   307   C  CA    . PHE A  1  48  ? 38.565  30.491  46.287  1.00 53.98  ? 48   PHE A CA    1 
ATOM   308   C  C     . PHE A  1  48  ? 37.786  29.525  45.436  1.00 52.61  ? 48   PHE A C     1 
ATOM   309   O  O     . PHE A  1  48  ? 36.893  28.852  45.917  1.00 52.75  ? 48   PHE A O     1 
ATOM   310   C  CB    . PHE A  1  48  ? 38.225  31.896  45.865  1.00 54.33  ? 48   PHE A CB    1 
ATOM   311   C  CG    . PHE A  1  48  ? 36.775  32.127  45.723  1.00 55.11  ? 48   PHE A CG    1 
ATOM   312   C  CD1   . PHE A  1  48  ? 35.967  32.220  46.835  1.00 56.53  ? 48   PHE A CD1   1 
ATOM   313   C  CD2   . PHE A  1  48  ? 36.206  32.244  44.475  1.00 55.97  ? 48   PHE A CD2   1 
ATOM   314   C  CE1   . PHE A  1  48  ? 34.608  32.431  46.701  1.00 57.14  ? 48   PHE A CE1   1 
ATOM   315   C  CE2   . PHE A  1  48  ? 34.850  32.454  44.338  1.00 57.71  ? 48   PHE A CE2   1 
ATOM   316   C  CZ    . PHE A  1  48  ? 34.052  32.548  45.452  1.00 56.49  ? 48   PHE A CZ    1 
ATOM   317   N  N     . VAL A  1  49  ? 38.127  29.463  44.163  1.00 51.27  ? 49   VAL A N     1 
ATOM   318   C  CA    . VAL A  1  49  ? 37.422  28.587  43.255  1.00 50.63  ? 49   VAL A CA    1 
ATOM   319   C  C     . VAL A  1  49  ? 37.406  27.126  43.677  1.00 50.72  ? 49   VAL A C     1 
ATOM   320   O  O     . VAL A  1  49  ? 36.451  26.405  43.394  1.00 50.06  ? 49   VAL A O     1 
ATOM   321   C  CB    . VAL A  1  49  ? 37.990  28.690  41.847  1.00 48.83  ? 49   VAL A CB    1 
ATOM   322   C  CG1   . VAL A  1  49  ? 37.361  27.660  40.959  1.00 49.21  ? 49   VAL A CG1   1 
ATOM   323   C  CG2   . VAL A  1  49  ? 37.727  30.059  41.300  1.00 49.42  ? 49   VAL A CG2   1 
ATOM   324   N  N     . ILE A  1  50  ? 38.452  26.680  44.351  1.00 50.35  ? 50   ILE A N     1 
ATOM   325   C  CA    . ILE A  1  50  ? 38.500  25.283  44.767  1.00 50.14  ? 50   ILE A CA    1 
ATOM   326   C  C     . ILE A  1  50  ? 37.740  25.136  46.044  1.00 48.55  ? 50   ILE A C     1 
ATOM   327   O  O     . ILE A  1  50  ? 36.979  24.196  46.222  1.00 47.75  ? 50   ILE A O     1 
ATOM   328   C  CB    . ILE A  1  50  ? 39.938  24.795  45.019  1.00 51.79  ? 50   ILE A CB    1 
ATOM   329   C  CG1   . ILE A  1  50  ? 40.727  24.789  43.716  1.00 51.52  ? 50   ILE A CG1   1 
ATOM   330   C  CG2   . ILE A  1  50  ? 39.923  23.394  45.586  1.00 52.41  ? 50   ILE A CG2   1 
ATOM   331   C  CD1   . ILE A  1  50  ? 42.168  24.478  43.914  1.00 53.42  ? 50   ILE A CD1   1 
ATOM   332   N  N     . ALA A  1  51  ? 37.957  26.083  46.937  1.00 47.76  ? 51   ALA A N     1 
ATOM   333   C  CA    . ALA A  1  51  ? 37.303  26.059  48.224  1.00 47.58  ? 51   ALA A CA    1 
ATOM   334   C  C     . ALA A  1  51  ? 35.805  26.002  48.042  1.00 46.88  ? 51   ALA A C     1 
ATOM   335   O  O     . ALA A  1  51  ? 35.118  25.218  48.689  1.00 45.72  ? 51   ALA A O     1 
ATOM   336   C  CB    . ALA A  1  51  ? 37.689  27.283  49.022  1.00 46.25  ? 51   ALA A CB    1 
ATOM   337   N  N     . PHE A  1  52  ? 35.312  26.833  47.141  1.00 46.40  ? 52   PHE A N     1 
ATOM   338   C  CA    . PHE A  1  52  ? 33.894  26.911  46.867  1.00 46.46  ? 52   PHE A CA    1 
ATOM   339   C  C     . PHE A  1  52  ? 33.337  25.622  46.259  1.00 47.32  ? 52   PHE A C     1 
ATOM   340   O  O     . PHE A  1  52  ? 32.204  25.250  46.545  1.00 48.57  ? 52   PHE A O     1 
ATOM   341   C  CB    . PHE A  1  52  ? 33.639  28.084  45.936  1.00 45.25  ? 52   PHE A CB    1 
ATOM   342   C  CG    . PHE A  1  52  ? 32.224  28.526  45.898  1.00 45.08  ? 52   PHE A CG    1 
ATOM   343   C  CD1   . PHE A  1  52  ? 31.801  29.559  46.687  1.00 45.22  ? 52   PHE A CD1   1 
ATOM   344   C  CD2   . PHE A  1  52  ? 31.314  27.923  45.048  1.00 45.65  ? 52   PHE A CD2   1 
ATOM   345   C  CE1   . PHE A  1  52  ? 30.503  29.993  46.631  1.00 45.35  ? 52   PHE A CE1   1 
ATOM   346   C  CE2   . PHE A  1  52  ? 30.014  28.351  44.989  1.00 44.44  ? 52   PHE A CE2   1 
ATOM   347   C  CZ    . PHE A  1  52  ? 29.611  29.391  45.782  1.00 44.93  ? 52   PHE A CZ    1 
ATOM   348   N  N     . ILE A  1  53  ? 34.109  24.938  45.427  1.00 47.13  ? 53   ILE A N     1 
ATOM   349   C  CA    . ILE A  1  53  ? 33.602  23.715  44.831  1.00 46.72  ? 53   ILE A CA    1 
ATOM   350   C  C     . ILE A  1  53  ? 33.670  22.566  45.813  1.00 47.66  ? 53   ILE A C     1 
ATOM   351   O  O     . ILE A  1  53  ? 32.660  21.930  46.065  1.00 49.59  ? 53   ILE A O     1 
ATOM   352   C  CB    . ILE A  1  53  ? 34.346  23.321  43.541  1.00 45.36  ? 53   ILE A CB    1 
ATOM   353   C  CG1   . ILE A  1  53  ? 34.376  24.480  42.556  1.00 45.45  ? 53   ILE A CG1   1 
ATOM   354   C  CG2   . ILE A  1  53  ? 33.613  22.193  42.860  1.00 44.79  ? 53   ILE A CG2   1 
ATOM   355   C  CD1   . ILE A  1  53  ? 34.858  24.074  41.190  1.00 46.24  ? 53   ILE A CD1   1 
ATOM   356   N  N     . ALA A  1  54  ? 34.840  22.291  46.371  1.00 47.63  ? 54   ALA A N     1 
ATOM   357   C  CA    . ALA A  1  54  ? 34.987  21.196  47.330  1.00 48.38  ? 54   ALA A CA    1 
ATOM   358   C  C     . ALA A  1  54  ? 35.663  21.755  48.538  1.00 47.72  ? 54   ALA A C     1 
ATOM   359   O  O     . ALA A  1  54  ? 36.562  22.553  48.390  1.00 48.92  ? 54   ALA A O     1 
ATOM   360   C  CB    . ALA A  1  54  ? 35.826  20.094  46.756  1.00 47.57  ? 54   ALA A CB    1 
ATOM   361   N  N     . ALA A  1  55  ? 35.249  21.340  49.724  1.00 46.78  ? 55   ALA A N     1 
ATOM   362   C  CA    . ALA A  1  55  ? 35.820  21.852  50.971  1.00 47.65  ? 55   ALA A CA    1 
ATOM   363   C  C     . ALA A  1  55  ? 34.933  21.489  52.151  1.00 48.43  ? 55   ALA A C     1 
ATOM   364   O  O     . ALA A  1  55  ? 33.785  21.879  52.221  1.00 48.76  ? 55   ALA A O     1 
ATOM   365   C  CB    . ALA A  1  55  ? 35.973  23.353  50.886  1.00 45.13  ? 55   ALA A CB    1 
ATOM   366   N  N     . PRO A  1  56  ? 35.477  20.754  53.110  1.00 49.06  ? 56   PRO A N     1 
ATOM   367   C  CA    . PRO A  1  56  ? 34.759  20.313  54.301  1.00 51.54  ? 56   PRO A CA    1 
ATOM   368   C  C     . PRO A  1  56  ? 34.080  21.449  55.067  1.00 52.36  ? 56   PRO A C     1 
ATOM   369   O  O     . PRO A  1  56  ? 34.413  22.619  54.883  1.00 52.78  ? 56   PRO A O     1 
ATOM   370   C  CB    . PRO A  1  56  ? 35.859  19.658  55.138  1.00 51.24  ? 56   PRO A CB    1 
ATOM   371   C  CG    . PRO A  1  56  ? 36.864  19.253  54.139  1.00 50.54  ? 56   PRO A CG    1 
ATOM   372   C  CD    . PRO A  1  56  ? 36.902  20.440  53.244  1.00 51.10  ? 56   PRO A CD    1 
ATOM   373   N  N     . PRO A  1  57  ? 33.108  21.109  55.937  1.00 52.21  ? 57   PRO A N     1 
ATOM   374   C  CA    . PRO A  1  57  ? 32.393  22.107  56.733  1.00 50.43  ? 57   PRO A CA    1 
ATOM   375   C  C     . PRO A  1  57  ? 33.399  22.753  57.637  1.00 50.60  ? 57   PRO A C     1 
ATOM   376   O  O     . PRO A  1  57  ? 34.295  22.091  58.138  1.00 50.12  ? 57   PRO A O     1 
ATOM   377   C  CB    . PRO A  1  57  ? 31.400  21.277  57.500  1.00 49.80  ? 57   PRO A CB    1 
ATOM   378   C  CG    . PRO A  1  57  ? 31.093  20.177  56.527  1.00 51.98  ? 57   PRO A CG    1 
ATOM   379   C  CD    . PRO A  1  57  ? 32.457  19.793  56.047  1.00 51.28  ? 57   PRO A CD    1 
ATOM   380   N  N     . VAL A  1  58  ? 33.253  24.050  57.852  1.00 51.58  ? 58   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  58  ? 34.182  24.801  58.689  1.00 51.98  ? 58   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  58  ? 33.584  25.307  60.007  1.00 52.18  ? 58   VAL A C     1 
ATOM   383   O  O     . VAL A  1  58  ? 32.610  26.035  60.021  1.00 52.70  ? 58   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  58  ? 34.740  25.970  57.899  1.00 50.19  ? 58   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  58  ? 35.704  26.733  58.737  1.00 50.12  ? 58   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  58  ? 35.402  25.455  56.654  1.00 50.54  ? 58   VAL A CG2   1 
ATOM   387   N  N     . ASP A  1  59  ? 34.186  24.913  61.114  1.00 53.39  ? 59   ASP A N     1 
ATOM   388   C  CA    . ASP A  1  59  ? 33.722  25.320  62.438  1.00 55.02  ? 59   ASP A CA    1 
ATOM   389   C  C     . ASP A  1  59  ? 33.842  26.841  62.585  1.00 55.13  ? 59   ASP A C     1 
ATOM   390   O  O     . ASP A  1  59  ? 34.713  27.335  63.298  1.00 56.67  ? 59   ASP A O     1 
ATOM   391   C  CB    . ASP A  1  59  ? 34.563  24.601  63.506  1.00 54.42  ? 59   ASP A CB    1 
ATOM   392   C  CG    . ASP A  1  59  ? 34.145  24.944  64.913  1.00 55.56  ? 59   ASP A CG    1 
ATOM   393   O  OD1   . ASP A  1  59  ? 32.946  24.774  65.220  1.00 54.58  ? 59   ASP A OD1   1 
ATOM   394   O  OD2   . ASP A  1  59  ? 35.018  25.367  65.712  1.00 55.38  ? 59   ASP A OD2   1 
ATOM   395   N  N     . ILE A  1  60  ? 32.961  27.576  61.911  1.00 54.61  ? 60   ILE A N     1 
ATOM   396   C  CA    . ILE A  1  60  ? 32.984  29.031  61.942  1.00 53.94  ? 60   ILE A CA    1 
ATOM   397   C  C     . ILE A  1  60  ? 32.942  29.643  63.338  1.00 55.06  ? 60   ILE A C     1 
ATOM   398   O  O     . ILE A  1  60  ? 33.918  30.256  63.785  1.00 53.32  ? 60   ILE A O     1 
ATOM   399   C  CB    . ILE A  1  60  ? 31.838  29.615  61.107  1.00 52.28  ? 60   ILE A CB    1 
ATOM   400   C  CG1   . ILE A  1  60  ? 31.878  31.138  61.174  1.00 51.25  ? 60   ILE A CG1   1 
ATOM   401   C  CG2   . ILE A  1  60  ? 30.492  29.076  61.600  1.00 51.67  ? 60   ILE A CG2   1 
ATOM   402   C  CD1   . ILE A  1  60  ? 30.930  31.799  60.216  1.00 50.39  ? 60   ILE A CD1   1 
ATOM   403   N  N     . ASP A  1  61  ? 31.817  29.488  64.023  1.00 56.55  ? 61   ASP A N     1 
ATOM   404   C  CA    . ASP A  1  61  ? 31.697  30.053  65.353  1.00 57.98  ? 61   ASP A CA    1 
ATOM   405   C  C     . ASP A  1  61  ? 32.711  29.296  66.161  1.00 59.72  ? 61   ASP A C     1 
ATOM   406   O  O     . ASP A  1  61  ? 33.430  28.494  65.598  1.00 60.71  ? 61   ASP A O     1 
ATOM   407   C  CB    . ASP A  1  61  ? 30.279  29.875  65.883  1.00 59.03  ? 61   ASP A CB    1 
ATOM   408   C  CG    . ASP A  1  61  ? 29.243  30.577  65.015  1.00 61.78  ? 61   ASP A CG    1 
ATOM   409   O  OD1   . ASP A  1  61  ? 29.529  31.695  64.531  1.00 62.12  ? 61   ASP A OD1   1 
ATOM   410   O  OD2   . ASP A  1  61  ? 28.137  30.020  64.809  1.00 62.77  ? 61   ASP A OD2   1 
ATOM   411   N  N     . GLY A  1  62  ? 32.796  29.522  67.458  1.00 61.30  ? 62   GLY A N     1 
ATOM   412   C  CA    . GLY A  1  62  ? 33.810  28.821  68.225  1.00 64.72  ? 62   GLY A CA    1 
ATOM   413   C  C     . GLY A  1  62  ? 33.553  27.367  68.595  1.00 64.80  ? 62   GLY A C     1 
ATOM   414   O  O     . GLY A  1  62  ? 34.482  26.547  68.724  1.00 65.28  ? 62   GLY A O     1 
ATOM   415   N  N     . ILE A  1  63  ? 32.277  27.068  68.786  1.00 64.57  ? 63   ILE A N     1 
ATOM   416   C  CA    . ILE A  1  63  ? 31.819  25.751  69.171  1.00 65.54  ? 63   ILE A CA    1 
ATOM   417   C  C     . ILE A  1  63  ? 32.350  24.658  68.243  1.00 67.24  ? 63   ILE A C     1 
ATOM   418   O  O     . ILE A  1  63  ? 33.456  24.761  67.714  1.00 69.43  ? 63   ILE A O     1 
ATOM   419   C  CB    . ILE A  1  63  ? 30.307  25.773  69.177  1.00 64.39  ? 63   ILE A CB    1 
ATOM   420   C  CG1   . ILE A  1  63  ? 29.805  26.110  67.778  1.00 64.09  ? 63   ILE A CG1   1 
ATOM   421   C  CG2   . ILE A  1  63  ? 29.837  26.865  70.114  1.00 63.07  ? 63   ILE A CG2   1 
ATOM   422   C  CD1   . ILE A  1  63  ? 28.312  26.376  67.669  1.00 64.56  ? 63   ILE A CD1   1 
ATOM   423   N  N     . ARG A  1  64  ? 31.586  23.595  68.066  1.00 67.19  ? 64   ARG A N     1 
ATOM   424   C  CA    . ARG A  1  64  ? 32.027  22.544  67.177  1.00 67.12  ? 64   ARG A CA    1 
ATOM   425   C  C     . ARG A  1  64  ? 30.819  22.180  66.359  1.00 68.83  ? 64   ARG A C     1 
ATOM   426   O  O     . ARG A  1  64  ? 30.429  21.018  66.283  1.00 70.59  ? 64   ARG A O     1 
ATOM   427   C  CB    . ARG A  1  64  ? 32.477  21.336  67.957  1.00 64.44  ? 64   ARG A CB    1 
ATOM   428   C  CG    . ARG A  1  64  ? 33.504  21.626  68.983  1.00 63.03  ? 64   ARG A CG    1 
ATOM   429   C  CD    . ARG A  1  64  ? 34.833  21.980  68.396  1.00 61.41  ? 64   ARG A CD    1 
ATOM   430   N  NE    . ARG A  1  64  ? 35.880  21.506  69.300  1.00 61.01  ? 64   ARG A NE    1 
ATOM   431   C  CZ    . ARG A  1  64  ? 36.901  22.244  69.716  1.00 63.37  ? 64   ARG A CZ    1 
ATOM   432   N  NH1   . ARG A  1  64  ? 37.019  23.511  69.303  1.00 64.72  ? 64   ARG A NH1   1 
ATOM   433   N  NH2   . ARG A  1  64  ? 37.794  21.724  70.554  1.00 62.96  ? 64   ARG A NH2   1 
ATOM   434   N  N     . GLU A  1  65  ? 30.213  23.184  65.752  1.00 69.63  ? 65   GLU A N     1 
ATOM   435   C  CA    . GLU A  1  65  ? 29.037  22.966  64.942  1.00 70.27  ? 65   GLU A CA    1 
ATOM   436   C  C     . GLU A  1  65  ? 29.426  23.432  63.560  1.00 69.36  ? 65   GLU A C     1 
ATOM   437   O  O     . GLU A  1  65  ? 29.023  24.510  63.129  1.00 69.36  ? 65   GLU A O     1 
ATOM   438   C  CB    . GLU A  1  65  ? 27.886  23.807  65.478  1.00 74.25  ? 65   GLU A CB    1 
ATOM   439   C  CG    . GLU A  1  65  ? 26.560  23.589  64.773  1.00 80.98  ? 65   GLU A CG    1 
ATOM   440   C  CD    . GLU A  1  65  ? 25.426  24.469  65.311  1.00 83.98  ? 65   GLU A CD    1 
ATOM   441   O  OE1   . GLU A  1  65  ? 24.265  24.239  64.859  1.00 86.07  ? 65   GLU A OE1   1 
ATOM   442   O  OE2   . GLU A  1  65  ? 25.688  25.374  66.163  1.00 84.36  ? 65   GLU A OE2   1 
ATOM   443   N  N     . PRO A  1  66  ? 30.231  22.626  62.845  1.00 67.44  ? 66   PRO A N     1 
ATOM   444   C  CA    . PRO A  1  66  ? 30.742  22.869  61.489  1.00 64.57  ? 66   PRO A CA    1 
ATOM   445   C  C     . PRO A  1  66  ? 29.691  23.211  60.430  1.00 62.56  ? 66   PRO A C     1 
ATOM   446   O  O     . PRO A  1  66  ? 28.681  22.513  60.296  1.00 62.30  ? 66   PRO A O     1 
ATOM   447   C  CB    . PRO A  1  66  ? 31.467  21.566  61.163  1.00 65.90  ? 66   PRO A CB    1 
ATOM   448   C  CG    . PRO A  1  66  ? 31.948  21.112  62.475  1.00 66.16  ? 66   PRO A CG    1 
ATOM   449   C  CD    . PRO A  1  66  ? 30.743  21.343  63.360  1.00 66.03  ? 66   PRO A CD    1 
ATOM   450   N  N     . VAL A  1  67  ? 29.945  24.276  59.676  1.00 58.81  ? 67   VAL A N     1 
ATOM   451   C  CA    . VAL A  1  67  ? 29.043  24.693  58.626  1.00 56.60  ? 67   VAL A CA    1 
ATOM   452   C  C     . VAL A  1  67  ? 29.672  24.355  57.302  1.00 56.88  ? 67   VAL A C     1 
ATOM   453   O  O     . VAL A  1  67  ? 30.847  24.617  57.108  1.00 58.17  ? 67   VAL A O     1 
ATOM   454   C  CB    . VAL A  1  67  ? 28.840  26.173  58.629  1.00 55.17  ? 67   VAL A CB    1 
ATOM   455   C  CG1   . VAL A  1  67  ? 27.919  26.545  57.505  1.00 55.75  ? 67   VAL A CG1   1 
ATOM   456   C  CG2   . VAL A  1  67  ? 28.285  26.620  59.957  1.00 55.86  ? 67   VAL A CG2   1 
ATOM   457   N  N     . SER A  1  68  ? 28.903  23.784  56.382  1.00 56.09  ? 68   SER A N     1 
ATOM   458   C  CA    . SER A  1  68  ? 29.448  23.431  55.077  1.00 54.55  ? 68   SER A CA    1 
ATOM   459   C  C     . SER A  1  68  ? 29.001  24.469  54.092  1.00 53.65  ? 68   SER A C     1 
ATOM   460   O  O     . SER A  1  68  ? 27.822  24.805  54.033  1.00 53.37  ? 68   SER A O     1 
ATOM   461   C  CB    . SER A  1  68  ? 28.931  22.086  54.614  1.00 55.23  ? 68   SER A CB    1 
ATOM   462   O  OG    . SER A  1  68  ? 27.584  22.235  54.224  1.00 55.06  ? 68   SER A OG    1 
ATOM   463   N  N     . GLY A  1  69  ? 29.941  24.960  53.304  1.00 52.23  ? 69   GLY A N     1 
ATOM   464   C  CA    . GLY A  1  69  ? 29.611  25.975  52.333  1.00 50.20  ? 69   GLY A CA    1 
ATOM   465   C  C     . GLY A  1  69  ? 29.838  25.552  50.906  1.00 50.39  ? 69   GLY A C     1 
ATOM   466   O  O     . GLY A  1  69  ? 29.152  26.037  50.025  1.00 50.68  ? 69   GLY A O     1 
ATOM   467   N  N     . SER A  1  70  ? 30.775  24.641  50.674  1.00 49.78  ? 70   SER A N     1 
ATOM   468   C  CA    . SER A  1  70  ? 31.089  24.183  49.325  1.00 49.71  ? 70   SER A CA    1 
ATOM   469   C  C     . SER A  1  70  ? 29.947  23.474  48.606  1.00 49.76  ? 70   SER A C     1 
ATOM   470   O  O     . SER A  1  70  ? 28.969  23.054  49.224  1.00 49.14  ? 70   SER A O     1 
ATOM   471   C  CB    . SER A  1  70  ? 32.287  23.252  49.342  1.00 50.53  ? 70   SER A CB    1 
ATOM   472   O  OG    . SER A  1  70  ? 31.877  21.957  49.696  1.00 50.59  ? 70   SER A OG    1 
ATOM   473   N  N     . LEU A  1  71  ? 30.095  23.348  47.291  1.00 48.50  ? 71   LEU A N     1 
ATOM   474   C  CA    . LEU A  1  71  ? 29.097  22.701  46.471  1.00 48.17  ? 71   LEU A CA    1 
ATOM   475   C  C     . LEU A  1  71  ? 29.046  21.199  46.720  1.00 50.15  ? 71   LEU A C     1 
ATOM   476   O  O     . LEU A  1  71  ? 27.982  20.666  47.005  1.00 52.05  ? 71   LEU A O     1 
ATOM   477   C  CB    . LEU A  1  71  ? 29.378  22.951  45.000  1.00 45.49  ? 71   LEU A CB    1 
ATOM   478   C  CG    . LEU A  1  71  ? 29.527  24.359  44.462  1.00 45.10  ? 71   LEU A CG    1 
ATOM   479   C  CD1   . LEU A  1  71  ? 29.549  24.244  42.970  1.00 43.17  ? 71   LEU A CD1   1 
ATOM   480   C  CD2   . LEU A  1  71  ? 28.391  25.254  44.870  1.00 45.12  ? 71   LEU A CD2   1 
ATOM   481   N  N     . LEU A  1  72  ? 30.185  20.518  46.623  1.00 49.44  ? 72   LEU A N     1 
ATOM   482   C  CA    . LEU A  1  72  ? 30.208  19.079  46.805  1.00 48.35  ? 72   LEU A CA    1 
ATOM   483   C  C     . LEU A  1  72  ? 29.762  18.642  48.180  1.00 49.75  ? 72   LEU A C     1 
ATOM   484   O  O     . LEU A  1  72  ? 29.747  17.447  48.476  1.00 52.94  ? 72   LEU A O     1 
ATOM   485   C  CB    . LEU A  1  72  ? 31.598  18.500  46.533  1.00 45.69  ? 72   LEU A CB    1 
ATOM   486   C  CG    . LEU A  1  72  ? 32.193  18.607  45.138  1.00 46.96  ? 72   LEU A CG    1 
ATOM   487   C  CD1   . LEU A  1  72  ? 33.492  17.838  45.064  1.00 44.27  ? 72   LEU A CD1   1 
ATOM   488   C  CD2   . LEU A  1  72  ? 31.208  18.087  44.141  1.00 44.59  ? 72   LEU A CD2   1 
ATOM   489   N  N     . TYR A  1  73  ? 29.386  19.581  49.032  1.00 49.54  ? 73   TYR A N     1 
ATOM   490   C  CA    . TYR A  1  73  ? 28.960  19.207  50.379  1.00 49.15  ? 73   TYR A CA    1 
ATOM   491   C  C     . TYR A  1  73  ? 27.546  19.616  50.687  1.00 48.46  ? 73   TYR A C     1 
ATOM   492   O  O     . TYR A  1  73  ? 27.199  19.806  51.835  1.00 45.53  ? 73   TYR A O     1 
ATOM   493   C  CB    . TYR A  1  73  ? 29.932  19.788  51.411  1.00 50.72  ? 73   TYR A CB    1 
ATOM   494   C  CG    . TYR A  1  73  ? 31.158  18.928  51.631  1.00 50.36  ? 73   TYR A CG    1 
ATOM   495   C  CD1   . TYR A  1  73  ? 31.223  18.030  52.689  1.00 52.60  ? 73   TYR A CD1   1 
ATOM   496   C  CD2   . TYR A  1  73  ? 32.212  18.962  50.749  1.00 49.72  ? 73   TYR A CD2   1 
ATOM   497   C  CE1   . TYR A  1  73  ? 32.316  17.183  52.854  1.00 52.33  ? 73   TYR A CE1   1 
ATOM   498   C  CE2   . TYR A  1  73  ? 33.299  18.123  50.897  1.00 51.57  ? 73   TYR A CE2   1 
ATOM   499   C  CZ    . TYR A  1  73  ? 33.351  17.240  51.942  1.00 52.16  ? 73   TYR A CZ    1 
ATOM   500   O  OH    . TYR A  1  73  ? 34.447  16.424  52.054  1.00 51.74  ? 73   TYR A OH    1 
ATOM   501   N  N     . GLY A  1  74  ? 26.740  19.762  49.644  1.00 49.10  ? 74   GLY A N     1 
ATOM   502   C  CA    . GLY A  1  74  ? 25.347  20.107  49.813  1.00 50.73  ? 74   GLY A CA    1 
ATOM   503   C  C     . GLY A  1  74  ? 24.856  21.496  49.458  1.00 52.40  ? 74   GLY A C     1 
ATOM   504   O  O     . GLY A  1  74  ? 23.744  21.849  49.824  1.00 55.60  ? 74   GLY A O     1 
ATOM   505   N  N     . ASN A  1  75  ? 25.641  22.294  48.755  1.00 51.67  ? 75   ASN A N     1 
ATOM   506   C  CA    . ASN A  1  75  ? 25.192  23.640  48.409  1.00 51.32  ? 75   ASN A CA    1 
ATOM   507   C  C     . ASN A  1  75  ? 24.944  23.890  46.944  1.00 50.91  ? 75   ASN A C     1 
ATOM   508   O  O     . ASN A  1  75  ? 25.273  23.071  46.098  1.00 51.95  ? 75   ASN A O     1 
ATOM   509   C  CB    . ASN A  1  75  ? 26.207  24.685  48.827  1.00 51.84  ? 75   ASN A CB    1 
ATOM   510   C  CG    . ASN A  1  75  ? 26.314  24.828  50.289  1.00 53.69  ? 75   ASN A CG    1 
ATOM   511   O  OD1   . ASN A  1  75  ? 26.940  24.005  50.939  1.00 54.84  ? 75   ASN A OD1   1 
ATOM   512   N  ND2   . ASN A  1  75  ? 25.704  25.883  50.838  1.00 51.80  ? 75   ASN A ND2   1 
ATOM   513   N  N     . ASN A  1  76  ? 24.376  25.053  46.660  1.00 49.04  ? 76   ASN A N     1 
ATOM   514   C  CA    . ASN A  1  76  ? 24.144  25.483  45.301  1.00 49.77  ? 76   ASN A CA    1 
ATOM   515   C  C     . ASN A  1  76  ? 24.786  26.856  45.271  1.00 48.90  ? 76   ASN A C     1 
ATOM   516   O  O     . ASN A  1  76  ? 25.189  27.347  46.305  1.00 48.34  ? 76   ASN A O     1 
ATOM   517   C  CB    . ASN A  1  76  ? 22.648  25.526  44.952  1.00 51.99  ? 76   ASN A CB    1 
ATOM   518   C  CG    . ASN A  1  76  ? 21.853  26.395  45.872  1.00 55.75  ? 76   ASN A CG    1 
ATOM   519   O  OD1   . ASN A  1  76  ? 20.628  26.481  45.753  1.00 55.79  ? 76   ASN A OD1   1 
ATOM   520   N  ND2   . ASN A  1  76  ? 22.533  27.046  46.802  1.00 55.55  ? 76   ASN A ND2   1 
ATOM   521   N  N     . ILE A  1  77  ? 24.909  27.465  44.105  1.00 47.93  ? 77   ILE A N     1 
ATOM   522   C  CA    . ILE A  1  77  ? 25.552  28.750  44.022  1.00 46.08  ? 77   ILE A CA    1 
ATOM   523   C  C     . ILE A  1  77  ? 25.016  29.789  44.999  1.00 48.12  ? 77   ILE A C     1 
ATOM   524   O  O     . ILE A  1  77  ? 25.786  30.591  45.526  1.00 50.87  ? 77   ILE A O     1 
ATOM   525   C  CB    . ILE A  1  77  ? 25.455  29.302  42.639  1.00 43.07  ? 77   ILE A CB    1 
ATOM   526   C  CG1   . ILE A  1  77  ? 25.798  28.225  41.656  1.00 40.80  ? 77   ILE A CG1   1 
ATOM   527   C  CG2   . ILE A  1  77  ? 26.438  30.390  42.452  1.00 40.87  ? 77   ILE A CG2   1 
ATOM   528   C  CD1   . ILE A  1  77  ? 25.394  28.610  40.297  1.00 39.69  ? 77   ILE A CD1   1 
ATOM   529   N  N     . ILE A  1  78  ? 23.718  29.781  45.272  1.00 48.02  ? 78   ILE A N     1 
ATOM   530   C  CA    . ILE A  1  78  ? 23.146  30.783  46.182  1.00 47.36  ? 78   ILE A CA    1 
ATOM   531   C  C     . ILE A  1  78  ? 23.420  30.562  47.666  1.00 46.37  ? 78   ILE A C     1 
ATOM   532   O  O     . ILE A  1  78  ? 23.586  31.516  48.415  1.00 45.84  ? 78   ILE A O     1 
ATOM   533   C  CB    . ILE A  1  78  ? 21.619  30.942  45.957  1.00 48.33  ? 78   ILE A CB    1 
ATOM   534   C  CG1   . ILE A  1  78  ? 21.355  31.756  44.697  1.00 49.12  ? 78   ILE A CG1   1 
ATOM   535   C  CG2   . ILE A  1  78  ? 20.991  31.708  47.084  1.00 49.54  ? 78   ILE A CG2   1 
ATOM   536   C  CD1   . ILE A  1  78  ? 21.744  31.055  43.415  1.00 52.82  ? 78   ILE A CD1   1 
ATOM   537   N  N     . THR A  1  79  ? 23.477  29.312  48.092  1.00 46.09  ? 79   THR A N     1 
ATOM   538   C  CA    . THR A  1  79  ? 23.733  29.015  49.494  1.00 46.67  ? 79   THR A CA    1 
ATOM   539   C  C     . THR A  1  79  ? 25.218  28.841  49.819  1.00 47.06  ? 79   THR A C     1 
ATOM   540   O  O     . THR A  1  79  ? 25.677  29.196  50.905  1.00 47.43  ? 79   THR A O     1 
ATOM   541   C  CB    . THR A  1  79  ? 22.996  27.747  49.922  1.00 47.36  ? 79   THR A CB    1 
ATOM   542   O  OG1   . THR A  1  79  ? 23.699  26.593  49.462  1.00 44.90  ? 79   THR A OG1   1 
ATOM   543   C  CG2   . THR A  1  79  ? 21.613  27.737  49.337  1.00 47.52  ? 79   THR A CG2   1 
ATOM   544   N  N     . GLY A  1  80  ? 25.962  28.300  48.867  1.00 46.56  ? 80   GLY A N     1 
ATOM   545   C  CA    . GLY A  1  80  ? 27.372  28.073  49.071  1.00 44.64  ? 80   GLY A CA    1 
ATOM   546   C  C     . GLY A  1  80  ? 28.215  29.288  49.391  1.00 44.25  ? 80   GLY A C     1 
ATOM   547   O  O     . GLY A  1  80  ? 27.863  30.425  49.081  1.00 45.04  ? 80   GLY A O     1 
ATOM   548   N  N     . ALA A  1  81  ? 29.354  29.017  50.011  1.00 42.03  ? 81   ALA A N     1 
ATOM   549   C  CA    . ALA A  1  81  ? 30.286  30.053  50.378  1.00 41.52  ? 81   ALA A CA    1 
ATOM   550   C  C     . ALA A  1  81  ? 31.555  29.490  50.967  1.00 41.07  ? 81   ALA A C     1 
ATOM   551   O  O     . ALA A  1  81  ? 31.657  28.299  51.249  1.00 40.29  ? 81   ALA A O     1 
ATOM   552   C  CB    . ALA A  1  81  ? 29.646  30.956  51.360  1.00 39.27  ? 81   ALA A CB    1 
ATOM   553   N  N     . VAL A  1  82  ? 32.536  30.359  51.119  1.00 40.17  ? 82   VAL A N     1 
ATOM   554   C  CA    . VAL A  1  82  ? 33.777  29.974  51.747  1.00 40.75  ? 82   VAL A CA    1 
ATOM   555   C  C     . VAL A  1  82  ? 33.538  30.500  53.149  1.00 42.32  ? 82   VAL A C     1 
ATOM   556   O  O     . VAL A  1  82  ? 33.310  31.682  53.313  1.00 44.22  ? 82   VAL A O     1 
ATOM   557   C  CB    . VAL A  1  82  ? 34.955  30.688  51.133  1.00 38.79  ? 82   VAL A CB    1 
ATOM   558   C  CG1   . VAL A  1  82  ? 36.227  30.357  51.891  1.00 38.76  ? 82   VAL A CG1   1 
ATOM   559   C  CG2   . VAL A  1  82  ? 35.079  30.281  49.724  1.00 37.24  ? 82   VAL A CG2   1 
ATOM   560   N  N     . VAL A  1  83  ? 33.577  29.635  54.153  1.00 41.95  ? 83   VAL A N     1 
ATOM   561   C  CA    . VAL A  1  83  ? 33.312  30.043  55.519  1.00 42.24  ? 83   VAL A CA    1 
ATOM   562   C  C     . VAL A  1  83  ? 34.507  30.665  56.242  1.00 43.63  ? 83   VAL A C     1 
ATOM   563   O  O     . VAL A  1  83  ? 35.635  30.245  56.044  1.00 45.32  ? 83   VAL A O     1 
ATOM   564   C  CB    . VAL A  1  83  ? 32.792  28.848  56.302  1.00 41.34  ? 83   VAL A CB    1 
ATOM   565   C  CG1   . VAL A  1  83  ? 32.493  29.222  57.711  1.00 40.89  ? 83   VAL A CG1   1 
ATOM   566   C  CG2   . VAL A  1  83  ? 31.564  28.331  55.638  1.00 40.44  ? 83   VAL A CG2   1 
ATOM   567   N  N     . PRO A  1  84  ? 34.265  31.696  57.074  1.00 44.32  ? 84   PRO A N     1 
ATOM   568   C  CA    . PRO A  1  84  ? 35.279  32.409  57.856  1.00 45.34  ? 84   PRO A CA    1 
ATOM   569   C  C     . PRO A  1  84  ? 36.058  31.502  58.826  1.00 46.58  ? 84   PRO A C     1 
ATOM   570   O  O     . PRO A  1  84  ? 35.498  30.579  59.399  1.00 42.80  ? 84   PRO A O     1 
ATOM   571   C  CB    . PRO A  1  84  ? 34.452  33.453  58.592  1.00 44.89  ? 84   PRO A CB    1 
ATOM   572   C  CG    . PRO A  1  84  ? 33.415  33.780  57.619  1.00 44.61  ? 84   PRO A CG    1 
ATOM   573   C  CD    . PRO A  1  84  ? 32.993  32.437  57.116  1.00 44.93  ? 84   PRO A CD    1 
ATOM   574   N  N     . SER A  1  85  ? 37.348  31.780  58.999  1.00 47.91  ? 85   SER A N     1 
ATOM   575   C  CA    . SER A  1  85  ? 38.201  31.006  59.897  1.00 49.10  ? 85   SER A CA    1 
ATOM   576   C  C     . SER A  1  85  ? 37.520  30.994  61.245  1.00 49.69  ? 85   SER A C     1 
ATOM   577   O  O     . SER A  1  85  ? 36.776  31.917  61.554  1.00 50.65  ? 85   SER A O     1 
ATOM   578   C  CB    . SER A  1  85  ? 39.584  31.650  60.017  1.00 50.47  ? 85   SER A CB    1 
ATOM   579   O  OG    . SER A  1  85  ? 39.540  32.890  60.708  1.00 53.48  ? 85   SER A OG    1 
ATOM   580   N  N     . SER A  1  86  ? 37.793  29.968  62.054  1.00 50.13  ? 86   SER A N     1 
ATOM   581   C  CA    . SER A  1  86  ? 37.156  29.785  63.367  1.00 49.88  ? 86   SER A CA    1 
ATOM   582   C  C     . SER A  1  86  ? 37.306  30.906  64.373  1.00 51.23  ? 86   SER A C     1 
ATOM   583   O  O     . SER A  1  86  ? 38.163  31.774  64.244  1.00 51.90  ? 86   SER A O     1 
ATOM   584   C  CB    . SER A  1  86  ? 37.621  28.480  64.005  1.00 49.47  ? 86   SER A CB    1 
ATOM   585   O  OG    . SER A  1  86  ? 36.972  28.250  65.238  1.00 50.45  ? 86   SER A OG    1 
ATOM   586   N  N     . ASN A  1  87  ? 36.445  30.868  65.377  1.00 51.00  ? 87   ASN A N     1 
ATOM   587   C  CA    . ASN A  1  87  ? 36.425  31.859  66.428  1.00 50.96  ? 87   ASN A CA    1 
ATOM   588   C  C     . ASN A  1  87  ? 37.470  31.477  67.445  1.00 51.28  ? 87   ASN A C     1 
ATOM   589   O  O     . ASN A  1  87  ? 37.938  32.300  68.202  1.00 51.05  ? 87   ASN A O     1 
ATOM   590   C  CB    . ASN A  1  87  ? 35.050  31.864  67.071  1.00 52.24  ? 87   ASN A CB    1 
ATOM   591   C  CG    . ASN A  1  87  ? 34.805  33.075  67.930  1.00 53.43  ? 87   ASN A CG    1 
ATOM   592   O  OD1   . ASN A  1  87  ? 34.622  34.187  67.420  1.00 53.83  ? 87   ASN A OD1   1 
ATOM   593   N  ND2   . ASN A  1  87  ? 34.776  32.870  69.246  1.00 53.54  ? 87   ASN A ND2   1 
ATOM   594   N  N     . ALA A  1  88  ? 37.830  30.211  67.467  1.00 52.52  ? 88   ALA A N     1 
ATOM   595   C  CA    . ALA A  1  88  ? 38.829  29.757  68.414  1.00 54.28  ? 88   ALA A CA    1 
ATOM   596   C  C     . ALA A  1  88  ? 40.162  30.336  67.986  1.00 55.31  ? 88   ALA A C     1 
ATOM   597   O  O     . ALA A  1  88  ? 41.103  30.461  68.786  1.00 54.94  ? 88   ALA A O     1 
ATOM   598   C  CB    . ALA A  1  88  ? 38.892  28.280  68.409  1.00 53.62  ? 88   ALA A CB    1 
ATOM   599   N  N     . ILE A  1  89  ? 40.228  30.673  66.703  1.00 54.96  ? 89   ILE A N     1 
ATOM   600   C  CA    . ILE A  1  89  ? 41.414  31.242  66.102  1.00 55.52  ? 89   ILE A CA    1 
ATOM   601   C  C     . ILE A  1  89  ? 41.431  32.734  66.360  1.00 57.32  ? 89   ILE A C     1 
ATOM   602   O  O     . ILE A  1  89  ? 42.472  33.304  66.662  1.00 57.76  ? 89   ILE A O     1 
ATOM   603   C  CB    . ILE A  1  89  ? 41.407  30.973  64.619  1.00 54.20  ? 89   ILE A CB    1 
ATOM   604   C  CG1   . ILE A  1  89  ? 41.614  29.494  64.383  1.00 52.44  ? 89   ILE A CG1   1 
ATOM   605   C  CG2   . ILE A  1  89  ? 42.489  31.755  63.938  1.00 55.63  ? 89   ILE A CG2   1 
ATOM   606   C  CD1   . ILE A  1  89  ? 41.439  29.111  62.963  1.00 51.78  ? 89   ILE A CD1   1 
ATOM   607   N  N     . GLY A  1  90  ? 40.267  33.363  66.230  1.00 58.99  ? 90   GLY A N     1 
ATOM   608   C  CA    . GLY A  1  90  ? 40.116  34.798  66.477  1.00 58.02  ? 90   GLY A CA    1 
ATOM   609   C  C     . GLY A  1  90  ? 40.756  35.750  65.490  1.00 57.58  ? 90   GLY A C     1 
ATOM   610   O  O     . GLY A  1  90  ? 40.324  35.867  64.345  1.00 56.70  ? 90   GLY A O     1 
ATOM   611   N  N     . LEU A  1  91  ? 41.771  36.456  65.973  1.00 57.15  ? 91   LEU A N     1 
ATOM   612   C  CA    . LEU A  1  91  ? 42.521  37.379  65.156  1.00 56.92  ? 91   LEU A CA    1 
ATOM   613   C  C     . LEU A  1  91  ? 43.892  36.782  64.871  1.00 55.68  ? 91   LEU A C     1 
ATOM   614   O  O     . LEU A  1  91  ? 44.665  37.312  64.088  1.00 55.04  ? 91   LEU A O     1 
ATOM   615   C  CB    . LEU A  1  91  ? 42.681  38.714  65.861  1.00 58.29  ? 91   LEU A CB    1 
ATOM   616   C  CG    . LEU A  1  91  ? 41.541  39.718  65.753  1.00 60.34  ? 91   LEU A CG    1 
ATOM   617   C  CD1   . LEU A  1  91  ? 42.031  41.037  66.350  1.00 63.22  ? 91   LEU A CD1   1 
ATOM   618   C  CD2   . LEU A  1  91  ? 41.134  39.931  64.313  1.00 60.49  ? 91   LEU A CD2   1 
ATOM   619   N  N     . HIS A  1  92  ? 44.187  35.670  65.514  1.00 54.66  ? 92   HIS A N     1 
ATOM   620   C  CA    . HIS A  1  92  ? 45.463  35.009  65.309  1.00 54.45  ? 92   HIS A CA    1 
ATOM   621   C  C     . HIS A  1  92  ? 45.705  34.687  63.823  1.00 55.11  ? 92   HIS A C     1 
ATOM   622   O  O     . HIS A  1  92  ? 44.774  34.395  63.069  1.00 55.79  ? 92   HIS A O     1 
ATOM   623   C  CB    . HIS A  1  92  ? 45.529  33.719  66.132  1.00 53.52  ? 92   HIS A CB    1 
ATOM   624   C  CG    . HIS A  1  92  ? 45.722  33.935  67.605  1.00 53.96  ? 92   HIS A CG    1 
ATOM   625   N  ND1   . HIS A  1  92  ? 46.834  33.482  68.279  1.00 53.87  ? 92   HIS A ND1   1 
ATOM   626   C  CD2   . HIS A  1  92  ? 44.922  34.496  68.544  1.00 54.41  ? 92   HIS A CD2   1 
ATOM   627   C  CE1   . HIS A  1  92  ? 46.710  33.749  69.566  1.00 53.77  ? 92   HIS A CE1   1 
ATOM   628   N  NE2   . HIS A  1  92  ? 45.559  34.363  69.754  1.00 53.41  ? 92   HIS A NE2   1 
ATOM   629   N  N     . PHE A  1  93  ? 46.968  34.728  63.420  1.00 54.92  ? 93   PHE A N     1 
ATOM   630   C  CA    . PHE A  1  93  ? 47.381  34.448  62.041  1.00 53.20  ? 93   PHE A CA    1 
ATOM   631   C  C     . PHE A  1  93  ? 47.500  32.930  61.794  1.00 51.73  ? 93   PHE A C     1 
ATOM   632   O  O     . PHE A  1  93  ? 48.446  32.292  62.243  1.00 52.15  ? 93   PHE A O     1 
ATOM   633   C  CB    . PHE A  1  93  ? 48.717  35.152  61.802  1.00 54.04  ? 93   PHE A CB    1 
ATOM   634   C  CG    . PHE A  1  93  ? 49.273  34.963  60.430  1.00 53.89  ? 93   PHE A CG    1 
ATOM   635   C  CD1   . PHE A  1  93  ? 50.378  34.157  60.230  1.00 53.47  ? 93   PHE A CD1   1 
ATOM   636   C  CD2   . PHE A  1  93  ? 48.728  35.631  59.346  1.00 53.54  ? 93   PHE A CD2   1 
ATOM   637   C  CE1   . PHE A  1  93  ? 50.936  34.023  58.974  1.00 54.23  ? 93   PHE A CE1   1 
ATOM   638   C  CE2   . PHE A  1  93  ? 49.282  35.501  58.087  1.00 53.93  ? 93   PHE A CE2   1 
ATOM   639   C  CZ    . PHE A  1  93  ? 50.389  34.697  57.902  1.00 53.89  ? 93   PHE A CZ    1 
ATOM   640   N  N     . TYR A  1  94  ? 46.555  32.370  61.055  1.00 49.44  ? 94   TYR A N     1 
ATOM   641   C  CA    . TYR A  1  94  ? 46.512  30.935  60.801  1.00 47.94  ? 94   TYR A CA    1 
ATOM   642   C  C     . TYR A  1  94  ? 46.831  30.507  59.375  1.00 47.79  ? 94   TYR A C     1 
ATOM   643   O  O     . TYR A  1  94  ? 45.938  30.155  58.624  1.00 48.64  ? 94   TYR A O     1 
ATOM   644   C  CB    . TYR A  1  94  ? 45.119  30.439  61.169  1.00 47.29  ? 94   TYR A CB    1 
ATOM   645   C  CG    . TYR A  1  94  ? 44.918  28.944  61.215  1.00 47.46  ? 94   TYR A CG    1 
ATOM   646   C  CD1   . TYR A  1  94  ? 43.916  28.335  60.456  1.00 47.76  ? 94   TYR A CD1   1 
ATOM   647   C  CD2   . TYR A  1  94  ? 45.682  28.143  62.053  1.00 47.60  ? 94   TYR A CD2   1 
ATOM   648   C  CE1   . TYR A  1  94  ? 43.684  26.966  60.536  1.00 46.82  ? 94   TYR A CE1   1 
ATOM   649   C  CE2   . TYR A  1  94  ? 45.458  26.768  62.140  1.00 46.21  ? 94   TYR A CE2   1 
ATOM   650   C  CZ    . TYR A  1  94  ? 44.460  26.190  61.379  1.00 46.88  ? 94   TYR A CZ    1 
ATOM   651   O  OH    . TYR A  1  94  ? 44.239  24.842  61.445  1.00 45.31  ? 94   TYR A OH    1 
ATOM   652   N  N     . PRO A  1  95  ? 48.106  30.524  58.977  1.00 47.65  ? 95   PRO A N     1 
ATOM   653   C  CA    . PRO A  1  95  ? 48.467  30.118  57.616  1.00 46.20  ? 95   PRO A CA    1 
ATOM   654   C  C     . PRO A  1  95  ? 48.545  28.605  57.547  1.00 45.74  ? 95   PRO A C     1 
ATOM   655   O  O     . PRO A  1  95  ? 48.425  27.955  58.577  1.00 45.59  ? 95   PRO A O     1 
ATOM   656   C  CB    . PRO A  1  95  ? 49.810  30.781  57.429  1.00 45.71  ? 95   PRO A CB    1 
ATOM   657   C  CG    . PRO A  1  95  ? 50.383  30.675  58.771  1.00 46.07  ? 95   PRO A CG    1 
ATOM   658   C  CD    . PRO A  1  95  ? 49.268  31.096  59.665  1.00 46.59  ? 95   PRO A CD    1 
ATOM   659   N  N     . ILE A  1  96  ? 48.750  28.045  56.357  1.00 43.94  ? 96   ILE A N     1 
ATOM   660   C  CA    . ILE A  1  96  ? 48.818  26.597  56.220  1.00 43.46  ? 96   ILE A CA    1 
ATOM   661   C  C     . ILE A  1  96  ? 49.924  25.950  57.032  1.00 45.34  ? 96   ILE A C     1 
ATOM   662   O  O     . ILE A  1  96  ? 49.732  24.881  57.593  1.00 44.28  ? 96   ILE A O     1 
ATOM   663   C  CB    . ILE A  1  96  ? 48.985  26.165  54.762  1.00 42.62  ? 96   ILE A CB    1 
ATOM   664   C  CG1   . ILE A  1  96  ? 47.795  26.646  53.938  1.00 42.21  ? 96   ILE A CG1   1 
ATOM   665   C  CG2   . ILE A  1  96  ? 49.049  24.650  54.671  1.00 42.79  ? 96   ILE A CG2   1 
ATOM   666   C  CD1   . ILE A  1  96  ? 47.895  26.341  52.465  1.00 42.83  ? 96   ILE A CD1   1 
ATOM   667   N  N     . TRP A  1  97  ? 51.076  26.591  57.112  1.00 46.88  ? 97   TRP A N     1 
ATOM   668   C  CA    . TRP A  1  97  ? 52.169  26.005  57.865  1.00 47.45  ? 97   TRP A CA    1 
ATOM   669   C  C     . TRP A  1  97  ? 51.931  25.969  59.342  1.00 49.77  ? 97   TRP A C     1 
ATOM   670   O  O     . TRP A  1  97  ? 52.659  25.304  60.066  1.00 51.74  ? 97   TRP A O     1 
ATOM   671   C  CB    . TRP A  1  97  ? 53.497  26.691  57.556  1.00 45.93  ? 97   TRP A CB    1 
ATOM   672   C  CG    . TRP A  1  97  ? 53.533  28.140  57.726  1.00 44.63  ? 97   TRP A CG    1 
ATOM   673   C  CD1   . TRP A  1  97  ? 53.721  28.811  58.873  1.00 45.45  ? 97   TRP A CD1   1 
ATOM   674   C  CD2   . TRP A  1  97  ? 53.386  29.120  56.706  1.00 43.95  ? 97   TRP A CD2   1 
ATOM   675   N  NE1   . TRP A  1  97  ? 53.704  30.164  58.645  1.00 44.84  ? 97   TRP A NE1   1 
ATOM   676   C  CE2   . TRP A  1  97  ? 53.496  30.378  57.315  1.00 44.70  ? 97   TRP A CE2   1 
ATOM   677   C  CE3   . TRP A  1  97  ? 53.172  29.057  55.337  1.00 45.48  ? 97   TRP A CE3   1 
ATOM   678   C  CZ2   . TRP A  1  97  ? 53.397  31.567  56.606  1.00 47.01  ? 97   TRP A CZ2   1 
ATOM   679   C  CZ3   . TRP A  1  97  ? 53.075  30.242  54.625  1.00 48.52  ? 97   TRP A CZ3   1 
ATOM   680   C  CH2   . TRP A  1  97  ? 53.186  31.479  55.261  1.00 48.37  ? 97   TRP A CH2   1 
ATOM   681   N  N     . GLU A  1  98  ? 50.902  26.667  59.801  1.00 52.64  ? 98   GLU A N     1 
ATOM   682   C  CA    . GLU A  1  98  ? 50.563  26.670  61.231  1.00 54.47  ? 98   GLU A CA    1 
ATOM   683   C  C     . GLU A  1  98  ? 49.574  25.571  61.572  1.00 53.79  ? 98   GLU A C     1 
ATOM   684   O  O     . GLU A  1  98  ? 49.130  25.476  62.704  1.00 54.24  ? 98   GLU A O     1 
ATOM   685   C  CB    . GLU A  1  98  ? 49.972  28.012  61.650  1.00 57.26  ? 98   GLU A CB    1 
ATOM   686   C  CG    . GLU A  1  98  ? 51.012  29.077  61.930  1.00 62.70  ? 98   GLU A CG    1 
ATOM   687   C  CD    . GLU A  1  98  ? 51.616  28.981  63.324  1.00 64.99  ? 98   GLU A CD    1 
ATOM   688   O  OE1   . GLU A  1  98  ? 51.085  29.639  64.246  1.00 65.36  ? 98   GLU A OE1   1 
ATOM   689   O  OE2   . GLU A  1  98  ? 52.616  28.248  63.497  1.00 67.18  ? 98   GLU A OE2   1 
ATOM   690   N  N     . ALA A  1  99  ? 49.220  24.750  60.593  1.00 52.91  ? 99   ALA A N     1 
ATOM   691   C  CA    . ALA A  1  99  ? 48.283  23.670  60.841  1.00 53.08  ? 99   ALA A CA    1 
ATOM   692   C  C     . ALA A  1  99  ? 49.042  22.377  60.975  1.00 52.25  ? 99   ALA A C     1 
ATOM   693   O  O     . ALA A  1  99  ? 50.138  22.244  60.442  1.00 53.86  ? 99   ALA A O     1 
ATOM   694   C  CB    . ALA A  1  99  ? 47.290  23.561  59.722  1.00 54.38  ? 99   ALA A CB    1 
ATOM   695   N  N     . ALA A  1  100 ? 48.455  21.426  61.679  1.00 49.34  ? 100  ALA A N     1 
ATOM   696   C  CA    . ALA A  1  100 ? 49.099  20.163  61.875  1.00 48.04  ? 100  ALA A CA    1 
ATOM   697   C  C     . ALA A  1  100 ? 48.857  19.321  60.668  1.00 49.05  ? 100  ALA A C     1 
ATOM   698   O  O     . ALA A  1  100 ? 49.517  18.317  60.483  1.00 49.68  ? 100  ALA A O     1 
ATOM   699   C  CB    . ALA A  1  100 ? 48.545  19.498  63.052  1.00 47.72  ? 100  ALA A CB    1 
ATOM   700   N  N     . SER A  1  101 ? 47.887  19.714  59.855  1.00 50.85  ? 101  SER A N     1 
ATOM   701   C  CA    . SER A  1  101 ? 47.538  18.991  58.629  1.00 52.81  ? 101  SER A CA    1 
ATOM   702   C  C     . SER A  1  101 ? 46.500  19.798  57.908  1.00 55.42  ? 101  SER A C     1 
ATOM   703   O  O     . SER A  1  101 ? 45.790  20.587  58.527  1.00 56.91  ? 101  SER A O     1 
ATOM   704   C  CB    . SER A  1  101 ? 46.914  17.656  58.935  1.00 51.36  ? 101  SER A CB    1 
ATOM   705   O  OG    . SER A  1  101 ? 45.675  17.880  59.547  1.00 49.04  ? 101  SER A OG    1 
ATOM   706   N  N     . LEU A  1  102 ? 46.394  19.597  56.605  1.00 57.22  ? 102  LEU A N     1 
ATOM   707   C  CA    . LEU A  1  102 ? 45.417  20.344  55.841  1.00 58.61  ? 102  LEU A CA    1 
ATOM   708   C  C     . LEU A  1  102 ? 44.030  20.207  56.485  1.00 60.25  ? 102  LEU A C     1 
ATOM   709   O  O     . LEU A  1  102 ? 43.337  21.206  56.726  1.00 61.41  ? 102  LEU A O     1 
ATOM   710   C  CB    . LEU A  1  102 ? 45.416  19.872  54.390  1.00 56.10  ? 102  LEU A CB    1 
ATOM   711   C  CG    . LEU A  1  102 ? 46.437  20.604  53.533  1.00 53.90  ? 102  LEU A CG    1 
ATOM   712   C  CD1   . LEU A  1  102 ? 46.571  19.919  52.220  1.00 56.29  ? 102  LEU A CD1   1 
ATOM   713   C  CD2   . LEU A  1  102 ? 46.010  22.018  53.318  1.00 52.90  ? 102  LEU A CD2   1 
ATOM   714   N  N     . ASP A  1  103 ? 43.650  18.981  56.800  1.00 59.14  ? 103  ASP A N     1 
ATOM   715   C  CA    . ASP A  1  103 ? 42.364  18.730  57.411  1.00 59.17  ? 103  ASP A CA    1 
ATOM   716   C  C     . ASP A  1  103 ? 42.091  19.653  58.549  1.00 58.57  ? 103  ASP A C     1 
ATOM   717   O  O     . ASP A  1  103 ? 40.993  20.174  58.657  1.00 59.60  ? 103  ASP A O     1 
ATOM   718   C  CB    . ASP A  1  103 ? 42.344  17.307  57.854  1.00 61.67  ? 103  ASP A CB    1 
ATOM   719   C  CG    . ASP A  1  103 ? 42.862  16.418  56.786  1.00 67.35  ? 103  ASP A CG    1 
ATOM   720   O  OD1   . ASP A  1  103 ? 44.021  16.652  56.362  1.00 68.17  ? 103  ASP A OD1   1 
ATOM   721   O  OD2   . ASP A  1  103 ? 42.117  15.517  56.341  1.00 70.07  ? 103  ASP A OD2   1 
ATOM   722   N  N     . GLU A  1  104 ? 43.084  19.861  59.400  1.00 58.89  ? 104  GLU A N     1 
ATOM   723   C  CA    . GLU A  1  104 ? 42.928  20.787  60.517  1.00 58.85  ? 104  GLU A CA    1 
ATOM   724   C  C     . GLU A  1  104 ? 42.716  22.164  59.925  1.00 58.53  ? 104  GLU A C     1 
ATOM   725   O  O     . GLU A  1  104 ? 41.810  22.884  60.322  1.00 59.65  ? 104  GLU A O     1 
ATOM   726   C  CB    . GLU A  1  104 ? 44.172  20.837  61.404  1.00 59.54  ? 104  GLU A CB    1 
ATOM   727   C  CG    . GLU A  1  104 ? 44.314  22.151  62.158  1.00 60.42  ? 104  GLU A CG    1 
ATOM   728   C  CD    . GLU A  1  104 ? 45.491  22.167  63.100  1.00 62.22  ? 104  GLU A CD    1 
ATOM   729   O  OE1   . GLU A  1  104 ? 46.018  23.264  63.405  1.00 61.72  ? 104  GLU A OE1   1 
ATOM   730   O  OE2   . GLU A  1  104 ? 45.881  21.074  63.547  1.00 63.30  ? 104  GLU A OE2   1 
ATOM   731   N  N     . TRP A  1  105 ? 43.569  22.521  58.978  1.00 55.39  ? 105  TRP A N     1 
ATOM   732   C  CA    . TRP A  1  105 ? 43.491  23.797  58.320  1.00 52.74  ? 105  TRP A CA    1 
ATOM   733   C  C     . TRP A  1  105 ? 42.099  24.038  57.715  1.00 53.03  ? 105  TRP A C     1 
ATOM   734   O  O     . TRP A  1  105 ? 41.560  25.146  57.787  1.00 53.07  ? 105  TRP A O     1 
ATOM   735   C  CB    . TRP A  1  105 ? 44.564  23.846  57.239  1.00 50.35  ? 105  TRP A CB    1 
ATOM   736   C  CG    . TRP A  1  105 ? 44.774  25.190  56.634  1.00 46.65  ? 105  TRP A CG    1 
ATOM   737   C  CD1   . TRP A  1  105 ? 45.319  26.296  57.232  1.00 45.36  ? 105  TRP A CD1   1 
ATOM   738   C  CD2   . TRP A  1  105 ? 44.408  25.584  55.322  1.00 44.00  ? 105  TRP A CD2   1 
ATOM   739   N  NE1   . TRP A  1  105 ? 45.307  27.356  56.367  1.00 42.99  ? 105  TRP A NE1   1 
ATOM   740   C  CE2   . TRP A  1  105 ? 44.752  26.943  55.184  1.00 43.37  ? 105  TRP A CE2   1 
ATOM   741   C  CE3   . TRP A  1  105 ? 43.816  24.921  54.246  1.00 41.65  ? 105  TRP A CE3   1 
ATOM   742   C  CZ2   . TRP A  1  105 ? 44.523  27.646  54.014  1.00 40.97  ? 105  TRP A CZ2   1 
ATOM   743   C  CZ3   . TRP A  1  105 ? 43.589  25.616  53.099  1.00 40.85  ? 105  TRP A CZ3   1 
ATOM   744   C  CH2   . TRP A  1  105 ? 43.940  26.967  52.985  1.00 40.36  ? 105  TRP A CH2   1 
ATOM   745   N  N     . LEU A  1  106 ? 41.511  23.000  57.130  1.00 52.38  ? 106  LEU A N     1 
ATOM   746   C  CA    . LEU A  1  106 ? 40.193  23.128  56.506  1.00 51.45  ? 106  LEU A CA    1 
ATOM   747   C  C     . LEU A  1  106 ? 39.063  23.192  57.516  1.00 50.24  ? 106  LEU A C     1 
ATOM   748   O  O     . LEU A  1  106 ? 38.175  24.018  57.398  1.00 50.12  ? 106  LEU A O     1 
ATOM   749   C  CB    . LEU A  1  106 ? 39.948  21.970  55.539  1.00 52.79  ? 106  LEU A CB    1 
ATOM   750   C  CG    . LEU A  1  106 ? 40.841  21.898  54.298  1.00 54.48  ? 106  LEU A CG    1 
ATOM   751   C  CD1   . LEU A  1  106 ? 40.802  20.505  53.672  1.00 53.49  ? 106  LEU A CD1   1 
ATOM   752   C  CD2   . LEU A  1  106 ? 40.398  22.956  53.311  1.00 55.13  ? 106  LEU A CD2   1 
ATOM   753   N  N     . TYR A  1  107 ? 39.095  22.308  58.496  1.00 47.67  ? 107  TYR A N     1 
ATOM   754   C  CA    . TYR A  1  107 ? 38.072  22.283  59.524  1.00 46.62  ? 107  TYR A CA    1 
ATOM   755   C  C     . TYR A  1  107 ? 38.041  23.582  60.313  1.00 47.43  ? 107  TYR A C     1 
ATOM   756   O  O     . TYR A  1  107 ? 37.002  23.995  60.797  1.00 47.47  ? 107  TYR A O     1 
ATOM   757   C  CB    . TYR A  1  107 ? 38.345  21.147  60.478  1.00 45.73  ? 107  TYR A CB    1 
ATOM   758   C  CG    . TYR A  1  107 ? 37.337  20.976  61.584  1.00 45.94  ? 107  TYR A CG    1 
ATOM   759   C  CD1   . TYR A  1  107 ? 36.363  19.992  61.512  1.00 46.71  ? 107  TYR A CD1   1 
ATOM   760   C  CD2   . TYR A  1  107 ? 37.377  21.761  62.722  1.00 45.48  ? 107  TYR A CD2   1 
ATOM   761   C  CE1   . TYR A  1  107 ? 35.462  19.791  62.545  1.00 45.43  ? 107  TYR A CE1   1 
ATOM   762   C  CE2   . TYR A  1  107 ? 36.470  21.567  63.761  1.00 44.81  ? 107  TYR A CE2   1 
ATOM   763   C  CZ    . TYR A  1  107 ? 35.526  20.582  63.659  1.00 45.41  ? 107  TYR A CZ    1 
ATOM   764   O  OH    . TYR A  1  107 ? 34.636  20.371  64.662  1.00 46.44  ? 107  TYR A OH    1 
ATOM   765   N  N     . ASN A  1  108 ? 39.178  24.228  60.454  1.00 47.45  ? 108  ASN A N     1 
ATOM   766   C  CA    . ASN A  1  108 ? 39.213  25.456  61.206  1.00 48.62  ? 108  ASN A CA    1 
ATOM   767   C  C     . ASN A  1  108 ? 39.036  26.699  60.344  1.00 50.10  ? 108  ASN A C     1 
ATOM   768   O  O     . ASN A  1  108 ? 39.117  27.821  60.834  1.00 51.72  ? 108  ASN A O     1 
ATOM   769   C  CB    . ASN A  1  108 ? 40.508  25.530  61.993  1.00 47.36  ? 108  ASN A CB    1 
ATOM   770   C  CG    . ASN A  1  108 ? 40.582  24.481  63.085  1.00 48.88  ? 108  ASN A CG    1 
ATOM   771   O  OD1   . ASN A  1  108 ? 39.994  24.631  64.151  1.00 49.62  ? 108  ASN A OD1   1 
ATOM   772   N  ND2   . ASN A  1  108 ? 41.310  23.409  62.823  1.00 48.42  ? 108  ASN A ND2   1 
ATOM   773   N  N     . GLY A  1  109 ? 38.808  26.515  59.055  1.00 49.77  ? 109  GLY A N     1 
ATOM   774   C  CA    . GLY A  1  109 ? 38.601  27.667  58.198  1.00 49.91  ? 109  GLY A CA    1 
ATOM   775   C  C     . GLY A  1  109 ? 39.822  28.338  57.607  1.00 51.06  ? 109  GLY A C     1 
ATOM   776   O  O     . GLY A  1  109 ? 39.729  29.481  57.175  1.00 52.42  ? 109  GLY A O     1 
ATOM   777   N  N     . GLY A  1  110 ? 40.949  27.639  57.566  1.00 50.72  ? 110  GLY A N     1 
ATOM   778   C  CA    . GLY A  1  110 ? 42.153  28.213  56.996  1.00 48.50  ? 110  GLY A CA    1 
ATOM   779   C  C     . GLY A  1  110 ? 41.969  28.894  55.654  1.00 48.06  ? 110  GLY A C     1 
ATOM   780   O  O     . GLY A  1  110 ? 42.508  29.950  55.448  1.00 46.97  ? 110  GLY A O     1 
ATOM   781   N  N     . PRO A  1  111 ? 41.211  28.313  54.717  1.00 47.97  ? 111  PRO A N     1 
ATOM   782   C  CA    . PRO A  1  111 ? 41.002  28.923  53.406  1.00 49.88  ? 111  PRO A CA    1 
ATOM   783   C  C     . PRO A  1  111 ? 40.566  30.376  53.421  1.00 50.96  ? 111  PRO A C     1 
ATOM   784   O  O     . PRO A  1  111 ? 40.994  31.168  52.586  1.00 50.88  ? 111  PRO A O     1 
ATOM   785   C  CB    . PRO A  1  111 ? 39.956  28.015  52.777  1.00 49.75  ? 111  PRO A CB    1 
ATOM   786   C  CG    . PRO A  1  111 ? 40.350  26.709  53.265  1.00 48.45  ? 111  PRO A CG    1 
ATOM   787   C  CD    . PRO A  1  111 ? 40.599  26.976  54.737  1.00 49.19  ? 111  PRO A CD    1 
ATOM   788   N  N     . TYR A  1  112 ? 39.719  30.738  54.364  1.00 51.04  ? 112  TYR A N     1 
ATOM   789   C  CA    . TYR A  1  112 ? 39.267  32.115  54.401  1.00 50.95  ? 112  TYR A CA    1 
ATOM   790   C  C     . TYR A  1  112 ? 40.414  33.095  54.512  1.00 49.61  ? 112  TYR A C     1 
ATOM   791   O  O     . TYR A  1  112 ? 40.573  33.946  53.647  1.00 48.07  ? 112  TYR A O     1 
ATOM   792   C  CB    . TYR A  1  112 ? 38.279  32.308  55.547  1.00 52.67  ? 112  TYR A CB    1 
ATOM   793   C  CG    . TYR A  1  112 ? 37.630  33.676  55.603  1.00 53.16  ? 112  TYR A CG    1 
ATOM   794   C  CD1   . TYR A  1  112 ? 38.049  34.623  56.519  1.00 53.20  ? 112  TYR A CD1   1 
ATOM   795   C  CD2   . TYR A  1  112 ? 36.574  34.008  54.767  1.00 53.67  ? 112  TYR A CD2   1 
ATOM   796   C  CE1   . TYR A  1  112 ? 37.433  35.862  56.607  1.00 51.81  ? 112  TYR A CE1   1 
ATOM   797   C  CE2   . TYR A  1  112 ? 35.952  35.255  54.854  1.00 52.61  ? 112  TYR A CE2   1 
ATOM   798   C  CZ    . TYR A  1  112 ? 36.394  36.165  55.778  1.00 51.45  ? 112  TYR A CZ    1 
ATOM   799   O  OH    . TYR A  1  112 ? 35.798  37.380  55.892  1.00 51.15  ? 112  TYR A OH    1 
ATOM   800   N  N     . GLN A  1  113 ? 41.216  32.977  55.566  1.00 50.36  ? 113  GLN A N     1 
ATOM   801   C  CA    . GLN A  1  113 ? 42.343  33.901  55.766  1.00 51.47  ? 113  GLN A CA    1 
ATOM   802   C  C     . GLN A  1  113 ? 43.232  33.977  54.536  1.00 51.74  ? 113  GLN A C     1 
ATOM   803   O  O     . GLN A  1  113 ? 43.599  35.059  54.114  1.00 51.57  ? 113  GLN A O     1 
ATOM   804   C  CB    . GLN A  1  113 ? 43.215  33.511  56.964  1.00 51.60  ? 113  GLN A CB    1 
ATOM   805   C  CG    . GLN A  1  113 ? 42.542  33.525  58.304  1.00 53.05  ? 113  GLN A CG    1 
ATOM   806   C  CD    . GLN A  1  113 ? 43.533  33.795  59.386  1.00 53.93  ? 113  GLN A CD    1 
ATOM   807   O  OE1   . GLN A  1  113 ? 44.645  33.305  59.345  1.00 55.75  ? 113  GLN A OE1   1 
ATOM   808   N  NE2   . GLN A  1  113 ? 43.140  34.576  60.364  1.00 54.82  ? 113  GLN A NE2   1 
ATOM   809   N  N     . LEU A  1  114 ? 43.580  32.831  53.971  1.00 51.05  ? 114  LEU A N     1 
ATOM   810   C  CA    . LEU A  1  114 ? 44.412  32.814  52.796  1.00 50.83  ? 114  LEU A CA    1 
ATOM   811   C  C     . LEU A  1  114 ? 43.737  33.639  51.726  1.00 50.30  ? 114  LEU A C     1 
ATOM   812   O  O     . LEU A  1  114 ? 44.365  34.486  51.098  1.00 51.40  ? 114  LEU A O     1 
ATOM   813   C  CB    . LEU A  1  114 ? 44.607  31.392  52.275  1.00 51.26  ? 114  LEU A CB    1 
ATOM   814   C  CG    . LEU A  1  114 ? 45.326  31.232  50.928  1.00 51.64  ? 114  LEU A CG    1 
ATOM   815   C  CD1   . LEU A  1  114 ? 46.791  31.393  51.092  1.00 52.27  ? 114  LEU A CD1   1 
ATOM   816   C  CD2   . LEU A  1  114 ? 45.079  29.878  50.382  1.00 52.36  ? 114  LEU A CD2   1 
ATOM   817   N  N     . ILE A  1  115 ? 42.451  33.417  51.528  1.00 49.65  ? 115  ILE A N     1 
ATOM   818   C  CA    . ILE A  1  115 ? 41.751  34.154  50.490  1.00 49.81  ? 115  ILE A CA    1 
ATOM   819   C  C     . ILE A  1  115 ? 41.552  35.628  50.708  1.00 50.71  ? 115  ILE A C     1 
ATOM   820   O  O     . ILE A  1  115 ? 41.657  36.379  49.760  1.00 50.78  ? 115  ILE A O     1 
ATOM   821   C  CB    . ILE A  1  115 ? 40.393  33.543  50.176  1.00 49.13  ? 115  ILE A CB    1 
ATOM   822   C  CG1   . ILE A  1  115 ? 40.587  32.109  49.690  1.00 50.68  ? 115  ILE A CG1   1 
ATOM   823   C  CG2   . ILE A  1  115 ? 39.696  34.368  49.133  1.00 48.25  ? 115  ILE A CG2   1 
ATOM   824   C  CD1   . ILE A  1  115 ? 39.325  31.400  49.241  1.00 52.49  ? 115  ILE A CD1   1 
ATOM   825   N  N     . ILE A  1  116 ? 41.266  36.071  51.924  1.00 51.99  ? 116  ILE A N     1 
ATOM   826   C  CA    . ILE A  1  116 ? 41.065  37.503  52.095  1.00 53.36  ? 116  ILE A CA    1 
ATOM   827   C  C     . ILE A  1  116 ? 42.346  38.300  52.184  1.00 55.40  ? 116  ILE A C     1 
ATOM   828   O  O     . ILE A  1  116 ? 42.421  39.378  51.597  1.00 56.71  ? 116  ILE A O     1 
ATOM   829   C  CB    . ILE A  1  116 ? 40.205  37.879  53.315  1.00 52.66  ? 116  ILE A CB    1 
ATOM   830   C  CG1   . ILE A  1  116 ? 40.893  37.440  54.591  1.00 50.91  ? 116  ILE A CG1   1 
ATOM   831   C  CG2   . ILE A  1  116 ? 38.796  37.332  53.157  1.00 51.88  ? 116  ILE A CG2   1 
ATOM   832   C  CD1   . ILE A  1  116 ? 40.355  38.148  55.798  1.00 53.00  ? 116  ILE A CD1   1 
ATOM   833   N  N     . PHE A  1  117 ? 43.347  37.806  52.912  1.00 56.67  ? 117  PHE A N     1 
ATOM   834   C  CA    . PHE A  1  117 ? 44.603  38.554  53.023  1.00 56.93  ? 117  PHE A CA    1 
ATOM   835   C  C     . PHE A  1  117 ? 45.139  38.755  51.614  1.00 57.59  ? 117  PHE A C     1 
ATOM   836   O  O     . PHE A  1  117 ? 45.656  39.826  51.281  1.00 57.71  ? 117  PHE A O     1 
ATOM   837   C  CB    . PHE A  1  117 ? 45.628  37.813  53.879  1.00 56.24  ? 117  PHE A CB    1 
ATOM   838   C  CG    . PHE A  1  117 ? 45.257  37.724  55.331  1.00 56.10  ? 117  PHE A CG    1 
ATOM   839   C  CD1   . PHE A  1  117 ? 45.831  36.758  56.149  1.00 56.50  ? 117  PHE A CD1   1 
ATOM   840   C  CD2   . PHE A  1  117 ? 44.322  38.592  55.881  1.00 55.79  ? 117  PHE A CD2   1 
ATOM   841   C  CE1   . PHE A  1  117 ? 45.472  36.660  57.489  1.00 56.94  ? 117  PHE A CE1   1 
ATOM   842   C  CE2   . PHE A  1  117 ? 43.958  38.503  57.216  1.00 54.87  ? 117  PHE A CE2   1 
ATOM   843   C  CZ    . PHE A  1  117 ? 44.531  37.538  58.020  1.00 55.83  ? 117  PHE A CZ    1 
ATOM   844   N  N     . HIS A  1  118 ? 44.999  37.733  50.779  1.00 56.96  ? 118  HIS A N     1 
ATOM   845   C  CA    . HIS A  1  118 ? 45.454  37.858  49.412  1.00 57.04  ? 118  HIS A CA    1 
ATOM   846   C  C     . HIS A  1  118 ? 44.584  38.772  48.561  1.00 55.58  ? 118  HIS A C     1 
ATOM   847   O  O     . HIS A  1  118 ? 45.093  39.557  47.796  1.00 55.35  ? 118  HIS A O     1 
ATOM   848   C  CB    . HIS A  1  118 ? 45.540  36.502  48.753  1.00 60.17  ? 118  HIS A CB    1 
ATOM   849   C  CG    . HIS A  1  118 ? 46.850  35.817  48.967  1.00 64.57  ? 118  HIS A CG    1 
ATOM   850   N  ND1   . HIS A  1  118 ? 47.098  35.013  50.058  1.00 66.62  ? 118  HIS A ND1   1 
ATOM   851   C  CD2   . HIS A  1  118 ? 47.981  35.800  48.220  1.00 65.78  ? 118  HIS A CD2   1 
ATOM   852   C  CE1   . HIS A  1  118 ? 48.324  34.525  49.969  1.00 67.41  ? 118  HIS A CE1   1 
ATOM   853   N  NE2   . HIS A  1  118 ? 48.882  34.988  48.865  1.00 66.82  ? 118  HIS A NE2   1 
ATOM   854   N  N     . PHE A  1  119 ? 43.274  38.678  48.663  1.00 54.58  ? 119  PHE A N     1 
ATOM   855   C  CA    . PHE A  1  119 ? 42.454  39.569  47.856  1.00 53.47  ? 119  PHE A CA    1 
ATOM   856   C  C     . PHE A  1  119 ? 42.654  41.018  48.262  1.00 55.95  ? 119  PHE A C     1 
ATOM   857   O  O     . PHE A  1  119 ? 42.675  41.893  47.420  1.00 56.29  ? 119  PHE A O     1 
ATOM   858   C  CB    . PHE A  1  119 ? 40.973  39.223  47.961  1.00 49.02  ? 119  PHE A CB    1 
ATOM   859   C  CG    . PHE A  1  119 ? 40.093  40.301  47.467  1.00 43.28  ? 119  PHE A CG    1 
ATOM   860   C  CD1   . PHE A  1  119 ? 39.638  41.278  48.317  1.00 41.90  ? 119  PHE A CD1   1 
ATOM   861   C  CD2   . PHE A  1  119 ? 39.748  40.359  46.152  1.00 41.07  ? 119  PHE A CD2   1 
ATOM   862   C  CE1   . PHE A  1  119 ? 38.849  42.290  47.853  1.00 40.69  ? 119  PHE A CE1   1 
ATOM   863   C  CE2   . PHE A  1  119 ? 38.962  41.365  45.682  1.00 40.31  ? 119  PHE A CE2   1 
ATOM   864   C  CZ    . PHE A  1  119 ? 38.509  42.334  46.531  1.00 39.33  ? 119  PHE A CZ    1 
ATOM   865   N  N     . LEU A  1  120 ? 42.773  41.282  49.551  1.00 58.15  ? 120  LEU A N     1 
ATOM   866   C  CA    . LEU A  1  120 ? 42.980  42.644  49.997  1.00 61.46  ? 120  LEU A CA    1 
ATOM   867   C  C     . LEU A  1  120 ? 44.326  43.203  49.535  1.00 63.20  ? 120  LEU A C     1 
ATOM   868   O  O     . LEU A  1  120 ? 44.450  44.397  49.255  1.00 64.50  ? 120  LEU A O     1 
ATOM   869   C  CB    . LEU A  1  120 ? 42.896  42.733  51.514  1.00 61.46  ? 120  LEU A CB    1 
ATOM   870   C  CG    . LEU A  1  120 ? 41.490  42.637  52.069  1.00 62.64  ? 120  LEU A CG    1 
ATOM   871   C  CD1   . LEU A  1  120 ? 41.551  42.797  53.566  1.00 62.18  ? 120  LEU A CD1   1 
ATOM   872   C  CD2   . LEU A  1  120 ? 40.622  43.707  51.433  1.00 60.98  ? 120  LEU A CD2   1 
ATOM   873   N  N     . LEU A  1  121 ? 45.341  42.355  49.460  1.00 64.29  ? 121  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  121 ? 46.659  42.815  49.024  1.00 64.24  ? 121  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  121 ? 46.624  43.161  47.542  1.00 64.25  ? 121  LEU A C     1 
ATOM   876   O  O     . LEU A  1  121 ? 47.004  44.254  47.162  1.00 64.66  ? 121  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  121 ? 47.711  41.739  49.284  1.00 64.78  ? 121  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  121 ? 49.124  42.248  49.535  1.00 63.97  ? 121  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  121 ? 49.107  43.232  50.678  1.00 63.91  ? 121  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  121 ? 50.016  41.087  49.868  1.00 63.76  ? 121  LEU A CD2   1 
ATOM   881   N  N     . GLY A  1  122 ? 46.164  42.237  46.714  1.00 62.97  ? 122  GLY A N     1 
ATOM   882   C  CA    . GLY A  1  122 ? 46.075  42.505  45.291  1.00 63.81  ? 122  GLY A CA    1 
ATOM   883   C  C     . GLY A  1  122 ? 45.122  43.646  44.929  1.00 64.71  ? 122  GLY A C     1 
ATOM   884   O  O     . GLY A  1  122 ? 45.424  44.478  44.081  1.00 63.99  ? 122  GLY A O     1 
ATOM   885   N  N     . ALA A  1  123 ? 43.964  43.687  45.574  1.00 66.10  ? 123  ALA A N     1 
ATOM   886   C  CA    . ALA A  1  123 ? 42.985  44.733  45.309  1.00 66.23  ? 123  ALA A CA    1 
ATOM   887   C  C     . ALA A  1  123 ? 43.546  46.101  45.643  1.00 67.33  ? 123  ALA A C     1 
ATOM   888   O  O     . ALA A  1  123 ? 43.054  47.118  45.148  1.00 68.93  ? 123  ALA A O     1 
ATOM   889   C  CB    . ALA A  1  123 ? 41.761  44.500  46.100  1.00 66.71  ? 123  ALA A CB    1 
ATOM   890   N  N     . SER A  1  124 ? 44.550  46.137  46.506  1.00 66.20  ? 124  SER A N     1 
ATOM   891   C  CA    . SER A  1  124 ? 45.168  47.396  46.855  1.00 65.30  ? 124  SER A CA    1 
ATOM   892   C  C     . SER A  1  124 ? 46.110  47.792  45.742  1.00 64.93  ? 124  SER A C     1 
ATOM   893   O  O     . SER A  1  124 ? 46.017  48.895  45.217  1.00 63.64  ? 124  SER A O     1 
ATOM   894   C  CB    . SER A  1  124 ? 45.939  47.254  48.138  1.00 66.34  ? 124  SER A CB    1 
ATOM   895   O  OG    . SER A  1  124 ? 45.036  47.125  49.210  1.00 69.38  ? 124  SER A OG    1 
ATOM   896   N  N     . CYS A  1  125 ? 47.021  46.890  45.391  1.00 63.91  ? 125  CYS A N     1 
ATOM   897   C  CA    . CYS A  1  125 ? 47.964  47.135  44.312  1.00 62.78  ? 125  CYS A CA    1 
ATOM   898   C  C     . CYS A  1  125 ? 47.174  47.426  43.050  1.00 63.09  ? 125  CYS A C     1 
ATOM   899   O  O     . CYS A  1  125 ? 47.630  48.174  42.178  1.00 64.12  ? 125  CYS A O     1 
ATOM   900   C  CB    . CYS A  1  125 ? 48.817  45.912  44.070  1.00 62.15  ? 125  CYS A CB    1 
ATOM   901   S  SG    . CYS A  1  125 ? 49.786  45.505  45.450  1.00 65.23  ? 125  CYS A SG    1 
ATOM   902   N  N     . TYR A  1  126 ? 45.996  46.814  42.942  1.00 62.48  ? 126  TYR A N     1 
ATOM   903   C  CA    . TYR A  1  126 ? 45.137  47.025  41.780  1.00 60.65  ? 126  TYR A CA    1 
ATOM   904   C  C     . TYR A  1  126 ? 44.786  48.524  41.766  1.00 61.09  ? 126  TYR A C     1 
ATOM   905   O  O     . TYR A  1  126 ? 44.614  49.125  40.694  1.00 60.38  ? 126  TYR A O     1 
ATOM   906   C  CB    . TYR A  1  126 ? 43.873  46.154  41.895  1.00 58.06  ? 126  TYR A CB    1 
ATOM   907   C  CG    . TYR A  1  126 ? 42.928  46.234  40.711  1.00 53.71  ? 126  TYR A CG    1 
ATOM   908   C  CD1   . TYR A  1  126 ? 43.014  45.329  39.656  1.00 52.37  ? 126  TYR A CD1   1 
ATOM   909   C  CD2   . TYR A  1  126 ? 41.969  47.243  40.635  1.00 51.77  ? 126  TYR A CD2   1 
ATOM   910   C  CE1   . TYR A  1  126 ? 42.161  45.432  38.550  1.00 50.53  ? 126  TYR A CE1   1 
ATOM   911   C  CE2   . TYR A  1  126 ? 41.120  47.356  39.535  1.00 49.48  ? 126  TYR A CE2   1 
ATOM   912   C  CZ    . TYR A  1  126 ? 41.218  46.451  38.501  1.00 48.45  ? 126  TYR A CZ    1 
ATOM   913   O  OH    . TYR A  1  126 ? 40.360  46.561  37.444  1.00 45.63  ? 126  TYR A OH    1 
ATOM   914   N  N     . MET A  1  127 ? 44.690  49.115  42.961  1.00 60.58  ? 127  MET A N     1 
ATOM   915   C  CA    . MET A  1  127 ? 44.395  50.540  43.101  1.00 61.15  ? 127  MET A CA    1 
ATOM   916   C  C     . MET A  1  127 ? 45.649  51.316  42.717  1.00 61.59  ? 127  MET A C     1 
ATOM   917   O  O     . MET A  1  127 ? 45.585  52.328  42.021  1.00 63.26  ? 127  MET A O     1 
ATOM   918   C  CB    . MET A  1  127 ? 43.994  50.874  44.536  1.00 61.00  ? 127  MET A CB    1 
ATOM   919   C  CG    . MET A  1  127 ? 43.964  52.360  44.847  1.00 60.61  ? 127  MET A CG    1 
ATOM   920   S  SD    . MET A  1  127 ? 43.269  52.720  46.461  1.00 61.24  ? 127  MET A SD    1 
ATOM   921   C  CE    . MET A  1  127 ? 44.641  52.675  47.460  1.00 60.89  ? 127  MET A CE    1 
ATOM   922   N  N     . GLY A  1  128 ? 46.788  50.836  43.184  1.00 61.45  ? 128  GLY A N     1 
ATOM   923   C  CA    . GLY A  1  128 ? 48.039  51.471  42.832  1.00 61.89  ? 128  GLY A CA    1 
ATOM   924   C  C     . GLY A  1  128 ? 48.280  51.345  41.330  1.00 61.86  ? 128  GLY A C     1 
ATOM   925   O  O     . GLY A  1  128 ? 48.659  52.308  40.670  1.00 62.06  ? 128  GLY A O     1 
ATOM   926   N  N     . ARG A  1  129 ? 48.074  50.158  40.787  1.00 61.74  ? 129  ARG A N     1 
ATOM   927   C  CA    . ARG A  1  129 ? 48.251  49.973  39.363  1.00 62.99  ? 129  ARG A CA    1 
ATOM   928   C  C     . ARG A  1  129 ? 47.389  51.015  38.613  1.00 64.86  ? 129  ARG A C     1 
ATOM   929   O  O     . ARG A  1  129 ? 47.838  51.619  37.645  1.00 64.81  ? 129  ARG A O     1 
ATOM   930   C  CB    . ARG A  1  129 ? 47.851  48.551  38.965  1.00 62.13  ? 129  ARG A CB    1 
ATOM   931   C  CG    . ARG A  1  129 ? 48.660  48.011  37.792  1.00 62.25  ? 129  ARG A CG    1 
ATOM   932   C  CD    . ARG A  1  129 ? 48.248  46.619  37.319  1.00 60.28  ? 129  ARG A CD    1 
ATOM   933   N  NE    . ARG A  1  129 ? 46.935  46.626  36.701  1.00 60.46  ? 129  ARG A NE    1 
ATOM   934   C  CZ    . ARG A  1  129 ? 46.618  45.884  35.652  1.00 61.88  ? 129  ARG A CZ    1 
ATOM   935   N  NH1   . ARG A  1  129 ? 47.539  45.096  35.134  1.00 62.43  ? 129  ARG A NH1   1 
ATOM   936   N  NH2   . ARG A  1  129 ? 45.400  45.925  35.121  1.00 61.08  ? 129  ARG A NH2   1 
ATOM   937   N  N     . GLN A  1  130 ? 46.160  51.239  39.068  1.00 67.50  ? 130  GLN A N     1 
ATOM   938   C  CA    . GLN A  1  130 ? 45.268  52.213  38.436  1.00 69.64  ? 130  GLN A CA    1 
ATOM   939   C  C     . GLN A  1  130 ? 45.782  53.660  38.501  1.00 70.68  ? 130  GLN A C     1 
ATOM   940   O  O     . GLN A  1  130 ? 45.042  54.631  38.335  1.00 71.91  ? 130  GLN A O     1 
ATOM   941   C  CB    . GLN A  1  130 ? 43.880  52.156  39.073  1.00 70.25  ? 130  GLN A CB    1 
ATOM   942   C  CG    . GLN A  1  130 ? 43.072  50.927  38.741  1.00 70.74  ? 130  GLN A CG    1 
ATOM   943   C  CD    . GLN A  1  130 ? 41.601  51.186  38.951  1.00 71.45  ? 130  GLN A CD    1 
ATOM   944   O  OE1   . GLN A  1  130 ? 41.238  52.121  39.661  1.00 71.07  ? 130  GLN A OE1   1 
ATOM   945   N  NE2   . GLN A  1  130 ? 40.745  50.365  38.345  1.00 71.06  ? 130  GLN A NE2   1 
ATOM   946   N  N     . TRP A  1  131 ? 47.055  53.807  38.750  1.00 70.85  ? 131  TRP A N     1 
ATOM   947   C  CA    . TRP A  1  131 ? 47.620  55.123  38.816  1.00 70.87  ? 131  TRP A CA    1 
ATOM   948   C  C     . TRP A  1  131 ? 48.810  55.036  37.891  1.00 71.26  ? 131  TRP A C     1 
ATOM   949   O  O     . TRP A  1  131 ? 48.952  55.834  36.956  1.00 71.75  ? 131  TRP A O     1 
ATOM   950   C  CB    . TRP A  1  131 ? 48.064  55.416  40.239  1.00 71.29  ? 131  TRP A CB    1 
ATOM   951   C  CG    . TRP A  1  131 ? 49.276  56.230  40.272  1.00 73.07  ? 131  TRP A CG    1 
ATOM   952   C  CD1   . TRP A  1  131 ? 49.354  57.588  40.171  1.00 74.60  ? 131  TRP A CD1   1 
ATOM   953   C  CD2   . TRP A  1  131 ? 50.621  55.745  40.266  1.00 73.36  ? 131  TRP A CD2   1 
ATOM   954   N  NE1   . TRP A  1  131 ? 50.671  57.980  40.092  1.00 75.76  ? 131  TRP A NE1   1 
ATOM   955   C  CE2   . TRP A  1  131 ? 51.467  56.865  40.148  1.00 74.48  ? 131  TRP A CE2   1 
ATOM   956   C  CE3   . TRP A  1  131 ? 51.193  54.469  40.340  1.00 72.35  ? 131  TRP A CE3   1 
ATOM   957   C  CZ2   . TRP A  1  131 ? 52.856  56.747  40.103  1.00 73.64  ? 131  TRP A CZ2   1 
ATOM   958   C  CZ3   . TRP A  1  131 ? 52.571  54.349  40.295  1.00 72.60  ? 131  TRP A CZ3   1 
ATOM   959   C  CH2   . TRP A  1  131 ? 53.387  55.478  40.178  1.00 73.31  ? 131  TRP A CH2   1 
ATOM   960   N  N     . GLU A  1  132 ? 49.647  54.034  38.150  1.00 70.93  ? 132  GLU A N     1 
ATOM   961   C  CA    . GLU A  1  132 ? 50.855  53.807  37.363  1.00 70.72  ? 132  GLU A CA    1 
ATOM   962   C  C     . GLU A  1  132 ? 50.568  53.917  35.874  1.00 70.51  ? 132  GLU A C     1 
ATOM   963   O  O     . GLU A  1  132 ? 51.223  54.695  35.180  1.00 71.94  ? 132  GLU A O     1 
ATOM   964   C  CB    . GLU A  1  132 ? 51.434  52.437  37.680  1.00 70.63  ? 132  GLU A CB    1 
ATOM   965   C  CG    . GLU A  1  132 ? 52.913  52.321  37.481  1.00 69.49  ? 132  GLU A CG    1 
ATOM   966   C  CD    . GLU A  1  132 ? 53.397  50.951  37.855  1.00 69.51  ? 132  GLU A CD    1 
ATOM   967   O  OE1   . GLU A  1  132 ? 52.991  50.447  38.928  1.00 68.55  ? 132  GLU A OE1   1 
ATOM   968   O  OE2   . GLU A  1  132 ? 54.182  50.378  37.080  1.00 69.31  ? 132  GLU A OE2   1 
ATOM   969   N  N     . LEU A  1  133 ? 49.585  53.165  35.386  1.00 69.50  ? 133  LEU A N     1 
ATOM   970   C  CA    . LEU A  1  133 ? 49.262  53.225  33.974  1.00 68.71  ? 133  LEU A CA    1 
ATOM   971   C  C     . LEU A  1  133 ? 48.903  54.640  33.545  1.00 68.98  ? 133  LEU A C     1 
ATOM   972   O  O     . LEU A  1  133 ? 49.387  55.106  32.511  1.00 69.74  ? 133  LEU A O     1 
ATOM   973   C  CB    . LEU A  1  133 ? 48.111  52.286  33.622  1.00 67.37  ? 133  LEU A CB    1 
ATOM   974   C  CG    . LEU A  1  133 ? 47.716  52.367  32.146  1.00 67.42  ? 133  LEU A CG    1 
ATOM   975   C  CD1   . LEU A  1  133 ? 48.878  51.882  31.328  1.00 66.69  ? 133  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A  1  133 ? 46.478  51.559  31.847  1.00 66.26  ? 133  LEU A CD2   1 
ATOM   977   N  N     . SER A  1  134 ? 48.072  55.327  34.325  1.00 69.08  ? 134  SER A N     1 
ATOM   978   C  CA    . SER A  1  134 ? 47.672  56.686  33.956  1.00 69.71  ? 134  SER A CA    1 
ATOM   979   C  C     . SER A  1  134 ? 48.916  57.561  33.745  1.00 70.26  ? 134  SER A C     1 
ATOM   980   O  O     . SER A  1  134 ? 49.008  58.309  32.752  1.00 70.61  ? 134  SER A O     1 
ATOM   981   C  CB    . SER A  1  134 ? 46.763  57.308  35.026  1.00 69.64  ? 134  SER A CB    1 
ATOM   982   O  OG    . SER A  1  134 ? 47.495  57.787  36.135  1.00 68.78  ? 134  SER A OG    1 
ATOM   983   N  N     . TYR A  1  135 ? 49.860  57.446  34.685  1.00 69.07  ? 135  TYR A N     1 
ATOM   984   C  CA    . TYR A  1  135 ? 51.131  58.166  34.661  1.00 67.38  ? 135  TYR A CA    1 
ATOM   985   C  C     . TYR A  1  135 ? 51.865  57.795  33.362  1.00 66.23  ? 135  TYR A C     1 
ATOM   986   O  O     . TYR A  1  135 ? 52.190  58.655  32.545  1.00 66.46  ? 135  TYR A O     1 
ATOM   987   C  CB    . TYR A  1  135 ? 51.930  57.743  35.883  1.00 68.93  ? 135  TYR A CB    1 
ATOM   988   C  CG    . TYR A  1  135 ? 53.207  58.491  36.120  1.00 71.95  ? 135  TYR A CG    1 
ATOM   989   C  CD1   . TYR A  1  135 ? 53.241  59.889  36.125  1.00 73.59  ? 135  TYR A CD1   1 
ATOM   990   C  CD2   . TYR A  1  135 ? 54.382  57.805  36.422  1.00 73.99  ? 135  TYR A CD2   1 
ATOM   991   C  CE1   . TYR A  1  135 ? 54.428  60.590  36.435  1.00 74.23  ? 135  TYR A CE1   1 
ATOM   992   C  CE2   . TYR A  1  135 ? 55.574  58.490  36.739  1.00 74.67  ? 135  TYR A CE2   1 
ATOM   993   C  CZ    . TYR A  1  135 ? 55.587  59.877  36.742  1.00 75.08  ? 135  TYR A CZ    1 
ATOM   994   O  OH    . TYR A  1  135 ? 56.757  60.531  37.056  1.00 76.67  ? 135  TYR A OH    1 
ATOM   995   N  N     . ARG A  1  136 ? 52.094  56.507  33.173  1.00 64.17  ? 136  ARG A N     1 
ATOM   996   C  CA    . ARG A  1  136 ? 52.749  56.012  31.976  1.00 62.13  ? 136  ARG A CA    1 
ATOM   997   C  C     . ARG A  1  136 ? 52.042  56.487  30.698  1.00 63.27  ? 136  ARG A C     1 
ATOM   998   O  O     . ARG A  1  136 ? 52.641  56.503  29.625  1.00 62.64  ? 136  ARG A O     1 
ATOM   999   C  CB    . ARG A  1  136 ? 52.774  54.488  32.010  1.00 59.94  ? 136  ARG A CB    1 
ATOM   1000  C  CG    . ARG A  1  136 ? 53.283  53.906  33.314  1.00 56.73  ? 136  ARG A CG    1 
ATOM   1001  C  CD    . ARG A  1  136 ? 54.786  53.950  33.412  1.00 55.76  ? 136  ARG A CD    1 
ATOM   1002  N  NE    . ARG A  1  136 ? 55.259  54.570  34.654  1.00 55.37  ? 136  ARG A NE    1 
ATOM   1003  C  CZ    . ARG A  1  136 ? 55.807  53.918  35.679  1.00 54.67  ? 136  ARG A CZ    1 
ATOM   1004  N  NH1   . ARG A  1  136 ? 55.962  52.599  35.646  1.00 54.77  ? 136  ARG A NH1   1 
ATOM   1005  N  NH2   . ARG A  1  136 ? 56.236  54.596  36.729  1.00 53.22  ? 136  ARG A NH2   1 
ATOM   1006  N  N     . LEU A  1  137 ? 50.773  56.863  30.805  1.00 63.67  ? 137  LEU A N     1 
ATOM   1007  C  CA    . LEU A  1  137 ? 50.017  57.330  29.637  1.00 64.59  ? 137  LEU A CA    1 
ATOM   1008  C  C     . LEU A  1  137 ? 49.858  58.846  29.654  1.00 66.09  ? 137  LEU A C     1 
ATOM   1009  O  O     . LEU A  1  137 ? 49.118  59.420  28.848  1.00 63.98  ? 137  LEU A O     1 
ATOM   1010  C  CB    . LEU A  1  137 ? 48.630  56.689  29.602  1.00 63.97  ? 137  LEU A CB    1 
ATOM   1011  C  CG    . LEU A  1  137 ? 48.512  55.182  29.508  1.00 62.58  ? 137  LEU A CG    1 
ATOM   1012  C  CD1   . LEU A  1  137 ? 47.084  54.850  29.140  1.00 62.26  ? 137  LEU A CD1   1 
ATOM   1013  C  CD2   . LEU A  1  137 ? 49.462  54.645  28.481  1.00 63.67  ? 137  LEU A CD2   1 
ATOM   1014  N  N     . GLY A  1  138 ? 50.546  59.488  30.593  1.00 68.55  ? 138  GLY A N     1 
ATOM   1015  C  CA    . GLY A  1  138 ? 50.483  60.937  30.712  1.00 69.95  ? 138  GLY A CA    1 
ATOM   1016  C  C     . GLY A  1  138 ? 49.131  61.531  31.075  1.00 71.40  ? 138  GLY A C     1 
ATOM   1017  O  O     . GLY A  1  138 ? 48.939  62.749  30.946  1.00 71.72  ? 138  GLY A O     1 
ATOM   1018  N  N     . MET A  1  139 ? 48.190  60.692  31.523  1.00 73.12  ? 139  MET A N     1 
ATOM   1019  C  CA    . MET A  1  139 ? 46.853  61.181  31.903  1.00 73.44  ? 139  MET A CA    1 
ATOM   1020  C  C     . MET A  1  139 ? 46.773  61.612  33.358  1.00 72.40  ? 139  MET A C     1 
ATOM   1021  O  O     . MET A  1  139 ? 47.663  61.336  34.160  1.00 71.14  ? 139  MET A O     1 
ATOM   1022  C  CB    . MET A  1  139 ? 45.754  60.138  31.586  1.00 73.94  ? 139  MET A CB    1 
ATOM   1023  C  CG    . MET A  1  139 ? 46.018  58.707  31.999  1.00 73.99  ? 139  MET A CG    1 
ATOM   1024  S  SD    . MET A  1  139 ? 44.774  57.588  31.305  1.00 75.50  ? 139  MET A SD    1 
ATOM   1025  C  CE    . MET A  1  139 ? 43.322  58.182  32.093  1.00 75.40  ? 139  MET A CE    1 
ATOM   1026  N  N     . ARG A  1  140 ? 45.714  62.322  33.684  1.00 71.86  ? 140  ARG A N     1 
ATOM   1027  C  CA    . ARG A  1  140 ? 45.553  62.774  35.052  1.00 72.73  ? 140  ARG A CA    1 
ATOM   1028  C  C     . ARG A  1  140 ? 45.350  61.533  35.915  1.00 73.00  ? 140  ARG A C     1 
ATOM   1029  O  O     . ARG A  1  140 ? 44.847  60.504  35.441  1.00 74.17  ? 140  ARG A O     1 
ATOM   1030  C  CB    . ARG A  1  140 ? 44.371  63.733  35.131  1.00 72.16  ? 140  ARG A CB    1 
ATOM   1031  C  CG    . ARG A  1  140 ? 44.334  64.705  33.937  1.00 71.53  ? 140  ARG A CG    1 
ATOM   1032  C  CD    . ARG A  1  140 ? 43.252  65.726  34.090  1.00 70.14  ? 140  ARG A CD    1 
ATOM   1033  N  NE    . ARG A  1  140 ? 43.465  66.509  35.303  1.00 70.80  ? 140  ARG A NE    1 
ATOM   1034  C  CZ    . ARG A  1  140 ? 42.480  67.052  36.020  1.00 71.93  ? 140  ARG A CZ    1 
ATOM   1035  N  NH1   . ARG A  1  140 ? 41.210  66.893  35.635  1.00 72.22  ? 140  ARG A NH1   1 
ATOM   1036  N  NH2   . ARG A  1  140 ? 42.753  67.727  37.132  1.00 70.85  ? 140  ARG A NH2   1 
ATOM   1037  N  N     . PRO A  1  141 ? 45.723  61.614  37.197  1.00 72.66  ? 141  PRO A N     1 
ATOM   1038  C  CA    . PRO A  1  141 ? 45.607  60.498  38.150  1.00 72.95  ? 141  PRO A CA    1 
ATOM   1039  C  C     . PRO A  1  141 ? 44.168  60.125  38.552  1.00 72.85  ? 141  PRO A C     1 
ATOM   1040  O  O     . PRO A  1  141 ? 43.403  59.554  37.768  1.00 73.14  ? 141  PRO A O     1 
ATOM   1041  C  CB    . PRO A  1  141 ? 46.422  61.000  39.340  1.00 73.24  ? 141  PRO A CB    1 
ATOM   1042  C  CG    . PRO A  1  141 ? 46.032  62.487  39.378  1.00 72.75  ? 141  PRO A CG    1 
ATOM   1043  C  CD    . PRO A  1  141 ? 46.062  62.874  37.888  1.00 72.64  ? 141  PRO A CD    1 
ATOM   1044  N  N     . TRP A  1  142 ? 43.859  60.472  39.802  1.00 71.82  ? 142  TRP A N     1 
ATOM   1045  C  CA    . TRP A  1  142 ? 42.597  60.286  40.516  1.00 70.06  ? 142  TRP A CA    1 
ATOM   1046  C  C     . TRP A  1  142 ? 41.590  59.177  40.202  1.00 69.05  ? 142  TRP A C     1 
ATOM   1047  O  O     . TRP A  1  142 ? 40.679  58.938  40.987  1.00 70.55  ? 142  TRP A O     1 
ATOM   1048  C  CB    . TRP A  1  142 ? 41.904  61.646  40.606  1.00 69.33  ? 142  TRP A CB    1 
ATOM   1049  C  CG    . TRP A  1  142 ? 42.862  62.674  41.111  1.00 68.89  ? 142  TRP A CG    1 
ATOM   1050  C  CD1   . TRP A  1  142 ? 43.891  62.482  42.004  1.00 68.12  ? 142  TRP A CD1   1 
ATOM   1051  C  CD2   . TRP A  1  142 ? 42.917  64.041  40.733  1.00 69.25  ? 142  TRP A CD2   1 
ATOM   1052  N  NE1   . TRP A  1  142 ? 44.584  63.648  42.194  1.00 68.08  ? 142  TRP A NE1   1 
ATOM   1053  C  CE2   . TRP A  1  142 ? 44.007  64.625  41.426  1.00 69.63  ? 142  TRP A CE2   1 
ATOM   1054  C  CE3   . TRP A  1  142 ? 42.151  64.837  39.876  1.00 69.73  ? 142  TRP A CE3   1 
ATOM   1055  C  CZ2   . TRP A  1  142 ? 44.346  65.970  41.281  1.00 70.44  ? 142  TRP A CZ2   1 
ATOM   1056  C  CZ3   . TRP A  1  142 ? 42.479  66.172  39.729  1.00 70.58  ? 142  TRP A CZ3   1 
ATOM   1057  C  CH2   . TRP A  1  142 ? 43.572  66.731  40.428  1.00 71.41  ? 142  TRP A CH2   1 
ATOM   1058  N  N     . ILE A  1  143 ? 41.731  58.491  39.092  1.00 65.84  ? 143  ILE A N     1 
ATOM   1059  C  CA    . ILE A  1  143 ? 40.798  57.427  38.838  1.00 62.76  ? 143  ILE A CA    1 
ATOM   1060  C  C     . ILE A  1  143 ? 40.926  56.450  40.023  1.00 62.38  ? 143  ILE A C     1 
ATOM   1061  O  O     . ILE A  1  143 ? 39.934  55.998  40.597  1.00 60.27  ? 143  ILE A O     1 
ATOM   1062  C  CB    . ILE A  1  143 ? 41.128  56.741  37.494  1.00 61.65  ? 143  ILE A CB    1 
ATOM   1063  C  CG1   . ILE A  1  143 ? 40.375  57.455  36.360  1.00 59.73  ? 143  ILE A CG1   1 
ATOM   1064  C  CG2   . ILE A  1  143 ? 40.809  55.267  37.566  1.00 62.28  ? 143  ILE A CG2   1 
ATOM   1065  C  CD1   . ILE A  1  143 ? 40.460  56.776  35.008  1.00 57.12  ? 143  ILE A CD1   1 
ATOM   1066  N  N     . CYS A  1  144 ? 42.164  56.170  40.403  1.00 62.50  ? 144  CYS A N     1 
ATOM   1067  C  CA    . CYS A  1  144 ? 42.449  55.251  41.490  1.00 62.86  ? 144  CYS A CA    1 
ATOM   1068  C  C     . CYS A  1  144 ? 41.857  55.730  42.792  1.00 62.77  ? 144  CYS A C     1 
ATOM   1069  O  O     . CYS A  1  144 ? 41.754  54.963  43.742  1.00 63.19  ? 144  CYS A O     1 
ATOM   1070  C  CB    . CYS A  1  144 ? 43.950  55.101  41.678  1.00 63.39  ? 144  CYS A CB    1 
ATOM   1071  S  SG    . CYS A  1  144 ? 44.703  56.531  42.546  1.00 67.09  ? 144  CYS A SG    1 
ATOM   1072  N  N     . VAL A  1  145 ? 41.493  56.997  42.865  1.00 62.71  ? 145  VAL A N     1 
ATOM   1073  C  CA    . VAL A  1  145 ? 40.914  57.496  44.108  1.00 63.27  ? 145  VAL A CA    1 
ATOM   1074  C  C     . VAL A  1  145 ? 39.418  57.241  44.148  1.00 63.61  ? 145  VAL A C     1 
ATOM   1075  O  O     . VAL A  1  145 ? 38.822  57.201  45.221  1.00 62.68  ? 145  VAL A O     1 
ATOM   1076  C  CB    . VAL A  1  145 ? 41.215  59.013  44.314  1.00 64.29  ? 145  VAL A CB    1 
ATOM   1077  C  CG1   . VAL A  1  145 ? 40.118  59.684  45.171  1.00 64.63  ? 145  VAL A CG1   1 
ATOM   1078  C  CG2   . VAL A  1  145 ? 42.582  59.165  45.001  1.00 64.64  ? 145  VAL A CG2   1 
ATOM   1079  N  N     . ALA A  1  146 ? 38.816  57.064  42.978  1.00 63.53  ? 146  ALA A N     1 
ATOM   1080  C  CA    . ALA A  1  146 ? 37.392  56.789  42.903  1.00 63.09  ? 146  ALA A CA    1 
ATOM   1081  C  C     . ALA A  1  146 ? 37.227  55.343  43.287  1.00 63.63  ? 146  ALA A C     1 
ATOM   1082  O  O     . ALA A  1  146 ? 36.243  54.982  43.913  1.00 65.36  ? 146  ALA A O     1 
ATOM   1083  C  CB    . ALA A  1  146 ? 36.876  57.008  41.515  1.00 63.15  ? 146  ALA A CB    1 
ATOM   1084  N  N     . TYR A  1  147 ? 38.205  54.519  42.916  1.00 63.38  ? 147  TYR A N     1 
ATOM   1085  C  CA    . TYR A  1  147 ? 38.187  53.087  43.229  1.00 63.27  ? 147  TYR A CA    1 
ATOM   1086  C  C     . TYR A  1  147 ? 38.535  52.799  44.689  1.00 63.37  ? 147  TYR A C     1 
ATOM   1087  O  O     . TYR A  1  147 ? 38.491  51.655  45.134  1.00 64.31  ? 147  TYR A O     1 
ATOM   1088  C  CB    . TYR A  1  147 ? 39.146  52.334  42.301  1.00 61.37  ? 147  TYR A CB    1 
ATOM   1089  C  CG    . TYR A  1  147 ? 39.379  50.866  42.630  1.00 60.24  ? 147  TYR A CG    1 
ATOM   1090  C  CD1   . TYR A  1  147 ? 40.525  50.456  43.311  1.00 59.25  ? 147  TYR A CD1   1 
ATOM   1091  C  CD2   . TYR A  1  147 ? 38.480  49.886  42.224  1.00 59.33  ? 147  TYR A CD2   1 
ATOM   1092  C  CE1   . TYR A  1  147 ? 40.761  49.106  43.570  1.00 58.02  ? 147  TYR A CE1   1 
ATOM   1093  C  CE2   . TYR A  1  147 ? 38.709  48.538  42.483  1.00 57.78  ? 147  TYR A CE2   1 
ATOM   1094  C  CZ    . TYR A  1  147 ? 39.847  48.163  43.152  1.00 57.28  ? 147  TYR A CZ    1 
ATOM   1095  O  OH    . TYR A  1  147 ? 40.071  46.849  43.422  1.00 57.89  ? 147  TYR A OH    1 
ATOM   1096  N  N     . SER A  1  148 ? 38.869  53.835  45.441  1.00 63.23  ? 148  SER A N     1 
ATOM   1097  C  CA    . SER A  1  148 ? 39.221  53.639  46.838  1.00 62.96  ? 148  SER A CA    1 
ATOM   1098  C  C     . SER A  1  148 ? 37.958  53.512  47.667  1.00 62.87  ? 148  SER A C     1 
ATOM   1099  O  O     . SER A  1  148 ? 38.016  53.291  48.874  1.00 62.29  ? 148  SER A O     1 
ATOM   1100  C  CB    . SER A  1  148 ? 40.037  54.818  47.362  1.00 63.49  ? 148  SER A CB    1 
ATOM   1101  O  OG    . SER A  1  148 ? 39.190  55.917  47.662  1.00 63.85  ? 148  SER A OG    1 
ATOM   1102  N  N     . ALA A  1  149 ? 36.813  53.675  47.025  1.00 62.87  ? 149  ALA A N     1 
ATOM   1103  C  CA    . ALA A  1  149 ? 35.557  53.577  47.751  1.00 62.77  ? 149  ALA A CA    1 
ATOM   1104  C  C     . ALA A  1  149 ? 35.226  52.104  47.904  1.00 62.35  ? 149  ALA A C     1 
ATOM   1105  O  O     . ALA A  1  149 ? 35.043  51.589  49.008  1.00 62.34  ? 149  ALA A O     1 
ATOM   1106  C  CB    . ALA A  1  149 ? 34.458  54.304  46.991  1.00 63.33  ? 149  ALA A CB    1 
ATOM   1107  N  N     . PRO A  1  150 ? 35.142  51.404  46.787  1.00 61.70  ? 150  PRO A N     1 
ATOM   1108  C  CA    . PRO A  1  150 ? 34.840  49.986  46.878  1.00 61.58  ? 150  PRO A CA    1 
ATOM   1109  C  C     . PRO A  1  150 ? 35.896  49.315  47.729  1.00 61.24  ? 150  PRO A C     1 
ATOM   1110  O  O     . PRO A  1  150 ? 35.567  48.638  48.688  1.00 60.57  ? 150  PRO A O     1 
ATOM   1111  C  CB    . PRO A  1  150 ? 34.904  49.542  45.436  1.00 62.68  ? 150  PRO A CB    1 
ATOM   1112  C  CG    . PRO A  1  150 ? 34.447  50.726  44.727  1.00 63.31  ? 150  PRO A CG    1 
ATOM   1113  C  CD    . PRO A  1  150 ? 35.148  51.843  45.388  1.00 62.90  ? 150  PRO A CD    1 
ATOM   1114  N  N     . LEU A  1  151 ? 37.163  49.511  47.381  1.00 61.27  ? 151  LEU A N     1 
ATOM   1115  C  CA    . LEU A  1  151 ? 38.234  48.908  48.155  1.00 61.76  ? 151  LEU A CA    1 
ATOM   1116  C  C     . LEU A  1  151 ? 38.013  49.172  49.655  1.00 61.94  ? 151  LEU A C     1 
ATOM   1117  O  O     . LEU A  1  151 ? 38.026  48.253  50.477  1.00 62.07  ? 151  LEU A O     1 
ATOM   1118  C  CB    . LEU A  1  151 ? 39.587  49.465  47.733  1.00 61.96  ? 151  LEU A CB    1 
ATOM   1119  C  CG    . LEU A  1  151 ? 40.754  48.727  48.405  1.00 63.89  ? 151  LEU A CG    1 
ATOM   1120  C  CD1   . LEU A  1  151 ? 40.774  47.312  47.897  1.00 64.02  ? 151  LEU A CD1   1 
ATOM   1121  C  CD2   . LEU A  1  151 ? 42.083  49.388  48.114  1.00 63.92  ? 151  LEU A CD2   1 
ATOM   1122  N  N     . ALA A  1  152 ? 37.800  50.431  50.007  1.00 61.09  ? 152  ALA A N     1 
ATOM   1123  C  CA    . ALA A  1  152 ? 37.565  50.795  51.395  1.00 59.90  ? 152  ALA A CA    1 
ATOM   1124  C  C     . ALA A  1  152 ? 36.404  50.007  51.991  1.00 59.35  ? 152  ALA A C     1 
ATOM   1125  O  O     . ALA A  1  152 ? 36.365  49.763  53.183  1.00 59.69  ? 152  ALA A O     1 
ATOM   1126  C  CB    . ALA A  1  152 ? 37.284  52.278  51.490  1.00 61.55  ? 152  ALA A CB    1 
ATOM   1127  N  N     . SER A  1  153 ? 35.452  49.628  51.161  1.00 58.36  ? 153  SER A N     1 
ATOM   1128  C  CA    . SER A  1  153 ? 34.316  48.873  51.645  1.00 57.44  ? 153  SER A CA    1 
ATOM   1129  C  C     . SER A  1  153 ? 34.679  47.407  51.804  1.00 56.24  ? 153  SER A C     1 
ATOM   1130  O  O     . SER A  1  153 ? 34.169  46.718  52.683  1.00 56.09  ? 153  SER A O     1 
ATOM   1131  C  CB    . SER A  1  153 ? 33.145  49.011  50.681  1.00 57.81  ? 153  SER A CB    1 
ATOM   1132  O  OG    . SER A  1  153 ? 32.687  50.340  50.628  1.00 60.23  ? 153  SER A OG    1 
ATOM   1133  N  N     . ALA A  1  154 ? 35.567  46.937  50.946  1.00 54.31  ? 154  ALA A N     1 
ATOM   1134  C  CA    . ALA A  1  154 ? 36.000  45.547  50.988  1.00 52.95  ? 154  ALA A CA    1 
ATOM   1135  C  C     . ALA A  1  154 ? 36.961  45.381  52.106  1.00 52.31  ? 154  ALA A C     1 
ATOM   1136  O  O     . ALA A  1  154 ? 37.143  44.287  52.594  1.00 53.05  ? 154  ALA A O     1 
ATOM   1137  C  CB    . ALA A  1  154 ? 36.677  45.158  49.691  1.00 54.09  ? 154  ALA A CB    1 
ATOM   1138  N  N     . PHE A  1  155 ? 37.596  46.478  52.490  1.00 52.25  ? 155  PHE A N     1 
ATOM   1139  C  CA    . PHE A  1  155 ? 38.571  46.472  53.563  1.00 51.96  ? 155  PHE A CA    1 
ATOM   1140  C  C     . PHE A  1  155 ? 37.819  46.464  54.869  1.00 51.64  ? 155  PHE A C     1 
ATOM   1141  O  O     . PHE A  1  155 ? 38.162  45.727  55.788  1.00 52.11  ? 155  PHE A O     1 
ATOM   1142  C  CB    . PHE A  1  155 ? 39.479  47.713  53.484  1.00 51.68  ? 155  PHE A CB    1 
ATOM   1143  C  CG    . PHE A  1  155 ? 40.905  47.411  53.075  1.00 53.52  ? 155  PHE A CG    1 
ATOM   1144  C  CD1   . PHE A  1  155 ? 41.869  47.126  54.028  1.00 53.40  ? 155  PHE A CD1   1 
ATOM   1145  C  CD2   . PHE A  1  155 ? 41.282  47.406  51.731  1.00 53.76  ? 155  PHE A CD2   1 
ATOM   1146  C  CE1   . PHE A  1  155 ? 43.187  46.839  53.647  1.00 53.61  ? 155  PHE A CE1   1 
ATOM   1147  C  CE2   . PHE A  1  155 ? 42.584  47.123  51.348  1.00 51.90  ? 155  PHE A CE2   1 
ATOM   1148  C  CZ    . PHE A  1  155 ? 43.537  46.839  52.302  1.00 52.93  ? 155  PHE A CZ    1 
ATOM   1149  N  N     . ALA A  1  156 ? 36.776  47.273  54.934  1.00 50.58  ? 156  ALA A N     1 
ATOM   1150  C  CA    . ALA A  1  156 ? 35.989  47.383  56.137  1.00 49.90  ? 156  ALA A CA    1 
ATOM   1151  C  C     . ALA A  1  156 ? 35.433  46.047  56.500  1.00 49.62  ? 156  ALA A C     1 
ATOM   1152  O  O     . ALA A  1  156 ? 35.713  45.517  57.567  1.00 48.40  ? 156  ALA A O     1 
ATOM   1153  C  CB    . ALA A  1  156 ? 34.868  48.357  55.935  1.00 50.43  ? 156  ALA A CB    1 
ATOM   1154  N  N     . VAL A  1  157 ? 34.650  45.509  55.580  1.00 48.50  ? 157  VAL A N     1 
ATOM   1155  C  CA    . VAL A  1  157 ? 33.973  44.236  55.731  1.00 47.97  ? 157  VAL A CA    1 
ATOM   1156  C  C     . VAL A  1  157 ? 34.828  42.992  55.936  1.00 48.11  ? 157  VAL A C     1 
ATOM   1157  O  O     . VAL A  1  157 ? 34.389  42.076  56.603  1.00 47.26  ? 157  VAL A O     1 
ATOM   1158  C  CB    . VAL A  1  157 ? 33.028  44.054  54.540  1.00 47.98  ? 157  VAL A CB    1 
ATOM   1159  C  CG1   . VAL A  1  157 ? 32.887  42.637  54.180  1.00 48.68  ? 157  VAL A CG1   1 
ATOM   1160  C  CG2   . VAL A  1  157 ? 31.698  44.616  54.886  1.00 47.90  ? 157  VAL A CG2   1 
ATOM   1161  N  N     . PHE A  1  158 ? 36.041  42.967  55.386  1.00 49.85  ? 158  PHE A N     1 
ATOM   1162  C  CA    . PHE A  1  158 ? 36.962  41.823  55.504  1.00 49.92  ? 158  PHE A CA    1 
ATOM   1163  C  C     . PHE A  1  158 ? 38.111  41.942  56.523  1.00 51.22  ? 158  PHE A C     1 
ATOM   1164  O  O     . PHE A  1  158 ? 38.622  40.921  56.998  1.00 52.46  ? 158  PHE A O     1 
ATOM   1165  C  CB    . PHE A  1  158 ? 37.593  41.527  54.154  1.00 49.96  ? 158  PHE A CB    1 
ATOM   1166  C  CG    . PHE A  1  158 ? 36.641  40.991  53.144  1.00 50.21  ? 158  PHE A CG    1 
ATOM   1167  C  CD1   . PHE A  1  158 ? 36.931  41.084  51.795  1.00 49.33  ? 158  PHE A CD1   1 
ATOM   1168  C  CD2   . PHE A  1  158 ? 35.466  40.371  53.533  1.00 50.42  ? 158  PHE A CD2   1 
ATOM   1169  C  CE1   . PHE A  1  158 ? 36.065  40.566  50.840  1.00 51.07  ? 158  PHE A CE1   1 
ATOM   1170  C  CE2   . PHE A  1  158 ? 34.593  39.848  52.586  1.00 50.76  ? 158  PHE A CE2   1 
ATOM   1171  C  CZ    . PHE A  1  158 ? 34.897  39.948  51.235  1.00 50.26  ? 158  PHE A CZ    1 
ATOM   1172  N  N     . LEU A  1  159 ? 38.529  43.168  56.843  1.00 49.64  ? 159  LEU A N     1 
ATOM   1173  C  CA    . LEU A  1  159 ? 39.633  43.387  57.778  1.00 48.63  ? 159  LEU A CA    1 
ATOM   1174  C  C     . LEU A  1  159 ? 39.374  44.280  58.992  1.00 49.77  ? 159  LEU A C     1 
ATOM   1175  O  O     . LEU A  1  159 ? 39.709  43.926  60.120  1.00 48.98  ? 159  LEU A O     1 
ATOM   1176  C  CB    . LEU A  1  159 ? 40.828  43.949  57.031  1.00 47.23  ? 159  LEU A CB    1 
ATOM   1177  C  CG    . LEU A  1  159 ? 42.011  44.336  57.906  1.00 46.82  ? 159  LEU A CG    1 
ATOM   1178  C  CD1   . LEU A  1  159 ? 42.476  43.136  58.697  1.00 46.90  ? 159  LEU A CD1   1 
ATOM   1179  C  CD2   . LEU A  1  159 ? 43.124  44.850  57.040  1.00 45.61  ? 159  LEU A CD2   1 
ATOM   1180  N  N     . ILE A  1  160 ? 38.811  45.453  58.763  1.00 50.44  ? 160  ILE A N     1 
ATOM   1181  C  CA    . ILE A  1  160 ? 38.523  46.368  59.856  1.00 50.26  ? 160  ILE A CA    1 
ATOM   1182  C  C     . ILE A  1  160 ? 37.498  45.825  60.839  1.00 50.93  ? 160  ILE A C     1 
ATOM   1183  O  O     . ILE A  1  160 ? 37.735  45.804  62.037  1.00 49.30  ? 160  ILE A O     1 
ATOM   1184  C  CB    . ILE A  1  160 ? 38.019  47.706  59.318  1.00 51.34  ? 160  ILE A CB    1 
ATOM   1185  C  CG1   . ILE A  1  160 ? 39.078  48.314  58.406  1.00 52.09  ? 160  ILE A CG1   1 
ATOM   1186  C  CG2   . ILE A  1  160 ? 37.704  48.642  60.454  1.00 49.61  ? 160  ILE A CG2   1 
ATOM   1187  C  CD1   . ILE A  1  160 ? 40.401  48.532  59.076  1.00 53.70  ? 160  ILE A CD1   1 
ATOM   1188  N  N     . TYR A  1  161 ? 36.360  45.377  60.328  1.00 52.45  ? 161  TYR A N     1 
ATOM   1189  C  CA    . TYR A  1  161 ? 35.300  44.861  61.194  1.00 52.95  ? 161  TYR A CA    1 
ATOM   1190  C  C     . TYR A  1  161 ? 35.772  43.757  62.105  1.00 51.61  ? 161  TYR A C     1 
ATOM   1191  O  O     . TYR A  1  161 ? 35.328  43.654  63.244  1.00 53.36  ? 161  TYR A O     1 
ATOM   1192  C  CB    . TYR A  1  161 ? 34.099  44.369  60.381  1.00 54.12  ? 161  TYR A CB    1 
ATOM   1193  C  CG    . TYR A  1  161 ? 32.875  44.187  61.234  1.00 56.37  ? 161  TYR A CG    1 
ATOM   1194  C  CD1   . TYR A  1  161 ? 32.340  45.261  61.941  1.00 58.03  ? 161  TYR A CD1   1 
ATOM   1195  C  CD2   . TYR A  1  161 ? 32.312  42.932  61.417  1.00 57.70  ? 161  TYR A CD2   1 
ATOM   1196  C  CE1   . TYR A  1  161 ? 31.285  45.089  62.819  1.00 59.80  ? 161  TYR A CE1   1 
ATOM   1197  C  CE2   . TYR A  1  161 ? 31.258  42.744  62.293  1.00 59.53  ? 161  TYR A CE2   1 
ATOM   1198  C  CZ    . TYR A  1  161 ? 30.751  43.821  62.995  1.00 60.35  ? 161  TYR A CZ    1 
ATOM   1199  O  OH    . TYR A  1  161 ? 29.737  43.615  63.902  1.00 61.31  ? 161  TYR A OH    1 
ATOM   1200  N  N     . PRO A  1  162 ? 36.660  42.901  61.615  1.00 49.96  ? 162  PRO A N     1 
ATOM   1201  C  CA    . PRO A  1  162 ? 37.140  41.827  62.486  1.00 49.44  ? 162  PRO A CA    1 
ATOM   1202  C  C     . PRO A  1  162 ? 38.141  42.310  63.531  1.00 47.82  ? 162  PRO A C     1 
ATOM   1203  O  O     . PRO A  1  162 ? 38.110  41.878  64.679  1.00 45.46  ? 162  PRO A O     1 
ATOM   1204  C  CB    . PRO A  1  162 ? 37.748  40.843  61.499  1.00 51.05  ? 162  PRO A CB    1 
ATOM   1205  C  CG    . PRO A  1  162 ? 36.924  41.066  60.267  1.00 51.21  ? 162  PRO A CG    1 
ATOM   1206  C  CD    . PRO A  1  162 ? 36.868  42.553  60.205  1.00 49.64  ? 162  PRO A CD    1 
ATOM   1207  N  N     . ILE A  1  163 ? 39.028  43.206  63.126  1.00 47.22  ? 163  ILE A N     1 
ATOM   1208  C  CA    . ILE A  1  163 ? 40.016  43.742  64.050  1.00 46.16  ? 163  ILE A CA    1 
ATOM   1209  C  C     . ILE A  1  163 ? 39.284  44.377  65.210  1.00 46.17  ? 163  ILE A C     1 
ATOM   1210  O  O     . ILE A  1  163 ? 39.788  44.396  66.321  1.00 47.19  ? 163  ILE A O     1 
ATOM   1211  C  CB    . ILE A  1  163 ? 40.897  44.801  63.380  1.00 45.23  ? 163  ILE A CB    1 
ATOM   1212  C  CG1   . ILE A  1  163 ? 41.727  44.149  62.264  1.00 45.46  ? 163  ILE A CG1   1 
ATOM   1213  C  CG2   . ILE A  1  163 ? 41.756  45.494  64.417  1.00 43.95  ? 163  ILE A CG2   1 
ATOM   1214  C  CD1   . ILE A  1  163 ? 42.645  45.088  61.509  1.00 42.94  ? 163  ILE A CD1   1 
ATOM   1215  N  N     . GLY A  1  164 ? 38.097  44.893  64.955  1.00 44.53  ? 164  GLY A N     1 
ATOM   1216  C  CA    . GLY A  1  164 ? 37.342  45.502  66.024  1.00 47.06  ? 164  GLY A CA    1 
ATOM   1217  C  C     . GLY A  1  164 ? 36.680  44.464  66.910  1.00 48.52  ? 164  GLY A C     1 
ATOM   1218  O  O     . GLY A  1  164 ? 36.828  44.461  68.129  1.00 48.77  ? 164  GLY A O     1 
ATOM   1219  N  N     . GLN A  1  165 ? 35.950  43.566  66.283  1.00 49.73  ? 165  GLN A N     1 
ATOM   1220  C  CA    . GLN A  1  165 ? 35.243  42.534  67.007  1.00 51.85  ? 165  GLN A CA    1 
ATOM   1221  C  C     . GLN A  1  165 ? 36.139  41.459  67.622  1.00 53.17  ? 165  GLN A C     1 
ATOM   1222  O  O     . GLN A  1  165 ? 35.692  40.675  68.448  1.00 54.30  ? 165  GLN A O     1 
ATOM   1223  C  CB    . GLN A  1  165 ? 34.204  41.907  66.082  1.00 52.68  ? 165  GLN A CB    1 
ATOM   1224  C  CG    . GLN A  1  165 ? 33.173  42.900  65.588  1.00 53.01  ? 165  GLN A CG    1 
ATOM   1225  C  CD    . GLN A  1  165 ? 32.377  43.491  66.728  1.00 52.91  ? 165  GLN A CD    1 
ATOM   1226  O  OE1   . GLN A  1  165 ? 32.180  44.707  66.799  1.00 50.57  ? 165  GLN A OE1   1 
ATOM   1227  N  NE2   . GLN A  1  165 ? 31.913  42.628  67.637  1.00 52.38  ? 165  GLN A NE2   1 
ATOM   1228  N  N     . GLY A  1  166 ? 37.395  41.404  67.222  1.00 53.85  ? 166  GLY A N     1 
ATOM   1229  C  CA    . GLY A  1  166 ? 38.275  40.407  67.800  1.00 53.05  ? 166  GLY A CA    1 
ATOM   1230  C  C     . GLY A  1  166 ? 38.463  39.097  67.058  1.00 53.68  ? 166  GLY A C     1 
ATOM   1231  O  O     . GLY A  1  166 ? 39.233  38.254  67.520  1.00 52.59  ? 166  GLY A O     1 
ATOM   1232  N  N     . SER A  1  167 ? 37.798  38.913  65.920  1.00 53.64  ? 167  SER A N     1 
ATOM   1233  C  CA    . SER A  1  167 ? 37.948  37.668  65.172  1.00 53.79  ? 167  SER A CA    1 
ATOM   1234  C  C     . SER A  1  167 ? 37.479  37.652  63.725  1.00 53.91  ? 167  SER A C     1 
ATOM   1235  O  O     . SER A  1  167 ? 36.457  38.217  63.377  1.00 54.88  ? 167  SER A O     1 
ATOM   1236  C  CB    . SER A  1  167 ? 37.231  36.545  65.890  1.00 54.38  ? 167  SER A CB    1 
ATOM   1237  O  OG    . SER A  1  167 ? 37.194  35.429  65.040  1.00 57.36  ? 167  SER A OG    1 
ATOM   1238  N  N     . PHE A  1  168 ? 38.224  36.970  62.884  1.00 53.73  ? 168  PHE A N     1 
ATOM   1239  C  CA    . PHE A  1  168 ? 37.836  36.875  61.497  1.00 53.11  ? 168  PHE A CA    1 
ATOM   1240  C  C     . PHE A  1  168 ? 36.607  36.005  61.356  1.00 54.18  ? 168  PHE A C     1 
ATOM   1241  O  O     . PHE A  1  168 ? 36.063  35.909  60.275  1.00 55.12  ? 168  PHE A O     1 
ATOM   1242  C  CB    . PHE A  1  168 ? 38.966  36.295  60.665  1.00 51.91  ? 168  PHE A CB    1 
ATOM   1243  C  CG    . PHE A  1  168 ? 40.140  37.197  60.563  1.00 51.38  ? 168  PHE A CG    1 
ATOM   1244  C  CD1   . PHE A  1  168 ? 40.045  38.393  59.872  1.00 50.74  ? 168  PHE A CD1   1 
ATOM   1245  C  CD2   . PHE A  1  168 ? 41.329  36.880  61.206  1.00 50.77  ? 168  PHE A CD2   1 
ATOM   1246  C  CE1   . PHE A  1  168 ? 41.109  39.255  59.831  1.00 51.53  ? 168  PHE A CE1   1 
ATOM   1247  C  CE2   . PHE A  1  168 ? 42.395  37.736  61.171  1.00 49.34  ? 168  PHE A CE2   1 
ATOM   1248  C  CZ    . PHE A  1  168 ? 42.293  38.927  60.486  1.00 51.05  ? 168  PHE A CZ    1 
ATOM   1249  N  N     . SER A  1  169 ? 36.176  35.352  62.428  1.00 53.99  ? 169  SER A N     1 
ATOM   1250  C  CA    . SER A  1  169 ? 34.987  34.530  62.335  1.00 54.32  ? 169  SER A CA    1 
ATOM   1251  C  C     . SER A  1  169 ? 33.830  35.474  62.005  1.00 54.18  ? 169  SER A C     1 
ATOM   1252  O  O     . SER A  1  169 ? 32.853  35.106  61.345  1.00 52.81  ? 169  SER A O     1 
ATOM   1253  C  CB    . SER A  1  169 ? 34.740  33.810  63.642  1.00 55.19  ? 169  SER A CB    1 
ATOM   1254  O  OG    . SER A  1  169 ? 34.630  34.750  64.685  1.00 59.88  ? 169  SER A OG    1 
ATOM   1255  N  N     . ASP A  1  170 ? 33.949  36.700  62.485  1.00 55.22  ? 170  ASP A N     1 
ATOM   1256  C  CA    . ASP A  1  170 ? 32.960  37.724  62.187  1.00 57.18  ? 170  ASP A CA    1 
ATOM   1257  C  C     . ASP A  1  170 ? 33.539  38.348  60.940  1.00 57.44  ? 170  ASP A C     1 
ATOM   1258  O  O     . ASP A  1  170 ? 34.689  38.086  60.614  1.00 57.76  ? 170  ASP A O     1 
ATOM   1259  C  CB    . ASP A  1  170 ? 32.870  38.766  63.307  1.00 58.77  ? 170  ASP A CB    1 
ATOM   1260  C  CG    . ASP A  1  170 ? 32.107  38.249  64.523  1.00 63.13  ? 170  ASP A CG    1 
ATOM   1261  O  OD1   . ASP A  1  170 ? 31.363  37.241  64.351  1.00 65.39  ? 170  ASP A OD1   1 
ATOM   1262  O  OD2   . ASP A  1  170 ? 32.225  38.836  65.640  1.00 62.19  ? 170  ASP A OD2   1 
ATOM   1263  N  N     . GLY A  1  171 ? 32.781  39.171  60.240  1.00 56.76  ? 171  GLY A N     1 
ATOM   1264  C  CA    . GLY A  1  171 ? 33.334  39.733  59.028  1.00 57.05  ? 171  GLY A CA    1 
ATOM   1265  C  C     . GLY A  1  171 ? 32.865  38.922  57.832  1.00 56.19  ? 171  GLY A C     1 
ATOM   1266  O  O     . GLY A  1  171 ? 33.273  37.789  57.628  1.00 56.56  ? 171  GLY A O     1 
ATOM   1267  N  N     . MET A  1  172 ? 32.000  39.536  57.041  1.00 55.63  ? 172  MET A N     1 
ATOM   1268  C  CA    . MET A  1  172 ? 31.381  38.943  55.871  1.00 53.74  ? 172  MET A CA    1 
ATOM   1269  C  C     . MET A  1  172 ? 32.071  37.769  55.234  1.00 52.59  ? 172  MET A C     1 
ATOM   1270  O  O     . MET A  1  172 ? 33.218  37.857  54.840  1.00 52.50  ? 172  MET A O     1 
ATOM   1271  C  CB    . MET A  1  172 ? 31.177  40.010  54.832  1.00 53.38  ? 172  MET A CB    1 
ATOM   1272  C  CG    . MET A  1  172 ? 30.118  39.662  53.862  1.00 55.55  ? 172  MET A CG    1 
ATOM   1273  S  SD    . MET A  1  172 ? 29.998  40.930  52.663  1.00 57.38  ? 172  MET A SD    1 
ATOM   1274  C  CE    . MET A  1  172 ? 31.092  40.277  51.387  1.00 59.92  ? 172  MET A CE    1 
ATOM   1275  N  N     . PRO A  1  173 ? 31.358  36.647  55.109  1.00 52.60  ? 173  PRO A N     1 
ATOM   1276  C  CA    . PRO A  1  173 ? 31.855  35.401  54.512  1.00 52.05  ? 173  PRO A CA    1 
ATOM   1277  C  C     . PRO A  1  173 ? 31.739  35.398  52.983  1.00 51.27  ? 173  PRO A C     1 
ATOM   1278  O  O     . PRO A  1  173 ? 30.792  35.932  52.420  1.00 51.32  ? 173  PRO A O     1 
ATOM   1279  C  CB    . PRO A  1  173 ? 30.980  34.347  55.163  1.00 51.65  ? 173  PRO A CB    1 
ATOM   1280  C  CG    . PRO A  1  173 ? 29.682  35.055  55.251  1.00 54.27  ? 173  PRO A CG    1 
ATOM   1281  C  CD    . PRO A  1  173 ? 30.066  36.422  55.776  1.00 52.02  ? 173  PRO A CD    1 
ATOM   1282  N  N     . LEU A  1  174 ? 32.700  34.777  52.316  1.00 51.01  ? 174  LEU A N     1 
ATOM   1283  C  CA    . LEU A  1  174 ? 32.719  34.747  50.860  1.00 51.09  ? 174  LEU A CA    1 
ATOM   1284  C  C     . LEU A  1  174 ? 31.665  33.864  50.253  1.00 51.40  ? 174  LEU A C     1 
ATOM   1285  O  O     . LEU A  1  174 ? 31.955  32.753  49.829  1.00 51.92  ? 174  LEU A O     1 
ATOM   1286  C  CB    . LEU A  1  174 ? 34.094  34.312  50.356  1.00 52.10  ? 174  LEU A CB    1 
ATOM   1287  C  CG    . LEU A  1  174 ? 35.287  34.964  51.059  1.00 55.28  ? 174  LEU A CG    1 
ATOM   1288  C  CD1   . LEU A  1  174 ? 36.583  34.443  50.465  1.00 54.40  ? 174  LEU A CD1   1 
ATOM   1289  C  CD2   . LEU A  1  174 ? 35.207  36.468  50.941  1.00 55.00  ? 174  LEU A CD2   1 
ATOM   1290  N  N     . GLY A  1  175 ? 30.441  34.367  50.196  1.00 51.24  ? 175  GLY A N     1 
ATOM   1291  C  CA    . GLY A  1  175 ? 29.372  33.598  49.610  1.00 53.05  ? 175  GLY A CA    1 
ATOM   1292  C  C     . GLY A  1  175 ? 28.106  34.408  49.523  1.00 53.53  ? 175  GLY A C     1 
ATOM   1293  O  O     . GLY A  1  175 ? 27.874  35.258  50.373  1.00 53.04  ? 175  GLY A O     1 
ATOM   1294  N  N     . ILE A  1  176 ? 27.280  34.147  48.513  1.00 53.67  ? 176  ILE A N     1 
ATOM   1295  C  CA    . ILE A  1  176 ? 26.045  34.891  48.343  1.00 52.92  ? 176  ILE A CA    1 
ATOM   1296  C  C     . ILE A  1  176 ? 25.120  34.936  49.558  1.00 54.07  ? 176  ILE A C     1 
ATOM   1297  O  O     . ILE A  1  176 ? 24.740  36.008  50.007  1.00 55.07  ? 176  ILE A O     1 
ATOM   1298  C  CB    . ILE A  1  176 ? 25.236  34.372  47.168  1.00 51.32  ? 176  ILE A CB    1 
ATOM   1299  C  CG1   . ILE A  1  176 ? 25.877  34.788  45.866  1.00 51.85  ? 176  ILE A CG1   1 
ATOM   1300  C  CG2   . ILE A  1  176 ? 23.880  34.977  47.178  1.00 52.87  ? 176  ILE A CG2   1 
ATOM   1301  C  CD1   . ILE A  1  176 ? 25.034  34.421  44.661  1.00 52.10  ? 176  ILE A CD1   1 
ATOM   1302  N  N     . SER A  1  177 ? 24.753  33.789  50.096  1.00 54.60  ? 177  SER A N     1 
ATOM   1303  C  CA    . SER A  1  177 ? 23.834  33.767  51.223  1.00 54.60  ? 177  SER A CA    1 
ATOM   1304  C  C     . SER A  1  177 ? 24.431  34.193  52.567  1.00 54.20  ? 177  SER A C     1 
ATOM   1305  O  O     . SER A  1  177 ? 23.753  34.769  53.415  1.00 52.74  ? 177  SER A O     1 
ATOM   1306  C  CB    . SER A  1  177 ? 23.225  32.379  51.330  1.00 55.66  ? 177  SER A CB    1 
ATOM   1307  O  OG    . SER A  1  177 ? 21.883  32.470  51.761  1.00 59.27  ? 177  SER A OG    1 
ATOM   1308  N  N     . GLY A  1  178 ? 25.702  33.902  52.759  1.00 54.40  ? 178  GLY A N     1 
ATOM   1309  C  CA    . GLY A  1  178 ? 26.358  34.270  53.997  1.00 54.44  ? 178  GLY A CA    1 
ATOM   1310  C  C     . GLY A  1  178 ? 26.602  35.755  54.016  1.00 54.72  ? 178  GLY A C     1 
ATOM   1311  O  O     . GLY A  1  178 ? 26.998  36.320  55.026  1.00 54.79  ? 178  GLY A O     1 
ATOM   1312  N  N     . THR A  1  179 ? 26.394  36.390  52.877  1.00 55.29  ? 179  THR A N     1 
ATOM   1313  C  CA    . THR A  1  179 ? 26.553  37.831  52.802  1.00 55.20  ? 179  THR A CA    1 
ATOM   1314  C  C     . THR A  1  179 ? 25.270  38.394  53.411  1.00 54.69  ? 179  THR A C     1 
ATOM   1315  O  O     . THR A  1  179 ? 25.300  39.395  54.118  1.00 54.66  ? 179  THR A O     1 
ATOM   1316  C  CB    . THR A  1  179 ? 26.697  38.300  51.357  1.00 56.39  ? 179  THR A CB    1 
ATOM   1317  O  OG1   . THR A  1  179 ? 27.955  37.875  50.848  1.00 57.94  ? 179  THR A OG1   1 
ATOM   1318  C  CG2   . THR A  1  179 ? 26.651  39.773  51.279  1.00 56.70  ? 179  THR A CG2   1 
ATOM   1319  N  N     . PHE A  1  180 ? 24.150  37.734  53.134  1.00 51.73  ? 180  PHE A N     1 
ATOM   1320  C  CA    . PHE A  1  180 ? 22.878  38.157  53.673  1.00 47.40  ? 180  PHE A CA    1 
ATOM   1321  C  C     . PHE A  1  180 ? 22.939  37.911  55.159  1.00 47.14  ? 180  PHE A C     1 
ATOM   1322  O  O     . PHE A  1  180 ? 22.336  38.631  55.939  1.00 48.36  ? 180  PHE A O     1 
ATOM   1323  C  CB    . PHE A  1  180 ? 21.753  37.345  53.068  1.00 43.85  ? 180  PHE A CB    1 
ATOM   1324  C  CG    . PHE A  1  180 ? 21.658  37.458  51.596  1.00 40.21  ? 180  PHE A CG    1 
ATOM   1325  C  CD1   . PHE A  1  180 ? 21.167  36.416  50.853  1.00 39.01  ? 180  PHE A CD1   1 
ATOM   1326  C  CD2   . PHE A  1  180 ? 22.034  38.609  50.952  1.00 40.27  ? 180  PHE A CD2   1 
ATOM   1327  C  CE1   . PHE A  1  180 ? 21.053  36.515  49.487  1.00 40.07  ? 180  PHE A CE1   1 
ATOM   1328  C  CE2   . PHE A  1  180 ? 21.919  38.718  49.579  1.00 43.02  ? 180  PHE A CE2   1 
ATOM   1329  C  CZ    . PHE A  1  180 ? 21.430  37.669  48.848  1.00 40.64  ? 180  PHE A CZ    1 
ATOM   1330  N  N     . ASN A  1  181 ? 23.664  36.884  55.555  1.00 46.03  ? 181  ASN A N     1 
ATOM   1331  C  CA    . ASN A  1  181 ? 23.769  36.586  56.970  1.00 46.79  ? 181  ASN A CA    1 
ATOM   1332  C  C     . ASN A  1  181 ? 24.483  37.738  57.651  1.00 47.12  ? 181  ASN A C     1 
ATOM   1333  O  O     . ASN A  1  181 ? 23.986  38.287  58.631  1.00 46.76  ? 181  ASN A O     1 
ATOM   1334  C  CB    . ASN A  1  181 ? 24.540  35.279  57.199  1.00 47.14  ? 181  ASN A CB    1 
ATOM   1335  C  CG    . ASN A  1  181 ? 24.684  34.936  58.667  1.00 47.65  ? 181  ASN A CG    1 
ATOM   1336  O  OD1   . ASN A  1  181 ? 25.688  35.248  59.306  1.00 48.14  ? 181  ASN A OD1   1 
ATOM   1337  N  ND2   . ASN A  1  181 ? 23.674  34.294  59.211  1.00 48.09  ? 181  ASN A ND2   1 
ATOM   1338  N  N     . PHE A  1  182 ? 25.637  38.114  57.116  1.00 45.87  ? 182  PHE A N     1 
ATOM   1339  C  CA    . PHE A  1  182 ? 26.432  39.184  57.689  1.00 43.90  ? 182  PHE A CA    1 
ATOM   1340  C  C     . PHE A  1  182 ? 25.559  40.384  57.947  1.00 44.44  ? 182  PHE A C     1 
ATOM   1341  O  O     . PHE A  1  182 ? 25.660  40.994  58.998  1.00 43.86  ? 182  PHE A O     1 
ATOM   1342  C  CB    . PHE A  1  182 ? 27.572  39.552  56.741  1.00 42.45  ? 182  PHE A CB    1 
ATOM   1343  C  CG    . PHE A  1  182 ? 28.425  40.716  57.211  1.00 41.07  ? 182  PHE A CG    1 
ATOM   1344  C  CD1   . PHE A  1  182 ? 29.257  40.602  58.316  1.00 38.91  ? 182  PHE A CD1   1 
ATOM   1345  C  CD2   . PHE A  1  182 ? 28.424  41.912  56.511  1.00 40.40  ? 182  PHE A CD2   1 
ATOM   1346  C  CE1   . PHE A  1  182 ? 30.069  41.656  58.704  1.00 38.19  ? 182  PHE A CE1   1 
ATOM   1347  C  CE2   . PHE A  1  182 ? 29.228  42.957  56.898  1.00 40.87  ? 182  PHE A CE2   1 
ATOM   1348  C  CZ    . PHE A  1  182 ? 30.051  42.827  57.994  1.00 39.92  ? 182  PHE A CZ    1 
ATOM   1349  N  N     . MET A  1  183 ? 24.687  40.700  56.991  1.00 45.04  ? 183  MET A N     1 
ATOM   1350  C  CA    . MET A  1  183 ? 23.803  41.849  57.091  1.00 46.36  ? 183  MET A CA    1 
ATOM   1351  C  C     . MET A  1  183 ? 22.722  41.702  58.139  1.00 46.58  ? 183  MET A C     1 
ATOM   1352  O  O     . MET A  1  183 ? 22.679  42.485  59.081  1.00 47.67  ? 183  MET A O     1 
ATOM   1353  C  CB    . MET A  1  183 ? 23.153  42.132  55.744  1.00 48.63  ? 183  MET A CB    1 
ATOM   1354  C  CG    . MET A  1  183 ? 24.097  42.605  54.680  1.00 50.06  ? 183  MET A CG    1 
ATOM   1355  S  SD    . MET A  1  183 ? 23.352  42.625  53.039  1.00 51.94  ? 183  MET A SD    1 
ATOM   1356  C  CE    . MET A  1  183 ? 22.607  44.126  53.015  1.00 52.82  ? 183  MET A CE    1 
ATOM   1357  N  N     . ILE A  1  184 ? 21.857  40.704  57.987  1.00 44.78  ? 184  ILE A N     1 
ATOM   1358  C  CA    . ILE A  1  184 ? 20.764  40.505  58.923  1.00 44.50  ? 184  ILE A CA    1 
ATOM   1359  C  C     . ILE A  1  184 ? 21.218  40.498  60.366  1.00 45.88  ? 184  ILE A C     1 
ATOM   1360  O  O     . ILE A  1  184 ? 20.488  40.900  61.258  1.00 46.11  ? 184  ILE A O     1 
ATOM   1361  C  CB    . ILE A  1  184 ? 20.000  39.226  58.624  1.00 42.54  ? 184  ILE A CB    1 
ATOM   1362  C  CG1   . ILE A  1  184 ? 19.443  39.289  57.213  1.00 43.48  ? 184  ILE A CG1   1 
ATOM   1363  C  CG2   . ILE A  1  184 ? 18.849  39.079  59.572  1.00 41.68  ? 184  ILE A CG2   1 
ATOM   1364  C  CD1   . ILE A  1  184 ? 18.492  38.188  56.877  1.00 42.77  ? 184  ILE A CD1   1 
ATOM   1365  N  N     . VAL A  1  185 ? 22.435  40.067  60.601  1.00 46.94  ? 185  VAL A N     1 
ATOM   1366  C  CA    . VAL A  1  185 ? 22.936  40.047  61.960  1.00 49.13  ? 185  VAL A CA    1 
ATOM   1367  C  C     . VAL A  1  185 ? 23.488  41.401  62.351  1.00 49.69  ? 185  VAL A C     1 
ATOM   1368  O  O     . VAL A  1  185 ? 23.227  41.900  63.438  1.00 48.80  ? 185  VAL A O     1 
ATOM   1369  C  CB    . VAL A  1  185 ? 24.046  39.012  62.129  1.00 49.65  ? 185  VAL A CB    1 
ATOM   1370  C  CG1   . VAL A  1  185 ? 24.697  39.178  63.484  1.00 48.40  ? 185  VAL A CG1   1 
ATOM   1371  C  CG2   . VAL A  1  185 ? 23.480  37.612  61.957  1.00 48.22  ? 185  VAL A CG2   1 
ATOM   1372  N  N     . PHE A  1  186 ? 24.274  41.977  61.458  1.00 51.41  ? 186  PHE A N     1 
ATOM   1373  C  CA    . PHE A  1  186 ? 24.894  43.273  61.687  1.00 53.59  ? 186  PHE A CA    1 
ATOM   1374  C  C     . PHE A  1  186 ? 23.814  44.197  62.180  1.00 54.60  ? 186  PHE A C     1 
ATOM   1375  O  O     . PHE A  1  186 ? 23.990  44.876  63.191  1.00 54.97  ? 186  PHE A O     1 
ATOM   1376  C  CB    . PHE A  1  186 ? 25.460  43.827  60.390  1.00 53.28  ? 186  PHE A CB    1 
ATOM   1377  C  CG    . PHE A  1  186 ? 26.522  44.846  60.579  1.00 54.39  ? 186  PHE A CG    1 
ATOM   1378  C  CD1   . PHE A  1  186 ? 27.853  44.492  60.512  1.00 56.02  ? 186  PHE A CD1   1 
ATOM   1379  C  CD2   . PHE A  1  186 ? 26.190  46.164  60.777  1.00 55.65  ? 186  PHE A CD2   1 
ATOM   1380  C  CE1   . PHE A  1  186 ? 28.840  45.437  60.633  1.00 56.92  ? 186  PHE A CE1   1 
ATOM   1381  C  CE2   . PHE A  1  186 ? 27.167  47.129  60.903  1.00 57.21  ? 186  PHE A CE2   1 
ATOM   1382  C  CZ    . PHE A  1  186 ? 28.496  46.765  60.830  1.00 57.47  ? 186  PHE A CZ    1 
ATOM   1383  N  N     . GLN A  1  187 ? 22.691  44.214  61.469  1.00 54.27  ? 187  GLN A N     1 
ATOM   1384  C  CA    . GLN A  1  187 ? 21.570  45.074  61.841  1.00 54.20  ? 187  GLN A CA    1 
ATOM   1385  C  C     . GLN A  1  187 ? 21.256  44.913  63.298  1.00 55.25  ? 187  GLN A C     1 
ATOM   1386  O  O     . GLN A  1  187 ? 21.392  45.845  64.077  1.00 54.77  ? 187  GLN A O     1 
ATOM   1387  C  CB    . GLN A  1  187 ? 20.325  44.733  61.022  1.00 52.96  ? 187  GLN A CB    1 
ATOM   1388  C  CG    . GLN A  1  187 ? 19.030  45.346  61.518  1.00 50.56  ? 187  GLN A CG    1 
ATOM   1389  C  CD    . GLN A  1  187 ? 19.041  46.848  61.507  1.00 50.23  ? 187  GLN A CD    1 
ATOM   1390  O  OE1   . GLN A  1  187 ? 19.319  47.455  60.498  1.00 51.43  ? 187  GLN A OE1   1 
ATOM   1391  N  NE2   . GLN A  1  187 ? 18.726  47.454  62.630  1.00 46.89  ? 187  GLN A NE2   1 
ATOM   1392  N  N     . ALA A  1  188 ? 20.841  43.713  63.668  1.00 56.29  ? 188  ALA A N     1 
ATOM   1393  C  CA    . ALA A  1  188 ? 20.488  43.444  65.055  1.00 56.87  ? 188  ALA A CA    1 
ATOM   1394  C  C     . ALA A  1  188 ? 21.560  43.831  66.056  1.00 56.22  ? 188  ALA A C     1 
ATOM   1395  O  O     . ALA A  1  188 ? 21.250  44.137  67.198  1.00 56.48  ? 188  ALA A O     1 
ATOM   1396  C  CB    . ALA A  1  188 ? 20.136  41.985  65.217  1.00 57.66  ? 188  ALA A CB    1 
ATOM   1397  N  N     . GLU A  1  189 ? 22.815  43.835  65.638  1.00 55.95  ? 189  GLU A N     1 
ATOM   1398  C  CA    . GLU A  1  189 ? 23.884  44.168  66.565  1.00 56.43  ? 189  GLU A CA    1 
ATOM   1399  C  C     . GLU A  1  189 ? 24.292  45.623  66.581  1.00 54.99  ? 189  GLU A C     1 
ATOM   1400  O  O     . GLU A  1  189 ? 24.834  46.089  67.568  1.00 54.83  ? 189  GLU A O     1 
ATOM   1401  C  CB    . GLU A  1  189 ? 25.119  43.289  66.306  1.00 59.17  ? 189  GLU A CB    1 
ATOM   1402  C  CG    . GLU A  1  189 ? 24.850  41.764  66.407  1.00 64.04  ? 189  GLU A CG    1 
ATOM   1403  C  CD    . GLU A  1  189 ? 26.104  40.910  66.687  1.00 65.98  ? 189  GLU A CD    1 
ATOM   1404  O  OE1   . GLU A  1  189 ? 27.159  41.162  66.048  1.00 67.53  ? 189  GLU A OE1   1 
ATOM   1405  O  OE2   . GLU A  1  189 ? 26.020  39.974  67.533  1.00 65.76  ? 189  GLU A OE2   1 
ATOM   1406  N  N     . HIS A  1  190 ? 24.019  46.344  65.501  1.00 53.16  ? 190  HIS A N     1 
ATOM   1407  C  CA    . HIS A  1  190 ? 24.390  47.754  65.409  1.00 52.20  ? 190  HIS A CA    1 
ATOM   1408  C  C     . HIS A  1  190 ? 23.275  48.696  64.960  1.00 51.15  ? 190  HIS A C     1 
ATOM   1409  O  O     . HIS A  1  190 ? 23.450  49.908  64.930  1.00 50.81  ? 190  HIS A O     1 
ATOM   1410  C  CB    . HIS A  1  190 ? 25.566  47.900  64.452  1.00 53.32  ? 190  HIS A CB    1 
ATOM   1411  C  CG    . HIS A  1  190 ? 26.792  47.144  64.869  1.00 54.34  ? 190  HIS A CG    1 
ATOM   1412  N  ND1   . HIS A  1  190 ? 27.655  47.604  65.838  1.00 54.21  ? 190  HIS A ND1   1 
ATOM   1413  C  CD2   . HIS A  1  190 ? 27.307  45.969  64.435  1.00 53.85  ? 190  HIS A CD2   1 
ATOM   1414  C  CE1   . HIS A  1  190 ? 28.648  46.746  65.982  1.00 54.34  ? 190  HIS A CE1   1 
ATOM   1415  N  NE2   . HIS A  1  190 ? 28.461  45.746  65.143  1.00 53.03  ? 190  HIS A NE2   1 
ATOM   1416  N  N     . ASN A  1  191 ? 22.131  48.136  64.617  1.00 50.24  ? 191  ASN A N     1 
ATOM   1417  C  CA    . ASN A  1  191 ? 21.012  48.930  64.145  1.00 48.77  ? 191  ASN A CA    1 
ATOM   1418  C  C     . ASN A  1  191 ? 21.547  49.884  63.078  1.00 48.89  ? 191  ASN A C     1 
ATOM   1419  O  O     . ASN A  1  191 ? 21.304  51.080  63.120  1.00 50.01  ? 191  ASN A O     1 
ATOM   1420  C  CB    . ASN A  1  191 ? 20.398  49.700  65.306  1.00 47.79  ? 191  ASN A CB    1 
ATOM   1421  C  CG    . ASN A  1  191 ? 19.048  50.290  64.962  1.00 48.26  ? 191  ASN A CG    1 
ATOM   1422  O  OD1   . ASN A  1  191 ? 18.196  49.621  64.399  1.00 47.04  ? 191  ASN A OD1   1 
ATOM   1423  N  ND2   . ASN A  1  191 ? 18.850  51.546  65.309  1.00 47.80  ? 191  ASN A ND2   1 
ATOM   1424  N  N     . ILE A  1  192 ? 22.262  49.331  62.109  1.00 47.31  ? 192  ILE A N     1 
ATOM   1425  C  CA    . ILE A  1  192 ? 22.860  50.095  61.030  1.00 45.85  ? 192  ILE A CA    1 
ATOM   1426  C  C     . ILE A  1  192 ? 21.910  50.965  60.199  1.00 47.69  ? 192  ILE A C     1 
ATOM   1427  O  O     . ILE A  1  192 ? 22.216  52.125  59.931  1.00 49.78  ? 192  ILE A O     1 
ATOM   1428  C  CB    . ILE A  1  192 ? 23.635  49.167  60.105  1.00 44.00  ? 192  ILE A CB    1 
ATOM   1429  C  CG1   . ILE A  1  192 ? 24.461  49.973  59.110  1.00 43.63  ? 192  ILE A CG1   1 
ATOM   1430  C  CG2   . ILE A  1  192 ? 22.682  48.268  59.401  1.00 40.77  ? 192  ILE A CG2   1 
ATOM   1431  C  CD1   . ILE A  1  192 ? 25.563  49.193  58.523  1.00 45.21  ? 192  ILE A CD1   1 
ATOM   1432  N  N     . LEU A  1  193 ? 20.776  50.423  59.776  1.00 47.38  ? 193  LEU A N     1 
ATOM   1433  C  CA    . LEU A  1  193 ? 19.811  51.203  59.005  1.00 44.99  ? 193  LEU A CA    1 
ATOM   1434  C  C     . LEU A  1  193 ? 19.588  52.549  59.687  1.00 45.59  ? 193  LEU A C     1 
ATOM   1435  O  O     . LEU A  1  193 ? 19.209  53.516  59.044  1.00 47.65  ? 193  LEU A O     1 
ATOM   1436  C  CB    . LEU A  1  193 ? 18.475  50.471  58.923  1.00 40.40  ? 193  LEU A CB    1 
ATOM   1437  C  CG    . LEU A  1  193 ? 18.359  49.174  58.144  1.00 38.12  ? 193  LEU A CG    1 
ATOM   1438  C  CD1   . LEU A  1  193 ? 17.072  48.480  58.480  1.00 35.10  ? 193  LEU A CD1   1 
ATOM   1439  C  CD2   . LEU A  1  193 ? 18.422  49.482  56.696  1.00 35.50  ? 193  LEU A CD2   1 
ATOM   1440  N  N     . MET A  1  194 ? 19.830  52.611  60.985  1.00 44.58  ? 194  MET A N     1 
ATOM   1441  C  CA    . MET A  1  194 ? 19.640  53.842  61.731  1.00 45.80  ? 194  MET A CA    1 
ATOM   1442  C  C     . MET A  1  194 ? 20.915  54.636  61.968  1.00 46.24  ? 194  MET A C     1 
ATOM   1443  O  O     . MET A  1  194 ? 20.991  55.420  62.913  1.00 44.63  ? 194  MET A O     1 
ATOM   1444  C  CB    . MET A  1  194 ? 18.988  53.526  63.073  1.00 47.17  ? 194  MET A CB    1 
ATOM   1445  C  CG    . MET A  1  194 ? 17.509  53.216  62.983  1.00 49.59  ? 194  MET A CG    1 
ATOM   1446  S  SD    . MET A  1  194 ? 16.500  54.630  62.446  1.00 52.73  ? 194  MET A SD    1 
ATOM   1447  C  CE    . MET A  1  194 ? 16.275  55.439  64.010  1.00 50.57  ? 194  MET A CE    1 
ATOM   1448  N  N     . HIS A  1  195 ? 21.911  54.440  61.108  1.00 46.49  ? 195  HIS A N     1 
ATOM   1449  C  CA    . HIS A  1  195 ? 23.190  55.126  61.254  1.00 47.00  ? 195  HIS A CA    1 
ATOM   1450  C  C     . HIS A  1  195 ? 23.422  56.055  60.080  1.00 47.64  ? 195  HIS A C     1 
ATOM   1451  O  O     . HIS A  1  195 ? 23.380  55.636  58.929  1.00 48.05  ? 195  HIS A O     1 
ATOM   1452  C  CB    . HIS A  1  195 ? 24.330  54.101  61.361  1.00 47.32  ? 195  HIS A CB    1 
ATOM   1453  C  CG    . HIS A  1  195 ? 25.640  54.678  61.808  1.00 49.09  ? 195  HIS A CG    1 
ATOM   1454  N  ND1   . HIS A  1  195 ? 26.348  55.584  61.053  1.00 49.32  ? 195  HIS A ND1   1 
ATOM   1455  C  CD2   . HIS A  1  195 ? 26.371  54.468  62.929  1.00 49.54  ? 195  HIS A CD2   1 
ATOM   1456  C  CE1   . HIS A  1  195 ? 27.457  55.909  61.690  1.00 51.26  ? 195  HIS A CE1   1 
ATOM   1457  N  NE2   . HIS A  1  195 ? 27.496  55.247  62.831  1.00 50.77  ? 195  HIS A NE2   1 
ATOM   1458  N  N     . PRO A  1  196 ? 23.679  57.342  60.361  1.00 48.27  ? 196  PRO A N     1 
ATOM   1459  C  CA    . PRO A  1  196 ? 23.917  58.353  59.329  1.00 47.77  ? 196  PRO A CA    1 
ATOM   1460  C  C     . PRO A  1  196 ? 24.776  57.880  58.163  1.00 49.22  ? 196  PRO A C     1 
ATOM   1461  O  O     . PRO A  1  196 ? 24.406  58.061  56.993  1.00 48.48  ? 196  PRO A O     1 
ATOM   1462  C  CB    . PRO A  1  196 ? 24.580  59.471  60.107  1.00 47.90  ? 196  PRO A CB    1 
ATOM   1463  C  CG    . PRO A  1  196 ? 23.896  59.373  61.410  1.00 47.51  ? 196  PRO A CG    1 
ATOM   1464  C  CD    . PRO A  1  196 ? 23.928  57.913  61.695  1.00 46.92  ? 196  PRO A CD    1 
ATOM   1465  N  N     . PHE A  1  197 ? 25.916  57.267  58.487  1.00 50.22  ? 197  PHE A N     1 
ATOM   1466  C  CA    . PHE A  1  197 ? 26.844  56.783  57.462  1.00 49.14  ? 197  PHE A CA    1 
ATOM   1467  C  C     . PHE A  1  197 ? 26.268  55.789  56.442  1.00 48.88  ? 197  PHE A C     1 
ATOM   1468  O  O     . PHE A  1  197 ? 26.731  55.768  55.293  1.00 47.92  ? 197  PHE A O     1 
ATOM   1469  C  CB    . PHE A  1  197 ? 28.111  56.216  58.116  1.00 48.09  ? 197  PHE A CB    1 
ATOM   1470  C  CG    . PHE A  1  197 ? 29.076  57.274  58.607  1.00 47.82  ? 197  PHE A CG    1 
ATOM   1471  C  CD1   . PHE A  1  197 ? 28.808  58.622  58.443  1.00 47.52  ? 197  PHE A CD1   1 
ATOM   1472  C  CD2   . PHE A  1  197 ? 30.232  56.910  59.283  1.00 49.11  ? 197  PHE A CD2   1 
ATOM   1473  C  CE1   . PHE A  1  197 ? 29.665  59.577  58.947  1.00 49.52  ? 197  PHE A CE1   1 
ATOM   1474  C  CE2   . PHE A  1  197 ? 31.092  57.866  59.793  1.00 49.23  ? 197  PHE A CE2   1 
ATOM   1475  C  CZ    . PHE A  1  197 ? 30.808  59.197  59.626  1.00 49.70  ? 197  PHE A CZ    1 
ATOM   1476  N  N     . HIS A  1  198 ? 25.270  54.990  56.839  1.00 47.76  ? 198  HIS A N     1 
ATOM   1477  C  CA    . HIS A  1  198 ? 24.666  54.035  55.918  1.00 47.95  ? 198  HIS A CA    1 
ATOM   1478  C  C     . HIS A  1  198 ? 23.677  54.792  55.063  1.00 48.72  ? 198  HIS A C     1 
ATOM   1479  O  O     . HIS A  1  198 ? 23.604  54.562  53.856  1.00 49.60  ? 198  HIS A O     1 
ATOM   1480  C  CB    . HIS A  1  198 ? 23.960  52.889  56.660  1.00 47.24  ? 198  HIS A CB    1 
ATOM   1481  C  CG    . HIS A  1  198 ? 23.446  51.796  55.761  1.00 47.83  ? 198  HIS A CG    1 
ATOM   1482  N  ND1   . HIS A  1  198 ? 22.234  51.868  55.102  1.00 47.67  ? 198  HIS A ND1   1 
ATOM   1483  C  CD2   . HIS A  1  198 ? 23.994  50.612  55.394  1.00 47.88  ? 198  HIS A CD2   1 
ATOM   1484  C  CE1   . HIS A  1  198 ? 22.060  50.783  54.369  1.00 45.03  ? 198  HIS A CE1   1 
ATOM   1485  N  NE2   . HIS A  1  198 ? 23.113  50.004  54.526  1.00 45.21  ? 198  HIS A NE2   1 
ATOM   1486  N  N     . GLN A  1  199 ? 22.929  55.711  55.671  1.00 49.19  ? 199  GLN A N     1 
ATOM   1487  C  CA    . GLN A  1  199 ? 21.950  56.485  54.917  1.00 48.93  ? 199  GLN A CA    1 
ATOM   1488  C  C     . GLN A  1  199 ? 22.649  57.279  53.837  1.00 47.64  ? 199  GLN A C     1 
ATOM   1489  O  O     . GLN A  1  199 ? 22.117  57.490  52.764  1.00 45.69  ? 199  GLN A O     1 
ATOM   1490  C  CB    . GLN A  1  199 ? 21.197  57.405  55.839  1.00 51.08  ? 199  GLN A CB    1 
ATOM   1491  C  CG    . GLN A  1  199 ? 20.472  56.677  56.923  1.00 54.97  ? 199  GLN A CG    1 
ATOM   1492  C  CD    . GLN A  1  199 ? 20.133  57.594  58.076  1.00 57.77  ? 199  GLN A CD    1 
ATOM   1493  O  OE1   . GLN A  1  199 ? 20.986  58.318  58.580  1.00 58.69  ? 199  GLN A OE1   1 
ATOM   1494  N  NE2   . GLN A  1  199 ? 18.889  57.565  58.503  1.00 60.34  ? 199  GLN A NE2   1 
ATOM   1495  N  N     . LEU A  1  200 ? 23.852  57.721  54.129  1.00 47.16  ? 200  LEU A N     1 
ATOM   1496  C  CA    . LEU A  1  200 ? 24.613  58.429  53.128  1.00 47.88  ? 200  LEU A CA    1 
ATOM   1497  C  C     . LEU A  1  200 ? 25.103  57.388  52.121  1.00 48.25  ? 200  LEU A C     1 
ATOM   1498  O  O     . LEU A  1  200 ? 25.293  57.685  50.944  1.00 48.83  ? 200  LEU A O     1 
ATOM   1499  C  CB    . LEU A  1  200 ? 25.797  59.163  53.760  1.00 46.97  ? 200  LEU A CB    1 
ATOM   1500  C  CG    . LEU A  1  200 ? 25.462  60.423  54.538  1.00 46.64  ? 200  LEU A CG    1 
ATOM   1501  C  CD1   . LEU A  1  200 ? 26.732  61.051  55.035  1.00 46.53  ? 200  LEU A CD1   1 
ATOM   1502  C  CD2   . LEU A  1  200 ? 24.716  61.382  53.640  1.00 45.63  ? 200  LEU A CD2   1 
ATOM   1503  N  N     . GLY A  1  201 ? 25.314  56.167  52.591  1.00 47.88  ? 201  GLY A N     1 
ATOM   1504  C  CA    . GLY A  1  201 ? 25.746  55.111  51.698  1.00 48.00  ? 201  GLY A CA    1 
ATOM   1505  C  C     . GLY A  1  201 ? 24.634  54.886  50.694  1.00 49.00  ? 201  GLY A C     1 
ATOM   1506  O  O     . GLY A  1  201 ? 24.887  54.803  49.508  1.00 49.49  ? 201  GLY A O     1 
ATOM   1507  N  N     . VAL A  1  202 ? 23.396  54.794  51.174  1.00 49.27  ? 202  VAL A N     1 
ATOM   1508  C  CA    . VAL A  1  202 ? 22.230  54.588  50.316  1.00 48.71  ? 202  VAL A CA    1 
ATOM   1509  C  C     . VAL A  1  202 ? 21.982  55.782  49.393  1.00 50.06  ? 202  VAL A C     1 
ATOM   1510  O  O     . VAL A  1  202 ? 21.638  55.613  48.229  1.00 50.83  ? 202  VAL A O     1 
ATOM   1511  C  CB    . VAL A  1  202 ? 20.959  54.357  51.137  1.00 46.94  ? 202  VAL A CB    1 
ATOM   1512  C  CG1   . VAL A  1  202 ? 19.825  54.010  50.244  1.00 44.55  ? 202  VAL A CG1   1 
ATOM   1513  C  CG2   . VAL A  1  202 ? 21.178  53.270  52.114  1.00 46.73  ? 202  VAL A CG2   1 
ATOM   1514  N  N     . ALA A  1  203 ? 22.130  56.994  49.907  1.00 50.51  ? 203  ALA A N     1 
ATOM   1515  C  CA    . ALA A  1  203 ? 21.913  58.166  49.059  1.00 51.84  ? 203  ALA A CA    1 
ATOM   1516  C  C     . ALA A  1  203 ? 22.939  58.103  47.932  1.00 51.41  ? 203  ALA A C     1 
ATOM   1517  O  O     . ALA A  1  203 ? 22.664  58.499  46.796  1.00 50.92  ? 203  ALA A O     1 
ATOM   1518  C  CB    . ALA A  1  203 ? 22.084  59.461  49.872  1.00 51.57  ? 203  ALA A CB    1 
ATOM   1519  N  N     . GLY A  1  204 ? 24.120  57.591  48.266  1.00 50.35  ? 204  GLY A N     1 
ATOM   1520  C  CA    . GLY A  1  204 ? 25.185  57.483  47.299  1.00 50.88  ? 204  GLY A CA    1 
ATOM   1521  C  C     . GLY A  1  204 ? 24.874  56.447  46.246  1.00 52.52  ? 204  GLY A C     1 
ATOM   1522  O  O     . GLY A  1  204 ? 24.832  56.741  45.059  1.00 54.13  ? 204  GLY A O     1 
ATOM   1523  N  N     . VAL A  1  205 ? 24.651  55.224  46.690  1.00 53.52  ? 205  VAL A N     1 
ATOM   1524  C  CA    . VAL A  1  205 ? 24.352  54.113  45.805  1.00 54.24  ? 205  VAL A CA    1 
ATOM   1525  C  C     . VAL A  1  205 ? 23.021  54.287  45.081  1.00 55.44  ? 205  VAL A C     1 
ATOM   1526  O  O     . VAL A  1  205 ? 22.900  53.952  43.916  1.00 55.70  ? 205  VAL A O     1 
ATOM   1527  C  CB    . VAL A  1  205 ? 24.375  52.800  46.616  1.00 54.78  ? 205  VAL A CB    1 
ATOM   1528  C  CG1   . VAL A  1  205 ? 23.744  51.681  45.837  1.00 56.24  ? 205  VAL A CG1   1 
ATOM   1529  C  CG2   . VAL A  1  205 ? 25.803  52.451  46.950  1.00 54.62  ? 205  VAL A CG2   1 
ATOM   1530  N  N     . PHE A  1  206 ? 22.027  54.811  45.774  1.00 56.56  ? 206  PHE A N     1 
ATOM   1531  C  CA    . PHE A  1  206 ? 20.720  55.038  45.180  1.00 57.24  ? 206  PHE A CA    1 
ATOM   1532  C  C     . PHE A  1  206 ? 20.881  56.222  44.252  1.00 57.30  ? 206  PHE A C     1 
ATOM   1533  O  O     . PHE A  1  206 ? 20.459  56.169  43.106  1.00 56.88  ? 206  PHE A O     1 
ATOM   1534  C  CB    . PHE A  1  206 ? 19.681  55.374  46.265  1.00 58.32  ? 206  PHE A CB    1 
ATOM   1535  C  CG    . PHE A  1  206 ? 18.632  54.304  46.473  1.00 59.59  ? 206  PHE A CG    1 
ATOM   1536  C  CD1   . PHE A  1  206 ? 17.839  54.302  47.624  1.00 57.31  ? 206  PHE A CD1   1 
ATOM   1537  C  CD2   . PHE A  1  206 ? 18.438  53.293  45.526  1.00 60.79  ? 206  PHE A CD2   1 
ATOM   1538  C  CE1   . PHE A  1  206 ? 16.881  53.319  47.825  1.00 58.43  ? 206  PHE A CE1   1 
ATOM   1539  C  CE2   . PHE A  1  206 ? 17.470  52.299  45.730  1.00 59.84  ? 206  PHE A CE2   1 
ATOM   1540  C  CZ    . PHE A  1  206 ? 16.695  52.314  46.878  1.00 59.46  ? 206  PHE A CZ    1 
ATOM   1541  N  N     . GLY A  1  207 ? 21.495  57.288  44.762  1.00 57.16  ? 207  GLY A N     1 
ATOM   1542  C  CA    . GLY A  1  207 ? 21.713  58.495  43.982  1.00 57.50  ? 207  GLY A CA    1 
ATOM   1543  C  C     . GLY A  1  207 ? 22.513  58.221  42.725  1.00 59.04  ? 207  GLY A C     1 
ATOM   1544  O  O     . GLY A  1  207 ? 22.098  58.558  41.599  1.00 57.69  ? 207  GLY A O     1 
ATOM   1545  N  N     . GLY A  1  208 ? 23.680  57.611  42.938  1.00 60.25  ? 208  GLY A N     1 
ATOM   1546  C  CA    . GLY A  1  208 ? 24.560  57.224  41.839  1.00 59.38  ? 208  GLY A CA    1 
ATOM   1547  C  C     . GLY A  1  208 ? 23.758  56.644  40.690  1.00 58.84  ? 208  GLY A C     1 
ATOM   1548  O  O     . GLY A  1  208 ? 23.821  57.163  39.586  1.00 58.96  ? 208  GLY A O     1 
ATOM   1549  N  N     . ALA A  1  209 ? 23.006  55.574  40.946  1.00 57.84  ? 209  ALA A N     1 
ATOM   1550  C  CA    . ALA A  1  209 ? 22.160  54.951  39.919  1.00 56.71  ? 209  ALA A CA    1 
ATOM   1551  C  C     . ALA A  1  209 ? 21.261  55.991  39.267  1.00 55.68  ? 209  ALA A C     1 
ATOM   1552  O  O     . ALA A  1  209 ? 21.213  56.083  38.056  1.00 54.55  ? 209  ALA A O     1 
ATOM   1553  C  CB    . ALA A  1  209 ? 21.306  53.861  40.528  1.00 56.65  ? 209  ALA A CB    1 
ATOM   1554  N  N     . LEU A  1  210 ? 20.544  56.755  40.081  1.00 54.83  ? 210  LEU A N     1 
ATOM   1555  C  CA    . LEU A  1  210 ? 19.650  57.791  39.601  1.00 54.96  ? 210  LEU A CA    1 
ATOM   1556  C  C     . LEU A  1  210 ? 20.307  58.664  38.562  1.00 56.17  ? 210  LEU A C     1 
ATOM   1557  O  O     . LEU A  1  210 ? 19.733  58.927  37.511  1.00 55.85  ? 210  LEU A O     1 
ATOM   1558  C  CB    . LEU A  1  210 ? 19.164  58.656  40.758  1.00 53.96  ? 210  LEU A CB    1 
ATOM   1559  C  CG    . LEU A  1  210 ? 18.634  60.076  40.528  1.00 53.31  ? 210  LEU A CG    1 
ATOM   1560  C  CD1   . LEU A  1  210 ? 17.657  60.102  39.422  1.00 50.86  ? 210  LEU A CD1   1 
ATOM   1561  C  CD2   . LEU A  1  210 ? 17.978  60.584  41.797  1.00 53.47  ? 210  LEU A CD2   1 
ATOM   1562  N  N     . PHE A  1  211 ? 21.515  59.118  38.856  1.00 57.48  ? 211  PHE A N     1 
ATOM   1563  C  CA    . PHE A  1  211 ? 22.260  59.964  37.923  1.00 58.35  ? 211  PHE A CA    1 
ATOM   1564  C  C     . PHE A  1  211 ? 22.842  59.200  36.730  1.00 57.90  ? 211  PHE A C     1 
ATOM   1565  O  O     . PHE A  1  211 ? 23.011  59.753  35.657  1.00 59.00  ? 211  PHE A O     1 
ATOM   1566  C  CB    . PHE A  1  211 ? 23.373  60.687  38.671  1.00 58.83  ? 211  PHE A CB    1 
ATOM   1567  C  CG    . PHE A  1  211 ? 22.879  61.557  39.778  1.00 59.44  ? 211  PHE A CG    1 
ATOM   1568  C  CD1   . PHE A  1  211 ? 23.668  61.798  40.889  1.00 60.07  ? 211  PHE A CD1   1 
ATOM   1569  C  CD2   . PHE A  1  211 ? 21.630  62.142  39.708  1.00 60.10  ? 211  PHE A CD2   1 
ATOM   1570  C  CE1   . PHE A  1  211 ? 23.221  62.605  41.907  1.00 60.88  ? 211  PHE A CE1   1 
ATOM   1571  C  CE2   . PHE A  1  211 ? 21.172  62.953  40.727  1.00 60.78  ? 211  PHE A CE2   1 
ATOM   1572  C  CZ    . PHE A  1  211 ? 21.967  63.186  41.826  1.00 60.78  ? 211  PHE A CZ    1 
ATOM   1573  N  N     . CYS A  1  212 ? 23.161  57.934  36.925  1.00 57.12  ? 212  CYS A N     1 
ATOM   1574  C  CA    . CYS A  1  212 ? 23.693  57.115  35.851  1.00 57.00  ? 212  CYS A CA    1 
ATOM   1575  C  C     . CYS A  1  212 ? 22.640  57.008  34.746  1.00 58.05  ? 212  CYS A C     1 
ATOM   1576  O  O     . CYS A  1  212 ? 22.952  56.936  33.566  1.00 56.87  ? 212  CYS A O     1 
ATOM   1577  C  CB    . CYS A  1  212 ? 24.031  55.731  36.386  1.00 55.60  ? 212  CYS A CB    1 
ATOM   1578  S  SG    . CYS A  1  212 ? 24.591  54.656  35.098  1.00 57.59  ? 212  CYS A SG    1 
ATOM   1579  N  N     . ALA A  1  213 ? 21.386  56.988  35.169  1.00 60.12  ? 213  ALA A N     1 
ATOM   1580  C  CA    . ALA A  1  213 ? 20.250  56.912  34.272  1.00 62.19  ? 213  ALA A CA    1 
ATOM   1581  C  C     . ALA A  1  213 ? 20.092  58.287  33.634  1.00 63.22  ? 213  ALA A C     1 
ATOM   1582  O  O     . ALA A  1  213 ? 19.834  58.385  32.433  1.00 64.84  ? 213  ALA A O     1 
ATOM   1583  C  CB    . ALA A  1  213 ? 18.988  56.541  35.036  1.00 63.16  ? 213  ALA A CB    1 
ATOM   1584  N  N     . MET A  1  214 ? 20.234  59.345  34.433  1.00 62.45  ? 214  MET A N     1 
ATOM   1585  C  CA    . MET A  1  214 ? 20.131  60.699  33.897  1.00 61.81  ? 214  MET A CA    1 
ATOM   1586  C  C     . MET A  1  214 ? 21.192  60.912  32.847  1.00 60.78  ? 214  MET A C     1 
ATOM   1587  O  O     . MET A  1  214 ? 20.872  61.066  31.683  1.00 60.14  ? 214  MET A O     1 
ATOM   1588  C  CB    . MET A  1  214 ? 20.306  61.753  34.980  1.00 62.47  ? 214  MET A CB    1 
ATOM   1589  C  CG    . MET A  1  214 ? 19.066  61.970  35.815  1.00 66.85  ? 214  MET A CG    1 
ATOM   1590  S  SD    . MET A  1  214 ? 17.638  62.444  34.809  1.00 68.74  ? 214  MET A SD    1 
ATOM   1591  C  CE    . MET A  1  214 ? 17.635  64.169  35.219  1.00 69.62  ? 214  MET A CE    1 
ATOM   1592  N  N     . HIS A  1  215 ? 22.453  60.907  33.250  1.00 61.01  ? 215  HIS A N     1 
ATOM   1593  C  CA    . HIS A  1  215 ? 23.507  61.116  32.279  1.00 62.35  ? 215  HIS A CA    1 
ATOM   1594  C  C     . HIS A  1  215 ? 23.252  60.242  31.063  1.00 63.30  ? 215  HIS A C     1 
ATOM   1595  O  O     . HIS A  1  215 ? 23.034  60.749  29.963  1.00 64.34  ? 215  HIS A O     1 
ATOM   1596  C  CB    . HIS A  1  215 ? 24.908  60.821  32.841  1.00 61.89  ? 215  HIS A CB    1 
ATOM   1597  C  CG    . HIS A  1  215 ? 26.017  61.286  31.932  1.00 62.98  ? 215  HIS A CG    1 
ATOM   1598  N  ND1   . HIS A  1  215 ? 26.156  62.602  31.538  1.00 62.87  ? 215  HIS A ND1   1 
ATOM   1599  C  CD2   . HIS A  1  215 ? 26.988  60.602  31.279  1.00 64.16  ? 215  HIS A CD2   1 
ATOM   1600  C  CE1   . HIS A  1  215 ? 27.157  62.705  30.681  1.00 62.20  ? 215  HIS A CE1   1 
ATOM   1601  N  NE2   . HIS A  1  215 ? 27.679  61.507  30.506  1.00 63.29  ? 215  HIS A NE2   1 
ATOM   1602  N  N     . GLY A  1  216 ? 23.271  58.934  31.248  1.00 63.74  ? 216  GLY A N     1 
ATOM   1603  C  CA    . GLY A  1  216 ? 23.037  58.055  30.119  1.00 64.22  ? 216  GLY A CA    1 
ATOM   1604  C  C     . GLY A  1  216 ? 21.788  58.423  29.341  1.00 64.73  ? 216  GLY A C     1 
ATOM   1605  O  O     . GLY A  1  216 ? 21.772  58.341  28.111  1.00 65.86  ? 216  GLY A O     1 
ATOM   1606  N  N     . SER A  1  217 ? 20.742  58.826  30.058  1.00 65.15  ? 217  SER A N     1 
ATOM   1607  C  CA    . SER A  1  217 ? 19.468  59.215  29.442  1.00 64.84  ? 217  SER A CA    1 
ATOM   1608  C  C     . SER A  1  217 ? 19.674  60.418  28.503  1.00 65.05  ? 217  SER A C     1 
ATOM   1609  O  O     . SER A  1  217 ? 19.714  60.264  27.269  1.00 66.31  ? 217  SER A O     1 
ATOM   1610  C  CB    . SER A  1  217 ? 18.450  59.571  30.539  1.00 64.02  ? 217  SER A CB    1 
ATOM   1611  O  OG    . SER A  1  217 ? 17.201  59.989  30.015  1.00 62.25  ? 217  SER A OG    1 
ATOM   1612  N  N     . LEU A  1  218 ? 19.822  61.598  29.111  1.00 63.43  ? 218  LEU A N     1 
ATOM   1613  C  CA    . LEU A  1  218 ? 20.024  62.870  28.414  1.00 62.34  ? 218  LEU A CA    1 
ATOM   1614  C  C     . LEU A  1  218 ? 20.928  62.813  27.185  1.00 62.00  ? 218  LEU A C     1 
ATOM   1615  O  O     . LEU A  1  218 ? 20.515  63.193  26.087  1.00 60.51  ? 218  LEU A O     1 
ATOM   1616  C  CB    . LEU A  1  218 ? 20.546  63.907  29.409  1.00 61.42  ? 218  LEU A CB    1 
ATOM   1617  C  CG    . LEU A  1  218 ? 19.536  64.166  30.536  1.00 61.91  ? 218  LEU A CG    1 
ATOM   1618  C  CD1   . LEU A  1  218 ? 20.096  65.157  31.528  1.00 61.53  ? 218  LEU A CD1   1 
ATOM   1619  C  CD2   . LEU A  1  218 ? 18.219  64.681  29.943  1.00 61.74  ? 218  LEU A CD2   1 
ATOM   1620  N  N     . VAL A  1  219 ? 22.159  62.350  27.374  1.00 62.13  ? 219  VAL A N     1 
ATOM   1621  C  CA    . VAL A  1  219 ? 23.092  62.229  26.266  1.00 61.94  ? 219  VAL A CA    1 
ATOM   1622  C  C     . VAL A  1  219 ? 22.449  61.462  25.117  1.00 63.70  ? 219  VAL A C     1 
ATOM   1623  O  O     . VAL A  1  219 ? 22.400  61.953  23.988  1.00 63.99  ? 219  VAL A O     1 
ATOM   1624  C  CB    . VAL A  1  219 ? 24.372  61.490  26.696  1.00 60.75  ? 219  VAL A CB    1 
ATOM   1625  C  CG1   . VAL A  1  219 ? 25.174  61.050  25.485  1.00 58.58  ? 219  VAL A CG1   1 
ATOM   1626  C  CG2   . VAL A  1  219 ? 25.206  62.392  27.558  1.00 61.14  ? 219  VAL A CG2   1 
ATOM   1627  N  N     . THR A  1  220 ? 21.951  60.264  25.401  1.00 64.99  ? 220  THR A N     1 
ATOM   1628  C  CA    . THR A  1  220 ? 21.350  59.458  24.350  1.00 66.12  ? 220  THR A CA    1 
ATOM   1629  C  C     . THR A  1  220 ? 20.238  60.232  23.675  1.00 68.12  ? 220  THR A C     1 
ATOM   1630  O  O     . THR A  1  220 ? 20.013  60.086  22.464  1.00 68.20  ? 220  THR A O     1 
ATOM   1631  C  CB    . THR A  1  220 ? 20.795  58.124  24.892  1.00 65.83  ? 220  THR A CB    1 
ATOM   1632  O  OG1   . THR A  1  220 ? 21.887  57.308  25.323  1.00 65.50  ? 220  THR A OG1   1 
ATOM   1633  C  CG2   . THR A  1  220 ? 20.024  57.369  23.805  1.00 64.02  ? 220  THR A CG2   1 
ATOM   1634  N  N     . SER A  1  221 ? 19.565  61.075  24.454  1.00 69.33  ? 221  SER A N     1 
ATOM   1635  C  CA    . SER A  1  221 ? 18.449  61.879  23.952  1.00 70.96  ? 221  SER A CA    1 
ATOM   1636  C  C     . SER A  1  221 ? 18.839  63.039  23.026  1.00 71.51  ? 221  SER A C     1 
ATOM   1637  O  O     . SER A  1  221 ? 17.980  63.664  22.395  1.00 71.12  ? 221  SER A O     1 
ATOM   1638  C  CB    . SER A  1  221 ? 17.651  62.419  25.133  1.00 71.33  ? 221  SER A CB    1 
ATOM   1639  O  OG    . SER A  1  221 ? 17.210  61.351  25.960  1.00 72.73  ? 221  SER A OG    1 
ATOM   1640  N  N     . SER A  1  222 ? 20.133  63.312  22.932  1.00 72.08  ? 222  SER A N     1 
ATOM   1641  C  CA    . SER A  1  222 ? 20.611  64.403  22.097  1.00 71.84  ? 222  SER A CA    1 
ATOM   1642  C  C     . SER A  1  222 ? 21.753  63.997  21.168  1.00 71.61  ? 222  SER A C     1 
ATOM   1643  O  O     . SER A  1  222 ? 22.712  64.741  20.994  1.00 71.11  ? 222  SER A O     1 
ATOM   1644  C  CB    . SER A  1  222 ? 21.041  65.573  22.991  1.00 72.20  ? 222  SER A CB    1 
ATOM   1645  O  OG    . SER A  1  222 ? 22.177  65.234  23.761  1.00 73.48  ? 222  SER A OG    1 
ATOM   1646  N  N     . LEU A  1  223 ? 21.654  62.810  20.582  1.00 71.92  ? 223  LEU A N     1 
ATOM   1647  C  CA    . LEU A  1  223 ? 22.669  62.353  19.645  1.00 72.54  ? 223  LEU A CA    1 
ATOM   1648  C  C     . LEU A  1  223 ? 22.342  63.026  18.309  1.00 73.04  ? 223  LEU A C     1 
ATOM   1649  O  O     . LEU A  1  223 ? 21.165  63.208  17.965  1.00 73.25  ? 223  LEU A O     1 
ATOM   1650  C  CB    . LEU A  1  223 ? 22.617  60.831  19.472  1.00 71.92  ? 223  LEU A CB    1 
ATOM   1651  C  CG    . LEU A  1  223 ? 22.754  59.883  20.666  1.00 71.87  ? 223  LEU A CG    1 
ATOM   1652  C  CD1   . LEU A  1  223 ? 22.808  58.461  20.153  1.00 70.56  ? 223  LEU A CD1   1 
ATOM   1653  C  CD2   . LEU A  1  223 ? 24.013  60.191  21.448  1.00 71.73  ? 223  LEU A CD2   1 
ATOM   1654  N  N     . ILE A  1  224 ? 23.363  63.392  17.546  1.00 72.61  ? 224  ILE A N     1 
ATOM   1655  C  CA    . ILE A  1  224 ? 23.094  64.050  16.273  1.00 72.03  ? 224  ILE A CA    1 
ATOM   1656  C  C     . ILE A  1  224 ? 22.797  63.075  15.135  1.00 71.10  ? 224  ILE A C     1 
ATOM   1657  O  O     . ILE A  1  224 ? 23.609  62.217  14.795  1.00 68.73  ? 224  ILE A O     1 
ATOM   1658  C  CB    . ILE A  1  224 ? 24.263  64.948  15.869  1.00 73.28  ? 224  ILE A CB    1 
ATOM   1659  C  CG1   . ILE A  1  224 ? 24.824  65.671  17.115  1.00 72.24  ? 224  ILE A CG1   1 
ATOM   1660  C  CG2   . ILE A  1  224 ? 23.786  65.930  14.774  1.00 74.06  ? 224  ILE A CG2   1 
ATOM   1661  C  CD1   . ILE A  1  224 ? 26.093  66.482  16.847  1.00 71.40  ? 224  ILE A CD1   1 
ATOM   1662  N  N     . ARG A  1  225 ? 21.619  63.231  14.549  1.00 72.18  ? 225  ARG A N     1 
ATOM   1663  C  CA    . ARG A  1  225 ? 21.170  62.380  13.445  1.00 73.76  ? 225  ARG A CA    1 
ATOM   1664  C  C     . ARG A  1  225 ? 22.252  62.156  12.410  1.00 74.74  ? 225  ARG A C     1 
ATOM   1665  O  O     . ARG A  1  225 ? 22.605  63.074  11.685  1.00 75.10  ? 225  ARG A O     1 
ATOM   1666  C  CB    . ARG A  1  225 ? 19.958  63.005  12.758  1.00 74.03  ? 225  ARG A CB    1 
ATOM   1667  C  CG    . ARG A  1  225 ? 19.503  62.296  11.485  1.00 74.76  ? 225  ARG A CG    1 
ATOM   1668  C  CD    . ARG A  1  225 ? 18.468  63.143  10.732  1.00 76.03  ? 225  ARG A CD    1 
ATOM   1669  N  NE    . ARG A  1  225 ? 17.408  63.631  11.622  1.00 77.65  ? 225  ARG A NE    1 
ATOM   1670  C  CZ    . ARG A  1  225 ? 17.282  64.891  12.056  1.00 78.74  ? 225  ARG A CZ    1 
ATOM   1671  N  NH1   . ARG A  1  225 ? 18.152  65.839  11.685  1.00 78.81  ? 225  ARG A NH1   1 
ATOM   1672  N  NH2   . ARG A  1  225 ? 16.280  65.205  12.879  1.00 77.45  ? 225  ARG A NH2   1 
ATOM   1673  N  N     . GLU A  1  226 ? 22.756  60.930  12.337  1.00 75.00  ? 226  GLU A N     1 
ATOM   1674  C  CA    . GLU A  1  226 ? 23.792  60.555  11.381  1.00 75.69  ? 226  GLU A CA    1 
ATOM   1675  C  C     . GLU A  1  226 ? 23.656  59.104  10.933  1.00 76.50  ? 226  GLU A C     1 
ATOM   1676  O  O     . GLU A  1  226 ? 24.635  58.467  10.551  1.00 76.85  ? 226  GLU A O     1 
ATOM   1677  C  CB    . GLU A  1  226 ? 25.153  60.772  12.002  1.00 76.18  ? 226  GLU A CB    1 
ATOM   1678  C  CG    . GLU A  1  226 ? 25.534  62.228  12.033  1.00 77.31  ? 226  GLU A CG    1 
ATOM   1679  C  CD    . GLU A  1  226 ? 26.556  62.534  13.084  1.00 77.92  ? 226  GLU A CD    1 
ATOM   1680  O  OE1   . GLU A  1  226 ? 27.551  61.771  13.176  1.00 80.08  ? 226  GLU A OE1   1 
ATOM   1681  O  OE2   . GLU A  1  226 ? 26.369  63.535  13.808  1.00 75.00  ? 226  GLU A OE2   1 
ATOM   1682  N  N     . THR A  1  227 ? 22.428  58.591  10.966  1.00 77.30  ? 227  THR A N     1 
ATOM   1683  C  CA    . THR A  1  227 ? 22.146  57.206  10.594  1.00 76.00  ? 227  THR A CA    1 
ATOM   1684  C  C     . THR A  1  227 ? 20.723  57.086  10.034  1.00 76.53  ? 227  THR A C     1 
ATOM   1685  O  O     . THR A  1  227 ? 19.857  57.927  10.322  1.00 76.24  ? 227  THR A O     1 
ATOM   1686  C  CB    . THR A  1  227 ? 22.254  56.321  11.841  1.00 75.83  ? 227  THR A CB    1 
ATOM   1687  O  OG1   . THR A  1  227 ? 21.396  56.858  12.862  1.00 75.02  ? 227  THR A OG1   1 
ATOM   1688  C  CG2   . THR A  1  227 ? 23.681  56.298  12.371  1.00 74.08  ? 227  THR A CG2   1 
ATOM   1689  N  N     . THR A  1  228 ? 20.479  56.048  9.240   1.00 76.55  ? 228  THR A N     1 
ATOM   1690  C  CA    . THR A  1  228 ? 19.132  55.839  8.680   1.00 77.78  ? 228  THR A CA    1 
ATOM   1691  C  C     . THR A  1  228 ? 18.207  55.385  9.819   1.00 77.80  ? 228  THR A C     1 
ATOM   1692  O  O     . THR A  1  228 ? 18.591  55.422  11.007  1.00 77.29  ? 228  THR A O     1 
ATOM   1693  C  CB    . THR A  1  228 ? 19.087  54.707  7.600   1.00 77.75  ? 228  THR A CB    1 
ATOM   1694  O  OG1   . THR A  1  228 ? 19.148  53.434  8.251   1.00 77.93  ? 228  THR A OG1   1 
ATOM   1695  C  CG2   . THR A  1  228 ? 20.255  54.814  6.616   1.00 78.47  ? 228  THR A CG2   1 
ATOM   1696  N  N     . GLU A  1  229 ? 16.995  54.958  9.450   1.00 78.07  ? 229  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  229 ? 16.040  54.439  10.431  1.00 77.72  ? 229  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  229 ? 16.326  52.948  10.595  1.00 77.36  ? 229  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  229 ? 16.059  52.386  11.652  1.00 77.99  ? 229  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  229 ? 14.591  54.638  9.968   1.00 76.67  ? 229  GLU A CB    1 
ATOM   1701  N  N     . THR A  1  230 ? 16.893  52.319  9.566   1.00 77.81  ? 230  THR A N     1 
ATOM   1702  C  CA    . THR A  1  230 ? 17.195  50.878  9.617   1.00 78.30  ? 230  THR A CA    1 
ATOM   1703  C  C     . THR A  1  230 ? 18.678  50.518  9.830   1.00 77.36  ? 230  THR A C     1 
ATOM   1704  O  O     . THR A  1  230 ? 19.301  49.773  9.054   1.00 75.82  ? 230  THR A O     1 
ATOM   1705  C  CB    . THR A  1  230 ? 16.681  50.140  8.335   1.00 79.62  ? 230  THR A CB    1 
ATOM   1706  O  OG1   . THR A  1  230 ? 17.181  50.803  7.164   1.00 80.39  ? 230  THR A OG1   1 
ATOM   1707  C  CG2   . THR A  1  230 ? 15.122  50.084  8.311   1.00 79.34  ? 230  THR A CG2   1 
ATOM   1708  N  N     . GLU A  1  231 ? 19.220  51.052  10.911  1.00 77.05  ? 231  GLU A N     1 
ATOM   1709  C  CA    . GLU A  1  231 ? 20.606  50.830  11.289  1.00 76.97  ? 231  GLU A CA    1 
ATOM   1710  C  C     . GLU A  1  231 ? 20.848  51.550  12.623  1.00 75.79  ? 231  GLU A C     1 
ATOM   1711  O  O     . GLU A  1  231 ? 20.455  52.709  12.820  1.00 75.06  ? 231  GLU A O     1 
ATOM   1712  C  CB    . GLU A  1  231 ? 21.558  51.377  10.215  1.00 78.63  ? 231  GLU A CB    1 
ATOM   1713  C  CG    . GLU A  1  231 ? 21.475  52.903  10.053  1.00 82.48  ? 231  GLU A CG    1 
ATOM   1714  C  CD    . GLU A  1  231 ? 22.438  53.483  9.010   1.00 84.60  ? 231  GLU A CD    1 
ATOM   1715  O  OE1   . GLU A  1  231 ? 22.390  53.027  7.838   1.00 85.85  ? 231  GLU A OE1   1 
ATOM   1716  O  OE2   . GLU A  1  231 ? 23.228  54.407  9.361   1.00 86.30  ? 231  GLU A OE2   1 
ATOM   1717  N  N     . SER A  1  232 ? 21.481  50.820  13.531  1.00 74.27  ? 232  SER A N     1 
ATOM   1718  C  CA    . SER A  1  232 ? 21.842  51.283  14.859  1.00 72.47  ? 232  SER A CA    1 
ATOM   1719  C  C     . SER A  1  232 ? 22.219  52.752  14.953  1.00 71.66  ? 232  SER A C     1 
ATOM   1720  O  O     . SER A  1  232 ? 22.839  53.320  14.056  1.00 70.77  ? 232  SER A O     1 
ATOM   1721  C  CB    . SER A  1  232 ? 23.017  50.453  15.342  1.00 72.90  ? 232  SER A CB    1 
ATOM   1722  O  OG    . SER A  1  232 ? 23.704  49.855  14.233  1.00 74.17  ? 232  SER A OG    1 
ATOM   1723  N  N     . ALA A  1  233 ? 21.849  53.358  16.065  1.00 71.11  ? 233  ALA A N     1 
ATOM   1724  C  CA    . ALA A  1  233 ? 22.166  54.755  16.301  1.00 70.16  ? 233  ALA A CA    1 
ATOM   1725  C  C     . ALA A  1  233 ? 23.670  54.829  16.628  1.00 70.04  ? 233  ALA A C     1 
ATOM   1726  O  O     . ALA A  1  233 ? 24.343  55.847  16.428  1.00 68.02  ? 233  ALA A O     1 
ATOM   1727  C  CB    . ALA A  1  233 ? 21.332  55.256  17.474  1.00 69.84  ? 233  ALA A CB    1 
ATOM   1728  N  N     . ASN A  1  234 ? 24.170  53.705  17.117  1.00 70.95  ? 234  ASN A N     1 
ATOM   1729  C  CA    . ASN A  1  234 ? 25.563  53.556  17.524  1.00 72.39  ? 234  ASN A CA    1 
ATOM   1730  C  C     . ASN A  1  234 ? 26.588  53.779  16.425  1.00 72.68  ? 234  ASN A C     1 
ATOM   1731  O  O     . ASN A  1  234 ? 27.676  54.307  16.662  1.00 72.31  ? 234  ASN A O     1 
ATOM   1732  C  CB    . ASN A  1  234 ? 25.775  52.164  18.140  1.00 73.60  ? 234  ASN A CB    1 
ATOM   1733  C  CG    . ASN A  1  234 ? 25.373  52.103  19.609  1.00 73.35  ? 234  ASN A CG    1 
ATOM   1734  O  OD1   . ASN A  1  234 ? 24.596  52.942  20.099  1.00 75.34  ? 234  ASN A OD1   1 
ATOM   1735  N  ND2   . ASN A  1  234 ? 25.887  51.097  20.317  1.00 73.47  ? 234  ASN A ND2   1 
ATOM   1736  N  N     . TYR A  1  235 ? 26.251  53.355  15.226  1.00 73.48  ? 235  TYR A N     1 
ATOM   1737  C  CA    . TYR A  1  235 ? 27.169  53.539  14.140  1.00 75.25  ? 235  TYR A CA    1 
ATOM   1738  C  C     . TYR A  1  235 ? 27.469  55.023  13.905  1.00 74.77  ? 235  TYR A C     1 
ATOM   1739  O  O     . TYR A  1  235 ? 28.513  55.348  13.351  1.00 75.84  ? 235  TYR A O     1 
ATOM   1740  C  CB    . TYR A  1  235 ? 26.606  52.864  12.900  1.00 77.89  ? 235  TYR A CB    1 
ATOM   1741  C  CG    . TYR A  1  235 ? 26.843  51.366  12.932  1.00 82.11  ? 235  TYR A CG    1 
ATOM   1742  C  CD1   . TYR A  1  235 ? 26.231  50.565  13.893  1.00 83.48  ? 235  TYR A CD1   1 
ATOM   1743  C  CD2   . TYR A  1  235 ? 27.751  50.755  12.041  1.00 84.84  ? 235  TYR A CD2   1 
ATOM   1744  C  CE1   . TYR A  1  235 ? 26.514  49.178  13.984  1.00 85.44  ? 235  TYR A CE1   1 
ATOM   1745  C  CE2   . TYR A  1  235 ? 28.054  49.367  12.117  1.00 85.55  ? 235  TYR A CE2   1 
ATOM   1746  C  CZ    . TYR A  1  235 ? 27.431  48.583  13.098  1.00 86.16  ? 235  TYR A CZ    1 
ATOM   1747  O  OH    . TYR A  1  235 ? 27.744  47.230  13.218  1.00 86.11  ? 235  TYR A OH    1 
ATOM   1748  N  N     . GLY A  1  236 ? 26.580  55.913  14.354  1.00 74.52  ? 236  GLY A N     1 
ATOM   1749  C  CA    . GLY A  1  236 ? 26.783  57.341  14.178  1.00 73.26  ? 236  GLY A CA    1 
ATOM   1750  C  C     . GLY A  1  236 ? 28.053  57.868  14.816  1.00 73.12  ? 236  GLY A C     1 
ATOM   1751  O  O     . GLY A  1  236 ? 28.448  59.018  14.591  1.00 73.69  ? 236  GLY A O     1 
ATOM   1752  N  N     . TYR A  1  237 ? 28.683  57.038  15.638  1.00 72.77  ? 237  TYR A N     1 
ATOM   1753  C  CA    . TYR A  1  237 ? 29.936  57.423  16.277  1.00 72.42  ? 237  TYR A CA    1 
ATOM   1754  C  C     . TYR A  1  237 ? 31.095  56.540  15.751  1.00 72.02  ? 237  TYR A C     1 
ATOM   1755  O  O     . TYR A  1  237 ? 30.902  55.373  15.386  1.00 69.70  ? 237  TYR A O     1 
ATOM   1756  C  CB    . TYR A  1  237 ? 29.828  57.301  17.799  1.00 72.47  ? 237  TYR A CB    1 
ATOM   1757  C  CG    . TYR A  1  237 ? 31.123  57.640  18.510  1.00 72.96  ? 237  TYR A CG    1 
ATOM   1758  C  CD1   . TYR A  1  237 ? 31.386  58.938  18.958  1.00 72.88  ? 237  TYR A CD1   1 
ATOM   1759  C  CD2   . TYR A  1  237 ? 32.122  56.673  18.682  1.00 73.44  ? 237  TYR A CD2   1 
ATOM   1760  C  CE1   . TYR A  1  237 ? 32.622  59.269  19.562  1.00 73.02  ? 237  TYR A CE1   1 
ATOM   1761  C  CE2   . TYR A  1  237 ? 33.367  56.989  19.282  1.00 73.10  ? 237  TYR A CE2   1 
ATOM   1762  C  CZ    . TYR A  1  237 ? 33.611  58.289  19.719  1.00 73.22  ? 237  TYR A CZ    1 
ATOM   1763  O  OH    . TYR A  1  237 ? 34.829  58.620  20.297  1.00 71.94  ? 237  TYR A OH    1 
ATOM   1764  N  N     . LYS A  1  238 ? 32.285  57.130  15.671  1.00 72.73  ? 238  LYS A N     1 
ATOM   1765  C  CA    . LYS A  1  238 ? 33.478  56.418  15.217  1.00 73.97  ? 238  LYS A CA    1 
ATOM   1766  C  C     . LYS A  1  238 ? 34.566  56.561  16.251  1.00 73.19  ? 238  LYS A C     1 
ATOM   1767  O  O     . LYS A  1  238 ? 34.864  57.664  16.708  1.00 72.78  ? 238  LYS A O     1 
ATOM   1768  C  CB    . LYS A  1  238 ? 33.983  56.949  13.876  1.00 75.99  ? 238  LYS A CB    1 
ATOM   1769  C  CG    . LYS A  1  238 ? 33.376  56.228  12.679  1.00 78.04  ? 238  LYS A CG    1 
ATOM   1770  C  CD    . LYS A  1  238 ? 34.117  56.588  11.396  1.00 81.03  ? 238  LYS A CD    1 
ATOM   1771  C  CE    . LYS A  1  238 ? 33.507  55.934  10.126  1.00 82.26  ? 238  LYS A CE    1 
ATOM   1772  N  NZ    . LYS A  1  238 ? 34.161  56.422  8.845   1.00 80.67  ? 238  LYS A NZ    1 
ATOM   1773  N  N     . PHE A  1  239 ? 35.157  55.438  16.625  1.00 72.81  ? 239  PHE A N     1 
ATOM   1774  C  CA    . PHE A  1  239 ? 36.199  55.458  17.631  1.00 72.87  ? 239  PHE A CA    1 
ATOM   1775  C  C     . PHE A  1  239 ? 37.276  56.523  17.409  1.00 74.59  ? 239  PHE A C     1 
ATOM   1776  O  O     . PHE A  1  239 ? 37.945  56.558  16.363  1.00 75.81  ? 239  PHE A O     1 
ATOM   1777  C  CB    . PHE A  1  239 ? 36.880  54.092  17.743  1.00 69.38  ? 239  PHE A CB    1 
ATOM   1778  C  CG    . PHE A  1  239 ? 37.934  54.044  18.811  1.00 66.06  ? 239  PHE A CG    1 
ATOM   1779  C  CD1   . PHE A  1  239 ? 39.047  53.232  18.674  1.00 64.82  ? 239  PHE A CD1   1 
ATOM   1780  C  CD2   . PHE A  1  239 ? 37.809  54.817  19.967  1.00 64.43  ? 239  PHE A CD2   1 
ATOM   1781  C  CE1   . PHE A  1  239 ? 40.029  53.190  19.674  1.00 63.44  ? 239  PHE A CE1   1 
ATOM   1782  C  CE2   . PHE A  1  239 ? 38.777  54.776  20.960  1.00 63.62  ? 239  PHE A CE2   1 
ATOM   1783  C  CZ    . PHE A  1  239 ? 39.894  53.959  20.814  1.00 62.45  ? 239  PHE A CZ    1 
ATOM   1784  N  N     . GLY A  1  240 ? 37.441  57.375  18.418  1.00 75.85  ? 240  GLY A N     1 
ATOM   1785  C  CA    . GLY A  1  240 ? 38.449  58.419  18.363  1.00 78.83  ? 240  GLY A CA    1 
ATOM   1786  C  C     . GLY A  1  240 ? 38.066  59.647  17.554  1.00 80.25  ? 240  GLY A C     1 
ATOM   1787  O  O     . GLY A  1  240 ? 38.818  60.635  17.493  1.00 81.11  ? 240  GLY A O     1 
ATOM   1788  N  N     . GLN A  1  241 ? 36.888  59.586  16.944  1.00 80.90  ? 241  GLN A N     1 
ATOM   1789  C  CA    . GLN A  1  241 ? 36.403  60.677  16.125  1.00 80.97  ? 241  GLN A CA    1 
ATOM   1790  C  C     . GLN A  1  241 ? 36.700  62.033  16.721  1.00 80.68  ? 241  GLN A C     1 
ATOM   1791  O  O     . GLN A  1  241 ? 36.722  62.215  17.940  1.00 79.45  ? 241  GLN A O     1 
ATOM   1792  C  CB    . GLN A  1  241 ? 34.915  60.526  15.875  1.00 82.11  ? 241  GLN A CB    1 
ATOM   1793  C  CG    . GLN A  1  241 ? 34.052  61.262  16.841  1.00 82.35  ? 241  GLN A CG    1 
ATOM   1794  C  CD    . GLN A  1  241 ? 32.598  61.128  16.454  1.00 84.64  ? 241  GLN A CD    1 
ATOM   1795  O  OE1   . GLN A  1  241 ? 31.730  61.737  17.071  1.00 86.67  ? 241  GLN A OE1   1 
ATOM   1796  N  NE2   . GLN A  1  241 ? 32.319  60.318  15.421  1.00 85.05  ? 241  GLN A NE2   1 
ATOM   1797  N  N     . GLU A  1  242 ? 36.916  62.978  15.818  1.00 81.83  ? 242  GLU A N     1 
ATOM   1798  C  CA    . GLU A  1  242 ? 37.282  64.349  16.144  1.00 82.95  ? 242  GLU A CA    1 
ATOM   1799  C  C     . GLU A  1  242 ? 36.536  65.051  17.271  1.00 82.99  ? 242  GLU A C     1 
ATOM   1800  O  O     . GLU A  1  242 ? 37.025  65.161  18.406  1.00 81.58  ? 242  GLU A O     1 
ATOM   1801  C  CB    . GLU A  1  242 ? 37.217  65.199  14.857  1.00 83.68  ? 242  GLU A CB    1 
ATOM   1802  C  CG    . GLU A  1  242 ? 38.383  64.926  13.879  1.00 83.24  ? 242  GLU A CG    1 
ATOM   1803  C  CD    . GLU A  1  242 ? 39.773  65.069  14.551  1.00 83.59  ? 242  GLU A CD    1 
ATOM   1804  O  OE1   . GLU A  1  242 ? 40.117  66.200  14.998  1.00 82.00  ? 242  GLU A OE1   1 
ATOM   1805  O  OE2   . GLU A  1  242 ? 40.508  64.040  14.631  1.00 83.59  ? 242  GLU A OE2   1 
ATOM   1806  N  N     . GLU A  1  243 ? 35.344  65.519  16.926  1.00 83.71  ? 243  GLU A N     1 
ATOM   1807  C  CA    . GLU A  1  243 ? 34.498  66.268  17.838  1.00 84.06  ? 243  GLU A CA    1 
ATOM   1808  C  C     . GLU A  1  243 ? 33.450  65.454  18.560  1.00 82.49  ? 243  GLU A C     1 
ATOM   1809  O  O     . GLU A  1  243 ? 33.271  64.262  18.305  1.00 82.78  ? 243  GLU A O     1 
ATOM   1810  C  CB    . GLU A  1  243 ? 33.762  67.346  17.065  1.00 86.98  ? 243  GLU A CB    1 
ATOM   1811  C  CG    . GLU A  1  243 ? 32.692  66.777  16.126  1.00 88.28  ? 243  GLU A CG    1 
ATOM   1812  C  CD    . GLU A  1  243 ? 31.664  67.838  15.740  1.00 90.72  ? 243  GLU A CD    1 
ATOM   1813  O  OE1   . GLU A  1  243 ? 31.090  68.466  16.675  1.00 91.29  ? 243  GLU A OE1   1 
ATOM   1814  O  OE2   . GLU A  1  243 ? 31.429  68.048  14.516  1.00 90.77  ? 243  GLU A OE2   1 
ATOM   1815  N  N     . GLU A  1  244 ? 32.734  66.146  19.441  1.00 79.84  ? 244  GLU A N     1 
ATOM   1816  C  CA    . GLU A  1  244 ? 31.659  65.554  20.224  1.00 76.90  ? 244  GLU A CA    1 
ATOM   1817  C  C     . GLU A  1  244 ? 30.660  64.779  19.330  1.00 74.31  ? 244  GLU A C     1 
ATOM   1818  O  O     . GLU A  1  244 ? 30.632  64.977  18.109  1.00 72.66  ? 244  GLU A O     1 
ATOM   1819  C  CB    . GLU A  1  244 ? 30.940  66.665  21.018  1.00 77.10  ? 244  GLU A CB    1 
ATOM   1820  C  CG    . GLU A  1  244 ? 29.805  66.162  21.899  1.00 78.14  ? 244  GLU A CG    1 
ATOM   1821  C  CD    . GLU A  1  244 ? 30.242  65.024  22.806  1.00 78.69  ? 244  GLU A CD    1 
ATOM   1822  O  OE1   . GLU A  1  244 ? 30.884  65.309  23.850  1.00 79.47  ? 244  GLU A OE1   1 
ATOM   1823  O  OE2   . GLU A  1  244 ? 29.955  63.849  22.462  1.00 78.40  ? 244  GLU A OE2   1 
ATOM   1824  N  N     . THR A  1  245 ? 29.848  63.915  19.952  1.00 71.77  ? 245  THR A N     1 
ATOM   1825  C  CA    . THR A  1  245 ? 28.879  63.089  19.238  1.00 68.79  ? 245  THR A CA    1 
ATOM   1826  C  C     . THR A  1  245 ? 27.417  63.359  19.611  1.00 67.68  ? 245  THR A C     1 
ATOM   1827  O  O     . THR A  1  245 ? 26.508  62.615  19.234  1.00 68.13  ? 245  THR A O     1 
ATOM   1828  C  CB    . THR A  1  245 ? 29.200  61.591  19.458  1.00 68.05  ? 245  THR A CB    1 
ATOM   1829  O  OG1   . THR A  1  245 ? 28.569  60.803  18.438  1.00 67.07  ? 245  THR A OG1   1 
ATOM   1830  C  CG2   . THR A  1  245 ? 28.745  61.147  20.835  1.00 65.92  ? 245  THR A CG2   1 
ATOM   1831  N  N     . TYR A  1  246 ? 27.187  64.428  20.347  1.00 66.45  ? 246  TYR A N     1 
ATOM   1832  C  CA    . TYR A  1  246 ? 25.828  64.787  20.724  1.00 66.52  ? 246  TYR A CA    1 
ATOM   1833  C  C     . TYR A  1  246 ? 25.799  66.245  21.175  1.00 67.57  ? 246  TYR A C     1 
ATOM   1834  O  O     . TYR A  1  246 ? 26.823  66.778  21.612  1.00 68.98  ? 246  TYR A O     1 
ATOM   1835  C  CB    . TYR A  1  246 ? 25.333  63.899  21.853  1.00 63.98  ? 246  TYR A CB    1 
ATOM   1836  C  CG    . TYR A  1  246 ? 25.987  64.224  23.166  1.00 63.40  ? 246  TYR A CG    1 
ATOM   1837  C  CD1   . TYR A  1  246 ? 27.270  63.779  23.444  1.00 64.31  ? 246  TYR A CD1   1 
ATOM   1838  C  CD2   . TYR A  1  246 ? 25.332  64.986  24.131  1.00 62.67  ? 246  TYR A CD2   1 
ATOM   1839  C  CE1   . TYR A  1  246 ? 27.891  64.073  24.650  1.00 63.17  ? 246  TYR A CE1   1 
ATOM   1840  C  CE2   . TYR A  1  246 ? 25.945  65.290  25.337  1.00 63.01  ? 246  TYR A CE2   1 
ATOM   1841  C  CZ    . TYR A  1  246 ? 27.230  64.825  25.588  1.00 63.25  ? 246  TYR A CZ    1 
ATOM   1842  O  OH    . TYR A  1  246 ? 27.874  65.098  26.779  1.00 66.72  ? 246  TYR A OH    1 
ATOM   1843  N  N     . ASN A  1  247 ? 24.625  66.878  21.101  1.00 67.19  ? 247  ASN A N     1 
ATOM   1844  C  CA    . ASN A  1  247 ? 24.481  68.284  21.480  1.00 66.63  ? 247  ASN A CA    1 
ATOM   1845  C  C     . ASN A  1  247 ? 24.317  68.585  22.975  1.00 67.04  ? 247  ASN A C     1 
ATOM   1846  O  O     . ASN A  1  247 ? 23.198  68.639  23.485  1.00 67.13  ? 247  ASN A O     1 
ATOM   1847  C  CB    . ASN A  1  247 ? 23.321  68.896  20.719  1.00 66.00  ? 247  ASN A CB    1 
ATOM   1848  C  CG    . ASN A  1  247 ? 23.482  70.384  20.538  1.00 66.25  ? 247  ASN A CG    1 
ATOM   1849  O  OD1   . ASN A  1  247 ? 23.582  71.127  21.519  1.00 67.77  ? 247  ASN A OD1   1 
ATOM   1850  N  ND2   . ASN A  1  247 ? 23.514  70.836  19.285  1.00 63.66  ? 247  ASN A ND2   1 
ATOM   1851  N  N     . ILE A  1  248 ? 25.445  68.811  23.654  1.00 67.73  ? 248  ILE A N     1 
ATOM   1852  C  CA    . ILE A  1  248 ? 25.481  69.093  25.089  1.00 67.71  ? 248  ILE A CA    1 
ATOM   1853  C  C     . ILE A  1  248 ? 24.697  70.349  25.463  1.00 67.01  ? 248  ILE A C     1 
ATOM   1854  O  O     . ILE A  1  248 ? 24.527  70.677  26.646  1.00 65.68  ? 248  ILE A O     1 
ATOM   1855  C  CB    . ILE A  1  248 ? 26.936  69.280  25.576  1.00 69.72  ? 248  ILE A CB    1 
ATOM   1856  C  CG1   . ILE A  1  248 ? 27.871  68.307  24.823  1.00 70.70  ? 248  ILE A CG1   1 
ATOM   1857  C  CG2   . ILE A  1  248 ? 26.994  69.108  27.116  1.00 70.87  ? 248  ILE A CG2   1 
ATOM   1858  C  CD1   . ILE A  1  248 ? 29.381  68.541  25.058  1.00 71.47  ? 248  ILE A CD1   1 
ATOM   1859  N  N     . VAL A  1  249 ? 24.221  71.049  24.445  1.00 66.28  ? 249  VAL A N     1 
ATOM   1860  C  CA    . VAL A  1  249 ? 23.465  72.266  24.655  1.00 66.28  ? 249  VAL A CA    1 
ATOM   1861  C  C     . VAL A  1  249 ? 21.986  71.996  24.497  1.00 65.75  ? 249  VAL A C     1 
ATOM   1862  O  O     . VAL A  1  249 ? 21.169  72.653  25.128  1.00 64.94  ? 249  VAL A O     1 
ATOM   1863  C  CB    . VAL A  1  249 ? 23.892  73.350  23.658  1.00 67.12  ? 249  VAL A CB    1 
ATOM   1864  C  CG1   . VAL A  1  249 ? 23.035  74.580  23.854  1.00 68.38  ? 249  VAL A CG1   1 
ATOM   1865  C  CG2   . VAL A  1  249 ? 25.368  73.683  23.859  1.00 67.73  ? 249  VAL A CG2   1 
ATOM   1866  N  N     . ALA A  1  250 ? 21.654  71.036  23.640  1.00 66.26  ? 250  ALA A N     1 
ATOM   1867  C  CA    . ALA A  1  250 ? 20.268  70.657  23.406  1.00 67.52  ? 250  ALA A CA    1 
ATOM   1868  C  C     . ALA A  1  250 ? 19.867  69.854  24.628  1.00 68.22  ? 250  ALA A C     1 
ATOM   1869  O  O     . ALA A  1  250 ? 18.710  69.866  25.077  1.00 69.10  ? 250  ALA A O     1 
ATOM   1870  C  CB    . ALA A  1  250 ? 20.159  69.801  22.174  1.00 66.60  ? 250  ALA A CB    1 
ATOM   1871  N  N     . ALA A  1  251 ? 20.857  69.150  25.153  1.00 68.29  ? 251  ALA A N     1 
ATOM   1872  C  CA    . ALA A  1  251 ? 20.688  68.336  26.332  1.00 68.08  ? 251  ALA A CA    1 
ATOM   1873  C  C     . ALA A  1  251 ? 20.219  69.234  27.467  1.00 68.43  ? 251  ALA A C     1 
ATOM   1874  O  O     . ALA A  1  251 ? 19.139  69.038  28.028  1.00 67.96  ? 251  ALA A O     1 
ATOM   1875  C  CB    . ALA A  1  251 ? 22.012  67.696  26.681  1.00 67.37  ? 251  ALA A CB    1 
ATOM   1876  N  N     . HIS A  1  252 ? 21.049  70.222  27.794  1.00 69.95  ? 252  HIS A N     1 
ATOM   1877  C  CA    . HIS A  1  252 ? 20.762  71.189  28.859  1.00 70.87  ? 252  HIS A CA    1 
ATOM   1878  C  C     . HIS A  1  252 ? 19.508  71.987  28.500  1.00 70.39  ? 252  HIS A C     1 
ATOM   1879  O  O     . HIS A  1  252 ? 18.761  72.419  29.378  1.00 69.35  ? 252  HIS A O     1 
ATOM   1880  C  CB    . HIS A  1  252 ? 21.981  72.118  29.053  1.00 72.17  ? 252  HIS A CB    1 
ATOM   1881  C  CG    . HIS A  1  252 ? 21.709  73.318  29.912  1.00 73.63  ? 252  HIS A CG    1 
ATOM   1882  N  ND1   . HIS A  1  252 ? 21.035  73.243  31.113  1.00 74.66  ? 252  HIS A ND1   1 
ATOM   1883  C  CD2   . HIS A  1  252 ? 22.046  74.621  29.757  1.00 74.62  ? 252  HIS A CD2   1 
ATOM   1884  C  CE1   . HIS A  1  252 ? 20.965  74.443  31.662  1.00 74.67  ? 252  HIS A CE1   1 
ATOM   1885  N  NE2   . HIS A  1  252 ? 21.571  75.297  30.860  1.00 75.65  ? 252  HIS A NE2   1 
ATOM   1886  N  N     . GLY A  1  253 ? 19.285  72.156  27.202  1.00 70.37  ? 253  GLY A N     1 
ATOM   1887  C  CA    . GLY A  1  253 ? 18.123  72.883  26.732  1.00 71.87  ? 253  GLY A CA    1 
ATOM   1888  C  C     . GLY A  1  253 ? 16.844  72.272  27.265  1.00 73.21  ? 253  GLY A C     1 
ATOM   1889  O  O     . GLY A  1  253 ? 15.899  72.991  27.587  1.00 74.07  ? 253  GLY A O     1 
ATOM   1890  N  N     . TYR A  1  254 ? 16.820  70.943  27.361  1.00 73.55  ? 254  TYR A N     1 
ATOM   1891  C  CA    . TYR A  1  254 ? 15.665  70.192  27.868  1.00 73.31  ? 254  TYR A CA    1 
ATOM   1892  C  C     . TYR A  1  254 ? 15.693  70.023  29.388  1.00 72.39  ? 254  TYR A C     1 
ATOM   1893  O  O     . TYR A  1  254 ? 14.768  70.435  30.090  1.00 71.17  ? 254  TYR A O     1 
ATOM   1894  C  CB    . TYR A  1  254 ? 15.618  68.823  27.183  1.00 74.08  ? 254  TYR A CB    1 
ATOM   1895  C  CG    . TYR A  1  254 ? 14.813  67.743  27.881  1.00 74.79  ? 254  TYR A CG    1 
ATOM   1896  C  CD1   . TYR A  1  254 ? 15.377  66.959  28.887  1.00 75.18  ? 254  TYR A CD1   1 
ATOM   1897  C  CD2   . TYR A  1  254 ? 13.513  67.451  27.478  1.00 75.90  ? 254  TYR A CD2   1 
ATOM   1898  C  CE1   . TYR A  1  254 ? 14.666  65.906  29.470  1.00 77.68  ? 254  TYR A CE1   1 
ATOM   1899  C  CE2   . TYR A  1  254 ? 12.789  66.396  28.051  1.00 77.81  ? 254  TYR A CE2   1 
ATOM   1900  C  CZ    . TYR A  1  254 ? 13.367  65.623  29.046  1.00 78.85  ? 254  TYR A CZ    1 
ATOM   1901  O  OH    . TYR A  1  254 ? 12.643  64.570  29.595  1.00 79.50  ? 254  TYR A OH    1 
ATOM   1902  N  N     . PHE A  1  255 ? 16.763  69.424  29.893  1.00 72.04  ? 255  PHE A N     1 
ATOM   1903  C  CA    . PHE A  1  255 ? 16.870  69.201  31.325  1.00 71.59  ? 255  PHE A CA    1 
ATOM   1904  C  C     . PHE A  1  255 ? 16.676  70.481  32.114  1.00 71.15  ? 255  PHE A C     1 
ATOM   1905  O  O     . PHE A  1  255 ? 16.052  70.469  33.174  1.00 70.37  ? 255  PHE A O     1 
ATOM   1906  C  CB    . PHE A  1  255 ? 18.214  68.589  31.688  1.00 71.96  ? 255  PHE A CB    1 
ATOM   1907  C  CG    . PHE A  1  255 ? 18.335  68.270  33.140  1.00 72.71  ? 255  PHE A CG    1 
ATOM   1908  C  CD1   . PHE A  1  255 ? 17.362  67.489  33.773  1.00 73.33  ? 255  PHE A CD1   1 
ATOM   1909  C  CD2   . PHE A  1  255 ? 19.392  68.771  33.894  1.00 72.81  ? 255  PHE A CD2   1 
ATOM   1910  C  CE1   . PHE A  1  255 ? 17.441  67.217  35.139  1.00 73.34  ? 255  PHE A CE1   1 
ATOM   1911  C  CE2   . PHE A  1  255 ? 19.482  68.504  35.263  1.00 73.20  ? 255  PHE A CE2   1 
ATOM   1912  C  CZ    . PHE A  1  255 ? 18.502  67.725  35.884  1.00 73.44  ? 255  PHE A CZ    1 
ATOM   1913  N  N     . GLY A  1  256 ? 17.220  71.576  31.598  1.00 70.36  ? 256  GLY A N     1 
ATOM   1914  C  CA    . GLY A  1  256 ? 17.068  72.840  32.275  1.00 69.61  ? 256  GLY A CA    1 
ATOM   1915  C  C     . GLY A  1  256 ? 15.595  73.192  32.380  1.00 69.51  ? 256  GLY A C     1 
ATOM   1916  O  O     . GLY A  1  256 ? 15.122  73.637  33.420  1.00 69.33  ? 256  GLY A O     1 
ATOM   1917  N  N     . ARG A  1  257 ? 14.861  72.977  31.296  1.00 69.41  ? 257  ARG A N     1 
ATOM   1918  C  CA    . ARG A  1  257 ? 13.439  73.290  31.266  1.00 69.90  ? 257  ARG A CA    1 
ATOM   1919  C  C     . ARG A  1  257 ? 12.553  72.315  32.042  1.00 69.98  ? 257  ARG A C     1 
ATOM   1920  O  O     . ARG A  1  257 ? 11.422  72.665  32.401  1.00 71.07  ? 257  ARG A O     1 
ATOM   1921  C  CB    . ARG A  1  257 ? 12.984  73.386  29.822  1.00 70.78  ? 257  ARG A CB    1 
ATOM   1922  C  CG    . ARG A  1  257 ? 13.277  74.748  29.232  1.00 74.07  ? 257  ARG A CG    1 
ATOM   1923  C  CD    . ARG A  1  257 ? 13.513  74.719  27.708  1.00 76.88  ? 257  ARG A CD    1 
ATOM   1924  N  NE    . ARG A  1  257 ? 13.782  76.057  27.182  1.00 78.55  ? 257  ARG A NE    1 
ATOM   1925  C  CZ    . ARG A  1  257 ? 14.682  76.896  27.703  1.00 81.70  ? 257  ARG A CZ    1 
ATOM   1926  N  NH1   . ARG A  1  257 ? 15.413  76.540  28.764  1.00 82.79  ? 257  ARG A NH1   1 
ATOM   1927  N  NH2   . ARG A  1  257 ? 14.835  78.113  27.191  1.00 83.88  ? 257  ARG A NH2   1 
ATOM   1928  N  N     . LEU A  1  258 ? 13.065  71.106  32.307  1.00 69.07  ? 258  LEU A N     1 
ATOM   1929  C  CA    . LEU A  1  258 ? 12.344  70.079  33.074  1.00 67.21  ? 258  LEU A CA    1 
ATOM   1930  C  C     . LEU A  1  258 ? 12.116  70.541  34.507  1.00 67.23  ? 258  LEU A C     1 
ATOM   1931  O  O     . LEU A  1  258 ? 11.014  70.454  35.035  1.00 66.20  ? 258  LEU A O     1 
ATOM   1932  C  CB    . LEU A  1  258 ? 13.153  68.798  33.105  1.00 66.49  ? 258  LEU A CB    1 
ATOM   1933  C  CG    . LEU A  1  258 ? 12.538  67.659  33.904  1.00 65.32  ? 258  LEU A CG    1 
ATOM   1934  C  CD1   . LEU A  1  258 ? 11.203  67.232  33.316  1.00 64.18  ? 258  LEU A CD1   1 
ATOM   1935  C  CD2   . LEU A  1  258 ? 13.525  66.506  33.880  1.00 66.53  ? 258  LEU A CD2   1 
ATOM   1936  N  N     . ILE A  1  259 ? 13.180  71.029  35.127  1.00 67.62  ? 259  ILE A N     1 
ATOM   1937  C  CA    . ILE A  1  259 ? 13.132  71.528  36.499  1.00 69.28  ? 259  ILE A CA    1 
ATOM   1938  C  C     . ILE A  1  259 ? 13.129  73.051  36.391  1.00 70.46  ? 259  ILE A C     1 
ATOM   1939  O  O     . ILE A  1  259 ? 12.123  73.707  36.686  1.00 71.32  ? 259  ILE A O     1 
ATOM   1940  C  CB    . ILE A  1  259 ? 14.377  71.038  37.294  1.00 69.81  ? 259  ILE A CB    1 
ATOM   1941  C  CG1   . ILE A  1  259 ? 14.570  69.532  37.036  1.00 70.72  ? 259  ILE A CG1   1 
ATOM   1942  C  CG2   . ILE A  1  259 ? 14.220  71.321  38.804  1.00 67.08  ? 259  ILE A CG2   1 
ATOM   1943  C  CD1   . ILE A  1  259 ? 15.871  68.959  37.581  1.00 73.16  ? 259  ILE A CD1   1 
ATOM   1944  N  N     . PHE A  1  260 ? 14.274  73.595  35.982  1.00 71.42  ? 260  PHE A N     1 
ATOM   1945  C  CA    . PHE A  1  260 ? 14.472  75.027  35.740  1.00 72.55  ? 260  PHE A CA    1 
ATOM   1946  C  C     . PHE A  1  260 ? 15.935  75.295  35.442  1.00 73.25  ? 260  PHE A C     1 
ATOM   1947  O  O     . PHE A  1  260 ? 16.821  74.773  36.114  1.00 73.74  ? 260  PHE A O     1 
ATOM   1948  C  CB    . PHE A  1  260 ? 13.925  75.910  36.885  1.00 71.51  ? 260  PHE A CB    1 
ATOM   1949  C  CG    . PHE A  1  260 ? 14.703  75.846  38.157  1.00 70.77  ? 260  PHE A CG    1 
ATOM   1950  C  CD1   . PHE A  1  260 ? 15.990  76.370  38.234  1.00 70.69  ? 260  PHE A CD1   1 
ATOM   1951  C  CD2   . PHE A  1  260 ? 14.117  75.320  39.307  1.00 70.82  ? 260  PHE A CD2   1 
ATOM   1952  C  CE1   . PHE A  1  260 ? 16.677  76.374  39.439  1.00 70.59  ? 260  PHE A CE1   1 
ATOM   1953  C  CE2   . PHE A  1  260 ? 14.796  75.318  40.517  1.00 69.90  ? 260  PHE A CE2   1 
ATOM   1954  C  CZ    . PHE A  1  260 ? 16.076  75.847  40.585  1.00 69.89  ? 260  PHE A CZ    1 
ATOM   1955  N  N     . GLN A  1  261 ? 16.156  76.088  34.394  1.00 75.11  ? 261  GLN A N     1 
ATOM   1956  C  CA    . GLN A  1  261 ? 17.481  76.442  33.863  1.00 76.82  ? 261  GLN A CA    1 
ATOM   1957  C  C     . GLN A  1  261 ? 18.705  76.223  34.773  1.00 77.67  ? 261  GLN A C     1 
ATOM   1958  O  O     . GLN A  1  261 ? 19.516  75.326  34.517  1.00 77.69  ? 261  GLN A O     1 
ATOM   1959  C  CB    . GLN A  1  261 ? 17.473  77.901  33.312  1.00 76.85  ? 261  GLN A CB    1 
ATOM   1960  C  CG    . GLN A  1  261 ? 16.314  78.220  32.318  1.00 76.17  ? 261  GLN A CG    1 
ATOM   1961  C  CD    . GLN A  1  261 ? 16.681  78.123  30.823  1.00 76.17  ? 261  GLN A CD    1 
ATOM   1962  O  OE1   . GLN A  1  261 ? 17.410  77.215  30.387  1.00 75.28  ? 261  GLN A OE1   1 
ATOM   1963  N  NE2   . GLN A  1  261 ? 16.140  79.053  30.028  1.00 75.15  ? 261  GLN A NE2   1 
ATOM   1964  N  N     . TYR A  1  262 ? 18.822  77.016  35.835  1.00 78.93  ? 262  TYR A N     1 
ATOM   1965  C  CA    . TYR A  1  262 ? 19.979  76.953  36.749  1.00 80.42  ? 262  TYR A CA    1 
ATOM   1966  C  C     . TYR A  1  262 ? 20.051  75.715  37.638  1.00 79.89  ? 262  TYR A C     1 
ATOM   1967  O  O     . TYR A  1  262 ? 21.064  75.457  38.301  1.00 78.78  ? 262  TYR A O     1 
ATOM   1968  C  CB    . TYR A  1  262 ? 20.022  78.235  37.594  1.00 82.86  ? 262  TYR A CB    1 
ATOM   1969  C  CG    . TYR A  1  262 ? 19.926  79.499  36.728  1.00 85.85  ? 262  TYR A CG    1 
ATOM   1970  C  CD1   . TYR A  1  262 ? 20.979  79.872  35.877  1.00 86.87  ? 262  TYR A CD1   1 
ATOM   1971  C  CD2   . TYR A  1  262 ? 18.748  80.264  36.693  1.00 86.85  ? 262  TYR A CD2   1 
ATOM   1972  C  CE1   . TYR A  1  262 ? 20.860  80.958  35.021  1.00 88.90  ? 262  TYR A CE1   1 
ATOM   1973  C  CE2   . TYR A  1  262 ? 18.617  81.350  35.837  1.00 87.96  ? 262  TYR A CE2   1 
ATOM   1974  C  CZ    . TYR A  1  262 ? 19.669  81.698  35.002  1.00 89.48  ? 262  TYR A CZ    1 
ATOM   1975  O  OH    . TYR A  1  262 ? 19.539  82.794  34.140  1.00 90.98  ? 262  TYR A OH    1 
ATOM   1976  N  N     . ALA A  1  263 ? 18.960  74.963  37.638  1.00 80.10  ? 263  ALA A N     1 
ATOM   1977  C  CA    . ALA A  1  263 ? 18.879  73.726  38.385  1.00 80.20  ? 263  ALA A CA    1 
ATOM   1978  C  C     . ALA A  1  263 ? 19.350  72.670  37.401  1.00 80.18  ? 263  ALA A C     1 
ATOM   1979  O  O     . ALA A  1  263 ? 18.857  71.536  37.402  1.00 80.88  ? 263  ALA A O     1 
ATOM   1980  C  CB    . ALA A  1  263 ? 17.443  73.445  38.794  1.00 80.83  ? 263  ALA A CB    1 
ATOM   1981  N  N     . SER A  1  264 ? 20.298  73.052  36.546  1.00 79.56  ? 264  SER A N     1 
ATOM   1982  C  CA    . SER A  1  264 ? 20.834  72.135  35.538  1.00 78.97  ? 264  SER A CA    1 
ATOM   1983  C  C     . SER A  1  264 ? 22.308  72.312  35.220  1.00 78.07  ? 264  SER A C     1 
ATOM   1984  O  O     . SER A  1  264 ? 22.933  73.254  35.688  1.00 78.06  ? 264  SER A O     1 
ATOM   1985  C  CB    . SER A  1  264 ? 20.062  72.280  34.242  1.00 78.91  ? 264  SER A CB    1 
ATOM   1986  O  OG    . SER A  1  264 ? 20.816  71.705  33.199  1.00 80.24  ? 264  SER A OG    1 
ATOM   1987  N  N     . PHE A  1  265 ? 22.855  71.394  34.425  1.00 77.51  ? 265  PHE A N     1 
ATOM   1988  C  CA    . PHE A  1  265 ? 24.256  71.458  34.017  1.00 77.35  ? 265  PHE A CA    1 
ATOM   1989  C  C     . PHE A  1  265 ? 24.402  72.043  32.619  1.00 76.98  ? 265  PHE A C     1 
ATOM   1990  O  O     . PHE A  1  265 ? 23.408  72.332  31.948  1.00 77.78  ? 265  PHE A O     1 
ATOM   1991  C  CB    . PHE A  1  265 ? 24.900  70.070  34.063  1.00 77.71  ? 265  PHE A CB    1 
ATOM   1992  C  CG    . PHE A  1  265 ? 25.429  69.716  35.411  1.00 78.40  ? 265  PHE A CG    1 
ATOM   1993  C  CD1   . PHE A  1  265 ? 26.471  70.452  35.968  1.00 79.41  ? 265  PHE A CD1   1 
ATOM   1994  C  CD2   . PHE A  1  265 ? 24.846  68.706  36.161  1.00 78.87  ? 265  PHE A CD2   1 
ATOM   1995  C  CE1   . PHE A  1  265 ? 26.932  70.198  37.272  1.00 79.45  ? 265  PHE A CE1   1 
ATOM   1996  C  CE2   . PHE A  1  265 ? 25.291  68.430  37.470  1.00 79.61  ? 265  PHE A CE2   1 
ATOM   1997  C  CZ    . PHE A  1  265 ? 26.338  69.184  38.026  1.00 79.63  ? 265  PHE A CZ    1 
ATOM   1998  N  N     . ASN A  1  266 ? 25.644  72.230  32.186  1.00 76.10  ? 266  ASN A N     1 
ATOM   1999  C  CA    . ASN A  1  266 ? 25.926  72.766  30.847  1.00 74.90  ? 266  ASN A CA    1 
ATOM   2000  C  C     . ASN A  1  266 ? 27.441  72.695  30.662  1.00 73.37  ? 266  ASN A C     1 
ATOM   2001  O  O     . ASN A  1  266 ? 27.969  73.009  29.599  1.00 73.26  ? 266  ASN A O     1 
ATOM   2002  C  CB    . ASN A  1  266 ? 25.477  74.212  30.747  1.00 75.28  ? 266  ASN A CB    1 
ATOM   2003  C  CG    . ASN A  1  266 ? 26.377  75.137  31.541  1.00 76.12  ? 266  ASN A CG    1 
ATOM   2004  O  OD1   . ASN A  1  266 ? 26.422  75.089  32.777  1.00 75.60  ? 266  ASN A OD1   1 
ATOM   2005  N  ND2   . ASN A  1  266 ? 27.119  75.971  30.834  1.00 76.68  ? 266  ASN A ND2   1 
ATOM   2006  N  N     . ASN A  1  267 ? 28.132  72.280  31.715  1.00 71.54  ? 267  ASN A N     1 
ATOM   2007  C  CA    . ASN A  1  267 ? 29.570  72.153  31.660  1.00 69.78  ? 267  ASN A CA    1 
ATOM   2008  C  C     . ASN A  1  267 ? 29.969  70.686  31.823  1.00 68.95  ? 267  ASN A C     1 
ATOM   2009  O  O     . ASN A  1  267 ? 30.035  70.195  32.947  1.00 68.55  ? 267  ASN A O     1 
ATOM   2010  C  CB    . ASN A  1  267 ? 30.191  72.982  32.774  1.00 69.83  ? 267  ASN A CB    1 
ATOM   2011  C  CG    . ASN A  1  267 ? 31.687  73.077  32.653  1.00 70.32  ? 267  ASN A CG    1 
ATOM   2012  O  OD1   . ASN A  1  267 ? 32.380  72.060  32.554  1.00 71.46  ? 267  ASN A OD1   1 
ATOM   2013  N  ND2   . ASN A  1  267 ? 32.203  74.301  32.661  1.00 70.05  ? 267  ASN A ND2   1 
ATOM   2014  N  N     . SER A  1  268 ? 30.224  69.991  30.711  1.00 67.45  ? 268  SER A N     1 
ATOM   2015  C  CA    . SER A  1  268 ? 30.633  68.584  30.743  1.00 65.99  ? 268  SER A CA    1 
ATOM   2016  C  C     . SER A  1  268 ? 31.609  68.258  31.867  1.00 65.34  ? 268  SER A C     1 
ATOM   2017  O  O     . SER A  1  268 ? 31.469  67.239  32.543  1.00 64.76  ? 268  SER A O     1 
ATOM   2018  C  CB    . SER A  1  268 ? 31.269  68.173  29.414  1.00 66.07  ? 268  SER A CB    1 
ATOM   2019  O  OG    . SER A  1  268 ? 30.295  67.714  28.491  1.00 69.51  ? 268  SER A OG    1 
ATOM   2020  N  N     . ARG A  1  269 ? 32.597  69.117  32.067  1.00 64.88  ? 269  ARG A N     1 
ATOM   2021  C  CA    . ARG A  1  269 ? 33.570  68.872  33.104  1.00 64.83  ? 269  ARG A CA    1 
ATOM   2022  C  C     . ARG A  1  269 ? 32.960  68.973  34.480  1.00 65.05  ? 269  ARG A C     1 
ATOM   2023  O  O     . ARG A  1  269 ? 33.191  68.110  35.327  1.00 64.07  ? 269  ARG A O     1 
ATOM   2024  C  CB    . ARG A  1  269 ? 34.738  69.834  32.962  1.00 66.02  ? 269  ARG A CB    1 
ATOM   2025  C  CG    . ARG A  1  269 ? 35.410  69.683  31.638  1.00 66.50  ? 269  ARG A CG    1 
ATOM   2026  C  CD    . ARG A  1  269 ? 36.775  70.270  31.663  1.00 68.27  ? 269  ARG A CD    1 
ATOM   2027  N  NE    . ARG A  1  269 ? 37.448  69.990  30.407  1.00 68.91  ? 269  ARG A NE    1 
ATOM   2028  C  CZ    . ARG A  1  269 ? 38.691  70.359  30.140  1.00 69.70  ? 269  ARG A CZ    1 
ATOM   2029  N  NH1   . ARG A  1  269 ? 39.387  71.032  31.055  1.00 69.57  ? 269  ARG A NH1   1 
ATOM   2030  N  NH2   . ARG A  1  269 ? 39.238  70.034  28.969  1.00 69.40  ? 269  ARG A NH2   1 
ATOM   2031  N  N     . SER A  1  270 ? 32.175  70.018  34.704  1.00 65.40  ? 270  SER A N     1 
ATOM   2032  C  CA    . SER A  1  270 ? 31.520  70.206  36.001  1.00 65.56  ? 270  SER A CA    1 
ATOM   2033  C  C     . SER A  1  270 ? 30.422  69.167  36.261  1.00 65.34  ? 270  SER A C     1 
ATOM   2034  O  O     . SER A  1  270 ? 30.115  68.851  37.416  1.00 65.94  ? 270  SER A O     1 
ATOM   2035  C  CB    . SER A  1  270 ? 30.918  71.600  36.095  1.00 66.18  ? 270  SER A CB    1 
ATOM   2036  O  OG    . SER A  1  270 ? 30.379  71.801  37.392  1.00 65.33  ? 270  SER A OG    1 
ATOM   2037  N  N     . LEU A  1  271 ? 29.825  68.658  35.182  1.00 64.44  ? 271  LEU A N     1 
ATOM   2038  C  CA    . LEU A  1  271 ? 28.787  67.629  35.257  1.00 62.16  ? 271  LEU A CA    1 
ATOM   2039  C  C     . LEU A  1  271 ? 29.407  66.260  35.537  1.00 60.59  ? 271  LEU A C     1 
ATOM   2040  O  O     . LEU A  1  271 ? 28.950  65.539  36.425  1.00 60.40  ? 271  LEU A O     1 
ATOM   2041  C  CB    . LEU A  1  271 ? 28.011  67.552  33.942  1.00 62.90  ? 271  LEU A CB    1 
ATOM   2042  C  CG    . LEU A  1  271 ? 27.471  66.154  33.576  1.00 62.67  ? 271  LEU A CG    1 
ATOM   2043  C  CD1   . LEU A  1  271 ? 26.396  65.729  34.552  1.00 63.16  ? 271  LEU A CD1   1 
ATOM   2044  C  CD2   . LEU A  1  271 ? 26.914  66.166  32.169  1.00 61.43  ? 271  LEU A CD2   1 
ATOM   2045  N  N     . HIS A  1  272 ? 30.433  65.909  34.770  1.00 58.50  ? 272  HIS A N     1 
ATOM   2046  C  CA    . HIS A  1  272 ? 31.093  64.635  34.950  1.00 57.69  ? 272  HIS A CA    1 
ATOM   2047  C  C     . HIS A  1  272 ? 31.789  64.490  36.291  1.00 58.67  ? 272  HIS A C     1 
ATOM   2048  O  O     . HIS A  1  272 ? 31.954  63.378  36.792  1.00 59.65  ? 272  HIS A O     1 
ATOM   2049  C  CB    . HIS A  1  272 ? 32.071  64.365  33.813  1.00 55.49  ? 272  HIS A CB    1 
ATOM   2050  C  CG    . HIS A  1  272 ? 31.413  63.851  32.576  1.00 55.87  ? 272  HIS A CG    1 
ATOM   2051  N  ND1   . HIS A  1  272 ? 30.543  64.612  31.832  1.00 55.65  ? 272  HIS A ND1   1 
ATOM   2052  C  CD2   . HIS A  1  272 ? 31.449  62.635  31.986  1.00 55.79  ? 272  HIS A CD2   1 
ATOM   2053  C  CE1   . HIS A  1  272 ? 30.068  63.885  30.838  1.00 55.19  ? 272  HIS A CE1   1 
ATOM   2054  N  NE2   . HIS A  1  272 ? 30.601  62.680  30.910  1.00 53.81  ? 272  HIS A NE2   1 
ATOM   2055  N  N     . PHE A  1  273 ? 32.205  65.592  36.885  1.00 58.67  ? 273  PHE A N     1 
ATOM   2056  C  CA    . PHE A  1  273 ? 32.846  65.494  38.184  1.00 60.13  ? 273  PHE A CA    1 
ATOM   2057  C  C     . PHE A  1  273 ? 31.787  65.172  39.234  1.00 62.35  ? 273  PHE A C     1 
ATOM   2058  O  O     . PHE A  1  273 ? 32.007  64.349  40.125  1.00 63.39  ? 273  PHE A O     1 
ATOM   2059  C  CB    . PHE A  1  273 ? 33.527  66.806  38.535  1.00 59.12  ? 273  PHE A CB    1 
ATOM   2060  C  CG    . PHE A  1  273 ? 33.904  66.922  39.980  1.00 58.03  ? 273  PHE A CG    1 
ATOM   2061  C  CD1   . PHE A  1  273 ? 34.947  66.181  40.501  1.00 58.17  ? 273  PHE A CD1   1 
ATOM   2062  C  CD2   . PHE A  1  273 ? 33.200  67.773  40.819  1.00 58.23  ? 273  PHE A CD2   1 
ATOM   2063  C  CE1   . PHE A  1  273 ? 35.285  66.287  41.840  1.00 58.15  ? 273  PHE A CE1   1 
ATOM   2064  C  CE2   . PHE A  1  273 ? 33.528  67.889  42.164  1.00 58.90  ? 273  PHE A CE2   1 
ATOM   2065  C  CZ    . PHE A  1  273 ? 34.570  67.148  42.679  1.00 58.11  ? 273  PHE A CZ    1 
ATOM   2066  N  N     . PHE A  1  274 ? 30.640  65.834  39.130  1.00 63.58  ? 274  PHE A N     1 
ATOM   2067  C  CA    . PHE A  1  274 ? 29.549  65.599  40.059  1.00 63.51  ? 274  PHE A CA    1 
ATOM   2068  C  C     . PHE A  1  274 ? 29.122  64.145  39.954  1.00 63.78  ? 274  PHE A C     1 
ATOM   2069  O  O     . PHE A  1  274 ? 28.503  63.609  40.866  1.00 65.72  ? 274  PHE A O     1 
ATOM   2070  C  CB    . PHE A  1  274 ? 28.364  66.474  39.725  1.00 63.55  ? 274  PHE A CB    1 
ATOM   2071  C  CG    . PHE A  1  274 ? 27.161  66.203  40.577  1.00 64.14  ? 274  PHE A CG    1 
ATOM   2072  C  CD1   . PHE A  1  274 ? 27.150  66.561  41.928  1.00 64.22  ? 274  PHE A CD1   1 
ATOM   2073  C  CD2   . PHE A  1  274 ? 26.012  65.640  40.014  1.00 64.53  ? 274  PHE A CD2   1 
ATOM   2074  C  CE1   . PHE A  1  274 ? 26.005  66.373  42.710  1.00 64.25  ? 274  PHE A CE1   1 
ATOM   2075  C  CE2   . PHE A  1  274 ? 24.863  65.446  40.783  1.00 64.22  ? 274  PHE A CE2   1 
ATOM   2076  C  CZ    . PHE A  1  274 ? 24.857  65.816  42.136  1.00 64.43  ? 274  PHE A CZ    1 
ATOM   2077  N  N     . LEU A  1  275 ? 29.431  63.507  38.838  1.00 62.10  ? 275  LEU A N     1 
ATOM   2078  C  CA    . LEU A  1  275 ? 29.077  62.112  38.686  1.00 61.36  ? 275  LEU A CA    1 
ATOM   2079  C  C     . LEU A  1  275 ? 30.027  61.221  39.457  1.00 61.05  ? 275  LEU A C     1 
ATOM   2080  O  O     . LEU A  1  275 ? 29.622  60.220  40.036  1.00 61.36  ? 275  LEU A O     1 
ATOM   2081  C  CB    . LEU A  1  275 ? 29.126  61.695  37.231  1.00 61.35  ? 275  LEU A CB    1 
ATOM   2082  C  CG    . LEU A  1  275 ? 28.103  62.342  36.335  1.00 61.85  ? 275  LEU A CG    1 
ATOM   2083  C  CD1   . LEU A  1  275 ? 28.156  61.666  34.994  1.00 61.56  ? 275  LEU A CD1   1 
ATOM   2084  C  CD2   . LEU A  1  275 ? 26.734  62.212  36.966  1.00 63.20  ? 275  LEU A CD2   1 
ATOM   2085  N  N     . ALA A  1  276 ? 31.300  61.569  39.450  1.00 60.34  ? 276  ALA A N     1 
ATOM   2086  C  CA    . ALA A  1  276 ? 32.278  60.746  40.144  1.00 58.82  ? 276  ALA A CA    1 
ATOM   2087  C  C     . ALA A  1  276 ? 32.445  61.124  41.605  1.00 56.68  ? 276  ALA A C     1 
ATOM   2088  O  O     . ALA A  1  276 ? 33.077  60.402  42.362  1.00 57.05  ? 276  ALA A O     1 
ATOM   2089  C  CB    . ALA A  1  276 ? 33.636  60.813  39.417  1.00 59.27  ? 276  ALA A CB    1 
ATOM   2090  N  N     . ALA A  1  277 ? 31.885  62.246  42.016  1.00 54.73  ? 277  ALA A N     1 
ATOM   2091  C  CA    . ALA A  1  277 ? 32.045  62.642  43.398  1.00 53.55  ? 277  ALA A CA    1 
ATOM   2092  C  C     . ALA A  1  277 ? 30.899  62.186  44.271  1.00 53.56  ? 277  ALA A C     1 
ATOM   2093  O  O     . ALA A  1  277 ? 31.116  61.769  45.406  1.00 52.61  ? 277  ALA A O     1 
ATOM   2094  C  CB    . ALA A  1  277 ? 32.193  64.106  43.484  1.00 52.36  ? 277  ALA A CB    1 
ATOM   2095  N  N     . TRP A  1  278 ? 29.683  62.258  43.737  1.00 53.28  ? 278  TRP A N     1 
ATOM   2096  C  CA    . TRP A  1  278 ? 28.492  61.863  44.485  1.00 52.98  ? 278  TRP A CA    1 
ATOM   2097  C  C     . TRP A  1  278 ? 28.532  60.431  44.989  1.00 51.97  ? 278  TRP A C     1 
ATOM   2098  O  O     . TRP A  1  278 ? 28.442  60.199  46.178  1.00 50.73  ? 278  TRP A O     1 
ATOM   2099  C  CB    . TRP A  1  278 ? 27.216  62.083  43.659  1.00 53.60  ? 278  TRP A CB    1 
ATOM   2100  C  CG    . TRP A  1  278 ? 25.997  61.696  44.422  1.00 54.70  ? 278  TRP A CG    1 
ATOM   2101  C  CD1   . TRP A  1  278 ? 25.486  60.452  44.555  1.00 54.87  ? 278  TRP A CD1   1 
ATOM   2102  C  CD2   . TRP A  1  278 ? 25.194  62.546  45.233  1.00 55.39  ? 278  TRP A CD2   1 
ATOM   2103  N  NE1   . TRP A  1  278 ? 24.417  60.463  45.398  1.00 55.69  ? 278  TRP A NE1   1 
ATOM   2104  C  CE2   . TRP A  1  278 ? 24.215  61.743  45.834  1.00 56.31  ? 278  TRP A CE2   1 
ATOM   2105  C  CE3   . TRP A  1  278 ? 25.208  63.917  45.514  1.00 56.44  ? 278  TRP A CE3   1 
ATOM   2106  C  CZ2   . TRP A  1  278 ? 23.254  62.260  46.705  1.00 57.13  ? 278  TRP A CZ2   1 
ATOM   2107  C  CZ3   . TRP A  1  278 ? 24.252  64.434  46.380  1.00 56.38  ? 278  TRP A CZ3   1 
ATOM   2108  C  CH2   . TRP A  1  278 ? 23.290  63.603  46.965  1.00 56.67  ? 278  TRP A CH2   1 
ATOM   2109  N  N     . PRO A  1  279 ? 28.639  59.449  44.092  1.00 50.98  ? 279  PRO A N     1 
ATOM   2110  C  CA    . PRO A  1  279 ? 28.687  58.080  44.599  1.00 51.31  ? 279  PRO A CA    1 
ATOM   2111  C  C     . PRO A  1  279 ? 29.976  57.764  45.375  1.00 52.74  ? 279  PRO A C     1 
ATOM   2112  O  O     . PRO A  1  279 ? 29.934  57.077  46.388  1.00 54.36  ? 279  PRO A O     1 
ATOM   2113  C  CB    . PRO A  1  279 ? 28.518  57.246  43.343  1.00 50.28  ? 279  PRO A CB    1 
ATOM   2114  C  CG    . PRO A  1  279 ? 29.108  58.110  42.291  1.00 52.94  ? 279  PRO A CG    1 
ATOM   2115  C  CD    . PRO A  1  279 ? 28.555  59.453  42.626  1.00 51.97  ? 279  PRO A CD    1 
ATOM   2116  N  N     . VAL A  1  280 ? 31.115  58.276  44.942  1.00 52.62  ? 280  VAL A N     1 
ATOM   2117  C  CA    . VAL A  1  280 ? 32.340  58.001  45.671  1.00 51.85  ? 280  VAL A CA    1 
ATOM   2118  C  C     . VAL A  1  280 ? 32.278  58.539  47.089  1.00 53.04  ? 280  VAL A C     1 
ATOM   2119  O  O     . VAL A  1  280 ? 32.566  57.817  48.049  1.00 52.61  ? 280  VAL A O     1 
ATOM   2120  C  CB    . VAL A  1  280 ? 33.574  58.600  44.982  1.00 50.84  ? 280  VAL A CB    1 
ATOM   2121  C  CG1   . VAL A  1  280 ? 34.779  58.517  45.909  1.00 50.56  ? 280  VAL A CG1   1 
ATOM   2122  C  CG2   . VAL A  1  280 ? 33.867  57.834  43.708  1.00 51.33  ? 280  VAL A CG2   1 
ATOM   2123  N  N     . VAL A  1  281 ? 31.918  59.806  47.241  1.00 53.04  ? 281  VAL A N     1 
ATOM   2124  C  CA    . VAL A  1  281 ? 31.850  60.381  48.583  1.00 51.65  ? 281  VAL A CA    1 
ATOM   2125  C  C     . VAL A  1  281 ? 30.867  59.633  49.446  1.00 50.94  ? 281  VAL A C     1 
ATOM   2126  O  O     . VAL A  1  281 ? 31.129  59.389  50.607  1.00 48.09  ? 281  VAL A O     1 
ATOM   2127  C  CB    . VAL A  1  281 ? 31.436  61.843  48.549  1.00 52.46  ? 281  VAL A CB    1 
ATOM   2128  C  CG1   . VAL A  1  281 ? 31.149  62.306  49.956  1.00 52.70  ? 281  VAL A CG1   1 
ATOM   2129  C  CG2   . VAL A  1  281 ? 32.536  62.693  47.923  1.00 51.91  ? 281  VAL A CG2   1 
ATOM   2130  N  N     . GLY A  1  282 ? 29.737  59.276  48.856  1.00 52.22  ? 282  GLY A N     1 
ATOM   2131  C  CA    . GLY A  1  282 ? 28.698  58.546  49.555  1.00 54.00  ? 282  GLY A CA    1 
ATOM   2132  C  C     . GLY A  1  282 ? 29.109  57.139  49.954  1.00 54.88  ? 282  GLY A C     1 
ATOM   2133  O  O     . GLY A  1  282 ? 28.908  56.743  51.106  1.00 55.44  ? 282  GLY A O     1 
ATOM   2134  N  N     . VAL A  1  283 ? 29.671  56.380  49.014  1.00 53.09  ? 283  VAL A N     1 
ATOM   2135  C  CA    . VAL A  1  283 ? 30.134  55.023  49.292  1.00 52.20  ? 283  VAL A CA    1 
ATOM   2136  C  C     . VAL A  1  283 ? 31.291  55.027  50.266  1.00 52.15  ? 283  VAL A C     1 
ATOM   2137  O  O     . VAL A  1  283 ? 31.456  54.090  51.008  1.00 51.02  ? 283  VAL A O     1 
ATOM   2138  C  CB    . VAL A  1  283 ? 30.568  54.302  48.008  1.00 53.23  ? 283  VAL A CB    1 
ATOM   2139  C  CG1   . VAL A  1  283 ? 31.389  53.079  48.333  1.00 52.53  ? 283  VAL A CG1   1 
ATOM   2140  C  CG2   . VAL A  1  283 ? 29.343  53.894  47.227  1.00 54.28  ? 283  VAL A CG2   1 
ATOM   2141  N  N     . TRP A  1  284 ? 32.100  56.072  50.264  1.00 54.57  ? 284  TRP A N     1 
ATOM   2142  C  CA    . TRP A  1  284 ? 33.195  56.125  51.212  1.00 57.07  ? 284  TRP A CA    1 
ATOM   2143  C  C     . TRP A  1  284 ? 32.559  55.985  52.583  1.00 58.81  ? 284  TRP A C     1 
ATOM   2144  O  O     . TRP A  1  284 ? 32.882  55.076  53.342  1.00 59.61  ? 284  TRP A O     1 
ATOM   2145  C  CB    . TRP A  1  284 ? 33.956  57.451  51.134  1.00 58.33  ? 284  TRP A CB    1 
ATOM   2146  C  CG    . TRP A  1  284 ? 35.184  57.422  50.241  1.00 61.11  ? 284  TRP A CG    1 
ATOM   2147  C  CD1   . TRP A  1  284 ? 36.010  56.364  50.025  1.00 62.64  ? 284  TRP A CD1   1 
ATOM   2148  C  CD2   . TRP A  1  284 ? 35.750  58.522  49.510  1.00 61.22  ? 284  TRP A CD2   1 
ATOM   2149  N  NE1   . TRP A  1  284 ? 37.050  56.731  49.211  1.00 62.62  ? 284  TRP A NE1   1 
ATOM   2150  C  CE2   . TRP A  1  284 ? 36.915  58.051  48.881  1.00 61.40  ? 284  TRP A CE2   1 
ATOM   2151  C  CE3   . TRP A  1  284 ? 35.384  59.859  49.328  1.00 61.25  ? 284  TRP A CE3   1 
ATOM   2152  C  CZ2   . TRP A  1  284 ? 37.720  58.867  48.083  1.00 61.80  ? 284  TRP A CZ2   1 
ATOM   2153  C  CZ3   . TRP A  1  284 ? 36.184  60.670  48.534  1.00 61.57  ? 284  TRP A CZ3   1 
ATOM   2154  C  CH2   . TRP A  1  284 ? 37.338  60.169  47.923  1.00 62.03  ? 284  TRP A CH2   1 
ATOM   2155  N  N     . PHE A  1  285 ? 31.629  56.879  52.878  1.00 59.78  ? 285  PHE A N     1 
ATOM   2156  C  CA    . PHE A  1  285 ? 30.923  56.872  54.145  1.00 61.11  ? 285  PHE A CA    1 
ATOM   2157  C  C     . PHE A  1  285 ? 30.457  55.512  54.630  1.00 61.31  ? 285  PHE A C     1 
ATOM   2158  O  O     . PHE A  1  285 ? 30.761  55.157  55.770  1.00 62.70  ? 285  PHE A O     1 
ATOM   2159  C  CB    . PHE A  1  285 ? 29.740  57.830  54.106  1.00 62.59  ? 285  PHE A CB    1 
ATOM   2160  C  CG    . PHE A  1  285 ? 30.122  59.263  54.391  1.00 63.93  ? 285  PHE A CG    1 
ATOM   2161  C  CD1   . PHE A  1  285 ? 29.826  60.278  53.474  1.00 64.93  ? 285  PHE A CD1   1 
ATOM   2162  C  CD2   . PHE A  1  285 ? 30.839  59.592  55.541  1.00 63.56  ? 285  PHE A CD2   1 
ATOM   2163  C  CE1   . PHE A  1  285 ? 30.250  61.600  53.695  1.00 63.51  ? 285  PHE A CE1   1 
ATOM   2164  C  CE2   . PHE A  1  285 ? 31.264  60.903  55.766  1.00 63.27  ? 285  PHE A CE2   1 
ATOM   2165  C  CZ    . PHE A  1  285 ? 30.972  61.907  54.844  1.00 62.95  ? 285  PHE A CZ    1 
ATOM   2166  N  N     . THR A  1  286 ? 29.723  54.749  53.826  1.00 60.60  ? 286  THR A N     1 
ATOM   2167  C  CA    . THR A  1  286 ? 29.308  53.438  54.318  1.00 59.97  ? 286  THR A CA    1 
ATOM   2168  C  C     . THR A  1  286 ? 30.538  52.663  54.773  1.00 59.49  ? 286  THR A C     1 
ATOM   2169  O  O     . THR A  1  286 ? 30.497  51.982  55.791  1.00 59.09  ? 286  THR A O     1 
ATOM   2170  C  CB    . THR A  1  286 ? 28.562  52.597  53.276  1.00 60.47  ? 286  THR A CB    1 
ATOM   2171  O  OG1   . THR A  1  286 ? 28.908  53.023  51.964  1.00 63.08  ? 286  THR A OG1   1 
ATOM   2172  C  CG2   . THR A  1  286 ? 27.078  52.705  53.471  1.00 60.54  ? 286  THR A CG2   1 
ATOM   2173  N  N     . ALA A  1  287 ? 31.632  52.773  54.036  1.00 57.77  ? 287  ALA A N     1 
ATOM   2174  C  CA    . ALA A  1  287 ? 32.849  52.086  54.439  1.00 57.54  ? 287  ALA A CA    1 
ATOM   2175  C  C     . ALA A  1  287 ? 33.271  52.615  55.817  1.00 57.99  ? 287  ALA A C     1 
ATOM   2176  O  O     . ALA A  1  287 ? 33.781  51.880  56.655  1.00 58.74  ? 287  ALA A O     1 
ATOM   2177  C  CB    . ALA A  1  287 ? 33.937  52.322  53.422  1.00 58.16  ? 287  ALA A CB    1 
ATOM   2178  N  N     . LEU A  1  288 ? 33.056  53.902  56.037  1.00 58.33  ? 288  LEU A N     1 
ATOM   2179  C  CA    . LEU A  1  288 ? 33.379  54.528  57.301  1.00 58.24  ? 288  LEU A CA    1 
ATOM   2180  C  C     . LEU A  1  288 ? 32.328  54.169  58.322  1.00 58.26  ? 288  LEU A C     1 
ATOM   2181  O  O     . LEU A  1  288 ? 32.530  54.380  59.510  1.00 59.63  ? 288  LEU A O     1 
ATOM   2182  C  CB    . LEU A  1  288 ? 33.433  56.041  57.162  1.00 59.58  ? 288  LEU A CB    1 
ATOM   2183  C  CG    . LEU A  1  288 ? 34.640  56.591  56.422  1.00 60.96  ? 288  LEU A CG    1 
ATOM   2184  C  CD1   . LEU A  1  288 ? 34.494  58.095  56.333  1.00 62.67  ? 288  LEU A CD1   1 
ATOM   2185  C  CD2   . LEU A  1  288 ? 35.927  56.211  57.152  1.00 60.69  ? 288  LEU A CD2   1 
ATOM   2186  N  N     . GLY A  1  289 ? 31.197  53.645  57.873  1.00 56.53  ? 289  GLY A N     1 
ATOM   2187  C  CA    . GLY A  1  289 ? 30.154  53.258  58.811  1.00 55.92  ? 289  GLY A CA    1 
ATOM   2188  C  C     . GLY A  1  289 ? 30.492  51.894  59.376  1.00 54.85  ? 289  GLY A C     1 
ATOM   2189  O  O     . GLY A  1  289 ? 30.486  51.694  60.587  1.00 54.97  ? 289  GLY A O     1 
ATOM   2190  N  N     . ILE A  1  290 ? 30.784  50.956  58.482  1.00 52.04  ? 290  ILE A N     1 
ATOM   2191  C  CA    . ILE A  1  290 ? 31.163  49.613  58.865  1.00 49.75  ? 290  ILE A CA    1 
ATOM   2192  C  C     . ILE A  1  290 ? 32.432  49.723  59.681  1.00 49.18  ? 290  ILE A C     1 
ATOM   2193  O  O     . ILE A  1  290 ? 32.577  49.056  60.685  1.00 48.63  ? 290  ILE A O     1 
ATOM   2194  C  CB    . ILE A  1  290 ? 31.428  48.752  57.620  1.00 50.53  ? 290  ILE A CB    1 
ATOM   2195  C  CG1   . ILE A  1  290 ? 30.137  48.555  56.844  1.00 51.22  ? 290  ILE A CG1   1 
ATOM   2196  C  CG2   . ILE A  1  290 ? 31.977  47.418  57.995  1.00 48.53  ? 290  ILE A CG2   1 
ATOM   2197  C  CD1   . ILE A  1  290 ? 29.069  47.858  57.612  1.00 51.66  ? 290  ILE A CD1   1 
ATOM   2198  N  N     . SER A  1  291 ? 33.345  50.581  59.255  1.00 49.70  ? 291  SER A N     1 
ATOM   2199  C  CA    . SER A  1  291 ? 34.608  50.764  59.962  1.00 51.07  ? 291  SER A CA    1 
ATOM   2200  C  C     . SER A  1  291 ? 34.428  51.417  61.318  1.00 51.22  ? 291  SER A C     1 
ATOM   2201  O  O     . SER A  1  291 ? 35.239  51.243  62.221  1.00 50.32  ? 291  SER A O     1 
ATOM   2202  C  CB    . SER A  1  291 ? 35.558  51.602  59.126  1.00 52.72  ? 291  SER A CB    1 
ATOM   2203  O  OG    . SER A  1  291 ? 35.919  50.906  57.955  1.00 56.45  ? 291  SER A OG    1 
ATOM   2204  N  N     . THR A  1  292 ? 33.356  52.180  61.438  1.00 50.86  ? 292  THR A N     1 
ATOM   2205  C  CA    . THR A  1  292 ? 33.010  52.879  62.663  1.00 50.55  ? 292  THR A CA    1 
ATOM   2206  C  C     . THR A  1  292 ? 32.243  51.960  63.601  1.00 51.75  ? 292  THR A C     1 
ATOM   2207  O  O     . THR A  1  292 ? 32.560  51.861  64.782  1.00 51.12  ? 292  THR A O     1 
ATOM   2208  C  CB    . THR A  1  292 ? 32.156  54.118  62.337  1.00 51.26  ? 292  THR A CB    1 
ATOM   2209  O  OG1   . THR A  1  292 ? 33.020  55.244  62.170  1.00 52.22  ? 292  THR A OG1   1 
ATOM   2210  C  CG2   . THR A  1  292 ? 31.137  54.410  63.432  1.00 52.54  ? 292  THR A CG2   1 
ATOM   2211  N  N     . MET A  1  293 ? 31.229  51.292  63.071  1.00 52.43  ? 293  MET A N     1 
ATOM   2212  C  CA    . MET A  1  293 ? 30.437  50.385  63.875  1.00 53.19  ? 293  MET A CA    1 
ATOM   2213  C  C     . MET A  1  293 ? 31.269  49.161  64.214  1.00 53.35  ? 293  MET A C     1 
ATOM   2214  O  O     . MET A  1  293 ? 30.792  48.229  64.847  1.00 54.33  ? 293  MET A O     1 
ATOM   2215  C  CB    . MET A  1  293 ? 29.168  49.979  63.129  1.00 53.38  ? 293  MET A CB    1 
ATOM   2216  C  CG    . MET A  1  293 ? 28.095  51.051  63.121  1.00 55.07  ? 293  MET A CG    1 
ATOM   2217  S  SD    . MET A  1  293 ? 26.664  50.609  62.136  1.00 52.18  ? 293  MET A SD    1 
ATOM   2218  C  CE    . MET A  1  293 ? 26.959  51.434  60.695  1.00 54.00  ? 293  MET A CE    1 
ATOM   2219  N  N     . ALA A  1  294 ? 32.522  49.179  63.783  1.00 52.19  ? 294  ALA A N     1 
ATOM   2220  C  CA    . ALA A  1  294 ? 33.456  48.092  64.033  1.00 49.58  ? 294  ALA A CA    1 
ATOM   2221  C  C     . ALA A  1  294 ? 33.982  48.246  65.442  1.00 48.01  ? 294  ALA A C     1 
ATOM   2222  O  O     . ALA A  1  294 ? 34.480  47.303  66.041  1.00 48.42  ? 294  ALA A O     1 
ATOM   2223  C  CB    . ALA A  1  294 ? 34.587  48.178  63.059  1.00 50.17  ? 294  ALA A CB    1 
ATOM   2224  N  N     . PHE A  1  295 ? 33.867  49.458  65.961  1.00 46.20  ? 295  PHE A N     1 
ATOM   2225  C  CA    . PHE A  1  295 ? 34.333  49.753  67.293  1.00 46.31  ? 295  PHE A CA    1 
ATOM   2226  C  C     . PHE A  1  295 ? 33.181  50.045  68.203  1.00 47.26  ? 295  PHE A C     1 
ATOM   2227  O  O     . PHE A  1  295 ? 33.336  50.670  69.240  1.00 48.38  ? 295  PHE A O     1 
ATOM   2228  C  CB    . PHE A  1  295 ? 35.333  50.902  67.263  1.00 44.49  ? 295  PHE A CB    1 
ATOM   2229  C  CG    . PHE A  1  295 ? 36.582  50.567  66.523  1.00 45.31  ? 295  PHE A CG    1 
ATOM   2230  C  CD1   . PHE A  1  295 ? 36.789  51.035  65.244  1.00 43.90  ? 295  PHE A CD1   1 
ATOM   2231  C  CD2   . PHE A  1  295 ? 37.533  49.723  67.087  1.00 46.78  ? 295  PHE A CD2   1 
ATOM   2232  C  CE1   . PHE A  1  295 ? 37.916  50.665  64.541  1.00 45.31  ? 295  PHE A CE1   1 
ATOM   2233  C  CE2   . PHE A  1  295 ? 38.669  49.346  66.386  1.00 45.87  ? 295  PHE A CE2   1 
ATOM   2234  C  CZ    . PHE A  1  295 ? 38.858  49.816  65.115  1.00 45.84  ? 295  PHE A CZ    1 
ATOM   2235  N  N     . ASN A  1  296 ? 32.013  49.579  67.792  1.00 48.25  ? 296  ASN A N     1 
ATOM   2236  C  CA    . ASN A  1  296 ? 30.777  49.697  68.557  1.00 49.62  ? 296  ASN A CA    1 
ATOM   2237  C  C     . ASN A  1  296 ? 30.119  51.048  68.814  1.00 49.58  ? 296  ASN A C     1 
ATOM   2238  O  O     . ASN A  1  296 ? 29.510  51.255  69.858  1.00 50.71  ? 296  ASN A O     1 
ATOM   2239  C  CB    . ASN A  1  296 ? 30.946  48.946  69.869  1.00 50.47  ? 296  ASN A CB    1 
ATOM   2240  C  CG    . ASN A  1  296 ? 31.112  47.455  69.660  1.00 52.21  ? 296  ASN A CG    1 
ATOM   2241  O  OD1   . ASN A  1  296 ? 31.753  46.780  70.452  1.00 53.69  ? 296  ASN A OD1   1 
ATOM   2242  N  ND2   . ASN A  1  296 ? 30.524  46.935  68.592  1.00 51.65  ? 296  ASN A ND2   1 
ATOM   2243  N  N     . LEU A  1  297 ? 30.255  51.963  67.865  1.00 49.71  ? 297  LEU A N     1 
ATOM   2244  C  CA    . LEU A  1  297 ? 29.583  53.246  67.938  1.00 50.32  ? 297  LEU A CA    1 
ATOM   2245  C  C     . LEU A  1  297 ? 28.508  52.923  66.897  1.00 52.15  ? 297  LEU A C     1 
ATOM   2246  O  O     . LEU A  1  297 ? 28.704  53.098  65.685  1.00 53.50  ? 297  LEU A O     1 
ATOM   2247  C  CB    . LEU A  1  297 ? 30.480  54.368  67.446  1.00 48.31  ? 297  LEU A CB    1 
ATOM   2248  C  CG    . LEU A  1  297 ? 30.119  55.779  67.895  1.00 48.31  ? 297  LEU A CG    1 
ATOM   2249  C  CD1   . LEU A  1  297 ? 30.747  56.746  66.927  1.00 47.40  ? 297  LEU A CD1   1 
ATOM   2250  C  CD2   . LEU A  1  297 ? 28.630  55.974  67.927  1.00 47.16  ? 297  LEU A CD2   1 
ATOM   2251  N  N     . ASN A  1  298 ? 27.378  52.426  67.375  1.00 52.18  ? 298  ASN A N     1 
ATOM   2252  C  CA    . ASN A  1  298 ? 26.299  51.983  66.504  1.00 51.41  ? 298  ASN A CA    1 
ATOM   2253  C  C     . ASN A  1  298 ? 25.347  53.052  66.027  1.00 50.62  ? 298  ASN A C     1 
ATOM   2254  O  O     . ASN A  1  298 ? 25.588  54.228  66.218  1.00 50.60  ? 298  ASN A O     1 
ATOM   2255  C  CB    . ASN A  1  298 ? 25.545  50.869  67.229  1.00 53.36  ? 298  ASN A CB    1 
ATOM   2256  C  CG    . ASN A  1  298 ? 26.479  49.733  67.698  1.00 54.30  ? 298  ASN A CG    1 
ATOM   2257  O  OD1   . ASN A  1  298 ? 27.623  49.969  68.089  1.00 54.08  ? 298  ASN A OD1   1 
ATOM   2258  N  ND2   . ASN A  1  298 ? 25.977  48.504  67.671  1.00 54.17  ? 298  ASN A ND2   1 
ATOM   2259  N  N     . GLY A  1  299 ? 24.262  52.638  65.404  1.00 50.18  ? 299  GLY A N     1 
ATOM   2260  C  CA    . GLY A  1  299 ? 23.309  53.599  64.888  1.00 50.74  ? 299  GLY A CA    1 
ATOM   2261  C  C     . GLY A  1  299 ? 22.519  54.316  65.959  1.00 52.98  ? 299  GLY A C     1 
ATOM   2262  O  O     . GLY A  1  299 ? 22.738  54.082  67.141  1.00 55.06  ? 299  GLY A O     1 
ATOM   2263  N  N     . PHE A  1  300 ? 21.593  55.183  65.559  1.00 53.07  ? 300  PHE A N     1 
ATOM   2264  C  CA    . PHE A  1  300 ? 20.779  55.918  66.527  1.00 52.68  ? 300  PHE A CA    1 
ATOM   2265  C  C     . PHE A  1  300 ? 19.904  54.975  67.330  1.00 52.66  ? 300  PHE A C     1 
ATOM   2266  O  O     . PHE A  1  300 ? 19.554  53.894  66.867  1.00 53.88  ? 300  PHE A O     1 
ATOM   2267  C  CB    . PHE A  1  300 ? 19.917  56.956  65.821  1.00 52.12  ? 300  PHE A CB    1 
ATOM   2268  C  CG    . PHE A  1  300 ? 20.660  58.204  65.465  1.00 50.48  ? 300  PHE A CG    1 
ATOM   2269  C  CD1   . PHE A  1  300 ? 20.574  58.742  64.199  1.00 49.18  ? 300  PHE A CD1   1 
ATOM   2270  C  CD2   . PHE A  1  300 ? 21.471  58.826  66.396  1.00 49.98  ? 300  PHE A CD2   1 
ATOM   2271  C  CE1   . PHE A  1  300 ? 21.289  59.876  63.874  1.00 49.76  ? 300  PHE A CE1   1 
ATOM   2272  C  CE2   . PHE A  1  300 ? 22.185  59.961  66.071  1.00 49.44  ? 300  PHE A CE2   1 
ATOM   2273  C  CZ    . PHE A  1  300 ? 22.098  60.486  64.814  1.00 48.49  ? 300  PHE A CZ    1 
ATOM   2274  N  N     . ASN A  1  301 ? 19.541  55.391  68.532  1.00 51.97  ? 301  ASN A N     1 
ATOM   2275  C  CA    . ASN A  1  301 ? 18.729  54.560  69.402  1.00 51.45  ? 301  ASN A CA    1 
ATOM   2276  C  C     . ASN A  1  301 ? 17.605  55.374  69.965  1.00 51.85  ? 301  ASN A C     1 
ATOM   2277  O  O     . ASN A  1  301 ? 17.837  56.192  70.829  1.00 49.89  ? 301  ASN A O     1 
ATOM   2278  C  CB    . ASN A  1  301 ? 19.583  54.046  70.542  1.00 51.55  ? 301  ASN A CB    1 
ATOM   2279  C  CG    . ASN A  1  301 ? 18.851  53.077  71.423  1.00 52.40  ? 301  ASN A CG    1 
ATOM   2280  O  OD1   . ASN A  1  301 ? 17.637  53.099  71.488  1.00 53.93  ? 301  ASN A OD1   1 
ATOM   2281  N  ND2   . ASN A  1  301 ? 19.592  52.221  72.122  1.00 54.20  ? 301  ASN A ND2   1 
ATOM   2282  N  N     . PHE A  1  302 ? 16.385  55.153  69.493  1.00 54.46  ? 302  PHE A N     1 
ATOM   2283  C  CA    . PHE A  1  302 ? 15.239  55.913  69.999  1.00 57.46  ? 302  PHE A CA    1 
ATOM   2284  C  C     . PHE A  1  302 ? 14.195  55.051  70.699  1.00 58.98  ? 302  PHE A C     1 
ATOM   2285  O  O     . PHE A  1  302 ? 13.007  55.374  70.703  1.00 59.32  ? 302  PHE A O     1 
ATOM   2286  C  CB    . PHE A  1  302 ? 14.576  56.688  68.868  1.00 56.49  ? 302  PHE A CB    1 
ATOM   2287  C  CG    . PHE A  1  302 ? 15.507  57.620  68.162  1.00 54.89  ? 302  PHE A CG    1 
ATOM   2288  C  CD1   . PHE A  1  302 ? 15.719  57.503  66.787  1.00 53.32  ? 302  PHE A CD1   1 
ATOM   2289  C  CD2   . PHE A  1  302 ? 16.188  58.597  68.866  1.00 53.45  ? 302  PHE A CD2   1 
ATOM   2290  C  CE1   . PHE A  1  302 ? 16.595  58.341  66.132  1.00 51.11  ? 302  PHE A CE1   1 
ATOM   2291  C  CE2   . PHE A  1  302 ? 17.070  59.444  68.218  1.00 53.90  ? 302  PHE A CE2   1 
ATOM   2292  C  CZ    . PHE A  1  302 ? 17.273  59.313  66.846  1.00 53.13  ? 302  PHE A CZ    1 
ATOM   2293  N  N     . ASN A  1  303 ? 14.655  53.954  71.285  1.00 59.75  ? 303  ASN A N     1 
ATOM   2294  C  CA    . ASN A  1  303 ? 13.792  53.032  71.992  1.00 61.84  ? 303  ASN A CA    1 
ATOM   2295  C  C     . ASN A  1  303 ? 13.279  53.617  73.294  1.00 63.41  ? 303  ASN A C     1 
ATOM   2296  O  O     . ASN A  1  303 ? 14.064  54.005  74.159  1.00 64.06  ? 303  ASN A O     1 
ATOM   2297  C  CB    . ASN A  1  303 ? 14.541  51.739  72.297  1.00 61.49  ? 303  ASN A CB    1 
ATOM   2298  C  CG    . ASN A  1  303 ? 15.033  51.056  71.065  1.00 60.37  ? 303  ASN A CG    1 
ATOM   2299  O  OD1   . ASN A  1  303 ? 14.263  50.732  70.181  1.00 60.33  ? 303  ASN A OD1   1 
ATOM   2300  N  ND2   . ASN A  1  303 ? 16.327  50.825  71.001  1.00 61.15  ? 303  ASN A ND2   1 
ATOM   2301  N  N     . HIS A  1  304 ? 11.961  53.651  73.439  1.00 64.31  ? 304  HIS A N     1 
ATOM   2302  C  CA    . HIS A  1  304 ? 11.350  54.178  74.642  1.00 65.13  ? 304  HIS A CA    1 
ATOM   2303  C  C     . HIS A  1  304 ? 11.528  55.683  74.788  1.00 65.56  ? 304  HIS A C     1 
ATOM   2304  O  O     . HIS A  1  304 ? 11.823  56.184  75.870  1.00 65.37  ? 304  HIS A O     1 
ATOM   2305  C  CB    . HIS A  1  304 ? 11.887  53.455  75.892  1.00 66.13  ? 304  HIS A CB    1 
ATOM   2306  C  CG    . HIS A  1  304 ? 11.307  52.085  76.105  1.00 68.13  ? 304  HIS A CG    1 
ATOM   2307  N  ND1   . HIS A  1  304 ? 11.421  51.069  75.180  1.00 69.82  ? 304  HIS A ND1   1 
ATOM   2308  C  CD2   . HIS A  1  304 ? 10.628  51.555  77.153  1.00 69.01  ? 304  HIS A CD2   1 
ATOM   2309  C  CE1   . HIS A  1  304 ? 10.843  49.974  75.645  1.00 69.57  ? 304  HIS A CE1   1 
ATOM   2310  N  NE2   . HIS A  1  304 ? 10.354  50.241  76.842  1.00 69.27  ? 304  HIS A NE2   1 
ATOM   2311  N  N     . SER A  1  305 ? 11.397  56.403  73.682  1.00 67.15  ? 305  SER A N     1 
ATOM   2312  C  CA    . SER A  1  305 ? 11.431  57.866  73.727  1.00 69.00  ? 305  SER A CA    1 
ATOM   2313  C  C     . SER A  1  305 ? 9.927   58.173  73.726  1.00 70.21  ? 305  SER A C     1 
ATOM   2314  O  O     . SER A  1  305 ? 9.135   57.338  74.194  1.00 72.79  ? 305  SER A O     1 
ATOM   2315  C  CB    . SER A  1  305 ? 12.098  58.448  72.493  1.00 68.22  ? 305  SER A CB    1 
ATOM   2316  O  OG    . SER A  1  305 ? 13.465  58.090  72.482  1.00 67.18  ? 305  SER A OG    1 
ATOM   2317  N  N     . VAL A  1  306 ? 9.500   59.313  73.213  1.00 69.37  ? 306  VAL A N     1 
ATOM   2318  C  CA    . VAL A  1  306 ? 8.064   59.583  73.222  1.00 68.92  ? 306  VAL A CA    1 
ATOM   2319  C  C     . VAL A  1  306 ? 7.307   58.812  74.296  1.00 69.45  ? 306  VAL A C     1 
ATOM   2320  O  O     . VAL A  1  306 ? 6.510   57.920  73.981  1.00 71.32  ? 306  VAL A O     1 
ATOM   2321  C  CB    . VAL A  1  306 ? 7.426   59.218  71.912  1.00 67.29  ? 306  VAL A CB    1 
ATOM   2322  C  CG1   . VAL A  1  306 ? 8.126   59.939  70.810  1.00 68.79  ? 306  VAL A CG1   1 
ATOM   2323  C  CG2   . VAL A  1  306 ? 7.500   57.705  71.705  1.00 68.29  ? 306  VAL A CG2   1 
ATOM   2324  N  N     . ILE A  1  307 ? 7.582   59.122  75.565  1.00 68.39  ? 307  ILE A N     1 
ATOM   2325  C  CA    . ILE A  1  307 ? 6.883   58.502  76.681  1.00 65.86  ? 307  ILE A CA    1 
ATOM   2326  C  C     . ILE A  1  307 ? 5.720   59.480  76.945  1.00 64.84  ? 307  ILE A C     1 
ATOM   2327  O  O     . ILE A  1  307 ? 5.873   60.683  76.713  1.00 63.91  ? 307  ILE A O     1 
ATOM   2328  C  CB    . ILE A  1  307 ? 7.809   58.382  77.920  1.00 66.92  ? 307  ILE A CB    1 
ATOM   2329  C  CG1   . ILE A  1  307 ? 7.112   57.579  79.014  1.00 68.59  ? 307  ILE A CG1   1 
ATOM   2330  C  CG2   . ILE A  1  307 ? 8.190   59.755  78.446  1.00 67.50  ? 307  ILE A CG2   1 
ATOM   2331  C  CD1   . ILE A  1  307 ? 8.029   57.189  80.196  1.00 70.42  ? 307  ILE A CD1   1 
ATOM   2332  N  N     . ASP A  1  308 ? 4.567   58.994  77.398  1.00 63.40  ? 308  ASP A N     1 
ATOM   2333  C  CA    . ASP A  1  308 ? 3.436   59.884  77.612  1.00 62.33  ? 308  ASP A CA    1 
ATOM   2334  C  C     . ASP A  1  308 ? 3.401   60.536  78.983  1.00 61.89  ? 308  ASP A C     1 
ATOM   2335  O  O     . ASP A  1  308 ? 4.368   60.455  79.738  1.00 62.75  ? 308  ASP A O     1 
ATOM   2336  C  CB    . ASP A  1  308 ? 2.118   59.149  77.317  1.00 63.35  ? 308  ASP A CB    1 
ATOM   2337  C  CG    . ASP A  1  308 ? 1.465   58.563  78.557  1.00 65.26  ? 308  ASP A CG    1 
ATOM   2338  O  OD1   . ASP A  1  308 ? 2.202   58.085  79.427  1.00 66.22  ? 308  ASP A OD1   1 
ATOM   2339  O  OD2   . ASP A  1  308 ? 0.214   58.561  78.654  1.00 65.54  ? 308  ASP A OD2   1 
ATOM   2340  N  N     . ALA A  1  309 ? 2.280   61.185  79.290  1.00 60.98  ? 309  ALA A N     1 
ATOM   2341  C  CA    . ALA A  1  309 ? 2.084   61.909  80.540  1.00 59.34  ? 309  ALA A CA    1 
ATOM   2342  C  C     . ALA A  1  309 ? 2.274   61.130  81.830  1.00 59.89  ? 309  ALA A C     1 
ATOM   2343  O  O     . ALA A  1  309 ? 2.838   61.653  82.783  1.00 59.93  ? 309  ALA A O     1 
ATOM   2344  C  CB    . ALA A  1  309 ? 0.732   62.550  80.538  1.00 57.88  ? 309  ALA A CB    1 
ATOM   2345  N  N     . LYS A  1  310 ? 1.800   59.893  81.867  1.00 59.93  ? 310  LYS A N     1 
ATOM   2346  C  CA    . LYS A  1  310 ? 1.907   59.049  83.068  1.00 60.18  ? 310  LYS A CA    1 
ATOM   2347  C  C     . LYS A  1  310 ? 3.257   58.335  83.149  1.00 59.46  ? 310  LYS A C     1 
ATOM   2348  O  O     . LYS A  1  310 ? 3.761   58.055  84.235  1.00 60.37  ? 310  LYS A O     1 
ATOM   2349  C  CB    . LYS A  1  310 ? 0.763   58.006  83.066  1.00 61.47  ? 310  LYS A CB    1 
ATOM   2350  C  CG    . LYS A  1  310 ? 0.631   57.046  84.268  1.00 58.63  ? 310  LYS A CG    1 
ATOM   2351  C  CD    . LYS A  1  310 ? -0.691  56.276  84.139  1.00 57.88  ? 310  LYS A CD    1 
ATOM   2352  C  CE    . LYS A  1  310 ? -0.940  55.292  85.263  1.00 57.98  ? 310  LYS A CE    1 
ATOM   2353  N  NZ    . LYS A  1  310 ? -0.137  54.069  85.087  1.00 56.98  ? 310  LYS A NZ    1 
ATOM   2354  N  N     . GLY A  1  311 ? 3.833   58.061  81.992  1.00 58.76  ? 311  GLY A N     1 
ATOM   2355  C  CA    . GLY A  1  311 ? 5.088   57.348  81.930  1.00 58.21  ? 311  GLY A CA    1 
ATOM   2356  C  C     . GLY A  1  311 ? 4.969   56.165  80.979  1.00 58.63  ? 311  GLY A C     1 
ATOM   2357  O  O     . GLY A  1  311 ? 5.944   55.444  80.788  1.00 59.89  ? 311  GLY A O     1 
ATOM   2358  N  N     . ASN A  1  312 ? 3.790   55.963  80.384  1.00 57.62  ? 312  ASN A N     1 
ATOM   2359  C  CA    . ASN A  1  312 ? 3.575   54.864  79.456  1.00 57.90  ? 312  ASN A CA    1 
ATOM   2360  C  C     . ASN A  1  312 ? 4.468   55.134  78.281  1.00 57.98  ? 312  ASN A C     1 
ATOM   2361  O  O     . ASN A  1  312 ? 4.555   56.267  77.843  1.00 59.04  ? 312  ASN A O     1 
ATOM   2362  C  CB    . ASN A  1  312 ? 2.142   54.823  78.924  1.00 59.12  ? 312  ASN A CB    1 
ATOM   2363  C  CG    . ASN A  1  312 ? 1.101   54.576  80.000  1.00 62.31  ? 312  ASN A CG    1 
ATOM   2364  O  OD1   . ASN A  1  312 ? 1.210   53.647  80.791  1.00 62.29  ? 312  ASN A OD1   1 
ATOM   2365  N  ND2   . ASN A  1  312 ? 0.057   55.405  80.009  1.00 64.01  ? 312  ASN A ND2   1 
ATOM   2366  N  N     . VAL A  1  313 ? 5.131   54.107  77.765  1.00 58.07  ? 313  VAL A N     1 
ATOM   2367  C  CA    . VAL A  1  313 ? 5.987   54.263  76.597  1.00 57.83  ? 313  VAL A CA    1 
ATOM   2368  C  C     . VAL A  1  313 ? 5.049   54.280  75.380  1.00 58.94  ? 313  VAL A C     1 
ATOM   2369  O  O     . VAL A  1  313 ? 4.192   53.403  75.244  1.00 58.92  ? 313  VAL A O     1 
ATOM   2370  C  CB    . VAL A  1  313 ? 6.966   53.096  76.491  1.00 56.84  ? 313  VAL A CB    1 
ATOM   2371  C  CG1   . VAL A  1  313 ? 7.987   53.363  75.414  1.00 57.62  ? 313  VAL A CG1   1 
ATOM   2372  C  CG2   . VAL A  1  313 ? 7.636   52.890  77.822  1.00 56.21  ? 313  VAL A CG2   1 
ATOM   2373  N  N     . ILE A  1  314 ? 5.216   55.256  74.489  1.00 59.26  ? 314  ILE A N     1 
ATOM   2374  C  CA    . ILE A  1  314 ? 4.316   55.363  73.343  1.00 59.74  ? 314  ILE A CA    1 
ATOM   2375  C  C     . ILE A  1  314 ? 4.727   54.692  72.061  1.00 60.96  ? 314  ILE A C     1 
ATOM   2376  O  O     . ILE A  1  314 ? 3.936   54.626  71.132  1.00 63.80  ? 314  ILE A O     1 
ATOM   2377  C  CB    . ILE A  1  314 ? 3.943   56.833  73.086  1.00 58.67  ? 314  ILE A CB    1 
ATOM   2378  C  CG1   . ILE A  1  314 ? 2.886   57.256  74.105  1.00 58.91  ? 314  ILE A CG1   1 
ATOM   2379  C  CG2   . ILE A  1  314 ? 3.349   57.035  71.737  1.00 58.12  ? 314  ILE A CG2   1 
ATOM   2380  C  CD1   . ILE A  1  314 ? 1.612   56.446  74.052  1.00 54.78  ? 314  ILE A CD1   1 
ATOM   2381  N  N     . ASN A  1  315 ? 5.940   54.165  71.989  1.00 62.22  ? 315  ASN A N     1 
ATOM   2382  C  CA    . ASN A  1  315 ? 6.370   53.446  70.774  1.00 61.69  ? 315  ASN A CA    1 
ATOM   2383  C  C     . ASN A  1  315 ? 6.237   54.233  69.464  1.00 61.38  ? 315  ASN A C     1 
ATOM   2384  O  O     . ASN A  1  315 ? 5.175   54.725  69.097  1.00 61.46  ? 315  ASN A O     1 
ATOM   2385  C  CB    . ASN A  1  315 ? 5.603   52.115  70.619  1.00 60.97  ? 315  ASN A CB    1 
ATOM   2386  C  CG    . ASN A  1  315 ? 6.201   50.975  71.446  1.00 61.04  ? 315  ASN A CG    1 
ATOM   2387  O  OD1   . ASN A  1  315 ? 6.437   49.889  70.927  1.00 62.42  ? 315  ASN A OD1   1 
ATOM   2388  N  ND2   . ASN A  1  315 ? 6.426   51.212  72.731  1.00 60.28  ? 315  ASN A ND2   1 
ATOM   2389  N  N     . THR A  1  316 ? 7.340   54.323  68.757  1.00 59.70  ? 316  THR A N     1 
ATOM   2390  C  CA    . THR A  1  316 ? 7.373   55.010  67.499  1.00 58.92  ? 316  THR A CA    1 
ATOM   2391  C  C     . THR A  1  316 ? 7.863   53.943  66.566  1.00 58.49  ? 316  THR A C     1 
ATOM   2392  O  O     . THR A  1  316 ? 8.132   52.841  67.017  1.00 59.60  ? 316  THR A O     1 
ATOM   2393  C  CB    . THR A  1  316 ? 8.343   56.149  67.591  1.00 58.99  ? 316  THR A CB    1 
ATOM   2394  O  OG1   . THR A  1  316 ? 9.603   55.672  68.059  1.00 58.50  ? 316  THR A OG1   1 
ATOM   2395  C  CG2   . THR A  1  316 ? 7.838   57.130  68.587  1.00 59.24  ? 316  THR A CG2   1 
ATOM   2396  N  N     . TRP A  1  317 ? 7.975   54.229  65.277  1.00 57.72  ? 317  TRP A N     1 
ATOM   2397  C  CA    . TRP A  1  317 ? 8.447   53.206  64.362  1.00 54.23  ? 317  TRP A CA    1 
ATOM   2398  C  C     . TRP A  1  317 ? 9.807   52.676  64.779  1.00 52.55  ? 317  TRP A C     1 
ATOM   2399  O  O     . TRP A  1  317 ? 10.153  51.543  64.495  1.00 52.07  ? 317  TRP A O     1 
ATOM   2400  C  CB    . TRP A  1  317 ? 8.501   53.744  62.941  1.00 54.85  ? 317  TRP A CB    1 
ATOM   2401  C  CG    . TRP A  1  317 ? 7.171   53.778  62.307  1.00 56.07  ? 317  TRP A CG    1 
ATOM   2402  C  CD1   . TRP A  1  317 ? 6.392   54.866  62.108  1.00 57.29  ? 317  TRP A CD1   1 
ATOM   2403  C  CD2   . TRP A  1  317 ? 6.423   52.646  61.833  1.00 55.72  ? 317  TRP A CD2   1 
ATOM   2404  N  NE1   . TRP A  1  317 ? 5.197   54.483  61.536  1.00 58.15  ? 317  TRP A NE1   1 
ATOM   2405  C  CE2   . TRP A  1  317 ? 5.196   53.126  61.364  1.00 55.88  ? 317  TRP A CE2   1 
ATOM   2406  C  CE3   . TRP A  1  317 ? 6.680   51.276  61.764  1.00 55.48  ? 317  TRP A CE3   1 
ATOM   2407  C  CZ2   . TRP A  1  317 ? 4.228   52.296  60.841  1.00 54.61  ? 317  TRP A CZ2   1 
ATOM   2408  C  CZ3   . TRP A  1  317 ? 5.717   50.450  61.241  1.00 55.12  ? 317  TRP A CZ3   1 
ATOM   2409  C  CH2   . TRP A  1  317 ? 4.503   50.963  60.787  1.00 54.67  ? 317  TRP A CH2   1 
ATOM   2410  N  N     . ALA A  1  318 ? 10.570  53.497  65.474  1.00 51.18  ? 318  ALA A N     1 
ATOM   2411  C  CA    . ALA A  1  318 ? 11.892  53.102  65.926  1.00 51.39  ? 318  ALA A CA    1 
ATOM   2412  C  C     . ALA A  1  318 ? 11.808  51.827  66.762  1.00 50.85  ? 318  ALA A C     1 
ATOM   2413  O  O     . ALA A  1  318 ? 12.757  51.048  66.806  1.00 51.33  ? 318  ALA A O     1 
ATOM   2414  C  CB    . ALA A  1  318 ? 12.534  54.234  66.741  1.00 51.45  ? 318  ALA A CB    1 
ATOM   2415  N  N     . ASP A  1  319 ? 10.670  51.625  67.414  1.00 49.56  ? 319  ASP A N     1 
ATOM   2416  C  CA    . ASP A  1  319 ? 10.461  50.458  68.249  1.00 48.01  ? 319  ASP A CA    1 
ATOM   2417  C  C     . ASP A  1  319 ? 10.044  49.215  67.496  1.00 46.74  ? 319  ASP A C     1 
ATOM   2418  O  O     . ASP A  1  319 ? 10.506  48.131  67.805  1.00 48.63  ? 319  ASP A O     1 
ATOM   2419  C  CB    . ASP A  1  319 ? 9.465   50.765  69.339  1.00 48.10  ? 319  ASP A CB    1 
ATOM   2420  C  CG    . ASP A  1  319 ? 10.017  51.738  70.356  1.00 50.29  ? 319  ASP A CG    1 
ATOM   2421  O  OD1   . ASP A  1  319 ? 9.726   52.938  70.250  1.00 52.04  ? 319  ASP A OD1   1 
ATOM   2422  O  OD2   . ASP A  1  319 ? 10.753  51.305  71.262  1.00 50.50  ? 319  ASP A OD2   1 
ATOM   2423  N  N     . ILE A  1  320 ? 9.176   49.337  66.515  1.00 44.55  ? 320  ILE A N     1 
ATOM   2424  C  CA    . ILE A  1  320 ? 8.826   48.154  65.753  1.00 43.09  ? 320  ILE A CA    1 
ATOM   2425  C  C     . ILE A  1  320 ? 10.110  47.654  65.143  1.00 43.62  ? 320  ILE A C     1 
ATOM   2426  O  O     . ILE A  1  320 ? 10.287  46.467  64.951  1.00 44.59  ? 320  ILE A O     1 
ATOM   2427  C  CB    . ILE A  1  320 ? 7.884   48.461  64.636  1.00 41.14  ? 320  ILE A CB    1 
ATOM   2428  C  CG1   . ILE A  1  320 ? 6.600   49.033  65.214  1.00 40.23  ? 320  ILE A CG1   1 
ATOM   2429  C  CG2   . ILE A  1  320 ? 7.677   47.229  63.813  1.00 39.85  ? 320  ILE A CG2   1 
ATOM   2430  C  CD1   . ILE A  1  320 ? 6.019   48.235  66.300  1.00 38.09  ? 320  ILE A CD1   1 
ATOM   2431  N  N     . ILE A  1  321 ? 10.993  48.583  64.816  1.00 43.69  ? 321  ILE A N     1 
ATOM   2432  C  CA    . ILE A  1  321 ? 12.288  48.241  64.263  1.00 43.69  ? 321  ILE A CA    1 
ATOM   2433  C  C     . ILE A  1  321 ? 12.971  47.335  65.270  1.00 45.15  ? 321  ILE A C     1 
ATOM   2434  O  O     . ILE A  1  321 ? 13.180  46.154  65.027  1.00 45.48  ? 321  ILE A O     1 
ATOM   2435  C  CB    . ILE A  1  321 ? 13.171  49.480  64.081  1.00 41.41  ? 321  ILE A CB    1 
ATOM   2436  C  CG1   . ILE A  1  321 ? 12.760  50.237  62.830  1.00 39.32  ? 321  ILE A CG1   1 
ATOM   2437  C  CG2   . ILE A  1  321 ? 14.614  49.079  63.994  1.00 40.64  ? 321  ILE A CG2   1 
ATOM   2438  C  CD1   . ILE A  1  321 ? 13.603  51.475  62.582  1.00 37.00  ? 321  ILE A CD1   1 
ATOM   2439  N  N     . ASN A  1  322 ? 13.303  47.916  66.414  1.00 46.26  ? 322  ASN A N     1 
ATOM   2440  C  CA    . ASN A  1  322 ? 13.995  47.231  67.513  1.00 48.84  ? 322  ASN A CA    1 
ATOM   2441  C  C     . ASN A  1  322 ? 13.370  45.919  67.871  1.00 50.95  ? 322  ASN A C     1 
ATOM   2442  O  O     . ASN A  1  322 ? 14.057  44.991  68.297  1.00 51.71  ? 322  ASN A O     1 
ATOM   2443  C  CB    . ASN A  1  322 ? 14.026  48.120  68.761  1.00 48.31  ? 322  ASN A CB    1 
ATOM   2444  C  CG    . ASN A  1  322 ? 15.046  47.671  69.777  1.00 48.66  ? 322  ASN A CG    1 
ATOM   2445  O  OD1   . ASN A  1  322 ? 14.727  46.942  70.710  1.00 48.61  ? 322  ASN A OD1   1 
ATOM   2446  N  ND2   . ASN A  1  322 ? 16.289  48.116  69.602  1.00 47.51  ? 322  ASN A ND2   1 
ATOM   2447  N  N     . ARG A  1  323 ? 12.058  45.844  67.702  1.00 53.19  ? 323  ARG A N     1 
ATOM   2448  C  CA    . ARG A  1  323 ? 11.329  44.630  68.025  1.00 54.15  ? 323  ARG A CA    1 
ATOM   2449  C  C     . ARG A  1  323 ? 11.789  43.546  67.066  1.00 54.35  ? 323  ARG A C     1 
ATOM   2450  O  O     . ARG A  1  323 ? 12.029  42.430  67.472  1.00 53.37  ? 323  ARG A O     1 
ATOM   2451  C  CB    . ARG A  1  323 ? 9.836   44.886  67.901  1.00 53.51  ? 323  ARG A CB    1 
ATOM   2452  C  CG    . ARG A  1  323 ? 9.016   43.972  68.720  1.00 53.98  ? 323  ARG A CG    1 
ATOM   2453  C  CD    . ARG A  1  323 ? 9.575   43.878  70.096  1.00 53.97  ? 323  ARG A CD    1 
ATOM   2454  N  NE    . ARG A  1  323 ? 8.864   42.861  70.852  1.00 56.77  ? 323  ARG A NE    1 
ATOM   2455  C  CZ    . ARG A  1  323 ? 9.279   42.386  72.012  1.00 57.35  ? 323  ARG A CZ    1 
ATOM   2456  N  NH1   . ARG A  1  323 ? 10.393  42.843  72.536  1.00 58.80  ? 323  ARG A NH1   1 
ATOM   2457  N  NH2   . ARG A  1  323 ? 8.592   41.452  72.636  1.00 59.77  ? 323  ARG A NH2   1 
ATOM   2458  N  N     . ALA A  1  324 ? 11.937  43.898  65.797  1.00 55.10  ? 324  ALA A N     1 
ATOM   2459  C  CA    . ALA A  1  324 ? 12.397  42.955  64.793  1.00 56.90  ? 324  ALA A CA    1 
ATOM   2460  C  C     . ALA A  1  324 ? 13.901  42.710  64.926  1.00 58.21  ? 324  ALA A C     1 
ATOM   2461  O  O     . ALA A  1  324 ? 14.421  41.695  64.461  1.00 59.81  ? 324  ALA A O     1 
ATOM   2462  C  CB    . ALA A  1  324 ? 12.082  43.466  63.409  1.00 55.40  ? 324  ALA A CB    1 
ATOM   2463  N  N     . ASN A  1  325 ? 14.601  43.646  65.547  1.00 57.48  ? 325  ASN A N     1 
ATOM   2464  C  CA    . ASN A  1  325 ? 16.032  43.493  65.724  1.00 57.21  ? 325  ASN A CA    1 
ATOM   2465  C  C     . ASN A  1  325 ? 16.303  42.479  66.814  1.00 56.72  ? 325  ASN A C     1 
ATOM   2466  O  O     . ASN A  1  325 ? 17.221  41.679  66.700  1.00 57.65  ? 325  ASN A O     1 
ATOM   2467  C  CB    . ASN A  1  325 ? 16.670  44.835  66.064  1.00 57.65  ? 325  ASN A CB    1 
ATOM   2468  C  CG    . ASN A  1  325 ? 17.022  45.629  64.835  1.00 59.29  ? 325  ASN A CG    1 
ATOM   2469  O  OD1   . ASN A  1  325 ? 18.017  45.352  64.182  1.00 60.73  ? 325  ASN A OD1   1 
ATOM   2470  N  ND2   . ASN A  1  325 ? 16.203  46.617  64.504  1.00 59.07  ? 325  ASN A ND2   1 
ATOM   2471  N  N     . LEU A  1  326 ? 15.503  42.507  67.873  1.00 55.42  ? 326  LEU A N     1 
ATOM   2472  C  CA    . LEU A  1  326 ? 15.660  41.566  68.977  1.00 53.59  ? 326  LEU A CA    1 
ATOM   2473  C  C     . LEU A  1  326 ? 15.563  40.172  68.431  1.00 53.02  ? 326  LEU A C     1 
ATOM   2474  O  O     . LEU A  1  326 ? 16.419  39.345  68.692  1.00 52.30  ? 326  LEU A O     1 
ATOM   2475  C  CB    . LEU A  1  326 ? 14.560  41.744  70.006  1.00 53.29  ? 326  LEU A CB    1 
ATOM   2476  C  CG    . LEU A  1  326 ? 14.541  43.000  70.852  1.00 53.55  ? 326  LEU A CG    1 
ATOM   2477  C  CD1   . LEU A  1  326 ? 13.379  42.942  71.809  1.00 54.35  ? 326  LEU A CD1   1 
ATOM   2478  C  CD2   . LEU A  1  326 ? 15.817  43.094  71.613  1.00 52.24  ? 326  LEU A CD2   1 
ATOM   2479  N  N     . GLY A  1  327 ? 14.496  39.920  67.683  1.00 52.60  ? 327  GLY A N     1 
ATOM   2480  C  CA    . GLY A  1  327 ? 14.279  38.621  67.076  1.00 54.27  ? 327  GLY A CA    1 
ATOM   2481  C  C     . GLY A  1  327 ? 15.527  38.128  66.378  1.00 54.41  ? 327  GLY A C     1 
ATOM   2482  O  O     . GLY A  1  327 ? 15.808  36.947  66.356  1.00 55.42  ? 327  GLY A O     1 
ATOM   2483  N  N     . MET A  1  328 ? 16.278  39.039  65.797  1.00 54.24  ? 328  MET A N     1 
ATOM   2484  C  CA    . MET A  1  328 ? 17.508  38.667  65.135  1.00 53.20  ? 328  MET A CA    1 
ATOM   2485  C  C     . MET A  1  328 ? 18.539  38.384  66.221  1.00 52.27  ? 328  MET A C     1 
ATOM   2486  O  O     . MET A  1  328 ? 19.154  37.320  66.252  1.00 51.78  ? 328  MET A O     1 
ATOM   2487  C  CB    . MET A  1  328 ? 17.981  39.811  64.250  1.00 53.17  ? 328  MET A CB    1 
ATOM   2488  C  CG    . MET A  1  328 ? 17.067  40.124  63.090  1.00 55.63  ? 328  MET A CG    1 
ATOM   2489  S  SD    . MET A  1  328 ? 17.667  41.575  62.235  1.00 54.83  ? 328  MET A SD    1 
ATOM   2490  C  CE    . MET A  1  328 ? 16.253  42.577  62.170  1.00 58.10  ? 328  MET A CE    1 
ATOM   2491  N  N     . GLU A  1  329 ? 18.707  39.341  67.122  1.00 50.93  ? 329  GLU A N     1 
ATOM   2492  C  CA    . GLU A  1  329 ? 19.675  39.215  68.204  1.00 50.36  ? 329  GLU A CA    1 
ATOM   2493  C  C     . GLU A  1  329 ? 19.590  37.909  68.943  1.00 50.01  ? 329  GLU A C     1 
ATOM   2494  O  O     . GLU A  1  329 ? 20.595  37.315  69.280  1.00 49.77  ? 329  GLU A O     1 
ATOM   2495  C  CB    . GLU A  1  329 ? 19.516  40.329  69.230  1.00 51.64  ? 329  GLU A CB    1 
ATOM   2496  C  CG    . GLU A  1  329 ? 20.429  40.109  70.413  1.00 54.34  ? 329  GLU A CG    1 
ATOM   2497  C  CD    . GLU A  1  329 ? 20.162  41.045  71.567  1.00 57.52  ? 329  GLU A CD    1 
ATOM   2498  O  OE1   . GLU A  1  329 ? 20.545  40.704  72.709  1.00 58.33  ? 329  GLU A OE1   1 
ATOM   2499  O  OE2   . GLU A  1  329 ? 19.582  42.125  71.345  1.00 58.89  ? 329  GLU A OE2   1 
ATOM   2500  N  N     . VAL A  1  330 ? 18.372  37.479  69.211  1.00 49.01  ? 330  VAL A N     1 
ATOM   2501  C  CA    . VAL A  1  330 ? 18.138  36.256  69.941  1.00 48.04  ? 330  VAL A CA    1 
ATOM   2502  C  C     . VAL A  1  330 ? 18.493  34.948  69.225  1.00 49.12  ? 330  VAL A C     1 
ATOM   2503  O  O     . VAL A  1  330 ? 19.305  34.155  69.713  1.00 51.13  ? 330  VAL A O     1 
ATOM   2504  C  CB    . VAL A  1  330 ? 16.697  36.214  70.376  1.00 46.84  ? 330  VAL A CB    1 
ATOM   2505  C  CG1   . VAL A  1  330 ? 16.354  34.881  70.915  1.00 47.25  ? 330  VAL A CG1   1 
ATOM   2506  C  CG2   . VAL A  1  330 ? 16.476  37.273  71.407  1.00 46.42  ? 330  VAL A CG2   1 
ATOM   2507  N  N     . MET A  1  331 ? 17.902  34.719  68.067  1.00 48.30  ? 331  MET A N     1 
ATOM   2508  C  CA    . MET A  1  331 ? 18.150  33.480  67.352  1.00 47.65  ? 331  MET A CA    1 
ATOM   2509  C  C     . MET A  1  331 ? 19.522  33.285  66.737  1.00 47.33  ? 331  MET A C     1 
ATOM   2510  O  O     . MET A  1  331 ? 19.925  32.141  66.505  1.00 46.51  ? 331  MET A O     1 
ATOM   2511  C  CB    . MET A  1  331 ? 17.114  33.301  66.254  1.00 47.69  ? 331  MET A CB    1 
ATOM   2512  C  CG    . MET A  1  331 ? 15.699  33.301  66.734  1.00 50.88  ? 331  MET A CG    1 
ATOM   2513  S  SD    . MET A  1  331 ? 15.376  31.888  67.706  1.00 56.10  ? 331  MET A SD    1 
ATOM   2514  C  CE    . MET A  1  331 ? 15.449  30.637  66.414  1.00 54.15  ? 331  MET A CE    1 
ATOM   2515  N  N     . HIS A  1  332 ? 20.248  34.370  66.477  1.00 46.62  ? 332  HIS A N     1 
ATOM   2516  C  CA    . HIS A  1  332 ? 21.543  34.236  65.824  1.00 45.81  ? 332  HIS A CA    1 
ATOM   2517  C  C     . HIS A  1  332 ? 22.550  33.564  66.699  1.00 45.18  ? 332  HIS A C     1 
ATOM   2518  O  O     . HIS A  1  332 ? 22.644  33.853  67.874  1.00 43.62  ? 332  HIS A O     1 
ATOM   2519  C  CB    . HIS A  1  332 ? 22.084  35.582  65.386  1.00 47.31  ? 332  HIS A CB    1 
ATOM   2520  C  CG    . HIS A  1  332 ? 22.902  36.258  66.425  1.00 48.42  ? 332  HIS A CG    1 
ATOM   2521  N  ND1   . HIS A  1  332 ? 22.383  36.644  67.635  1.00 49.81  ? 332  HIS A ND1   1 
ATOM   2522  C  CD2   . HIS A  1  332 ? 24.206  36.617  66.439  1.00 50.11  ? 332  HIS A CD2   1 
ATOM   2523  C  CE1   . HIS A  1  332 ? 23.334  37.218  68.351  1.00 52.92  ? 332  HIS A CE1   1 
ATOM   2524  N  NE2   . HIS A  1  332 ? 24.451  37.215  67.648  1.00 51.41  ? 332  HIS A NE2   1 
ATOM   2525  N  N     . GLU A  1  333 ? 23.312  32.665  66.100  1.00 45.05  ? 333  GLU A N     1 
ATOM   2526  C  CA    . GLU A  1  333 ? 24.318  31.916  66.813  1.00 45.00  ? 333  GLU A CA    1 
ATOM   2527  C  C     . GLU A  1  333 ? 23.736  31.291  68.082  1.00 45.29  ? 333  GLU A C     1 
ATOM   2528  O  O     . GLU A  1  333 ? 24.273  31.413  69.184  1.00 46.22  ? 333  GLU A O     1 
ATOM   2529  C  CB    . GLU A  1  333 ? 25.504  32.825  67.098  1.00 45.38  ? 333  GLU A CB    1 
ATOM   2530  C  CG    . GLU A  1  333 ? 26.510  32.823  65.953  1.00 46.79  ? 333  GLU A CG    1 
ATOM   2531  C  CD    . GLU A  1  333 ? 27.216  34.144  65.753  1.00 48.97  ? 333  GLU A CD    1 
ATOM   2532  O  OE1   . GLU A  1  333 ? 27.749  34.726  66.733  1.00 47.95  ? 333  GLU A OE1   1 
ATOM   2533  O  OE2   . GLU A  1  333 ? 27.243  34.593  64.586  1.00 50.51  ? 333  GLU A OE2   1 
ATOM   2534  N  N     . ARG A  1  334 ? 22.636  30.575  67.884  1.00 44.17  ? 334  ARG A N     1 
ATOM   2535  C  CA    . ARG A  1  334 ? 21.913  29.913  68.942  1.00 42.44  ? 334  ARG A CA    1 
ATOM   2536  C  C     . ARG A  1  334 ? 22.718  29.150  69.971  1.00 43.11  ? 334  ARG A C     1 
ATOM   2537  O  O     . ARG A  1  334 ? 22.405  29.204  71.144  1.00 43.80  ? 334  ARG A O     1 
ATOM   2538  C  CB    . ARG A  1  334 ? 20.887  28.987  68.322  1.00 40.88  ? 334  ARG A CB    1 
ATOM   2539  C  CG    . ARG A  1  334 ? 21.492  27.990  67.407  1.00 40.66  ? 334  ARG A CG    1 
ATOM   2540  C  CD    . ARG A  1  334 ? 20.500  27.538  66.392  1.00 44.12  ? 334  ARG A CD    1 
ATOM   2541  N  NE    . ARG A  1  334 ? 21.184  27.059  65.204  1.00 47.79  ? 334  ARG A NE    1 
ATOM   2542  C  CZ    . ARG A  1  334 ? 21.590  25.810  65.037  1.00 50.87  ? 334  ARG A CZ    1 
ATOM   2543  N  NH1   . ARG A  1  334 ? 21.370  24.915  65.985  1.00 51.95  ? 334  ARG A NH1   1 
ATOM   2544  N  NH2   . ARG A  1  334 ? 22.223  25.456  63.927  1.00 52.69  ? 334  ARG A NH2   1 
ATOM   2545  N  N     . ASN A  1  335 ? 23.753  28.454  69.554  1.00 43.59  ? 335  ASN A N     1 
ATOM   2546  C  CA    . ASN A  1  335 ? 24.530  27.666  70.498  1.00 44.14  ? 335  ASN A CA    1 
ATOM   2547  C  C     . ASN A  1  335 ? 25.851  28.260  70.916  1.00 45.74  ? 335  ASN A C     1 
ATOM   2548  O  O     . ASN A  1  335 ? 26.664  27.571  71.504  1.00 45.39  ? 335  ASN A O     1 
ATOM   2549  C  CB    . ASN A  1  335 ? 24.802  26.285  69.916  1.00 45.00  ? 335  ASN A CB    1 
ATOM   2550  C  CG    . ASN A  1  335 ? 23.542  25.534  69.590  1.00 44.29  ? 335  ASN A CG    1 
ATOM   2551  O  OD1   . ASN A  1  335 ? 22.732  25.262  70.460  1.00 47.81  ? 335  ASN A OD1   1 
ATOM   2552  N  ND2   . ASN A  1  335 ? 23.372  25.189  68.335  1.00 42.08  ? 335  ASN A ND2   1 
ATOM   2553  N  N     . ALA A  1  336 ? 26.077  29.530  70.649  1.00 45.56  ? 336  ALA A N     1 
ATOM   2554  C  CA    . ALA A  1  336 ? 27.362  30.080  71.001  1.00 46.59  ? 336  ALA A CA    1 
ATOM   2555  C  C     . ALA A  1  336 ? 27.409  30.948  72.219  1.00 48.94  ? 336  ALA A C     1 
ATOM   2556  O  O     . ALA A  1  336 ? 28.478  31.439  72.567  1.00 50.13  ? 336  ALA A O     1 
ATOM   2557  C  CB    . ALA A  1  336 ? 27.906  30.826  69.858  1.00 45.04  ? 336  ALA A CB    1 
ATOM   2558  N  N     . HIS A  1  337 ? 26.274  31.145  72.879  1.00 50.11  ? 337  HIS A N     1 
ATOM   2559  C  CA    . HIS A  1  337 ? 26.239  32.003  74.060  1.00 50.49  ? 337  HIS A CA    1 
ATOM   2560  C  C     . HIS A  1  337 ? 26.050  31.325  75.417  1.00 51.02  ? 337  HIS A C     1 
ATOM   2561  O  O     . HIS A  1  337 ? 25.216  30.434  75.563  1.00 51.26  ? 337  HIS A O     1 
ATOM   2562  C  CB    . HIS A  1  337 ? 25.169  33.082  73.888  1.00 51.08  ? 337  HIS A CB    1 
ATOM   2563  C  CG    . HIS A  1  337 ? 25.392  33.962  72.702  1.00 51.90  ? 337  HIS A CG    1 
ATOM   2564  N  ND1   . HIS A  1  337 ? 24.911  33.651  71.453  1.00 53.83  ? 337  HIS A ND1   1 
ATOM   2565  C  CD2   . HIS A  1  337 ? 26.103  35.102  72.558  1.00 52.14  ? 337  HIS A CD2   1 
ATOM   2566  C  CE1   . HIS A  1  337 ? 25.319  34.562  70.587  1.00 54.84  ? 337  HIS A CE1   1 
ATOM   2567  N  NE2   . HIS A  1  337 ? 26.045  35.452  71.232  1.00 54.10  ? 337  HIS A NE2   1 
ATOM   2568  N  N     . ASN A  1  338 ? 26.827  31.754  76.405  1.00 49.89  ? 338  ASN A N     1 
ATOM   2569  C  CA    . ASN A  1  338 ? 26.708  31.194  77.724  1.00 50.23  ? 338  ASN A CA    1 
ATOM   2570  C  C     . ASN A  1  338 ? 26.269  32.231  78.760  1.00 51.61  ? 338  ASN A C     1 
ATOM   2571  O  O     . ASN A  1  338 ? 25.806  31.876  79.844  1.00 53.23  ? 338  ASN A O     1 
ATOM   2572  C  CB    . ASN A  1  338 ? 28.028  30.593  78.147  1.00 50.89  ? 338  ASN A CB    1 
ATOM   2573  C  CG    . ASN A  1  338 ? 28.343  29.320  77.421  1.00 52.04  ? 338  ASN A CG    1 
ATOM   2574  O  OD1   . ASN A  1  338 ? 27.483  28.704  76.811  1.00 50.28  ? 338  ASN A OD1   1 
ATOM   2575  N  ND2   . ASN A  1  338 ? 29.586  28.899  77.506  1.00 53.33  ? 338  ASN A ND2   1 
ATOM   2576  N  N     . PHE A  1  339 ? 26.397  33.507  78.430  1.00 51.94  ? 339  PHE A N     1 
ATOM   2577  C  CA    . PHE A  1  339 ? 26.033  34.567  79.364  1.00 52.47  ? 339  PHE A CA    1 
ATOM   2578  C  C     . PHE A  1  339 ? 25.101  35.635  78.751  1.00 54.06  ? 339  PHE A C     1 
ATOM   2579  O  O     . PHE A  1  339 ? 25.045  35.794  77.538  1.00 54.81  ? 339  PHE A O     1 
ATOM   2580  C  CB    . PHE A  1  339 ? 27.321  35.155  79.905  1.00 51.12  ? 339  PHE A CB    1 
ATOM   2581  C  CG    . PHE A  1  339 ? 28.328  34.101  80.286  1.00 51.70  ? 339  PHE A CG    1 
ATOM   2582  C  CD1   . PHE A  1  339 ? 28.073  33.223  81.320  1.00 51.26  ? 339  PHE A CD1   1 
ATOM   2583  C  CD2   . PHE A  1  339 ? 29.516  33.959  79.582  1.00 51.22  ? 339  PHE A CD2   1 
ATOM   2584  C  CE1   . PHE A  1  339 ? 28.982  32.225  81.643  1.00 49.80  ? 339  PHE A CE1   1 
ATOM   2585  C  CE2   . PHE A  1  339 ? 30.427  32.958  79.905  1.00 48.43  ? 339  PHE A CE2   1 
ATOM   2586  C  CZ    . PHE A  1  339 ? 30.157  32.094  80.933  1.00 47.75  ? 339  PHE A CZ    1 
ATOM   2587  N  N     . PRO A  1  340 ? 24.359  36.376  79.594  1.00 53.85  ? 340  PRO A N     1 
ATOM   2588  C  CA    . PRO A  1  340 ? 23.395  37.426  79.255  1.00 53.93  ? 340  PRO A CA    1 
ATOM   2589  C  C     . PRO A  1  340 ? 23.707  38.481  78.181  1.00 55.75  ? 340  PRO A C     1 
ATOM   2590  O  O     . PRO A  1  340 ? 22.862  38.772  77.335  1.00 55.25  ? 340  PRO A O     1 
ATOM   2591  C  CB    . PRO A  1  340 ? 23.134  38.074  80.603  1.00 53.40  ? 340  PRO A CB    1 
ATOM   2592  C  CG    . PRO A  1  340 ? 23.271  36.972  81.535  1.00 52.09  ? 340  PRO A CG    1 
ATOM   2593  C  CD    . PRO A  1  340 ? 24.515  36.308  81.056  1.00 53.95  ? 340  PRO A CD    1 
ATOM   2594  N  N     . LEU A  1  341 ? 24.900  39.066  78.220  1.00 57.04  ? 341  LEU A N     1 
ATOM   2595  C  CA    . LEU A  1  341 ? 25.255  40.132  77.272  1.00 57.31  ? 341  LEU A CA    1 
ATOM   2596  C  C     . LEU A  1  341 ? 26.134  39.720  76.085  1.00 58.43  ? 341  LEU A C     1 
ATOM   2597  O  O     . LEU A  1  341 ? 27.132  39.032  76.248  1.00 58.30  ? 341  LEU A O     1 
ATOM   2598  C  CB    . LEU A  1  341 ? 25.937  41.266  78.033  1.00 56.30  ? 341  LEU A CB    1 
ATOM   2599  C  CG    . LEU A  1  341 ? 25.333  41.573  79.398  1.00 57.64  ? 341  LEU A CG    1 
ATOM   2600  C  CD1   . LEU A  1  341 ? 26.020  42.758  79.996  1.00 58.00  ? 341  LEU A CD1   1 
ATOM   2601  C  CD2   . LEU A  1  341 ? 23.853  41.853  79.275  1.00 58.42  ? 341  LEU A CD2   1 
ATOM   2602  N  N     . ASP A  1  342 ? 25.767  40.170  74.895  1.00 58.66  ? 342  ASP A N     1 
ATOM   2603  C  CA    . ASP A  1  342 ? 26.515  39.847  73.693  1.00 60.29  ? 342  ASP A CA    1 
ATOM   2604  C  C     . ASP A  1  342 ? 27.630  40.873  73.519  1.00 62.29  ? 342  ASP A C     1 
ATOM   2605  O  O     . ASP A  1  342 ? 27.470  41.837  72.787  1.00 63.48  ? 342  ASP A O     1 
ATOM   2606  C  CB    . ASP A  1  342 ? 25.577  39.871  72.478  1.00 60.43  ? 342  ASP A CB    1 
ATOM   2607  C  CG    . ASP A  1  342 ? 26.216  39.287  71.210  1.00 63.40  ? 342  ASP A CG    1 
ATOM   2608  O  OD1   . ASP A  1  342 ? 27.427  38.988  71.227  1.00 64.19  ? 342  ASP A OD1   1 
ATOM   2609  O  OD2   . ASP A  1  342 ? 25.513  39.123  70.179  1.00 63.77  ? 342  ASP A OD2   1 
ATOM   2610  N  N     . LEU A  1  343 ? 28.755  40.671  74.194  1.00 64.21  ? 343  LEU A N     1 
ATOM   2611  C  CA    . LEU A  1  343 ? 29.886  41.591  74.088  1.00 66.35  ? 343  LEU A CA    1 
ATOM   2612  C  C     . LEU A  1  343 ? 30.993  41.021  73.188  1.00 69.06  ? 343  LEU A C     1 
ATOM   2613  O  O     . LEU A  1  343 ? 32.182  41.150  73.506  1.00 69.25  ? 343  LEU A O     1 
ATOM   2614  C  CB    . LEU A  1  343 ? 30.465  41.872  75.468  1.00 64.70  ? 343  LEU A CB    1 
ATOM   2615  C  CG    . LEU A  1  343 ? 29.434  41.986  76.575  1.00 63.46  ? 343  LEU A CG    1 
ATOM   2616  C  CD1   . LEU A  1  343 ? 30.135  42.133  77.886  1.00 62.63  ? 343  LEU A CD1   1 
ATOM   2617  C  CD2   . LEU A  1  343 ? 28.536  43.150  76.313  1.00 62.43  ? 343  LEU A CD2   1 
ATOM   2618  N  N     . ALA A  1  344 ? 30.591  40.388  72.076  1.00 71.12  ? 344  ALA A N     1 
ATOM   2619  C  CA    . ALA A  1  344 ? 31.525  39.798  71.108  1.00 71.83  ? 344  ALA A CA    1 
ATOM   2620  C  C     . ALA A  1  344 ? 30.811  39.189  69.873  1.00 72.39  ? 344  ALA A C     1 
ATOM   2621  O  O     . ALA A  1  344 ? 30.820  39.825  68.780  1.00 73.77  ? 344  ALA A O     1 
ATOM   2622  C  CB    . ALA A  1  344 ? 32.398  38.734  71.818  1.00 71.85  ? 344  ALA A CB    1 
ATOM   2623  O  OXT   . ALA A  1  344 ? 30.216  38.092  69.986  1.00 72.94  ? 344  ALA A OXT   1 
ATOM   2624  N  N     . GLY B  2  2   ? 23.540  46.054  8.149   1.00 69.32  ? 2    GLY B N     1 
ATOM   2625  C  CA    . GLY B  2  2   ? 22.907  45.499  9.377   1.00 68.69  ? 2    GLY B CA    1 
ATOM   2626  C  C     . GLY B  2  2   ? 21.726  46.208  10.046  1.00 68.52  ? 2    GLY B C     1 
ATOM   2627  O  O     . GLY B  2  2   ? 21.695  47.433  10.232  1.00 67.89  ? 2    GLY B O     1 
ATOM   2628  N  N     . LEU B  2  3   ? 20.743  45.389  10.399  1.00 68.20  ? 3    LEU B N     1 
ATOM   2629  C  CA    . LEU B  2  3   ? 19.549  45.821  11.093  1.00 66.97  ? 3    LEU B CA    1 
ATOM   2630  C  C     . LEU B  2  3   ? 19.818  45.125  12.426  1.00 67.16  ? 3    LEU B C     1 
ATOM   2631  O  O     . LEU B  2  3   ? 20.320  44.002  12.446  1.00 68.43  ? 3    LEU B O     1 
ATOM   2632  C  CB    . LEU B  2  3   ? 18.314  45.249  10.393  1.00 65.77  ? 3    LEU B CB    1 
ATOM   2633  C  CG    . LEU B  2  3   ? 16.927  45.721  10.841  1.00 65.83  ? 3    LEU B CG    1 
ATOM   2634  C  CD1   . LEU B  2  3   ? 16.908  47.232  10.932  1.00 66.27  ? 3    LEU B CD1   1 
ATOM   2635  C  CD2   . LEU B  2  3   ? 15.865  45.252  9.861   1.00 64.31  ? 3    LEU B CD2   1 
ATOM   2636  N  N     . PRO B  2  4   ? 19.531  45.783  13.554  1.00 67.23  ? 4    PRO B N     1 
ATOM   2637  C  CA    . PRO B  2  4   ? 19.790  45.134  14.849  1.00 67.25  ? 4    PRO B CA    1 
ATOM   2638  C  C     . PRO B  2  4   ? 18.875  43.936  15.040  1.00 68.31  ? 4    PRO B C     1 
ATOM   2639  O  O     . PRO B  2  4   ? 17.828  43.854  14.384  1.00 69.77  ? 4    PRO B O     1 
ATOM   2640  C  CB    . PRO B  2  4   ? 19.489  46.237  15.855  1.00 68.22  ? 4    PRO B CB    1 
ATOM   2641  C  CG    . PRO B  2  4   ? 19.596  47.521  15.061  1.00 67.24  ? 4    PRO B CG    1 
ATOM   2642  C  CD    . PRO B  2  4   ? 19.009  47.146  13.735  1.00 66.83  ? 4    PRO B CD    1 
ATOM   2643  N  N     . TRP B  2  5   ? 19.235  43.012  15.931  1.00 68.75  ? 5    TRP B N     1 
ATOM   2644  C  CA    . TRP B  2  5   ? 18.368  41.836  16.135  1.00 67.33  ? 5    TRP B CA    1 
ATOM   2645  C  C     . TRP B  2  5   ? 17.013  42.249  16.716  1.00 66.62  ? 5    TRP B C     1 
ATOM   2646  O  O     . TRP B  2  5   ? 15.967  41.723  16.338  1.00 66.41  ? 5    TRP B O     1 
ATOM   2647  C  CB    . TRP B  2  5   ? 19.030  40.807  17.056  1.00 65.80  ? 5    TRP B CB    1 
ATOM   2648  C  CG    . TRP B  2  5   ? 19.355  41.329  18.389  1.00 66.12  ? 5    TRP B CG    1 
ATOM   2649  C  CD1   . TRP B  2  5   ? 20.478  41.999  18.747  1.00 66.20  ? 5    TRP B CD1   1 
ATOM   2650  C  CD2   . TRP B  2  5   ? 18.531  41.261  19.560  1.00 67.14  ? 5    TRP B CD2   1 
ATOM   2651  N  NE1   . TRP B  2  5   ? 20.417  42.359  20.081  1.00 66.89  ? 5    TRP B NE1   1 
ATOM   2652  C  CE2   . TRP B  2  5   ? 19.231  41.918  20.602  1.00 67.03  ? 5    TRP B CE2   1 
ATOM   2653  C  CE3   . TRP B  2  5   ? 17.265  40.713  19.833  1.00 67.66  ? 5    TRP B CE3   1 
ATOM   2654  C  CZ2   . TRP B  2  5   ? 18.711  42.040  21.894  1.00 67.77  ? 5    TRP B CZ2   1 
ATOM   2655  C  CZ3   . TRP B  2  5   ? 16.743  40.838  21.119  1.00 67.22  ? 5    TRP B CZ3   1 
ATOM   2656  C  CH2   . TRP B  2  5   ? 17.466  41.495  22.131  1.00 68.04  ? 5    TRP B CH2   1 
ATOM   2657  N  N     . TYR B  2  6   ? 17.036  43.214  17.614  1.00 64.97  ? 6    TYR B N     1 
ATOM   2658  C  CA    . TYR B  2  6   ? 15.812  43.642  18.225  1.00 64.63  ? 6    TYR B CA    1 
ATOM   2659  C  C     . TYR B  2  6   ? 14.926  44.484  17.301  1.00 64.56  ? 6    TYR B C     1 
ATOM   2660  O  O     . TYR B  2  6   ? 13.984  45.138  17.769  1.00 65.61  ? 6    TYR B O     1 
ATOM   2661  C  CB    . TYR B  2  6   ? 16.143  44.386  19.521  1.00 65.12  ? 6    TYR B CB    1 
ATOM   2662  C  CG    . TYR B  2  6   ? 17.100  45.540  19.352  1.00 65.64  ? 6    TYR B CG    1 
ATOM   2663  C  CD1   . TYR B  2  6   ? 16.637  46.826  19.044  1.00 65.01  ? 6    TYR B CD1   1 
ATOM   2664  C  CD2   . TYR B  2  6   ? 18.472  45.346  19.473  1.00 65.81  ? 6    TYR B CD2   1 
ATOM   2665  C  CE1   . TYR B  2  6   ? 17.522  47.887  18.859  1.00 65.23  ? 6    TYR B CE1   1 
ATOM   2666  C  CE2   . TYR B  2  6   ? 19.367  46.402  19.287  1.00 65.60  ? 6    TYR B CE2   1 
ATOM   2667  C  CZ    . TYR B  2  6   ? 18.884  47.663  18.978  1.00 65.44  ? 6    TYR B CZ    1 
ATOM   2668  O  OH    . TYR B  2  6   ? 19.777  48.677  18.755  1.00 66.49  ? 6    TYR B OH    1 
ATOM   2669  N  N     . ARG B  2  7   ? 15.207  44.457  15.996  1.00 63.65  ? 7    ARG B N     1 
ATOM   2670  C  CA    . ARG B  2  7   ? 14.413  45.221  15.033  1.00 62.36  ? 7    ARG B CA    1 
ATOM   2671  C  C     . ARG B  2  7   ? 13.986  44.361  13.855  1.00 61.10  ? 7    ARG B C     1 
ATOM   2672  O  O     . ARG B  2  7   ? 13.105  44.731  13.080  1.00 60.83  ? 7    ARG B O     1 
ATOM   2673  C  CB    . ARG B  2  7   ? 15.195  46.424  14.515  1.00 62.68  ? 7    ARG B CB    1 
ATOM   2674  C  CG    . ARG B  2  7   ? 15.384  47.534  15.529  1.00 64.85  ? 7    ARG B CG    1 
ATOM   2675  C  CD    . ARG B  2  7   ? 16.073  48.710  14.890  1.00 67.01  ? 7    ARG B CD    1 
ATOM   2676  N  NE    . ARG B  2  7   ? 16.361  49.782  15.837  1.00 71.21  ? 7    ARG B NE    1 
ATOM   2677  C  CZ    . ARG B  2  7   ? 17.004  50.905  15.503  1.00 73.89  ? 7    ARG B CZ    1 
ATOM   2678  N  NH1   . ARG B  2  7   ? 17.421  51.090  14.253  1.00 75.33  ? 7    ARG B NH1   1 
ATOM   2679  N  NH2   . ARG B  2  7   ? 17.232  51.851  16.404  1.00 73.56  ? 7    ARG B NH2   1 
ATOM   2680  N  N     . VAL B  2  8   ? 14.608  43.201  13.734  1.00 59.77  ? 8    VAL B N     1 
ATOM   2681  C  CA    . VAL B  2  8   ? 14.295  42.307  12.644  1.00 59.20  ? 8    VAL B CA    1 
ATOM   2682  C  C     . VAL B  2  8   ? 12.836  42.350  12.194  1.00 58.66  ? 8    VAL B C     1 
ATOM   2683  O  O     . VAL B  2  8   ? 12.563  42.326  11.011  1.00 59.08  ? 8    VAL B O     1 
ATOM   2684  C  CB    . VAL B  2  8   ? 14.669  40.884  13.015  1.00 58.70  ? 8    VAL B CB    1 
ATOM   2685  C  CG1   . VAL B  2  8   ? 16.154  40.799  13.253  1.00 59.23  ? 8    VAL B CG1   1 
ATOM   2686  C  CG2   . VAL B  2  8   ? 13.917  40.463  14.239  1.00 58.55  ? 8    VAL B CG2   1 
ATOM   2687  N  N     . HIS B  2  9   ? 11.910  42.436  13.126  1.00 59.02  ? 9    HIS B N     1 
ATOM   2688  C  CA    . HIS B  2  9   ? 10.499  42.462  12.781  1.00 60.14  ? 9    HIS B CA    1 
ATOM   2689  C  C     . HIS B  2  9   ? 9.970   43.809  12.277  1.00 61.82  ? 9    HIS B C     1 
ATOM   2690  O  O     . HIS B  2  9   ? 8.760   44.027  12.211  1.00 62.10  ? 9    HIS B O     1 
ATOM   2691  C  CB    . HIS B  2  9   ? 9.669   42.027  13.980  1.00 58.80  ? 9    HIS B CB    1 
ATOM   2692  C  CG    . HIS B  2  9   ? 9.721   40.558  14.254  1.00 57.38  ? 9    HIS B CG    1 
ATOM   2693  N  ND1   . HIS B  2  9   ? 9.135   39.998  15.366  1.00 56.45  ? 9    HIS B ND1   1 
ATOM   2694  C  CD2   . HIS B  2  9   ? 10.274  39.534  13.562  1.00 56.21  ? 9    HIS B CD2   1 
ATOM   2695  C  CE1   . HIS B  2  9   ? 9.323   38.693  15.349  1.00 56.31  ? 9    HIS B CE1   1 
ATOM   2696  N  NE2   . HIS B  2  9   ? 10.011  38.385  14.266  1.00 55.81  ? 9    HIS B NE2   1 
ATOM   2697  N  N     . THR B  2  10  ? 10.874  44.711  11.929  1.00 63.15  ? 10   THR B N     1 
ATOM   2698  C  CA    . THR B  2  10  ? 10.481  46.022  11.425  1.00 63.92  ? 10   THR B CA    1 
ATOM   2699  C  C     . THR B  2  10  ? 10.081  45.904  9.936   1.00 63.54  ? 10   THR B C     1 
ATOM   2700  O  O     . THR B  2  10  ? 9.300   46.707  9.393   1.00 63.31  ? 10   THR B O     1 
ATOM   2701  C  CB    . THR B  2  10  ? 11.657  47.009  11.546  1.00 64.90  ? 10   THR B CB    1 
ATOM   2702  O  OG1   . THR B  2  10  ? 12.320  46.817  12.799  1.00 66.13  ? 10   THR B OG1   1 
ATOM   2703  C  CG2   . THR B  2  10  ? 11.157  48.432  11.486  1.00 66.34  ? 10   THR B CG2   1 
ATOM   2704  N  N     . VAL B  2  11  ? 10.638  44.888  9.296   1.00 62.76  ? 11   VAL B N     1 
ATOM   2705  C  CA    . VAL B  2  11  ? 10.412  44.610  7.894   1.00 62.10  ? 11   VAL B CA    1 
ATOM   2706  C  C     . VAL B  2  11  ? 8.930   44.412  7.580   1.00 61.20  ? 11   VAL B C     1 
ATOM   2707  O  O     . VAL B  2  11  ? 8.564   43.979  6.495   1.00 60.71  ? 11   VAL B O     1 
ATOM   2708  C  CB    . VAL B  2  11  ? 11.209  43.349  7.509   1.00 62.86  ? 11   VAL B CB    1 
ATOM   2709  C  CG1   . VAL B  2  11  ? 10.556  42.137  8.117   1.00 63.80  ? 11   VAL B CG1   1 
ATOM   2710  C  CG2   . VAL B  2  11  ? 11.314  43.213  6.011   1.00 64.82  ? 11   VAL B CG2   1 
ATOM   2711  N  N     . LEU B  2  12  ? 8.067   44.727  8.526   1.00 61.44  ? 12   LEU B N     1 
ATOM   2712  C  CA    . LEU B  2  12  ? 6.639   44.560  8.279   1.00 63.09  ? 12   LEU B CA    1 
ATOM   2713  C  C     . LEU B  2  12  ? 5.835   45.812  8.502   1.00 64.94  ? 12   LEU B C     1 
ATOM   2714  O  O     . LEU B  2  12  ? 4.625   45.788  8.291   1.00 65.97  ? 12   LEU B O     1 
ATOM   2715  C  CB    . LEU B  2  12  ? 6.042   43.492  9.178   1.00 61.62  ? 12   LEU B CB    1 
ATOM   2716  C  CG    . LEU B  2  12  ? 6.650   42.104  9.083   1.00 62.06  ? 12   LEU B CG    1 
ATOM   2717  C  CD1   . LEU B  2  12  ? 6.001   41.248  10.133  1.00 60.80  ? 12   LEU B CD1   1 
ATOM   2718  C  CD2   . LEU B  2  12  ? 6.453   41.529  7.704   1.00 59.68  ? 12   LEU B CD2   1 
ATOM   2719  N  N     . ILE B  2  13  ? 6.485   46.898  8.914   1.00 66.17  ? 13   ILE B N     1 
ATOM   2720  C  CA    . ILE B  2  13  ? 5.763   48.125  9.194   1.00 66.56  ? 13   ILE B CA    1 
ATOM   2721  C  C     . ILE B  2  13  ? 4.997   48.689  8.015   1.00 68.51  ? 13   ILE B C     1 
ATOM   2722  O  O     . ILE B  2  13  ? 4.209   49.619  8.182   1.00 70.32  ? 13   ILE B O     1 
ATOM   2723  C  CB    . ILE B  2  13  ? 6.684   49.195  9.749   1.00 66.32  ? 13   ILE B CB    1 
ATOM   2724  C  CG1   . ILE B  2  13  ? 7.541   48.582  10.850  1.00 66.43  ? 13   ILE B CG1   1 
ATOM   2725  C  CG2   . ILE B  2  13  ? 5.859   50.370  10.287  1.00 63.25  ? 13   ILE B CG2   1 
ATOM   2726  C  CD1   . ILE B  2  13  ? 8.105   49.575  11.815  1.00 69.82  ? 13   ILE B CD1   1 
ATOM   2727  N  N     . ASN B  2  14  ? 5.204   48.127  6.832   1.00 69.83  ? 14   ASN B N     1 
ATOM   2728  C  CA    . ASN B  2  14  ? 4.491   48.601  5.655   1.00 72.29  ? 14   ASN B CA    1 
ATOM   2729  C  C     . ASN B  2  14  ? 4.319   47.479  4.621   1.00 72.89  ? 14   ASN B C     1 
ATOM   2730  O  O     . ASN B  2  14  ? 4.494   47.675  3.406   1.00 73.84  ? 14   ASN B O     1 
ATOM   2731  C  CB    . ASN B  2  14  ? 5.248   49.773  5.044   1.00 73.95  ? 14   ASN B CB    1 
ATOM   2732  C  CG    . ASN B  2  14  ? 6.653   49.386  4.618   1.00 77.73  ? 14   ASN B CG    1 
ATOM   2733  O  OD1   . ASN B  2  14  ? 7.315   48.564  5.282   1.00 77.74  ? 14   ASN B OD1   1 
ATOM   2734  N  ND2   . ASN B  2  14  ? 7.126   49.977  3.512   1.00 77.97  ? 14   ASN B ND2   1 
ATOM   2735  N  N     . ASP B  2  15  ? 3.964   46.296  5.115   1.00 72.35  ? 15   ASP B N     1 
ATOM   2736  C  CA    . ASP B  2  15  ? 3.765   45.127  4.257   1.00 70.40  ? 15   ASP B CA    1 
ATOM   2737  C  C     . ASP B  2  15  ? 2.511   44.428  4.753   1.00 69.30  ? 15   ASP B C     1 
ATOM   2738  O  O     . ASP B  2  15  ? 2.562   43.279  5.172   1.00 68.70  ? 15   ASP B O     1 
ATOM   2739  C  CB    . ASP B  2  15  ? 4.965   44.181  4.375   1.00 70.71  ? 15   ASP B CB    1 
ATOM   2740  C  CG    . ASP B  2  15  ? 5.128   43.302  3.165   1.00 69.35  ? 15   ASP B CG    1 
ATOM   2741  O  OD1   . ASP B  2  15  ? 4.088   42.895  2.608   1.00 69.35  ? 15   ASP B OD1   1 
ATOM   2742  O  OD2   . ASP B  2  15  ? 6.287   43.022  2.774   1.00 69.23  ? 15   ASP B OD2   1 
ATOM   2743  N  N     . PRO B  2  16  ? 1.367   45.129  4.733   1.00 69.12  ? 16   PRO B N     1 
ATOM   2744  C  CA    . PRO B  2  16  ? 0.091   44.572  5.189   1.00 68.69  ? 16   PRO B CA    1 
ATOM   2745  C  C     . PRO B  2  16  ? -0.092  43.075  4.883   1.00 68.45  ? 16   PRO B C     1 
ATOM   2746  O  O     . PRO B  2  16  ? -0.861  42.385  5.550   1.00 67.54  ? 16   PRO B O     1 
ATOM   2747  C  CB    . PRO B  2  16  ? -0.920  45.464  4.480   1.00 68.13  ? 16   PRO B CB    1 
ATOM   2748  C  CG    . PRO B  2  16  ? -0.251  46.784  4.562   1.00 67.99  ? 16   PRO B CG    1 
ATOM   2749  C  CD    . PRO B  2  16  ? 1.154   46.459  4.133   1.00 68.52  ? 16   PRO B CD    1 
ATOM   2750  N  N     . GLY B  2  17  ? 0.609   42.572  3.878   1.00 67.55  ? 17   GLY B N     1 
ATOM   2751  C  CA    . GLY B  2  17  ? 0.483   41.163  3.567   1.00 65.87  ? 17   GLY B CA    1 
ATOM   2752  C  C     . GLY B  2  17  ? 1.334   40.356  4.525   1.00 65.58  ? 17   GLY B C     1 
ATOM   2753  O  O     . GLY B  2  17  ? 0.837   39.453  5.172   1.00 64.63  ? 17   GLY B O     1 
ATOM   2754  N  N     . ARG B  2  18  ? 2.621   40.694  4.609   1.00 67.07  ? 18   ARG B N     1 
ATOM   2755  C  CA    . ARG B  2  18  ? 3.572   40.005  5.487   1.00 67.15  ? 18   ARG B CA    1 
ATOM   2756  C  C     . ARG B  2  18  ? 3.294   40.360  6.947   1.00 67.48  ? 18   ARG B C     1 
ATOM   2757  O  O     . ARG B  2  18  ? 3.924   39.822  7.854   1.00 67.45  ? 18   ARG B O     1 
ATOM   2758  C  CB    . ARG B  2  18  ? 5.032   40.360  5.149   1.00 66.44  ? 18   ARG B CB    1 
ATOM   2759  C  CG    . ARG B  2  18  ? 5.499   40.053  3.716   1.00 66.84  ? 18   ARG B CG    1 
ATOM   2760  C  CD    . ARG B  2  18  ? 5.245   38.619  3.333   1.00 66.38  ? 18   ARG B CD    1 
ATOM   2761  N  NE    . ARG B  2  18  ? 5.939   38.196  2.116   1.00 67.27  ? 18   ARG B NE    1 
ATOM   2762  C  CZ    . ARG B  2  18  ? 7.250   38.306  1.901   1.00 66.49  ? 18   ARG B CZ    1 
ATOM   2763  N  NH1   . ARG B  2  18  ? 8.052   38.846  2.810   1.00 66.43  ? 18   ARG B NH1   1 
ATOM   2764  N  NH2   . ARG B  2  18  ? 7.771   37.817  0.789   1.00 65.07  ? 18   ARG B NH2   1 
ATOM   2765  N  N     . LEU B  2  19  ? 2.362   41.276  7.172   1.00 66.42  ? 19   LEU B N     1 
ATOM   2766  C  CA    . LEU B  2  19  ? 2.010   41.645  8.526   1.00 66.26  ? 19   LEU B CA    1 
ATOM   2767  C  C     . LEU B  2  19  ? 0.871   40.731  8.898   1.00 67.11  ? 19   LEU B C     1 
ATOM   2768  O  O     . LEU B  2  19  ? 0.843   40.158  9.987   1.00 68.50  ? 19   LEU B O     1 
ATOM   2769  C  CB    . LEU B  2  19  ? 1.514   43.076  8.602   1.00 66.02  ? 19   LEU B CB    1 
ATOM   2770  C  CG    . LEU B  2  19  ? 1.462   43.571  10.046  1.00 65.99  ? 19   LEU B CG    1 
ATOM   2771  C  CD1   . LEU B  2  19  ? 2.901   43.830  10.459  1.00 66.36  ? 19   LEU B CD1   1 
ATOM   2772  C  CD2   . LEU B  2  19  ? 0.621   44.831  10.190  1.00 64.48  ? 19   LEU B CD2   1 
ATOM   2773  N  N     . ILE B  2  20  ? -0.088  40.620  7.990   1.00 66.71  ? 20   ILE B N     1 
ATOM   2774  C  CA    . ILE B  2  20  ? -1.235  39.763  8.201   1.00 65.08  ? 20   ILE B CA    1 
ATOM   2775  C  C     . ILE B  2  20  ? -0.691  38.354  8.243   1.00 64.94  ? 20   ILE B C     1 
ATOM   2776  O  O     . ILE B  2  20  ? -1.207  37.506  8.969   1.00 65.28  ? 20   ILE B O     1 
ATOM   2777  C  CB    . ILE B  2  20  ? -2.245  39.926  7.056   1.00 65.50  ? 20   ILE B CB    1 
ATOM   2778  C  CG1   . ILE B  2  20  ? -3.119  41.133  7.342   1.00 66.57  ? 20   ILE B CG1   1 
ATOM   2779  C  CG2   . ILE B  2  20  ? -3.088  38.678  6.872   1.00 65.30  ? 20   ILE B CG2   1 
ATOM   2780  C  CD1   . ILE B  2  20  ? -3.931  41.532  6.156   1.00 69.45  ? 20   ILE B CD1   1 
ATOM   2781  N  N     . ALA B  2  21  ? 0.365   38.109  7.478   1.00 64.04  ? 21   ALA B N     1 
ATOM   2782  C  CA    . ALA B  2  21  ? 0.980   36.784  7.453   1.00 64.36  ? 21   ALA B CA    1 
ATOM   2783  C  C     . ALA B  2  21  ? 1.568   36.533  8.813   1.00 64.51  ? 21   ALA B C     1 
ATOM   2784  O  O     . ALA B  2  21  ? 1.426   35.443  9.353   1.00 65.95  ? 21   ALA B O     1 
ATOM   2785  C  CB    . ALA B  2  21  ? 2.076   36.704  6.402   1.00 63.84  ? 21   ALA B CB    1 
ATOM   2786  N  N     . ALA B  2  22  ? 2.232   37.545  9.361   1.00 63.97  ? 22   ALA B N     1 
ATOM   2787  C  CA    . ALA B  2  22  ? 2.843   37.427  10.666  1.00 62.77  ? 22   ALA B CA    1 
ATOM   2788  C  C     . ALA B  2  22  ? 1.745   37.204  11.661  1.00 62.63  ? 22   ALA B C     1 
ATOM   2789  O  O     . ALA B  2  22  ? 1.706   36.173  12.314  1.00 63.44  ? 22   ALA B O     1 
ATOM   2790  C  CB    . ALA B  2  22  ? 3.589   38.665  11.012  1.00 64.17  ? 22   ALA B CB    1 
ATOM   2791  N  N     . HIS B  2  23  ? 0.848   38.171  11.779  1.00 62.23  ? 23   HIS B N     1 
ATOM   2792  C  CA    . HIS B  2  23  ? -0.257  38.049  12.718  1.00 62.22  ? 23   HIS B CA    1 
ATOM   2793  C  C     . HIS B  2  23  ? -1.036  36.717  12.604  1.00 62.01  ? 23   HIS B C     1 
ATOM   2794  O  O     . HIS B  2  23  ? -1.595  36.230  13.593  1.00 60.57  ? 23   HIS B O     1 
ATOM   2795  C  CB    . HIS B  2  23  ? -1.203  39.234  12.563  1.00 63.12  ? 23   HIS B CB    1 
ATOM   2796  C  CG    . HIS B  2  23  ? -0.634  40.520  13.065  1.00 64.68  ? 23   HIS B CG    1 
ATOM   2797  N  ND1   . HIS B  2  23  ? -1.411  41.627  13.313  1.00 66.50  ? 23   HIS B ND1   1 
ATOM   2798  C  CD2   . HIS B  2  23  ? 0.631   40.873  13.392  1.00 65.86  ? 23   HIS B CD2   1 
ATOM   2799  C  CE1   . HIS B  2  23  ? -0.653  42.607  13.775  1.00 65.54  ? 23   HIS B CE1   1 
ATOM   2800  N  NE2   . HIS B  2  23  ? 0.591   42.176  13.834  1.00 65.52  ? 23   HIS B NE2   1 
ATOM   2801  N  N     . LEU B  2  24  ? -1.082  36.142  11.404  1.00 60.98  ? 24   LEU B N     1 
ATOM   2802  C  CA    . LEU B  2  24  ? -1.773  34.868  11.181  1.00 59.91  ? 24   LEU B CA    1 
ATOM   2803  C  C     . LEU B  2  24  ? -1.020  33.734  11.859  1.00 58.98  ? 24   LEU B C     1 
ATOM   2804  O  O     . LEU B  2  24  ? -1.626  32.781  12.327  1.00 60.32  ? 24   LEU B O     1 
ATOM   2805  C  CB    . LEU B  2  24  ? -1.866  34.556  9.686   1.00 61.21  ? 24   LEU B CB    1 
ATOM   2806  C  CG    . LEU B  2  24  ? -3.192  34.721  8.949   1.00 61.94  ? 24   LEU B CG    1 
ATOM   2807  C  CD1   . LEU B  2  24  ? -2.977  34.397  7.475   1.00 63.06  ? 24   LEU B CD1   1 
ATOM   2808  C  CD2   . LEU B  2  24  ? -4.231  33.813  9.539   1.00 59.78  ? 24   LEU B CD2   1 
ATOM   2809  N  N     . MET B  2  25  ? 0.303   33.840  11.891  1.00 57.62  ? 25   MET B N     1 
ATOM   2810  C  CA    . MET B  2  25  ? 1.157   32.839  12.501  1.00 56.57  ? 25   MET B CA    1 
ATOM   2811  C  C     . MET B  2  25  ? 1.066   32.891  14.027  1.00 57.24  ? 25   MET B C     1 
ATOM   2812  O  O     . MET B  2  25  ? 1.125   31.855  14.687  1.00 57.20  ? 25   MET B O     1 
ATOM   2813  C  CB    . MET B  2  25  ? 2.599   33.059  12.043  1.00 55.94  ? 25   MET B CB    1 
ATOM   2814  C  CG    . MET B  2  25  ? 3.562   31.981  12.421  1.00 54.40  ? 25   MET B CG    1 
ATOM   2815  S  SD    . MET B  2  25  ? 2.900   30.422  11.877  1.00 58.07  ? 25   MET B SD    1 
ATOM   2816  C  CE    . MET B  2  25  ? 3.819   30.132  10.428  1.00 54.76  ? 25   MET B CE    1 
ATOM   2817  N  N     . HIS B  2  26  ? 0.927   34.085  14.587  1.00 56.21  ? 26   HIS B N     1 
ATOM   2818  C  CA    . HIS B  2  26  ? 0.822   34.224  16.035  1.00 57.29  ? 26   HIS B CA    1 
ATOM   2819  C  C     . HIS B  2  26  ? -0.463  33.565  16.457  1.00 57.32  ? 26   HIS B C     1 
ATOM   2820  O  O     . HIS B  2  26  ? -0.471  32.712  17.327  1.00 58.93  ? 26   HIS B O     1 
ATOM   2821  C  CB    . HIS B  2  26  ? 0.804   35.704  16.456  1.00 58.57  ? 26   HIS B CB    1 
ATOM   2822  C  CG    . HIS B  2  26  ? 0.848   35.927  17.941  1.00 59.65  ? 26   HIS B CG    1 
ATOM   2823  N  ND1   . HIS B  2  26  ? -0.287  36.055  18.711  1.00 59.43  ? 26   HIS B ND1   1 
ATOM   2824  C  CD2   . HIS B  2  26  ? 1.896   36.048  18.794  1.00 60.79  ? 26   HIS B CD2   1 
ATOM   2825  C  CE1   . HIS B  2  26  ? 0.061   36.247  19.974  1.00 61.24  ? 26   HIS B CE1   1 
ATOM   2826  N  NE2   . HIS B  2  26  ? 1.380   36.248  20.052  1.00 59.53  ? 26   HIS B NE2   1 
ATOM   2827  N  N     . THR B  2  27  ? -1.557  33.961  15.839  1.00 57.60  ? 27   THR B N     1 
ATOM   2828  C  CA    . THR B  2  27  ? -2.834  33.370  16.178  1.00 56.72  ? 27   THR B CA    1 
ATOM   2829  C  C     . THR B  2  27  ? -2.641  31.855  16.069  1.00 55.86  ? 27   THR B C     1 
ATOM   2830  O  O     . THR B  2  27  ? -2.721  31.156  17.074  1.00 55.99  ? 27   THR B O     1 
ATOM   2831  C  CB    . THR B  2  27  ? -3.960  33.914  15.251  1.00 57.93  ? 27   THR B CB    1 
ATOM   2832  O  OG1   . THR B  2  27  ? -4.011  35.344  15.377  1.00 58.54  ? 27   THR B OG1   1 
ATOM   2833  C  CG2   . THR B  2  27  ? -5.322  33.363  15.644  1.00 57.95  ? 27   THR B CG2   1 
ATOM   2834  N  N     . ALA B  2  28  ? -2.339  31.342  14.885  1.00 53.99  ? 28   ALA B N     1 
ATOM   2835  C  CA    . ALA B  2  28  ? -2.145  29.900  14.728  1.00 54.03  ? 28   ALA B CA    1 
ATOM   2836  C  C     . ALA B  2  28  ? -1.390  29.239  15.893  1.00 54.36  ? 28   ALA B C     1 
ATOM   2837  O  O     . ALA B  2  28  ? -1.757  28.142  16.312  1.00 55.76  ? 28   ALA B O     1 
ATOM   2838  C  CB    . ALA B  2  28  ? -1.429  29.610  13.439  1.00 54.28  ? 28   ALA B CB    1 
ATOM   2839  N  N     . LEU B  2  29  ? -0.338  29.881  16.403  1.00 52.36  ? 29   LEU B N     1 
ATOM   2840  C  CA    . LEU B  2  29  ? 0.431   29.316  17.509  1.00 50.10  ? 29   LEU B CA    1 
ATOM   2841  C  C     . LEU B  2  29  ? -0.351  29.285  18.817  1.00 50.71  ? 29   LEU B C     1 
ATOM   2842  O  O     . LEU B  2  29  ? -0.302  28.302  19.552  1.00 51.71  ? 29   LEU B O     1 
ATOM   2843  C  CB    . LEU B  2  29  ? 1.726   30.099  17.708  1.00 48.44  ? 29   LEU B CB    1 
ATOM   2844  C  CG    . LEU B  2  29  ? 2.828   29.868  16.685  1.00 48.14  ? 29   LEU B CG    1 
ATOM   2845  C  CD1   . LEU B  2  29  ? 4.123   30.445  17.152  1.00 45.04  ? 29   LEU B CD1   1 
ATOM   2846  C  CD2   . LEU B  2  29  ? 3.005   28.389  16.504  1.00 50.20  ? 29   LEU B CD2   1 
ATOM   2847  N  N     . VAL B  2  30  ? -1.065  30.366  19.107  1.00 50.38  ? 30   VAL B N     1 
ATOM   2848  C  CA    . VAL B  2  30  ? -1.851  30.458  20.328  1.00 49.84  ? 30   VAL B CA    1 
ATOM   2849  C  C     . VAL B  2  30  ? -3.003  29.467  20.327  1.00 50.66  ? 30   VAL B C     1 
ATOM   2850  O  O     . VAL B  2  30  ? -3.551  29.158  21.362  1.00 50.73  ? 30   VAL B O     1 
ATOM   2851  C  CB    . VAL B  2  30  ? -2.416  31.869  20.521  1.00 49.27  ? 30   VAL B CB    1 
ATOM   2852  C  CG1   . VAL B  2  30  ? -3.261  31.913  21.745  1.00 50.15  ? 30   VAL B CG1   1 
ATOM   2853  C  CG2   . VAL B  2  30  ? -1.311  32.848  20.661  1.00 48.36  ? 30   VAL B CG2   1 
ATOM   2854  N  N     . ALA B  2  31  ? -3.391  28.976  19.174  1.00 50.82  ? 31   ALA B N     1 
ATOM   2855  C  CA    . ALA B  2  31  ? -4.475  28.030  19.167  1.00 51.00  ? 31   ALA B CA    1 
ATOM   2856  C  C     . ALA B  2  31  ? -3.787  26.739  19.438  1.00 51.43  ? 31   ALA B C     1 
ATOM   2857  O  O     . ALA B  2  31  ? -4.190  25.982  20.312  1.00 53.21  ? 31   ALA B O     1 
ATOM   2858  C  CB    . ALA B  2  31  ? -5.148  27.987  17.824  1.00 52.64  ? 31   ALA B CB    1 
ATOM   2859  N  N     . GLY B  2  32  ? -2.736  26.487  18.675  1.00 51.91  ? 32   GLY B N     1 
ATOM   2860  C  CA    . GLY B  2  32  ? -1.987  25.267  18.855  1.00 52.03  ? 32   GLY B CA    1 
ATOM   2861  C  C     . GLY B  2  32  ? -1.857  25.112  20.341  1.00 52.88  ? 32   GLY B C     1 
ATOM   2862  O  O     . GLY B  2  32  ? -2.437  24.208  20.925  1.00 53.32  ? 32   GLY B O     1 
ATOM   2863  N  N     . TRP B  2  33  ? -1.131  26.023  20.962  1.00 52.73  ? 33   TRP B N     1 
ATOM   2864  C  CA    . TRP B  2  33  ? -0.959  25.948  22.396  1.00 54.40  ? 33   TRP B CA    1 
ATOM   2865  C  C     . TRP B  2  33  ? -2.280  25.711  23.120  1.00 54.82  ? 33   TRP B C     1 
ATOM   2866  O  O     . TRP B  2  33  ? -2.350  24.895  24.020  1.00 55.65  ? 33   TRP B O     1 
ATOM   2867  C  CB    . TRP B  2  33  ? -0.324  27.231  22.918  1.00 55.33  ? 33   TRP B CB    1 
ATOM   2868  C  CG    . TRP B  2  33  ? -0.235  27.252  24.403  1.00 56.52  ? 33   TRP B CG    1 
ATOM   2869  C  CD1   . TRP B  2  33  ? 0.823   26.852  25.161  1.00 57.72  ? 33   TRP B CD1   1 
ATOM   2870  C  CD2   . TRP B  2  33  ? -1.274  27.630  25.327  1.00 56.04  ? 33   TRP B CD2   1 
ATOM   2871  N  NE1   . TRP B  2  33  ? 0.510   26.953  26.494  1.00 58.66  ? 33   TRP B NE1   1 
ATOM   2872  C  CE2   . TRP B  2  33  ? -0.770  27.428  26.623  1.00 57.13  ? 33   TRP B CE2   1 
ATOM   2873  C  CE3   . TRP B  2  33  ? -2.579  28.113  25.181  1.00 53.57  ? 33   TRP B CE3   1 
ATOM   2874  C  CZ2   . TRP B  2  33  ? -1.527  27.695  27.769  1.00 55.60  ? 33   TRP B CZ2   1 
ATOM   2875  C  CZ3   . TRP B  2  33  ? -3.325  28.373  26.312  1.00 53.91  ? 33   TRP B CZ3   1 
ATOM   2876  C  CH2   . TRP B  2  33  ? -2.798  28.164  27.591  1.00 54.20  ? 33   TRP B CH2   1 
ATOM   2877  N  N     . ALA B  2  34  ? -3.322  26.421  22.719  1.00 54.99  ? 34   ALA B N     1 
ATOM   2878  C  CA    . ALA B  2  34  ? -4.617  26.316  23.373  1.00 53.50  ? 34   ALA B CA    1 
ATOM   2879  C  C     . ALA B  2  34  ? -5.112  24.906  23.472  1.00 52.69  ? 34   ALA B C     1 
ATOM   2880  O  O     . ALA B  2  34  ? -5.392  24.431  24.557  1.00 53.22  ? 34   ALA B O     1 
ATOM   2881  C  CB    . ALA B  2  34  ? -5.634  27.171  22.668  1.00 54.28  ? 34   ALA B CB    1 
ATOM   2882  N  N     . GLY B  2  35  ? -5.239  24.232  22.347  1.00 51.36  ? 35   GLY B N     1 
ATOM   2883  C  CA    . GLY B  2  35  ? -5.721  22.867  22.385  1.00 53.83  ? 35   GLY B CA    1 
ATOM   2884  C  C     . GLY B  2  35  ? -4.648  21.951  22.932  1.00 54.26  ? 35   GLY B C     1 
ATOM   2885  O  O     . GLY B  2  35  ? -4.908  20.941  23.574  1.00 53.92  ? 35   GLY B O     1 
ATOM   2886  N  N     . SER B  2  36  ? -3.421  22.324  22.638  1.00 54.86  ? 36   SER B N     1 
ATOM   2887  C  CA    . SER B  2  36  ? -2.260  21.603  23.091  1.00 55.12  ? 36   SER B CA    1 
ATOM   2888  C  C     . SER B  2  36  ? -2.338  21.435  24.598  1.00 55.34  ? 36   SER B C     1 
ATOM   2889  O  O     . SER B  2  36  ? -2.251  20.330  25.116  1.00 56.57  ? 36   SER B O     1 
ATOM   2890  C  CB    . SER B  2  36  ? -1.041  22.412  22.738  1.00 55.92  ? 36   SER B CB    1 
ATOM   2891  O  OG    . SER B  2  36  ? -0.460  21.961  21.533  1.00 59.22  ? 36   SER B OG    1 
ATOM   2892  N  N     . MET B  2  37  ? -2.487  22.547  25.298  1.00 54.78  ? 37   MET B N     1 
ATOM   2893  C  CA    . MET B  2  37  ? -2.600  22.537  26.747  1.00 53.60  ? 37   MET B CA    1 
ATOM   2894  C  C     . MET B  2  37  ? -3.737  21.610  27.123  1.00 53.09  ? 37   MET B C     1 
ATOM   2895  O  O     . MET B  2  37  ? -3.562  20.708  27.914  1.00 54.08  ? 37   MET B O     1 
ATOM   2896  C  CB    . MET B  2  37  ? -2.914  23.936  27.261  1.00 53.96  ? 37   MET B CB    1 
ATOM   2897  C  CG    . MET B  2  37  ? -2.671  24.141  28.718  1.00 56.78  ? 37   MET B CG    1 
ATOM   2898  S  SD    . MET B  2  37  ? -0.902  24.178  29.027  1.00 61.65  ? 37   MET B SD    1 
ATOM   2899  C  CE    . MET B  2  37  ? -0.692  22.808  30.237  1.00 61.13  ? 37   MET B CE    1 
ATOM   2900  N  N     . ALA B  2  38  ? -4.904  21.844  26.554  1.00 51.74  ? 38   ALA B N     1 
ATOM   2901  C  CA    . ALA B  2  38  ? -6.066  21.025  26.835  1.00 50.16  ? 38   ALA B CA    1 
ATOM   2902  C  C     . ALA B  2  38  ? -5.730  19.541  26.885  1.00 49.66  ? 38   ALA B C     1 
ATOM   2903  O  O     . ALA B  2  38  ? -5.932  18.872  27.887  1.00 48.64  ? 38   ALA B O     1 
ATOM   2904  C  CB    . ALA B  2  38  ? -7.122  21.280  25.805  1.00 49.13  ? 38   ALA B CB    1 
ATOM   2905  N  N     . LEU B  2  39  ? -5.215  19.023  25.796  1.00 50.39  ? 39   LEU B N     1 
ATOM   2906  C  CA    . LEU B  2  39  ? -4.855  17.625  25.747  1.00 52.43  ? 39   LEU B CA    1 
ATOM   2907  C  C     . LEU B  2  39  ? -3.929  17.190  26.875  1.00 53.91  ? 39   LEU B C     1 
ATOM   2908  O  O     . LEU B  2  39  ? -4.136  16.141  27.474  1.00 56.19  ? 39   LEU B O     1 
ATOM   2909  C  CB    . LEU B  2  39  ? -4.222  17.313  24.408  1.00 51.79  ? 39   LEU B CB    1 
ATOM   2910  C  CG    . LEU B  2  39  ? -5.184  17.579  23.261  1.00 52.01  ? 39   LEU B CG    1 
ATOM   2911  C  CD1   . LEU B  2  39  ? -4.464  17.265  21.984  1.00 52.10  ? 39   LEU B CD1   1 
ATOM   2912  C  CD2   . LEU B  2  39  ? -6.430  16.734  23.381  1.00 50.72  ? 39   LEU B CD2   1 
ATOM   2913  N  N     . TYR B  2  40  ? -2.904  17.980  27.162  1.00 53.63  ? 40   TYR B N     1 
ATOM   2914  C  CA    . TYR B  2  40  ? -1.970  17.654  28.242  1.00 52.04  ? 40   TYR B CA    1 
ATOM   2915  C  C     . TYR B  2  40  ? -2.736  17.482  29.532  1.00 51.85  ? 40   TYR B C     1 
ATOM   2916  O  O     . TYR B  2  40  ? -2.503  16.555  30.281  1.00 51.75  ? 40   TYR B O     1 
ATOM   2917  C  CB    . TYR B  2  40  ? -0.964  18.776  28.430  1.00 50.47  ? 40   TYR B CB    1 
ATOM   2918  C  CG    . TYR B  2  40  ? -0.054  18.579  29.605  1.00 48.31  ? 40   TYR B CG    1 
ATOM   2919  C  CD1   . TYR B  2  40  ? 0.921   17.594  29.593  1.00 47.37  ? 40   TYR B CD1   1 
ATOM   2920  C  CD2   . TYR B  2  40  ? -0.135  19.414  30.707  1.00 48.24  ? 40   TYR B CD2   1 
ATOM   2921  C  CE1   . TYR B  2  40  ? 1.794   17.451  30.633  1.00 48.30  ? 40   TYR B CE1   1 
ATOM   2922  C  CE2   . TYR B  2  40  ? 0.737   19.280  31.760  1.00 49.71  ? 40   TYR B CE2   1 
ATOM   2923  C  CZ    . TYR B  2  40  ? 1.707   18.295  31.714  1.00 51.02  ? 40   TYR B CZ    1 
ATOM   2924  O  OH    . TYR B  2  40  ? 2.621   18.169  32.740  1.00 54.83  ? 40   TYR B OH    1 
ATOM   2925  N  N     . GLU B  2  41  ? -3.651  18.388  29.788  1.00 51.72  ? 41   GLU B N     1 
ATOM   2926  C  CA    . GLU B  2  41  ? -4.419  18.297  30.994  1.00 53.42  ? 41   GLU B CA    1 
ATOM   2927  C  C     . GLU B  2  41  ? -5.389  17.134  30.964  1.00 53.29  ? 41   GLU B C     1 
ATOM   2928  O  O     . GLU B  2  41  ? -5.625  16.514  31.991  1.00 54.46  ? 41   GLU B O     1 
ATOM   2929  C  CB    . GLU B  2  41  ? -5.188  19.578  31.246  1.00 55.65  ? 41   GLU B CB    1 
ATOM   2930  C  CG    . GLU B  2  41  ? -4.334  20.814  31.474  1.00 60.61  ? 41   GLU B CG    1 
ATOM   2931  C  CD    . GLU B  2  41  ? -5.164  21.959  32.050  1.00 63.44  ? 41   GLU B CD    1 
ATOM   2932  O  OE1   . GLU B  2  41  ? -6.393  21.967  31.810  1.00 64.08  ? 41   GLU B OE1   1 
ATOM   2933  O  OE2   . GLU B  2  41  ? -4.601  22.846  32.735  1.00 64.14  ? 41   GLU B OE2   1 
ATOM   2934  N  N     . LEU B  2  42  ? -5.971  16.832  29.813  1.00 52.36  ? 42   LEU B N     1 
ATOM   2935  C  CA    . LEU B  2  42  ? -6.909  15.721  29.759  1.00 51.83  ? 42   LEU B CA    1 
ATOM   2936  C  C     . LEU B  2  42  ? -6.172  14.423  29.972  1.00 52.51  ? 42   LEU B C     1 
ATOM   2937  O  O     . LEU B  2  42  ? -6.729  13.439  30.461  1.00 53.26  ? 42   LEU B O     1 
ATOM   2938  C  CB    . LEU B  2  42  ? -7.618  15.675  28.419  1.00 49.72  ? 42   LEU B CB    1 
ATOM   2939  C  CG    . LEU B  2  42  ? -8.664  16.762  28.254  1.00 50.68  ? 42   LEU B CG    1 
ATOM   2940  C  CD1   . LEU B  2  42  ? -9.193  16.716  26.846  1.00 48.60  ? 42   LEU B CD1   1 
ATOM   2941  C  CD2   . LEU B  2  42  ? -9.779  16.569  29.288  1.00 49.29  ? 42   LEU B CD2   1 
ATOM   2942  N  N     . ALA B  2  43  ? -4.902  14.436  29.613  1.00 51.89  ? 43   ALA B N     1 
ATOM   2943  C  CA    . ALA B  2  43  ? -4.068  13.263  29.733  1.00 50.77  ? 43   ALA B CA    1 
ATOM   2944  C  C     . ALA B  2  43  ? -3.553  13.055  31.133  1.00 51.49  ? 43   ALA B C     1 
ATOM   2945  O  O     . ALA B  2  43  ? -2.876  12.059  31.389  1.00 51.51  ? 43   ALA B O     1 
ATOM   2946  C  CB    . ALA B  2  43  ? -2.936  13.382  28.814  1.00 49.84  ? 43   ALA B CB    1 
ATOM   2947  N  N     . THR B  2  44  ? -3.871  13.989  32.031  1.00 50.38  ? 44   THR B N     1 
ATOM   2948  C  CA    . THR B  2  44  ? -3.416  13.906  33.409  1.00 50.33  ? 44   THR B CA    1 
ATOM   2949  C  C     . THR B  2  44  ? -4.444  14.335  34.476  1.00 51.47  ? 44   THR B C     1 
ATOM   2950  O  O     . THR B  2  44  ? -4.192  14.209  35.678  1.00 50.81  ? 44   THR B O     1 
ATOM   2951  C  CB    . THR B  2  44  ? -2.160  14.750  33.600  1.00 49.49  ? 44   THR B CB    1 
ATOM   2952  O  OG1   . THR B  2  44  ? -2.480  16.105  33.308  1.00 48.86  ? 44   THR B OG1   1 
ATOM   2953  C  CG2   . THR B  2  44  ? -1.042  14.291  32.674  1.00 48.36  ? 44   THR B CG2   1 
ATOM   2954  N  N     . PHE B  2  45  ? -5.595  14.837  34.055  1.00 52.30  ? 45   PHE B N     1 
ATOM   2955  C  CA    . PHE B  2  45  ? -6.612  15.262  35.009  1.00 52.69  ? 45   PHE B CA    1 
ATOM   2956  C  C     . PHE B  2  45  ? -7.341  14.072  35.566  1.00 53.19  ? 45   PHE B C     1 
ATOM   2957  O  O     . PHE B  2  45  ? -7.731  13.202  34.810  1.00 53.54  ? 45   PHE B O     1 
ATOM   2958  C  CB    . PHE B  2  45  ? -7.638  16.162  34.345  1.00 53.22  ? 45   PHE B CB    1 
ATOM   2959  C  CG    . PHE B  2  45  ? -8.865  16.374  35.180  1.00 55.30  ? 45   PHE B CG    1 
ATOM   2960  C  CD1   . PHE B  2  45  ? -8.821  17.172  36.314  1.00 56.54  ? 45   PHE B CD1   1 
ATOM   2961  C  CD2   . PHE B  2  45  ? -10.062 15.760  34.846  1.00 56.07  ? 45   PHE B CD2   1 
ATOM   2962  C  CE1   . PHE B  2  45  ? -9.942  17.360  37.094  1.00 56.13  ? 45   PHE B CE1   1 
ATOM   2963  C  CE2   . PHE B  2  45  ? -11.184 15.943  35.620  1.00 57.33  ? 45   PHE B CE2   1 
ATOM   2964  C  CZ    . PHE B  2  45  ? -11.121 16.749  36.751  1.00 57.26  ? 45   PHE B CZ    1 
ATOM   2965  N  N     . ASP B  2  46  ? -7.548  14.048  36.877  1.00 54.26  ? 46   ASP B N     1 
ATOM   2966  C  CA    . ASP B  2  46  ? -8.256  12.954  37.527  1.00 55.99  ? 46   ASP B CA    1 
ATOM   2967  C  C     . ASP B  2  46  ? -9.648  13.446  37.876  1.00 57.01  ? 46   ASP B C     1 
ATOM   2968  O  O     . ASP B  2  46  ? -9.818  14.340  38.695  1.00 56.67  ? 46   ASP B O     1 
ATOM   2969  C  CB    . ASP B  2  46  ? -7.543  12.524  38.796  1.00 56.25  ? 46   ASP B CB    1 
ATOM   2970  C  CG    . ASP B  2  46  ? -8.213  11.360  39.466  1.00 58.47  ? 46   ASP B CG    1 
ATOM   2971  O  OD1   . ASP B  2  46  ? -9.447  11.248  39.341  1.00 59.29  ? 46   ASP B OD1   1 
ATOM   2972  O  OD2   . ASP B  2  46  ? -7.509  10.564  40.131  1.00 60.45  ? 46   ASP B OD2   1 
ATOM   2973  N  N     . PRO B  2  47  ? -10.669 12.850  37.264  1.00 57.50  ? 47   PRO B N     1 
ATOM   2974  C  CA    . PRO B  2  47  ? -12.054 13.250  37.517  1.00 58.56  ? 47   PRO B CA    1 
ATOM   2975  C  C     . PRO B  2  47  ? -12.761 12.480  38.616  1.00 59.12  ? 47   PRO B C     1 
ATOM   2976  O  O     . PRO B  2  47  ? -13.887 12.804  38.993  1.00 59.39  ? 47   PRO B O     1 
ATOM   2977  C  CB    . PRO B  2  47  ? -12.696 13.030  36.165  1.00 59.84  ? 47   PRO B CB    1 
ATOM   2978  C  CG    . PRO B  2  47  ? -12.003 11.787  35.699  1.00 57.39  ? 47   PRO B CG    1 
ATOM   2979  C  CD    . PRO B  2  47  ? -10.573 12.024  36.051  1.00 55.64  ? 47   PRO B CD    1 
ATOM   2980  N  N     . SER B  2  48  ? -12.076 11.469  39.130  1.00 59.99  ? 48   SER B N     1 
ATOM   2981  C  CA    . SER B  2  48  ? -12.608 10.591  40.162  1.00 60.52  ? 48   SER B CA    1 
ATOM   2982  C  C     . SER B  2  48  ? -13.206 11.220  41.434  1.00 60.66  ? 48   SER B C     1 
ATOM   2983  O  O     . SER B  2  48  ? -13.959 10.546  42.147  1.00 60.98  ? 48   SER B O     1 
ATOM   2984  C  CB    . SER B  2  48  ? -11.529 9.603   40.567  1.00 59.53  ? 48   SER B CB    1 
ATOM   2985  O  OG    . SER B  2  48  ? -10.530 10.251  41.322  1.00 59.20  ? 48   SER B OG    1 
ATOM   2986  N  N     . ASP B  2  49  ? -12.882 12.477  41.735  1.00 59.57  ? 49   ASP B N     1 
ATOM   2987  C  CA    . ASP B  2  49  ? -13.409 13.110  42.946  1.00 59.08  ? 49   ASP B CA    1 
ATOM   2988  C  C     . ASP B  2  49  ? -13.432 14.632  42.935  1.00 57.70  ? 49   ASP B C     1 
ATOM   2989  O  O     . ASP B  2  49  ? -12.437 15.292  43.206  1.00 56.88  ? 49   ASP B O     1 
ATOM   2990  C  CB    . ASP B  2  49  ? -12.642 12.620  44.171  1.00 60.36  ? 49   ASP B CB    1 
ATOM   2991  C  CG    . ASP B  2  49  ? -12.858 13.506  45.389  1.00 64.19  ? 49   ASP B CG    1 
ATOM   2992  O  OD1   . ASP B  2  49  ? -14.013 13.948  45.600  1.00 65.99  ? 49   ASP B OD1   1 
ATOM   2993  O  OD2   . ASP B  2  49  ? -11.876 13.746  46.145  1.00 65.82  ? 49   ASP B OD2   1 
ATOM   2994  N  N     . PRO B  2  50  ? -14.599 15.201  42.642  1.00 56.04  ? 50   PRO B N     1 
ATOM   2995  C  CA    . PRO B  2  50  ? -14.817 16.632  42.576  1.00 54.66  ? 50   PRO B CA    1 
ATOM   2996  C  C     . PRO B  2  50  ? -15.116 17.205  43.934  1.00 53.46  ? 50   PRO B C     1 
ATOM   2997  O  O     . PRO B  2  50  ? -15.495 18.361  44.050  1.00 54.21  ? 50   PRO B O     1 
ATOM   2998  C  CB    . PRO B  2  50  ? -16.004 16.733  41.647  1.00 55.36  ? 50   PRO B CB    1 
ATOM   2999  C  CG    . PRO B  2  50  ? -16.820 15.614  42.094  1.00 57.32  ? 50   PRO B CG    1 
ATOM   3000  C  CD    . PRO B  2  50  ? -15.822 14.490  42.240  1.00 57.45  ? 50   PRO B CD    1 
ATOM   3001  N  N     . VAL B  2  51  ? -14.947 16.403  44.965  1.00 50.98  ? 51   VAL B N     1 
ATOM   3002  C  CA    . VAL B  2  51  ? -15.206 16.901  46.291  1.00 49.70  ? 51   VAL B CA    1 
ATOM   3003  C  C     . VAL B  2  51  ? -13.906 17.313  46.936  1.00 50.39  ? 51   VAL B C     1 
ATOM   3004  O  O     . VAL B  2  51  ? -13.739 18.478  47.301  1.00 50.58  ? 51   VAL B O     1 
ATOM   3005  C  CB    . VAL B  2  51  ? -15.857 15.859  47.163  1.00 48.92  ? 51   VAL B CB    1 
ATOM   3006  C  CG1   . VAL B  2  51  ? -16.315 16.494  48.446  1.00 49.61  ? 51   VAL B CG1   1 
ATOM   3007  C  CG2   . VAL B  2  51  ? -17.007 15.235  46.440  1.00 49.64  ? 51   VAL B CG2   1 
ATOM   3008  N  N     . LEU B  2  52  ? -12.985 16.361  47.076  1.00 50.01  ? 52   LEU B N     1 
ATOM   3009  C  CA    . LEU B  2  52  ? -11.699 16.646  47.683  1.00 49.18  ? 52   LEU B CA    1 
ATOM   3010  C  C     . LEU B  2  52  ? -10.547 16.712  46.709  1.00 48.79  ? 52   LEU B C     1 
ATOM   3011  O  O     . LEU B  2  52  ? -9.431  17.029  47.092  1.00 50.07  ? 52   LEU B O     1 
ATOM   3012  C  CB    . LEU B  2  52  ? -11.390 15.650  48.793  1.00 48.69  ? 52   LEU B CB    1 
ATOM   3013  C  CG    . LEU B  2  52  ? -12.244 15.859  50.046  1.00 50.44  ? 52   LEU B CG    1 
ATOM   3014  C  CD1   . LEU B  2  52  ? -11.735 14.970  51.173  1.00 50.17  ? 52   LEU B CD1   1 
ATOM   3015  C  CD2   . LEU B  2  52  ? -12.196 17.321  50.461  1.00 49.14  ? 52   LEU B CD2   1 
ATOM   3016  N  N     . ASN B  2  53  ? -10.792 16.418  45.449  1.00 48.58  ? 53   ASN B N     1 
ATOM   3017  C  CA    . ASN B  2  53  ? -9.710  16.521  44.490  1.00 50.22  ? 53   ASN B CA    1 
ATOM   3018  C  C     . ASN B  2  53  ? -10.235 17.165  43.248  1.00 50.80  ? 53   ASN B C     1 
ATOM   3019  O  O     . ASN B  2  53  ? -10.178 16.590  42.177  1.00 50.45  ? 53   ASN B O     1 
ATOM   3020  C  CB    . ASN B  2  53  ? -9.133  15.161  44.142  1.00 50.50  ? 53   ASN B CB    1 
ATOM   3021  C  CG    . ASN B  2  53  ? -7.759  15.266  43.537  1.00 51.66  ? 53   ASN B CG    1 
ATOM   3022  O  OD1   . ASN B  2  53  ? -6.865  15.861  44.130  1.00 52.79  ? 53   ASN B OD1   1 
ATOM   3023  N  ND2   . ASN B  2  53  ? -7.577  14.697  42.361  1.00 51.40  ? 53   ASN B ND2   1 
ATOM   3024  N  N     . PRO B  2  54  ? -10.752 18.384  43.375  1.00 50.76  ? 54   PRO B N     1 
ATOM   3025  C  CA    . PRO B  2  54  ? -11.306 19.134  42.258  1.00 52.41  ? 54   PRO B CA    1 
ATOM   3026  C  C     . PRO B  2  54  ? -10.185 19.608  41.340  1.00 53.59  ? 54   PRO B C     1 
ATOM   3027  O  O     . PRO B  2  54  ? -9.035  19.646  41.755  1.00 56.54  ? 54   PRO B O     1 
ATOM   3028  C  CB    . PRO B  2  54  ? -12.009 20.273  42.966  1.00 52.83  ? 54   PRO B CB    1 
ATOM   3029  C  CG    . PRO B  2  54  ? -11.063 20.563  44.074  1.00 50.71  ? 54   PRO B CG    1 
ATOM   3030  C  CD    . PRO B  2  54  ? -10.734 19.210  44.592  1.00 50.59  ? 54   PRO B CD    1 
ATOM   3031  N  N     . MET B  2  55  ? -10.514 19.958  40.105  1.00 52.46  ? 55   MET B N     1 
ATOM   3032  C  CA    . MET B  2  55  ? -9.514  20.426  39.168  1.00 51.30  ? 55   MET B CA    1 
ATOM   3033  C  C     . MET B  2  55  ? -8.471  21.409  39.714  1.00 49.72  ? 55   MET B C     1 
ATOM   3034  O  O     . MET B  2  55  ? -7.307  21.294  39.379  1.00 47.99  ? 55   MET B O     1 
ATOM   3035  C  CB    . MET B  2  55  ? -10.194 21.047  37.950  1.00 53.94  ? 55   MET B CB    1 
ATOM   3036  C  CG    . MET B  2  55  ? -11.277 22.061  38.292  1.00 56.76  ? 55   MET B CG    1 
ATOM   3037  S  SD    . MET B  2  55  ? -11.844 23.073  36.900  1.00 61.21  ? 55   MET B SD    1 
ATOM   3038  C  CE    . MET B  2  55  ? -12.561 21.860  35.807  1.00 57.70  ? 55   MET B CE    1 
ATOM   3039  N  N     . TRP B  2  56  ? -8.851  22.360  40.551  1.00 47.86  ? 56   TRP B N     1 
ATOM   3040  C  CA    . TRP B  2  56  ? -7.859  23.310  41.026  1.00 48.54  ? 56   TRP B CA    1 
ATOM   3041  C  C     . TRP B  2  56  ? -6.734  22.795  41.937  1.00 49.87  ? 56   TRP B C     1 
ATOM   3042  O  O     . TRP B  2  56  ? -5.741  23.483  42.173  1.00 50.58  ? 56   TRP B O     1 
ATOM   3043  C  CB    . TRP B  2  56  ? -8.537  24.514  41.674  1.00 47.71  ? 56   TRP B CB    1 
ATOM   3044  C  CG    . TRP B  2  56  ? -9.578  24.184  42.672  1.00 47.26  ? 56   TRP B CG    1 
ATOM   3045  C  CD1   . TRP B  2  56  ? -10.868 23.865  42.423  1.00 47.42  ? 56   TRP B CD1   1 
ATOM   3046  C  CD2   . TRP B  2  56  ? -9.418  24.139  44.086  1.00 46.78  ? 56   TRP B CD2   1 
ATOM   3047  N  NE1   . TRP B  2  56  ? -11.532 23.624  43.592  1.00 47.95  ? 56   TRP B NE1   1 
ATOM   3048  C  CE2   . TRP B  2  56  ? -10.663 23.784  44.633  1.00 47.40  ? 56   TRP B CE2   1 
ATOM   3049  C  CE3   . TRP B  2  56  ? -8.341  24.361  44.946  1.00 46.73  ? 56   TRP B CE3   1 
ATOM   3050  C  CZ2   . TRP B  2  56  ? -10.865 23.642  45.999  1.00 47.56  ? 56   TRP B CZ2   1 
ATOM   3051  C  CZ3   . TRP B  2  56  ? -8.537  24.221  46.301  1.00 47.09  ? 56   TRP B CZ3   1 
ATOM   3052  C  CH2   . TRP B  2  56  ? -9.793  23.863  46.818  1.00 47.51  ? 56   TRP B CH2   1 
ATOM   3053  N  N     . ARG B  2  57  ? -6.875  21.586  42.451  1.00 51.55  ? 57   ARG B N     1 
ATOM   3054  C  CA    . ARG B  2  57  ? -5.853  20.998  43.329  1.00 50.95  ? 57   ARG B CA    1 
ATOM   3055  C  C     . ARG B  2  57  ? -4.770  20.379  42.453  1.00 50.22  ? 57   ARG B C     1 
ATOM   3056  O  O     . ARG B  2  57  ? -3.620  20.236  42.871  1.00 50.01  ? 57   ARG B O     1 
ATOM   3057  C  CB    . ARG B  2  57  ? -6.473  19.889  44.207  1.00 51.34  ? 57   ARG B CB    1 
ATOM   3058  C  CG    . ARG B  2  57  ? -7.401  20.332  45.331  1.00 52.07  ? 57   ARG B CG    1 
ATOM   3059  C  CD    . ARG B  2  57  ? -6.641  20.893  46.508  1.00 50.12  ? 57   ARG B CD    1 
ATOM   3060  N  NE    . ARG B  2  57  ? -5.693  19.929  47.039  1.00 49.71  ? 57   ARG B NE    1 
ATOM   3061  C  CZ    . ARG B  2  57  ? -4.905  20.180  48.071  1.00 49.82  ? 57   ARG B CZ    1 
ATOM   3062  N  NH1   . ARG B  2  57  ? -4.972  21.354  48.662  1.00 49.28  ? 57   ARG B NH1   1 
ATOM   3063  N  NH2   . ARG B  2  57  ? -4.046  19.278  48.499  1.00 48.05  ? 57   ARG B NH2   1 
ATOM   3064  N  N     . GLN B  2  58  ? -5.165  20.018  41.238  1.00 47.95  ? 58   GLN B N     1 
ATOM   3065  C  CA    . GLN B  2  58  ? -4.284  19.373  40.285  1.00 48.67  ? 58   GLN B CA    1 
ATOM   3066  C  C     . GLN B  2  58  ? -3.589  20.325  39.338  1.00 49.52  ? 58   GLN B C     1 
ATOM   3067  O  O     . GLN B  2  58  ? -3.242  19.945  38.218  1.00 47.96  ? 58   GLN B O     1 
ATOM   3068  C  CB    . GLN B  2  58  ? -5.083  18.376  39.469  1.00 47.59  ? 58   GLN B CB    1 
ATOM   3069  C  CG    . GLN B  2  58  ? -5.892  17.457  40.308  1.00 49.75  ? 58   GLN B CG    1 
ATOM   3070  C  CD    . GLN B  2  58  ? -6.767  16.582  39.492  1.00 50.04  ? 58   GLN B CD    1 
ATOM   3071  O  OE1   . GLN B  2  58  ? -6.317  15.936  38.561  1.00 48.74  ? 58   GLN B OE1   1 
ATOM   3072  N  NE2   . GLN B  2  58  ? -8.032  16.548  39.836  1.00 51.47  ? 58   GLN B NE2   1 
ATOM   3073  N  N     . GLY B  2  59  ? -3.390  21.559  39.777  1.00 50.87  ? 59   GLY B N     1 
ATOM   3074  C  CA    . GLY B  2  59  ? -2.756  22.536  38.917  1.00 50.39  ? 59   GLY B CA    1 
ATOM   3075  C  C     . GLY B  2  59  ? -3.359  22.623  37.528  1.00 50.91  ? 59   GLY B C     1 
ATOM   3076  O  O     . GLY B  2  59  ? -2.634  22.665  36.557  1.00 52.09  ? 59   GLY B O     1 
ATOM   3077  N  N     . MET B  2  60  ? -4.681  22.637  37.427  1.00 53.19  ? 60   MET B N     1 
ATOM   3078  C  CA    . MET B  2  60  ? -5.366  22.750  36.138  1.00 54.64  ? 60   MET B CA    1 
ATOM   3079  C  C     . MET B  2  60  ? -5.550  24.234  35.806  1.00 55.02  ? 60   MET B C     1 
ATOM   3080  O  O     . MET B  2  60  ? -6.135  24.993  36.595  1.00 55.43  ? 60   MET B O     1 
ATOM   3081  C  CB    . MET B  2  60  ? -6.721  22.053  36.186  1.00 54.83  ? 60   MET B CB    1 
ATOM   3082  C  CG    . MET B  2  60  ? -6.625  20.554  36.290  1.00 57.01  ? 60   MET B CG    1 
ATOM   3083  S  SD    . MET B  2  60  ? -5.862  19.800  34.846  1.00 61.42  ? 60   MET B SD    1 
ATOM   3084  C  CE    . MET B  2  60  ? -4.166  19.626  35.385  1.00 60.63  ? 60   MET B CE    1 
ATOM   3085  N  N     . PHE B  2  61  ? -5.064  24.633  34.632  1.00 53.21  ? 61   PHE B N     1 
ATOM   3086  C  CA    . PHE B  2  61  ? -5.115  26.026  34.210  1.00 51.50  ? 61   PHE B CA    1 
ATOM   3087  C  C     . PHE B  2  61  ? -6.117  26.360  33.136  1.00 51.02  ? 61   PHE B C     1 
ATOM   3088  O  O     . PHE B  2  61  ? -6.801  27.365  33.218  1.00 50.80  ? 61   PHE B O     1 
ATOM   3089  C  CB    . PHE B  2  61  ? -3.735  26.444  33.731  1.00 49.94  ? 61   PHE B CB    1 
ATOM   3090  C  CG    . PHE B  2  61  ? -3.641  27.878  33.343  1.00 45.38  ? 61   PHE B CG    1 
ATOM   3091  C  CD1   . PHE B  2  61  ? -4.008  28.877  34.226  1.00 43.68  ? 61   PHE B CD1   1 
ATOM   3092  C  CD2   . PHE B  2  61  ? -3.154  28.225  32.117  1.00 42.50  ? 61   PHE B CD2   1 
ATOM   3093  C  CE1   . PHE B  2  61  ? -3.884  30.183  33.886  1.00 42.64  ? 61   PHE B CE1   1 
ATOM   3094  C  CE2   . PHE B  2  61  ? -3.029  29.523  31.770  1.00 42.59  ? 61   PHE B CE2   1 
ATOM   3095  C  CZ    . PHE B  2  61  ? -3.392  30.507  32.654  1.00 43.36  ? 61   PHE B CZ    1 
ATOM   3096  N  N     . VAL B  2  62  ? -6.175  25.526  32.119  1.00 50.65  ? 62   VAL B N     1 
ATOM   3097  C  CA    . VAL B  2  62  ? -7.083  25.726  31.006  1.00 50.65  ? 62   VAL B CA    1 
ATOM   3098  C  C     . VAL B  2  62  ? -8.432  25.020  31.196  1.00 50.83  ? 62   VAL B C     1 
ATOM   3099  O  O     . VAL B  2  62  ? -9.450  25.463  30.689  1.00 50.16  ? 62   VAL B O     1 
ATOM   3100  C  CB    . VAL B  2  62  ? -6.419  25.229  29.719  1.00 51.31  ? 62   VAL B CB    1 
ATOM   3101  C  CG1   . VAL B  2  62  ? -7.450  24.876  28.710  1.00 53.85  ? 62   VAL B CG1   1 
ATOM   3102  C  CG2   . VAL B  2  62  ? -5.488  26.269  29.179  1.00 51.31  ? 62   VAL B CG2   1 
ATOM   3103  N  N     . LEU B  2  63  ? -8.434  23.915  31.918  1.00 51.49  ? 63   LEU B N     1 
ATOM   3104  C  CA    . LEU B  2  63  ? -9.662  23.174  32.152  1.00 51.84  ? 63   LEU B CA    1 
ATOM   3105  C  C     . LEU B  2  63  ? -10.719 24.084  32.746  1.00 52.75  ? 63   LEU B C     1 
ATOM   3106  O  O     . LEU B  2  63  ? -11.849 24.100  32.277  1.00 53.28  ? 63   LEU B O     1 
ATOM   3107  C  CB    . LEU B  2  63  ? -9.412  21.999  33.088  1.00 50.82  ? 63   LEU B CB    1 
ATOM   3108  C  CG    . LEU B  2  63  ? -10.399 20.835  33.014  1.00 49.64  ? 63   LEU B CG    1 
ATOM   3109  C  CD1   . LEU B  2  63  ? -10.354 20.237  31.619  1.00 49.19  ? 63   LEU B CD1   1 
ATOM   3110  C  CD2   . LEU B  2  63  ? -10.056 19.781  34.062  1.00 47.52  ? 63   LEU B CD2   1 
ATOM   3111  N  N     . PRO B  2  64  ? -10.378 24.856  33.790  1.00 53.30  ? 64   PRO B N     1 
ATOM   3112  C  CA    . PRO B  2  64  ? -11.380 25.755  34.382  1.00 53.43  ? 64   PRO B CA    1 
ATOM   3113  C  C     . PRO B  2  64  ? -12.045 26.737  33.413  1.00 52.51  ? 64   PRO B C     1 
ATOM   3114  O  O     . PRO B  2  64  ? -13.217 27.063  33.558  1.00 52.24  ? 64   PRO B O     1 
ATOM   3115  C  CB    . PRO B  2  64  ? -10.597 26.472  35.495  1.00 52.85  ? 64   PRO B CB    1 
ATOM   3116  C  CG    . PRO B  2  64  ? -9.211  26.398  35.048  1.00 54.23  ? 64   PRO B CG    1 
ATOM   3117  C  CD    . PRO B  2  64  ? -9.101  24.992  34.495  1.00 53.33  ? 64   PRO B CD    1 
ATOM   3118  N  N     . PHE B  2  65  ? -11.303 27.187  32.418  1.00 52.52  ? 65   PHE B N     1 
ATOM   3119  C  CA    . PHE B  2  65  ? -11.841 28.142  31.466  1.00 53.74  ? 65   PHE B CA    1 
ATOM   3120  C  C     . PHE B  2  65  ? -12.874 27.540  30.544  1.00 54.54  ? 65   PHE B C     1 
ATOM   3121  O  O     . PHE B  2  65  ? -13.774 28.240  30.074  1.00 55.43  ? 65   PHE B O     1 
ATOM   3122  C  CB    . PHE B  2  65  ? -10.698 28.802  30.683  1.00 51.77  ? 65   PHE B CB    1 
ATOM   3123  C  CG    . PHE B  2  65  ? -9.962  29.833  31.479  1.00 50.98  ? 65   PHE B CG    1 
ATOM   3124  C  CD1   . PHE B  2  65  ? -10.467 31.118  31.600  1.00 52.14  ? 65   PHE B CD1   1 
ATOM   3125  C  CD2   . PHE B  2  65  ? -8.855  29.485  32.239  1.00 51.22  ? 65   PHE B CD2   1 
ATOM   3126  C  CE1   . PHE B  2  65  ? -9.891  32.038  32.479  1.00 51.70  ? 65   PHE B CE1   1 
ATOM   3127  C  CE2   . PHE B  2  65  ? -8.275  30.393  33.118  1.00 51.54  ? 65   PHE B CE2   1 
ATOM   3128  C  CZ    . PHE B  2  65  ? -8.796  31.671  33.240  1.00 51.19  ? 65   PHE B CZ    1 
ATOM   3129  N  N     . MET B  2  66  ? -12.756 26.242  30.298  1.00 55.33  ? 66   MET B N     1 
ATOM   3130  C  CA    . MET B  2  66  ? -13.711 25.555  29.437  1.00 57.52  ? 66   MET B CA    1 
ATOM   3131  C  C     . MET B  2  66  ? -14.936 25.198  30.232  1.00 58.80  ? 66   MET B C     1 
ATOM   3132  O  O     . MET B  2  66  ? -15.985 24.944  29.666  1.00 60.62  ? 66   MET B O     1 
ATOM   3133  C  CB    . MET B  2  66  ? -13.129 24.269  28.861  1.00 56.42  ? 66   MET B CB    1 
ATOM   3134  C  CG    . MET B  2  66  ? -12.066 24.482  27.821  1.00 58.49  ? 66   MET B CG    1 
ATOM   3135  S  SD    . MET B  2  66  ? -11.426 22.939  27.221  1.00 54.78  ? 66   MET B SD    1 
ATOM   3136  C  CE    . MET B  2  66  ? -10.185 22.684  28.353  1.00 56.33  ? 66   MET B CE    1 
ATOM   3137  N  N     . ALA B  2  67  ? -14.800 25.170  31.546  1.00 59.05  ? 67   ALA B N     1 
ATOM   3138  C  CA    . ALA B  2  67  ? -15.914 24.824  32.406  1.00 58.96  ? 67   ALA B CA    1 
ATOM   3139  C  C     . ALA B  2  67  ? -16.855 25.996  32.531  1.00 60.06  ? 67   ALA B C     1 
ATOM   3140  O  O     . ALA B  2  67  ? -18.074 25.849  32.468  1.00 61.24  ? 67   ALA B O     1 
ATOM   3141  C  CB    . ALA B  2  67  ? -15.411 24.438  33.775  1.00 58.40  ? 67   ALA B CB    1 
ATOM   3142  N  N     . ARG B  2  68  ? -16.272 27.166  32.709  1.00 60.20  ? 68   ARG B N     1 
ATOM   3143  C  CA    . ARG B  2  68  ? -17.043 28.375  32.888  1.00 61.25  ? 68   ARG B CA    1 
ATOM   3144  C  C     . ARG B  2  68  ? -18.067 28.643  31.785  1.00 61.50  ? 68   ARG B C     1 
ATOM   3145  O  O     . ARG B  2  68  ? -19.167 29.146  32.041  1.00 60.98  ? 68   ARG B O     1 
ATOM   3146  C  CB    . ARG B  2  68  ? -16.089 29.565  33.011  1.00 62.05  ? 68   ARG B CB    1 
ATOM   3147  C  CG    . ARG B  2  68  ? -16.764 30.884  33.395  1.00 63.28  ? 68   ARG B CG    1 
ATOM   3148  C  CD    . ARG B  2  68  ? -15.735 31.983  33.587  1.00 62.22  ? 68   ARG B CD    1 
ATOM   3149  N  NE    . ARG B  2  68  ? -14.925 32.149  32.394  1.00 59.62  ? 68   ARG B NE    1 
ATOM   3150  C  CZ    . ARG B  2  68  ? -13.895 32.968  32.315  1.00 58.05  ? 68   ARG B CZ    1 
ATOM   3151  N  NH1   . ARG B  2  68  ? -13.553 33.691  33.370  1.00 54.02  ? 68   ARG B NH1   1 
ATOM   3152  N  NH2   . ARG B  2  68  ? -13.227 33.063  31.176  1.00 56.58  ? 68   ARG B NH2   1 
ATOM   3153  N  N     . LEU B  2  69  ? -17.714 28.293  30.562  1.00 60.76  ? 69   LEU B N     1 
ATOM   3154  C  CA    . LEU B  2  69  ? -18.609 28.560  29.457  1.00 60.93  ? 69   LEU B CA    1 
ATOM   3155  C  C     . LEU B  2  69  ? -19.533 27.448  29.034  1.00 60.83  ? 69   LEU B C     1 
ATOM   3156  O  O     . LEU B  2  69  ? -20.305 27.638  28.110  1.00 60.95  ? 69   LEU B O     1 
ATOM   3157  C  CB    . LEU B  2  69  ? -17.791 29.026  28.261  1.00 61.76  ? 69   LEU B CB    1 
ATOM   3158  C  CG    . LEU B  2  69  ? -16.980 30.301  28.497  1.00 61.66  ? 69   LEU B CG    1 
ATOM   3159  C  CD1   . LEU B  2  69  ? -16.247 30.675  27.232  1.00 62.77  ? 69   LEU B CD1   1 
ATOM   3160  C  CD2   . LEU B  2  69  ? -17.905 31.438  28.911  1.00 60.88  ? 69   LEU B CD2   1 
ATOM   3161  N  N     . GLY B  2  70  ? -19.460 26.294  29.684  1.00 61.41  ? 70   GLY B N     1 
ATOM   3162  C  CA    . GLY B  2  70  ? -20.343 25.210  29.309  1.00 61.50  ? 70   GLY B CA    1 
ATOM   3163  C  C     . GLY B  2  70  ? -19.731 23.851  29.024  1.00 62.30  ? 70   GLY B C     1 
ATOM   3164  O  O     . GLY B  2  70  ? -20.416 22.844  29.139  1.00 64.70  ? 70   GLY B O     1 
ATOM   3165  N  N     . VAL B  2  71  ? -18.470 23.794  28.635  1.00 60.62  ? 71   VAL B N     1 
ATOM   3166  C  CA    . VAL B  2  71  ? -17.855 22.500  28.374  1.00 59.87  ? 71   VAL B CA    1 
ATOM   3167  C  C     . VAL B  2  71  ? -17.593 21.864  29.734  1.00 60.40  ? 71   VAL B C     1 
ATOM   3168  O  O     . VAL B  2  71  ? -16.665 22.264  30.437  1.00 61.31  ? 71   VAL B O     1 
ATOM   3169  C  CB    . VAL B  2  71  ? -16.529 22.656  27.648  1.00 59.33  ? 71   VAL B CB    1 
ATOM   3170  C  CG1   . VAL B  2  71  ? -16.042 21.318  27.175  1.00 60.43  ? 71   VAL B CG1   1 
ATOM   3171  C  CG2   . VAL B  2  71  ? -16.690 23.576  26.480  1.00 60.73  ? 71   VAL B CG2   1 
ATOM   3172  N  N     . THR B  2  72  ? -18.395 20.878  30.108  1.00 60.38  ? 72   THR B N     1 
ATOM   3173  C  CA    . THR B  2  72  ? -18.216 20.254  31.410  1.00 60.67  ? 72   THR B CA    1 
ATOM   3174  C  C     . THR B  2  72  ? -18.111 18.725  31.417  1.00 61.21  ? 72   THR B C     1 
ATOM   3175  O  O     . THR B  2  72  ? -18.179 18.098  32.477  1.00 62.13  ? 72   THR B O     1 
ATOM   3176  C  CB    . THR B  2  72  ? -19.352 20.691  32.394  1.00 61.59  ? 72   THR B CB    1 
ATOM   3177  O  OG1   . THR B  2  72  ? -20.645 20.354  31.858  1.00 61.06  ? 72   THR B OG1   1 
ATOM   3178  C  CG2   . THR B  2  72  ? -19.276 22.185  32.640  1.00 60.58  ? 72   THR B CG2   1 
ATOM   3179  N  N     . GLY B  2  73  ? -17.927 18.124  30.254  1.00 60.50  ? 73   GLY B N     1 
ATOM   3180  C  CA    . GLY B  2  73  ? -17.833 16.681  30.217  1.00 61.50  ? 73   GLY B CA    1 
ATOM   3181  C  C     . GLY B  2  73  ? -16.815 16.156  29.231  1.00 62.91  ? 73   GLY B C     1 
ATOM   3182  O  O     . GLY B  2  73  ? -16.237 16.924  28.463  1.00 64.09  ? 73   GLY B O     1 
ATOM   3183  N  N     . SER B  2  74  ? -16.602 14.843  29.252  1.00 63.87  ? 74   SER B N     1 
ATOM   3184  C  CA    . SER B  2  74  ? -15.646 14.211  28.358  1.00 65.17  ? 74   SER B CA    1 
ATOM   3185  C  C     . SER B  2  74  ? -16.254 13.088  27.567  1.00 67.19  ? 74   SER B C     1 
ATOM   3186  O  O     . SER B  2  74  ? -17.250 12.478  27.973  1.00 68.13  ? 74   SER B O     1 
ATOM   3187  C  CB    . SER B  2  74  ? -14.465 13.636  29.125  1.00 64.80  ? 74   SER B CB    1 
ATOM   3188  O  OG    . SER B  2  74  ? -13.730 12.761  28.280  1.00 61.98  ? 74   SER B OG    1 
ATOM   3189  N  N     . TRP B  2  75  ? -15.629 12.804  26.435  1.00 68.58  ? 75   TRP B N     1 
ATOM   3190  C  CA    . TRP B  2  75  ? -16.098 11.731  25.580  1.00 69.29  ? 75   TRP B CA    1 
ATOM   3191  C  C     . TRP B  2  75  ? -15.922 10.468  26.380  1.00 69.56  ? 75   TRP B C     1 
ATOM   3192  O  O     . TRP B  2  75  ? -16.449 9.425   26.005  1.00 71.41  ? 75   TRP B O     1 
ATOM   3193  C  CB    . TRP B  2  75  ? -15.273 11.653  24.290  1.00 69.53  ? 75   TRP B CB    1 
ATOM   3194  C  CG    . TRP B  2  75  ? -15.536 12.759  23.256  1.00 70.65  ? 75   TRP B CG    1 
ATOM   3195  C  CD1   . TRP B  2  75  ? -16.666 13.535  23.134  1.00 70.72  ? 75   TRP B CD1   1 
ATOM   3196  C  CD2   . TRP B  2  75  ? -14.696 13.111  22.141  1.00 71.32  ? 75   TRP B CD2   1 
ATOM   3197  N  NE1   . TRP B  2  75  ? -16.578 14.331  22.017  1.00 70.78  ? 75   TRP B NE1   1 
ATOM   3198  C  CE2   . TRP B  2  75  ? -15.382 14.092  21.391  1.00 71.22  ? 75   TRP B CE2   1 
ATOM   3199  C  CE3   . TRP B  2  75  ? -13.430 12.688  21.702  1.00 71.95  ? 75   TRP B CE3   1 
ATOM   3200  C  CZ2   . TRP B  2  75  ? -14.844 14.657  20.229  1.00 71.47  ? 75   TRP B CZ2   1 
ATOM   3201  C  CZ3   . TRP B  2  75  ? -12.900 13.254  20.546  1.00 72.22  ? 75   TRP B CZ3   1 
ATOM   3202  C  CH2   . TRP B  2  75  ? -13.608 14.227  19.826  1.00 71.50  ? 75   TRP B CH2   1 
ATOM   3203  N  N     . SER B  2  76  ? -15.169 10.573  27.482  1.00 69.74  ? 76   SER B N     1 
ATOM   3204  C  CA    . SER B  2  76  ? -14.898 9.439   28.382  1.00 69.49  ? 76   SER B CA    1 
ATOM   3205  C  C     . SER B  2  76  ? -16.060 9.171   29.322  1.00 68.85  ? 76   SER B C     1 
ATOM   3206  O  O     . SER B  2  76  ? -15.957 8.307   30.183  1.00 69.59  ? 76   SER B O     1 
ATOM   3207  C  CB    . SER B  2  76  ? -13.642 9.687   29.221  1.00 69.48  ? 76   SER B CB    1 
ATOM   3208  O  OG    . SER B  2  76  ? -12.484 9.685   28.426  1.00 70.41  ? 76   SER B OG    1 
ATOM   3209  N  N     . GLY B  2  77  ? -17.137 9.939   29.166  1.00 67.73  ? 77   GLY B N     1 
ATOM   3210  C  CA    . GLY B  2  77  ? -18.318 9.756   29.979  1.00 66.72  ? 77   GLY B CA    1 
ATOM   3211  C  C     . GLY B  2  77  ? -18.391 10.400  31.346  1.00 66.46  ? 77   GLY B C     1 
ATOM   3212  O  O     . GLY B  2  77  ? -19.421 10.271  32.015  1.00 68.37  ? 77   GLY B O     1 
ATOM   3213  N  N     . TRP B  2  78  ? -17.339 11.077  31.786  1.00 65.24  ? 78   TRP B N     1 
ATOM   3214  C  CA    . TRP B  2  78  ? -17.394 11.707  33.109  1.00 64.33  ? 78   TRP B CA    1 
ATOM   3215  C  C     . TRP B  2  78  ? -17.694 13.200  33.035  1.00 63.21  ? 78   TRP B C     1 
ATOM   3216  O  O     . TRP B  2  78  ? -17.450 13.826  32.014  1.00 63.48  ? 78   TRP B O     1 
ATOM   3217  C  CB    . TRP B  2  78  ? -16.097 11.473  33.888  1.00 64.29  ? 78   TRP B CB    1 
ATOM   3218  C  CG    . TRP B  2  78  ? -14.879 11.909  33.186  1.00 65.10  ? 78   TRP B CG    1 
ATOM   3219  C  CD1   . TRP B  2  78  ? -14.087 11.150  32.397  1.00 65.46  ? 78   TRP B CD1   1 
ATOM   3220  C  CD2   . TRP B  2  78  ? -14.341 13.241  33.140  1.00 65.53  ? 78   TRP B CD2   1 
ATOM   3221  N  NE1   . TRP B  2  78  ? -13.082 11.919  31.848  1.00 65.73  ? 78   TRP B NE1   1 
ATOM   3222  C  CE2   . TRP B  2  78  ? -13.216 13.207  32.285  1.00 65.15  ? 78   TRP B CE2   1 
ATOM   3223  C  CE3   . TRP B  2  78  ? -14.702 14.458  33.738  1.00 64.78  ? 78   TRP B CE3   1 
ATOM   3224  C  CZ2   . TRP B  2  78  ? -12.452 14.331  32.006  1.00 64.10  ? 78   TRP B CZ2   1 
ATOM   3225  C  CZ3   . TRP B  2  78  ? -13.937 15.579  33.465  1.00 64.63  ? 78   TRP B CZ3   1 
ATOM   3226  C  CH2   . TRP B  2  78  ? -12.820 15.505  32.600  1.00 64.38  ? 78   TRP B CH2   1 
ATOM   3227  N  N     . SER B  2  79  ? -18.219 13.763  34.116  1.00 62.65  ? 79   SER B N     1 
ATOM   3228  C  CA    . SER B  2  79  ? -18.584 15.177  34.159  1.00 62.50  ? 79   SER B CA    1 
ATOM   3229  C  C     . SER B  2  79  ? -17.749 15.920  35.196  1.00 61.48  ? 79   SER B C     1 
ATOM   3230  O  O     . SER B  2  79  ? -17.378 15.345  36.192  1.00 59.11  ? 79   SER B O     1 
ATOM   3231  C  CB    . SER B  2  79  ? -20.086 15.317  34.505  1.00 64.47  ? 79   SER B CB    1 
ATOM   3232  O  OG    . SER B  2  79  ? -20.547 16.671  34.524  1.00 67.47  ? 79   SER B OG    1 
ATOM   3233  N  N     . ILE B  2  80  ? -17.474 17.198  34.967  1.00 61.62  ? 80   ILE B N     1 
ATOM   3234  C  CA    . ILE B  2  80  ? -16.692 17.984  35.901  1.00 62.21  ? 80   ILE B CA    1 
ATOM   3235  C  C     . ILE B  2  80  ? -17.452 18.214  37.215  1.00 63.66  ? 80   ILE B C     1 
ATOM   3236  O  O     . ILE B  2  80  ? -16.880 18.675  38.207  1.00 61.64  ? 80   ILE B O     1 
ATOM   3237  C  CB    . ILE B  2  80  ? -16.308 19.333  35.286  1.00 62.80  ? 80   ILE B CB    1 
ATOM   3238  C  CG1   . ILE B  2  80  ? -14.983 19.812  35.863  1.00 62.84  ? 80   ILE B CG1   1 
ATOM   3239  C  CG2   . ILE B  2  80  ? -17.367 20.374  35.580  1.00 63.70  ? 80   ILE B CG2   1 
ATOM   3240  C  CD1   . ILE B  2  80  ? -13.788 19.004  35.390  1.00 62.57  ? 80   ILE B CD1   1 
ATOM   3241  N  N     . THR B  2  81  ? -18.754 17.922  37.198  1.00 66.29  ? 81   THR B N     1 
ATOM   3242  C  CA    . THR B  2  81  ? -19.619 18.062  38.378  1.00 68.87  ? 81   THR B CA    1 
ATOM   3243  C  C     . THR B  2  81  ? -19.786 16.672  38.935  1.00 72.08  ? 81   THR B C     1 
ATOM   3244  O  O     . THR B  2  81  ? -20.287 16.482  40.040  1.00 73.10  ? 81   THR B O     1 
ATOM   3245  C  CB    . THR B  2  81  ? -21.024 18.612  38.049  1.00 67.28  ? 81   THR B CB    1 
ATOM   3246  O  OG1   . THR B  2  81  ? -21.452 18.119  36.772  1.00 64.07  ? 81   THR B OG1   1 
ATOM   3247  C  CG2   . THR B  2  81  ? -21.013 20.126  38.076  1.00 65.66  ? 81   THR B CG2   1 
ATOM   3248  N  N     . GLY B  2  82  ? -19.361 15.693  38.147  1.00 75.14  ? 82   GLY B N     1 
ATOM   3249  C  CA    . GLY B  2  82  ? -19.426 14.308  38.584  1.00 78.21  ? 82   GLY B CA    1 
ATOM   3250  C  C     . GLY B  2  82  ? -20.751 13.636  38.308  1.00 79.92  ? 82   GLY B C     1 
ATOM   3251  O  O     . GLY B  2  82  ? -21.303 12.970  39.183  1.00 79.28  ? 82   GLY B O     1 
ATOM   3252  N  N     . GLU B  2  83  ? -21.259 13.789  37.096  1.00 81.30  ? 83   GLU B N     1 
ATOM   3253  C  CA    . GLU B  2  83  ? -22.521 13.170  36.799  1.00 83.24  ? 83   GLU B CA    1 
ATOM   3254  C  C     . GLU B  2  83  ? -22.410 11.877  36.015  1.00 84.07  ? 83   GLU B C     1 
ATOM   3255  O  O     . GLU B  2  83  ? -21.663 11.778  35.027  1.00 84.12  ? 83   GLU B O     1 
ATOM   3256  C  CB    . GLU B  2  83  ? -23.441 14.171  36.107  1.00 84.40  ? 83   GLU B CB    1 
ATOM   3257  C  CG    . GLU B  2  83  ? -23.988 15.203  37.089  1.00 86.16  ? 83   GLU B CG    1 
ATOM   3258  C  CD    . GLU B  2  83  ? -24.772 16.312  36.399  1.00 88.81  ? 83   GLU B CD    1 
ATOM   3259  O  OE1   . GLU B  2  83  ? -25.811 16.000  35.773  1.00 90.19  ? 83   GLU B OE1   1 
ATOM   3260  O  OE2   . GLU B  2  83  ? -24.351 17.496  36.473  1.00 89.24  ? 83   GLU B OE2   1 
ATOM   3261  N  N     . THR B  2  84  ? -23.163 10.884  36.497  1.00 85.48  ? 84   THR B N     1 
ATOM   3262  C  CA    . THR B  2  84  ? -23.222 9.546   35.907  1.00 86.41  ? 84   THR B CA    1 
ATOM   3263  C  C     . THR B  2  84  ? -23.471 9.616   34.386  1.00 86.30  ? 84   THR B C     1 
ATOM   3264  O  O     . THR B  2  84  ? -24.370 10.342  33.922  1.00 87.07  ? 84   THR B O     1 
ATOM   3265  C  CB    . THR B  2  84  ? -24.367 8.700   36.557  1.00 87.49  ? 84   THR B CB    1 
ATOM   3266  O  OG1   . THR B  2  84  ? -25.640 9.266   36.203  1.00 88.34  ? 84   THR B OG1   1 
ATOM   3267  C  CG2   . THR B  2  84  ? -24.243 8.678   38.087  1.00 87.38  ? 84   THR B CG2   1 
ATOM   3268  N  N     . GLY B  2  85  ? -22.667 8.863   33.634  1.00 84.95  ? 85   GLY B N     1 
ATOM   3269  C  CA    . GLY B  2  85  ? -22.786 8.814   32.187  1.00 82.43  ? 85   GLY B CA    1 
ATOM   3270  C  C     . GLY B  2  85  ? -23.688 9.782   31.433  1.00 81.45  ? 85   GLY B C     1 
ATOM   3271  O  O     . GLY B  2  85  ? -24.785 9.400   30.999  1.00 81.23  ? 85   GLY B O     1 
ATOM   3272  N  N     . ILE B  2  86  ? -23.238 11.034  31.299  1.00 81.47  ? 86   ILE B N     1 
ATOM   3273  C  CA    . ILE B  2  86  ? -23.964 12.062  30.527  1.00 80.78  ? 86   ILE B CA    1 
ATOM   3274  C  C     . ILE B  2  86  ? -23.339 11.983  29.106  1.00 81.75  ? 86   ILE B C     1 
ATOM   3275  O  O     . ILE B  2  86  ? -22.704 10.961  28.763  1.00 82.01  ? 86   ILE B O     1 
ATOM   3276  C  CB    . ILE B  2  86  ? -23.774 13.496  31.112  1.00 78.62  ? 86   ILE B CB    1 
ATOM   3277  C  CG1   . ILE B  2  86  ? -22.291 13.730  31.453  1.00 77.80  ? 86   ILE B CG1   1 
ATOM   3278  C  CG2   . ILE B  2  86  ? -24.682 13.695  32.335  1.00 76.77  ? 86   ILE B CG2   1 
ATOM   3279  C  CD1   . ILE B  2  86  ? -21.333 13.869  30.252  1.00 76.89  ? 86   ILE B CD1   1 
ATOM   3280  N  N     . ASP B  2  87  ? -23.486 13.025  28.285  1.00 81.30  ? 87   ASP B N     1 
ATOM   3281  C  CA    . ASP B  2  87  ? -22.909 12.947  26.941  1.00 81.46  ? 87   ASP B CA    1 
ATOM   3282  C  C     . ASP B  2  87  ? -22.749 14.279  26.254  1.00 80.96  ? 87   ASP B C     1 
ATOM   3283  O  O     . ASP B  2  87  ? -23.658 14.756  25.588  1.00 81.07  ? 87   ASP B O     1 
ATOM   3284  C  CB    . ASP B  2  87  ? -23.769 12.074  26.054  1.00 83.20  ? 87   ASP B CB    1 
ATOM   3285  C  CG    . ASP B  2  87  ? -25.184 12.612  25.929  1.00 85.91  ? 87   ASP B CG    1 
ATOM   3286  O  OD1   . ASP B  2  87  ? -25.609 12.823  24.761  1.00 86.32  ? 87   ASP B OD1   1 
ATOM   3287  O  OD2   . ASP B  2  87  ? -25.857 12.817  26.990  1.00 86.32  ? 87   ASP B OD2   1 
ATOM   3288  N  N     . PRO B  2  88  ? -21.573 14.894  26.379  1.00 80.57  ? 88   PRO B N     1 
ATOM   3289  C  CA    . PRO B  2  88  ? -21.447 16.182  25.708  1.00 79.65  ? 88   PRO B CA    1 
ATOM   3290  C  C     . PRO B  2  88  ? -21.732 15.877  24.279  1.00 79.71  ? 88   PRO B C     1 
ATOM   3291  O  O     . PRO B  2  88  ? -21.714 14.701  23.879  1.00 78.44  ? 88   PRO B O     1 
ATOM   3292  C  CB    . PRO B  2  88  ? -19.986 16.537  25.901  1.00 79.26  ? 88   PRO B CB    1 
ATOM   3293  C  CG    . PRO B  2  88  ? -19.618 15.785  27.127  1.00 81.04  ? 88   PRO B CG    1 
ATOM   3294  C  CD    . PRO B  2  88  ? -20.286 14.472  26.943  1.00 80.38  ? 88   PRO B CD    1 
ATOM   3295  N  N     . GLY B  2  89  ? -22.032 16.924  23.521  1.00 78.86  ? 89   GLY B N     1 
ATOM   3296  C  CA    . GLY B  2  89  ? -22.270 16.722  22.114  1.00 78.33  ? 89   GLY B CA    1 
ATOM   3297  C  C     . GLY B  2  89  ? -20.888 16.397  21.592  1.00 76.76  ? 89   GLY B C     1 
ATOM   3298  O  O     . GLY B  2  89  ? -20.243 15.432  22.024  1.00 76.49  ? 89   GLY B O     1 
ATOM   3299  N  N     . PHE B  2  90  ? -20.427 17.196  20.651  1.00 75.80  ? 90   PHE B N     1 
ATOM   3300  C  CA    . PHE B  2  90  ? -19.101 16.988  20.146  1.00 73.70  ? 90   PHE B CA    1 
ATOM   3301  C  C     . PHE B  2  90  ? -18.309 17.850  21.092  1.00 71.49  ? 90   PHE B C     1 
ATOM   3302  O  O     . PHE B  2  90  ? -17.213 17.500  21.496  1.00 70.36  ? 90   PHE B O     1 
ATOM   3303  C  CB    . PHE B  2  90  ? -18.986 17.500  18.714  1.00 75.51  ? 90   PHE B CB    1 
ATOM   3304  C  CG    . PHE B  2  90  ? -17.575 17.749  18.276  1.00 77.11  ? 90   PHE B CG    1 
ATOM   3305  C  CD1   . PHE B  2  90  ? -16.903 18.903  18.690  1.00 77.95  ? 90   PHE B CD1   1 
ATOM   3306  C  CD2   . PHE B  2  90  ? -16.912 16.825  17.462  1.00 77.17  ? 90   PHE B CD2   1 
ATOM   3307  C  CE1   . PHE B  2  90  ? -15.587 19.135  18.300  1.00 79.38  ? 90   PHE B CE1   1 
ATOM   3308  C  CE2   . PHE B  2  90  ? -15.596 17.034  17.061  1.00 77.62  ? 90   PHE B CE2   1 
ATOM   3309  C  CZ    . PHE B  2  90  ? -14.926 18.188  17.478  1.00 79.43  ? 90   PHE B CZ    1 
ATOM   3310  N  N     . TRP B  2  91  ? -18.911 18.957  21.485  1.00 69.36  ? 91   TRP B N     1 
ATOM   3311  C  CA    . TRP B  2  91  ? -18.237 19.882  22.363  1.00 69.42  ? 91   TRP B CA    1 
ATOM   3312  C  C     . TRP B  2  91  ? -17.895 19.404  23.772  1.00 69.47  ? 91   TRP B C     1 
ATOM   3313  O  O     . TRP B  2  91  ? -18.441 19.889  24.770  1.00 70.42  ? 91   TRP B O     1 
ATOM   3314  C  CB    . TRP B  2  91  ? -19.011 21.195  22.406  1.00 69.79  ? 91   TRP B CB    1 
ATOM   3315  C  CG    . TRP B  2  91  ? -19.119 21.824  21.035  1.00 69.94  ? 91   TRP B CG    1 
ATOM   3316  C  CD1   . TRP B  2  91  ? -20.265 22.125  20.344  1.00 70.28  ? 91   TRP B CD1   1 
ATOM   3317  C  CD2   . TRP B  2  91  ? -18.036 22.196  20.182  1.00 69.34  ? 91   TRP B CD2   1 
ATOM   3318  N  NE1   . TRP B  2  91  ? -19.956 22.657  19.117  1.00 68.28  ? 91   TRP B NE1   1 
ATOM   3319  C  CE2   . TRP B  2  91  ? -18.596 22.713  18.993  1.00 68.88  ? 91   TRP B CE2   1 
ATOM   3320  C  CE3   . TRP B  2  91  ? -16.647 22.136  20.306  1.00 68.57  ? 91   TRP B CE3   1 
ATOM   3321  C  CZ2   . TRP B  2  91  ? -17.818 23.168  17.943  1.00 68.65  ? 91   TRP B CZ2   1 
ATOM   3322  C  CZ3   . TRP B  2  91  ? -15.878 22.582  19.269  1.00 68.78  ? 91   TRP B CZ3   1 
ATOM   3323  C  CH2   . TRP B  2  91  ? -16.463 23.095  18.095  1.00 68.90  ? 91   TRP B CH2   1 
ATOM   3324  N  N     . SER B  2  92  ? -16.972 18.448  23.843  1.00 68.75  ? 92   SER B N     1 
ATOM   3325  C  CA    . SER B  2  92  ? -16.478 17.923  25.116  1.00 67.06  ? 92   SER B CA    1 
ATOM   3326  C  C     . SER B  2  92  ? -15.083 18.527  25.222  1.00 66.42  ? 92   SER B C     1 
ATOM   3327  O  O     . SER B  2  92  ? -14.629 19.185  24.288  1.00 67.93  ? 92   SER B O     1 
ATOM   3328  C  CB    . SER B  2  92  ? -16.352 16.405  25.061  1.00 67.10  ? 92   SER B CB    1 
ATOM   3329  O  OG    . SER B  2  92  ? -15.369 16.038  24.119  1.00 64.13  ? 92   SER B OG    1 
ATOM   3330  N  N     . PHE B  2  93  ? -14.402 18.321  26.337  1.00 64.16  ? 93   PHE B N     1 
ATOM   3331  C  CA    . PHE B  2  93  ? -13.058 18.843  26.460  1.00 62.40  ? 93   PHE B CA    1 
ATOM   3332  C  C     . PHE B  2  93  ? -12.199 18.328  25.285  1.00 63.47  ? 93   PHE B C     1 
ATOM   3333  O  O     . PHE B  2  93  ? -11.331 19.042  24.769  1.00 62.24  ? 93   PHE B O     1 
ATOM   3334  C  CB    . PHE B  2  93  ? -12.438 18.385  27.768  1.00 60.71  ? 93   PHE B CB    1 
ATOM   3335  C  CG    . PHE B  2  93  ? -13.096 18.953  28.985  1.00 60.61  ? 93   PHE B CG    1 
ATOM   3336  C  CD1   . PHE B  2  93  ? -13.050 20.313  29.240  1.00 59.91  ? 93   PHE B CD1   1 
ATOM   3337  C  CD2   . PHE B  2  93  ? -13.752 18.124  29.884  1.00 60.50  ? 93   PHE B CD2   1 
ATOM   3338  C  CE1   . PHE B  2  93  ? -13.641 20.834  30.363  1.00 60.05  ? 93   PHE B CE1   1 
ATOM   3339  C  CE2   . PHE B  2  93  ? -14.349 18.639  31.013  1.00 59.01  ? 93   PHE B CE2   1 
ATOM   3340  C  CZ    . PHE B  2  93  ? -14.294 19.995  31.255  1.00 59.72  ? 93   PHE B CZ    1 
ATOM   3341  N  N     . GLU B  2  94  ? -12.425 17.092  24.859  1.00 63.97  ? 94   GLU B N     1 
ATOM   3342  C  CA    . GLU B  2  94  ? -11.624 16.576  23.756  1.00 64.75  ? 94   GLU B CA    1 
ATOM   3343  C  C     . GLU B  2  94  ? -11.991 17.319  22.490  1.00 64.52  ? 94   GLU B C     1 
ATOM   3344  O  O     . GLU B  2  94  ? -11.127 17.635  21.674  1.00 65.60  ? 94   GLU B O     1 
ATOM   3345  C  CB    . GLU B  2  94  ? -11.848 15.077  23.531  1.00 67.49  ? 94   GLU B CB    1 
ATOM   3346  C  CG    . GLU B  2  94  ? -11.404 14.150  24.649  1.00 69.51  ? 94   GLU B CG    1 
ATOM   3347  C  CD    . GLU B  2  94  ? -12.342 14.173  25.837  1.00 71.38  ? 94   GLU B CD    1 
ATOM   3348  O  OE1   . GLU B  2  94  ? -13.573 14.096  25.654  1.00 72.73  ? 94   GLU B OE1   1 
ATOM   3349  O  OE2   . GLU B  2  94  ? -11.845 14.260  26.972  1.00 73.00  ? 94   GLU B OE2   1 
ATOM   3350  N  N     . GLY B  2  95  ? -13.279 17.583  22.316  1.00 63.23  ? 95   GLY B N     1 
ATOM   3351  C  CA    . GLY B  2  95  ? -13.722 18.303  21.134  1.00 60.95  ? 95   GLY B CA    1 
ATOM   3352  C  C     . GLY B  2  95  ? -13.128 19.699  21.049  1.00 59.11  ? 95   GLY B C     1 
ATOM   3353  O  O     . GLY B  2  95  ? -12.620 20.098  20.006  1.00 58.83  ? 95   GLY B O     1 
ATOM   3354  N  N     . VAL B  2  96  ? -13.203 20.443  22.144  1.00 56.27  ? 96   VAL B N     1 
ATOM   3355  C  CA    . VAL B  2  96  ? -12.657 21.789  22.181  1.00 55.38  ? 96   VAL B CA    1 
ATOM   3356  C  C     . VAL B  2  96  ? -11.181 21.764  21.790  1.00 54.46  ? 96   VAL B C     1 
ATOM   3357  O  O     . VAL B  2  96  ? -10.723 22.546  20.966  1.00 53.00  ? 96   VAL B O     1 
ATOM   3358  C  CB    . VAL B  2  96  ? -12.773 22.389  23.584  1.00 55.26  ? 96   VAL B CB    1 
ATOM   3359  C  CG1   . VAL B  2  96  ? -12.196 23.773  23.598  1.00 55.06  ? 96   VAL B CG1   1 
ATOM   3360  C  CG2   . VAL B  2  96  ? -14.217 22.396  24.032  1.00 55.60  ? 96   VAL B CG2   1 
ATOM   3361  N  N     . ALA B  2  97  ? -10.441 20.860  22.400  1.00 55.06  ? 97   ALA B N     1 
ATOM   3362  C  CA    . ALA B  2  97  ? -9.030  20.733  22.107  1.00 56.15  ? 97   ALA B CA    1 
ATOM   3363  C  C     . ALA B  2  97  ? -8.842  20.424  20.621  1.00 57.26  ? 97   ALA B C     1 
ATOM   3364  O  O     . ALA B  2  97  ? -7.947  20.969  19.956  1.00 58.28  ? 97   ALA B O     1 
ATOM   3365  C  CB    . ALA B  2  97  ? -8.436  19.642  22.941  1.00 54.83  ? 97   ALA B CB    1 
ATOM   3366  N  N     . LEU B  2  98  ? -9.691  19.546  20.105  1.00 57.09  ? 98   LEU B N     1 
ATOM   3367  C  CA    . LEU B  2  98  ? -9.620  19.175  18.706  1.00 58.20  ? 98   LEU B CA    1 
ATOM   3368  C  C     . LEU B  2  98  ? -9.818  20.400  17.826  1.00 59.08  ? 98   LEU B C     1 
ATOM   3369  O  O     . LEU B  2  98  ? -8.924  20.798  17.082  1.00 60.25  ? 98   LEU B O     1 
ATOM   3370  C  CB    . LEU B  2  98  ? -10.688 18.147  18.388  1.00 58.15  ? 98   LEU B CB    1 
ATOM   3371  C  CG    . LEU B  2  98  ? -10.682 17.749  16.914  1.00 59.14  ? 98   LEU B CG    1 
ATOM   3372  C  CD1   . LEU B  2  98  ? -9.311  17.164  16.542  1.00 57.74  ? 98   LEU B CD1   1 
ATOM   3373  C  CD2   . LEU B  2  98  ? -11.822 16.756  16.659  1.00 58.68  ? 98   LEU B CD2   1 
ATOM   3374  N  N     . ALA B  2  99  ? -10.999 20.987  17.917  1.00 58.36  ? 99   ALA B N     1 
ATOM   3375  C  CA    . ALA B  2  99  ? -11.321 22.169  17.148  1.00 56.26  ? 99   ALA B CA    1 
ATOM   3376  C  C     . ALA B  2  99  ? -10.116 23.055  17.038  1.00 56.15  ? 99   ALA B C     1 
ATOM   3377  O  O     . ALA B  2  99  ? -9.705  23.391  15.940  1.00 55.79  ? 99   ALA B O     1 
ATOM   3378  C  CB    . ALA B  2  99  ? -12.413 22.905  17.809  1.00 56.61  ? 99   ALA B CB    1 
ATOM   3379  N  N     . HIS B  2  100 ? -9.545  23.426  18.180  1.00 56.26  ? 100  HIS B N     1 
ATOM   3380  C  CA    . HIS B  2  100 ? -8.365  24.289  18.203  1.00 57.46  ? 100  HIS B CA    1 
ATOM   3381  C  C     . HIS B  2  100 ? -7.201  23.765  17.386  1.00 57.57  ? 100  HIS B C     1 
ATOM   3382  O  O     . HIS B  2  100 ? -6.641  24.505  16.588  1.00 57.54  ? 100  HIS B O     1 
ATOM   3383  C  CB    . HIS B  2  100 ? -7.886  24.522  19.624  1.00 56.89  ? 100  HIS B CB    1 
ATOM   3384  C  CG    . HIS B  2  100 ? -8.646  25.582  20.344  1.00 57.74  ? 100  HIS B CG    1 
ATOM   3385  N  ND1   . HIS B  2  100 ? -9.935  25.402  20.793  1.00 58.48  ? 100  HIS B ND1   1 
ATOM   3386  C  CD2   . HIS B  2  100 ? -8.288  26.833  20.714  1.00 59.11  ? 100  HIS B CD2   1 
ATOM   3387  C  CE1   . HIS B  2  100 ? -10.337 26.496  21.415  1.00 59.96  ? 100  HIS B CE1   1 
ATOM   3388  N  NE2   . HIS B  2  100 ? -9.356  27.381  21.381  1.00 60.63  ? 100  HIS B NE2   1 
ATOM   3389  N  N     . ILE B  2  101 ? -6.820  22.505  17.592  1.00 56.88  ? 101  ILE B N     1 
ATOM   3390  C  CA    . ILE B  2  101 ? -5.713  21.909  16.833  1.00 56.50  ? 101  ILE B CA    1 
ATOM   3391  C  C     . ILE B  2  101 ? -5.941  22.040  15.326  1.00 57.55  ? 101  ILE B C     1 
ATOM   3392  O  O     . ILE B  2  101 ? -4.990  22.206  14.569  1.00 59.48  ? 101  ILE B O     1 
ATOM   3393  C  CB    . ILE B  2  101 ? -5.522  20.421  17.163  1.00 54.19  ? 101  ILE B CB    1 
ATOM   3394  C  CG1   . ILE B  2  101 ? -5.081  20.264  18.605  1.00 51.79  ? 101  ILE B CG1   1 
ATOM   3395  C  CG2   . ILE B  2  101 ? -4.489  19.822  16.245  1.00 52.17  ? 101  ILE B CG2   1 
ATOM   3396  C  CD1   . ILE B  2  101 ? -3.729  20.817  18.854  1.00 51.68  ? 101  ILE B CD1   1 
ATOM   3397  N  N     . VAL B  2  102 ? -7.197  21.958  14.898  1.00 57.75  ? 102  VAL B N     1 
ATOM   3398  C  CA    . VAL B  2  102 ? -7.539  22.101  13.487  1.00 57.95  ? 102  VAL B CA    1 
ATOM   3399  C  C     . VAL B  2  102 ? -7.417  23.558  13.035  1.00 57.92  ? 102  VAL B C     1 
ATOM   3400  O  O     . VAL B  2  102 ? -6.832  23.836  12.000  1.00 57.14  ? 102  VAL B O     1 
ATOM   3401  C  CB    . VAL B  2  102 ? -8.961  21.641  13.232  1.00 58.35  ? 102  VAL B CB    1 
ATOM   3402  C  CG1   . VAL B  2  102 ? -9.257  21.665  11.740  1.00 59.32  ? 102  VAL B CG1   1 
ATOM   3403  C  CG2   . VAL B  2  102 ? -9.142  20.268  13.809  1.00 57.84  ? 102  VAL B CG2   1 
ATOM   3404  N  N     . LEU B  2  103 ? -7.982  24.470  13.820  1.00 57.43  ? 103  LEU B N     1 
ATOM   3405  C  CA    . LEU B  2  103 ? -7.941  25.889  13.530  1.00 57.39  ? 103  LEU B CA    1 
ATOM   3406  C  C     . LEU B  2  103 ? -6.523  26.364  13.343  1.00 58.21  ? 103  LEU B C     1 
ATOM   3407  O  O     . LEU B  2  103 ? -6.227  27.088  12.402  1.00 59.15  ? 103  LEU B O     1 
ATOM   3408  C  CB    . LEU B  2  103 ? -8.581  26.692  14.660  1.00 57.19  ? 103  LEU B CB    1 
ATOM   3409  C  CG    . LEU B  2  103 ? -8.547  28.221  14.558  1.00 57.19  ? 103  LEU B CG    1 
ATOM   3410  C  CD1   . LEU B  2  103 ? -9.138  28.686  13.244  1.00 58.28  ? 103  LEU B CD1   1 
ATOM   3411  C  CD2   . LEU B  2  103 ? -9.335  28.812  15.697  1.00 57.28  ? 103  LEU B CD2   1 
ATOM   3412  N  N     . SER B  2  104 ? -5.642  25.969  14.243  1.00 59.76  ? 104  SER B N     1 
ATOM   3413  C  CA    . SER B  2  104 ? -4.261  26.395  14.140  1.00 61.74  ? 104  SER B CA    1 
ATOM   3414  C  C     . SER B  2  104 ? -3.647  25.774  12.915  1.00 63.16  ? 104  SER B C     1 
ATOM   3415  O  O     . SER B  2  104 ? -2.591  26.203  12.470  1.00 64.81  ? 104  SER B O     1 
ATOM   3416  C  CB    . SER B  2  104 ? -3.448  25.984  15.358  1.00 62.04  ? 104  SER B CB    1 
ATOM   3417  O  OG    . SER B  2  104 ? -3.262  24.586  15.369  1.00 62.45  ? 104  SER B OG    1 
ATOM   3418  N  N     . GLY B  2  105 ? -4.288  24.752  12.371  1.00 62.72  ? 105  GLY B N     1 
ATOM   3419  C  CA    . GLY B  2  105 ? -3.754  24.133  11.166  1.00 62.66  ? 105  GLY B CA    1 
ATOM   3420  C  C     . GLY B  2  105 ? -4.069  24.999  9.954   1.00 62.09  ? 105  GLY B C     1 
ATOM   3421  O  O     . GLY B  2  105 ? -3.194  25.313  9.141   1.00 61.97  ? 105  GLY B O     1 
ATOM   3422  N  N     . LEU B  2  106 ? -5.344  25.371  9.844   1.00 62.41  ? 106  LEU B N     1 
ATOM   3423  C  CA    . LEU B  2  106 ? -5.842  26.216  8.773   1.00 61.98  ? 106  LEU B CA    1 
ATOM   3424  C  C     . LEU B  2  106 ? -5.125  27.554  8.840   1.00 62.42  ? 106  LEU B C     1 
ATOM   3425  O  O     . LEU B  2  106 ? -4.571  28.004  7.835   1.00 61.83  ? 106  LEU B O     1 
ATOM   3426  C  CB    . LEU B  2  106 ? -7.348  26.412  8.926   1.00 60.93  ? 106  LEU B CB    1 
ATOM   3427  C  CG    . LEU B  2  106 ? -8.152  25.161  8.588   1.00 60.02  ? 106  LEU B CG    1 
ATOM   3428  C  CD1   . LEU B  2  106 ? -9.568  25.292  9.099   1.00 59.81  ? 106  LEU B CD1   1 
ATOM   3429  C  CD2   . LEU B  2  106 ? -8.134  24.946  7.096   1.00 58.75  ? 106  LEU B CD2   1 
ATOM   3430  N  N     . LEU B  2  107 ? -5.135  28.182  10.018  1.00 62.27  ? 107  LEU B N     1 
ATOM   3431  C  CA    . LEU B  2  107 ? -4.445  29.453  10.202  1.00 62.26  ? 107  LEU B CA    1 
ATOM   3432  C  C     . LEU B  2  107 ? -2.992  29.353  9.733   1.00 62.05  ? 107  LEU B C     1 
ATOM   3433  O  O     . LEU B  2  107 ? -2.465  30.285  9.146   1.00 62.77  ? 107  LEU B O     1 
ATOM   3434  C  CB    . LEU B  2  107 ? -4.487  29.890  11.665  1.00 62.49  ? 107  LEU B CB    1 
ATOM   3435  C  CG    . LEU B  2  107 ? -5.761  30.560  12.164  1.00 62.62  ? 107  LEU B CG    1 
ATOM   3436  C  CD1   . LEU B  2  107 ? -5.664  30.754  13.650  1.00 62.75  ? 107  LEU B CD1   1 
ATOM   3437  C  CD2   . LEU B  2  107 ? -5.946  31.895  11.494  1.00 63.40  ? 107  LEU B CD2   1 
ATOM   3438  N  N     . PHE B  2  108 ? -2.343  28.231  9.984   1.00 62.12  ? 108  PHE B N     1 
ATOM   3439  C  CA    . PHE B  2  108 ? -0.965  28.072  9.542   1.00 63.66  ? 108  PHE B CA    1 
ATOM   3440  C  C     . PHE B  2  108 ? -0.863  28.172  8.031   1.00 64.99  ? 108  PHE B C     1 
ATOM   3441  O  O     . PHE B  2  108 ? -0.056  28.934  7.486   1.00 64.78  ? 108  PHE B O     1 
ATOM   3442  C  CB    . PHE B  2  108 ? -0.429  26.719  9.943   1.00 63.69  ? 108  PHE B CB    1 
ATOM   3443  C  CG    . PHE B  2  108 ? 0.954   26.452  9.438   1.00 63.90  ? 108  PHE B CG    1 
ATOM   3444  C  CD1   . PHE B  2  108 ? 2.060   27.035  10.048  1.00 64.23  ? 108  PHE B CD1   1 
ATOM   3445  C  CD2   . PHE B  2  108 ? 1.155   25.611  8.361   1.00 62.58  ? 108  PHE B CD2   1 
ATOM   3446  C  CE1   . PHE B  2  108 ? 3.340   26.772  9.588   1.00 63.30  ? 108  PHE B CE1   1 
ATOM   3447  C  CE2   . PHE B  2  108 ? 2.426   25.350  7.901   1.00 62.94  ? 108  PHE B CE2   1 
ATOM   3448  C  CZ    . PHE B  2  108 ? 3.522   25.928  8.514   1.00 62.61  ? 108  PHE B CZ    1 
ATOM   3449  N  N     . LEU B  2  109 ? -1.665  27.361  7.355   1.00 66.23  ? 109  LEU B N     1 
ATOM   3450  C  CA    . LEU B  2  109 ? -1.692  27.356  5.896   1.00 66.70  ? 109  LEU B CA    1 
ATOM   3451  C  C     . LEU B  2  109 ? -2.044  28.734  5.353   1.00 66.83  ? 109  LEU B C     1 
ATOM   3452  O  O     . LEU B  2  109 ? -1.329  29.261  4.512   1.00 67.54  ? 109  LEU B O     1 
ATOM   3453  C  CB    . LEU B  2  109 ? -2.707  26.326  5.399   1.00 66.41  ? 109  LEU B CB    1 
ATOM   3454  C  CG    . LEU B  2  109 ? -2.319  24.903  5.789   1.00 65.95  ? 109  LEU B CG    1 
ATOM   3455  C  CD1   . LEU B  2  109 ? -3.457  23.927  5.494   1.00 64.05  ? 109  LEU B CD1   1 
ATOM   3456  C  CD2   . LEU B  2  109 ? -1.042  24.538  5.036   1.00 65.43  ? 109  LEU B CD2   1 
ATOM   3457  N  N     . ALA B  2  110 ? -3.147  29.306  5.830   1.00 66.95  ? 110  ALA B N     1 
ATOM   3458  C  CA    . ALA B  2  110 ? -3.564  30.632  5.402   1.00 67.90  ? 110  ALA B CA    1 
ATOM   3459  C  C     . ALA B  2  110 ? -2.403  31.598  5.605   1.00 68.96  ? 110  ALA B C     1 
ATOM   3460  O  O     . ALA B  2  110 ? -2.200  32.509  4.813   1.00 69.22  ? 110  ALA B O     1 
ATOM   3461  C  CB    . ALA B  2  110 ? -4.771  31.103  6.205   1.00 66.69  ? 110  ALA B CB    1 
ATOM   3462  N  N     . ALA B  2  111 ? -1.640  31.395  6.668   1.00 69.75  ? 111  ALA B N     1 
ATOM   3463  C  CA    . ALA B  2  111 ? -0.505  32.260  6.945   1.00 70.90  ? 111  ALA B CA    1 
ATOM   3464  C  C     . ALA B  2  111 ? 0.588   32.159  5.874   1.00 71.21  ? 111  ALA B C     1 
ATOM   3465  O  O     . ALA B  2  111 ? 1.425   33.047  5.739   1.00 71.72  ? 111  ALA B O     1 
ATOM   3466  C  CB    . ALA B  2  111 ? 0.056   31.938  8.290   1.00 72.30  ? 111  ALA B CB    1 
ATOM   3467  N  N     . CYS B  2  112 ? 0.592   31.073  5.123   1.00 71.72  ? 112  CYS B N     1 
ATOM   3468  C  CA    . CYS B  2  112 ? 1.581   30.918  4.068   1.00 72.34  ? 112  CYS B CA    1 
ATOM   3469  C  C     . CYS B  2  112 ? 1.079   31.645  2.803   1.00 72.33  ? 112  CYS B C     1 
ATOM   3470  O  O     . CYS B  2  112 ? 1.784   32.469  2.206   1.00 72.02  ? 112  CYS B O     1 
ATOM   3471  C  CB    . CYS B  2  112 ? 1.833   29.429  3.781   1.00 72.54  ? 112  CYS B CB    1 
ATOM   3472  S  SG    . CYS B  2  112 ? 2.801   28.587  5.040   1.00 74.51  ? 112  CYS B SG    1 
ATOM   3473  N  N     . TRP B  2  113 ? -0.144  31.347  2.403   1.00 71.27  ? 113  TRP B N     1 
ATOM   3474  C  CA    . TRP B  2  113 ? -0.708  31.986  1.228   1.00 70.37  ? 113  TRP B CA    1 
ATOM   3475  C  C     . TRP B  2  113 ? -0.457  33.488  1.317   1.00 68.90  ? 113  TRP B C     1 
ATOM   3476  O  O     . TRP B  2  113 ? 0.079   34.080  0.398   1.00 68.92  ? 113  TRP B O     1 
ATOM   3477  C  CB    . TRP B  2  113 ? -2.230  31.717  1.145   1.00 72.55  ? 113  TRP B CB    1 
ATOM   3478  C  CG    . TRP B  2  113 ? -2.846  32.184  -0.145  1.00 74.55  ? 113  TRP B CG    1 
ATOM   3479  C  CD1   . TRP B  2  113 ? -2.916  31.486  -1.323  1.00 75.38  ? 113  TRP B CD1   1 
ATOM   3480  C  CD2   . TRP B  2  113 ? -3.328  33.508  -0.437  1.00 74.58  ? 113  TRP B CD2   1 
ATOM   3481  N  NE1   . TRP B  2  113 ? -3.399  32.298  -2.330  1.00 75.68  ? 113  TRP B NE1   1 
ATOM   3482  C  CE2   . TRP B  2  113 ? -3.658  33.543  -1.813  1.00 74.62  ? 113  TRP B CE2   1 
ATOM   3483  C  CE3   . TRP B  2  113 ? -3.502  34.671  0.326   1.00 74.14  ? 113  TRP B CE3   1 
ATOM   3484  C  CZ2   . TRP B  2  113 ? -4.150  34.695  -2.435  1.00 73.29  ? 113  TRP B CZ2   1 
ATOM   3485  C  CZ3   . TRP B  2  113 ? -3.991  35.819  -0.304  1.00 72.49  ? 113  TRP B CZ3   1 
ATOM   3486  C  CH2   . TRP B  2  113 ? -4.305  35.817  -1.665  1.00 72.34  ? 113  TRP B CH2   1 
ATOM   3487  N  N     . HIS B  2  114 ? -0.843  34.093  2.431   1.00 67.34  ? 114  HIS B N     1 
ATOM   3488  C  CA    . HIS B  2  114 ? -0.680  35.520  2.610   1.00 66.33  ? 114  HIS B CA    1 
ATOM   3489  C  C     . HIS B  2  114 ? 0.771   35.964  2.649   1.00 66.16  ? 114  HIS B C     1 
ATOM   3490  O  O     . HIS B  2  114 ? 1.033   37.170  2.567   1.00 68.34  ? 114  HIS B O     1 
ATOM   3491  C  CB    . HIS B  2  114 ? -1.395  36.008  3.877   1.00 66.72  ? 114  HIS B CB    1 
ATOM   3492  C  CG    . HIS B  2  114 ? -2.852  36.326  3.675   1.00 69.73  ? 114  HIS B CG    1 
ATOM   3493  N  ND1   . HIS B  2  114 ? -3.298  37.224  2.726   1.00 70.72  ? 114  HIS B ND1   1 
ATOM   3494  C  CD2   . HIS B  2  114 ? -3.965  35.880  4.313   1.00 70.18  ? 114  HIS B CD2   1 
ATOM   3495  C  CE1   . HIS B  2  114 ? -4.616  37.316  2.788   1.00 69.40  ? 114  HIS B CE1   1 
ATOM   3496  N  NE2   . HIS B  2  114 ? -5.047  36.511  3.741   1.00 69.07  ? 114  HIS B NE2   1 
ATOM   3497  N  N     . TRP B  2  115 ? 1.717   35.032  2.777   1.00 64.16  ? 115  TRP B N     1 
ATOM   3498  C  CA    . TRP B  2  115 ? 3.131   35.432  2.808   1.00 62.26  ? 115  TRP B CA    1 
ATOM   3499  C  C     . TRP B  2  115 ? 3.674   35.479  1.400   1.00 62.56  ? 115  TRP B C     1 
ATOM   3500  O  O     . TRP B  2  115 ? 4.348   36.433  1.032   1.00 62.81  ? 115  TRP B O     1 
ATOM   3501  C  CB    . TRP B  2  115 ? 3.975   34.482  3.657   1.00 60.35  ? 115  TRP B CB    1 
ATOM   3502  C  CG    . TRP B  2  115 ? 5.455   34.849  3.714   1.00 57.66  ? 115  TRP B CG    1 
ATOM   3503  C  CD1   . TRP B  2  115 ? 6.465   34.352  2.922   1.00 56.39  ? 115  TRP B CD1   1 
ATOM   3504  C  CD2   . TRP B  2  115 ? 6.087   35.744  4.645   1.00 55.59  ? 115  TRP B CD2   1 
ATOM   3505  N  NE1   . TRP B  2  115 ? 7.677   34.873  3.311   1.00 55.74  ? 115  TRP B NE1   1 
ATOM   3506  C  CE2   . TRP B  2  115 ? 7.476   35.731  4.363   1.00 55.52  ? 115  TRP B CE2   1 
ATOM   3507  C  CE3   . TRP B  2  115 ? 5.618   36.554  5.692   1.00 54.56  ? 115  TRP B CE3   1 
ATOM   3508  C  CZ2   . TRP B  2  115 ? 8.400   36.500  5.096   1.00 53.54  ? 115  TRP B CZ2   1 
ATOM   3509  C  CZ3   . TRP B  2  115 ? 6.545   37.320  6.422   1.00 52.91  ? 115  TRP B CZ3   1 
ATOM   3510  C  CH2   . TRP B  2  115 ? 7.914   37.282  6.116   1.00 52.25  ? 115  TRP B CH2   1 
ATOM   3511  N  N     . VAL B  2  116 ? 3.378   34.448  0.611   1.00 62.38  ? 116  VAL B N     1 
ATOM   3512  C  CA    . VAL B  2  116 ? 3.810   34.393  -0.790  1.00 62.30  ? 116  VAL B CA    1 
ATOM   3513  C  C     . VAL B  2  116 ? 3.137   35.543  -1.558  1.00 63.25  ? 116  VAL B C     1 
ATOM   3514  O  O     . VAL B  2  116 ? 3.811   36.411  -2.115  1.00 63.94  ? 116  VAL B O     1 
ATOM   3515  C  CB    . VAL B  2  116 ? 3.391   33.063  -1.468  1.00 62.21  ? 116  VAL B CB    1 
ATOM   3516  C  CG1   . VAL B  2  116 ? 3.748   33.084  -2.930  1.00 61.55  ? 116  VAL B CG1   1 
ATOM   3517  C  CG2   . VAL B  2  116 ? 4.059   31.904  -0.794  1.00 61.18  ? 116  VAL B CG2   1 
ATOM   3518  N  N     . TYR B  2  117 ? 1.801   35.530  -1.571  1.00 63.12  ? 117  TYR B N     1 
ATOM   3519  C  CA    . TYR B  2  117 ? 0.983   36.534  -2.243  1.00 62.13  ? 117  TYR B CA    1 
ATOM   3520  C  C     . TYR B  2  117 ? 0.784   37.733  -1.336  1.00 62.91  ? 117  TYR B C     1 
ATOM   3521  O  O     . TYR B  2  117 ? -0.304  37.976  -0.825  1.00 62.94  ? 117  TYR B O     1 
ATOM   3522  C  CB    . TYR B  2  117 ? -0.342  35.901  -2.623  1.00 60.25  ? 117  TYR B CB    1 
ATOM   3523  C  CG    . TYR B  2  117 ? -0.131  34.687  -3.484  1.00 60.11  ? 117  TYR B CG    1 
ATOM   3524  C  CD1   . TYR B  2  117 ? 0.661   34.757  -4.634  1.00 60.79  ? 117  TYR B CD1   1 
ATOM   3525  C  CD2   . TYR B  2  117 ? -0.709  33.472  -3.166  1.00 59.38  ? 117  TYR B CD2   1 
ATOM   3526  C  CE1   . TYR B  2  117 ? 0.867   33.642  -5.448  1.00 59.49  ? 117  TYR B CE1   1 
ATOM   3527  C  CE2   . TYR B  2  117 ? -0.509  32.351  -3.974  1.00 59.64  ? 117  TYR B CE2   1 
ATOM   3528  C  CZ    . TYR B  2  117 ? 0.276   32.441  -5.113  1.00 59.09  ? 117  TYR B CZ    1 
ATOM   3529  O  OH    . TYR B  2  117 ? 0.441   31.344  -5.924  1.00 58.54  ? 117  TYR B OH    1 
ATOM   3530  N  N     . TRP B  2  118 ? 1.861   38.488  -1.162  1.00 63.11  ? 118  TRP B N     1 
ATOM   3531  C  CA    . TRP B  2  118 ? 1.873   39.650  -0.297  1.00 63.67  ? 118  TRP B CA    1 
ATOM   3532  C  C     . TRP B  2  118 ? 1.544   40.949  -0.990  1.00 63.88  ? 118  TRP B C     1 
ATOM   3533  O  O     . TRP B  2  118 ? 1.163   41.918  -0.334  1.00 63.43  ? 118  TRP B O     1 
ATOM   3534  C  CB    . TRP B  2  118 ? 3.245   39.779  0.345   1.00 64.89  ? 118  TRP B CB    1 
ATOM   3535  C  CG    . TRP B  2  118 ? 4.327   40.027  -0.651  1.00 65.02  ? 118  TRP B CG    1 
ATOM   3536  C  CD1   . TRP B  2  118 ? 5.117   39.102  -1.259  1.00 64.07  ? 118  TRP B CD1   1 
ATOM   3537  C  CD2   . TRP B  2  118 ? 4.705   41.290  -1.182  1.00 65.95  ? 118  TRP B CD2   1 
ATOM   3538  N  NE1   . TRP B  2  118 ? 5.972   39.712  -2.142  1.00 64.19  ? 118  TRP B NE1   1 
ATOM   3539  C  CE2   . TRP B  2  118 ? 5.736   41.060  -2.114  1.00 66.19  ? 118  TRP B CE2   1 
ATOM   3540  C  CE3   . TRP B  2  118 ? 4.268   42.603  -0.963  1.00 67.05  ? 118  TRP B CE3   1 
ATOM   3541  C  CZ2   . TRP B  2  118 ? 6.341   42.097  -2.829  1.00 68.75  ? 118  TRP B CZ2   1 
ATOM   3542  C  CZ3   . TRP B  2  118 ? 4.865   43.636  -1.671  1.00 68.50  ? 118  TRP B CZ3   1 
ATOM   3543  C  CH2   . TRP B  2  118 ? 5.893   43.378  -2.596  1.00 69.10  ? 118  TRP B CH2   1 
ATOM   3544  N  N     . ASP B  2  119 ? 1.714   40.978  -2.308  1.00 64.76  ? 119  ASP B N     1 
ATOM   3545  C  CA    . ASP B  2  119 ? 1.447   42.188  -3.075  1.00 66.71  ? 119  ASP B CA    1 
ATOM   3546  C  C     . ASP B  2  119 ? 0.053   42.189  -3.701  1.00 68.10  ? 119  ASP B C     1 
ATOM   3547  O  O     . ASP B  2  119 ? -0.114  41.969  -4.898  1.00 69.33  ? 119  ASP B O     1 
ATOM   3548  C  CB    . ASP B  2  119 ? 2.524   42.358  -4.139  1.00 65.26  ? 119  ASP B CB    1 
ATOM   3549  C  CG    . ASP B  2  119 ? 2.562   43.753  -4.688  1.00 66.70  ? 119  ASP B CG    1 
ATOM   3550  O  OD1   . ASP B  2  119 ? 2.166   44.671  -3.933  1.00 66.92  ? 119  ASP B OD1   1 
ATOM   3551  O  OD2   . ASP B  2  119 ? 2.993   43.941  -5.851  1.00 65.58  ? 119  ASP B OD2   1 
ATOM   3552  N  N     . LEU B  2  120 ? -0.950  42.438  -2.876  1.00 69.71  ? 120  LEU B N     1 
ATOM   3553  C  CA    . LEU B  2  120 ? -2.327  42.446  -3.334  1.00 71.73  ? 120  LEU B CA    1 
ATOM   3554  C  C     . LEU B  2  120 ? -2.848  43.873  -3.556  1.00 73.10  ? 120  LEU B C     1 
ATOM   3555  O  O     . LEU B  2  120 ? -2.805  44.713  -2.649  1.00 73.17  ? 120  LEU B O     1 
ATOM   3556  C  CB    . LEU B  2  120 ? -3.219  41.751  -2.308  1.00 72.23  ? 120  LEU B CB    1 
ATOM   3557  C  CG    . LEU B  2  120 ? -2.796  40.405  -1.742  1.00 71.32  ? 120  LEU B CG    1 
ATOM   3558  C  CD1   . LEU B  2  120 ? -3.735  40.052  -0.619  1.00 71.74  ? 120  LEU B CD1   1 
ATOM   3559  C  CD2   . LEU B  2  120 ? -2.833  39.341  -2.818  1.00 71.65  ? 120  LEU B CD2   1 
ATOM   3560  N  N     . GLU B  2  121 ? -3.347  44.135  -4.757  1.00 75.58  ? 121  GLU B N     1 
ATOM   3561  C  CA    . GLU B  2  121 ? -3.884  45.453  -5.101  1.00 77.91  ? 121  GLU B CA    1 
ATOM   3562  C  C     . GLU B  2  121 ? -4.552  46.166  -3.899  1.00 76.97  ? 121  GLU B C     1 
ATOM   3563  O  O     . GLU B  2  121 ? -4.220  47.322  -3.553  1.00 76.34  ? 121  GLU B O     1 
ATOM   3564  C  CB    . GLU B  2  121 ? -4.891  45.305  -6.264  1.00 80.45  ? 121  GLU B CB    1 
ATOM   3565  C  CG    . GLU B  2  121 ? -5.933  46.443  -6.335  1.00 85.43  ? 121  GLU B CG    1 
ATOM   3566  C  CD    . GLU B  2  121 ? -5.678  47.487  -7.448  1.00 87.83  ? 121  GLU B CD    1 
ATOM   3567  O  OE1   . GLU B  2  121 ? -6.309  48.586  -7.376  1.00 88.16  ? 121  GLU B OE1   1 
ATOM   3568  O  OE2   . GLU B  2  121 ? -4.874  47.207  -8.389  1.00 88.06  ? 121  GLU B OE2   1 
ATOM   3569  N  N     . LEU B  2  122 ? -5.479  45.453  -3.270  1.00 76.26  ? 122  LEU B N     1 
ATOM   3570  C  CA    . LEU B  2  122 ? -6.243  45.972  -2.146  1.00 75.99  ? 122  LEU B CA    1 
ATOM   3571  C  C     . LEU B  2  122 ? -5.380  46.592  -1.067  1.00 75.61  ? 122  LEU B C     1 
ATOM   3572  O  O     . LEU B  2  122 ? -5.888  47.271  -0.173  1.00 75.54  ? 122  LEU B O     1 
ATOM   3573  C  CB    . LEU B  2  122 ? -7.103  44.847  -1.564  1.00 75.48  ? 122  LEU B CB    1 
ATOM   3574  C  CG    . LEU B  2  122 ? -7.911  45.081  -0.288  1.00 75.27  ? 122  LEU B CG    1 
ATOM   3575  C  CD1   . LEU B  2  122 ? -8.872  46.243  -0.445  1.00 76.07  ? 122  LEU B CD1   1 
ATOM   3576  C  CD2   . LEU B  2  122 ? -8.673  43.810  0.028   1.00 74.92  ? 122  LEU B CD2   1 
ATOM   3577  N  N     . PHE B  2  123 ? -4.070  46.391  -1.170  1.00 75.92  ? 123  PHE B N     1 
ATOM   3578  C  CA    . PHE B  2  123 ? -3.131  46.914  -0.170  1.00 75.52  ? 123  PHE B CA    1 
ATOM   3579  C  C     . PHE B  2  123 ? -2.482  48.258  -0.487  1.00 75.90  ? 123  PHE B C     1 
ATOM   3580  O  O     . PHE B  2  123 ? -1.935  48.923  0.405   1.00 75.09  ? 123  PHE B O     1 
ATOM   3581  C  CB    . PHE B  2  123 ? -2.032  45.886  0.072   1.00 73.98  ? 123  PHE B CB    1 
ATOM   3582  C  CG    . PHE B  2  123 ? -2.470  44.728  0.909   1.00 72.35  ? 123  PHE B CG    1 
ATOM   3583  C  CD1   . PHE B  2  123 ? -1.855  43.500  0.777   1.00 70.81  ? 123  PHE B CD1   1 
ATOM   3584  C  CD2   . PHE B  2  123 ? -3.493  44.873  1.843   1.00 70.99  ? 123  PHE B CD2   1 
ATOM   3585  C  CE1   . PHE B  2  123 ? -2.247  42.439  1.554   1.00 70.70  ? 123  PHE B CE1   1 
ATOM   3586  C  CE2   . PHE B  2  123 ? -3.891  43.813  2.626   1.00 69.42  ? 123  PHE B CE2   1 
ATOM   3587  C  CZ    . PHE B  2  123 ? -3.273  42.598  2.487   1.00 69.53  ? 123  PHE B CZ    1 
ATOM   3588  N  N     . ARG B  2  124 ? -2.534  48.657  -1.752  1.00 75.82  ? 124  ARG B N     1 
ATOM   3589  C  CA    . ARG B  2  124 ? -1.918  49.909  -2.146  1.00 76.11  ? 124  ARG B CA    1 
ATOM   3590  C  C     . ARG B  2  124 ? -2.908  51.031  -2.383  1.00 78.52  ? 124  ARG B C     1 
ATOM   3591  O  O     . ARG B  2  124 ? -4.014  50.812  -2.891  1.00 78.96  ? 124  ARG B O     1 
ATOM   3592  C  CB    . ARG B  2  124 ? -1.096  49.692  -3.402  1.00 73.12  ? 124  ARG B CB    1 
ATOM   3593  C  CG    . ARG B  2  124 ? 0.074   48.770  -3.213  1.00 69.10  ? 124  ARG B CG    1 
ATOM   3594  C  CD    . ARG B  2  124 ? 1.374   49.531  -3.408  1.00 66.13  ? 124  ARG B CD    1 
ATOM   3595  N  NE    . ARG B  2  124 ? 2.537   48.655  -3.398  1.00 63.15  ? 124  ARG B NE    1 
ATOM   3596  C  CZ    . ARG B  2  124 ? 2.616   47.527  -4.094  1.00 63.10  ? 124  ARG B CZ    1 
ATOM   3597  N  NH1   . ARG B  2  124 ? 1.600   47.141  -4.847  1.00 64.53  ? 124  ARG B NH1   1 
ATOM   3598  N  NH2   . ARG B  2  124 ? 3.713   46.790  -4.054  1.00 61.92  ? 124  ARG B NH2   1 
ATOM   3599  N  N     . ASP B  2  125 ? -2.497  52.237  -1.995  1.00 81.63  ? 125  ASP B N     1 
ATOM   3600  C  CA    . ASP B  2  125 ? -3.304  53.449  -2.174  1.00 84.37  ? 125  ASP B CA    1 
ATOM   3601  C  C     . ASP B  2  125 ? -3.489  53.619  -3.694  1.00 84.89  ? 125  ASP B C     1 
ATOM   3602  O  O     . ASP B  2  125 ? -2.497  53.655  -4.441  1.00 85.28  ? 125  ASP B O     1 
ATOM   3603  C  CB    . ASP B  2  125 ? -2.544  54.643  -1.570  1.00 85.95  ? 125  ASP B CB    1 
ATOM   3604  C  CG    . ASP B  2  125 ? -3.174  55.994  -1.909  1.00 87.76  ? 125  ASP B CG    1 
ATOM   3605  O  OD1   . ASP B  2  125 ? -3.183  56.371  -3.111  1.00 88.19  ? 125  ASP B OD1   1 
ATOM   3606  O  OD2   . ASP B  2  125 ? -3.656  56.685  -0.970  1.00 88.73  ? 125  ASP B OD2   1 
ATOM   3607  N  N     . PRO B  2  126 ? -4.754  53.704  -4.173  1.00 85.10  ? 126  PRO B N     1 
ATOM   3608  C  CA    . PRO B  2  126 ? -5.010  53.864  -5.623  1.00 84.59  ? 126  PRO B CA    1 
ATOM   3609  C  C     . PRO B  2  126 ? -4.392  55.157  -6.195  1.00 83.89  ? 126  PRO B C     1 
ATOM   3610  O  O     . PRO B  2  126 ? -3.903  55.183  -7.327  1.00 82.87  ? 126  PRO B O     1 
ATOM   3611  C  CB    . PRO B  2  126 ? -6.542  53.855  -5.717  1.00 84.37  ? 126  PRO B CB    1 
ATOM   3612  C  CG    . PRO B  2  126 ? -6.972  53.098  -4.475  1.00 84.11  ? 126  PRO B CG    1 
ATOM   3613  C  CD    . PRO B  2  126 ? -6.018  53.614  -3.417  1.00 84.35  ? 126  PRO B CD    1 
ATOM   3614  N  N     . ARG B  2  127 ? -4.423  56.213  -5.386  1.00 83.70  ? 127  ARG B N     1 
ATOM   3615  C  CA    . ARG B  2  127 ? -3.866  57.500  -5.760  1.00 84.65  ? 127  ARG B CA    1 
ATOM   3616  C  C     . ARG B  2  127 ? -2.332  57.436  -5.945  1.00 85.57  ? 127  ARG B C     1 
ATOM   3617  O  O     . ARG B  2  127 ? -1.774  58.083  -6.841  1.00 86.53  ? 127  ARG B O     1 
ATOM   3618  C  CB    . ARG B  2  127 ? -4.212  58.557  -4.698  1.00 83.89  ? 127  ARG B CB    1 
ATOM   3619  N  N     . THR B  2  128 ? -1.649  56.669  -5.103  1.00 85.84  ? 128  THR B N     1 
ATOM   3620  C  CA    . THR B  2  128 ? -0.197  56.555  -5.206  1.00 84.97  ? 128  THR B CA    1 
ATOM   3621  C  C     . THR B  2  128 ? 0.174   55.143  -5.638  1.00 86.40  ? 128  THR B C     1 
ATOM   3622  O  O     . THR B  2  128 ? -0.696  54.286  -5.858  1.00 87.54  ? 128  THR B O     1 
ATOM   3623  C  CB    . THR B  2  128 ? 0.476   56.804  -3.855  1.00 84.08  ? 128  THR B CB    1 
ATOM   3624  O  OG1   . THR B  2  128 ? 0.194   55.702  -2.984  1.00 83.72  ? 128  THR B OG1   1 
ATOM   3625  C  CG2   . THR B  2  128 ? -0.044  58.094  -3.218  1.00 82.87  ? 128  THR B CG2   1 
ATOM   3626  N  N     . GLY B  2  129 ? 1.472   54.899  -5.775  1.00 86.59  ? 129  GLY B N     1 
ATOM   3627  C  CA    . GLY B  2  129 ? 1.921   53.555  -6.126  1.00 86.07  ? 129  GLY B CA    1 
ATOM   3628  C  C     . GLY B  2  129 ? 2.431   52.873  -4.859  1.00 85.55  ? 129  GLY B C     1 
ATOM   3629  O  O     . GLY B  2  129 ? 2.979   51.765  -4.914  1.00 85.27  ? 129  GLY B O     1 
ATOM   3630  N  N     . GLU B  2  130 ? 2.239   53.553  -3.724  1.00 85.05  ? 130  GLU B N     1 
ATOM   3631  C  CA    . GLU B  2  130 ? 2.694   53.073  -2.420  1.00 84.59  ? 130  GLU B CA    1 
ATOM   3632  C  C     . GLU B  2  130 ? 1.616   52.279  -1.668  1.00 82.76  ? 130  GLU B C     1 
ATOM   3633  O  O     . GLU B  2  130 ? 0.403   52.515  -1.835  1.00 82.06  ? 130  GLU B O     1 
ATOM   3634  C  CB    . GLU B  2  130 ? 3.119   54.250  -1.519  1.00 86.50  ? 130  GLU B CB    1 
ATOM   3635  C  CG    . GLU B  2  130 ? 3.858   55.388  -2.200  1.00 88.69  ? 130  GLU B CG    1 
ATOM   3636  C  CD    . GLU B  2  130 ? 3.534   56.730  -1.541  1.00 90.77  ? 130  GLU B CD    1 
ATOM   3637  O  OE1   . GLU B  2  130 ? 4.092   57.771  -1.983  1.00 91.81  ? 130  GLU B OE1   1 
ATOM   3638  O  OE2   . GLU B  2  130 ? 2.711   56.740  -0.583  1.00 90.69  ? 130  GLU B OE2   1 
ATOM   3639  N  N     . PRO B  2  131 ? 2.062   51.325  -0.820  1.00 80.74  ? 131  PRO B N     1 
ATOM   3640  C  CA    . PRO B  2  131 ? 1.155   50.490  -0.022  1.00 78.47  ? 131  PRO B CA    1 
ATOM   3641  C  C     . PRO B  2  131 ? 0.536   51.378  1.074   1.00 76.51  ? 131  PRO B C     1 
ATOM   3642  O  O     . PRO B  2  131 ? 1.151   52.359  1.501   1.00 75.74  ? 131  PRO B O     1 
ATOM   3643  C  CB    . PRO B  2  131 ? 2.093   49.424  0.568   1.00 78.90  ? 131  PRO B CB    1 
ATOM   3644  C  CG    . PRO B  2  131 ? 3.355   49.472  -0.300  1.00 78.18  ? 131  PRO B CG    1 
ATOM   3645  C  CD    . PRO B  2  131 ? 3.475   50.923  -0.623  1.00 79.16  ? 131  PRO B CD    1 
ATOM   3646  N  N     . ALA B  2  132 ? -0.658  51.045  1.540   1.00 74.33  ? 132  ALA B N     1 
ATOM   3647  C  CA    . ALA B  2  132 ? -1.268  51.870  2.576   1.00 72.68  ? 132  ALA B CA    1 
ATOM   3648  C  C     . ALA B  2  132 ? -2.544  51.281  3.177   1.00 71.60  ? 132  ALA B C     1 
ATOM   3649  O  O     . ALA B  2  132 ? -3.287  50.591  2.492   1.00 71.20  ? 132  ALA B O     1 
ATOM   3650  C  CB    . ALA B  2  132 ? -1.539  53.263  2.012   1.00 72.91  ? 132  ALA B CB    1 
ATOM   3651  N  N     . LEU B  2  133 ? -2.791  51.573  4.453   1.00 70.42  ? 133  LEU B N     1 
ATOM   3652  C  CA    . LEU B  2  133 ? -3.966  51.074  5.152   1.00 69.98  ? 133  LEU B CA    1 
ATOM   3653  C  C     . LEU B  2  133 ? -4.782  52.175  5.837   1.00 70.63  ? 133  LEU B C     1 
ATOM   3654  O  O     . LEU B  2  133 ? -4.269  52.942  6.667   1.00 70.84  ? 133  LEU B O     1 
ATOM   3655  C  CB    . LEU B  2  133 ? -3.550  50.030  6.189   1.00 68.93  ? 133  LEU B CB    1 
ATOM   3656  C  CG    . LEU B  2  133 ? -3.683  48.545  5.863   1.00 67.45  ? 133  LEU B CG    1 
ATOM   3657  C  CD1   . LEU B  2  133 ? -3.228  48.259  4.458   1.00 67.34  ? 133  LEU B CD1   1 
ATOM   3658  C  CD2   . LEU B  2  133 ? -2.865  47.767  6.860   1.00 67.56  ? 133  LEU B CD2   1 
ATOM   3659  N  N     . ASP B  2  134 ? -6.063  52.234  5.493   1.00 70.98  ? 134  ASP B N     1 
ATOM   3660  C  CA    . ASP B  2  134 ? -6.953  53.241  6.055   1.00 71.51  ? 134  ASP B CA    1 
ATOM   3661  C  C     . ASP B  2  134 ? -7.371  52.795  7.435   1.00 71.44  ? 134  ASP B C     1 
ATOM   3662  O  O     . ASP B  2  134 ? -8.450  52.237  7.636   1.00 71.75  ? 134  ASP B O     1 
ATOM   3663  C  CB    . ASP B  2  134 ? -8.169  53.411  5.150   1.00 72.23  ? 134  ASP B CB    1 
ATOM   3664  C  CG    . ASP B  2  134 ? -9.106  54.473  5.647   1.00 73.79  ? 134  ASP B CG    1 
ATOM   3665  O  OD1   . ASP B  2  134 ? -8.623  55.442  6.297   1.00 73.64  ? 134  ASP B OD1   1 
ATOM   3666  O  OD2   . ASP B  2  134 ? -10.321 54.331  5.376   1.00 74.25  ? 134  ASP B OD2   1 
ATOM   3667  N  N     . LEU B  2  135 ? -6.513  53.060  8.399   1.00 71.94  ? 135  LEU B N     1 
ATOM   3668  C  CA    . LEU B  2  135 ? -6.787  52.620  9.754   1.00 72.30  ? 135  LEU B CA    1 
ATOM   3669  C  C     . LEU B  2  135 ? -8.121  53.044  10.377  1.00 71.75  ? 135  LEU B C     1 
ATOM   3670  O  O     . LEU B  2  135 ? -8.811  52.227  10.985  1.00 72.82  ? 135  LEU B O     1 
ATOM   3671  C  CB    . LEU B  2  135 ? -5.602  53.004  10.639  1.00 71.93  ? 135  LEU B CB    1 
ATOM   3672  C  CG    . LEU B  2  135 ? -4.285  52.553  9.981   1.00 70.92  ? 135  LEU B CG    1 
ATOM   3673  C  CD1   . LEU B  2  135 ? -3.497  53.781  9.540   1.00 70.42  ? 135  LEU B CD1   1 
ATOM   3674  C  CD2   . LEU B  2  135 ? -3.483  51.694  10.945  1.00 69.24  ? 135  LEU B CD2   1 
ATOM   3675  N  N     . PRO B  2  136 ? -8.523  54.306  10.209  1.00 71.48  ? 136  PRO B N     1 
ATOM   3676  C  CA    . PRO B  2  136 ? -9.796  54.782  10.786  1.00 70.96  ? 136  PRO B CA    1 
ATOM   3677  C  C     . PRO B  2  136 ? -11.046 54.003  10.349  1.00 69.04  ? 136  PRO B C     1 
ATOM   3678  O  O     . PRO B  2  136 ? -11.956 53.750  11.132  1.00 67.25  ? 136  PRO B O     1 
ATOM   3679  C  CB    . PRO B  2  136 ? -9.841  56.246  10.358  1.00 71.07  ? 136  PRO B CB    1 
ATOM   3680  C  CG    . PRO B  2  136 ? -8.368  56.603  10.195  1.00 71.55  ? 136  PRO B CG    1 
ATOM   3681  C  CD    . PRO B  2  136 ? -7.810  55.390  9.515   1.00 70.63  ? 136  PRO B CD    1 
ATOM   3682  N  N     . LYS B  2  137 ? -11.088 53.635  9.089   1.00 68.91  ? 137  LYS B N     1 
ATOM   3683  C  CA    . LYS B  2  137 ? -12.222 52.879  8.606   1.00 70.58  ? 137  LYS B CA    1 
ATOM   3684  C  C     . LYS B  2  137 ? -11.923 51.452  9.016   1.00 70.90  ? 137  LYS B C     1 
ATOM   3685  O  O     . LYS B  2  137 ? -12.831 50.670  9.296   1.00 71.94  ? 137  LYS B O     1 
ATOM   3686  C  CB    . LYS B  2  137 ? -12.327 52.974  7.070   1.00 70.74  ? 137  LYS B CB    1 
ATOM   3687  C  CG    . LYS B  2  137 ? -13.665 52.513  6.470   1.00 70.95  ? 137  LYS B CG    1 
ATOM   3688  C  CD    . LYS B  2  137 ? -13.637 52.446  4.921   1.00 71.97  ? 137  LYS B CD    1 
ATOM   3689  C  CE    . LYS B  2  137 ? -13.236 53.775  4.254   1.00 72.21  ? 137  LYS B CE    1 
ATOM   3690  N  NZ    . LYS B  2  137 ? -12.036 53.670  3.346   1.00 71.21  ? 137  LYS B NZ    1 
ATOM   3691  N  N     . MET B  2  138 ? -10.636 51.120  9.052   1.00 71.03  ? 138  MET B N     1 
ATOM   3692  C  CA    . MET B  2  138 ? -10.214 49.765  9.401   1.00 69.90  ? 138  MET B CA    1 
ATOM   3693  C  C     . MET B  2  138 ? -10.794 49.476  10.766  1.00 68.41  ? 138  MET B C     1 
ATOM   3694  O  O     . MET B  2  138 ? -11.527 48.515  10.940  1.00 68.88  ? 138  MET B O     1 
ATOM   3695  C  CB    . MET B  2  138 ? -8.683  49.678  9.417   1.00 70.44  ? 138  MET B CB    1 
ATOM   3696  C  CG    . MET B  2  138 ? -8.103  48.298  9.140   1.00 70.67  ? 138  MET B CG    1 
ATOM   3697  S  SD    . MET B  2  138 ? -6.688  48.458  8.038   1.00 71.79  ? 138  MET B SD    1 
ATOM   3698  C  CE    . MET B  2  138 ? -5.463  49.261  9.106   1.00 72.40  ? 138  MET B CE    1 
ATOM   3699  N  N     . PHE B  2  139 ? -10.479 50.341  11.714  1.00 66.24  ? 139  PHE B N     1 
ATOM   3700  C  CA    . PHE B  2  139 ? -10.955 50.226  13.075  1.00 65.66  ? 139  PHE B CA    1 
ATOM   3701  C  C     . PHE B  2  139 ? -12.477 50.081  13.128  1.00 65.95  ? 139  PHE B C     1 
ATOM   3702  O  O     . PHE B  2  139 ? -13.002 49.082  13.620  1.00 65.51  ? 139  PHE B O     1 
ATOM   3703  C  CB    . PHE B  2  139 ? -10.494 51.460  13.855  1.00 64.66  ? 139  PHE B CB    1 
ATOM   3704  C  CG    . PHE B  2  139 ? -11.083 51.584  15.227  1.00 64.72  ? 139  PHE B CG    1 
ATOM   3705  C  CD1   . PHE B  2  139 ? -10.961 50.568  16.149  1.00 65.63  ? 139  PHE B CD1   1 
ATOM   3706  C  CD2   . PHE B  2  139 ? -11.714 52.754  15.612  1.00 66.28  ? 139  PHE B CD2   1 
ATOM   3707  C  CE1   . PHE B  2  139 ? -11.460 50.712  17.442  1.00 66.11  ? 139  PHE B CE1   1 
ATOM   3708  C  CE2   . PHE B  2  139 ? -12.214 52.911  16.902  1.00 66.46  ? 139  PHE B CE2   1 
ATOM   3709  C  CZ    . PHE B  2  139 ? -12.086 51.887  17.818  1.00 65.67  ? 139  PHE B CZ    1 
ATOM   3710  N  N     . GLY B  2  140 ? -13.183 51.075  12.610  1.00 66.72  ? 140  GLY B N     1 
ATOM   3711  C  CA    . GLY B  2  140 ? -14.634 51.032  12.623  1.00 65.56  ? 140  GLY B CA    1 
ATOM   3712  C  C     . GLY B  2  140 ? -15.243 49.704  12.187  1.00 65.00  ? 140  GLY B C     1 
ATOM   3713  O  O     . GLY B  2  140 ? -16.255 49.272  12.737  1.00 65.00  ? 140  GLY B O     1 
ATOM   3714  N  N     . ILE B  2  141 ? -14.638 49.063  11.194  1.00 64.39  ? 141  ILE B N     1 
ATOM   3715  C  CA    . ILE B  2  141 ? -15.145 47.785  10.701  1.00 64.24  ? 141  ILE B CA    1 
ATOM   3716  C  C     . ILE B  2  141 ? -14.978 46.727  11.794  1.00 64.13  ? 141  ILE B C     1 
ATOM   3717  O  O     . ILE B  2  141 ? -15.922 46.004  12.122  1.00 63.85  ? 141  ILE B O     1 
ATOM   3718  C  CB    . ILE B  2  141 ? -14.371 47.295  9.446   1.00 63.57  ? 141  ILE B CB    1 
ATOM   3719  C  CG1   . ILE B  2  141 ? -14.424 48.340  8.351   1.00 64.02  ? 141  ILE B CG1   1 
ATOM   3720  C  CG2   . ILE B  2  141 ? -14.984 46.011  8.910   1.00 61.88  ? 141  ILE B CG2   1 
ATOM   3721  C  CD1   . ILE B  2  141 ? -13.739 47.875  7.090   1.00 65.55  ? 141  ILE B CD1   1 
ATOM   3722  N  N     . HIS B  2  142 ? -13.768 46.639  12.340  1.00 63.39  ? 142  HIS B N     1 
ATOM   3723  C  CA    . HIS B  2  142 ? -13.451 45.673  13.391  1.00 62.81  ? 142  HIS B CA    1 
ATOM   3724  C  C     . HIS B  2  142 ? -14.316 45.880  14.666  1.00 63.51  ? 142  HIS B C     1 
ATOM   3725  O  O     . HIS B  2  142 ? -14.912 44.932  15.194  1.00 62.94  ? 142  HIS B O     1 
ATOM   3726  C  CB    . HIS B  2  142 ? -11.956 45.756  13.714  1.00 60.92  ? 142  HIS B CB    1 
ATOM   3727  C  CG    . HIS B  2  142 ? -11.066 45.335  12.584  1.00 59.19  ? 142  HIS B CG    1 
ATOM   3728  N  ND1   . HIS B  2  142 ? -9.703  45.526  12.603  1.00 59.28  ? 142  HIS B ND1   1 
ATOM   3729  C  CD2   . HIS B  2  142 ? -11.338 44.730  11.403  1.00 60.67  ? 142  HIS B CD2   1 
ATOM   3730  C  CE1   . HIS B  2  142 ? -9.172  45.061  11.484  1.00 59.85  ? 142  HIS B CE1   1 
ATOM   3731  N  NE2   . HIS B  2  142 ? -10.143 44.571  10.738  1.00 59.95  ? 142  HIS B NE2   1 
ATOM   3732  N  N     . LEU B  2  143 ? -14.379 47.117  15.154  1.00 64.90  ? 143  LEU B N     1 
ATOM   3733  C  CA    . LEU B  2  143 ? -15.189 47.430  16.332  1.00 65.94  ? 143  LEU B CA    1 
ATOM   3734  C  C     . LEU B  2  143 ? -16.658 47.044  16.056  1.00 67.81  ? 143  LEU B C     1 
ATOM   3735  O  O     . LEU B  2  143 ? -17.392 46.648  16.971  1.00 68.33  ? 143  LEU B O     1 
ATOM   3736  C  CB    . LEU B  2  143 ? -15.076 48.920  16.670  1.00 63.72  ? 143  LEU B CB    1 
ATOM   3737  C  CG    . LEU B  2  143 ? -16.026 49.493  17.720  1.00 63.11  ? 143  LEU B CG    1 
ATOM   3738  C  CD1   . LEU B  2  143 ? -16.070 48.611  18.952  1.00 62.22  ? 143  LEU B CD1   1 
ATOM   3739  C  CD2   . LEU B  2  143 ? -15.576 50.895  18.086  1.00 61.86  ? 143  LEU B CD2   1 
ATOM   3740  N  N     . PHE B  2  144 ? -17.081 47.159  14.798  1.00 68.21  ? 144  PHE B N     1 
ATOM   3741  C  CA    . PHE B  2  144 ? -18.444 46.796  14.420  1.00 68.63  ? 144  PHE B CA    1 
ATOM   3742  C  C     . PHE B  2  144 ? -18.624 45.303  14.679  1.00 69.07  ? 144  PHE B C     1 
ATOM   3743  O  O     . PHE B  2  144 ? -19.523 44.893  15.415  1.00 69.57  ? 144  PHE B O     1 
ATOM   3744  C  CB    . PHE B  2  144 ? -18.695 47.095  12.936  1.00 69.12  ? 144  PHE B CB    1 
ATOM   3745  C  CG    . PHE B  2  144 ? -20.043 46.635  12.444  1.00 69.11  ? 144  PHE B CG    1 
ATOM   3746  C  CD1   . PHE B  2  144 ? -21.203 47.300  12.829  1.00 69.77  ? 144  PHE B CD1   1 
ATOM   3747  C  CD2   . PHE B  2  144 ? -20.160 45.508  11.636  1.00 69.26  ? 144  PHE B CD2   1 
ATOM   3748  C  CE1   . PHE B  2  144 ? -22.456 46.847  12.424  1.00 68.97  ? 144  PHE B CE1   1 
ATOM   3749  C  CE2   . PHE B  2  144 ? -21.417 45.048  11.224  1.00 68.89  ? 144  PHE B CE2   1 
ATOM   3750  C  CZ    . PHE B  2  144 ? -22.560 45.717  11.621  1.00 68.68  ? 144  PHE B CZ    1 
ATOM   3751  N  N     . LEU B  2  145 ? -17.763 44.500  14.067  1.00 69.83  ? 145  LEU B N     1 
ATOM   3752  C  CA    . LEU B  2  145 ? -17.801 43.049  14.229  1.00 70.32  ? 145  LEU B CA    1 
ATOM   3753  C  C     . LEU B  2  145 ? -17.706 42.693  15.704  1.00 71.27  ? 145  LEU B C     1 
ATOM   3754  O  O     . LEU B  2  145 ? -18.559 41.958  16.226  1.00 70.68  ? 145  LEU B O     1 
ATOM   3755  C  CB    . LEU B  2  145 ? -16.627 42.420  13.496  1.00 70.44  ? 145  LEU B CB    1 
ATOM   3756  C  CG    . LEU B  2  145 ? -16.637 42.677  11.993  1.00 71.45  ? 145  LEU B CG    1 
ATOM   3757  C  CD1   . LEU B  2  145 ? -15.220 42.657  11.470  1.00 71.36  ? 145  LEU B CD1   1 
ATOM   3758  C  CD2   . LEU B  2  145 ? -17.513 41.639  11.317  1.00 71.72  ? 145  LEU B CD2   1 
ATOM   3759  N  N     . ALA B  2  146 ? -16.662 43.213  16.363  1.00 71.73  ? 146  ALA B N     1 
ATOM   3760  C  CA    . ALA B  2  146 ? -16.433 42.968  17.785  1.00 71.92  ? 146  ALA B CA    1 
ATOM   3761  C  C     . ALA B  2  146 ? -17.752 43.081  18.550  1.00 72.68  ? 146  ALA B C     1 
ATOM   3762  O  O     . ALA B  2  146 ? -18.202 42.108  19.168  1.00 73.73  ? 146  ALA B O     1 
ATOM   3763  C  CB    . ALA B  2  146 ? -15.424 43.961  18.322  1.00 71.32  ? 146  ALA B CB    1 
ATOM   3764  N  N     . GLY B  2  147 ? -18.364 44.266  18.497  1.00 73.29  ? 147  GLY B N     1 
ATOM   3765  C  CA    . GLY B  2  147 ? -19.646 44.494  19.154  1.00 72.46  ? 147  GLY B CA    1 
ATOM   3766  C  C     . GLY B  2  147 ? -20.718 43.536  18.660  1.00 71.53  ? 147  GLY B C     1 
ATOM   3767  O  O     . GLY B  2  147 ? -21.473 42.991  19.458  1.00 71.88  ? 147  GLY B O     1 
ATOM   3768  N  N     . LEU B  2  148 ? -20.802 43.343  17.354  1.00 70.98  ? 148  LEU B N     1 
ATOM   3769  C  CA    . LEU B  2  148 ? -21.765 42.398  16.798  1.00 70.75  ? 148  LEU B CA    1 
ATOM   3770  C  C     . LEU B  2  148 ? -21.603 41.049  17.544  1.00 70.60  ? 148  LEU B C     1 
ATOM   3771  O  O     . LEU B  2  148 ? -22.568 40.460  18.047  1.00 69.06  ? 148  LEU B O     1 
ATOM   3772  C  CB    . LEU B  2  148 ? -21.480 42.199  15.311  1.00 71.30  ? 148  LEU B CB    1 
ATOM   3773  C  CG    . LEU B  2  148 ? -22.526 41.513  14.442  1.00 71.34  ? 148  LEU B CG    1 
ATOM   3774  C  CD1   . LEU B  2  148 ? -23.773 42.360  14.390  1.00 71.50  ? 148  LEU B CD1   1 
ATOM   3775  C  CD2   . LEU B  2  148 ? -21.968 41.338  13.038  1.00 72.16  ? 148  LEU B CD2   1 
ATOM   3776  N  N     . LEU B  2  149 ? -20.363 40.587  17.624  1.00 70.12  ? 149  LEU B N     1 
ATOM   3777  C  CA    . LEU B  2  149 ? -20.054 39.341  18.294  1.00 69.46  ? 149  LEU B CA    1 
ATOM   3778  C  C     . LEU B  2  149 ? -20.283 39.422  19.784  1.00 69.56  ? 149  LEU B C     1 
ATOM   3779  O  O     . LEU B  2  149 ? -20.818 38.498  20.373  1.00 70.54  ? 149  LEU B O     1 
ATOM   3780  C  CB    . LEU B  2  149 ? -18.606 38.959  18.005  1.00 69.16  ? 149  LEU B CB    1 
ATOM   3781  C  CG    . LEU B  2  149 ? -18.096 37.600  18.490  1.00 69.48  ? 149  LEU B CG    1 
ATOM   3782  C  CD1   . LEU B  2  149 ? -19.132 36.493  18.217  1.00 68.44  ? 149  LEU B CD1   1 
ATOM   3783  C  CD2   . LEU B  2  149 ? -16.754 37.318  17.804  1.00 69.26  ? 149  LEU B CD2   1 
ATOM   3784  N  N     . CYS B  2  150 ? -19.866 40.518  20.402  1.00 70.26  ? 150  CYS B N     1 
ATOM   3785  C  CA    . CYS B  2  150 ? -20.049 40.716  21.851  1.00 70.91  ? 150  CYS B CA    1 
ATOM   3786  C  C     . CYS B  2  150 ? -21.516 40.528  22.225  1.00 71.58  ? 150  CYS B C     1 
ATOM   3787  O  O     . CYS B  2  150 ? -21.843 39.849  23.200  1.00 69.52  ? 150  CYS B O     1 
ATOM   3788  C  CB    . CYS B  2  150 ? -19.623 42.123  22.246  1.00 71.63  ? 150  CYS B CB    1 
ATOM   3789  S  SG    . CYS B  2  150 ? -19.808 42.469  23.999  1.00 73.92  ? 150  CYS B SG    1 
ATOM   3790  N  N     . PHE B  2  151 ? -22.383 41.168  21.435  1.00 71.96  ? 151  PHE B N     1 
ATOM   3791  C  CA    . PHE B  2  151 ? -23.830 41.092  21.593  1.00 71.32  ? 151  PHE B CA    1 
ATOM   3792  C  C     . PHE B  2  151 ? -24.244 39.620  21.521  1.00 70.30  ? 151  PHE B C     1 
ATOM   3793  O  O     . PHE B  2  151 ? -24.862 39.079  22.446  1.00 68.58  ? 151  PHE B O     1 
ATOM   3794  C  CB    . PHE B  2  151 ? -24.530 41.857  20.462  1.00 72.59  ? 151  PHE B CB    1 
ATOM   3795  C  CG    . PHE B  2  151 ? -26.034 41.784  20.529  1.00 72.62  ? 151  PHE B CG    1 
ATOM   3796  C  CD1   . PHE B  2  151 ? -26.736 42.545  21.472  1.00 72.81  ? 151  PHE B CD1   1 
ATOM   3797  C  CD2   . PHE B  2  151 ? -26.740 40.882  19.718  1.00 71.78  ? 151  PHE B CD2   1 
ATOM   3798  C  CE1   . PHE B  2  151 ? -28.114 42.403  21.617  1.00 73.49  ? 151  PHE B CE1   1 
ATOM   3799  C  CE2   . PHE B  2  151 ? -28.107 40.730  19.849  1.00 72.75  ? 151  PHE B CE2   1 
ATOM   3800  C  CZ    . PHE B  2  151 ? -28.803 41.489  20.805  1.00 73.96  ? 151  PHE B CZ    1 
ATOM   3801  N  N     . GLY B  2  152 ? -23.897 38.987  20.403  1.00 70.12  ? 152  GLY B N     1 
ATOM   3802  C  CA    . GLY B  2  152 ? -24.226 37.585  20.203  1.00 70.85  ? 152  GLY B CA    1 
ATOM   3803  C  C     . GLY B  2  152 ? -23.880 36.695  21.387  1.00 71.16  ? 152  GLY B C     1 
ATOM   3804  O  O     . GLY B  2  152 ? -24.701 35.862  21.800  1.00 72.28  ? 152  GLY B O     1 
ATOM   3805  N  N     . PHE B  2  153 ? -22.662 36.848  21.914  1.00 69.96  ? 153  PHE B N     1 
ATOM   3806  C  CA    . PHE B  2  153 ? -22.200 36.063  23.063  1.00 68.48  ? 153  PHE B CA    1 
ATOM   3807  C  C     . PHE B  2  153 ? -23.118 36.258  24.287  1.00 67.83  ? 153  PHE B C     1 
ATOM   3808  O  O     . PHE B  2  153 ? -23.543 35.288  24.926  1.00 66.57  ? 153  PHE B O     1 
ATOM   3809  C  CB    . PHE B  2  153 ? -20.748 36.455  23.394  1.00 68.20  ? 153  PHE B CB    1 
ATOM   3810  C  CG    . PHE B  2  153 ? -20.239 35.912  24.709  1.00 67.06  ? 153  PHE B CG    1 
ATOM   3811  C  CD1   . PHE B  2  153 ? -20.185 34.543  24.936  1.00 65.35  ? 153  PHE B CD1   1 
ATOM   3812  C  CD2   . PHE B  2  153 ? -19.843 36.787  25.735  1.00 65.72  ? 153  PHE B CD2   1 
ATOM   3813  C  CE1   . PHE B  2  153 ? -19.751 34.052  26.166  1.00 65.93  ? 153  PHE B CE1   1 
ATOM   3814  C  CE2   . PHE B  2  153 ? -19.410 36.303  26.961  1.00 64.72  ? 153  PHE B CE2   1 
ATOM   3815  C  CZ    . PHE B  2  153 ? -19.364 34.936  27.180  1.00 65.22  ? 153  PHE B CZ    1 
ATOM   3816  N  N     . GLY B  2  154 ? -23.438 37.503  24.604  1.00 67.71  ? 154  GLY B N     1 
ATOM   3817  C  CA    . GLY B  2  154 ? -24.304 37.735  25.745  1.00 68.59  ? 154  GLY B CA    1 
ATOM   3818  C  C     . GLY B  2  154 ? -25.736 37.311  25.480  1.00 68.81  ? 154  GLY B C     1 
ATOM   3819  O  O     . GLY B  2  154 ? -26.337 36.632  26.295  1.00 69.29  ? 154  GLY B O     1 
ATOM   3820  N  N     . ALA B  2  155 ? -26.273 37.708  24.337  1.00 69.75  ? 155  ALA B N     1 
ATOM   3821  C  CA    . ALA B  2  155 ? -27.648 37.407  23.966  1.00 70.39  ? 155  ALA B CA    1 
ATOM   3822  C  C     . ALA B  2  155 ? -28.024 35.918  23.897  1.00 70.96  ? 155  ALA B C     1 
ATOM   3823  O  O     . ALA B  2  155 ? -28.962 35.447  24.547  1.00 70.12  ? 155  ALA B O     1 
ATOM   3824  C  CB    . ALA B  2  155 ? -27.956 38.075  22.629  1.00 69.73  ? 155  ALA B CB    1 
ATOM   3825  N  N     . PHE B  2  156 ? -27.276 35.184  23.099  1.00 72.02  ? 156  PHE B N     1 
ATOM   3826  C  CA    . PHE B  2  156 ? -27.552 33.777  22.893  1.00 73.67  ? 156  PHE B CA    1 
ATOM   3827  C  C     . PHE B  2  156 ? -26.825 32.769  23.762  1.00 74.05  ? 156  PHE B C     1 
ATOM   3828  O  O     . PHE B  2  156 ? -27.419 31.778  24.204  1.00 74.79  ? 156  PHE B O     1 
ATOM   3829  C  CB    . PHE B  2  156 ? -27.309 33.459  21.435  1.00 75.57  ? 156  PHE B CB    1 
ATOM   3830  C  CG    . PHE B  2  156 ? -28.026 34.387  20.519  1.00 78.55  ? 156  PHE B CG    1 
ATOM   3831  C  CD1   . PHE B  2  156 ? -29.402 34.250  20.301  1.00 79.85  ? 156  PHE B CD1   1 
ATOM   3832  C  CD2   . PHE B  2  156 ? -27.353 35.463  19.951  1.00 79.34  ? 156  PHE B CD2   1 
ATOM   3833  C  CE1   . PHE B  2  156 ? -30.098 35.169  19.540  1.00 79.56  ? 156  PHE B CE1   1 
ATOM   3834  C  CE2   . PHE B  2  156 ? -28.034 36.396  19.185  1.00 80.09  ? 156  PHE B CE2   1 
ATOM   3835  C  CZ    . PHE B  2  156 ? -29.415 36.250  18.978  1.00 80.52  ? 156  PHE B CZ    1 
ATOM   3836  N  N     . HIS B  2  157 ? -25.541 33.000  24.002  1.00 73.85  ? 157  HIS B N     1 
ATOM   3837  C  CA    . HIS B  2  157 ? -24.761 32.073  24.822  1.00 72.46  ? 157  HIS B CA    1 
ATOM   3838  C  C     . HIS B  2  157 ? -25.131 32.177  26.304  1.00 71.93  ? 157  HIS B C     1 
ATOM   3839  O  O     . HIS B  2  157 ? -25.921 31.363  26.800  1.00 71.74  ? 157  HIS B O     1 
ATOM   3840  C  CB    . HIS B  2  157 ? -23.258 32.329  24.621  1.00 71.77  ? 157  HIS B CB    1 
ATOM   3841  C  CG    . HIS B  2  157 ? -22.382 31.193  25.055  1.00 69.65  ? 157  HIS B CG    1 
ATOM   3842  N  ND1   . HIS B  2  157 ? -22.099 30.935  26.379  1.00 67.32  ? 157  HIS B ND1   1 
ATOM   3843  C  CD2   . HIS B  2  157 ? -21.753 30.231  24.339  1.00 68.63  ? 157  HIS B CD2   1 
ATOM   3844  C  CE1   . HIS B  2  157 ? -21.336 29.859  26.459  1.00 67.78  ? 157  HIS B CE1   1 
ATOM   3845  N  NE2   . HIS B  2  157 ? -21.112 29.413  25.235  1.00 68.28  ? 157  HIS B NE2   1 
ATOM   3846  N  N     . LEU B  2  158 ? -24.583 33.174  26.998  1.00 70.52  ? 158  LEU B N     1 
ATOM   3847  C  CA    . LEU B  2  158 ? -24.856 33.332  28.422  1.00 70.41  ? 158  LEU B CA    1 
ATOM   3848  C  C     . LEU B  2  158 ? -26.330 33.179  28.811  1.00 71.05  ? 158  LEU B C     1 
ATOM   3849  O  O     . LEU B  2  158 ? -26.638 32.674  29.889  1.00 71.86  ? 158  LEU B O     1 
ATOM   3850  C  CB    . LEU B  2  158 ? -24.330 34.679  28.931  1.00 69.05  ? 158  LEU B CB    1 
ATOM   3851  C  CG    . LEU B  2  158 ? -22.863 34.986  28.643  1.00 68.44  ? 158  LEU B CG    1 
ATOM   3852  C  CD1   . LEU B  2  158 ? -22.476 36.260  29.337  1.00 69.09  ? 158  LEU B CD1   1 
ATOM   3853  C  CD2   . LEU B  2  158 ? -21.991 33.870  29.117  1.00 67.35  ? 158  LEU B CD2   1 
ATOM   3854  N  N     . THR B  2  159 ? -27.240 33.597  27.940  1.00 72.04  ? 159  THR B N     1 
ATOM   3855  C  CA    . THR B  2  159 ? -28.669 33.505  28.245  1.00 73.05  ? 159  THR B CA    1 
ATOM   3856  C  C     . THR B  2  159 ? -29.229 32.101  28.128  1.00 72.43  ? 159  THR B C     1 
ATOM   3857  O  O     . THR B  2  159 ? -30.265 31.781  28.712  1.00 72.13  ? 159  THR B O     1 
ATOM   3858  C  CB    . THR B  2  159 ? -29.486 34.376  27.308  1.00 74.04  ? 159  THR B CB    1 
ATOM   3859  O  OG1   . THR B  2  159 ? -28.950 35.696  27.324  1.00 75.91  ? 159  THR B OG1   1 
ATOM   3860  C  CG2   . THR B  2  159 ? -30.942 34.428  27.762  1.00 75.84  ? 159  THR B CG2   1 
ATOM   3861  N  N     . GLY B  2  160 ? -28.545 31.269  27.368  1.00 72.36  ? 160  GLY B N     1 
ATOM   3862  C  CA    . GLY B  2  160 ? -29.038 29.927  27.180  1.00 74.01  ? 160  GLY B CA    1 
ATOM   3863  C  C     . GLY B  2  160 ? -30.080 29.993  26.077  1.00 73.99  ? 160  GLY B C     1 
ATOM   3864  O  O     . GLY B  2  160 ? -30.666 28.986  25.672  1.00 74.99  ? 160  GLY B O     1 
ATOM   3865  N  N     . LEU B  2  161 ? -30.308 31.200  25.596  1.00 73.18  ? 161  LEU B N     1 
ATOM   3866  C  CA    . LEU B  2  161 ? -31.258 31.401  24.527  1.00 72.55  ? 161  LEU B CA    1 
ATOM   3867  C  C     . LEU B  2  161 ? -30.837 30.486  23.370  1.00 71.84  ? 161  LEU B C     1 
ATOM   3868  O  O     . LEU B  2  161 ? -31.669 29.865  22.696  1.00 71.45  ? 161  LEU B O     1 
ATOM   3869  C  CB    . LEU B  2  161 ? -31.225 32.863  24.114  1.00 73.12  ? 161  LEU B CB    1 
ATOM   3870  C  CG    . LEU B  2  161 ? -32.253 33.280  23.085  1.00 73.66  ? 161  LEU B CG    1 
ATOM   3871  C  CD1   . LEU B  2  161 ? -33.622 32.788  23.514  1.00 74.12  ? 161  LEU B CD1   1 
ATOM   3872  C  CD2   . LEU B  2  161 ? -32.219 34.792  22.947  1.00 74.31  ? 161  LEU B CD2   1 
ATOM   3873  N  N     . PHE B  2  162 ? -29.536 30.408  23.148  1.00 71.14  ? 162  PHE B N     1 
ATOM   3874  C  CA    . PHE B  2  162 ? -29.000 29.544  22.110  1.00 71.00  ? 162  PHE B CA    1 
ATOM   3875  C  C     . PHE B  2  162 ? -27.577 29.167  22.453  1.00 71.48  ? 162  PHE B C     1 
ATOM   3876  O  O     . PHE B  2  162 ? -26.628 29.753  21.940  1.00 72.16  ? 162  PHE B O     1 
ATOM   3877  C  CB    . PHE B  2  162 ? -29.021 30.213  20.742  1.00 69.92  ? 162  PHE B CB    1 
ATOM   3878  C  CG    . PHE B  2  162 ? -28.534 29.311  19.635  1.00 69.63  ? 162  PHE B CG    1 
ATOM   3879  C  CD1   . PHE B  2  162 ? -27.601 29.761  18.702  1.00 69.31  ? 162  PHE B CD1   1 
ATOM   3880  C  CD2   . PHE B  2  162 ? -28.976 27.994  19.553  1.00 68.48  ? 162  PHE B CD2   1 
ATOM   3881  C  CE1   . PHE B  2  162 ? -27.119 28.918  17.717  1.00 68.46  ? 162  PHE B CE1   1 
ATOM   3882  C  CE2   . PHE B  2  162 ? -28.494 27.147  18.567  1.00 67.47  ? 162  PHE B CE2   1 
ATOM   3883  C  CZ    . PHE B  2  162 ? -27.568 27.604  17.651  1.00 67.78  ? 162  PHE B CZ    1 
ATOM   3884  N  N     . GLY B  2  163 ? -27.443 28.177  23.325  1.00 72.27  ? 163  GLY B N     1 
ATOM   3885  C  CA    . GLY B  2  163 ? -26.137 27.713  23.746  1.00 72.35  ? 163  GLY B CA    1 
ATOM   3886  C  C     . GLY B  2  163 ? -26.255 27.346  25.207  1.00 72.55  ? 163  GLY B C     1 
ATOM   3887  O  O     . GLY B  2  163 ? -27.383 27.320  25.737  1.00 73.85  ? 163  GLY B O     1 
ATOM   3888  N  N     . PRO B  2  164 ? -25.134 27.038  25.890  1.00 71.42  ? 164  PRO B N     1 
ATOM   3889  C  CA    . PRO B  2  164 ? -25.155 26.678  27.304  1.00 69.75  ? 164  PRO B CA    1 
ATOM   3890  C  C     . PRO B  2  164 ? -25.240 27.983  28.045  1.00 70.00  ? 164  PRO B C     1 
ATOM   3891  O  O     . PRO B  2  164 ? -25.528 29.026  27.443  1.00 70.22  ? 164  PRO B O     1 
ATOM   3892  C  CB    . PRO B  2  164 ? -23.811 26.031  27.495  1.00 68.36  ? 164  PRO B CB    1 
ATOM   3893  C  CG    . PRO B  2  164 ? -22.955 26.901  26.678  1.00 68.45  ? 164  PRO B CG    1 
ATOM   3894  C  CD    . PRO B  2  164 ? -23.751 27.032  25.393  1.00 70.49  ? 164  PRO B CD    1 
ATOM   3895  N  N     . GLY B  2  165 ? -24.982 27.938  29.342  1.00 69.57  ? 165  GLY B N     1 
ATOM   3896  C  CA    . GLY B  2  165 ? -25.015 29.159  30.118  1.00 68.87  ? 165  GLY B CA    1 
ATOM   3897  C  C     . GLY B  2  165 ? -23.596 29.504  30.509  1.00 68.57  ? 165  GLY B C     1 
ATOM   3898  O  O     . GLY B  2  165 ? -22.701 29.587  29.668  1.00 67.04  ? 165  GLY B O     1 
ATOM   3899  N  N     . MET B  2  166 ? -23.411 29.701  31.805  1.00 69.64  ? 166  MET B N     1 
ATOM   3900  C  CA    . MET B  2  166 ? -22.114 30.014  32.370  1.00 70.73  ? 166  MET B CA    1 
ATOM   3901  C  C     . MET B  2  166 ? -22.069 29.365  33.757  1.00 71.87  ? 166  MET B C     1 
ATOM   3902  O  O     . MET B  2  166 ? -23.118 29.060  34.343  1.00 72.80  ? 166  MET B O     1 
ATOM   3903  C  CB    . MET B  2  166 ? -21.920 31.529  32.472  1.00 70.00  ? 166  MET B CB    1 
ATOM   3904  C  CG    . MET B  2  166 ? -22.787 32.225  33.491  1.00 67.70  ? 166  MET B CG    1 
ATOM   3905  S  SD    . MET B  2  166 ? -22.488 33.991  33.435  1.00 67.04  ? 166  MET B SD    1 
ATOM   3906  C  CE    . MET B  2  166 ? -20.947 34.144  34.285  1.00 68.01  ? 166  MET B CE    1 
ATOM   3907  N  N     . TRP B  2  167 ? -20.869 29.137  34.276  1.00 71.24  ? 167  TRP B N     1 
ATOM   3908  C  CA    . TRP B  2  167 ? -20.779 28.509  35.568  1.00 69.81  ? 167  TRP B CA    1 
ATOM   3909  C  C     . TRP B  2  167 ? -21.260 29.464  36.628  1.00 69.39  ? 167  TRP B C     1 
ATOM   3910  O  O     . TRP B  2  167 ? -20.690 30.547  36.845  1.00 68.74  ? 167  TRP B O     1 
ATOM   3911  C  CB    . TRP B  2  167 ? -19.360 28.068  35.855  1.00 69.07  ? 167  TRP B CB    1 
ATOM   3912  C  CG    . TRP B  2  167 ? -19.249 27.273  37.102  1.00 67.59  ? 167  TRP B CG    1 
ATOM   3913  C  CD1   . TRP B  2  167 ? -19.171 27.746  38.377  1.00 67.71  ? 167  TRP B CD1   1 
ATOM   3914  C  CD2   . TRP B  2  167 ? -19.198 25.852  37.199  1.00 66.75  ? 167  TRP B CD2   1 
ATOM   3915  N  NE1   . TRP B  2  167 ? -19.070 26.699  39.266  1.00 67.06  ? 167  TRP B NE1   1 
ATOM   3916  C  CE2   . TRP B  2  167 ? -19.084 25.527  38.561  1.00 66.12  ? 167  TRP B CE2   1 
ATOM   3917  C  CE3   . TRP B  2  167 ? -19.237 24.818  36.259  1.00 67.38  ? 167  TRP B CE3   1 
ATOM   3918  C  CZ2   . TRP B  2  167 ? -19.008 24.220  39.005  1.00 66.39  ? 167  TRP B CZ2   1 
ATOM   3919  C  CZ3   . TRP B  2  167 ? -19.162 23.510  36.701  1.00 66.66  ? 167  TRP B CZ3   1 
ATOM   3920  C  CH2   . TRP B  2  167 ? -19.048 23.222  38.060  1.00 66.83  ? 167  TRP B CH2   1 
ATOM   3921  N  N     . VAL B  2  168 ? -22.348 29.047  37.265  1.00 69.70  ? 168  VAL B N     1 
ATOM   3922  C  CA    . VAL B  2  168 ? -22.966 29.805  38.342  1.00 70.06  ? 168  VAL B CA    1 
ATOM   3923  C  C     . VAL B  2  168 ? -23.030 28.868  39.533  1.00 69.03  ? 168  VAL B C     1 
ATOM   3924  O  O     . VAL B  2  168 ? -23.402 27.704  39.390  1.00 68.45  ? 168  VAL B O     1 
ATOM   3925  C  CB    . VAL B  2  168 ? -24.401 30.261  37.976  1.00 70.67  ? 168  VAL B CB    1 
ATOM   3926  C  CG1   . VAL B  2  168 ? -25.030 30.977  39.166  1.00 72.11  ? 168  VAL B CG1   1 
ATOM   3927  C  CG2   . VAL B  2  168 ? -24.363 31.199  36.794  1.00 71.71  ? 168  VAL B CG2   1 
ATOM   3928  N  N     . SER B  2  169 ? -22.670 29.378  40.702  1.00 67.69  ? 169  SER B N     1 
ATOM   3929  C  CA    . SER B  2  169 ? -22.667 28.575  41.912  1.00 66.58  ? 169  SER B CA    1 
ATOM   3930  C  C     . SER B  2  169 ? -23.397 29.314  43.047  1.00 65.99  ? 169  SER B C     1 
ATOM   3931  O  O     . SER B  2  169 ? -24.026 30.359  42.816  1.00 67.95  ? 169  SER B O     1 
ATOM   3932  C  CB    . SER B  2  169 ? -21.215 28.280  42.304  1.00 66.61  ? 169  SER B CB    1 
ATOM   3933  O  OG    . SER B  2  169 ? -21.135 27.335  43.345  1.00 66.80  ? 169  SER B OG    1 
ATOM   3934  N  N     . ASP B  2  170 ? -23.329 28.768  44.258  1.00 63.82  ? 170  ASP B N     1 
ATOM   3935  C  CA    . ASP B  2  170 ? -23.963 29.391  45.415  1.00 61.78  ? 170  ASP B CA    1 
ATOM   3936  C  C     . ASP B  2  170 ? -22.911 30.167  46.227  1.00 61.12  ? 170  ASP B C     1 
ATOM   3937  O  O     . ASP B  2  170 ? -21.736 30.246  45.843  1.00 61.20  ? 170  ASP B O     1 
ATOM   3938  C  CB    . ASP B  2  170 ? -24.607 28.338  46.289  1.00 61.77  ? 170  ASP B CB    1 
ATOM   3939  C  CG    . ASP B  2  170 ? -23.610 27.335  46.804  1.00 63.49  ? 170  ASP B CG    1 
ATOM   3940  O  OD1   . ASP B  2  170 ? -23.190 26.465  46.006  1.00 61.05  ? 170  ASP B OD1   1 
ATOM   3941  O  OD2   . ASP B  2  170 ? -23.245 27.428  48.003  1.00 63.62  ? 170  ASP B OD2   1 
ATOM   3942  N  N     . PRO B  2  171 ? -23.307 30.734  47.373  1.00 58.55  ? 171  PRO B N     1 
ATOM   3943  C  CA    . PRO B  2  171 ? -22.339 31.492  48.161  1.00 55.98  ? 171  PRO B CA    1 
ATOM   3944  C  C     . PRO B  2  171 ? -21.083 30.761  48.598  1.00 55.30  ? 171  PRO B C     1 
ATOM   3945  O  O     . PRO B  2  171 ? -20.042 31.393  48.790  1.00 55.94  ? 171  PRO B O     1 
ATOM   3946  C  CB    . PRO B  2  171 ? -23.171 31.968  49.346  1.00 55.21  ? 171  PRO B CB    1 
ATOM   3947  C  CG    . PRO B  2  171 ? -24.487 32.150  48.754  1.00 55.69  ? 171  PRO B CG    1 
ATOM   3948  C  CD    . PRO B  2  171 ? -24.651 30.904  47.937  1.00 58.15  ? 171  PRO B CD    1 
ATOM   3949  N  N     . TYR B  2  172 ? -21.174 29.442  48.747  1.00 52.24  ? 172  TYR B N     1 
ATOM   3950  C  CA    . TYR B  2  172 ? -20.037 28.660  49.211  1.00 49.21  ? 172  TYR B CA    1 
ATOM   3951  C  C     . TYR B  2  172 ? -19.532 27.588  48.272  1.00 49.00  ? 172  TYR B C     1 
ATOM   3952  O  O     . TYR B  2  172 ? -19.118 26.531  48.703  1.00 48.12  ? 172  TYR B O     1 
ATOM   3953  C  CB    . TYR B  2  172 ? -20.393 28.051  50.548  1.00 47.14  ? 172  TYR B CB    1 
ATOM   3954  C  CG    . TYR B  2  172 ? -20.750 29.089  51.548  1.00 46.15  ? 172  TYR B CG    1 
ATOM   3955  C  CD1   . TYR B  2  172 ? -19.771 29.753  52.254  1.00 48.32  ? 172  TYR B CD1   1 
ATOM   3956  C  CD2   . TYR B  2  172 ? -22.070 29.442  51.755  1.00 47.09  ? 172  TYR B CD2   1 
ATOM   3957  C  CE1   . TYR B  2  172 ? -20.092 30.755  53.155  1.00 50.98  ? 172  TYR B CE1   1 
ATOM   3958  C  CE2   . TYR B  2  172 ? -22.412 30.442  52.647  1.00 49.07  ? 172  TYR B CE2   1 
ATOM   3959  C  CZ    . TYR B  2  172 ? -21.415 31.100  53.347  1.00 51.15  ? 172  TYR B CZ    1 
ATOM   3960  O  OH    . TYR B  2  172 ? -21.735 32.113  54.225  1.00 52.57  ? 172  TYR B OH    1 
ATOM   3961  N  N     . GLY B  2  173 ? -19.564 27.857  46.984  1.00 48.91  ? 173  GLY B N     1 
ATOM   3962  C  CA    . GLY B  2  173 ? -19.089 26.883  46.024  1.00 50.64  ? 173  GLY B CA    1 
ATOM   3963  C  C     . GLY B  2  173 ? -19.340 25.426  46.356  1.00 50.90  ? 173  GLY B C     1 
ATOM   3964  O  O     . GLY B  2  173 ? -18.423 24.618  46.316  1.00 52.09  ? 173  GLY B O     1 
ATOM   3965  N  N     . LEU B  2  174 ? -20.582 25.087  46.662  1.00 51.45  ? 174  LEU B N     1 
ATOM   3966  C  CA    . LEU B  2  174 ? -20.936 23.720  46.981  1.00 50.43  ? 174  LEU B CA    1 
ATOM   3967  C  C     . LEU B  2  174 ? -21.797 23.132  45.874  1.00 51.80  ? 174  LEU B C     1 
ATOM   3968  O  O     . LEU B  2  174 ? -21.752 21.940  45.639  1.00 50.99  ? 174  LEU B O     1 
ATOM   3969  C  CB    . LEU B  2  174 ? -21.712 23.669  48.295  1.00 49.24  ? 174  LEU B CB    1 
ATOM   3970  C  CG    . LEU B  2  174 ? -21.078 24.194  49.583  1.00 50.71  ? 174  LEU B CG    1 
ATOM   3971  C  CD1   . LEU B  2  174 ? -22.113 24.213  50.684  1.00 49.86  ? 174  LEU B CD1   1 
ATOM   3972  C  CD2   . LEU B  2  174 ? -19.910 23.326  49.984  1.00 50.48  ? 174  LEU B CD2   1 
ATOM   3973  N  N     . THR B  2  175 ? -22.552 23.977  45.179  1.00 53.02  ? 175  THR B N     1 
ATOM   3974  C  CA    . THR B  2  175 ? -23.474 23.509  44.149  1.00 54.36  ? 175  THR B CA    1 
ATOM   3975  C  C     . THR B  2  175 ? -23.228 23.983  42.720  1.00 56.12  ? 175  THR B C     1 
ATOM   3976  O  O     . THR B  2  175 ? -24.002 23.674  41.816  1.00 57.95  ? 175  THR B O     1 
ATOM   3977  C  CB    . THR B  2  175 ? -24.919 23.897  44.520  1.00 55.08  ? 175  THR B CB    1 
ATOM   3978  O  OG1   . THR B  2  175 ? -25.131 23.682  45.915  1.00 57.34  ? 175  THR B OG1   1 
ATOM   3979  C  CG2   . THR B  2  175 ? -25.908 23.042  43.780  1.00 56.65  ? 175  THR B CG2   1 
ATOM   3980  N  N     . GLY B  2  176 ? -22.163 24.731  42.496  1.00 56.90  ? 176  GLY B N     1 
ATOM   3981  C  CA    . GLY B  2  176 ? -21.896 25.229  41.154  1.00 56.22  ? 176  GLY B CA    1 
ATOM   3982  C  C     . GLY B  2  176 ? -22.254 24.310  39.999  1.00 56.20  ? 176  GLY B C     1 
ATOM   3983  O  O     . GLY B  2  176 ? -22.236 23.082  40.134  1.00 56.04  ? 176  GLY B O     1 
ATOM   3984  N  N     . SER B  2  177 ? -22.563 24.923  38.856  1.00 56.27  ? 177  SER B N     1 
ATOM   3985  C  CA    . SER B  2  177 ? -22.930 24.214  37.635  1.00 57.06  ? 177  SER B CA    1 
ATOM   3986  C  C     . SER B  2  177 ? -23.082 25.211  36.514  1.00 57.25  ? 177  SER B C     1 
ATOM   3987  O  O     . SER B  2  177 ? -22.933 26.418  36.718  1.00 56.12  ? 177  SER B O     1 
ATOM   3988  C  CB    . SER B  2  177 ? -24.262 23.492  37.799  1.00 59.17  ? 177  SER B CB    1 
ATOM   3989  O  OG    . SER B  2  177 ? -25.329 24.411  37.991  1.00 63.60  ? 177  SER B OG    1 
ATOM   3990  N  N     . VAL B  2  178 ? -23.396 24.701  35.330  1.00 57.81  ? 178  VAL B N     1 
ATOM   3991  C  CA    . VAL B  2  178 ? -23.588 25.554  34.173  1.00 59.18  ? 178  VAL B CA    1 
ATOM   3992  C  C     . VAL B  2  178 ? -25.067 25.720  33.964  1.00 60.17  ? 178  VAL B C     1 
ATOM   3993  O  O     . VAL B  2  178 ? -25.763 24.763  33.664  1.00 59.81  ? 178  VAL B O     1 
ATOM   3994  C  CB    . VAL B  2  178 ? -23.003 24.944  32.916  1.00 59.67  ? 178  VAL B CB    1 
ATOM   3995  C  CG1   . VAL B  2  178 ? -23.271 25.839  31.750  1.00 61.29  ? 178  VAL B CG1   1 
ATOM   3996  C  CG2   . VAL B  2  178 ? -21.526 24.757  33.075  1.00 62.69  ? 178  VAL B CG2   1 
ATOM   3997  N  N     . GLN B  2  179 ? -25.536 26.947  34.137  1.00 61.68  ? 179  GLN B N     1 
ATOM   3998  C  CA    . GLN B  2  179 ? -26.940 27.290  33.982  1.00 62.81  ? 179  GLN B CA    1 
ATOM   3999  C  C     . GLN B  2  179 ? -27.009 28.514  33.107  1.00 63.49  ? 179  GLN B C     1 
ATOM   4000  O  O     . GLN B  2  179 ? -26.019 29.224  32.958  1.00 65.32  ? 179  GLN B O     1 
ATOM   4001  C  CB    . GLN B  2  179 ? -27.539 27.653  35.319  1.00 62.83  ? 179  GLN B CB    1 
ATOM   4002  C  CG    . GLN B  2  179 ? -27.381 26.598  36.340  1.00 65.24  ? 179  GLN B CG    1 
ATOM   4003  C  CD    . GLN B  2  179 ? -28.363 25.479  36.147  1.00 66.86  ? 179  GLN B CD    1 
ATOM   4004  O  OE1   . GLN B  2  179 ? -28.500 24.618  37.012  1.00 67.19  ? 179  GLN B OE1   1 
ATOM   4005  N  NE2   . GLN B  2  179 ? -29.065 25.482  35.012  1.00 66.46  ? 179  GLN B NE2   1 
ATOM   4006  N  N     . PRO B  2  180 ? -28.181 28.783  32.518  1.00 63.31  ? 180  PRO B N     1 
ATOM   4007  C  CA    . PRO B  2  180 ? -28.391 29.945  31.650  1.00 61.82  ? 180  PRO B CA    1 
ATOM   4008  C  C     . PRO B  2  180 ? -28.684 31.165  32.526  1.00 61.13  ? 180  PRO B C     1 
ATOM   4009  O  O     . PRO B  2  180 ? -29.552 31.115  33.397  1.00 59.31  ? 180  PRO B O     1 
ATOM   4010  C  CB    . PRO B  2  180 ? -29.603 29.535  30.834  1.00 63.22  ? 180  PRO B CB    1 
ATOM   4011  C  CG    . PRO B  2  180 ? -29.572 28.028  30.885  1.00 62.52  ? 180  PRO B CG    1 
ATOM   4012  C  CD    . PRO B  2  180 ? -29.251 27.800  32.315  1.00 62.41  ? 180  PRO B CD    1 
ATOM   4013  N  N     . VAL B  2  181 ? -27.962 32.252  32.296  1.00 61.38  ? 181  VAL B N     1 
ATOM   4014  C  CA    . VAL B  2  181 ? -28.157 33.455  33.089  1.00 62.40  ? 181  VAL B CA    1 
ATOM   4015  C  C     . VAL B  2  181 ? -29.019 34.489  32.390  1.00 62.70  ? 181  VAL B C     1 
ATOM   4016  O  O     . VAL B  2  181 ? -28.948 34.646  31.173  1.00 62.86  ? 181  VAL B O     1 
ATOM   4017  C  CB    . VAL B  2  181 ? -26.816 34.086  33.449  1.00 61.95  ? 181  VAL B CB    1 
ATOM   4018  C  CG1   . VAL B  2  181 ? -27.030 35.300  34.364  1.00 60.50  ? 181  VAL B CG1   1 
ATOM   4019  C  CG2   . VAL B  2  181 ? -25.934 33.030  34.111  1.00 60.78  ? 181  VAL B CG2   1 
ATOM   4020  N  N     . ALA B  2  182 ? -29.841 35.178  33.180  1.00 63.35  ? 182  ALA B N     1 
ATOM   4021  C  CA    . ALA B  2  182 ? -30.752 36.213  32.705  1.00 63.84  ? 182  ALA B CA    1 
ATOM   4022  C  C     . ALA B  2  182 ? -30.138 37.589  32.915  1.00 65.21  ? 182  ALA B C     1 
ATOM   4023  O  O     . ALA B  2  182 ? -29.647 37.919  33.994  1.00 66.32  ? 182  ALA B O     1 
ATOM   4024  C  CB    . ALA B  2  182 ? -32.058 36.130  33.443  1.00 63.85  ? 182  ALA B CB    1 
ATOM   4025  N  N     . PRO B  2  183 ? -30.182 38.427  31.890  1.00 65.60  ? 183  PRO B N     1 
ATOM   4026  C  CA    . PRO B  2  183 ? -29.591 39.757  32.063  1.00 66.49  ? 183  PRO B CA    1 
ATOM   4027  C  C     . PRO B  2  183 ? -30.186 40.463  33.266  1.00 67.99  ? 183  PRO B C     1 
ATOM   4028  O  O     . PRO B  2  183 ? -31.243 40.071  33.752  1.00 67.71  ? 183  PRO B O     1 
ATOM   4029  C  CB    . PRO B  2  183 ? -29.979 40.477  30.777  1.00 66.11  ? 183  PRO B CB    1 
ATOM   4030  C  CG    . PRO B  2  183 ? -30.137 39.356  29.796  1.00 67.20  ? 183  PRO B CG    1 
ATOM   4031  C  CD    . PRO B  2  183 ? -30.830 38.291  30.578  1.00 64.93  ? 183  PRO B CD    1 
ATOM   4032  N  N     . GLU B  2  184 ? -29.500 41.477  33.769  1.00 68.93  ? 184  GLU B N     1 
ATOM   4033  C  CA    . GLU B  2  184 ? -30.059 42.261  34.854  1.00 70.51  ? 184  GLU B CA    1 
ATOM   4034  C  C     . GLU B  2  184 ? -29.541 43.672  34.699  1.00 71.12  ? 184  GLU B C     1 
ATOM   4035  O  O     . GLU B  2  184 ? -28.351 43.933  34.913  1.00 72.01  ? 184  GLU B O     1 
ATOM   4036  C  CB    . GLU B  2  184 ? -29.698 41.711  36.220  1.00 71.94  ? 184  GLU B CB    1 
ATOM   4037  C  CG    . GLU B  2  184 ? -30.432 42.464  37.309  1.00 75.04  ? 184  GLU B CG    1 
ATOM   4038  C  CD    . GLU B  2  184 ? -30.195 41.884  38.685  1.00 77.90  ? 184  GLU B CD    1 
ATOM   4039  O  OE1   . GLU B  2  184 ? -30.708 40.774  38.988  1.00 77.85  ? 184  GLU B OE1   1 
ATOM   4040  O  OE2   . GLU B  2  184 ? -29.481 42.548  39.470  1.00 79.64  ? 184  GLU B OE2   1 
ATOM   4041  N  N     . TRP B  2  185 ? -30.453 44.571  34.323  1.00 70.97  ? 185  TRP B N     1 
ATOM   4042  C  CA    . TRP B  2  185 ? -30.162 45.981  34.070  1.00 70.05  ? 185  TRP B CA    1 
ATOM   4043  C  C     . TRP B  2  185 ? -30.248 46.827  35.327  1.00 70.40  ? 185  TRP B C     1 
ATOM   4044  O  O     . TRP B  2  185 ? -29.795 47.979  35.349  1.00 71.43  ? 185  TRP B O     1 
ATOM   4045  C  CB    . TRP B  2  185 ? -31.123 46.494  33.007  1.00 68.54  ? 185  TRP B CB    1 
ATOM   4046  C  CG    . TRP B  2  185 ? -31.443 45.415  32.018  1.00 67.18  ? 185  TRP B CG    1 
ATOM   4047  C  CD1   . TRP B  2  185 ? -32.426 44.463  32.122  1.00 66.49  ? 185  TRP B CD1   1 
ATOM   4048  C  CD2   . TRP B  2  185 ? -30.715 45.107  30.830  1.00 66.39  ? 185  TRP B CD2   1 
ATOM   4049  N  NE1   . TRP B  2  185 ? -32.346 43.582  31.072  1.00 66.04  ? 185  TRP B NE1   1 
ATOM   4050  C  CE2   . TRP B  2  185 ? -31.304 43.953  30.263  1.00 66.05  ? 185  TRP B CE2   1 
ATOM   4051  C  CE3   . TRP B  2  185 ? -29.617 45.690  30.190  1.00 66.02  ? 185  TRP B CE3   1 
ATOM   4052  C  CZ2   . TRP B  2  185 ? -30.832 43.372  29.085  1.00 65.72  ? 185  TRP B CZ2   1 
ATOM   4053  C  CZ3   . TRP B  2  185 ? -29.147 45.114  29.020  1.00 66.74  ? 185  TRP B CZ3   1 
ATOM   4054  C  CH2   . TRP B  2  185 ? -29.757 43.964  28.479  1.00 66.40  ? 185  TRP B CH2   1 
ATOM   4055  N  N     . GLY B  2  186 ? -30.822 46.250  36.378  1.00 69.94  ? 186  GLY B N     1 
ATOM   4056  C  CA    . GLY B  2  186 ? -30.921 46.960  37.639  1.00 69.72  ? 186  GLY B CA    1 
ATOM   4057  C  C     . GLY B  2  186 ? -29.545 47.431  38.079  1.00 69.26  ? 186  GLY B C     1 
ATOM   4058  O  O     . GLY B  2  186 ? -28.534 47.177  37.418  1.00 70.27  ? 186  GLY B O     1 
ATOM   4059  N  N     . PRO B  2  187 ? -29.467 48.143  39.187  1.00 68.34  ? 187  PRO B N     1 
ATOM   4060  C  CA    . PRO B  2  187 ? -28.112 48.553  39.549  1.00 69.80  ? 187  PRO B CA    1 
ATOM   4061  C  C     . PRO B  2  187 ? -27.244 47.381  40.053  1.00 70.32  ? 187  PRO B C     1 
ATOM   4062  O  O     . PRO B  2  187 ? -26.027 47.400  39.894  1.00 70.80  ? 187  PRO B O     1 
ATOM   4063  C  CB    . PRO B  2  187 ? -28.354 49.625  40.614  1.00 69.08  ? 187  PRO B CB    1 
ATOM   4064  C  CG    . PRO B  2  187 ? -29.658 49.182  41.241  1.00 68.74  ? 187  PRO B CG    1 
ATOM   4065  C  CD    . PRO B  2  187 ? -30.478 48.763  40.056  1.00 68.21  ? 187  PRO B CD    1 
ATOM   4066  N  N     . ASP B  2  188 ? -27.865 46.366  40.644  1.00 70.25  ? 188  ASP B N     1 
ATOM   4067  C  CA    . ASP B  2  188 ? -27.120 45.217  41.162  1.00 70.19  ? 188  ASP B CA    1 
ATOM   4068  C  C     . ASP B  2  188 ? -26.310 44.554  40.057  1.00 69.66  ? 188  ASP B C     1 
ATOM   4069  O  O     . ASP B  2  188 ? -25.319 43.882  40.318  1.00 71.25  ? 188  ASP B O     1 
ATOM   4070  C  CB    . ASP B  2  188 ? -28.083 44.192  41.765  1.00 70.05  ? 188  ASP B CB    1 
ATOM   4071  C  CG    . ASP B  2  188 ? -27.376 43.105  42.564  1.00 69.71  ? 188  ASP B CG    1 
ATOM   4072  O  OD1   . ASP B  2  188 ? -26.855 43.418  43.655  1.00 67.50  ? 188  ASP B OD1   1 
ATOM   4073  O  OD2   . ASP B  2  188 ? -27.364 41.942  42.096  1.00 69.32  ? 188  ASP B OD2   1 
ATOM   4074  N  N     . GLY B  2  189 ? -26.741 44.722  38.821  1.00 68.63  ? 189  GLY B N     1 
ATOM   4075  C  CA    . GLY B  2  189 ? -26.010 44.126  37.718  1.00 67.12  ? 189  GLY B CA    1 
ATOM   4076  C  C     . GLY B  2  189 ? -24.615 44.718  37.598  1.00 66.10  ? 189  GLY B C     1 
ATOM   4077  O  O     . GLY B  2  189 ? -23.882 44.401  36.668  1.00 65.03  ? 189  GLY B O     1 
ATOM   4078  N  N     . PHE B  2  190 ? -24.259 45.601  38.518  1.00 65.53  ? 190  PHE B N     1 
ATOM   4079  C  CA    . PHE B  2  190 ? -22.935 46.190  38.497  1.00 66.81  ? 190  PHE B CA    1 
ATOM   4080  C  C     . PHE B  2  190 ? -22.127 45.623  39.640  1.00 67.42  ? 190  PHE B C     1 
ATOM   4081  O  O     . PHE B  2  190 ? -20.985 46.012  39.861  1.00 69.76  ? 190  PHE B O     1 
ATOM   4082  C  CB    . PHE B  2  190 ? -23.008 47.708  38.579  1.00 67.12  ? 190  PHE B CB    1 
ATOM   4083  C  CG    . PHE B  2  190 ? -23.249 48.350  37.250  1.00 69.02  ? 190  PHE B CG    1 
ATOM   4084  C  CD1   . PHE B  2  190 ? -24.450 48.139  36.566  1.00 70.96  ? 190  PHE B CD1   1 
ATOM   4085  C  CD2   . PHE B  2  190 ? -22.254 49.092  36.633  1.00 68.69  ? 190  PHE B CD2   1 
ATOM   4086  C  CE1   . PHE B  2  190 ? -24.649 48.649  35.284  1.00 69.42  ? 190  PHE B CE1   1 
ATOM   4087  C  CE2   . PHE B  2  190 ? -22.445 49.605  35.352  1.00 70.39  ? 190  PHE B CE2   1 
ATOM   4088  C  CZ    . PHE B  2  190 ? -23.645 49.379  34.677  1.00 69.56  ? 190  PHE B CZ    1 
ATOM   4089  N  N     . ASN B  2  191 ? -22.743 44.692  40.362  1.00 67.40  ? 191  ASN B N     1 
ATOM   4090  C  CA    . ASN B  2  191 ? -22.126 43.989  41.482  1.00 65.90  ? 191  ASN B CA    1 
ATOM   4091  C  C     . ASN B  2  191 ? -21.304 42.893  40.829  1.00 64.76  ? 191  ASN B C     1 
ATOM   4092  O  O     . ASN B  2  191 ? -21.847 42.035  40.148  1.00 65.16  ? 191  ASN B O     1 
ATOM   4093  C  CB    . ASN B  2  191 ? -23.192 43.354  42.366  1.00 65.65  ? 191  ASN B CB    1 
ATOM   4094  C  CG    . ASN B  2  191 ? -22.601 42.662  43.552  1.00 67.41  ? 191  ASN B CG    1 
ATOM   4095  O  OD1   . ASN B  2  191 ? -23.307 42.170  44.422  1.00 68.73  ? 191  ASN B OD1   1 
ATOM   4096  N  ND2   . ASN B  2  191 ? -21.285 42.624  43.602  1.00 68.43  ? 191  ASN B ND2   1 
ATOM   4097  N  N     . PRO B  2  192 ? -19.984 42.904  41.030  1.00 63.79  ? 192  PRO B N     1 
ATOM   4098  C  CA    . PRO B  2  192 ? -19.121 41.884  40.425  1.00 64.11  ? 192  PRO B CA    1 
ATOM   4099  C  C     . PRO B  2  192 ? -19.508 40.432  40.702  1.00 64.96  ? 192  PRO B C     1 
ATOM   4100  O  O     . PRO B  2  192 ? -19.031 39.515  40.029  1.00 66.01  ? 192  PRO B O     1 
ATOM   4101  C  CB    . PRO B  2  192 ? -17.746 42.235  40.980  1.00 62.37  ? 192  PRO B CB    1 
ATOM   4102  C  CG    . PRO B  2  192 ? -18.073 42.851  42.274  1.00 62.21  ? 192  PRO B CG    1 
ATOM   4103  C  CD    . PRO B  2  192 ? -19.206 43.754  41.939  1.00 61.44  ? 192  PRO B CD    1 
ATOM   4104  N  N     . TYR B  2  193 ? -20.386 40.222  41.669  1.00 64.87  ? 193  TYR B N     1 
ATOM   4105  C  CA    . TYR B  2  193 ? -20.778 38.867  42.006  1.00 65.37  ? 193  TYR B CA    1 
ATOM   4106  C  C     . TYR B  2  193 ? -22.089 38.425  41.390  1.00 65.84  ? 193  TYR B C     1 
ATOM   4107  O  O     . TYR B  2  193 ? -22.475 37.279  41.573  1.00 67.76  ? 193  TYR B O     1 
ATOM   4108  C  CB    . TYR B  2  193 ? -20.838 38.709  43.532  1.00 64.67  ? 193  TYR B CB    1 
ATOM   4109  C  CG    . TYR B  2  193 ? -19.487 38.919  44.187  1.00 65.37  ? 193  TYR B CG    1 
ATOM   4110  C  CD1   . TYR B  2  193 ? -18.423 38.071  43.897  1.00 64.44  ? 193  TYR B CD1   1 
ATOM   4111  C  CD2   . TYR B  2  193 ? -19.245 40.017  45.020  1.00 65.36  ? 193  TYR B CD2   1 
ATOM   4112  C  CE1   . TYR B  2  193 ? -17.167 38.303  44.398  1.00 63.50  ? 193  TYR B CE1   1 
ATOM   4113  C  CE2   . TYR B  2  193 ? -17.973 40.258  45.528  1.00 64.83  ? 193  TYR B CE2   1 
ATOM   4114  C  CZ    . TYR B  2  193 ? -16.939 39.383  45.205  1.00 64.32  ? 193  TYR B CZ    1 
ATOM   4115  O  OH    . TYR B  2  193 ? -15.670 39.560  45.699  1.00 65.31  ? 193  TYR B OH    1 
ATOM   4116  N  N     . ASN B  2  194 ? -22.774 39.300  40.658  1.00 63.95  ? 194  ASN B N     1 
ATOM   4117  C  CA    . ASN B  2  194 ? -24.045 38.926  40.059  1.00 62.23  ? 194  ASN B CA    1 
ATOM   4118  C  C     . ASN B  2  194 ? -23.870 38.585  38.589  1.00 63.01  ? 194  ASN B C     1 
ATOM   4119  O  O     . ASN B  2  194 ? -23.702 39.464  37.764  1.00 63.29  ? 194  ASN B O     1 
ATOM   4120  C  CB    . ASN B  2  194 ? -25.039 40.059  40.212  1.00 62.01  ? 194  ASN B CB    1 
ATOM   4121  C  CG    . ASN B  2  194 ? -26.379 39.745  39.581  1.00 64.54  ? 194  ASN B CG    1 
ATOM   4122  O  OD1   . ASN B  2  194 ? -26.468 39.433  38.390  1.00 63.51  ? 194  ASN B OD1   1 
ATOM   4123  N  ND2   . ASN B  2  194 ? -27.436 39.830  40.377  1.00 64.04  ? 194  ASN B ND2   1 
ATOM   4124  N  N     . PRO B  2  195 ? -23.914 37.298  38.237  1.00 62.62  ? 195  PRO B N     1 
ATOM   4125  C  CA    . PRO B  2  195 ? -23.749 36.873  36.845  1.00 63.84  ? 195  PRO B CA    1 
ATOM   4126  C  C     . PRO B  2  195 ? -24.631 37.640  35.871  1.00 66.01  ? 195  PRO B C     1 
ATOM   4127  O  O     . PRO B  2  195 ? -24.220 37.934  34.746  1.00 66.84  ? 195  PRO B O     1 
ATOM   4128  C  CB    . PRO B  2  195 ? -24.105 35.398  36.893  1.00 63.85  ? 195  PRO B CB    1 
ATOM   4129  C  CG    . PRO B  2  195 ? -23.599 35.004  38.229  1.00 64.59  ? 195  PRO B CG    1 
ATOM   4130  C  CD    . PRO B  2  195 ? -24.071 36.134  39.116  1.00 63.68  ? 195  PRO B CD    1 
ATOM   4131  N  N     . GLY B  2  196 ? -25.845 37.961  36.301  1.00 67.20  ? 196  GLY B N     1 
ATOM   4132  C  CA    . GLY B  2  196 ? -26.758 38.690  35.440  1.00 67.87  ? 196  GLY B CA    1 
ATOM   4133  C  C     . GLY B  2  196 ? -26.098 39.947  34.918  1.00 68.40  ? 196  GLY B C     1 
ATOM   4134  O  O     . GLY B  2  196 ? -26.479 40.473  33.861  1.00 68.77  ? 196  GLY B O     1 
ATOM   4135  N  N     . GLY B  2  197 ? -25.111 40.426  35.673  1.00 68.19  ? 197  GLY B N     1 
ATOM   4136  C  CA    . GLY B  2  197 ? -24.387 41.619  35.284  1.00 68.24  ? 197  GLY B CA    1 
ATOM   4137  C  C     . GLY B  2  197 ? -23.449 41.284  34.147  1.00 68.53  ? 197  GLY B C     1 
ATOM   4138  O  O     . GLY B  2  197 ? -23.187 42.117  33.282  1.00 69.30  ? 197  GLY B O     1 
ATOM   4139  N  N     . VAL B  2  198 ? -22.943 40.058  34.148  1.00 67.85  ? 198  VAL B N     1 
ATOM   4140  C  CA    . VAL B  2  198 ? -22.037 39.608  33.100  1.00 66.26  ? 198  VAL B CA    1 
ATOM   4141  C  C     . VAL B  2  198 ? -22.802 39.457  31.791  1.00 65.36  ? 198  VAL B C     1 
ATOM   4142  O  O     . VAL B  2  198 ? -22.232 39.524  30.706  1.00 65.69  ? 198  VAL B O     1 
ATOM   4143  C  CB    . VAL B  2  198 ? -21.395 38.266  33.477  1.00 66.23  ? 198  VAL B CB    1 
ATOM   4144  C  CG1   . VAL B  2  198 ? -20.507 37.772  32.347  1.00 65.54  ? 198  VAL B CG1   1 
ATOM   4145  C  CG2   . VAL B  2  198 ? -20.603 38.424  34.760  1.00 65.47  ? 198  VAL B CG2   1 
ATOM   4146  N  N     . VAL B  2  199 ? -24.099 39.245  31.901  1.00 64.81  ? 199  VAL B N     1 
ATOM   4147  C  CA    . VAL B  2  199 ? -24.924 39.104  30.714  1.00 64.77  ? 199  VAL B CA    1 
ATOM   4148  C  C     . VAL B  2  199 ? -25.361 40.482  30.205  1.00 64.58  ? 199  VAL B C     1 
ATOM   4149  O  O     . VAL B  2  199 ? -25.130 40.845  29.053  1.00 64.19  ? 199  VAL B O     1 
ATOM   4150  C  CB    . VAL B  2  199 ? -26.166 38.278  31.012  1.00 64.53  ? 199  VAL B CB    1 
ATOM   4151  C  CG1   . VAL B  2  199 ? -26.851 37.925  29.724  1.00 64.84  ? 199  VAL B CG1   1 
ATOM   4152  C  CG2   . VAL B  2  199 ? -25.785 37.031  31.788  1.00 65.15  ? 199  VAL B CG2   1 
ATOM   4153  N  N     . ALA B  2  200 ? -25.999 41.246  31.074  1.00 63.92  ? 200  ALA B N     1 
ATOM   4154  C  CA    . ALA B  2  200 ? -26.451 42.576  30.710  1.00 64.16  ? 200  ALA B CA    1 
ATOM   4155  C  C     . ALA B  2  200 ? -25.330 43.407  30.082  1.00 63.97  ? 200  ALA B C     1 
ATOM   4156  O  O     . ALA B  2  200 ? -25.563 44.207  29.172  1.00 65.33  ? 200  ALA B O     1 
ATOM   4157  C  CB    . ALA B  2  200 ? -27.001 43.277  31.936  1.00 64.36  ? 200  ALA B CB    1 
ATOM   4158  N  N     . HIS B  2  201 ? -24.115 43.218  30.578  1.00 63.56  ? 201  HIS B N     1 
ATOM   4159  C  CA    . HIS B  2  201 ? -22.968 43.945  30.068  1.00 62.62  ? 201  HIS B CA    1 
ATOM   4160  C  C     . HIS B  2  201 ? -22.721 43.620  28.616  1.00 62.23  ? 201  HIS B C     1 
ATOM   4161  O  O     . HIS B  2  201 ? -22.786 44.503  27.786  1.00 64.25  ? 201  HIS B O     1 
ATOM   4162  C  CB    . HIS B  2  201 ? -21.706 43.610  30.836  1.00 62.83  ? 201  HIS B CB    1 
ATOM   4163  C  CG    . HIS B  2  201 ? -20.464 44.027  30.123  1.00 63.31  ? 201  HIS B CG    1 
ATOM   4164  N  ND1   . HIS B  2  201 ? -19.904 45.275  30.276  1.00 63.26  ? 201  HIS B ND1   1 
ATOM   4165  C  CD2   . HIS B  2  201 ? -19.724 43.391  29.185  1.00 62.98  ? 201  HIS B CD2   1 
ATOM   4166  C  CE1   . HIS B  2  201 ? -18.873 45.390  29.461  1.00 62.98  ? 201  HIS B CE1   1 
ATOM   4167  N  NE2   . HIS B  2  201 ? -18.743 44.261  28.787  1.00 62.48  ? 201  HIS B NE2   1 
ATOM   4168  N  N     . HIS B  2  202 ? -22.427 42.368  28.300  1.00 60.28  ? 202  HIS B N     1 
ATOM   4169  C  CA    . HIS B  2  202 ? -22.164 42.007  26.914  1.00 59.13  ? 202  HIS B CA    1 
ATOM   4170  C  C     . HIS B  2  202 ? -23.324 42.315  25.945  1.00 58.97  ? 202  HIS B C     1 
ATOM   4171  O  O     . HIS B  2  202 ? -23.141 42.323  24.719  1.00 59.47  ? 202  HIS B O     1 
ATOM   4172  C  CB    . HIS B  2  202 ? -21.780 40.531  26.816  1.00 59.24  ? 202  HIS B CB    1 
ATOM   4173  C  CG    . HIS B  2  202 ? -20.464 40.200  27.454  1.00 59.70  ? 202  HIS B CG    1 
ATOM   4174  N  ND1   . HIS B  2  202 ? -20.353 39.740  28.748  1.00 58.80  ? 202  HIS B ND1   1 
ATOM   4175  C  CD2   . HIS B  2  202 ? -19.199 40.281  26.978  1.00 59.56  ? 202  HIS B CD2   1 
ATOM   4176  C  CE1   . HIS B  2  202 ? -19.078 39.554  29.040  1.00 57.36  ? 202  HIS B CE1   1 
ATOM   4177  N  NE2   . HIS B  2  202 ? -18.358 39.874  27.983  1.00 57.36  ? 202  HIS B NE2   1 
ATOM   4178  N  N     . ILE B  2  203 ? -24.514 42.555  26.488  1.00 58.58  ? 203  ILE B N     1 
ATOM   4179  C  CA    . ILE B  2  203 ? -25.674 42.885  25.662  1.00 58.23  ? 203  ILE B CA    1 
ATOM   4180  C  C     . ILE B  2  203 ? -25.700 44.383  25.405  1.00 58.46  ? 203  ILE B C     1 
ATOM   4181  O  O     . ILE B  2  203 ? -25.922 44.808  24.277  1.00 58.16  ? 203  ILE B O     1 
ATOM   4182  C  CB    . ILE B  2  203 ? -26.982 42.465  26.328  1.00 57.83  ? 203  ILE B CB    1 
ATOM   4183  C  CG1   . ILE B  2  203 ? -27.247 40.990  26.054  1.00 56.08  ? 203  ILE B CG1   1 
ATOM   4184  C  CG2   . ILE B  2  203 ? -28.117 43.283  25.788  1.00 57.70  ? 203  ILE B CG2   1 
ATOM   4185  C  CD1   . ILE B  2  203 ? -28.445 40.481  26.774  1.00 55.79  ? 203  ILE B CD1   1 
ATOM   4186  N  N     . ALA B  2  204 ? -25.485 45.172  26.456  1.00 58.14  ? 204  ALA B N     1 
ATOM   4187  C  CA    . ALA B  2  204 ? -25.447 46.622  26.328  1.00 59.38  ? 204  ALA B CA    1 
ATOM   4188  C  C     . ALA B  2  204 ? -24.164 47.014  25.574  1.00 60.87  ? 204  ALA B C     1 
ATOM   4189  O  O     . ALA B  2  204 ? -24.228 47.544  24.460  1.00 61.76  ? 204  ALA B O     1 
ATOM   4190  C  CB    . ALA B  2  204 ? -25.485 47.290  27.698  1.00 57.41  ? 204  ALA B CB    1 
ATOM   4191  N  N     . ALA B  2  205 ? -23.004 46.743  26.168  1.00 62.15  ? 205  ALA B N     1 
ATOM   4192  C  CA    . ALA B  2  205 ? -21.721 47.070  25.547  1.00 63.14  ? 205  ALA B CA    1 
ATOM   4193  C  C     . ALA B  2  205 ? -21.574 46.499  24.150  1.00 64.07  ? 205  ALA B C     1 
ATOM   4194  O  O     . ALA B  2  205 ? -20.707 46.948  23.390  1.00 64.24  ? 205  ALA B O     1 
ATOM   4195  C  CB    . ALA B  2  205 ? -20.581 46.604  26.413  1.00 62.75  ? 205  ALA B CB    1 
ATOM   4196  N  N     . GLY B  2  206 ? -22.407 45.509  23.814  1.00 65.38  ? 206  GLY B N     1 
ATOM   4197  C  CA    . GLY B  2  206 ? -22.389 44.907  22.475  1.00 66.24  ? 206  GLY B CA    1 
ATOM   4198  C  C     . GLY B  2  206 ? -23.075 45.849  21.482  1.00 66.55  ? 206  GLY B C     1 
ATOM   4199  O  O     . GLY B  2  206 ? -22.562 46.124  20.397  1.00 66.40  ? 206  GLY B O     1 
ATOM   4200  N  N     . ILE B  2  207 ? -24.247 46.343  21.874  1.00 66.66  ? 207  ILE B N     1 
ATOM   4201  C  CA    . ILE B  2  207 ? -25.025 47.292  21.076  1.00 64.77  ? 207  ILE B CA    1 
ATOM   4202  C  C     . ILE B  2  207 ? -24.223 48.585  21.000  1.00 63.86  ? 207  ILE B C     1 
ATOM   4203  O  O     . ILE B  2  207 ? -23.987 49.112  19.914  1.00 63.08  ? 207  ILE B O     1 
ATOM   4204  C  CB    . ILE B  2  207 ? -26.386 47.556  21.750  1.00 64.32  ? 207  ILE B CB    1 
ATOM   4205  C  CG1   . ILE B  2  207 ? -27.263 46.314  21.602  1.00 63.29  ? 207  ILE B CG1   1 
ATOM   4206  C  CG2   . ILE B  2  207 ? -27.017 48.808  21.197  1.00 61.97  ? 207  ILE B CG2   1 
ATOM   4207  C  CD1   . ILE B  2  207 ? -28.571 46.413  22.299  1.00 64.55  ? 207  ILE B CD1   1 
ATOM   4208  N  N     . VAL B  2  208 ? -23.806 49.082  22.161  1.00 62.04  ? 208  VAL B N     1 
ATOM   4209  C  CA    . VAL B  2  208 ? -23.012 50.292  22.221  1.00 62.36  ? 208  VAL B CA    1 
ATOM   4210  C  C     . VAL B  2  208 ? -21.777 50.076  21.387  1.00 62.67  ? 208  VAL B C     1 
ATOM   4211  O  O     . VAL B  2  208 ? -21.126 51.025  20.971  1.00 63.64  ? 208  VAL B O     1 
ATOM   4212  C  CB    . VAL B  2  208 ? -22.562 50.612  23.644  1.00 61.31  ? 208  VAL B CB    1 
ATOM   4213  C  CG1   . VAL B  2  208 ? -21.584 51.752  23.627  1.00 61.16  ? 208  VAL B CG1   1 
ATOM   4214  C  CG2   . VAL B  2  208 ? -23.746 50.956  24.491  1.00 61.67  ? 208  VAL B CG2   1 
ATOM   4215  N  N     . GLY B  2  209 ? -21.439 48.824  21.140  1.00 62.27  ? 209  GLY B N     1 
ATOM   4216  C  CA    . GLY B  2  209 ? -20.254 48.555  20.346  1.00 62.20  ? 209  GLY B CA    1 
ATOM   4217  C  C     . GLY B  2  209 ? -20.566 48.508  18.869  1.00 61.63  ? 209  GLY B C     1 
ATOM   4218  O  O     . GLY B  2  209 ? -19.694 48.770  18.036  1.00 61.51  ? 209  GLY B O     1 
ATOM   4219  N  N     . ILE B  2  210 ? -21.812 48.143  18.555  1.00 62.04  ? 210  ILE B N     1 
ATOM   4220  C  CA    . ILE B  2  210 ? -22.287 48.064  17.173  1.00 60.43  ? 210  ILE B CA    1 
ATOM   4221  C  C     . ILE B  2  210 ? -22.482 49.480  16.646  1.00 59.58  ? 210  ILE B C     1 
ATOM   4222  O  O     . ILE B  2  210 ? -22.024 49.825  15.554  1.00 57.70  ? 210  ILE B O     1 
ATOM   4223  C  CB    . ILE B  2  210 ? -23.636 47.321  17.069  1.00 61.11  ? 210  ILE B CB    1 
ATOM   4224  C  CG1   . ILE B  2  210 ? -23.462 45.849  17.465  1.00 62.94  ? 210  ILE B CG1   1 
ATOM   4225  C  CG2   . ILE B  2  210 ? -24.155 47.404  15.642  1.00 60.02  ? 210  ILE B CG2   1 
ATOM   4226  C  CD1   . ILE B  2  210 ? -24.660 44.936  17.116  1.00 64.71  ? 210  ILE B CD1   1 
ATOM   4227  N  N     . ILE B  2  211 ? -23.168 50.290  17.441  1.00 57.88  ? 211  ILE B N     1 
ATOM   4228  C  CA    . ILE B  2  211 ? -23.426 51.667  17.083  1.00 57.62  ? 211  ILE B CA    1 
ATOM   4229  C  C     . ILE B  2  211 ? -22.111 52.369  16.777  1.00 58.72  ? 211  ILE B C     1 
ATOM   4230  O  O     . ILE B  2  211 ? -21.915 52.880  15.674  1.00 58.58  ? 211  ILE B O     1 
ATOM   4231  C  CB    . ILE B  2  211 ? -24.128 52.398  18.241  1.00 56.96  ? 211  ILE B CB    1 
ATOM   4232  C  CG1   . ILE B  2  211 ? -25.591 51.983  18.315  1.00 54.50  ? 211  ILE B CG1   1 
ATOM   4233  C  CG2   . ILE B  2  211 ? -23.979 53.894  18.082  1.00 57.22  ? 211  ILE B CG2   1 
ATOM   4234  C  CD1   . ILE B  2  211 ? -26.254 52.416  19.589  1.00 50.83  ? 211  ILE B CD1   1 
ATOM   4235  N  N     . ALA B  2  212 ? -21.215 52.375  17.763  1.00 58.65  ? 212  ALA B N     1 
ATOM   4236  C  CA    . ALA B  2  212 ? -19.924 53.029  17.654  1.00 58.62  ? 212  ALA B CA    1 
ATOM   4237  C  C     . ALA B  2  212 ? -19.126 52.618  16.441  1.00 59.67  ? 212  ALA B C     1 
ATOM   4238  O  O     . ALA B  2  212 ? -18.363 53.406  15.888  1.00 58.58  ? 212  ALA B O     1 
ATOM   4239  C  CB    . ALA B  2  212 ? -19.132 52.775  18.890  1.00 58.67  ? 212  ALA B CB    1 
ATOM   4240  N  N     . GLY B  2  213 ? -19.296 51.375  16.030  1.00 61.81  ? 213  GLY B N     1 
ATOM   4241  C  CA    . GLY B  2  213 ? -18.583 50.883  14.862  1.00 64.96  ? 213  GLY B CA    1 
ATOM   4242  C  C     . GLY B  2  213 ? -18.995 51.621  13.596  1.00 66.56  ? 213  GLY B C     1 
ATOM   4243  O  O     . GLY B  2  213 ? -18.158 52.198  12.906  1.00 67.19  ? 213  GLY B O     1 
ATOM   4244  N  N     . LEU B  2  214 ? -20.288 51.586  13.292  1.00 67.56  ? 214  LEU B N     1 
ATOM   4245  C  CA    . LEU B  2  214 ? -20.832 52.257  12.122  1.00 67.13  ? 214  LEU B CA    1 
ATOM   4246  C  C     . LEU B  2  214 ? -20.310 53.686  12.091  1.00 67.97  ? 214  LEU B C     1 
ATOM   4247  O  O     . LEU B  2  214 ? -19.828 54.150  11.054  1.00 66.72  ? 214  LEU B O     1 
ATOM   4248  C  CB    . LEU B  2  214 ? -22.353 52.286  12.202  1.00 67.26  ? 214  LEU B CB    1 
ATOM   4249  C  CG    . LEU B  2  214 ? -23.057 50.942  12.294  1.00 65.69  ? 214  LEU B CG    1 
ATOM   4250  C  CD1   . LEU B  2  214 ? -24.528 51.176  12.603  1.00 65.59  ? 214  LEU B CD1   1 
ATOM   4251  C  CD2   . LEU B  2  214 ? -22.865 50.184  10.996  1.00 64.83  ? 214  LEU B CD2   1 
ATOM   4252  N  N     . PHE B  2  215 ? -20.426 54.374  13.230  1.00 68.68  ? 215  PHE B N     1 
ATOM   4253  C  CA    . PHE B  2  215 ? -19.958 55.745  13.349  1.00 70.39  ? 215  PHE B CA    1 
ATOM   4254  C  C     . PHE B  2  215 ? -18.568 55.856  12.721  1.00 71.79  ? 215  PHE B C     1 
ATOM   4255  O  O     . PHE B  2  215 ? -18.390 56.547  11.717  1.00 72.00  ? 215  PHE B O     1 
ATOM   4256  C  CB    . PHE B  2  215 ? -19.901 56.167  14.819  1.00 71.26  ? 215  PHE B CB    1 
ATOM   4257  C  CG    . PHE B  2  215 ? -19.294 57.541  15.043  1.00 73.81  ? 215  PHE B CG    1 
ATOM   4258  C  CD1   . PHE B  2  215 ? -20.081 58.592  15.511  1.00 75.58  ? 215  PHE B CD1   1 
ATOM   4259  C  CD2   . PHE B  2  215 ? -17.940 57.795  14.767  1.00 74.43  ? 215  PHE B CD2   1 
ATOM   4260  C  CE1   . PHE B  2  215 ? -19.528 59.888  15.699  1.00 76.39  ? 215  PHE B CE1   1 
ATOM   4261  C  CE2   . PHE B  2  215 ? -17.380 59.080  14.952  1.00 75.98  ? 215  PHE B CE2   1 
ATOM   4262  C  CZ    . PHE B  2  215 ? -18.175 60.128  15.417  1.00 75.72  ? 215  PHE B CZ    1 
ATOM   4263  N  N     . HIS B  2  216 ? -17.585 55.172  13.302  1.00 72.53  ? 216  HIS B N     1 
ATOM   4264  C  CA    . HIS B  2  216 ? -16.223 55.233  12.781  1.00 73.27  ? 216  HIS B CA    1 
ATOM   4265  C  C     . HIS B  2  216 ? -16.147 54.709  11.355  1.00 73.80  ? 216  HIS B C     1 
ATOM   4266  O  O     . HIS B  2  216 ? -15.231 55.046  10.601  1.00 75.18  ? 216  HIS B O     1 
ATOM   4267  C  CB    . HIS B  2  216 ? -15.263 54.451  13.684  1.00 74.59  ? 216  HIS B CB    1 
ATOM   4268  C  CG    . HIS B  2  216 ? -14.980 55.121  15.000  1.00 75.72  ? 216  HIS B CG    1 
ATOM   4269  N  ND1   . HIS B  2  216 ? -15.811 55.004  16.096  1.00 76.03  ? 216  HIS B ND1   1 
ATOM   4270  C  CD2   . HIS B  2  216 ? -13.967 55.933  15.387  1.00 75.64  ? 216  HIS B CD2   1 
ATOM   4271  C  CE1   . HIS B  2  216 ? -15.322 55.714  17.098  1.00 75.65  ? 216  HIS B CE1   1 
ATOM   4272  N  NE2   . HIS B  2  216 ? -14.203 56.286  16.694  1.00 75.90  ? 216  HIS B NE2   1 
ATOM   4273  N  N     . ILE B  2  217 ? -17.111 53.883  10.981  1.00 73.39  ? 217  ILE B N     1 
ATOM   4274  C  CA    . ILE B  2  217 ? -17.144 53.348  9.632   1.00 72.00  ? 217  ILE B CA    1 
ATOM   4275  C  C     . ILE B  2  217 ? -17.538 54.488  8.701   1.00 71.72  ? 217  ILE B C     1 
ATOM   4276  O  O     . ILE B  2  217 ? -17.104 54.545  7.547   1.00 71.84  ? 217  ILE B O     1 
ATOM   4277  C  CB    . ILE B  2  217 ? -18.180 52.208  9.521   1.00 72.38  ? 217  ILE B CB    1 
ATOM   4278  C  CG1   . ILE B  2  217 ? -17.550 50.898  10.008  1.00 72.90  ? 217  ILE B CG1   1 
ATOM   4279  C  CG2   . ILE B  2  217 ? -18.688 52.093  8.088   1.00 71.78  ? 217  ILE B CG2   1 
ATOM   4280  C  CD1   . ILE B  2  217 ? -18.412 49.665  9.779   1.00 74.26  ? 217  ILE B CD1   1 
ATOM   4281  N  N     . LEU B  2  218 ? -18.339 55.409  9.234   1.00 70.23  ? 218  LEU B N     1 
ATOM   4282  C  CA    . LEU B  2  218 ? -18.845 56.535  8.466   1.00 68.70  ? 218  LEU B CA    1 
ATOM   4283  C  C     . LEU B  2  218 ? -18.150 57.880  8.696   1.00 68.11  ? 218  LEU B C     1 
ATOM   4284  O  O     . LEU B  2  218 ? -17.667 58.501  7.748   1.00 69.56  ? 218  LEU B O     1 
ATOM   4285  C  CB    . LEU B  2  218 ? -20.353 56.676  8.717   1.00 67.82  ? 218  LEU B CB    1 
ATOM   4286  C  CG    . LEU B  2  218 ? -21.191 55.381  8.663   1.00 67.17  ? 218  LEU B CG    1 
ATOM   4287  C  CD1   . LEU B  2  218 ? -22.658 55.696  8.943   1.00 66.05  ? 218  LEU B CD1   1 
ATOM   4288  C  CD2   . LEU B  2  218 ? -21.054 54.720  7.315   1.00 65.24  ? 218  LEU B CD2   1 
ATOM   4289  N  N     . VAL B  2  219 ? -18.095 58.340  9.936   1.00 66.79  ? 219  VAL B N     1 
ATOM   4290  C  CA    . VAL B  2  219 ? -17.464 59.629  10.227  1.00 64.77  ? 219  VAL B CA    1 
ATOM   4291  C  C     . VAL B  2  219 ? -15.922 59.607  10.193  1.00 65.88  ? 219  VAL B C     1 
ATOM   4292  O  O     . VAL B  2  219 ? -15.292 58.732  10.768  1.00 67.81  ? 219  VAL B O     1 
ATOM   4293  C  CB    . VAL B  2  219 ? -17.925 60.151  11.604  1.00 62.33  ? 219  VAL B CB    1 
ATOM   4294  C  CG1   . VAL B  2  219 ? -17.241 61.465  11.937  1.00 60.47  ? 219  VAL B CG1   1 
ATOM   4295  C  CG2   . VAL B  2  219 ? -19.429 60.305  11.610  1.00 60.33  ? 219  VAL B CG2   1 
ATOM   4296  N  N     . ARG B  2  220 ? -15.320 60.571  9.513   1.00 65.61  ? 220  ARG B N     1 
ATOM   4297  C  CA    . ARG B  2  220 ? -13.869 60.678  9.440   1.00 64.94  ? 220  ARG B CA    1 
ATOM   4298  C  C     . ARG B  2  220 ? -13.336 61.418  10.655  1.00 65.75  ? 220  ARG B C     1 
ATOM   4299  O  O     . ARG B  2  220 ? -14.049 62.203  11.302  1.00 62.56  ? 220  ARG B O     1 
ATOM   4300  C  CB    . ARG B  2  220 ? -13.448 61.436  8.203   1.00 65.23  ? 220  ARG B CB    1 
ATOM   4301  C  CG    . ARG B  2  220 ? -13.380 60.598  6.985   1.00 67.48  ? 220  ARG B CG    1 
ATOM   4302  C  CD    . ARG B  2  220 ? -12.137 59.766  7.038   1.00 68.89  ? 220  ARG B CD    1 
ATOM   4303  N  NE    . ARG B  2  220 ? -12.373 58.441  6.487   1.00 71.57  ? 220  ARG B NE    1 
ATOM   4304  C  CZ    . ARG B  2  220 ? -11.410 57.584  6.171   1.00 72.50  ? 220  ARG B CZ    1 
ATOM   4305  N  NH1   . ARG B  2  220 ? -10.135 57.918  6.349   1.00 72.86  ? 220  ARG B NH1   1 
ATOM   4306  N  NH2   . ARG B  2  220 ? -11.727 56.395  5.682   1.00 72.07  ? 220  ARG B NH2   1 
ATOM   4307  N  N     . PRO B  2  221 ? -12.047 61.194  10.961  1.00 67.77  ? 221  PRO B N     1 
ATOM   4308  C  CA    . PRO B  2  221 ? -11.343 61.799  12.091  1.00 68.49  ? 221  PRO B CA    1 
ATOM   4309  C  C     . PRO B  2  221 ? -11.035 63.296  11.957  1.00 68.86  ? 221  PRO B C     1 
ATOM   4310  O  O     . PRO B  2  221 ? -10.373 63.726  11.012  1.00 69.28  ? 221  PRO B O     1 
ATOM   4311  C  CB    . PRO B  2  221 ? -10.070 60.956  12.187  1.00 68.63  ? 221  PRO B CB    1 
ATOM   4312  C  CG    . PRO B  2  221 ? -9.769  60.662  10.765  1.00 68.16  ? 221  PRO B CG    1 
ATOM   4313  C  CD    . PRO B  2  221 ? -11.143 60.280  10.230  1.00 69.19  ? 221  PRO B CD    1 
ATOM   4314  N  N     . PRO B  2  222 ? -11.533 64.111  12.902  1.00 68.92  ? 222  PRO B N     1 
ATOM   4315  C  CA    . PRO B  2  222 ? -11.252 65.544  12.819  1.00 69.31  ? 222  PRO B CA    1 
ATOM   4316  C  C     . PRO B  2  222 ? -9.794  65.790  12.412  1.00 68.77  ? 222  PRO B C     1 
ATOM   4317  O  O     . PRO B  2  222 ? -8.860  65.196  12.949  1.00 67.61  ? 222  PRO B O     1 
ATOM   4318  C  CB    . PRO B  2  222 ? -11.578 66.028  14.230  1.00 69.43  ? 222  PRO B CB    1 
ATOM   4319  C  CG    . PRO B  2  222 ? -12.812 65.209  14.552  1.00 68.83  ? 222  PRO B CG    1 
ATOM   4320  C  CD    . PRO B  2  222 ? -12.479 63.824  14.002  1.00 69.39  ? 222  PRO B CD    1 
ATOM   4321  N  N     . GLN B  2  223 ? -9.633  66.645  11.422  1.00 69.24  ? 223  GLN B N     1 
ATOM   4322  C  CA    . GLN B  2  223 ? -8.328  67.010  10.896  1.00 69.75  ? 223  GLN B CA    1 
ATOM   4323  C  C     . GLN B  2  223 ? -7.328  67.083  12.052  1.00 69.15  ? 223  GLN B C     1 
ATOM   4324  O  O     . GLN B  2  223 ? -6.295  66.404  12.036  1.00 68.72  ? 223  GLN B O     1 
ATOM   4325  C  CB    . GLN B  2  223 ? -8.460  68.370  10.175  1.00 70.48  ? 223  GLN B CB    1 
ATOM   4326  C  CG    . GLN B  2  223 ? -7.313  68.751  9.257   1.00 70.34  ? 223  GLN B CG    1 
ATOM   4327  C  CD    . GLN B  2  223 ? -6.044  69.108  10.016  1.00 70.88  ? 223  GLN B CD    1 
ATOM   4328  O  OE1   . GLN B  2  223 ? -6.038  70.022  10.855  1.00 70.47  ? 223  GLN B OE1   1 
ATOM   4329  N  NE2   . GLN B  2  223 ? -4.958  68.392  9.721   1.00 70.59  ? 223  GLN B NE2   1 
ATOM   4330  N  N     . ARG B  2  224 ? -7.668  67.895  13.057  1.00 68.11  ? 224  ARG B N     1 
ATOM   4331  C  CA    . ARG B  2  224 ? -6.843  68.106  14.241  1.00 66.77  ? 224  ARG B CA    1 
ATOM   4332  C  C     . ARG B  2  224 ? -6.355  66.799  14.878  1.00 66.33  ? 224  ARG B C     1 
ATOM   4333  O  O     . ARG B  2  224 ? -5.152  66.630  15.104  1.00 67.21  ? 224  ARG B O     1 
ATOM   4334  C  CB    . ARG B  2  224 ? -7.611  68.949  15.271  1.00 64.92  ? 224  ARG B CB    1 
ATOM   4335  N  N     . LEU B  2  225 ? -7.276  65.878  15.154  1.00 65.01  ? 225  LEU B N     1 
ATOM   4336  C  CA    . LEU B  2  225 ? -6.914  64.599  15.782  1.00 64.02  ? 225  LEU B CA    1 
ATOM   4337  C  C     . LEU B  2  225 ? -6.039  63.687  14.904  1.00 63.99  ? 225  LEU B C     1 
ATOM   4338  O  O     . LEU B  2  225 ? -5.054  63.122  15.390  1.00 63.53  ? 225  LEU B O     1 
ATOM   4339  C  CB    . LEU B  2  225 ? -8.177  63.848  16.229  1.00 60.97  ? 225  LEU B CB    1 
ATOM   4340  C  CG    . LEU B  2  225 ? -8.985  64.489  17.357  1.00 58.77  ? 225  LEU B CG    1 
ATOM   4341  C  CD1   . LEU B  2  225 ? -10.223 63.680  17.631  1.00 57.21  ? 225  LEU B CD1   1 
ATOM   4342  C  CD2   . LEU B  2  225 ? -8.135  64.603  18.598  1.00 56.99  ? 225  LEU B CD2   1 
ATOM   4343  N  N     . TYR B  2  226 ? -6.389  63.538  13.625  1.00 63.63  ? 226  TYR B N     1 
ATOM   4344  C  CA    . TYR B  2  226 ? -5.598  62.696  12.719  1.00 62.81  ? 226  TYR B CA    1 
ATOM   4345  C  C     . TYR B  2  226 ? -4.145  63.142  12.746  1.00 63.68  ? 226  TYR B C     1 
ATOM   4346  O  O     . TYR B  2  226 ? -3.228  62.346  12.559  1.00 63.26  ? 226  TYR B O     1 
ATOM   4347  C  CB    . TYR B  2  226 ? -6.132  62.796  11.295  1.00 60.04  ? 226  TYR B CB    1 
ATOM   4348  C  CG    . TYR B  2  226 ? -5.490  61.844  10.304  1.00 56.38  ? 226  TYR B CG    1 
ATOM   4349  C  CD1   . TYR B  2  226 ? -6.224  60.801  9.749   1.00 55.20  ? 226  TYR B CD1   1 
ATOM   4350  C  CD2   . TYR B  2  226 ? -4.171  62.013  9.878   1.00 54.78  ? 226  TYR B CD2   1 
ATOM   4351  C  CE1   . TYR B  2  226 ? -5.675  59.963  8.795   1.00 52.88  ? 226  TYR B CE1   1 
ATOM   4352  C  CE2   . TYR B  2  226 ? -3.616  61.173  8.923   1.00 52.34  ? 226  TYR B CE2   1 
ATOM   4353  C  CZ    . TYR B  2  226 ? -4.381  60.154  8.385   1.00 51.41  ? 226  TYR B CZ    1 
ATOM   4354  O  OH    . TYR B  2  226 ? -3.883  59.347  7.400   1.00 50.18  ? 226  TYR B OH    1 
ATOM   4355  N  N     . LYS B  2  227 ? -3.940  64.430  12.969  1.00 65.21  ? 227  LYS B N     1 
ATOM   4356  C  CA    . LYS B  2  227 ? -2.588  64.957  13.032  1.00 67.06  ? 227  LYS B CA    1 
ATOM   4357  C  C     . LYS B  2  227 ? -2.031  64.591  14.395  1.00 66.56  ? 227  LYS B C     1 
ATOM   4358  O  O     . LYS B  2  227 ? -0.995  63.944  14.505  1.00 65.32  ? 227  LYS B O     1 
ATOM   4359  C  CB    . LYS B  2  227 ? -2.584  66.490  12.832  1.00 68.44  ? 227  LYS B CB    1 
ATOM   4360  C  CG    . LYS B  2  227 ? -2.990  66.935  11.409  1.00 71.53  ? 227  LYS B CG    1 
ATOM   4361  C  CD    . LYS B  2  227 ? -2.323  68.254  10.977  1.00 72.84  ? 227  LYS B CD    1 
ATOM   4362  C  CE    . LYS B  2  227 ? -2.685  69.397  11.922  1.00 74.13  ? 227  LYS B CE    1 
ATOM   4363  N  NZ    . LYS B  2  227 ? -2.041  70.699  11.583  1.00 72.39  ? 227  LYS B NZ    1 
ATOM   4364  N  N     . ALA B  2  228 ? -2.760  65.001  15.425  1.00 66.96  ? 228  ALA B N     1 
ATOM   4365  C  CA    . ALA B  2  228 ? -2.388  64.763  16.814  1.00 68.46  ? 228  ALA B CA    1 
ATOM   4366  C  C     . ALA B  2  228 ? -1.854  63.352  17.032  1.00 69.82  ? 228  ALA B C     1 
ATOM   4367  O  O     . ALA B  2  228 ? -0.643  63.145  17.132  1.00 70.41  ? 228  ALA B O     1 
ATOM   4368  C  CB    . ALA B  2  228 ? -3.585  65.011  17.708  1.00 68.51  ? 228  ALA B CB    1 
ATOM   4369  N  N     . LEU B  2  229 ? -2.770  62.390  17.108  1.00 70.38  ? 229  LEU B N     1 
ATOM   4370  C  CA    . LEU B  2  229 ? -2.430  60.988  17.303  1.00 69.52  ? 229  LEU B CA    1 
ATOM   4371  C  C     . LEU B  2  229 ? -1.892  60.389  15.998  1.00 69.35  ? 229  LEU B C     1 
ATOM   4372  O  O     . LEU B  2  229 ? -2.414  59.392  15.527  1.00 69.23  ? 229  LEU B O     1 
ATOM   4373  C  CB    . LEU B  2  229 ? -3.681  60.228  17.735  1.00 68.48  ? 229  LEU B CB    1 
ATOM   4374  C  CG    . LEU B  2  229 ? -4.474  60.891  18.859  1.00 67.72  ? 229  LEU B CG    1 
ATOM   4375  C  CD1   . LEU B  2  229 ? -5.793  60.203  19.063  1.00 67.10  ? 229  LEU B CD1   1 
ATOM   4376  C  CD2   . LEU B  2  229 ? -3.674  60.835  20.125  1.00 67.97  ? 229  LEU B CD2   1 
ATOM   4377  N  N     . ARG B  2  230 ? -0.863  61.000  15.426  1.00 68.50  ? 230  ARG B N     1 
ATOM   4378  C  CA    . ARG B  2  230 ? -0.274  60.517  14.188  1.00 69.16  ? 230  ARG B CA    1 
ATOM   4379  C  C     . ARG B  2  230 ? -1.000  59.316  13.540  1.00 69.40  ? 230  ARG B C     1 
ATOM   4380  O  O     . ARG B  2  230 ? -0.386  58.255  13.359  1.00 69.66  ? 230  ARG B O     1 
ATOM   4381  C  CB    . ARG B  2  230 ? 1.180   60.116  14.423  1.00 69.65  ? 230  ARG B CB    1 
ATOM   4382  C  CG    . ARG B  2  230 ? 1.976   61.063  15.300  1.00 72.91  ? 230  ARG B CG    1 
ATOM   4383  C  CD    . ARG B  2  230 ? 2.290   62.403  14.630  1.00 74.71  ? 230  ARG B CD    1 
ATOM   4384  N  NE    . ARG B  2  230 ? 3.225   63.231  15.412  1.00 77.86  ? 230  ARG B NE    1 
ATOM   4385  C  CZ    . ARG B  2  230 ? 2.969   63.779  16.614  1.00 79.74  ? 230  ARG B CZ    1 
ATOM   4386  N  NH1   . ARG B  2  230 ? 1.784   63.603  17.204  1.00 81.18  ? 230  ARG B NH1   1 
ATOM   4387  N  NH2   . ARG B  2  230 ? 3.907   64.497  17.253  1.00 79.02  ? 230  ARG B NH2   1 
ATOM   4388  N  N     . MET B  2  231 ? -2.282  59.463  13.185  1.00 68.42  ? 231  MET B N     1 
ATOM   4389  C  CA    . MET B  2  231 ? -3.010  58.369  12.532  1.00 66.86  ? 231  MET B CA    1 
ATOM   4390  C  C     . MET B  2  231 ? -2.244  58.016  11.282  1.00 66.48  ? 231  MET B C     1 
ATOM   4391  O  O     . MET B  2  231 ? -1.179  58.569  11.048  1.00 67.42  ? 231  MET B O     1 
ATOM   4392  C  CB    . MET B  2  231 ? -4.412  58.782  12.114  1.00 66.72  ? 231  MET B CB    1 
ATOM   4393  C  CG    . MET B  2  231 ? -5.491  58.328  13.040  1.00 66.62  ? 231  MET B CG    1 
ATOM   4394  S  SD    . MET B  2  231 ? -5.963  59.529  14.287  1.00 70.00  ? 231  MET B SD    1 
ATOM   4395  C  CE    . MET B  2  231 ? -7.740  59.641  14.010  1.00 66.24  ? 231  MET B CE    1 
ATOM   4396  N  N     . GLY B  2  232 ? -2.769  57.122  10.455  1.00 66.23  ? 232  GLY B N     1 
ATOM   4397  C  CA    . GLY B  2  232 ? -2.032  56.777  9.250   1.00 66.96  ? 232  GLY B CA    1 
ATOM   4398  C  C     . GLY B  2  232 ? -0.683  56.109  9.510   1.00 66.93  ? 232  GLY B C     1 
ATOM   4399  O  O     . GLY B  2  232 ? -0.088  55.515  8.608   1.00 67.14  ? 232  GLY B O     1 
ATOM   4400  N  N     . ASN B  2  233 ? -0.179  56.236  10.732  1.00 66.87  ? 233  ASN B N     1 
ATOM   4401  C  CA    . ASN B  2  233 ? 1.065   55.566  11.123  1.00 66.70  ? 233  ASN B CA    1 
ATOM   4402  C  C     . ASN B  2  233 ? 0.598   54.357  11.923  1.00 66.73  ? 233  ASN B C     1 
ATOM   4403  O  O     . ASN B  2  233 ? 0.175   54.506  13.079  1.00 66.56  ? 233  ASN B O     1 
ATOM   4404  C  CB    . ASN B  2  233 ? 1.920   56.436  12.039  1.00 67.04  ? 233  ASN B CB    1 
ATOM   4405  C  CG    . ASN B  2  233 ? 3.091   55.670  12.614  1.00 66.28  ? 233  ASN B CG    1 
ATOM   4406  O  OD1   . ASN B  2  233 ? 3.865   56.201  13.397  1.00 65.99  ? 233  ASN B OD1   1 
ATOM   4407  N  ND2   . ASN B  2  233 ? 3.225   54.402  12.215  1.00 66.52  ? 233  ASN B ND2   1 
ATOM   4408  N  N     . ILE B  2  234 ? 0.677   53.167  11.333  1.00 65.71  ? 234  ILE B N     1 
ATOM   4409  C  CA    . ILE B  2  234 ? 0.191   51.994  12.033  1.00 64.28  ? 234  ILE B CA    1 
ATOM   4410  C  C     . ILE B  2  234 ? 0.738   51.886  13.449  1.00 64.95  ? 234  ILE B C     1 
ATOM   4411  O  O     . ILE B  2  234 ? 0.024   51.460  14.349  1.00 65.74  ? 234  ILE B O     1 
ATOM   4412  C  CB    . ILE B  2  234 ? 0.501   50.712  11.265  1.00 62.59  ? 234  ILE B CB    1 
ATOM   4413  C  CG1   . ILE B  2  234 ? -0.398  49.583  11.760  1.00 61.88  ? 234  ILE B CG1   1 
ATOM   4414  C  CG2   . ILE B  2  234 ? 1.948   50.363  11.420  1.00 62.40  ? 234  ILE B CG2   1 
ATOM   4415  C  CD1   . ILE B  2  234 ? -0.357  48.379  10.896  1.00 61.61  ? 234  ILE B CD1   1 
ATOM   4416  N  N     . GLU B  2  235 ? 1.978   52.313  13.662  1.00 64.78  ? 235  GLU B N     1 
ATOM   4417  C  CA    . GLU B  2  235 ? 2.576   52.224  14.999  1.00 64.18  ? 235  GLU B CA    1 
ATOM   4418  C  C     . GLU B  2  235 ? 1.949   53.097  16.078  1.00 64.69  ? 235  GLU B C     1 
ATOM   4419  O  O     . GLU B  2  235 ? 2.497   53.213  17.162  1.00 65.58  ? 235  GLU B O     1 
ATOM   4420  C  CB    . GLU B  2  235 ? 4.069   52.524  14.935  1.00 63.20  ? 235  GLU B CB    1 
ATOM   4421  C  CG    . GLU B  2  235 ? 4.839   51.972  16.117  1.00 62.38  ? 235  GLU B CG    1 
ATOM   4422  C  CD    . GLU B  2  235 ? 6.294   52.373  16.099  1.00 62.61  ? 235  GLU B CD    1 
ATOM   4423  O  OE1   . GLU B  2  235 ? 6.900   52.274  15.013  1.00 63.41  ? 235  GLU B OE1   1 
ATOM   4424  O  OE2   . GLU B  2  235 ? 6.825   52.774  17.159  1.00 59.53  ? 235  GLU B OE2   1 
ATOM   4425  N  N     . THR B  2  236 ? 0.815   53.722  15.798  1.00 65.92  ? 236  THR B N     1 
ATOM   4426  C  CA    . THR B  2  236 ? 0.165   54.544  16.816  1.00 66.65  ? 236  THR B CA    1 
ATOM   4427  C  C     . THR B  2  236 ? -1.020  53.713  17.296  1.00 67.85  ? 236  THR B C     1 
ATOM   4428  O  O     . THR B  2  236 ? -1.655  54.004  18.309  1.00 67.96  ? 236  THR B O     1 
ATOM   4429  C  CB    . THR B  2  236 ? -0.363  55.841  16.244  1.00 65.94  ? 236  THR B CB    1 
ATOM   4430  O  OG1   . THR B  2  236 ? -0.564  56.781  17.302  1.00 63.80  ? 236  THR B OG1   1 
ATOM   4431  C  CG2   . THR B  2  236 ? -1.701  55.586  15.533  1.00 66.69  ? 236  THR B CG2   1 
ATOM   4432  N  N     . VAL B  2  237 ? -1.328  52.690  16.521  1.00 69.27  ? 237  VAL B N     1 
ATOM   4433  C  CA    . VAL B  2  237 ? -2.407  51.794  16.870  1.00 71.16  ? 237  VAL B CA    1 
ATOM   4434  C  C     . VAL B  2  237 ? -1.806  50.812  17.879  1.00 72.97  ? 237  VAL B C     1 
ATOM   4435  O  O     . VAL B  2  237 ? -2.466  50.410  18.852  1.00 74.76  ? 237  VAL B O     1 
ATOM   4436  C  CB    . VAL B  2  237 ? -2.923  51.000  15.623  1.00 70.58  ? 237  VAL B CB    1 
ATOM   4437  C  CG1   . VAL B  2  237 ? -3.942  49.950  16.029  1.00 68.82  ? 237  VAL B CG1   1 
ATOM   4438  C  CG2   . VAL B  2  237 ? -3.530  51.955  14.629  1.00 70.13  ? 237  VAL B CG2   1 
ATOM   4439  N  N     . LEU B  2  238 ? -0.547  50.443  17.654  1.00 73.12  ? 238  LEU B N     1 
ATOM   4440  C  CA    . LEU B  2  238 ? 0.109   49.498  18.528  1.00 72.82  ? 238  LEU B CA    1 
ATOM   4441  C  C     . LEU B  2  238 ? 0.170   50.009  19.954  1.00 73.49  ? 238  LEU B C     1 
ATOM   4442  O  O     . LEU B  2  238 ? -0.097  49.243  20.884  1.00 74.09  ? 238  LEU B O     1 
ATOM   4443  C  CB    . LEU B  2  238 ? 1.518   49.220  18.031  1.00 71.52  ? 238  LEU B CB    1 
ATOM   4444  C  CG    . LEU B  2  238 ? 2.257   48.145  18.823  1.00 70.82  ? 238  LEU B CG    1 
ATOM   4445  C  CD1   . LEU B  2  238 ? 1.660   46.804  18.487  1.00 71.01  ? 238  LEU B CD1   1 
ATOM   4446  C  CD2   . LEU B  2  238 ? 3.726   48.160  18.476  1.00 70.25  ? 238  LEU B CD2   1 
ATOM   4447  N  N     . SER B  2  239 ? 0.513   51.293  20.123  1.00 73.45  ? 239  SER B N     1 
ATOM   4448  C  CA    . SER B  2  239 ? 0.642   51.914  21.451  1.00 73.37  ? 239  SER B CA    1 
ATOM   4449  C  C     . SER B  2  239 ? -0.702  52.069  22.132  1.00 73.03  ? 239  SER B C     1 
ATOM   4450  O  O     . SER B  2  239 ? -0.806  52.021  23.355  1.00 72.65  ? 239  SER B O     1 
ATOM   4451  C  CB    . SER B  2  239 ? 1.287   53.301  21.344  1.00 74.70  ? 239  SER B CB    1 
ATOM   4452  O  OG    . SER B  2  239 ? 2.442   53.285  20.518  1.00 75.81  ? 239  SER B OG    1 
ATOM   4453  N  N     . SER B  2  240 ? -1.724  52.281  21.321  1.00 72.73  ? 240  SER B N     1 
ATOM   4454  C  CA    . SER B  2  240 ? -3.071  52.446  21.823  1.00 72.44  ? 240  SER B CA    1 
ATOM   4455  C  C     . SER B  2  240 ? -3.625  51.090  22.313  1.00 71.60  ? 240  SER B C     1 
ATOM   4456  O  O     . SER B  2  240 ? -4.287  51.022  23.367  1.00 71.03  ? 240  SER B O     1 
ATOM   4457  C  CB    . SER B  2  240 ? -3.952  53.021  20.716  1.00 73.49  ? 240  SER B CB    1 
ATOM   4458  O  OG    . SER B  2  240 ? -4.064  52.112  19.626  1.00 74.63  ? 240  SER B OG    1 
ATOM   4459  N  N     . SER B  2  241 ? -3.353  50.020  21.563  1.00 69.12  ? 241  SER B N     1 
ATOM   4460  C  CA    . SER B  2  241 ? -3.837  48.696  21.955  1.00 66.86  ? 241  SER B CA    1 
ATOM   4461  C  C     . SER B  2  241 ? -3.079  48.192  23.178  1.00 66.10  ? 241  SER B C     1 
ATOM   4462  O  O     . SER B  2  241 ? -3.694  47.785  24.171  1.00 66.23  ? 241  SER B O     1 
ATOM   4463  C  CB    . SER B  2  241 ? -3.696  47.715  20.804  1.00 66.15  ? 241  SER B CB    1 
ATOM   4464  O  OG    . SER B  2  241 ? -4.498  48.133  19.720  1.00 66.67  ? 241  SER B OG    1 
ATOM   4465  N  N     . ILE B  2  242 ? -1.750  48.221  23.103  1.00 63.35  ? 242  ILE B N     1 
ATOM   4466  C  CA    . ILE B  2  242 ? -0.912  47.803  24.213  1.00 59.15  ? 242  ILE B CA    1 
ATOM   4467  C  C     . ILE B  2  242 ? -1.351  48.512  25.492  1.00 59.29  ? 242  ILE B C     1 
ATOM   4468  O  O     . ILE B  2  242 ? -1.150  47.993  26.580  1.00 60.96  ? 242  ILE B O     1 
ATOM   4469  C  CB    . ILE B  2  242 ? 0.562   48.142  23.954  1.00 58.73  ? 242  ILE B CB    1 
ATOM   4470  C  CG1   . ILE B  2  242 ? 1.180   47.096  23.029  1.00 59.70  ? 242  ILE B CG1   1 
ATOM   4471  C  CG2   . ILE B  2  242 ? 1.314   48.249  25.265  1.00 57.04  ? 242  ILE B CG2   1 
ATOM   4472  C  CD1   . ILE B  2  242 ? 2.694   47.229  22.849  1.00 60.14  ? 242  ILE B CD1   1 
ATOM   4473  N  N     . ALA B  2  243 ? -1.945  49.694  25.369  1.00 55.92  ? 243  ALA B N     1 
ATOM   4474  C  CA    . ALA B  2  243 ? -2.390  50.426  26.547  1.00 53.10  ? 243  ALA B CA    1 
ATOM   4475  C  C     . ALA B  2  243 ? -3.671  49.842  27.101  1.00 51.81  ? 243  ALA B C     1 
ATOM   4476  O  O     . ALA B  2  243 ? -3.868  49.810  28.308  1.00 49.97  ? 243  ALA B O     1 
ATOM   4477  C  CB    . ALA B  2  243 ? -2.599  51.860  26.207  1.00 53.05  ? 243  ALA B CB    1 
ATOM   4478  N  N     . ALA B  2  244 ? -4.543  49.394  26.206  1.00 51.47  ? 244  ALA B N     1 
ATOM   4479  C  CA    . ALA B  2  244 ? -5.810  48.801  26.601  1.00 51.95  ? 244  ALA B CA    1 
ATOM   4480  C  C     . ALA B  2  244 ? -5.567  47.368  27.007  1.00 53.10  ? 244  ALA B C     1 
ATOM   4481  O  O     . ALA B  2  244 ? -6.126  46.909  27.992  1.00 54.21  ? 244  ALA B O     1 
ATOM   4482  C  CB    . ALA B  2  244 ? -6.813  48.856  25.472  1.00 51.76  ? 244  ALA B CB    1 
ATOM   4483  N  N     . VAL B  2  245 ? -4.746  46.653  26.251  1.00 53.46  ? 245  VAL B N     1 
ATOM   4484  C  CA    . VAL B  2  245 ? -4.448  45.274  26.603  1.00 53.67  ? 245  VAL B CA    1 
ATOM   4485  C  C     . VAL B  2  245 ? -3.861  45.204  28.014  1.00 54.94  ? 245  VAL B C     1 
ATOM   4486  O  O     . VAL B  2  245 ? -4.141  44.261  28.738  1.00 56.46  ? 245  VAL B O     1 
ATOM   4487  C  CB    . VAL B  2  245 ? -3.491  44.613  25.581  1.00 52.11  ? 245  VAL B CB    1 
ATOM   4488  C  CG1   . VAL B  2  245 ? -2.506  43.700  26.255  1.00 50.02  ? 245  VAL B CG1   1 
ATOM   4489  C  CG2   . VAL B  2  245 ? -4.284  43.800  24.623  1.00 52.59  ? 245  VAL B CG2   1 
ATOM   4490  N  N     . PHE B  2  246 ? -3.068  46.183  28.428  1.00 55.91  ? 246  PHE B N     1 
ATOM   4491  C  CA    . PHE B  2  246 ? -2.541  46.105  29.777  1.00 58.35  ? 246  PHE B CA    1 
ATOM   4492  C  C     . PHE B  2  246 ? -3.591  46.587  30.775  1.00 58.59  ? 246  PHE B C     1 
ATOM   4493  O  O     . PHE B  2  246 ? -3.492  46.321  31.965  1.00 60.89  ? 246  PHE B O     1 
ATOM   4494  C  CB    . PHE B  2  246 ? -1.204  46.863  29.921  1.00 59.51  ? 246  PHE B CB    1 
ATOM   4495  C  CG    . PHE B  2  246 ? -1.333  48.337  30.233  1.00 62.19  ? 246  PHE B CG    1 
ATOM   4496  C  CD1   . PHE B  2  246 ? -2.094  48.792  31.302  1.00 63.05  ? 246  PHE B CD1   1 
ATOM   4497  C  CD2   . PHE B  2  246 ? -0.612  49.269  29.500  1.00 63.47  ? 246  PHE B CD2   1 
ATOM   4498  C  CE1   . PHE B  2  246 ? -2.127  50.147  31.629  1.00 64.61  ? 246  PHE B CE1   1 
ATOM   4499  C  CE2   . PHE B  2  246 ? -0.639  50.616  29.821  1.00 63.43  ? 246  PHE B CE2   1 
ATOM   4500  C  CZ    . PHE B  2  246 ? -1.393  51.058  30.882  1.00 63.72  ? 246  PHE B CZ    1 
ATOM   4501  N  N     . PHE B  2  247 ? -4.591  47.302  30.292  1.00 57.69  ? 247  PHE B N     1 
ATOM   4502  C  CA    . PHE B  2  247 ? -5.663  47.768  31.160  1.00 56.44  ? 247  PHE B CA    1 
ATOM   4503  C  C     . PHE B  2  247 ? -6.548  46.559  31.415  1.00 55.70  ? 247  PHE B C     1 
ATOM   4504  O  O     . PHE B  2  247 ? -6.926  46.269  32.546  1.00 55.08  ? 247  PHE B O     1 
ATOM   4505  C  CB    . PHE B  2  247 ? -6.462  48.877  30.472  1.00 57.14  ? 247  PHE B CB    1 
ATOM   4506  C  CG    . PHE B  2  247 ? -7.748  49.213  31.158  1.00 58.46  ? 247  PHE B CG    1 
ATOM   4507  C  CD1   . PHE B  2  247 ? -7.772  49.548  32.500  1.00 58.43  ? 247  PHE B CD1   1 
ATOM   4508  C  CD2   . PHE B  2  247 ? -8.943  49.175  30.460  1.00 60.30  ? 247  PHE B CD2   1 
ATOM   4509  C  CE1   . PHE B  2  247 ? -8.961  49.835  33.140  1.00 58.93  ? 247  PHE B CE1   1 
ATOM   4510  C  CE2   . PHE B  2  247 ? -10.153 49.464  31.094  1.00 61.45  ? 247  PHE B CE2   1 
ATOM   4511  C  CZ    . PHE B  2  247 ? -10.156 49.793  32.437  1.00 60.68  ? 247  PHE B CZ    1 
ATOM   4512  N  N     . ALA B  2  248 ? -6.873  45.849  30.350  1.00 55.11  ? 248  ALA B N     1 
ATOM   4513  C  CA    . ALA B  2  248 ? -7.702  44.667  30.469  1.00 55.59  ? 248  ALA B CA    1 
ATOM   4514  C  C     . ALA B  2  248 ? -7.024  43.733  31.459  1.00 55.65  ? 248  ALA B C     1 
ATOM   4515  O  O     . ALA B  2  248 ? -7.655  43.248  32.399  1.00 55.23  ? 248  ALA B O     1 
ATOM   4516  C  CB    . ALA B  2  248 ? -7.838  44.004  29.127  1.00 55.21  ? 248  ALA B CB    1 
ATOM   4517  N  N     . ALA B  2  249 ? -5.727  43.507  31.244  1.00 55.53  ? 249  ALA B N     1 
ATOM   4518  C  CA    . ALA B  2  249 ? -4.905  42.655  32.102  1.00 54.80  ? 249  ALA B CA    1 
ATOM   4519  C  C     . ALA B  2  249 ? -5.058  43.000  33.567  1.00 54.81  ? 249  ALA B C     1 
ATOM   4520  O  O     . ALA B  2  249 ? -5.558  42.192  34.332  1.00 54.58  ? 249  ALA B O     1 
ATOM   4521  C  CB    . ALA B  2  249 ? -3.471  42.781  31.720  1.00 54.15  ? 249  ALA B CB    1 
ATOM   4522  N  N     . PHE B  2  250 ? -4.615  44.190  33.963  1.00 54.98  ? 250  PHE B N     1 
ATOM   4523  C  CA    . PHE B  2  250 ? -4.728  44.624  35.357  1.00 55.95  ? 250  PHE B CA    1 
ATOM   4524  C  C     . PHE B  2  250 ? -6.124  44.392  35.939  1.00 56.39  ? 250  PHE B C     1 
ATOM   4525  O  O     . PHE B  2  250 ? -6.285  44.306  37.152  1.00 55.38  ? 250  PHE B O     1 
ATOM   4526  C  CB    . PHE B  2  250 ? -4.388  46.108  35.508  1.00 56.72  ? 250  PHE B CB    1 
ATOM   4527  C  CG    . PHE B  2  250 ? -2.936  46.384  35.747  1.00 57.61  ? 250  PHE B CG    1 
ATOM   4528  C  CD1   . PHE B  2  250 ? -2.291  45.852  36.840  1.00 58.40  ? 250  PHE B CD1   1 
ATOM   4529  C  CD2   . PHE B  2  250 ? -2.209  47.183  34.872  1.00 58.53  ? 250  PHE B CD2   1 
ATOM   4530  C  CE1   . PHE B  2  250 ? -0.933  46.107  37.062  1.00 60.06  ? 250  PHE B CE1   1 
ATOM   4531  C  CE2   . PHE B  2  250 ? -0.852  47.443  35.086  1.00 58.77  ? 250  PHE B CE2   1 
ATOM   4532  C  CZ    . PHE B  2  250 ? -0.218  46.904  36.180  1.00 58.96  ? 250  PHE B CZ    1 
ATOM   4533  N  N     . VAL B  2  251 ? -7.132  44.301  35.080  1.00 57.51  ? 251  VAL B N     1 
ATOM   4534  C  CA    . VAL B  2  251 ? -8.496  44.085  35.554  1.00 58.81  ? 251  VAL B CA    1 
ATOM   4535  C  C     . VAL B  2  251 ? -8.835  42.605  35.708  1.00 59.87  ? 251  VAL B C     1 
ATOM   4536  O  O     . VAL B  2  251 ? -9.626  42.246  36.578  1.00 60.14  ? 251  VAL B O     1 
ATOM   4537  C  CB    . VAL B  2  251 ? -9.534  44.727  34.632  1.00 57.81  ? 251  VAL B CB    1 
ATOM   4538  C  CG1   . VAL B  2  251 ? -10.914 44.604  35.260  1.00 57.33  ? 251  VAL B CG1   1 
ATOM   4539  C  CG2   . VAL B  2  251 ? -9.187  46.174  34.403  1.00 57.46  ? 251  VAL B CG2   1 
ATOM   4540  N  N     . VAL B  2  252 ? -8.258  41.752  34.866  1.00 60.16  ? 252  VAL B N     1 
ATOM   4541  C  CA    . VAL B  2  252 ? -8.519  40.324  34.986  1.00 60.94  ? 252  VAL B CA    1 
ATOM   4542  C  C     . VAL B  2  252 ? -7.679  39.755  36.128  1.00 61.03  ? 252  VAL B C     1 
ATOM   4543  O  O     . VAL B  2  252 ? -8.040  38.748  36.743  1.00 61.16  ? 252  VAL B O     1 
ATOM   4544  C  CB    . VAL B  2  252 ? -8.179  39.551  33.703  1.00 61.61  ? 252  VAL B CB    1 
ATOM   4545  C  CG1   . VAL B  2  252 ? -9.151  39.905  32.605  1.00 61.61  ? 252  VAL B CG1   1 
ATOM   4546  C  CG2   . VAL B  2  252 ? -6.759  39.841  33.284  1.00 61.98  ? 252  VAL B CG2   1 
ATOM   4547  N  N     . ALA B  2  253 ? -6.555  40.404  36.398  1.00 59.92  ? 253  ALA B N     1 
ATOM   4548  C  CA    . ALA B  2  253 ? -5.683  39.974  37.477  1.00 58.35  ? 253  ALA B CA    1 
ATOM   4549  C  C     . ALA B  2  253 ? -6.373  40.288  38.798  1.00 57.32  ? 253  ALA B C     1 
ATOM   4550  O  O     . ALA B  2  253 ? -6.311  39.523  39.744  1.00 55.24  ? 253  ALA B O     1 
ATOM   4551  C  CB    . ALA B  2  253 ? -4.348  40.700  37.383  1.00 57.77  ? 253  ALA B CB    1 
ATOM   4552  N  N     . GLY B  2  254 ? -7.039  41.424  38.846  1.00 57.57  ? 254  GLY B N     1 
ATOM   4553  C  CA    . GLY B  2  254 ? -7.728  41.815  40.052  1.00 56.97  ? 254  GLY B CA    1 
ATOM   4554  C  C     . GLY B  2  254 ? -8.971  40.985  40.329  1.00 56.92  ? 254  GLY B C     1 
ATOM   4555  O  O     . GLY B  2  254 ? -9.196  40.578  41.461  1.00 57.45  ? 254  GLY B O     1 
ATOM   4556  N  N     . THR B  2  255 ? -9.790  40.733  39.319  1.00 54.72  ? 255  THR B N     1 
ATOM   4557  C  CA    . THR B  2  255 ? -10.992 39.952  39.538  1.00 53.20  ? 255  THR B CA    1 
ATOM   4558  C  C     . THR B  2  255 ? -10.680 38.485  39.857  1.00 54.76  ? 255  THR B C     1 
ATOM   4559  O  O     . THR B  2  255 ? -11.518 37.753  40.402  1.00 56.69  ? 255  THR B O     1 
ATOM   4560  C  CB    . THR B  2  255 ? -11.864 39.999  38.338  1.00 51.18  ? 255  THR B CB    1 
ATOM   4561  O  OG1   . THR B  2  255 ? -11.156 39.439  37.240  1.00 51.85  ? 255  THR B OG1   1 
ATOM   4562  C  CG2   . THR B  2  255 ? -12.227 41.423  38.019  1.00 52.08  ? 255  THR B CG2   1 
ATOM   4563  N  N     . MET B  2  256 ? -9.481  38.047  39.508  1.00 54.20  ? 256  MET B N     1 
ATOM   4564  C  CA    . MET B  2  256 ? -9.073  36.676  39.780  1.00 51.31  ? 256  MET B CA    1 
ATOM   4565  C  C     . MET B  2  256 ? -8.596  36.585  41.224  1.00 51.23  ? 256  MET B C     1 
ATOM   4566  O  O     . MET B  2  256 ? -8.857  35.599  41.881  1.00 52.33  ? 256  MET B O     1 
ATOM   4567  C  CB    . MET B  2  256 ? -7.956  36.271  38.815  1.00 51.01  ? 256  MET B CB    1 
ATOM   4568  C  CG    . MET B  2  256 ? -7.421  34.879  38.995  1.00 49.89  ? 256  MET B CG    1 
ATOM   4569  S  SD    . MET B  2  256 ? -8.682  33.699  38.853  1.00 46.93  ? 256  MET B SD    1 
ATOM   4570  C  CE    . MET B  2  256 ? -8.904  33.612  37.174  1.00 47.57  ? 256  MET B CE    1 
ATOM   4571  N  N     . TRP B  2  257 ? -7.917  37.615  41.722  1.00 49.23  ? 257  TRP B N     1 
ATOM   4572  C  CA    . TRP B  2  257 ? -7.416  37.600  43.096  1.00 47.02  ? 257  TRP B CA    1 
ATOM   4573  C  C     . TRP B  2  257 ? -8.497  37.830  44.135  1.00 47.24  ? 257  TRP B C     1 
ATOM   4574  O  O     . TRP B  2  257 ? -8.503  37.192  45.180  1.00 45.00  ? 257  TRP B O     1 
ATOM   4575  C  CB    . TRP B  2  257 ? -6.313  38.630  43.281  1.00 45.38  ? 257  TRP B CB    1 
ATOM   4576  C  CG    . TRP B  2  257 ? -5.560  38.410  44.526  1.00 44.73  ? 257  TRP B CG    1 
ATOM   4577  C  CD1   . TRP B  2  257 ? -5.472  39.250  45.595  1.00 44.61  ? 257  TRP B CD1   1 
ATOM   4578  C  CD2   . TRP B  2  257 ? -4.767  37.276  44.842  1.00 43.32  ? 257  TRP B CD2   1 
ATOM   4579  N  NE1   . TRP B  2  257 ? -4.668  38.707  46.558  1.00 45.01  ? 257  TRP B NE1   1 
ATOM   4580  C  CE2   . TRP B  2  257 ? -4.222  37.490  46.116  1.00 44.41  ? 257  TRP B CE2   1 
ATOM   4581  C  CE3   . TRP B  2  257 ? -4.464  36.097  44.169  1.00 43.48  ? 257  TRP B CE3   1 
ATOM   4582  C  CZ2   . TRP B  2  257 ? -3.391  36.568  46.728  1.00 44.40  ? 257  TRP B CZ2   1 
ATOM   4583  C  CZ3   . TRP B  2  257 ? -3.646  35.184  44.773  1.00 43.89  ? 257  TRP B CZ3   1 
ATOM   4584  C  CH2   . TRP B  2  257 ? -3.115  35.421  46.042  1.00 43.97  ? 257  TRP B CH2   1 
ATOM   4585  N  N     . TYR B  2  258 ? -9.388  38.768  43.862  1.00 48.30  ? 258  TYR B N     1 
ATOM   4586  C  CA    . TYR B  2  258 ? -10.491 39.040  44.761  1.00 49.30  ? 258  TYR B CA    1 
ATOM   4587  C  C     . TYR B  2  258 ? -11.575 38.126  44.227  1.00 51.32  ? 258  TYR B C     1 
ATOM   4588  O  O     . TYR B  2  258 ? -11.286 37.231  43.426  1.00 50.77  ? 258  TYR B O     1 
ATOM   4589  C  CB    . TYR B  2  258 ? -10.953 40.477  44.628  1.00 47.76  ? 258  TYR B CB    1 
ATOM   4590  C  CG    . TYR B  2  258 ? -9.879  41.511  44.831  1.00 47.88  ? 258  TYR B CG    1 
ATOM   4591  C  CD1   . TYR B  2  258 ? -9.647  42.492  43.875  1.00 48.22  ? 258  TYR B CD1   1 
ATOM   4592  C  CD2   . TYR B  2  258 ? -9.113  41.531  45.975  1.00 48.27  ? 258  TYR B CD2   1 
ATOM   4593  C  CE1   . TYR B  2  258 ? -8.673  43.471  44.054  1.00 46.26  ? 258  TYR B CE1   1 
ATOM   4594  C  CE2   . TYR B  2  258 ? -8.130  42.512  46.167  1.00 47.19  ? 258  TYR B CE2   1 
ATOM   4595  C  CZ    . TYR B  2  258 ? -7.916  43.477  45.199  1.00 46.11  ? 258  TYR B CZ    1 
ATOM   4596  O  OH    . TYR B  2  258 ? -6.947  44.438  45.367  1.00 44.04  ? 258  TYR B OH    1 
ATOM   4597  N  N     . GLY B  2  259 ? -12.818 38.344  44.633  1.00 52.28  ? 259  GLY B N     1 
ATOM   4598  C  CA    . GLY B  2  259 ? -13.888 37.502  44.117  1.00 54.25  ? 259  GLY B CA    1 
ATOM   4599  C  C     . GLY B  2  259 ? -14.315 37.885  42.707  1.00 55.72  ? 259  GLY B C     1 
ATOM   4600  O  O     . GLY B  2  259 ? -13.588 38.582  42.020  1.00 58.16  ? 259  GLY B O     1 
ATOM   4601  N  N     . SER B  2  260 ? -15.487 37.430  42.281  1.00 56.65  ? 260  SER B N     1 
ATOM   4602  C  CA    . SER B  2  260 ? -16.058 37.731  40.957  1.00 56.24  ? 260  SER B CA    1 
ATOM   4603  C  C     . SER B  2  260 ? -16.822 36.542  40.427  1.00 57.21  ? 260  SER B C     1 
ATOM   4604  O  O     . SER B  2  260 ? -16.346 35.420  40.497  1.00 56.61  ? 260  SER B O     1 
ATOM   4605  C  CB    . SER B  2  260 ? -14.988 38.093  39.933  1.00 55.42  ? 260  SER B CB    1 
ATOM   4606  O  OG    . SER B  2  260 ? -15.550 38.151  38.639  1.00 52.09  ? 260  SER B OG    1 
ATOM   4607  N  N     . ALA B  2  261 ? -18.005 36.799  39.890  1.00 57.47  ? 261  ALA B N     1 
ATOM   4608  C  CA    . ALA B  2  261 ? -18.839 35.750  39.329  1.00 56.58  ? 261  ALA B CA    1 
ATOM   4609  C  C     . ALA B  2  261 ? -18.188 35.117  38.095  1.00 56.49  ? 261  ALA B C     1 
ATOM   4610  O  O     . ALA B  2  261 ? -18.705 34.166  37.522  1.00 57.30  ? 261  ALA B O     1 
ATOM   4611  C  CB    . ALA B  2  261 ? -20.192 36.321  38.972  1.00 54.81  ? 261  ALA B CB    1 
ATOM   4612  N  N     . THR B  2  262 ? -17.052 35.655  37.690  1.00 55.78  ? 262  THR B N     1 
ATOM   4613  C  CA    . THR B  2  262 ? -16.342 35.149  36.527  1.00 56.00  ? 262  THR B CA    1 
ATOM   4614  C  C     . THR B  2  262 ? -15.217 34.258  36.967  1.00 55.57  ? 262  THR B C     1 
ATOM   4615  O  O     . THR B  2  262 ? -14.588 33.592  36.154  1.00 57.34  ? 262  THR B O     1 
ATOM   4616  C  CB    . THR B  2  262 ? -15.789 36.305  35.691  1.00 55.77  ? 262  THR B CB    1 
ATOM   4617  O  OG1   . THR B  2  262 ? -16.748 36.626  34.688  1.00 56.55  ? 262  THR B OG1   1 
ATOM   4618  C  CG2   . THR B  2  262 ? -14.468 35.948  35.026  1.00 55.90  ? 262  THR B CG2   1 
ATOM   4619  N  N     . THR B  2  263 ? -14.980 34.251  38.269  1.00 53.71  ? 263  THR B N     1 
ATOM   4620  C  CA    . THR B  2  263 ? -13.933 33.462  38.873  1.00 52.41  ? 263  THR B CA    1 
ATOM   4621  C  C     . THR B  2  263 ? -14.556 32.538  39.890  1.00 52.95  ? 263  THR B C     1 
ATOM   4622  O  O     . THR B  2  263 ? -14.286 32.657  41.078  1.00 54.52  ? 263  THR B O     1 
ATOM   4623  C  CB    . THR B  2  263 ? -12.976 34.350  39.594  1.00 51.69  ? 263  THR B CB    1 
ATOM   4624  O  OG1   . THR B  2  263 ? -12.421 35.273  38.674  1.00 52.61  ? 263  THR B OG1   1 
ATOM   4625  C  CG2   . THR B  2  263 ? -11.878 33.563  40.170  1.00 52.95  ? 263  THR B CG2   1 
ATOM   4626  N  N     . PRO B  2  264 ? -15.414 31.609  39.444  1.00 52.95  ? 264  PRO B N     1 
ATOM   4627  C  CA    . PRO B  2  264 ? -16.087 30.658  40.323  1.00 53.23  ? 264  PRO B CA    1 
ATOM   4628  C  C     . PRO B  2  264 ? -15.039 29.966  41.168  1.00 54.29  ? 264  PRO B C     1 
ATOM   4629  O  O     . PRO B  2  264 ? -13.970 29.647  40.665  1.00 54.15  ? 264  PRO B O     1 
ATOM   4630  C  CB    . PRO B  2  264 ? -16.742 29.695  39.343  1.00 52.81  ? 264  PRO B CB    1 
ATOM   4631  C  CG    . PRO B  2  264 ? -17.022 30.529  38.177  1.00 53.02  ? 264  PRO B CG    1 
ATOM   4632  C  CD    . PRO B  2  264 ? -15.735 31.310  38.041  1.00 55.20  ? 264  PRO B CD    1 
ATOM   4633  N  N     . ILE B  2  265 ? -15.334 29.721  42.438  1.00 55.19  ? 265  ILE B N     1 
ATOM   4634  C  CA    . ILE B  2  265 ? -14.348 29.077  43.281  1.00 55.86  ? 265  ILE B CA    1 
ATOM   4635  C  C     . ILE B  2  265 ? -14.300 27.573  43.168  1.00 56.66  ? 265  ILE B C     1 
ATOM   4636  O  O     . ILE B  2  265 ? -13.547 26.940  43.872  1.00 57.38  ? 265  ILE B O     1 
ATOM   4637  C  CB    . ILE B  2  265 ? -14.512 29.471  44.749  1.00 55.91  ? 265  ILE B CB    1 
ATOM   4638  C  CG1   . ILE B  2  265 ? -15.926 29.209  45.226  1.00 56.40  ? 265  ILE B CG1   1 
ATOM   4639  C  CG2   . ILE B  2  265 ? -14.192 30.926  44.918  1.00 57.44  ? 265  ILE B CG2   1 
ATOM   4640  C  CD1   . ILE B  2  265 ? -16.134 29.673  46.644  1.00 57.54  ? 265  ILE B CD1   1 
ATOM   4641  N  N     . GLU B  2  266 ? -15.087 26.996  42.282  1.00 56.97  ? 266  GLU B N     1 
ATOM   4642  C  CA    . GLU B  2  266 ? -15.041 25.559  42.117  1.00 58.27  ? 266  GLU B CA    1 
ATOM   4643  C  C     . GLU B  2  266 ? -14.246 25.222  40.880  1.00 59.48  ? 266  GLU B C     1 
ATOM   4644  O  O     . GLU B  2  266 ? -13.913 24.065  40.636  1.00 59.98  ? 266  GLU B O     1 
ATOM   4645  C  CB    . GLU B  2  266 ? -16.440 24.983  41.995  1.00 59.01  ? 266  GLU B CB    1 
ATOM   4646  C  CG    . GLU B  2  266 ? -17.247 25.048  43.263  1.00 59.70  ? 266  GLU B CG    1 
ATOM   4647  C  CD    . GLU B  2  266 ? -18.680 24.645  43.031  1.00 60.42  ? 266  GLU B CD    1 
ATOM   4648  O  OE1   . GLU B  2  266 ? -19.327 25.298  42.184  1.00 61.40  ? 266  GLU B OE1   1 
ATOM   4649  O  OE2   . GLU B  2  266 ? -19.155 23.688  43.686  1.00 58.37  ? 266  GLU B OE2   1 
ATOM   4650  N  N     . LEU B  2  267 ? -13.974 26.253  40.088  1.00 61.64  ? 267  LEU B N     1 
ATOM   4651  C  CA    . LEU B  2  267 ? -13.197 26.137  38.855  1.00 63.03  ? 267  LEU B CA    1 
ATOM   4652  C  C     . LEU B  2  267 ? -11.771 26.571  39.174  1.00 63.68  ? 267  LEU B C     1 
ATOM   4653  O  O     . LEU B  2  267 ? -10.805 25.942  38.751  1.00 65.39  ? 267  LEU B O     1 
ATOM   4654  C  CB    . LEU B  2  267 ? -13.786 27.037  37.787  1.00 62.83  ? 267  LEU B CB    1 
ATOM   4655  C  CG    . LEU B  2  267 ? -15.247 26.748  37.543  1.00 62.15  ? 267  LEU B CG    1 
ATOM   4656  C  CD1   . LEU B  2  267 ? -15.749 27.717  36.525  1.00 64.81  ? 267  LEU B CD1   1 
ATOM   4657  C  CD2   . LEU B  2  267 ? -15.425 25.348  37.051  1.00 62.29  ? 267  LEU B CD2   1 
ATOM   4658  N  N     . PHE B  2  268 ? -11.649 27.663  39.911  1.00 63.20  ? 268  PHE B N     1 
ATOM   4659  C  CA    . PHE B  2  268 ? -10.355 28.163  40.356  1.00 63.10  ? 268  PHE B CA    1 
ATOM   4660  C  C     . PHE B  2  268 ? -10.506 27.964  41.862  1.00 62.81  ? 268  PHE B C     1 
ATOM   4661  O  O     . PHE B  2  268 ? -11.611 27.706  42.333  1.00 64.36  ? 268  PHE B O     1 
ATOM   4662  C  CB    . PHE B  2  268 ? -10.202 29.642  40.002  1.00 63.59  ? 268  PHE B CB    1 
ATOM   4663  C  CG    . PHE B  2  268 ? -10.562 29.967  38.564  1.00 62.12  ? 268  PHE B CG    1 
ATOM   4664  C  CD1   . PHE B  2  268 ? -11.885 30.189  38.187  1.00 62.02  ? 268  PHE B CD1   1 
ATOM   4665  C  CD2   . PHE B  2  268 ? -9.583  30.028  37.598  1.00 60.77  ? 268  PHE B CD2   1 
ATOM   4666  C  CE1   . PHE B  2  268 ? -12.213 30.460  36.882  1.00 60.03  ? 268  PHE B CE1   1 
ATOM   4667  C  CE2   . PHE B  2  268 ? -9.907  30.298  36.292  1.00 62.05  ? 268  PHE B CE2   1 
ATOM   4668  C  CZ    . PHE B  2  268 ? -11.226 30.514  35.934  1.00 60.91  ? 268  PHE B CZ    1 
ATOM   4669  N  N     . GLY B  2  269 ? -9.452  28.079  42.641  1.00 61.71  ? 269  GLY B N     1 
ATOM   4670  C  CA    . GLY B  2  269 ? -9.643  27.820  44.064  1.00 59.21  ? 269  GLY B CA    1 
ATOM   4671  C  C     . GLY B  2  269 ? -10.318 28.880  44.917  1.00 57.26  ? 269  GLY B C     1 
ATOM   4672  O  O     . GLY B  2  269 ? -10.873 29.834  44.402  1.00 54.79  ? 269  GLY B O     1 
ATOM   4673  N  N     . PRO B  2  270 ? -10.305 28.703  46.245  1.00 57.45  ? 270  PRO B N     1 
ATOM   4674  C  CA    . PRO B  2  270 ? -10.907 29.669  47.165  1.00 57.65  ? 270  PRO B CA    1 
ATOM   4675  C  C     . PRO B  2  270 ? -10.092 30.938  47.093  1.00 57.46  ? 270  PRO B C     1 
ATOM   4676  O  O     . PRO B  2  270 ? -8.985  30.926  46.561  1.00 58.31  ? 270  PRO B O     1 
ATOM   4677  C  CB    . PRO B  2  270 ? -10.769 28.977  48.516  1.00 57.78  ? 270  PRO B CB    1 
ATOM   4678  C  CG    . PRO B  2  270 ? -10.941 27.556  48.156  1.00 56.11  ? 270  PRO B CG    1 
ATOM   4679  C  CD    . PRO B  2  270 ? -10.083 27.420  46.935  1.00 57.97  ? 270  PRO B CD    1 
ATOM   4680  N  N     . THR B  2  271 ? -10.632 32.017  47.642  1.00 56.38  ? 271  THR B N     1 
ATOM   4681  C  CA    . THR B  2  271 ? -9.986  33.323  47.642  1.00 56.14  ? 271  THR B CA    1 
ATOM   4682  C  C     . THR B  2  271 ? -9.171  33.442  48.901  1.00 55.88  ? 271  THR B C     1 
ATOM   4683  O  O     . THR B  2  271 ? -9.517  32.813  49.875  1.00 56.49  ? 271  THR B O     1 
ATOM   4684  C  CB    . THR B  2  271 ? -11.068 34.415  47.593  1.00 56.74  ? 271  THR B CB    1 
ATOM   4685  O  OG1   . THR B  2  271 ? -11.093 34.980  46.278  1.00 55.88  ? 271  THR B OG1   1 
ATOM   4686  C  CG2   . THR B  2  271 ? -10.849 35.491  48.673  1.00 55.92  ? 271  THR B CG2   1 
ATOM   4687  N  N     . ARG B  2  272 ? -8.105  34.229  48.906  1.00 56.25  ? 272  ARG B N     1 
ATOM   4688  C  CA    . ARG B  2  272 ? -7.309  34.341  50.125  1.00 56.73  ? 272  ARG B CA    1 
ATOM   4689  C  C     . ARG B  2  272 ? -8.035  35.146  51.189  1.00 57.29  ? 272  ARG B C     1 
ATOM   4690  O  O     . ARG B  2  272 ? -7.671  35.103  52.367  1.00 57.66  ? 272  ARG B O     1 
ATOM   4691  C  CB    . ARG B  2  272 ? -5.972  35.034  49.877  1.00 56.85  ? 272  ARG B CB    1 
ATOM   4692  C  CG    . ARG B  2  272 ? -6.065  36.558  49.889  1.00 57.27  ? 272  ARG B CG    1 
ATOM   4693  C  CD    . ARG B  2  272 ? -4.737  37.230  50.232  1.00 58.60  ? 272  ARG B CD    1 
ATOM   4694  N  NE    . ARG B  2  272 ? -4.534  37.409  51.668  1.00 58.24  ? 272  ARG B NE    1 
ATOM   4695  C  CZ    . ARG B  2  272 ? -3.406  37.855  52.209  1.00 58.00  ? 272  ARG B CZ    1 
ATOM   4696  N  NH1   . ARG B  2  272 ? -2.387  38.161  51.432  1.00 59.04  ? 272  ARG B NH1   1 
ATOM   4697  N  NH2   . ARG B  2  272 ? -3.295  37.996  53.518  1.00 57.95  ? 272  ARG B NH2   1 
ATOM   4698  N  N     . TYR B  2  273 ? -9.046  35.895  50.757  1.00 56.22  ? 273  TYR B N     1 
ATOM   4699  C  CA    . TYR B  2  273 ? -9.807  36.750  51.645  1.00 53.57  ? 273  TYR B CA    1 
ATOM   4700  C  C     . TYR B  2  273 ? -10.883 35.971  52.358  1.00 52.78  ? 273  TYR B C     1 
ATOM   4701  O  O     . TYR B  2  273 ? -11.377 36.402  53.386  1.00 53.16  ? 273  TYR B O     1 
ATOM   4702  C  CB    . TYR B  2  273 ? -10.391 37.927  50.849  1.00 53.31  ? 273  TYR B CB    1 
ATOM   4703  C  CG    . TYR B  2  273 ? -9.321  38.754  50.165  1.00 52.40  ? 273  TYR B CG    1 
ATOM   4704  C  CD1   . TYR B  2  273 ? -8.590  39.702  50.869  1.00 52.74  ? 273  TYR B CD1   1 
ATOM   4705  C  CD2   . TYR B  2  273 ? -8.928  38.468  48.869  1.00 52.48  ? 273  TYR B CD2   1 
ATOM   4706  C  CE1   . TYR B  2  273 ? -7.485  40.325  50.305  1.00 52.26  ? 273  TYR B CE1   1 
ATOM   4707  C  CE2   . TYR B  2  273 ? -7.827  39.084  48.302  1.00 53.05  ? 273  TYR B CE2   1 
ATOM   4708  C  CZ    . TYR B  2  273 ? -7.104  40.005  49.028  1.00 52.36  ? 273  TYR B CZ    1 
ATOM   4709  O  OH    . TYR B  2  273 ? -5.964  40.557  48.500  1.00 51.92  ? 273  TYR B OH    1 
ATOM   4710  N  N     . GLN B  2  274 ? -11.249 34.820  51.819  1.00 52.31  ? 274  GLN B N     1 
ATOM   4711  C  CA    . GLN B  2  274 ? -12.254 33.998  52.469  1.00 53.41  ? 274  GLN B CA    1 
ATOM   4712  C  C     . GLN B  2  274 ? -11.656 33.331  53.726  1.00 54.48  ? 274  GLN B C     1 
ATOM   4713  O  O     . GLN B  2  274 ? -12.384 32.922  54.647  1.00 56.09  ? 274  GLN B O     1 
ATOM   4714  C  CB    . GLN B  2  274 ? -12.764 32.934  51.513  1.00 51.57  ? 274  GLN B CB    1 
ATOM   4715  C  CG    . GLN B  2  274 ? -13.066 33.461  50.143  1.00 53.73  ? 274  GLN B CG    1 
ATOM   4716  C  CD    . GLN B  2  274 ? -13.958 32.530  49.349  1.00 54.80  ? 274  GLN B CD    1 
ATOM   4717  O  OE1   . GLN B  2  274 ? -15.161 32.487  49.560  1.00 54.68  ? 274  GLN B OE1   1 
ATOM   4718  N  NE2   . GLN B  2  274 ? -13.370 31.774  48.434  1.00 54.73  ? 274  GLN B NE2   1 
ATOM   4719  N  N     . TRP B  2  275 ? -10.329 33.221  53.758  1.00 52.66  ? 275  TRP B N     1 
ATOM   4720  C  CA    . TRP B  2  275 ? -9.625  32.621  54.888  1.00 49.49  ? 275  TRP B CA    1 
ATOM   4721  C  C     . TRP B  2  275 ? -9.316  33.723  55.860  1.00 48.90  ? 275  TRP B C     1 
ATOM   4722  O  O     . TRP B  2  275 ? -9.338  33.518  57.061  1.00 48.39  ? 275  TRP B O     1 
ATOM   4723  C  CB    . TRP B  2  275 ? -8.325  31.948  54.417  1.00 47.35  ? 275  TRP B CB    1 
ATOM   4724  C  CG    . TRP B  2  275 ? -7.336  31.659  55.525  1.00 43.95  ? 275  TRP B CG    1 
ATOM   4725  C  CD1   . TRP B  2  275 ? -6.307  32.455  55.935  1.00 43.40  ? 275  TRP B CD1   1 
ATOM   4726  C  CD2   . TRP B  2  275 ? -7.334  30.529  56.396  1.00 41.22  ? 275  TRP B CD2   1 
ATOM   4727  N  NE1   . TRP B  2  275 ? -5.670  31.897  57.008  1.00 39.76  ? 275  TRP B NE1   1 
ATOM   4728  C  CE2   . TRP B  2  275 ? -6.281  30.714  57.315  1.00 40.42  ? 275  TRP B CE2   1 
ATOM   4729  C  CE3   . TRP B  2  275 ? -8.122  29.376  56.492  1.00 39.43  ? 275  TRP B CE3   1 
ATOM   4730  C  CZ2   . TRP B  2  275 ? -6.001  29.794  58.317  1.00 40.13  ? 275  TRP B CZ2   1 
ATOM   4731  C  CZ3   . TRP B  2  275 ? -7.843  28.460  57.484  1.00 40.20  ? 275  TRP B CZ3   1 
ATOM   4732  C  CH2   . TRP B  2  275 ? -6.792  28.674  58.386  1.00 40.48  ? 275  TRP B CH2   1 
ATOM   4733  N  N     . ASP B  2  276 ? -9.045  34.905  55.327  1.00 50.70  ? 276  ASP B N     1 
ATOM   4734  C  CA    . ASP B  2  276 ? -8.723  36.062  56.148  1.00 51.86  ? 276  ASP B CA    1 
ATOM   4735  C  C     . ASP B  2  276 ? -9.841  36.348  57.117  1.00 51.55  ? 276  ASP B C     1 
ATOM   4736  O  O     . ASP B  2  276 ? -9.605  36.597  58.292  1.00 51.33  ? 276  ASP B O     1 
ATOM   4737  C  CB    . ASP B  2  276 ? -8.491  37.315  55.291  1.00 53.85  ? 276  ASP B CB    1 
ATOM   4738  C  CG    . ASP B  2  276 ? -7.223  37.242  54.458  1.00 56.85  ? 276  ASP B CG    1 
ATOM   4739  O  OD1   . ASP B  2  276 ? -6.212  36.660  54.926  1.00 60.36  ? 276  ASP B OD1   1 
ATOM   4740  O  OD2   . ASP B  2  276 ? -7.230  37.787  53.337  1.00 55.03  ? 276  ASP B OD2   1 
ATOM   4741  N  N     . SER B  2  277 ? -11.062 36.302  56.610  1.00 51.77  ? 277  SER B N     1 
ATOM   4742  C  CA    . SER B  2  277 ? -12.246 36.571  57.410  1.00 53.81  ? 277  SER B CA    1 
ATOM   4743  C  C     . SER B  2  277 ? -12.967 35.322  57.909  1.00 54.07  ? 277  SER B C     1 
ATOM   4744  O  O     . SER B  2  277 ? -14.130 35.387  58.299  1.00 55.21  ? 277  SER B O     1 
ATOM   4745  C  CB    . SER B  2  277 ? -13.211 37.409  56.594  1.00 53.84  ? 277  SER B CB    1 
ATOM   4746  O  OG    . SER B  2  277 ? -13.488 36.756  55.373  1.00 53.89  ? 277  SER B OG    1 
ATOM   4747  N  N     . SER B  2  278 ? -12.283 34.189  57.900  1.00 53.67  ? 278  SER B N     1 
ATOM   4748  C  CA    . SER B  2  278 ? -12.892 32.943  58.350  1.00 52.79  ? 278  SER B CA    1 
ATOM   4749  C  C     . SER B  2  278 ? -14.265 32.803  57.752  1.00 51.10  ? 278  SER B C     1 
ATOM   4750  O  O     . SER B  2  278 ? -15.192 32.359  58.413  1.00 49.26  ? 278  SER B O     1 
ATOM   4751  C  CB    . SER B  2  278 ? -13.001 32.943  59.856  1.00 53.66  ? 278  SER B CB    1 
ATOM   4752  O  OG    . SER B  2  278 ? -11.729 33.139  60.420  1.00 56.31  ? 278  SER B OG    1 
ATOM   4753  N  N     . TYR B  2  279 ? -14.373 33.202  56.490  1.00 50.56  ? 279  TYR B N     1 
ATOM   4754  C  CA    . TYR B  2  279 ? -15.617 33.144  55.753  1.00 50.93  ? 279  TYR B CA    1 
ATOM   4755  C  C     . TYR B  2  279 ? -16.258 31.789  55.920  1.00 52.43  ? 279  TYR B C     1 
ATOM   4756  O  O     . TYR B  2  279 ? -17.340 31.670  56.488  1.00 54.03  ? 279  TYR B O     1 
ATOM   4757  C  CB    . TYR B  2  279 ? -15.370 33.406  54.274  1.00 48.31  ? 279  TYR B CB    1 
ATOM   4758  C  CG    . TYR B  2  279 ? -16.588 33.325  53.383  1.00 47.05  ? 279  TYR B CG    1 
ATOM   4759  C  CD1   . TYR B  2  279 ? -17.643 34.216  53.518  1.00 46.44  ? 279  TYR B CD1   1 
ATOM   4760  C  CD2   . TYR B  2  279 ? -16.652 32.390  52.349  1.00 47.64  ? 279  TYR B CD2   1 
ATOM   4761  C  CE1   . TYR B  2  279 ? -18.733 34.180  52.636  1.00 45.08  ? 279  TYR B CE1   1 
ATOM   4762  C  CE2   . TYR B  2  279 ? -17.733 32.348  51.464  1.00 45.10  ? 279  TYR B CE2   1 
ATOM   4763  C  CZ    . TYR B  2  279 ? -18.763 33.242  51.614  1.00 44.39  ? 279  TYR B CZ    1 
ATOM   4764  O  OH    . TYR B  2  279 ? -19.818 33.180  50.745  1.00 42.21  ? 279  TYR B OH    1 
ATOM   4765  N  N     . PHE B  2  280 ? -15.580 30.767  55.430  1.00 52.31  ? 280  PHE B N     1 
ATOM   4766  C  CA    . PHE B  2  280 ? -16.094 29.415  55.509  1.00 52.47  ? 280  PHE B CA    1 
ATOM   4767  C  C     . PHE B  2  280 ? -16.313 28.946  56.944  1.00 54.41  ? 280  PHE B C     1 
ATOM   4768  O  O     . PHE B  2  280 ? -17.305 28.300  57.241  1.00 54.75  ? 280  PHE B O     1 
ATOM   4769  C  CB    . PHE B  2  280 ? -15.152 28.479  54.764  1.00 49.94  ? 280  PHE B CB    1 
ATOM   4770  C  CG    . PHE B  2  280 ? -15.164 28.670  53.273  1.00 46.03  ? 280  PHE B CG    1 
ATOM   4771  C  CD1   . PHE B  2  280 ? -16.231 28.230  52.512  1.00 46.05  ? 280  PHE B CD1   1 
ATOM   4772  C  CD2   . PHE B  2  280 ? -14.112 29.287  52.635  1.00 45.81  ? 280  PHE B CD2   1 
ATOM   4773  C  CE1   . PHE B  2  280 ? -16.247 28.398  51.141  1.00 45.63  ? 280  PHE B CE1   1 
ATOM   4774  C  CE2   . PHE B  2  280 ? -14.121 29.463  51.260  1.00 45.02  ? 280  PHE B CE2   1 
ATOM   4775  C  CZ    . PHE B  2  280 ? -15.190 29.016  50.515  1.00 45.47  ? 280  PHE B CZ    1 
ATOM   4776  N  N     . GLN B  2  281 ? -15.406 29.285  57.843  1.00 56.84  ? 281  GLN B N     1 
ATOM   4777  C  CA    . GLN B  2  281 ? -15.564 28.861  59.226  1.00 58.70  ? 281  GLN B CA    1 
ATOM   4778  C  C     . GLN B  2  281 ? -16.844 29.354  59.815  1.00 59.84  ? 281  GLN B C     1 
ATOM   4779  O  O     . GLN B  2  281 ? -17.497 28.638  60.545  1.00 59.94  ? 281  GLN B O     1 
ATOM   4780  C  CB    . GLN B  2  281 ? -14.428 29.361  60.081  1.00 59.67  ? 281  GLN B CB    1 
ATOM   4781  C  CG    . GLN B  2  281 ? -14.779 29.370  61.529  1.00 62.29  ? 281  GLN B CG    1 
ATOM   4782  C  CD    . GLN B  2  281 ? -13.668 29.958  62.352  1.00 66.55  ? 281  GLN B CD    1 
ATOM   4783  O  OE1   . GLN B  2  281 ? -12.637 29.315  62.550  1.00 68.10  ? 281  GLN B OE1   1 
ATOM   4784  N  NE2   . GLN B  2  281 ? -13.852 31.199  62.826  1.00 66.43  ? 281  GLN B NE2   1 
ATOM   4785  N  N     . GLN B  2  282 ? -17.189 30.595  59.523  1.00 61.47  ? 282  GLN B N     1 
ATOM   4786  C  CA    . GLN B  2  282 ? -18.418 31.171  60.035  1.00 63.42  ? 282  GLN B CA    1 
ATOM   4787  C  C     . GLN B  2  282 ? -19.619 30.334  59.630  1.00 64.06  ? 282  GLN B C     1 
ATOM   4788  O  O     . GLN B  2  282 ? -20.288 29.774  60.478  1.00 64.80  ? 282  GLN B O     1 
ATOM   4789  C  CB    . GLN B  2  282 ? -18.581 32.595  59.521  1.00 64.71  ? 282  GLN B CB    1 
ATOM   4790  C  CG    . GLN B  2  282 ? -17.658 33.614  60.192  1.00 66.49  ? 282  GLN B CG    1 
ATOM   4791  C  CD    . GLN B  2  282 ? -17.771 34.995  59.566  1.00 66.15  ? 282  GLN B CD    1 
ATOM   4792  O  OE1   . GLN B  2  282 ? -18.858 35.569  59.466  1.00 66.52  ? 282  GLN B OE1   1 
ATOM   4793  N  NE2   . GLN B  2  282 ? -16.639 35.532  59.140  1.00 66.98  ? 282  GLN B NE2   1 
ATOM   4794  N  N     . GLU B  2  283 ? -19.885 30.251  58.333  1.00 64.79  ? 283  GLU B N     1 
ATOM   4795  C  CA    . GLU B  2  283 ? -20.996 29.463  57.806  1.00 65.67  ? 283  GLU B CA    1 
ATOM   4796  C  C     . GLU B  2  283 ? -21.073 28.052  58.408  1.00 65.32  ? 283  GLU B C     1 
ATOM   4797  O  O     . GLU B  2  283 ? -22.172 27.529  58.634  1.00 64.87  ? 283  GLU B O     1 
ATOM   4798  C  CB    . GLU B  2  283 ? -20.884 29.350  56.294  1.00 67.41  ? 283  GLU B CB    1 
ATOM   4799  C  CG    . GLU B  2  283 ? -21.848 28.352  55.700  1.00 70.27  ? 283  GLU B CG    1 
ATOM   4800  C  CD    . GLU B  2  283 ? -23.276 28.830  55.758  1.00 71.60  ? 283  GLU B CD    1 
ATOM   4801  O  OE1   . GLU B  2  283 ? -23.585 29.688  56.617  1.00 72.72  ? 283  GLU B OE1   1 
ATOM   4802  O  OE2   . GLU B  2  283 ? -24.088 28.339  54.948  1.00 72.58  ? 283  GLU B OE2   1 
ATOM   4803  N  N     . ILE B  2  284 ? -19.916 27.434  58.642  1.00 64.47  ? 284  ILE B N     1 
ATOM   4804  C  CA    . ILE B  2  284 ? -19.877 26.114  59.252  1.00 63.39  ? 284  ILE B CA    1 
ATOM   4805  C  C     . ILE B  2  284 ? -20.496 26.202  60.643  1.00 63.53  ? 284  ILE B C     1 
ATOM   4806  O  O     . ILE B  2  284 ? -21.450 25.504  60.930  1.00 63.63  ? 284  ILE B O     1 
ATOM   4807  C  CB    . ILE B  2  284 ? -18.434 25.595  59.366  1.00 62.51  ? 284  ILE B CB    1 
ATOM   4808  C  CG1   . ILE B  2  284 ? -17.882 25.312  57.975  1.00 62.41  ? 284  ILE B CG1   1 
ATOM   4809  C  CG2   . ILE B  2  284 ? -18.391 24.351  60.221  1.00 61.92  ? 284  ILE B CG2   1 
ATOM   4810  C  CD1   . ILE B  2  284 ? -16.487 24.736  57.969  1.00 63.50  ? 284  ILE B CD1   1 
ATOM   4811  N  N     . ASN B  2  285 ? -19.967 27.058  61.503  1.00 64.48  ? 285  ASN B N     1 
ATOM   4812  C  CA    . ASN B  2  285 ? -20.523 27.196  62.849  1.00 66.37  ? 285  ASN B CA    1 
ATOM   4813  C  C     . ASN B  2  285 ? -22.004 27.498  62.783  1.00 66.66  ? 285  ASN B C     1 
ATOM   4814  O  O     . ASN B  2  285 ? -22.827 26.852  63.422  1.00 65.59  ? 285  ASN B O     1 
ATOM   4815  C  CB    . ASN B  2  285 ? -19.822 28.310  63.622  1.00 67.54  ? 285  ASN B CB    1 
ATOM   4816  C  CG    . ASN B  2  285 ? -18.582 27.819  64.337  1.00 70.08  ? 285  ASN B CG    1 
ATOM   4817  O  OD1   . ASN B  2  285 ? -18.662 26.977  65.247  1.00 70.49  ? 285  ASN B OD1   1 
ATOM   4818  N  ND2   . ASN B  2  285 ? -17.423 28.339  63.935  1.00 71.84  ? 285  ASN B ND2   1 
ATOM   4819  N  N     . ARG B  2  286 ? -22.318 28.507  61.996  1.00 68.17  ? 286  ARG B N     1 
ATOM   4820  C  CA    . ARG B  2  286 ? -23.683 28.951  61.778  1.00 69.45  ? 286  ARG B CA    1 
ATOM   4821  C  C     . ARG B  2  286 ? -24.581 27.732  61.517  1.00 69.44  ? 286  ARG B C     1 
ATOM   4822  O  O     . ARG B  2  286 ? -25.737 27.712  61.934  1.00 70.49  ? 286  ARG B O     1 
ATOM   4823  C  CB    . ARG B  2  286 ? -23.682 29.978  60.614  1.00 70.92  ? 286  ARG B CB    1 
ATOM   4824  C  CG    . ARG B  2  286 ? -24.994 30.327  59.973  1.00 71.50  ? 286  ARG B CG    1 
ATOM   4825  C  CD    . ARG B  2  286 ? -25.334 29.248  58.981  1.00 74.63  ? 286  ARG B CD    1 
ATOM   4826  N  NE    . ARG B  2  286 ? -26.581 29.505  58.287  1.00 77.81  ? 286  ARG B NE    1 
ATOM   4827  C  CZ    . ARG B  2  286 ? -27.046 28.761  57.293  1.00 78.84  ? 286  ARG B CZ    1 
ATOM   4828  N  NH1   . ARG B  2  286 ? -26.359 27.701  56.888  1.00 78.95  ? 286  ARG B NH1   1 
ATOM   4829  N  NH2   . ARG B  2  286 ? -28.181 29.102  56.673  1.00 81.56  ? 286  ARG B NH2   1 
ATOM   4830  N  N     . ARG B  2  287 ? -24.050 26.706  60.862  1.00 69.01  ? 287  ARG B N     1 
ATOM   4831  C  CA    . ARG B  2  287 ? -24.847 25.511  60.596  1.00 68.75  ? 287  ARG B CA    1 
ATOM   4832  C  C     . ARG B  2  287 ? -24.871 24.641  61.836  1.00 69.48  ? 287  ARG B C     1 
ATOM   4833  O  O     . ARG B  2  287 ? -25.933 24.285  62.340  1.00 70.17  ? 287  ARG B O     1 
ATOM   4834  C  CB    . ARG B  2  287 ? -24.258 24.682  59.455  1.00 67.38  ? 287  ARG B CB    1 
ATOM   4835  C  CG    . ARG B  2  287 ? -24.303 25.297  58.074  1.00 67.79  ? 287  ARG B CG    1 
ATOM   4836  C  CD    . ARG B  2  287 ? -24.132 24.196  57.034  1.00 67.38  ? 287  ARG B CD    1 
ATOM   4837  N  NE    . ARG B  2  287 ? -24.203 24.669  55.655  1.00 68.48  ? 287  ARG B NE    1 
ATOM   4838  C  CZ    . ARG B  2  287 ? -24.404 23.874  54.607  1.00 68.90  ? 287  ARG B CZ    1 
ATOM   4839  N  NH1   . ARG B  2  287 ? -24.560 22.561  54.773  1.00 68.00  ? 287  ARG B NH1   1 
ATOM   4840  N  NH2   . ARG B  2  287 ? -24.441 24.397  53.387  1.00 70.33  ? 287  ARG B NH2   1 
ATOM   4841  N  N     . VAL B  2  288 ? -23.682 24.291  62.313  1.00 68.91  ? 288  VAL B N     1 
ATOM   4842  C  CA    . VAL B  2  288 ? -23.533 23.446  63.490  1.00 68.35  ? 288  VAL B CA    1 
ATOM   4843  C  C     . VAL B  2  288 ? -24.378 23.945  64.638  1.00 68.76  ? 288  VAL B C     1 
ATOM   4844  O  O     . VAL B  2  288 ? -25.134 23.188  65.222  1.00 68.26  ? 288  VAL B O     1 
ATOM   4845  C  CB    . VAL B  2  288 ? -22.070 23.413  63.972  1.00 69.01  ? 288  VAL B CB    1 
ATOM   4846  C  CG1   . VAL B  2  288 ? -21.996 22.747  65.331  1.00 68.92  ? 288  VAL B CG1   1 
ATOM   4847  C  CG2   . VAL B  2  288 ? -21.209 22.665  62.975  1.00 69.64  ? 288  VAL B CG2   1 
ATOM   4848  N  N     . GLN B  2  289 ? -24.229 25.231  64.958  1.00 69.39  ? 289  GLN B N     1 
ATOM   4849  C  CA    . GLN B  2  289 ? -24.951 25.876  66.051  1.00 68.89  ? 289  GLN B CA    1 
ATOM   4850  C  C     . GLN B  2  289 ? -26.449 25.711  65.870  1.00 68.72  ? 289  GLN B C     1 
ATOM   4851  O  O     . GLN B  2  289 ? -27.191 25.506  66.831  1.00 67.57  ? 289  GLN B O     1 
ATOM   4852  C  CB    . GLN B  2  289 ? -24.585 27.349  66.112  1.00 68.47  ? 289  GLN B CB    1 
ATOM   4853  C  CG    . GLN B  2  289 ? -24.515 27.857  67.524  1.00 70.61  ? 289  GLN B CG    1 
ATOM   4854  C  CD    . GLN B  2  289 ? -23.783 26.888  68.438  1.00 71.69  ? 289  GLN B CD    1 
ATOM   4855  O  OE1   . GLN B  2  289 ? -22.594 26.620  68.266  1.00 72.87  ? 289  GLN B OE1   1 
ATOM   4856  N  NE2   . GLN B  2  289 ? -24.502 26.345  69.412  1.00 72.84  ? 289  GLN B NE2   1 
ATOM   4857  N  N     . ALA B  2  290 ? -26.878 25.803  64.621  1.00 68.73  ? 290  ALA B N     1 
ATOM   4858  C  CA    . ALA B  2  290 ? -28.277 25.633  64.274  1.00 69.24  ? 290  ALA B CA    1 
ATOM   4859  C  C     . ALA B  2  290 ? -28.661 24.185  64.537  1.00 69.26  ? 290  ALA B C     1 
ATOM   4860  O  O     . ALA B  2  290 ? -29.566 23.914  65.307  1.00 69.16  ? 290  ALA B O     1 
ATOM   4861  C  CB    . ALA B  2  290 ? -28.501 25.977  62.817  1.00 69.26  ? 290  ALA B CB    1 
ATOM   4862  N  N     . SER B  2  291 ? -27.965 23.260  63.898  1.00 69.98  ? 291  SER B N     1 
ATOM   4863  C  CA    . SER B  2  291 ? -28.232 21.828  64.077  1.00 70.63  ? 291  SER B CA    1 
ATOM   4864  C  C     . SER B  2  291 ? -28.442 21.452  65.548  1.00 70.57  ? 291  SER B C     1 
ATOM   4865  O  O     . SER B  2  291 ? -29.225 20.562  65.859  1.00 70.36  ? 291  SER B O     1 
ATOM   4866  C  CB    . SER B  2  291 ? -27.072 20.996  63.511  1.00 70.87  ? 291  SER B CB    1 
ATOM   4867  O  OG    . SER B  2  291 ? -26.845 21.299  62.147  1.00 71.25  ? 291  SER B OG    1 
ATOM   4868  N  N     . LEU B  2  292 ? -27.727 22.126  66.436  1.00 70.41  ? 292  LEU B N     1 
ATOM   4869  C  CA    . LEU B  2  292 ? -27.839 21.864  67.853  1.00 71.12  ? 292  LEU B CA    1 
ATOM   4870  C  C     . LEU B  2  292 ? -29.191 22.362  68.360  1.00 72.15  ? 292  LEU B C     1 
ATOM   4871  O  O     . LEU B  2  292 ? -29.837 21.689  69.166  1.00 73.57  ? 292  LEU B O     1 
ATOM   4872  C  CB    . LEU B  2  292 ? -26.711 22.565  68.599  1.00 69.92  ? 292  LEU B CB    1 
ATOM   4873  C  CG    . LEU B  2  292 ? -25.293 22.127  68.247  1.00 69.80  ? 292  LEU B CG    1 
ATOM   4874  C  CD1   . LEU B  2  292 ? -24.286 23.087  68.851  1.00 69.45  ? 292  LEU B CD1   1 
ATOM   4875  C  CD2   . LEU B  2  292 ? -25.059 20.717  68.747  1.00 69.10  ? 292  LEU B CD2   1 
ATOM   4876  N  N     . ALA B  2  293 ? -29.613 23.545  67.908  1.00 72.52  ? 293  ALA B N     1 
ATOM   4877  C  CA    . ALA B  2  293 ? -30.909 24.108  68.313  1.00 71.58  ? 293  ALA B CA    1 
ATOM   4878  C  C     . ALA B  2  293 ? -32.024 23.164  67.854  1.00 70.95  ? 293  ALA B C     1 
ATOM   4879  O  O     . ALA B  2  293 ? -33.107 23.139  68.423  1.00 70.52  ? 293  ALA B O     1 
ATOM   4880  C  CB    . ALA B  2  293 ? -31.102 25.473  67.679  1.00 72.17  ? 293  ALA B CB    1 
ATOM   4881  N  N     . SER B  2  294 ? -31.738 22.395  66.818  1.00 69.93  ? 294  SER B N     1 
ATOM   4882  C  CA    . SER B  2  294 ? -32.688 21.460  66.265  1.00 69.91  ? 294  SER B CA    1 
ATOM   4883  C  C     . SER B  2  294 ? -32.626 20.198  67.077  1.00 69.65  ? 294  SER B C     1 
ATOM   4884  O  O     . SER B  2  294 ? -33.262 19.195  66.735  1.00 69.33  ? 294  SER B O     1 
ATOM   4885  C  CB    . SER B  2  294 ? -32.316 21.127  64.831  1.00 70.95  ? 294  SER B CB    1 
ATOM   4886  O  OG    . SER B  2  294 ? -32.138 22.308  64.082  1.00 74.76  ? 294  SER B OG    1 
ATOM   4887  N  N     . GLY B  2  295 ? -31.831 20.243  68.143  1.00 69.51  ? 295  GLY B N     1 
ATOM   4888  C  CA    . GLY B  2  295 ? -31.657 19.085  69.015  1.00 69.49  ? 295  GLY B CA    1 
ATOM   4889  C  C     . GLY B  2  295 ? -30.896 17.956  68.338  1.00 68.61  ? 295  GLY B C     1 
ATOM   4890  O  O     . GLY B  2  295 ? -31.488 16.965  67.900  1.00 69.93  ? 295  GLY B O     1 
ATOM   4891  N  N     . ALA B  2  296 ? -29.584 18.101  68.242  1.00 66.80  ? 296  ALA B N     1 
ATOM   4892  C  CA    . ALA B  2  296 ? -28.804 17.068  67.595  1.00 65.28  ? 296  ALA B CA    1 
ATOM   4893  C  C     . ALA B  2  296 ? -27.518 16.884  68.354  1.00 64.90  ? 296  ALA B C     1 
ATOM   4894  O  O     . ALA B  2  296 ? -26.899 17.868  68.756  1.00 64.24  ? 296  ALA B O     1 
ATOM   4895  C  CB    . ALA B  2  296 ? -28.530 17.457  66.175  1.00 64.32  ? 296  ALA B CB    1 
ATOM   4896  N  N     . THR B  2  297 ? -27.127 15.626  68.552  1.00 64.74  ? 297  THR B N     1 
ATOM   4897  C  CA    . THR B  2  297 ? -25.903 15.303  69.270  1.00 64.14  ? 297  THR B CA    1 
ATOM   4898  C  C     . THR B  2  297 ? -24.789 16.142  68.671  1.00 65.07  ? 297  THR B C     1 
ATOM   4899  O  O     . THR B  2  297 ? -24.869 16.522  67.499  1.00 65.36  ? 297  THR B O     1 
ATOM   4900  C  CB    . THR B  2  297 ? -25.529 13.815  69.116  1.00 62.15  ? 297  THR B CB    1 
ATOM   4901  N  N     . LEU B  2  298 ? -23.769 16.462  69.461  1.00 64.92  ? 298  LEU B N     1 
ATOM   4902  C  CA    . LEU B  2  298 ? -22.658 17.242  68.925  1.00 65.24  ? 298  LEU B CA    1 
ATOM   4903  C  C     . LEU B  2  298 ? -22.168 16.492  67.687  1.00 66.86  ? 298  LEU B C     1 
ATOM   4904  O  O     . LEU B  2  298 ? -22.001 17.066  66.616  1.00 65.47  ? 298  LEU B O     1 
ATOM   4905  C  CB    . LEU B  2  298 ? -21.527 17.351  69.950  1.00 64.03  ? 298  LEU B CB    1 
ATOM   4906  C  CG    . LEU B  2  298 ? -20.381 18.294  69.591  1.00 61.44  ? 298  LEU B CG    1 
ATOM   4907  C  CD1   . LEU B  2  298 ? -20.967 19.545  68.985  1.00 61.07  ? 298  LEU B CD1   1 
ATOM   4908  C  CD2   . LEU B  2  298 ? -19.549 18.623  70.824  1.00 60.78  ? 298  LEU B CD2   1 
ATOM   4909  N  N     . GLU B  2  299 ? -21.948 15.196  67.852  1.00 68.70  ? 299  GLU B N     1 
ATOM   4910  C  CA    . GLU B  2  299 ? -21.521 14.368  66.751  1.00 71.63  ? 299  GLU B CA    1 
ATOM   4911  C  C     . GLU B  2  299 ? -22.455 14.584  65.580  1.00 72.72  ? 299  GLU B C     1 
ATOM   4912  O  O     . GLU B  2  299 ? -22.037 15.070  64.539  1.00 74.69  ? 299  GLU B O     1 
ATOM   4913  C  CB    . GLU B  2  299 ? -21.565 12.906  67.138  1.00 73.98  ? 299  GLU B CB    1 
ATOM   4914  C  CG    . GLU B  2  299 ? -20.540 12.505  68.183  1.00 78.14  ? 299  GLU B CG    1 
ATOM   4915  C  CD    . GLU B  2  299 ? -20.243 11.010  68.143  1.00 79.45  ? 299  GLU B CD    1 
ATOM   4916  O  OE1   . GLU B  2  299 ? -19.364 10.571  68.931  1.00 79.87  ? 299  GLU B OE1   1 
ATOM   4917  O  OE2   . GLU B  2  299 ? -20.890 10.288  67.326  1.00 79.37  ? 299  GLU B OE2   1 
ATOM   4918  N  N     . GLU B  2  300 ? -23.716 14.217  65.748  1.00 73.80  ? 300  GLU B N     1 
ATOM   4919  C  CA    . GLU B  2  300 ? -24.733 14.383  64.702  1.00 73.53  ? 300  GLU B CA    1 
ATOM   4920  C  C     . GLU B  2  300 ? -24.638 15.719  63.959  1.00 72.29  ? 300  GLU B C     1 
ATOM   4921  O  O     . GLU B  2  300 ? -24.724 15.770  62.725  1.00 70.90  ? 300  GLU B O     1 
ATOM   4922  C  CB    . GLU B  2  300 ? -26.122 14.306  65.317  1.00 77.04  ? 300  GLU B CB    1 
ATOM   4923  C  CG    . GLU B  2  300 ? -26.303 13.162  66.270  1.00 80.44  ? 300  GLU B CG    1 
ATOM   4924  C  CD    . GLU B  2  300 ? -27.654 13.188  66.946  1.00 82.66  ? 300  GLU B CD    1 
ATOM   4925  O  OE1   . GLU B  2  300 ? -27.868 12.331  67.843  1.00 84.01  ? 300  GLU B OE1   1 
ATOM   4926  O  OE2   . GLU B  2  300 ? -28.493 14.057  66.581  1.00 83.24  ? 300  GLU B OE2   1 
ATOM   4927  N  N     . ALA B  2  301 ? -24.483 16.791  64.729  1.00 70.00  ? 301  ALA B N     1 
ATOM   4928  C  CA    . ALA B  2  301 ? -24.393 18.134  64.167  1.00 68.47  ? 301  ALA B CA    1 
ATOM   4929  C  C     . ALA B  2  301 ? -23.243 18.312  63.181  1.00 66.93  ? 301  ALA B C     1 
ATOM   4930  O  O     . ALA B  2  301 ? -23.461 18.721  62.045  1.00 67.41  ? 301  ALA B O     1 
ATOM   4931  C  CB    . ALA B  2  301 ? -24.278 19.149  65.284  1.00 68.76  ? 301  ALA B CB    1 
ATOM   4932  N  N     . TRP B  2  302 ? -22.027 18.014  63.627  1.00 64.64  ? 302  TRP B N     1 
ATOM   4933  C  CA    . TRP B  2  302 ? -20.855 18.148  62.793  1.00 62.46  ? 302  TRP B CA    1 
ATOM   4934  C  C     . TRP B  2  302 ? -20.904 17.204  61.622  1.00 62.95  ? 302  TRP B C     1 
ATOM   4935  O  O     . TRP B  2  302 ? -20.616 17.585  60.489  1.00 63.90  ? 302  TRP B O     1 
ATOM   4936  C  CB    . TRP B  2  302 ? -19.594 17.886  63.597  1.00 59.40  ? 302  TRP B CB    1 
ATOM   4937  C  CG    . TRP B  2  302 ? -19.197 19.058  64.385  1.00 57.32  ? 302  TRP B CG    1 
ATOM   4938  C  CD1   . TRP B  2  302 ? -19.418 19.267  65.712  1.00 57.59  ? 302  TRP B CD1   1 
ATOM   4939  C  CD2   . TRP B  2  302 ? -18.548 20.234  63.897  1.00 55.59  ? 302  TRP B CD2   1 
ATOM   4940  N  NE1   . TRP B  2  302 ? -18.945 20.505  66.088  1.00 55.01  ? 302  TRP B NE1   1 
ATOM   4941  C  CE2   . TRP B  2  302 ? -18.406 21.118  64.990  1.00 54.77  ? 302  TRP B CE2   1 
ATOM   4942  C  CE3   . TRP B  2  302 ? -18.071 20.628  62.642  1.00 55.17  ? 302  TRP B CE3   1 
ATOM   4943  C  CZ2   . TRP B  2  302 ? -17.808 22.366  64.866  1.00 53.58  ? 302  TRP B CZ2   1 
ATOM   4944  C  CZ3   . TRP B  2  302 ? -17.475 21.876  62.520  1.00 54.46  ? 302  TRP B CZ3   1 
ATOM   4945  C  CH2   . TRP B  2  302 ? -17.349 22.728  63.629  1.00 53.46  ? 302  TRP B CH2   1 
ATOM   4946  N  N     . SER B  2  303 ? -21.279 15.969  61.904  1.00 63.02  ? 303  SER B N     1 
ATOM   4947  C  CA    . SER B  2  303 ? -21.360 14.931  60.888  1.00 63.23  ? 303  SER B CA    1 
ATOM   4948  C  C     . SER B  2  303 ? -22.238 15.367  59.713  1.00 63.51  ? 303  SER B C     1 
ATOM   4949  O  O     . SER B  2  303 ? -22.246 14.744  58.642  1.00 62.94  ? 303  SER B O     1 
ATOM   4950  C  CB    . SER B  2  303 ? -21.893 13.648  61.529  1.00 63.12  ? 303  SER B CB    1 
ATOM   4951  O  OG    . SER B  2  303 ? -21.067 13.257  62.617  1.00 63.77  ? 303  SER B OG    1 
ATOM   4952  N  N     . ALA B  2  304 ? -22.965 16.454  59.928  1.00 63.32  ? 304  ALA B N     1 
ATOM   4953  C  CA    . ALA B  2  304 ? -23.859 17.009  58.918  1.00 62.27  ? 304  ALA B CA    1 
ATOM   4954  C  C     . ALA B  2  304 ? -23.097 17.927  57.976  1.00 61.45  ? 304  ALA B C     1 
ATOM   4955  O  O     . ALA B  2  304 ? -23.487 18.124  56.826  1.00 61.34  ? 304  ALA B O     1 
ATOM   4956  C  CB    . ALA B  2  304 ? -24.971 17.781  59.600  1.00 62.73  ? 304  ALA B CB    1 
ATOM   4957  N  N     . ILE B  2  305 ? -22.014 18.501  58.480  1.00 60.38  ? 305  ILE B N     1 
ATOM   4958  C  CA    . ILE B  2  305 ? -21.207 19.402  57.685  1.00 59.09  ? 305  ILE B CA    1 
ATOM   4959  C  C     . ILE B  2  305 ? -20.644 18.693  56.455  1.00 59.08  ? 305  ILE B C     1 
ATOM   4960  O  O     . ILE B  2  305 ? -19.889 17.718  56.563  1.00 59.16  ? 305  ILE B O     1 
ATOM   4961  C  CB    . ILE B  2  305 ? -20.049 19.966  58.511  1.00 58.13  ? 305  ILE B CB    1 
ATOM   4962  C  CG1   . ILE B  2  305 ? -20.579 20.893  59.595  1.00 58.43  ? 305  ILE B CG1   1 
ATOM   4963  C  CG2   . ILE B  2  305 ? -19.132 20.748  57.617  1.00 58.69  ? 305  ILE B CG2   1 
ATOM   4964  C  CD1   . ILE B  2  305 ? -21.151 22.189  59.045  1.00 57.35  ? 305  ILE B CD1   1 
ATOM   4965  N  N     . PRO B  2  306 ? -21.014 19.168  55.262  1.00 57.36  ? 306  PRO B N     1 
ATOM   4966  C  CA    . PRO B  2  306 ? -20.506 18.538  54.038  1.00 57.57  ? 306  PRO B CA    1 
ATOM   4967  C  C     . PRO B  2  306 ? -18.964 18.568  53.994  1.00 58.46  ? 306  PRO B C     1 
ATOM   4968  O  O     . PRO B  2  306 ? -18.351 19.529  54.471  1.00 58.71  ? 306  PRO B O     1 
ATOM   4969  C  CB    . PRO B  2  306 ? -21.129 19.384  52.944  1.00 56.35  ? 306  PRO B CB    1 
ATOM   4970  C  CG    . PRO B  2  306 ? -21.272 20.719  53.610  1.00 56.51  ? 306  PRO B CG    1 
ATOM   4971  C  CD    . PRO B  2  306 ? -21.803 20.365  54.950  1.00 55.99  ? 306  PRO B CD    1 
ATOM   4972  N  N     . GLU B  2  307 ? -18.338 17.531  53.439  1.00 57.71  ? 307  GLU B N     1 
ATOM   4973  C  CA    . GLU B  2  307 ? -16.892 17.523  53.376  1.00 55.49  ? 307  GLU B CA    1 
ATOM   4974  C  C     . GLU B  2  307 ? -16.394 18.709  52.564  1.00 53.49  ? 307  GLU B C     1 
ATOM   4975  O  O     . GLU B  2  307 ? -15.477 19.445  52.981  1.00 51.45  ? 307  GLU B O     1 
ATOM   4976  C  CB    . GLU B  2  307 ? -16.391 16.221  52.764  1.00 57.01  ? 307  GLU B CB    1 
ATOM   4977  C  CG    . GLU B  2  307 ? -16.568 15.020  53.669  1.00 58.82  ? 307  GLU B CG    1 
ATOM   4978  C  CD    . GLU B  2  307 ? -15.438 13.999  53.543  1.00 61.44  ? 307  GLU B CD    1 
ATOM   4979  O  OE1   . GLU B  2  307 ? -15.240 13.433  52.445  1.00 62.96  ? 307  GLU B OE1   1 
ATOM   4980  O  OE2   . GLU B  2  307 ? -14.742 13.755  54.550  1.00 62.22  ? 307  GLU B OE2   1 
ATOM   4981  N  N     . LYS B  2  308 ? -17.017 18.901  51.414  1.00 50.78  ? 308  LYS B N     1 
ATOM   4982  C  CA    . LYS B  2  308 ? -16.616 19.981  50.538  1.00 49.69  ? 308  LYS B CA    1 
ATOM   4983  C  C     . LYS B  2  308 ? -16.442 21.293  51.282  1.00 49.83  ? 308  LYS B C     1 
ATOM   4984  O  O     . LYS B  2  308 ? -15.450 21.996  51.084  1.00 50.28  ? 308  LYS B O     1 
ATOM   4985  C  CB    . LYS B  2  308 ? -17.636 20.145  49.419  1.00 48.82  ? 308  LYS B CB    1 
ATOM   4986  C  CG    . LYS B  2  308 ? -17.075 20.893  48.214  1.00 49.93  ? 308  LYS B CG    1 
ATOM   4987  C  CD    . LYS B  2  308 ? -17.923 20.717  46.977  1.00 47.18  ? 308  LYS B CD    1 
ATOM   4988  C  CE    . LYS B  2  308 ? -17.241 21.258  45.772  1.00 46.35  ? 308  LYS B CE    1 
ATOM   4989  N  NZ    . LYS B  2  308 ? -18.002 20.849  44.591  1.00 47.40  ? 308  LYS B NZ    1 
ATOM   4990  N  N     . LEU B  2  309 ? -17.404 21.608  52.141  1.00 48.47  ? 309  LEU B N     1 
ATOM   4991  C  CA    . LEU B  2  309 ? -17.387 22.838  52.908  1.00 46.22  ? 309  LEU B CA    1 
ATOM   4992  C  C     . LEU B  2  309 ? -16.206 22.874  53.832  1.00 46.27  ? 309  LEU B C     1 
ATOM   4993  O  O     . LEU B  2  309 ? -15.458 23.833  53.848  1.00 44.86  ? 309  LEU B O     1 
ATOM   4994  C  CB    . LEU B  2  309 ? -18.663 22.967  53.720  1.00 45.09  ? 309  LEU B CB    1 
ATOM   4995  C  CG    . LEU B  2  309 ? -19.161 24.383  53.952  1.00 44.93  ? 309  LEU B CG    1 
ATOM   4996  C  CD1   . LEU B  2  309 ? -20.303 24.381  54.917  1.00 45.33  ? 309  LEU B CD1   1 
ATOM   4997  C  CD2   . LEU B  2  309 ? -18.072 25.194  54.513  1.00 47.13  ? 309  LEU B CD2   1 
ATOM   4998  N  N     . ALA B  2  310 ? -16.042 21.824  54.609  1.00 47.31  ? 310  ALA B N     1 
ATOM   4999  C  CA    . ALA B  2  310 ? -14.929 21.781  55.524  1.00 48.62  ? 310  ALA B CA    1 
ATOM   5000  C  C     . ALA B  2  310 ? -13.642 22.034  54.759  1.00 49.88  ? 310  ALA B C     1 
ATOM   5001  O  O     . ALA B  2  310 ? -12.836 22.867  55.182  1.00 50.84  ? 310  ALA B O     1 
ATOM   5002  C  CB    . ALA B  2  310 ? -14.869 20.455  56.204  1.00 48.56  ? 310  ALA B CB    1 
ATOM   5003  N  N     . PHE B  2  311 ? -13.459 21.347  53.628  1.00 48.93  ? 311  PHE B N     1 
ATOM   5004  C  CA    . PHE B  2  311 ? -12.235 21.501  52.826  1.00 49.92  ? 311  PHE B CA    1 
ATOM   5005  C  C     . PHE B  2  311 ? -11.836 22.961  52.520  1.00 51.59  ? 311  PHE B C     1 
ATOM   5006  O  O     . PHE B  2  311 ? -10.670 23.322  52.609  1.00 52.81  ? 311  PHE B O     1 
ATOM   5007  C  CB    . PHE B  2  311 ? -12.361 20.690  51.532  1.00 46.90  ? 311  PHE B CB    1 
ATOM   5008  C  CG    . PHE B  2  311 ? -11.040 20.329  50.897  1.00 44.92  ? 311  PHE B CG    1 
ATOM   5009  C  CD1   . PHE B  2  311 ? -9.980  19.920  51.660  1.00 44.77  ? 311  PHE B CD1   1 
ATOM   5010  C  CD2   . PHE B  2  311 ? -10.889 20.344  49.528  1.00 45.08  ? 311  PHE B CD2   1 
ATOM   5011  C  CE1   . PHE B  2  311 ? -8.805  19.531  51.075  1.00 43.36  ? 311  PHE B CE1   1 
ATOM   5012  C  CE2   . PHE B  2  311 ? -9.715  19.957  48.944  1.00 43.29  ? 311  PHE B CE2   1 
ATOM   5013  C  CZ    . PHE B  2  311 ? -8.677  19.549  49.719  1.00 43.21  ? 311  PHE B CZ    1 
ATOM   5014  N  N     . TYR B  2  312 ? -12.806 23.797  52.180  1.00 52.37  ? 312  TYR B N     1 
ATOM   5015  C  CA    . TYR B  2  312 ? -12.530 25.196  51.880  1.00 50.93  ? 312  TYR B CA    1 
ATOM   5016  C  C     . TYR B  2  312 ? -11.987 25.901  53.100  1.00 50.67  ? 312  TYR B C     1 
ATOM   5017  O  O     . TYR B  2  312 ? -11.311 26.921  52.981  1.00 50.40  ? 312  TYR B O     1 
ATOM   5018  C  CB    . TYR B  2  312 ? -13.811 25.909  51.453  1.00 52.07  ? 312  TYR B CB    1 
ATOM   5019  C  CG    . TYR B  2  312 ? -14.329 25.591  50.075  1.00 52.37  ? 312  TYR B CG    1 
ATOM   5020  C  CD1   . TYR B  2  312 ? -15.685 25.416  49.852  1.00 52.30  ? 312  TYR B CD1   1 
ATOM   5021  C  CD2   . TYR B  2  312 ? -13.480 25.521  48.996  1.00 52.70  ? 312  TYR B CD2   1 
ATOM   5022  C  CE1   . TYR B  2  312 ? -16.171 25.181  48.599  1.00 53.18  ? 312  TYR B CE1   1 
ATOM   5023  C  CE2   . TYR B  2  312 ? -13.959 25.289  47.734  1.00 54.68  ? 312  TYR B CE2   1 
ATOM   5024  C  CZ    . TYR B  2  312 ? -15.303 25.116  47.538  1.00 54.77  ? 312  TYR B CZ    1 
ATOM   5025  O  OH    . TYR B  2  312 ? -15.761 24.850  46.271  1.00 56.30  ? 312  TYR B OH    1 
ATOM   5026  N  N     . ASP B  2  313 ? -12.297 25.362  54.272  1.00 49.19  ? 313  ASP B N     1 
ATOM   5027  C  CA    . ASP B  2  313 ? -11.875 25.966  55.516  1.00 50.70  ? 313  ASP B CA    1 
ATOM   5028  C  C     . ASP B  2  313 ? -10.516 25.434  55.957  1.00 51.35  ? 313  ASP B C     1 
ATOM   5029  O  O     . ASP B  2  313 ? -10.291 25.179  57.140  1.00 52.90  ? 313  ASP B O     1 
ATOM   5030  C  CB    . ASP B  2  313 ? -12.945 25.719  56.584  1.00 51.81  ? 313  ASP B CB    1 
ATOM   5031  C  CG    . ASP B  2  313 ? -12.633 26.392  57.909  1.00 55.70  ? 313  ASP B CG    1 
ATOM   5032  O  OD1   . ASP B  2  313 ? -12.050 27.496  57.913  1.00 55.30  ? 313  ASP B OD1   1 
ATOM   5033  O  OD2   . ASP B  2  313 ? -12.992 25.813  58.958  1.00 56.28  ? 313  ASP B OD2   1 
ATOM   5034  N  N     . TYR B  2  314 ? -9.605  25.286  55.000  1.00 48.96  ? 314  TYR B N     1 
ATOM   5035  C  CA    . TYR B  2  314 ? -8.268  24.780  55.267  1.00 46.28  ? 314  TYR B CA    1 
ATOM   5036  C  C     . TYR B  2  314 ? -7.223  25.666  54.600  1.00 44.54  ? 314  TYR B C     1 
ATOM   5037  O  O     . TYR B  2  314 ? -7.239  25.825  53.388  1.00 43.85  ? 314  TYR B O     1 
ATOM   5038  C  CB    . TYR B  2  314 ? -8.199  23.348  54.747  1.00 46.42  ? 314  TYR B CB    1 
ATOM   5039  C  CG    . TYR B  2  314 ? -6.822  22.780  54.535  1.00 46.52  ? 314  TYR B CG    1 
ATOM   5040  C  CD1   . TYR B  2  314 ? -5.895  22.734  55.562  1.00 46.04  ? 314  TYR B CD1   1 
ATOM   5041  C  CD2   . TYR B  2  314 ? -6.469  22.237  53.309  1.00 45.97  ? 314  TYR B CD2   1 
ATOM   5042  C  CE1   . TYR B  2  314 ? -4.659  22.159  55.368  1.00 45.75  ? 314  TYR B CE1   1 
ATOM   5043  C  CE2   . TYR B  2  314 ? -5.242  21.663  53.111  1.00 45.67  ? 314  TYR B CE2   1 
ATOM   5044  C  CZ    . TYR B  2  314 ? -4.343  21.623  54.134  1.00 45.58  ? 314  TYR B CZ    1 
ATOM   5045  O  OH    . TYR B  2  314 ? -3.130  21.035  53.907  1.00 43.09  ? 314  TYR B OH    1 
ATOM   5046  N  N     . ILE B  2  315 ? -6.319  26.238  55.392  1.00 42.29  ? 315  ILE B N     1 
ATOM   5047  C  CA    . ILE B  2  315 ? -5.272  27.125  54.873  1.00 40.16  ? 315  ILE B CA    1 
ATOM   5048  C  C     . ILE B  2  315 ? -4.527  26.557  53.691  1.00 40.17  ? 315  ILE B C     1 
ATOM   5049  O  O     . ILE B  2  315 ? -3.966  27.292  52.895  1.00 38.61  ? 315  ILE B O     1 
ATOM   5050  C  CB    . ILE B  2  315 ? -4.231  27.450  55.930  1.00 39.88  ? 315  ILE B CB    1 
ATOM   5051  C  CG1   . ILE B  2  315 ? -3.593  28.796  55.639  1.00 37.90  ? 315  ILE B CG1   1 
ATOM   5052  C  CG2   . ILE B  2  315 ? -3.139  26.424  55.900  1.00 38.65  ? 315  ILE B CG2   1 
ATOM   5053  C  CD1   . ILE B  2  315 ? -2.748  29.288  56.772  1.00 39.54  ? 315  ILE B CD1   1 
ATOM   5054  N  N     . GLY B  2  316 ? -4.520  25.242  53.587  1.00 40.09  ? 316  GLY B N     1 
ATOM   5055  C  CA    . GLY B  2  316 ? -3.829  24.587  52.495  1.00 40.50  ? 316  GLY B CA    1 
ATOM   5056  C  C     . GLY B  2  316 ? -4.388  24.873  51.129  1.00 39.20  ? 316  GLY B C     1 
ATOM   5057  O  O     . GLY B  2  316 ? -3.764  24.548  50.141  1.00 39.91  ? 316  GLY B O     1 
ATOM   5058  N  N     . ASN B  2  317 ? -5.567  25.458  51.077  1.00 40.77  ? 317  ASN B N     1 
ATOM   5059  C  CA    . ASN B  2  317 ? -6.174  25.805  49.812  1.00 42.35  ? 317  ASN B CA    1 
ATOM   5060  C  C     . ASN B  2  317 ? -6.148  27.328  49.682  1.00 43.29  ? 317  ASN B C     1 
ATOM   5061  O  O     . ASN B  2  317 ? -6.826  27.900  48.843  1.00 44.01  ? 317  ASN B O     1 
ATOM   5062  C  CB    . ASN B  2  317 ? -7.615  25.294  49.729  1.00 41.46  ? 317  ASN B CB    1 
ATOM   5063  C  CG    . ASN B  2  317 ? -7.703  23.788  49.585  1.00 40.94  ? 317  ASN B CG    1 
ATOM   5064  O  OD1   . ASN B  2  317 ? -7.094  23.185  48.715  1.00 40.62  ? 317  ASN B OD1   1 
ATOM   5065  N  ND2   . ASN B  2  317 ? -8.494  23.181  50.433  1.00 40.47  ? 317  ASN B ND2   1 
ATOM   5066  N  N     . ASN B  2  318 ? -5.371  27.987  50.529  1.00 42.31  ? 318  ASN B N     1 
ATOM   5067  C  CA    . ASN B  2  318 ? -5.260  29.441  50.467  1.00 41.48  ? 318  ASN B CA    1 
ATOM   5068  C  C     . ASN B  2  318 ? -4.208  29.835  49.445  1.00 42.16  ? 318  ASN B C     1 
ATOM   5069  O  O     . ASN B  2  318 ? -3.022  29.554  49.618  1.00 40.68  ? 318  ASN B O     1 
ATOM   5070  C  CB    . ASN B  2  318 ? -4.849  30.034  51.800  1.00 39.28  ? 318  ASN B CB    1 
ATOM   5071  C  CG    . ASN B  2  318 ? -4.892  31.524  51.773  1.00 38.55  ? 318  ASN B CG    1 
ATOM   5072  O  OD1   . ASN B  2  318 ? -5.018  32.093  50.706  1.00 38.14  ? 318  ASN B OD1   1 
ATOM   5073  N  ND2   . ASN B  2  318 ? -4.793  32.172  52.930  1.00 36.58  ? 318  ASN B ND2   1 
ATOM   5074  N  N     . PRO B  2  319 ? -4.624  30.513  48.368  1.00 42.28  ? 319  PRO B N     1 
ATOM   5075  C  CA    . PRO B  2  319 ? -3.721  30.950  47.300  1.00 40.97  ? 319  PRO B CA    1 
ATOM   5076  C  C     . PRO B  2  319 ? -2.579  31.801  47.815  1.00 40.64  ? 319  PRO B C     1 
ATOM   5077  O  O     . PRO B  2  319 ? -1.580  31.977  47.141  1.00 39.71  ? 319  PRO B O     1 
ATOM   5078  C  CB    . PRO B  2  319 ? -4.638  31.725  46.389  1.00 40.70  ? 319  PRO B CB    1 
ATOM   5079  C  CG    . PRO B  2  319 ? -5.926  31.031  46.578  1.00 43.12  ? 319  PRO B CG    1 
ATOM   5080  C  CD    . PRO B  2  319 ? -6.004  30.894  48.053  1.00 41.95  ? 319  PRO B CD    1 
ATOM   5081  N  N     . ALA B  2  320 ? -2.741  32.320  49.018  1.00 39.78  ? 320  ALA B N     1 
ATOM   5082  C  CA    . ALA B  2  320 ? -1.724  33.147  49.624  1.00 41.65  ? 320  ALA B CA    1 
ATOM   5083  C  C     . ALA B  2  320 ? -0.530  32.344  50.081  1.00 43.41  ? 320  ALA B C     1 
ATOM   5084  O  O     . ALA B  2  320 ? 0.572   32.867  50.121  1.00 46.62  ? 320  ALA B O     1 
ATOM   5085  C  CB    . ALA B  2  320 ? -2.290  33.904  50.781  1.00 42.09  ? 320  ALA B CB    1 
ATOM   5086  N  N     . LYS B  2  321 ? -0.727  31.091  50.454  1.00 43.27  ? 321  LYS B N     1 
ATOM   5087  C  CA    . LYS B  2  321 ? 0.398   30.274  50.883  1.00 42.77  ? 321  LYS B CA    1 
ATOM   5088  C  C     . LYS B  2  321 ? 1.124   29.965  49.603  1.00 42.72  ? 321  LYS B C     1 
ATOM   5089  O  O     . LYS B  2  321 ? 0.735   30.473  48.561  1.00 44.40  ? 321  LYS B O     1 
ATOM   5090  C  CB    . LYS B  2  321 ? -0.097  28.999  51.537  1.00 42.48  ? 321  LYS B CB    1 
ATOM   5091  C  CG    . LYS B  2  321 ? -0.973  29.258  52.765  1.00 43.26  ? 321  LYS B CG    1 
ATOM   5092  C  CD    . LYS B  2  321 ? -0.230  29.994  53.870  1.00 41.34  ? 321  LYS B CD    1 
ATOM   5093  C  CE    . LYS B  2  321 ? 0.970   29.208  54.346  1.00 42.22  ? 321  LYS B CE    1 
ATOM   5094  N  NZ    . LYS B  2  321 ? 1.678   29.895  55.423  1.00 41.47  ? 321  LYS B NZ    1 
ATOM   5095  N  N     . GLY B  2  322 ? 2.168   29.163  49.624  1.00 41.98  ? 322  GLY B N     1 
ATOM   5096  C  CA    . GLY B  2  322 ? 2.824   28.902  48.354  1.00 45.19  ? 322  GLY B CA    1 
ATOM   5097  C  C     . GLY B  2  322 ? 4.115   29.655  48.078  1.00 45.84  ? 322  GLY B C     1 
ATOM   5098  O  O     . GLY B  2  322 ? 4.528   30.510  48.851  1.00 45.20  ? 322  GLY B O     1 
ATOM   5099  N  N     . GLY B  2  323 ? 4.756   29.341  46.964  1.00 45.94  ? 323  GLY B N     1 
ATOM   5100  C  CA    . GLY B  2  323 ? 6.021   29.982  46.649  1.00 47.40  ? 323  GLY B CA    1 
ATOM   5101  C  C     . GLY B  2  323 ? 6.271   30.065  45.166  1.00 47.80  ? 323  GLY B C     1 
ATOM   5102  O  O     . GLY B  2  323 ? 5.680   29.312  44.409  1.00 49.14  ? 323  GLY B O     1 
ATOM   5103  N  N     . LEU B  2  324 ? 7.158   30.972  44.763  1.00 48.62  ? 324  LEU B N     1 
ATOM   5104  C  CA    . LEU B  2  324 ? 7.484   31.213  43.354  1.00 47.74  ? 324  LEU B CA    1 
ATOM   5105  C  C     . LEU B  2  324 ? 8.069   30.021  42.609  1.00 48.20  ? 324  LEU B C     1 
ATOM   5106  O  O     . LEU B  2  324 ? 7.731   29.799  41.448  1.00 49.38  ? 324  LEU B O     1 
ATOM   5107  C  CB    . LEU B  2  324 ? 8.425   32.415  43.227  1.00 45.27  ? 324  LEU B CB    1 
ATOM   5108  C  CG    . LEU B  2  324 ? 9.044   32.805  41.894  1.00 41.71  ? 324  LEU B CG    1 
ATOM   5109  C  CD1   . LEU B  2  324 ? 7.982   33.007  40.877  1.00 43.55  ? 324  LEU B CD1   1 
ATOM   5110  C  CD2   . LEU B  2  324 ? 9.843   34.060  42.063  1.00 40.31  ? 324  LEU B CD2   1 
ATOM   5111  N  N     . PHE B  2  325 ? 8.939   29.254  43.252  1.00 47.40  ? 325  PHE B N     1 
ATOM   5112  C  CA    . PHE B  2  325 ? 9.496   28.108  42.566  1.00 46.25  ? 325  PHE B CA    1 
ATOM   5113  C  C     . PHE B  2  325 ? 8.958   26.769  43.042  1.00 46.65  ? 325  PHE B C     1 
ATOM   5114  O  O     . PHE B  2  325 ? 9.460   25.716  42.652  1.00 46.69  ? 325  PHE B O     1 
ATOM   5115  C  CB    . PHE B  2  325 ? 11.007  28.156  42.635  1.00 44.36  ? 325  PHE B CB    1 
ATOM   5116  C  CG    . PHE B  2  325 ? 11.576  29.284  41.880  1.00 41.84  ? 325  PHE B CG    1 
ATOM   5117  C  CD1   . PHE B  2  325 ? 11.959  30.430  42.519  1.00 41.82  ? 325  PHE B CD1   1 
ATOM   5118  C  CD2   . PHE B  2  325 ? 11.656  29.228  40.515  1.00 42.85  ? 325  PHE B CD2   1 
ATOM   5119  C  CE1   . PHE B  2  325 ? 12.410  31.512  41.806  1.00 42.22  ? 325  PHE B CE1   1 
ATOM   5120  C  CE2   . PHE B  2  325 ? 12.108  30.306  39.792  1.00 44.19  ? 325  PHE B CE2   1 
ATOM   5121  C  CZ    . PHE B  2  325 ? 12.483  31.452  40.443  1.00 43.79  ? 325  PHE B CZ    1 
ATOM   5122  N  N     . ARG B  2  326 ? 7.928   26.819  43.882  1.00 46.28  ? 326  ARG B N     1 
ATOM   5123  C  CA    . ARG B  2  326 ? 7.276   25.617  44.369  1.00 45.58  ? 326  ARG B CA    1 
ATOM   5124  C  C     . ARG B  2  326 ? 6.307   25.214  43.261  1.00 45.00  ? 326  ARG B C     1 
ATOM   5125  O  O     . ARG B  2  326 ? 5.107   25.467  43.308  1.00 45.31  ? 326  ARG B O     1 
ATOM   5126  C  CB    . ARG B  2  326 ? 6.549   25.901  45.664  1.00 44.96  ? 326  ARG B CB    1 
ATOM   5127  C  CG    . ARG B  2  326 ? 7.481   26.031  46.841  1.00 46.09  ? 326  ARG B CG    1 
ATOM   5128  C  CD    . ARG B  2  326 ? 6.702   26.205  48.132  1.00 46.88  ? 326  ARG B CD    1 
ATOM   5129  N  NE    . ARG B  2  326 ? 7.579   26.590  49.220  1.00 48.91  ? 326  ARG B NE    1 
ATOM   5130  C  CZ    . ARG B  2  326 ? 7.168   27.218  50.308  1.00 50.59  ? 326  ARG B CZ    1 
ATOM   5131  N  NH1   . ARG B  2  326 ? 5.889   27.526  50.450  1.00 51.57  ? 326  ARG B NH1   1 
ATOM   5132  N  NH2   . ARG B  2  326 ? 8.044   27.551  51.242  1.00 50.54  ? 326  ARG B NH2   1 
ATOM   5133  N  N     . THR B  2  327 ? 6.889   24.583  42.256  1.00 43.86  ? 327  THR B N     1 
ATOM   5134  C  CA    . THR B  2  327 ? 6.219   24.150  41.056  1.00 44.03  ? 327  THR B CA    1 
ATOM   5135  C  C     . THR B  2  327 ? 5.280   23.006  41.246  1.00 44.72  ? 327  THR B C     1 
ATOM   5136  O  O     . THR B  2  327 ? 5.410   22.260  42.202  1.00 45.44  ? 327  THR B O     1 
ATOM   5137  C  CB    . THR B  2  327 ? 7.266   23.739  40.035  1.00 44.36  ? 327  THR B CB    1 
ATOM   5138  O  OG1   . THR B  2  327 ? 8.199   22.854  40.656  1.00 43.93  ? 327  THR B OG1   1 
ATOM   5139  C  CG2   . THR B  2  327 ? 8.025   24.920  39.552  1.00 43.17  ? 327  THR B CG2   1 
ATOM   5140  N  N     . GLY B  2  328 ? 4.347   22.861  40.313  1.00 44.75  ? 328  GLY B N     1 
ATOM   5141  C  CA    . GLY B  2  328 ? 3.412   21.760  40.352  1.00 45.20  ? 328  GLY B CA    1 
ATOM   5142  C  C     . GLY B  2  328 ? 2.066   22.104  40.927  1.00 47.74  ? 328  GLY B C     1 
ATOM   5143  O  O     . GLY B  2  328 ? 1.837   23.255  41.321  1.00 48.50  ? 328  GLY B O     1 
ATOM   5144  N  N     . PRO B  2  329 ? 1.151   21.125  40.994  1.00 47.51  ? 329  PRO B N     1 
ATOM   5145  C  CA    . PRO B  2  329 ? -0.208  21.264  41.524  1.00 49.19  ? 329  PRO B CA    1 
ATOM   5146  C  C     . PRO B  2  329 ? -0.184  21.309  43.045  1.00 50.42  ? 329  PRO B C     1 
ATOM   5147  O  O     . PRO B  2  329 ? 0.805   20.945  43.659  1.00 51.33  ? 329  PRO B O     1 
ATOM   5148  C  CB    . PRO B  2  329 ? -0.898  20.023  41.011  1.00 46.48  ? 329  PRO B CB    1 
ATOM   5149  C  CG    . PRO B  2  329 ? 0.156   19.044  41.093  1.00 47.62  ? 329  PRO B CG    1 
ATOM   5150  C  CD    . PRO B  2  329 ? 1.400   19.738  40.599  1.00 45.57  ? 329  PRO B CD    1 
ATOM   5151  N  N     . MET B  2  330 ? -1.267  21.740  43.657  1.00 51.20  ? 330  MET B N     1 
ATOM   5152  C  CA    . MET B  2  330 ? -1.272  21.821  45.093  1.00 52.51  ? 330  MET B CA    1 
ATOM   5153  C  C     . MET B  2  330 ? -1.033  20.470  45.743  1.00 53.94  ? 330  MET B C     1 
ATOM   5154  O  O     . MET B  2  330 ? -0.597  20.406  46.903  1.00 55.94  ? 330  MET B O     1 
ATOM   5155  C  CB    . MET B  2  330 ? -2.581  22.409  45.565  1.00 54.13  ? 330  MET B CB    1 
ATOM   5156  C  CG    . MET B  2  330 ? -2.748  23.817  45.108  1.00 57.58  ? 330  MET B CG    1 
ATOM   5157  S  SD    . MET B  2  330 ? -4.269  24.539  45.609  1.00 59.61  ? 330  MET B SD    1 
ATOM   5158  C  CE    . MET B  2  330 ? -3.738  25.507  46.988  1.00 58.73  ? 330  MET B CE    1 
ATOM   5159  N  N     . ASN B  2  331 ? -1.303  19.393  45.006  1.00 53.11  ? 331  ASN B N     1 
ATOM   5160  C  CA    . ASN B  2  331 ? -1.110  18.047  45.536  1.00 51.19  ? 331  ASN B CA    1 
ATOM   5161  C  C     . ASN B  2  331 ? 0.322   17.587  45.678  1.00 49.39  ? 331  ASN B C     1 
ATOM   5162  O  O     . ASN B  2  331 ? 0.568   16.537  46.247  1.00 47.74  ? 331  ASN B O     1 
ATOM   5163  C  CB    . ASN B  2  331 ? -1.837  17.029  44.687  1.00 52.76  ? 331  ASN B CB    1 
ATOM   5164  C  CG    . ASN B  2  331 ? -3.296  17.210  44.721  1.00 53.80  ? 331  ASN B CG    1 
ATOM   5165  O  OD1   . ASN B  2  331 ? -3.843  17.659  45.719  1.00 54.73  ? 331  ASN B OD1   1 
ATOM   5166  N  ND2   . ASN B  2  331 ? -3.957  16.839  43.640  1.00 53.18  ? 331  ASN B ND2   1 
ATOM   5167  N  N     . LYS B  2  332 ? 1.270   18.337  45.150  1.00 47.22  ? 332  LYS B N     1 
ATOM   5168  C  CA    . LYS B  2  332 ? 2.649   17.927  45.302  1.00 46.96  ? 332  LYS B CA    1 
ATOM   5169  C  C     . LYS B  2  332 ? 3.068   18.440  46.661  1.00 46.93  ? 332  LYS B C     1 
ATOM   5170  O  O     . LYS B  2  332 ? 4.055   17.995  47.233  1.00 47.43  ? 332  LYS B O     1 
ATOM   5171  C  CB    . LYS B  2  332 ? 3.524   18.530  44.208  1.00 47.99  ? 332  LYS B CB    1 
ATOM   5172  C  CG    . LYS B  2  332 ? 5.011   18.189  44.305  1.00 49.74  ? 332  LYS B CG    1 
ATOM   5173  C  CD    . LYS B  2  332 ? 5.359   16.797  43.791  1.00 49.62  ? 332  LYS B CD    1 
ATOM   5174  C  CE    . LYS B  2  332 ? 6.853   16.521  43.918  1.00 49.98  ? 332  LYS B CE    1 
ATOM   5175  N  NZ    . LYS B  2  332 ? 7.272   15.434  43.003  1.00 49.82  ? 332  LYS B NZ    1 
ATOM   5176  N  N     . GLY B  2  333 ? 2.293   19.376  47.182  1.00 46.97  ? 333  GLY B N     1 
ATOM   5177  C  CA    . GLY B  2  333 ? 2.587   19.934  48.486  1.00 46.10  ? 333  GLY B CA    1 
ATOM   5178  C  C     . GLY B  2  333 ? 2.161   19.048  49.635  1.00 45.20  ? 333  GLY B C     1 
ATOM   5179  O  O     . GLY B  2  333 ? 2.859   18.111  50.008  1.00 43.72  ? 333  GLY B O     1 
ATOM   5180  N  N     . ASP B  2  334 ? 0.998   19.336  50.184  1.00 45.37  ? 334  ASP B N     1 
ATOM   5181  C  CA    . ASP B  2  334 ? 0.519   18.578  51.318  1.00 46.01  ? 334  ASP B CA    1 
ATOM   5182  C  C     . ASP B  2  334 ? -0.050  17.223  51.019  1.00 46.13  ? 334  ASP B C     1 
ATOM   5183  O  O     . ASP B  2  334 ? -0.377  16.490  51.943  1.00 45.29  ? 334  ASP B O     1 
ATOM   5184  C  CB    . ASP B  2  334 ? -0.493  19.398  52.108  1.00 47.35  ? 334  ASP B CB    1 
ATOM   5185  C  CG    . ASP B  2  334 ? -1.630  19.918  51.258  1.00 48.06  ? 334  ASP B CG    1 
ATOM   5186  O  OD1   . ASP B  2  334 ? -2.360  20.797  51.750  1.00 47.98  ? 334  ASP B OD1   1 
ATOM   5187  O  OD2   . ASP B  2  334 ? -1.804  19.451  50.119  1.00 48.98  ? 334  ASP B OD2   1 
ATOM   5188  N  N     . GLY B  2  335 ? -0.174  16.897  49.735  1.00 47.32  ? 335  GLY B N     1 
ATOM   5189  C  CA    . GLY B  2  335 ? -0.699  15.602  49.314  1.00 48.40  ? 335  GLY B CA    1 
ATOM   5190  C  C     . GLY B  2  335 ? -2.091  15.617  48.701  1.00 48.86  ? 335  GLY B C     1 
ATOM   5191  O  O     . GLY B  2  335 ? -2.702  16.667  48.591  1.00 51.54  ? 335  GLY B O     1 
ATOM   5192  N  N     . ILE B  2  336 ? -2.596  14.457  48.299  1.00 48.47  ? 336  ILE B N     1 
ATOM   5193  C  CA    . ILE B  2  336 ? -3.927  14.366  47.709  1.00 47.08  ? 336  ILE B CA    1 
ATOM   5194  C  C     . ILE B  2  336 ? -4.983  14.156  48.794  1.00 47.85  ? 336  ILE B C     1 
ATOM   5195  O  O     . ILE B  2  336 ? -5.029  13.093  49.416  1.00 47.41  ? 336  ILE B O     1 
ATOM   5196  C  CB    . ILE B  2  336 ? -4.038  13.187  46.752  1.00 46.54  ? 336  ILE B CB    1 
ATOM   5197  C  CG1   . ILE B  2  336 ? -2.977  13.270  45.671  1.00 46.20  ? 336  ILE B CG1   1 
ATOM   5198  C  CG2   . ILE B  2  336 ? -5.387  13.178  46.129  1.00 46.95  ? 336  ILE B CG2   1 
ATOM   5199  C  CD1   . ILE B  2  336 ? -3.012  12.127  44.695  1.00 43.92  ? 336  ILE B CD1   1 
ATOM   5200  N  N     . ALA B  2  337 ? -5.834  15.159  49.011  1.00 47.92  ? 337  ALA B N     1 
ATOM   5201  C  CA    . ALA B  2  337 ? -6.882  15.078  50.022  1.00 47.15  ? 337  ALA B CA    1 
ATOM   5202  C  C     . ALA B  2  337 ? -7.714  13.810  49.849  1.00 47.99  ? 337  ALA B C     1 
ATOM   5203  O  O     . ALA B  2  337 ? -8.267  13.552  48.780  1.00 48.26  ? 337  ALA B O     1 
ATOM   5204  C  CB    . ALA B  2  337 ? -7.765  16.305  49.952  1.00 45.66  ? 337  ALA B CB    1 
ATOM   5205  N  N     . GLN B  2  338 ? -7.794  13.028  50.921  1.00 48.74  ? 338  GLN B N     1 
ATOM   5206  C  CA    . GLN B  2  338 ? -8.537  11.777  50.924  1.00 50.13  ? 338  GLN B CA    1 
ATOM   5207  C  C     . GLN B  2  338 ? -9.845  11.857  51.709  1.00 50.20  ? 338  GLN B C     1 
ATOM   5208  O  O     . GLN B  2  338 ? -10.880 11.353  51.271  1.00 50.36  ? 338  GLN B O     1 
ATOM   5209  C  CB    . GLN B  2  338 ? -7.664  10.680  51.516  1.00 50.93  ? 338  GLN B CB    1 
ATOM   5210  C  CG    . GLN B  2  338 ? -6.445  10.312  50.714  1.00 53.36  ? 338  GLN B CG    1 
ATOM   5211  C  CD    . GLN B  2  338 ? -6.801  9.479   49.506  1.00 57.64  ? 338  GLN B CD    1 
ATOM   5212  O  OE1   . GLN B  2  338 ? -6.997  9.998   48.407  1.00 58.47  ? 338  GLN B OE1   1 
ATOM   5213  N  NE2   . GLN B  2  338 ? -6.907  8.168   49.710  1.00 59.61  ? 338  GLN B NE2   1 
ATOM   5214  N  N     . ALA B  2  339 ? -9.795  12.481  52.872  1.00 49.92  ? 339  ALA B N     1 
ATOM   5215  C  CA    . ALA B  2  339 ? -10.986 12.583  53.685  1.00 50.97  ? 339  ALA B CA    1 
ATOM   5216  C  C     . ALA B  2  339 ? -10.855 13.500  54.897  1.00 52.19  ? 339  ALA B C     1 
ATOM   5217  O  O     . ALA B  2  339 ? -9.762  13.753  55.401  1.00 53.48  ? 339  ALA B O     1 
ATOM   5218  C  CB    . ALA B  2  339 ? -11.406 11.202  54.121  1.00 50.54  ? 339  ALA B CB    1 
ATOM   5219  N  N     . TRP B  2  340 ? -11.998 13.997  55.347  1.00 52.09  ? 340  TRP B N     1 
ATOM   5220  C  CA    . TRP B  2  340 ? -12.064 14.893  56.483  1.00 51.96  ? 340  TRP B CA    1 
ATOM   5221  C  C     . TRP B  2  340 ? -12.046 14.057  57.738  1.00 52.55  ? 340  TRP B C     1 
ATOM   5222  O  O     . TRP B  2  340 ? -12.959 13.276  57.982  1.00 53.11  ? 340  TRP B O     1 
ATOM   5223  C  CB    . TRP B  2  340 ? -13.348 15.738  56.408  1.00 49.68  ? 340  TRP B CB    1 
ATOM   5224  C  CG    . TRP B  2  340 ? -13.546 16.686  57.543  1.00 47.95  ? 340  TRP B CG    1 
ATOM   5225  C  CD1   . TRP B  2  340 ? -12.591 17.420  58.167  1.00 48.07  ? 340  TRP B CD1   1 
ATOM   5226  C  CD2   . TRP B  2  340 ? -14.780 17.007  58.185  1.00 47.93  ? 340  TRP B CD2   1 
ATOM   5227  N  NE1   . TRP B  2  340 ? -13.146 18.175  59.163  1.00 47.93  ? 340  TRP B NE1   1 
ATOM   5228  C  CE2   . TRP B  2  340 ? -14.493 17.938  59.194  1.00 48.49  ? 340  TRP B CE2   1 
ATOM   5229  C  CE3   . TRP B  2  340 ? -16.101 16.596  58.008  1.00 47.60  ? 340  TRP B CE3   1 
ATOM   5230  C  CZ2   . TRP B  2  340 ? -15.481 18.465  60.022  1.00 48.81  ? 340  TRP B CZ2   1 
ATOM   5231  C  CZ3   . TRP B  2  340 ? -17.078 17.120  58.831  1.00 46.85  ? 340  TRP B CZ3   1 
ATOM   5232  C  CH2   . TRP B  2  340 ? -16.763 18.042  59.823  1.00 48.19  ? 340  TRP B CH2   1 
ATOM   5233  N  N     . LYS B  2  341 ? -10.992 14.212  58.528  1.00 52.95  ? 341  LYS B N     1 
ATOM   5234  C  CA    . LYS B  2  341 ? -10.863 13.472  59.776  1.00 52.85  ? 341  LYS B CA    1 
ATOM   5235  C  C     . LYS B  2  341 ? -11.819 13.977  60.845  1.00 52.53  ? 341  LYS B C     1 
ATOM   5236  O  O     . LYS B  2  341 ? -11.828 13.439  61.928  1.00 53.88  ? 341  LYS B O     1 
ATOM   5237  C  CB    . LYS B  2  341 ? -9.421  13.553  60.296  1.00 52.49  ? 341  LYS B CB    1 
ATOM   5238  C  CG    . LYS B  2  341 ? -8.437  12.708  59.505  1.00 53.46  ? 341  LYS B CG    1 
ATOM   5239  C  CD    . LYS B  2  341 ? -7.056  13.312  59.528  1.00 53.51  ? 341  LYS B CD    1 
ATOM   5240  C  CE    . LYS B  2  341 ? -6.424  13.207  60.881  1.00 55.08  ? 341  LYS B CE    1 
ATOM   5241  N  NZ    . LYS B  2  341 ? -5.774  11.886  61.062  1.00 58.75  ? 341  LYS B NZ    1 
ATOM   5242  N  N     . GLY B  2  342 ? -12.618 14.998  60.560  1.00 52.64  ? 342  GLY B N     1 
ATOM   5243  C  CA    . GLY B  2  342 ? -13.540 15.517  61.559  1.00 53.17  ? 342  GLY B CA    1 
ATOM   5244  C  C     . GLY B  2  342 ? -13.110 16.779  62.317  1.00 54.13  ? 342  GLY B C     1 
ATOM   5245  O  O     . GLY B  2  342 ? -11.948 17.189  62.310  1.00 52.36  ? 342  GLY B O     1 
ATOM   5246  N  N     . HIS B  2  343 ? -14.065 17.403  62.983  1.00 54.08  ? 343  HIS B N     1 
ATOM   5247  C  CA    . HIS B  2  343 ? -13.740 18.610  63.726  1.00 55.19  ? 343  HIS B CA    1 
ATOM   5248  C  C     . HIS B  2  343 ? -13.102 18.281  65.059  1.00 55.96  ? 343  HIS B C     1 
ATOM   5249  O  O     . HIS B  2  343 ? -13.581 17.436  65.792  1.00 56.23  ? 343  HIS B O     1 
ATOM   5250  C  CB    . HIS B  2  343 ? -14.988 19.468  63.941  1.00 53.81  ? 343  HIS B CB    1 
ATOM   5251  C  CG    . HIS B  2  343 ? -14.713 20.752  64.648  1.00 49.58  ? 343  HIS B CG    1 
ATOM   5252  N  ND1   . HIS B  2  343 ? -15.126 20.987  65.939  1.00 47.58  ? 343  HIS B ND1   1 
ATOM   5253  C  CD2   . HIS B  2  343 ? -14.012 21.840  64.268  1.00 47.21  ? 343  HIS B CD2   1 
ATOM   5254  C  CE1   . HIS B  2  343 ? -14.686 22.167  66.329  1.00 48.41  ? 343  HIS B CE1   1 
ATOM   5255  N  NE2   . HIS B  2  343 ? -14.007 22.703  65.333  1.00 50.31  ? 343  HIS B NE2   1 
ATOM   5256  N  N     . ALA B  2  344 ? -12.034 18.980  65.386  1.00 57.51  ? 344  ALA B N     1 
ATOM   5257  C  CA    . ALA B  2  344 ? -11.335 18.719  66.622  1.00 58.56  ? 344  ALA B CA    1 
ATOM   5258  C  C     . ALA B  2  344 ? -11.542 19.764  67.714  1.00 59.17  ? 344  ALA B C     1 
ATOM   5259  O  O     . ALA B  2  344 ? -11.216 20.936  67.524  1.00 60.14  ? 344  ALA B O     1 
ATOM   5260  C  CB    . ALA B  2  344 ? -9.867  18.568  66.331  1.00 58.88  ? 344  ALA B CB    1 
ATOM   5261  N  N     . VAL B  2  345 ? -12.083 19.335  68.850  1.00 59.40  ? 345  VAL B N     1 
ATOM   5262  C  CA    . VAL B  2  345 ? -12.279 20.228  69.988  1.00 61.21  ? 345  VAL B CA    1 
ATOM   5263  C  C     . VAL B  2  345 ? -11.175 19.866  71.004  1.00 60.99  ? 345  VAL B C     1 
ATOM   5264  O  O     . VAL B  2  345 ? -10.886 18.687  71.257  1.00 60.98  ? 345  VAL B O     1 
ATOM   5265  C  CB    . VAL B  2  345 ? -13.674 20.054  70.634  1.00 61.77  ? 345  VAL B CB    1 
ATOM   5266  C  CG1   . VAL B  2  345 ? -14.761 20.172  69.585  1.00 61.73  ? 345  VAL B CG1   1 
ATOM   5267  C  CG2   . VAL B  2  345 ? -13.773 18.722  71.298  1.00 64.32  ? 345  VAL B CG2   1 
ATOM   5268  N  N     . PHE B  2  346 ? -10.543 20.882  71.566  1.00 60.15  ? 346  PHE B N     1 
ATOM   5269  C  CA    . PHE B  2  346 ? -9.460  20.654  72.502  1.00 59.33  ? 346  PHE B CA    1 
ATOM   5270  C  C     . PHE B  2  346 ? -9.876  21.147  73.864  1.00 60.69  ? 346  PHE B C     1 
ATOM   5271  O  O     . PHE B  2  346 ? -10.072 22.346  74.043  1.00 62.78  ? 346  PHE B O     1 
ATOM   5272  C  CB    . PHE B  2  346 ? -8.218  21.437  72.062  1.00 56.08  ? 346  PHE B CB    1 
ATOM   5273  C  CG    . PHE B  2  346 ? -7.606  20.952  70.797  1.00 51.79  ? 346  PHE B CG    1 
ATOM   5274  C  CD1   . PHE B  2  346 ? -6.586  20.026  70.825  1.00 51.12  ? 346  PHE B CD1   1 
ATOM   5275  C  CD2   . PHE B  2  346 ? -8.046  21.422  69.576  1.00 50.78  ? 346  PHE B CD2   1 
ATOM   5276  C  CE1   . PHE B  2  346 ? -6.008  19.575  69.658  1.00 50.95  ? 346  PHE B CE1   1 
ATOM   5277  C  CE2   . PHE B  2  346 ? -7.476  20.978  68.401  1.00 50.67  ? 346  PHE B CE2   1 
ATOM   5278  C  CZ    . PHE B  2  346 ? -6.452  20.051  68.444  1.00 51.32  ? 346  PHE B CZ    1 
ATOM   5279  N  N     . ARG B  2  347 ? -10.006 20.236  74.821  1.00 61.81  ? 347  ARG B N     1 
ATOM   5280  C  CA    . ARG B  2  347 ? -10.365 20.612  76.191  1.00 62.57  ? 347  ARG B CA    1 
ATOM   5281  C  C     . ARG B  2  347 ? -9.151  20.409  77.107  1.00 63.29  ? 347  ARG B C     1 
ATOM   5282  O  O     . ARG B  2  347 ? -8.290  19.560  76.831  1.00 63.35  ? 347  ARG B O     1 
ATOM   5283  C  CB    . ARG B  2  347 ? -11.525 19.752  76.705  1.00 61.44  ? 347  ARG B CB    1 
ATOM   5284  C  CG    . ARG B  2  347 ? -12.806 19.912  75.932  1.00 60.92  ? 347  ARG B CG    1 
ATOM   5285  C  CD    . ARG B  2  347 ? -13.819 18.919  76.405  1.00 60.02  ? 347  ARG B CD    1 
ATOM   5286  N  NE    . ARG B  2  347 ? -14.482 18.250  75.292  1.00 61.46  ? 347  ARG B NE    1 
ATOM   5287  C  CZ    . ARG B  2  347 ? -15.503 18.759  74.608  1.00 64.07  ? 347  ARG B CZ    1 
ATOM   5288  N  NH1   . ARG B  2  347 ? -15.996 19.969  74.914  1.00 64.36  ? 347  ARG B NH1   1 
ATOM   5289  N  NH2   . ARG B  2  347 ? -16.059 18.034  73.638  1.00 64.00  ? 347  ARG B NH2   1 
ATOM   5290  N  N     . ASN B  2  348 ? -9.073  21.187  78.178  1.00 62.89  ? 348  ASN B N     1 
ATOM   5291  C  CA    . ASN B  2  348 ? -7.973  21.003  79.103  1.00 63.92  ? 348  ASN B CA    1 
ATOM   5292  C  C     . ASN B  2  348 ? -8.496  20.115  80.224  1.00 64.97  ? 348  ASN B C     1 
ATOM   5293  O  O     . ASN B  2  348 ? -9.585  19.543  80.128  1.00 64.28  ? 348  ASN B O     1 
ATOM   5294  C  CB    . ASN B  2  348 ? -7.506  22.329  79.667  1.00 63.40  ? 348  ASN B CB    1 
ATOM   5295  C  CG    . ASN B  2  348 ? -8.559  22.981  80.485  1.00 62.96  ? 348  ASN B CG    1 
ATOM   5296  O  OD1   . ASN B  2  348 ? -9.729  22.655  80.347  1.00 63.34  ? 348  ASN B OD1   1 
ATOM   5297  N  ND2   . ASN B  2  348 ? -8.169  23.916  81.333  1.00 62.70  ? 348  ASN B ND2   1 
ATOM   5298  N  N     . LYS B  2  349 ? -7.715  20.009  81.286  1.00 67.08  ? 349  LYS B N     1 
ATOM   5299  C  CA    . LYS B  2  349 ? -8.068  19.167  82.416  1.00 68.87  ? 349  LYS B CA    1 
ATOM   5300  C  C     . LYS B  2  349 ? -9.374  19.565  83.075  1.00 68.37  ? 349  LYS B C     1 
ATOM   5301  O  O     . LYS B  2  349 ? -10.107 18.709  83.575  1.00 68.01  ? 349  LYS B O     1 
ATOM   5302  C  CB    . LYS B  2  349 ? -6.940  19.195  83.449  1.00 71.96  ? 349  LYS B CB    1 
ATOM   5303  C  CG    . LYS B  2  349 ? -7.031  18.068  84.468  1.00 77.17  ? 349  LYS B CG    1 
ATOM   5304  C  CD    . LYS B  2  349 ? -5.661  17.734  85.080  1.00 79.36  ? 349  LYS B CD    1 
ATOM   5305  C  CE    . LYS B  2  349 ? -5.652  16.343  85.745  1.00 79.86  ? 349  LYS B CE    1 
ATOM   5306  N  NZ    . LYS B  2  349 ? -4.257  15.869  85.995  1.00 79.65  ? 349  LYS B NZ    1 
ATOM   5307  N  N     . GLU B  2  350 ? -9.655  20.862  83.082  1.00 68.69  ? 350  GLU B N     1 
ATOM   5308  C  CA    . GLU B  2  350 ? -10.875 21.376  83.698  1.00 69.39  ? 350  GLU B CA    1 
ATOM   5309  C  C     . GLU B  2  350 ? -12.086 21.137  82.828  1.00 68.72  ? 350  GLU B C     1 
ATOM   5310  O  O     . GLU B  2  350 ? -13.196 21.406  83.249  1.00 68.87  ? 350  GLU B O     1 
ATOM   5311  C  CB    . GLU B  2  350 ? -10.755 22.875  83.969  1.00 71.38  ? 350  GLU B CB    1 
ATOM   5312  C  CG    . GLU B  2  350 ? -9.782  23.260  85.078  1.00 74.74  ? 350  GLU B CG    1 
ATOM   5313  C  CD    . GLU B  2  350 ? -8.604  22.302  85.191  1.00 77.33  ? 350  GLU B CD    1 
ATOM   5314  O  OE1   . GLU B  2  350 ? -8.844  21.149  85.624  1.00 78.69  ? 350  GLU B OE1   1 
ATOM   5315  O  OE2   . GLU B  2  350 ? -7.448  22.681  84.855  1.00 77.31  ? 350  GLU B OE2   1 
ATOM   5316  N  N     . GLY B  2  351 ? -11.883 20.640  81.618  1.00 67.38  ? 351  GLY B N     1 
ATOM   5317  C  CA    . GLY B  2  351 ? -13.013 20.398  80.750  1.00 66.25  ? 351  GLY B CA    1 
ATOM   5318  C  C     . GLY B  2  351 ? -13.290 21.588  79.866  1.00 65.61  ? 351  GLY B C     1 
ATOM   5319  O  O     . GLY B  2  351 ? -14.021 21.479  78.894  1.00 65.86  ? 351  GLY B O     1 
ATOM   5320  N  N     . GLU B  2  352 ? -12.698 22.726  80.212  1.00 66.25  ? 352  GLU B N     1 
ATOM   5321  C  CA    . GLU B  2  352 ? -12.872 23.953  79.441  1.00 66.09  ? 352  GLU B CA    1 
ATOM   5322  C  C     . GLU B  2  352 ? -12.472 23.652  78.008  1.00 65.90  ? 352  GLU B C     1 
ATOM   5323  O  O     . GLU B  2  352 ? -11.551 22.856  77.777  1.00 64.62  ? 352  GLU B O     1 
ATOM   5324  C  CB    . GLU B  2  352 ? -11.990 25.089  79.984  1.00 66.32  ? 352  GLU B CB    1 
ATOM   5325  C  CG    . GLU B  2  352 ? -12.201 25.411  81.446  1.00 68.75  ? 352  GLU B CG    1 
ATOM   5326  C  CD    . GLU B  2  352 ? -11.342 26.579  81.922  1.00 71.71  ? 352  GLU B CD    1 
ATOM   5327  O  OE1   . GLU B  2  352 ? -11.627 27.735  81.531  1.00 72.36  ? 352  GLU B OE1   1 
ATOM   5328  O  OE2   . GLU B  2  352 ? -10.371 26.353  82.687  1.00 72.98  ? 352  GLU B OE2   1 
ATOM   5329  N  N     . GLU B  2  353 ? -13.171 24.279  77.057  1.00 64.42  ? 353  GLU B N     1 
ATOM   5330  C  CA    . GLU B  2  353 ? -12.880 24.090  75.644  1.00 62.85  ? 353  GLU B CA    1 
ATOM   5331  C  C     . GLU B  2  353 ? -11.954 25.178  75.190  1.00 62.45  ? 353  GLU B C     1 
ATOM   5332  O  O     . GLU B  2  353 ? -12.275 26.350  75.287  1.00 63.89  ? 353  GLU B O     1 
ATOM   5333  C  CB    . GLU B  2  353 ? -14.125 24.158  74.793  1.00 63.04  ? 353  GLU B CB    1 
ATOM   5334  C  CG    . GLU B  2  353 ? -13.795 23.905  73.349  1.00 64.23  ? 353  GLU B CG    1 
ATOM   5335  C  CD    . GLU B  2  353 ? -14.937 24.224  72.429  1.00 65.14  ? 353  GLU B CD    1 
ATOM   5336  O  OE1   . GLU B  2  353 ? -16.065 24.413  72.948  1.00 65.88  ? 353  GLU B OE1   1 
ATOM   5337  O  OE2   . GLU B  2  353 ? -14.703 24.274  71.194  1.00 63.91  ? 353  GLU B OE2   1 
ATOM   5338  N  N     . LEU B  2  354 ? -10.801 24.768  74.695  1.00 61.46  ? 354  LEU B N     1 
ATOM   5339  C  CA    . LEU B  2  354 ? -9.782  25.664  74.211  1.00 59.64  ? 354  LEU B CA    1 
ATOM   5340  C  C     . LEU B  2  354 ? -9.918  25.798  72.702  1.00 60.15  ? 354  LEU B C     1 
ATOM   5341  O  O     . LEU B  2  354 ? -10.658 25.031  72.071  1.00 60.78  ? 354  LEU B O     1 
ATOM   5342  C  CB    . LEU B  2  354 ? -8.415  25.104  74.571  1.00 56.99  ? 354  LEU B CB    1 
ATOM   5343  C  CG    . LEU B  2  354 ? -7.946  25.382  75.983  1.00 55.25  ? 354  LEU B CG    1 
ATOM   5344  C  CD1   . LEU B  2  354 ? -9.092  25.428  76.919  1.00 55.02  ? 354  LEU B CD1   1 
ATOM   5345  C  CD2   . LEU B  2  354 ? -6.966  24.335  76.379  1.00 54.39  ? 354  LEU B CD2   1 
ATOM   5346  N  N     . PHE B  2  355 ? -9.208  26.769  72.127  1.00 58.20  ? 355  PHE B N     1 
ATOM   5347  C  CA    . PHE B  2  355 ? -9.241  27.006  70.689  1.00 55.72  ? 355  PHE B CA    1 
ATOM   5348  C  C     . PHE B  2  355 ? -7.856  27.298  70.175  1.00 54.27  ? 355  PHE B C     1 
ATOM   5349  O  O     . PHE B  2  355 ? -7.122  28.094  70.766  1.00 54.02  ? 355  PHE B O     1 
ATOM   5350  C  CB    . PHE B  2  355 ? -10.136 28.185  70.386  1.00 56.40  ? 355  PHE B CB    1 
ATOM   5351  C  CG    . PHE B  2  355 ? -11.539 27.986  70.822  1.00 56.85  ? 355  PHE B CG    1 
ATOM   5352  C  CD1   . PHE B  2  355 ? -12.390 27.189  70.087  1.00 56.40  ? 355  PHE B CD1   1 
ATOM   5353  C  CD2   . PHE B  2  355 ? -12.007 28.581  71.978  1.00 58.48  ? 355  PHE B CD2   1 
ATOM   5354  C  CE1   . PHE B  2  355 ? -13.670 26.983  70.485  1.00 57.40  ? 355  PHE B CE1   1 
ATOM   5355  C  CE2   . PHE B  2  355 ? -13.299 28.379  72.388  1.00 59.00  ? 355  PHE B CE2   1 
ATOM   5356  C  CZ    . PHE B  2  355 ? -14.130 27.575  71.634  1.00 58.72  ? 355  PHE B CZ    1 
ATOM   5357  N  N     . VAL B  2  356 ? -7.507  26.657  69.064  1.00 52.65  ? 356  VAL B N     1 
ATOM   5358  C  CA    . VAL B  2  356 ? -6.191  26.849  68.464  1.00 51.53  ? 356  VAL B CA    1 
ATOM   5359  C  C     . VAL B  2  356 ? -6.142  28.145  67.657  1.00 51.12  ? 356  VAL B C     1 
ATOM   5360  O  O     . VAL B  2  356 ? -7.035  28.399  66.850  1.00 52.04  ? 356  VAL B O     1 
ATOM   5361  C  CB    . VAL B  2  356 ? -5.830  25.679  67.534  1.00 50.57  ? 356  VAL B CB    1 
ATOM   5362  C  CG1   . VAL B  2  356 ? -4.400  25.772  67.122  1.00 50.97  ? 356  VAL B CG1   1 
ATOM   5363  C  CG2   . VAL B  2  356 ? -6.060  24.374  68.225  1.00 50.33  ? 356  VAL B CG2   1 
ATOM   5364  N  N     . ARG B  2  357 ? -5.114  28.966  67.880  1.00 50.10  ? 357  ARG B N     1 
ATOM   5365  C  CA    . ARG B  2  357 ? -4.970  30.217  67.140  1.00 49.39  ? 357  ARG B CA    1 
ATOM   5366  C  C     . ARG B  2  357 ? -4.515  29.858  65.734  1.00 48.53  ? 357  ARG B C     1 
ATOM   5367  O  O     . ARG B  2  357 ? -3.467  29.249  65.561  1.00 48.99  ? 357  ARG B O     1 
ATOM   5368  C  CB    . ARG B  2  357 ? -3.937  31.119  67.801  1.00 48.95  ? 357  ARG B CB    1 
ATOM   5369  C  CG    . ARG B  2  357 ? -3.678  32.395  67.034  1.00 50.73  ? 357  ARG B CG    1 
ATOM   5370  C  CD    . ARG B  2  357 ? -4.971  33.136  66.856  1.00 55.13  ? 357  ARG B CD    1 
ATOM   5371  N  NE    . ARG B  2  357 ? -4.801  34.533  66.485  1.00 56.12  ? 357  ARG B NE    1 
ATOM   5372  C  CZ    . ARG B  2  357 ? -4.643  34.944  65.240  1.00 58.68  ? 357  ARG B CZ    1 
ATOM   5373  N  NH1   . ARG B  2  357 ? -4.629  34.064  64.247  1.00 60.14  ? 357  ARG B NH1   1 
ATOM   5374  N  NH2   . ARG B  2  357 ? -4.531  36.237  64.991  1.00 61.37  ? 357  ARG B NH2   1 
ATOM   5375  N  N     . ARG B  2  358 ? -5.292  30.237  64.730  1.00 47.48  ? 358  ARG B N     1 
ATOM   5376  C  CA    . ARG B  2  358 ? -4.953  29.878  63.365  1.00 47.80  ? 358  ARG B CA    1 
ATOM   5377  C  C     . ARG B  2  358 ? -3.747  30.598  62.750  1.00 49.85  ? 358  ARG B C     1 
ATOM   5378  O  O     . ARG B  2  358 ? -3.285  31.617  63.249  1.00 50.32  ? 358  ARG B O     1 
ATOM   5379  C  CB    . ARG B  2  358 ? -6.182  30.038  62.464  1.00 43.98  ? 358  ARG B CB    1 
ATOM   5380  C  CG    . ARG B  2  358 ? -7.281  29.029  62.671  1.00 40.40  ? 358  ARG B CG    1 
ATOM   5381  C  CD    . ARG B  2  358 ? -8.317  29.198  61.609  1.00 40.65  ? 358  ARG B CD    1 
ATOM   5382  N  NE    . ARG B  2  358 ? -9.358  28.185  61.674  1.00 41.87  ? 358  ARG B NE    1 
ATOM   5383  C  CZ    . ARG B  2  358 ? -10.360 28.077  60.800  1.00 43.86  ? 358  ARG B CZ    1 
ATOM   5384  N  NH1   . ARG B  2  358 ? -10.465 28.916  59.784  1.00 42.37  ? 358  ARG B NH1   1 
ATOM   5385  N  NH2   . ARG B  2  358 ? -11.274 27.128  60.948  1.00 45.45  ? 358  ARG B NH2   1 
ATOM   5386  N  N     . MET B  2  359 ? -3.253  30.044  61.652  1.00 51.26  ? 359  MET B N     1 
ATOM   5387  C  CA    . MET B  2  359 ? -2.096  30.577  60.949  1.00 52.34  ? 359  MET B CA    1 
ATOM   5388  C  C     . MET B  2  359 ? -2.485  31.658  59.983  1.00 53.60  ? 359  MET B C     1 
ATOM   5389  O  O     . MET B  2  359 ? -3.260  31.409  59.068  1.00 55.76  ? 359  MET B O     1 
ATOM   5390  C  CB    . MET B  2  359 ? -1.398  29.468  60.163  1.00 51.90  ? 359  MET B CB    1 
ATOM   5391  C  CG    . MET B  2  359 ? -0.331  29.973  59.237  1.00 53.53  ? 359  MET B CG    1 
ATOM   5392  S  SD    . MET B  2  359 ? 0.553   28.687  58.321  1.00 56.80  ? 359  MET B SD    1 
ATOM   5393  C  CE    . MET B  2  359 ? 2.108   28.544  59.299  1.00 55.48  ? 359  MET B CE    1 
ATOM   5394  N  N     . PRO B  2  360 ? -1.948  32.879  60.163  1.00 53.07  ? 360  PRO B N     1 
ATOM   5395  C  CA    . PRO B  2  360 ? -2.270  33.983  59.262  1.00 52.51  ? 360  PRO B CA    1 
ATOM   5396  C  C     . PRO B  2  360 ? -1.516  33.729  57.968  1.00 54.25  ? 360  PRO B C     1 
ATOM   5397  O  O     . PRO B  2  360 ? -0.299  33.594  57.995  1.00 56.06  ? 360  PRO B O     1 
ATOM   5398  C  CB    . PRO B  2  360 ? -1.717  35.199  59.988  1.00 51.47  ? 360  PRO B CB    1 
ATOM   5399  C  CG    . PRO B  2  360 ? -1.598  34.777  61.383  1.00 52.93  ? 360  PRO B CG    1 
ATOM   5400  C  CD    . PRO B  2  360 ? -1.165  33.362  61.307  1.00 53.04  ? 360  PRO B CD    1 
ATOM   5401  N  N     . ALA B  2  361 ? -2.217  33.639  56.845  1.00 55.15  ? 361  ALA B N     1 
ATOM   5402  C  CA    . ALA B  2  361 ? -1.532  33.410  55.569  1.00 54.74  ? 361  ALA B CA    1 
ATOM   5403  C  C     . ALA B  2  361 ? -0.511  34.519  55.503  1.00 54.42  ? 361  ALA B C     1 
ATOM   5404  O  O     . ALA B  2  361 ? -0.865  35.645  55.194  1.00 57.62  ? 361  ALA B O     1 
ATOM   5405  C  CB    . ALA B  2  361 ? -2.513  33.532  54.406  1.00 53.73  ? 361  ALA B CB    1 
ATOM   5406  N  N     . PHE B  2  362 ? 0.747   34.228  55.798  1.00 52.37  ? 362  PHE B N     1 
ATOM   5407  C  CA    . PHE B  2  362 ? 1.774   35.273  55.794  1.00 52.35  ? 362  PHE B CA    1 
ATOM   5408  C  C     . PHE B  2  362 ? 2.963   34.639  56.438  1.00 52.06  ? 362  PHE B C     1 
ATOM   5409  O  O     . PHE B  2  362 ? 4.090   34.864  56.020  1.00 53.30  ? 362  PHE B O     1 
ATOM   5410  C  CB    . PHE B  2  362 ? 1.369   36.460  56.689  1.00 52.44  ? 362  PHE B CB    1 
ATOM   5411  C  CG    . PHE B  2  362 ? 1.486   37.814  56.035  1.00 55.36  ? 362  PHE B CG    1 
ATOM   5412  C  CD1   . PHE B  2  362 ? 1.927   38.905  56.762  1.00 56.32  ? 362  PHE B CD1   1 
ATOM   5413  C  CD2   . PHE B  2  362 ? 1.117   38.015  54.707  1.00 57.53  ? 362  PHE B CD2   1 
ATOM   5414  C  CE1   . PHE B  2  362 ? 2.004   40.175  56.185  1.00 55.52  ? 362  PHE B CE1   1 
ATOM   5415  C  CE2   . PHE B  2  362 ? 1.198   39.292  54.133  1.00 57.86  ? 362  PHE B CE2   1 
ATOM   5416  C  CZ    . PHE B  2  362 ? 1.646   40.364  54.884  1.00 56.45  ? 362  PHE B CZ    1 
ATOM   5417  N  N     . PHE B  2  363 ? 2.677   33.862  57.490  1.00 50.65  ? 363  PHE B N     1 
ATOM   5418  C  CA    . PHE B  2  363 ? 3.668   33.159  58.305  1.00 47.17  ? 363  PHE B CA    1 
ATOM   5419  C  C     . PHE B  2  363 ? 4.030   31.774  57.730  1.00 46.92  ? 363  PHE B C     1 
ATOM   5420  O  O     . PHE B  2  363 ? 3.150   30.938  57.568  1.00 46.68  ? 363  PHE B O     1 
ATOM   5421  C  CB    . PHE B  2  363 ? 3.124   32.981  59.730  1.00 44.49  ? 363  PHE B CB    1 
ATOM   5422  C  CG    . PHE B  2  363 ? 2.996   34.246  60.520  1.00 41.27  ? 363  PHE B CG    1 
ATOM   5423  C  CD1   . PHE B  2  363 ? 3.931   34.572  61.484  1.00 40.65  ? 363  PHE B CD1   1 
ATOM   5424  C  CD2   . PHE B  2  363 ? 1.934   35.099  60.309  1.00 39.92  ? 363  PHE B CD2   1 
ATOM   5425  C  CE1   . PHE B  2  363 ? 3.802   35.739  62.225  1.00 42.62  ? 363  PHE B CE1   1 
ATOM   5426  C  CE2   . PHE B  2  363 ? 1.798   36.262  61.040  1.00 40.69  ? 363  PHE B CE2   1 
ATOM   5427  C  CZ    . PHE B  2  363 ? 2.734   36.588  62.001  1.00 41.74  ? 363  PHE B CZ    1 
ATOM   5428  N  N     . GLU B  2  364 ? 5.302   31.528  57.422  1.00 46.77  ? 364  GLU B N     1 
ATOM   5429  C  CA    . GLU B  2  364 ? 5.678   30.220  56.898  1.00 46.02  ? 364  GLU B CA    1 
ATOM   5430  C  C     . GLU B  2  364 ? 5.481   29.203  58.019  1.00 45.81  ? 364  GLU B C     1 
ATOM   5431  O  O     . GLU B  2  364 ? 5.008   28.090  57.798  1.00 46.10  ? 364  GLU B O     1 
ATOM   5432  C  CB    . GLU B  2  364 ? 7.136   30.194  56.442  1.00 45.13  ? 364  GLU B CB    1 
ATOM   5433  C  CG    . GLU B  2  364 ? 7.471   30.963  55.176  1.00 43.84  ? 364  GLU B CG    1 
ATOM   5434  C  CD    . GLU B  2  364 ? 6.979   30.313  53.896  1.00 44.77  ? 364  GLU B CD    1 
ATOM   5435  O  OE1   . GLU B  2  364 ? 7.133   29.092  53.738  1.00 43.90  ? 364  GLU B OE1   1 
ATOM   5436  O  OE2   . GLU B  2  364 ? 6.448   31.036  53.028  1.00 45.77  ? 364  GLU B OE2   1 
ATOM   5437  N  N     . SER B  2  365 ? 5.865   29.602  59.220  1.00 44.75  ? 365  SER B N     1 
ATOM   5438  C  CA    . SER B  2  365 ? 5.718   28.773  60.408  1.00 46.22  ? 365  SER B CA    1 
ATOM   5439  C  C     . SER B  2  365 ? 5.021   29.606  61.483  1.00 46.20  ? 365  SER B C     1 
ATOM   5440  O  O     . SER B  2  365 ? 5.245   30.811  61.585  1.00 45.66  ? 365  SER B O     1 
ATOM   5441  C  CB    . SER B  2  365 ? 7.075   28.329  60.930  1.00 46.30  ? 365  SER B CB    1 
ATOM   5442  O  OG    . SER B  2  365 ? 7.788   29.424  61.457  1.00 45.70  ? 365  SER B OG    1 
ATOM   5443  N  N     . PHE B  2  366 ? 4.200   28.963  62.301  1.00 46.10  ? 366  PHE B N     1 
ATOM   5444  C  CA    . PHE B  2  366 ? 3.462   29.673  63.333  1.00 45.76  ? 366  PHE B CA    1 
ATOM   5445  C  C     . PHE B  2  366 ? 3.427   28.841  64.600  1.00 45.58  ? 366  PHE B C     1 
ATOM   5446  O  O     . PHE B  2  366 ? 3.390   27.627  64.528  1.00 44.12  ? 366  PHE B O     1 
ATOM   5447  C  CB    . PHE B  2  366 ? 2.043   29.904  62.839  1.00 46.06  ? 366  PHE B CB    1 
ATOM   5448  C  CG    . PHE B  2  366 ? 1.270   30.894  63.632  1.00 45.29  ? 366  PHE B CG    1 
ATOM   5449  C  CD1   . PHE B  2  366 ? 1.602   32.230  63.603  1.00 46.00  ? 366  PHE B CD1   1 
ATOM   5450  C  CD2   . PHE B  2  366 ? 0.191   30.494  64.386  1.00 45.70  ? 366  PHE B CD2   1 
ATOM   5451  C  CE1   . PHE B  2  366 ? 0.869   33.155  64.312  1.00 48.67  ? 366  PHE B CE1   1 
ATOM   5452  C  CE2   . PHE B  2  366 ? -0.554  31.414  65.103  1.00 46.63  ? 366  PHE B CE2   1 
ATOM   5453  C  CZ    . PHE B  2  366 ? -0.216  32.747  65.067  1.00 48.37  ? 366  PHE B CZ    1 
ATOM   5454  N  N     . PRO B  2  367 ? 3.445   29.487  65.778  1.00 46.35  ? 367  PRO B N     1 
ATOM   5455  C  CA    . PRO B  2  367 ? 3.411   28.772  67.052  1.00 48.53  ? 367  PRO B CA    1 
ATOM   5456  C  C     . PRO B  2  367 ? 1.997   28.274  67.317  1.00 51.35  ? 367  PRO B C     1 
ATOM   5457  O  O     . PRO B  2  367 ? 1.028   28.797  66.766  1.00 53.72  ? 367  PRO B O     1 
ATOM   5458  C  CB    . PRO B  2  367 ? 3.829   29.837  68.042  1.00 45.84  ? 367  PRO B CB    1 
ATOM   5459  C  CG    . PRO B  2  367 ? 3.175   31.003  67.503  1.00 47.03  ? 367  PRO B CG    1 
ATOM   5460  C  CD    . PRO B  2  367 ? 3.508   30.933  66.029  1.00 46.27  ? 367  PRO B CD    1 
ATOM   5461  N  N     . VAL B  2  368 ? 1.863   27.270  68.167  1.00 53.05  ? 368  VAL B N     1 
ATOM   5462  C  CA    . VAL B  2  368 ? 0.539   26.723  68.457  1.00 52.96  ? 368  VAL B CA    1 
ATOM   5463  C  C     . VAL B  2  368 ? 0.059   27.205  69.817  1.00 51.16  ? 368  VAL B C     1 
ATOM   5464  O  O     . VAL B  2  368 ? 0.422   26.635  70.819  1.00 51.71  ? 368  VAL B O     1 
ATOM   5465  C  CB    . VAL B  2  368 ? 0.595   25.164  68.388  1.00 54.06  ? 368  VAL B CB    1 
ATOM   5466  C  CG1   . VAL B  2  368 ? 1.742   24.677  69.184  1.00 55.16  ? 368  VAL B CG1   1 
ATOM   5467  C  CG2   . VAL B  2  368 ? -0.660  24.551  68.914  1.00 54.44  ? 368  VAL B CG2   1 
ATOM   5468  N  N     . ILE B  2  369 ? -0.743  28.261  69.849  1.00 49.89  ? 369  ILE B N     1 
ATOM   5469  C  CA    . ILE B  2  369 ? -1.246  28.780  71.113  1.00 49.49  ? 369  ILE B CA    1 
ATOM   5470  C  C     . ILE B  2  369 ? -2.691  28.343  71.244  1.00 50.06  ? 369  ILE B C     1 
ATOM   5471  O  O     . ILE B  2  369 ? -3.410  28.360  70.259  1.00 50.35  ? 369  ILE B O     1 
ATOM   5472  C  CB    . ILE B  2  369 ? -1.248  30.294  71.143  1.00 48.88  ? 369  ILE B CB    1 
ATOM   5473  C  CG1   . ILE B  2  369 ? 0.106   30.833  70.697  1.00 51.07  ? 369  ILE B CG1   1 
ATOM   5474  C  CG2   . ILE B  2  369 ? -1.622  30.786  72.519  1.00 45.82  ? 369  ILE B CG2   1 
ATOM   5475  C  CD1   . ILE B  2  369 ? 1.152   30.929  71.780  1.00 54.41  ? 369  ILE B CD1   1 
ATOM   5476  N  N     . LEU B  2  370 ? -3.111  27.958  72.451  1.00 50.01  ? 370  LEU B N     1 
ATOM   5477  C  CA    . LEU B  2  370 ? -4.483  27.535  72.723  1.00 49.75  ? 370  LEU B CA    1 
ATOM   5478  C  C     . LEU B  2  370 ? -5.108  28.436  73.783  1.00 51.01  ? 370  LEU B C     1 
ATOM   5479  O  O     . LEU B  2  370 ? -4.589  28.546  74.889  1.00 49.98  ? 370  LEU B O     1 
ATOM   5480  C  CB    . LEU B  2  370 ? -4.520  26.106  73.231  1.00 47.46  ? 370  LEU B CB    1 
ATOM   5481  C  CG    . LEU B  2  370 ? -4.131  24.978  72.309  1.00 46.35  ? 370  LEU B CG    1 
ATOM   5482  C  CD1   . LEU B  2  370 ? -4.590  23.698  72.922  1.00 46.97  ? 370  LEU B CD1   1 
ATOM   5483  C  CD2   . LEU B  2  370 ? -4.794  25.143  70.990  1.00 47.35  ? 370  LEU B CD2   1 
ATOM   5484  N  N     . THR B  2  371 ? -6.224  29.073  73.460  1.00 53.61  ? 371  THR B N     1 
ATOM   5485  C  CA    . THR B  2  371 ? -6.860  29.964  74.423  1.00 57.61  ? 371  THR B CA    1 
ATOM   5486  C  C     . THR B  2  371 ? -8.301  29.620  74.584  1.00 59.45  ? 371  THR B C     1 
ATOM   5487  O  O     . THR B  2  371 ? -8.884  28.998  73.711  1.00 59.74  ? 371  THR B O     1 
ATOM   5488  C  CB    . THR B  2  371 ? -6.845  31.396  73.974  1.00 57.68  ? 371  THR B CB    1 
ATOM   5489  O  OG1   . THR B  2  371 ? -7.578  31.486  72.752  1.00 59.12  ? 371  THR B OG1   1 
ATOM   5490  C  CG2   . THR B  2  371 ? -5.425  31.886  73.788  1.00 59.25  ? 371  THR B CG2   1 
ATOM   5491  N  N     . ASP B  2  372 ? -8.882  30.073  75.687  1.00 62.18  ? 372  ASP B N     1 
ATOM   5492  C  CA    . ASP B  2  372 ? -10.287 29.811  75.986  1.00 66.04  ? 372  ASP B CA    1 
ATOM   5493  C  C     . ASP B  2  372 ? -11.240 30.668  75.157  1.00 68.44  ? 372  ASP B C     1 
ATOM   5494  O  O     . ASP B  2  372 ? -10.893 31.198  74.102  1.00 69.55  ? 372  ASP B O     1 
ATOM   5495  C  CB    . ASP B  2  372 ? -10.583 30.066  77.471  1.00 65.30  ? 372  ASP B CB    1 
ATOM   5496  C  CG    . ASP B  2  372 ? -10.623 31.561  77.817  1.00 65.53  ? 372  ASP B CG    1 
ATOM   5497  O  OD1   . ASP B  2  372 ? -11.015 31.898  78.952  1.00 64.61  ? 372  ASP B OD1   1 
ATOM   5498  O  OD2   . ASP B  2  372 ? -10.263 32.403  76.959  1.00 64.57  ? 372  ASP B OD2   1 
ATOM   5499  N  N     . LYS B  2  373 ? -12.446 30.801  75.682  1.00 70.92  ? 373  LYS B N     1 
ATOM   5500  C  CA    . LYS B  2  373 ? -13.512 31.573  75.077  1.00 73.14  ? 373  LYS B CA    1 
ATOM   5501  C  C     . LYS B  2  373 ? -13.127 33.007  74.783  1.00 73.96  ? 373  LYS B C     1 
ATOM   5502  O  O     . LYS B  2  373 ? -13.281 33.468  73.656  1.00 75.27  ? 373  LYS B O     1 
ATOM   5503  C  CB    . LYS B  2  373 ? -14.722 31.568  76.016  1.00 74.46  ? 373  LYS B CB    1 
ATOM   5504  C  CG    . LYS B  2  373 ? -14.921 30.215  76.726  1.00 77.97  ? 373  LYS B CG    1 
ATOM   5505  C  CD    . LYS B  2  373 ? -15.014 29.018  75.727  1.00 79.22  ? 373  LYS B CD    1 
ATOM   5506  C  CE    . LYS B  2  373 ? -15.235 27.677  76.430  1.00 79.11  ? 373  LYS B CE    1 
ATOM   5507  N  NZ    . LYS B  2  373 ? -15.757 26.633  75.491  1.00 79.79  ? 373  LYS B NZ    1 
ATOM   5508  N  N     . ASN B  2  374 ? -12.636 33.709  75.801  1.00 74.66  ? 374  ASN B N     1 
ATOM   5509  C  CA    . ASN B  2  374 ? -12.266 35.121  75.670  1.00 75.30  ? 374  ASN B CA    1 
ATOM   5510  C  C     . ASN B  2  374 ? -10.795 35.310  75.299  1.00 75.48  ? 374  ASN B C     1 
ATOM   5511  O  O     . ASN B  2  374 ? -10.186 36.320  75.668  1.00 76.68  ? 374  ASN B O     1 
ATOM   5512  C  CB    . ASN B  2  374 ? -12.540 35.844  76.988  1.00 75.65  ? 374  ASN B CB    1 
ATOM   5513  C  CG    . ASN B  2  374 ? -13.714 35.240  77.754  1.00 77.91  ? 374  ASN B CG    1 
ATOM   5514  O  OD1   . ASN B  2  374 ? -14.860 35.280  77.295  1.00 78.37  ? 374  ASN B OD1   1 
ATOM   5515  N  ND2   . ASN B  2  374 ? -13.431 34.672  78.929  1.00 76.90  ? 374  ASN B ND2   1 
ATOM   5516  N  N     . GLY B  2  375 ? -10.220 34.339  74.592  1.00 74.45  ? 375  GLY B N     1 
ATOM   5517  C  CA    . GLY B  2  375 ? -8.826  34.435  74.196  1.00 72.39  ? 375  GLY B CA    1 
ATOM   5518  C  C     . GLY B  2  375 ? -7.806  34.463  75.325  1.00 71.54  ? 375  GLY B C     1 
ATOM   5519  O  O     . GLY B  2  375 ? -6.753  35.076  75.179  1.00 72.24  ? 375  GLY B O     1 
ATOM   5520  N  N     . VAL B  2  376 ? -8.091  33.823  76.446  1.00 70.03  ? 376  VAL B N     1 
ATOM   5521  C  CA    . VAL B  2  376 ? -7.113  33.812  77.518  1.00 68.90  ? 376  VAL B CA    1 
ATOM   5522  C  C     . VAL B  2  376 ? -6.177  32.669  77.197  1.00 68.27  ? 376  VAL B C     1 
ATOM   5523  O  O     . VAL B  2  376 ? -6.637  31.583  76.861  1.00 68.33  ? 376  VAL B O     1 
ATOM   5524  C  CB    . VAL B  2  376 ? -7.757  33.518  78.858  1.00 69.03  ? 376  VAL B CB    1 
ATOM   5525  C  CG1   . VAL B  2  376 ? -6.760  33.748  79.980  1.00 68.82  ? 376  VAL B CG1   1 
ATOM   5526  C  CG2   . VAL B  2  376 ? -8.997  34.362  79.019  1.00 71.11  ? 376  VAL B CG2   1 
ATOM   5527  N  N     . VAL B  2  377 ? -4.876  32.893  77.292  1.00 67.09  ? 377  VAL B N     1 
ATOM   5528  C  CA    . VAL B  2  377 ? -3.944  31.819  76.993  1.00 65.26  ? 377  VAL B CA    1 
ATOM   5529  C  C     . VAL B  2  377 ? -4.128  30.744  78.055  1.00 64.32  ? 377  VAL B C     1 
ATOM   5530  O  O     . VAL B  2  377 ? -3.949  30.996  79.248  1.00 63.39  ? 377  VAL B O     1 
ATOM   5531  C  CB    . VAL B  2  377 ? -2.509  32.319  77.022  1.00 66.44  ? 377  VAL B CB    1 
ATOM   5532  C  CG1   . VAL B  2  377 ? -1.587  31.316  76.328  1.00 65.91  ? 377  VAL B CG1   1 
ATOM   5533  C  CG2   . VAL B  2  377 ? -2.445  33.691  76.379  1.00 65.72  ? 377  VAL B CG2   1 
ATOM   5534  N  N     . LYS B  2  378 ? -4.491  29.544  77.613  1.00 62.19  ? 378  LYS B N     1 
ATOM   5535  C  CA    . LYS B  2  378 ? -4.734  28.430  78.527  1.00 59.53  ? 378  LYS B CA    1 
ATOM   5536  C  C     . LYS B  2  378 ? -3.741  27.288  78.366  1.00 57.30  ? 378  LYS B C     1 
ATOM   5537  O  O     . LYS B  2  378 ? -3.405  26.635  79.336  1.00 56.70  ? 378  LYS B O     1 
ATOM   5538  C  CB    . LYS B  2  378 ? -6.163  27.892  78.332  1.00 60.52  ? 378  LYS B CB    1 
ATOM   5539  C  CG    . LYS B  2  378 ? -7.293  28.876  78.641  1.00 61.03  ? 378  LYS B CG    1 
ATOM   5540  C  CD    . LYS B  2  378 ? -7.365  29.270  80.113  1.00 61.99  ? 378  LYS B CD    1 
ATOM   5541  C  CE    . LYS B  2  378 ? -7.944  28.156  80.970  1.00 62.52  ? 378  LYS B CE    1 
ATOM   5542  N  NZ    . LYS B  2  378 ? -7.881  28.450  82.438  1.00 61.69  ? 378  LYS B NZ    1 
ATOM   5543  N  N     . ALA B  2  379 ? -3.287  27.043  77.147  1.00 55.27  ? 379  ALA B N     1 
ATOM   5544  C  CA    . ALA B  2  379 ? -2.337  25.969  76.884  1.00 53.54  ? 379  ALA B CA    1 
ATOM   5545  C  C     . ALA B  2  379 ? -1.497  26.319  75.669  1.00 53.90  ? 379  ALA B C     1 
ATOM   5546  O  O     . ALA B  2  379 ? -1.850  27.231  74.920  1.00 54.66  ? 379  ALA B O     1 
ATOM   5547  C  CB    . ALA B  2  379 ? -3.076  24.699  76.629  1.00 51.64  ? 379  ALA B CB    1 
ATOM   5548  N  N     . ASP B  2  380 ? -0.393  25.607  75.462  1.00 52.92  ? 380  ASP B N     1 
ATOM   5549  C  CA    . ASP B  2  380 ? 0.466   25.864  74.299  1.00 51.19  ? 380  ASP B CA    1 
ATOM   5550  C  C     . ASP B  2  380 ? 1.607   24.868  74.233  1.00 50.34  ? 380  ASP B C     1 
ATOM   5551  O  O     . ASP B  2  380 ? 1.736   24.038  75.113  1.00 53.49  ? 380  ASP B O     1 
ATOM   5552  C  CB    . ASP B  2  380 ? 1.037   27.277  74.377  1.00 49.70  ? 380  ASP B CB    1 
ATOM   5553  C  CG    . ASP B  2  380 ? 2.111   27.417  75.426  1.00 48.23  ? 380  ASP B CG    1 
ATOM   5554  O  OD1   . ASP B  2  380 ? 2.257   28.510  75.974  1.00 48.15  ? 380  ASP B OD1   1 
ATOM   5555  O  OD2   . ASP B  2  380 ? 2.823   26.448  75.697  1.00 45.86  ? 380  ASP B OD2   1 
ATOM   5556  N  N     . ILE B  2  381 ? 2.430   24.941  73.200  1.00 46.91  ? 381  ILE B N     1 
ATOM   5557  C  CA    . ILE B  2  381 ? 3.571   24.051  73.095  1.00 43.45  ? 381  ILE B CA    1 
ATOM   5558  C  C     . ILE B  2  381 ? 4.748   24.976  73.264  1.00 43.81  ? 381  ILE B C     1 
ATOM   5559  O  O     . ILE B  2  381 ? 4.908   25.890  72.490  1.00 44.65  ? 381  ILE B O     1 
ATOM   5560  C  CB    . ILE B  2  381 ? 3.632   23.385  71.734  1.00 41.44  ? 381  ILE B CB    1 
ATOM   5561  C  CG1   . ILE B  2  381 ? 2.385   22.538  71.524  1.00 41.17  ? 381  ILE B CG1   1 
ATOM   5562  C  CG2   . ILE B  2  381 ? 4.836   22.500  71.639  1.00 39.36  ? 381  ILE B CG2   1 
ATOM   5563  C  CD1   . ILE B  2  381 ? 2.394   21.719  70.262  1.00 41.11  ? 381  ILE B CD1   1 
ATOM   5564  N  N     . PRO B  2  382 ? 5.573   24.765  74.296  1.00 43.43  ? 382  PRO B N     1 
ATOM   5565  C  CA    . PRO B  2  382 ? 6.758   25.569  74.617  1.00 44.43  ? 382  PRO B CA    1 
ATOM   5566  C  C     . PRO B  2  382 ? 7.959   25.455  73.689  1.00 44.58  ? 382  PRO B C     1 
ATOM   5567  O  O     . PRO B  2  382 ? 7.979   24.606  72.814  1.00 44.19  ? 382  PRO B O     1 
ATOM   5568  C  CB    . PRO B  2  382 ? 7.094   25.113  76.022  1.00 44.85  ? 382  PRO B CB    1 
ATOM   5569  C  CG    . PRO B  2  382 ? 6.693   23.707  76.001  1.00 45.18  ? 382  PRO B CG    1 
ATOM   5570  C  CD    . PRO B  2  382 ? 5.352   23.754  75.337  1.00 43.51  ? 382  PRO B CD    1 
ATOM   5571  N  N     . PHE B  2  383 ? 8.947   26.329  73.891  1.00 45.32  ? 383  PHE B N     1 
ATOM   5572  C  CA    . PHE B  2  383 ? 10.192  26.346  73.109  1.00 46.60  ? 383  PHE B CA    1 
ATOM   5573  C  C     . PHE B  2  383 ? 11.314  26.087  74.103  1.00 48.27  ? 383  PHE B C     1 
ATOM   5574  O  O     . PHE B  2  383 ? 12.214  25.296  73.846  1.00 48.87  ? 383  PHE B O     1 
ATOM   5575  C  CB    . PHE B  2  383 ? 10.434  27.709  72.430  1.00 44.88  ? 383  PHE B CB    1 
ATOM   5576  C  CG    . PHE B  2  383 ? 11.505  27.683  71.336  1.00 45.02  ? 383  PHE B CG    1 
ATOM   5577  C  CD1   . PHE B  2  383 ? 11.181  27.382  70.030  1.00 42.77  ? 383  PHE B CD1   1 
ATOM   5578  C  CD2   . PHE B  2  383 ? 12.836  27.948  71.625  1.00 46.30  ? 383  PHE B CD2   1 
ATOM   5579  C  CE1   . PHE B  2  383 ? 12.156  27.348  69.049  1.00 42.80  ? 383  PHE B CE1   1 
ATOM   5580  C  CE2   . PHE B  2  383 ? 13.811  27.910  70.630  1.00 42.51  ? 383  PHE B CE2   1 
ATOM   5581  C  CZ    . PHE B  2  383 ? 13.466  27.612  69.357  1.00 41.33  ? 383  PHE B CZ    1 
ATOM   5582  N  N     . ARG B  2  384 ? 11.258  26.779  75.233  1.00 48.66  ? 384  ARG B N     1 
ATOM   5583  C  CA    . ARG B  2  384 ? 12.238  26.621  76.296  1.00 50.06  ? 384  ARG B CA    1 
ATOM   5584  C  C     . ARG B  2  384 ? 11.509  25.931  77.449  1.00 52.44  ? 384  ARG B C     1 
ATOM   5585  O  O     . ARG B  2  384 ? 10.829  26.601  78.226  1.00 55.05  ? 384  ARG B O     1 
ATOM   5586  C  CB    . ARG B  2  384 ? 12.743  27.982  76.791  1.00 47.92  ? 384  ARG B CB    1 
ATOM   5587  C  CG    . ARG B  2  384 ? 13.940  28.555  76.090  1.00 43.86  ? 384  ARG B CG    1 
ATOM   5588  C  CD    . ARG B  2  384 ? 14.450  29.776  76.853  1.00 43.88  ? 384  ARG B CD    1 
ATOM   5589  N  NE    . ARG B  2  384 ? 15.632  30.366  76.231  1.00 45.83  ? 384  ARG B NE    1 
ATOM   5590  C  CZ    . ARG B  2  384 ? 16.322  31.391  76.721  1.00 45.81  ? 384  ARG B CZ    1 
ATOM   5591  N  NH1   . ARG B  2  384 ? 15.953  31.953  77.851  1.00 46.63  ? 384  ARG B NH1   1 
ATOM   5592  N  NH2   . ARG B  2  384 ? 17.385  31.856  76.081  1.00 47.11  ? 384  ARG B NH2   1 
ATOM   5593  N  N     . ARG B  2  385 ? 11.640  24.616  77.578  1.00 52.28  ? 385  ARG B N     1 
ATOM   5594  C  CA    . ARG B  2  385 ? 10.945  23.932  78.658  1.00 52.11  ? 385  ARG B CA    1 
ATOM   5595  C  C     . ARG B  2  385 ? 11.316  24.401  80.047  1.00 53.31  ? 385  ARG B C     1 
ATOM   5596  O  O     . ARG B  2  385 ? 10.537  24.266  80.983  1.00 54.22  ? 385  ARG B O     1 
ATOM   5597  C  CB    . ARG B  2  385 ? 11.179  22.437  78.579  1.00 51.32  ? 385  ARG B CB    1 
ATOM   5598  C  CG    . ARG B  2  385 ? 10.312  21.751  77.582  1.00 51.57  ? 385  ARG B CG    1 
ATOM   5599  C  CD    . ARG B  2  385 ? 10.624  22.216  76.202  1.00 50.62  ? 385  ARG B CD    1 
ATOM   5600  N  NE    . ARG B  2  385 ? 10.346  21.154  75.261  1.00 51.02  ? 385  ARG B NE    1 
ATOM   5601  C  CZ    . ARG B  2  385 ? 10.566  21.259  73.966  1.00 53.76  ? 385  ARG B CZ    1 
ATOM   5602  N  NH1   . ARG B  2  385 ? 11.057  22.388  73.490  1.00 54.79  ? 385  ARG B NH1   1 
ATOM   5603  N  NH2   . ARG B  2  385 ? 10.317  20.236  73.161  1.00 52.85  ? 385  ARG B NH2   1 
ATOM   5604  N  N     . ALA B  2  386 ? 12.508  24.944  80.189  1.00 54.22  ? 386  ALA B N     1 
ATOM   5605  C  CA    . ALA B  2  386 ? 12.952  25.387  81.498  1.00 54.01  ? 386  ALA B CA    1 
ATOM   5606  C  C     . ALA B  2  386 ? 11.868  26.017  82.366  1.00 54.54  ? 386  ALA B C     1 
ATOM   5607  O  O     . ALA B  2  386 ? 11.895  25.889  83.584  1.00 55.59  ? 386  ALA B O     1 
ATOM   5608  C  CB    . ALA B  2  386 ? 14.110  26.337  81.349  1.00 54.50  ? 386  ALA B CB    1 
ATOM   5609  N  N     . GLU B  2  387 ? 10.896  26.675  81.762  1.00 55.19  ? 387  GLU B N     1 
ATOM   5610  C  CA    . GLU B  2  387 ? 9.872   27.317  82.565  1.00 55.82  ? 387  GLU B CA    1 
ATOM   5611  C  C     . GLU B  2  387 ? 8.485   27.302  81.987  1.00 55.40  ? 387  GLU B C     1 
ATOM   5612  O  O     . GLU B  2  387 ? 7.775   28.285  82.117  1.00 55.72  ? 387  GLU B O     1 
ATOM   5613  C  CB    . GLU B  2  387 ? 10.270  28.757  82.817  1.00 57.50  ? 387  GLU B CB    1 
ATOM   5614  C  CG    . GLU B  2  387 ? 11.354  28.912  83.840  1.00 62.03  ? 387  GLU B CG    1 
ATOM   5615  C  CD    . GLU B  2  387 ? 12.148  30.187  83.666  1.00 64.36  ? 387  GLU B CD    1 
ATOM   5616  O  OE1   . GLU B  2  387 ? 11.516  31.247  83.438  1.00 64.84  ? 387  GLU B OE1   1 
ATOM   5617  O  OE2   . GLU B  2  387 ? 13.401  30.124  83.770  1.00 65.73  ? 387  GLU B OE2   1 
ATOM   5618  N  N     . SER B  2  388 ? 8.085   26.201  81.362  1.00 53.16  ? 388  SER B N     1 
ATOM   5619  C  CA    . SER B  2  388 ? 6.761   26.112  80.778  1.00 52.11  ? 388  SER B CA    1 
ATOM   5620  C  C     . SER B  2  388 ? 5.704   26.251  81.834  1.00 51.31  ? 388  SER B C     1 
ATOM   5621  O  O     . SER B  2  388 ? 5.833   25.705  82.905  1.00 50.71  ? 388  SER B O     1 
ATOM   5622  C  CB    . SER B  2  388 ? 6.568   24.777  80.115  1.00 53.29  ? 388  SER B CB    1 
ATOM   5623  O  OG    . SER B  2  388 ? 7.716   24.455  79.370  1.00 57.77  ? 388  SER B OG    1 
ATOM   5624  N  N     . LYS B  2  389 ? 4.652   26.972  81.524  1.00 51.28  ? 389  LYS B N     1 
ATOM   5625  C  CA    . LYS B  2  389 ? 3.584   27.109  82.461  1.00 51.61  ? 389  LYS B CA    1 
ATOM   5626  C  C     . LYS B  2  389 ? 2.340   26.543  81.822  1.00 51.70  ? 389  LYS B C     1 
ATOM   5627  O  O     . LYS B  2  389 ? 1.477   26.024  82.495  1.00 51.71  ? 389  LYS B O     1 
ATOM   5628  C  CB    . LYS B  2  389 ? 3.336   28.560  82.786  1.00 52.68  ? 389  LYS B CB    1 
ATOM   5629  C  CG    . LYS B  2  389 ? 4.413   29.249  83.568  1.00 56.36  ? 389  LYS B CG    1 
ATOM   5630  C  CD    . LYS B  2  389 ? 3.949   30.693  83.849  1.00 57.21  ? 389  LYS B CD    1 
ATOM   5631  C  CE    . LYS B  2  389 ? 5.045   31.621  84.384  1.00 56.55  ? 389  LYS B CE    1 
ATOM   5632  N  NZ    . LYS B  2  389 ? 4.529   33.017  84.528  1.00 54.45  ? 389  LYS B NZ    1 
ATOM   5633  N  N     . TYR B  2  390 ? 2.251   26.624  80.515  1.00 51.12  ? 390  TYR B N     1 
ATOM   5634  C  CA    . TYR B  2  390 ? 1.055   26.151  79.862  1.00 52.32  ? 390  TYR B CA    1 
ATOM   5635  C  C     . TYR B  2  390 ? 1.233   24.917  79.024  1.00 54.39  ? 390  TYR B C     1 
ATOM   5636  O  O     . TYR B  2  390 ? 0.325   24.523  78.297  1.00 54.99  ? 390  TYR B O     1 
ATOM   5637  C  CB    . TYR B  2  390 ? 0.493   27.242  78.961  1.00 53.38  ? 390  TYR B CB    1 
ATOM   5638  C  CG    . TYR B  2  390 ? 0.275   28.564  79.626  1.00 55.07  ? 390  TYR B CG    1 
ATOM   5639  C  CD1   . TYR B  2  390 ? 1.335   29.278  80.177  1.00 56.48  ? 390  TYR B CD1   1 
ATOM   5640  C  CD2   . TYR B  2  390 ? -0.990  29.125  79.674  1.00 55.94  ? 390  TYR B CD2   1 
ATOM   5641  C  CE1   . TYR B  2  390 ? 1.141   30.526  80.755  1.00 55.65  ? 390  TYR B CE1   1 
ATOM   5642  C  CE2   . TYR B  2  390 ? -1.200  30.370  80.247  1.00 57.30  ? 390  TYR B CE2   1 
ATOM   5643  C  CZ    . TYR B  2  390 ? -0.129  31.069  80.784  1.00 56.99  ? 390  TYR B CZ    1 
ATOM   5644  O  OH    . TYR B  2  390 ? -0.339  32.323  81.317  1.00 56.77  ? 390  TYR B OH    1 
ATOM   5645  N  N     . SER B  2  391 ? 2.400   24.311  79.091  1.00 55.59  ? 391  SER B N     1 
ATOM   5646  C  CA    . SER B  2  391 ? 2.641   23.145  78.268  1.00 55.90  ? 391  SER B CA    1 
ATOM   5647  C  C     . SER B  2  391 ? 1.473   22.176  78.359  1.00 55.80  ? 391  SER B C     1 
ATOM   5648  O  O     . SER B  2  391 ? 0.815   22.124  79.390  1.00 54.28  ? 391  SER B O     1 
ATOM   5649  C  CB    . SER B  2  391 ? 3.922   22.450  78.717  1.00 56.91  ? 391  SER B CB    1 
ATOM   5650  O  OG    . SER B  2  391 ? 3.842   22.052  80.074  1.00 58.80  ? 391  SER B OG    1 
ATOM   5651  N  N     . PHE B  2  392 ? 1.186   21.442  77.280  1.00 56.19  ? 392  PHE B N     1 
ATOM   5652  C  CA    . PHE B  2  392 ? 0.130   20.427  77.314  1.00 57.21  ? 392  PHE B CA    1 
ATOM   5653  C  C     . PHE B  2  392 ? 0.698   19.512  78.403  1.00 59.23  ? 392  PHE B C     1 
ATOM   5654  O  O     . PHE B  2  392 ? 1.854   19.686  78.808  1.00 60.01  ? 392  PHE B O     1 
ATOM   5655  C  CB    . PHE B  2  392 ? 0.067   19.650  76.003  1.00 55.74  ? 392  PHE B CB    1 
ATOM   5656  C  CG    . PHE B  2  392 ? -0.590  20.389  74.865  1.00 56.24  ? 392  PHE B CG    1 
ATOM   5657  C  CD1   . PHE B  2  392 ? -0.500  21.763  74.751  1.00 55.96  ? 392  PHE B CD1   1 
ATOM   5658  C  CD2   . PHE B  2  392 ? -1.281  19.683  73.877  1.00 56.49  ? 392  PHE B CD2   1 
ATOM   5659  C  CE1   . PHE B  2  392 ? -1.092  22.420  73.673  1.00 56.49  ? 392  PHE B CE1   1 
ATOM   5660  C  CE2   . PHE B  2  392 ? -1.873  20.329  72.801  1.00 55.10  ? 392  PHE B CE2   1 
ATOM   5661  C  CZ    . PHE B  2  392 ? -1.779  21.698  72.698  1.00 56.18  ? 392  PHE B CZ    1 
ATOM   5662  N  N     . GLU B  2  393 ? -0.053  18.532  78.876  1.00 60.12  ? 393  GLU B N     1 
ATOM   5663  C  CA    . GLU B  2  393 ? 0.480   17.667  79.941  1.00 61.56  ? 393  GLU B CA    1 
ATOM   5664  C  C     . GLU B  2  393 ? 0.403   18.433  81.238  1.00 62.16  ? 393  GLU B C     1 
ATOM   5665  O  O     . GLU B  2  393 ? -0.227  17.999  82.181  1.00 63.91  ? 393  GLU B O     1 
ATOM   5666  C  CB    . GLU B  2  393 ? 1.951   17.315  79.714  1.00 61.09  ? 393  GLU B CB    1 
ATOM   5667  C  CG    . GLU B  2  393 ? 2.267   16.701  78.374  1.00 61.94  ? 393  GLU B CG    1 
ATOM   5668  C  CD    . GLU B  2  393 ? 3.499   17.312  77.771  1.00 60.97  ? 393  GLU B CD    1 
ATOM   5669  O  OE1   . GLU B  2  393 ? 4.255   17.922  78.549  1.00 61.03  ? 393  GLU B OE1   1 
ATOM   5670  O  OE2   . GLU B  2  393 ? 3.712   17.183  76.544  1.00 60.51  ? 393  GLU B OE2   1 
ATOM   5671  N  N     . GLN B  2  394 ? 1.076   19.569  81.288  1.00 62.46  ? 394  GLN B N     1 
ATOM   5672  C  CA    . GLN B  2  394 ? 1.052   20.407  82.474  1.00 61.54  ? 394  GLN B CA    1 
ATOM   5673  C  C     . GLN B  2  394 ? -0.396  20.883  82.648  1.00 61.34  ? 394  GLN B C     1 
ATOM   5674  O  O     . GLN B  2  394 ? -0.847  21.121  83.768  1.00 61.17  ? 394  GLN B O     1 
ATOM   5675  C  CB    . GLN B  2  394 ? 1.976   21.603  82.266  1.00 61.74  ? 394  GLN B CB    1 
ATOM   5676  C  CG    . GLN B  2  394 ? 2.704   22.067  83.485  1.00 61.78  ? 394  GLN B CG    1 
ATOM   5677  C  CD    . GLN B  2  394 ? 3.774   23.106  83.175  1.00 63.20  ? 394  GLN B CD    1 
ATOM   5678  O  OE1   . GLN B  2  394 ? 4.567   23.459  84.048  1.00 63.55  ? 394  GLN B OE1   1 
ATOM   5679  N  NE2   . GLN B  2  394 ? 3.798   23.604  81.938  1.00 62.67  ? 394  GLN B NE2   1 
ATOM   5680  N  N     . GLN B  2  395 ? -1.114  21.008  81.536  1.00 60.19  ? 395  GLN B N     1 
ATOM   5681  C  CA    . GLN B  2  395 ? -2.490  21.456  81.570  1.00 60.10  ? 395  GLN B CA    1 
ATOM   5682  C  C     . GLN B  2  395 ? -3.421  20.329  81.286  1.00 59.50  ? 395  GLN B C     1 
ATOM   5683  O  O     . GLN B  2  395 ? -4.625  20.473  81.386  1.00 60.18  ? 395  GLN B O     1 
ATOM   5684  C  CB    . GLN B  2  395 ? -2.728  22.548  80.549  1.00 61.49  ? 395  GLN B CB    1 
ATOM   5685  C  CG    . GLN B  2  395 ? -1.928  23.779  80.803  1.00 64.94  ? 395  GLN B CG    1 
ATOM   5686  C  CD    . GLN B  2  395 ? -2.255  24.394  82.137  1.00 67.13  ? 395  GLN B CD    1 
ATOM   5687  O  OE1   . GLN B  2  395 ? -3.424  24.549  82.484  1.00 69.65  ? 395  GLN B OE1   1 
ATOM   5688  N  NE2   . GLN B  2  395 ? -1.229  24.761  82.895  1.00 68.73  ? 395  GLN B NE2   1 
ATOM   5689  N  N     . GLY B  2  396 ? -2.862  19.207  80.893  1.00 59.18  ? 396  GLY B N     1 
ATOM   5690  C  CA    . GLY B  2  396 ? -3.688  18.051  80.615  1.00 59.61  ? 396  GLY B CA    1 
ATOM   5691  C  C     . GLY B  2  396 ? -4.674  18.246  79.489  1.00 59.33  ? 396  GLY B C     1 
ATOM   5692  O  O     . GLY B  2  396 ? -5.847  17.928  79.634  1.00 61.29  ? 396  GLY B O     1 
ATOM   5693  N  N     . VAL B  2  397 ? -4.199  18.750  78.361  1.00 58.35  ? 397  VAL B N     1 
ATOM   5694  C  CA    . VAL B  2  397 ? -5.061  18.981  77.210  1.00 57.05  ? 397  VAL B CA    1 
ATOM   5695  C  C     . VAL B  2  397 ? -5.487  17.649  76.596  1.00 57.16  ? 397  VAL B C     1 
ATOM   5696  O  O     . VAL B  2  397 ? -4.810  16.639  76.778  1.00 57.25  ? 397  VAL B O     1 
ATOM   5697  C  CB    . VAL B  2  397 ? -4.330  19.799  76.135  1.00 56.51  ? 397  VAL B CB    1 
ATOM   5698  C  CG1   . VAL B  2  397 ? -5.308  20.385  75.177  1.00 55.24  ? 397  VAL B CG1   1 
ATOM   5699  C  CG2   . VAL B  2  397 ? -3.534  20.883  76.774  1.00 56.26  ? 397  VAL B CG2   1 
ATOM   5700  N  N     . THR B  2  398 ? -6.606  17.647  75.877  1.00 56.08  ? 398  THR B N     1 
ATOM   5701  C  CA    . THR B  2  398 ? -7.094  16.445  75.210  1.00 55.84  ? 398  THR B CA    1 
ATOM   5702  C  C     . THR B  2  398 ? -7.788  16.928  73.967  1.00 55.65  ? 398  THR B C     1 
ATOM   5703  O  O     . THR B  2  398 ? -7.995  18.120  73.810  1.00 55.92  ? 398  THR B O     1 
ATOM   5704  C  CB    . THR B  2  398 ? -8.149  15.682  76.025  1.00 57.54  ? 398  THR B CB    1 
ATOM   5705  O  OG1   . THR B  2  398 ? -9.400  16.372  75.938  1.00 58.84  ? 398  THR B OG1   1 
ATOM   5706  C  CG2   . THR B  2  398 ? -7.731  15.558  77.481  1.00 58.38  ? 398  THR B CG2   1 
ATOM   5707  N  N     . VAL B  2  399 ? -8.174  16.004  73.099  1.00 54.96  ? 399  VAL B N     1 
ATOM   5708  C  CA    . VAL B  2  399 ? -8.846  16.354  71.865  1.00 53.72  ? 399  VAL B CA    1 
ATOM   5709  C  C     . VAL B  2  399 ? -9.873  15.287  71.515  1.00 53.75  ? 399  VAL B C     1 
ATOM   5710  O  O     . VAL B  2  399 ? -9.625  14.093  71.662  1.00 52.32  ? 399  VAL B O     1 
ATOM   5711  C  CB    . VAL B  2  399 ? -7.806  16.510  70.715  1.00 55.30  ? 399  VAL B CB    1 
ATOM   5712  C  CG1   . VAL B  2  399 ? -6.820  15.373  70.761  1.00 56.88  ? 399  VAL B CG1   1 
ATOM   5713  C  CG2   . VAL B  2  399 ? -8.475  16.526  69.360  1.00 56.00  ? 399  VAL B CG2   1 
ATOM   5714  N  N     . SER B  2  400 ? -11.037 15.728  71.075  1.00 52.92  ? 400  SER B N     1 
ATOM   5715  C  CA    . SER B  2  400 ? -12.105 14.822  70.689  1.00 53.79  ? 400  SER B CA    1 
ATOM   5716  C  C     . SER B  2  400 ? -12.485 15.194  69.281  1.00 55.18  ? 400  SER B C     1 
ATOM   5717  O  O     . SER B  2  400 ? -12.300 16.327  68.879  1.00 58.36  ? 400  SER B O     1 
ATOM   5718  C  CB    . SER B  2  400 ? -13.315 15.025  71.574  1.00 53.80  ? 400  SER B CB    1 
ATOM   5719  O  OG    . SER B  2  400 ? -12.945 15.004  72.931  1.00 56.21  ? 400  SER B OG    1 
ATOM   5720  N  N     . PHE B  2  401 ? -13.036 14.264  68.530  1.00 55.58  ? 401  PHE B N     1 
ATOM   5721  C  CA    . PHE B  2  401 ? -13.417 14.559  67.160  1.00 56.17  ? 401  PHE B CA    1 
ATOM   5722  C  C     . PHE B  2  401 ? -14.925 14.341  66.916  1.00 56.49  ? 401  PHE B C     1 
ATOM   5723  O  O     . PHE B  2  401 ? -15.536 13.490  67.544  1.00 57.79  ? 401  PHE B O     1 
ATOM   5724  C  CB    . PHE B  2  401 ? -12.569 13.695  66.208  1.00 56.70  ? 401  PHE B CB    1 
ATOM   5725  C  CG    . PHE B  2  401 ? -11.171 14.243  65.942  1.00 56.83  ? 401  PHE B CG    1 
ATOM   5726  C  CD1   . PHE B  2  401 ? -10.970 15.271  65.034  1.00 57.43  ? 401  PHE B CD1   1 
ATOM   5727  C  CD2   . PHE B  2  401 ? -10.064 13.709  66.577  1.00 56.76  ? 401  PHE B CD2   1 
ATOM   5728  C  CE1   . PHE B  2  401 ? -9.699  15.746  64.766  1.00 56.81  ? 401  PHE B CE1   1 
ATOM   5729  C  CE2   . PHE B  2  401 ? -8.788  14.180  66.315  1.00 55.98  ? 401  PHE B CE2   1 
ATOM   5730  C  CZ    . PHE B  2  401 ? -8.608  15.196  65.409  1.00 56.70  ? 401  PHE B CZ    1 
ATOM   5731  N  N     . TYR B  2  402 ? -15.513 15.120  66.015  1.00 56.05  ? 402  TYR B N     1 
ATOM   5732  C  CA    . TYR B  2  402 ? -16.929 15.024  65.666  1.00 54.79  ? 402  TYR B CA    1 
ATOM   5733  C  C     . TYR B  2  402 ? -17.104 15.041  64.153  1.00 55.28  ? 402  TYR B C     1 
ATOM   5734  O  O     . TYR B  2  402 ? -16.449 15.816  63.455  1.00 55.08  ? 402  TYR B O     1 
ATOM   5735  C  CB    . TYR B  2  402 ? -17.678 16.179  66.279  1.00 54.46  ? 402  TYR B CB    1 
ATOM   5736  C  CG    . TYR B  2  402 ? -17.545 16.209  67.768  1.00 55.25  ? 402  TYR B CG    1 
ATOM   5737  C  CD1   . TYR B  2  402 ? -18.455 15.557  68.578  1.00 55.83  ? 402  TYR B CD1   1 
ATOM   5738  C  CD2   . TYR B  2  402 ? -16.477 16.844  68.364  1.00 55.97  ? 402  TYR B CD2   1 
ATOM   5739  C  CE1   . TYR B  2  402 ? -18.300 15.531  69.943  1.00 56.65  ? 402  TYR B CE1   1 
ATOM   5740  C  CE2   . TYR B  2  402 ? -16.312 16.828  69.728  1.00 57.59  ? 402  TYR B CE2   1 
ATOM   5741  C  CZ    . TYR B  2  402 ? -17.223 16.166  70.518  1.00 57.01  ? 402  TYR B CZ    1 
ATOM   5742  O  OH    . TYR B  2  402 ? -17.015 16.122  71.879  1.00 58.19  ? 402  TYR B OH    1 
ATOM   5743  N  N     . GLY B  2  403 ? -17.981 14.187  63.643  1.00 55.47  ? 403  GLY B N     1 
ATOM   5744  C  CA    . GLY B  2  403 ? -18.164 14.121  62.203  1.00 59.02  ? 403  GLY B CA    1 
ATOM   5745  C  C     . GLY B  2  403 ? -16.851 13.656  61.604  1.00 60.84  ? 403  GLY B C     1 
ATOM   5746  O  O     . GLY B  2  403 ? -15.948 13.315  62.354  1.00 62.08  ? 403  GLY B O     1 
ATOM   5747  N  N     . GLY B  2  404 ? -16.715 13.624  60.285  1.00 62.38  ? 404  GLY B N     1 
ATOM   5748  C  CA    . GLY B  2  404 ? -15.448 13.186  59.710  1.00 65.54  ? 404  GLY B CA    1 
ATOM   5749  C  C     . GLY B  2  404 ? -15.121 11.731  60.027  1.00 66.98  ? 404  GLY B C     1 
ATOM   5750  O  O     . GLY B  2  404 ? -15.932 11.041  60.627  1.00 68.82  ? 404  GLY B O     1 
ATOM   5751  N  N     . GLU B  2  405 ? -13.943 11.253  59.666  1.00 67.97  ? 405  GLU B N     1 
ATOM   5752  C  CA    . GLU B  2  405 ? -13.680 9.860   59.932  1.00 68.92  ? 405  GLU B CA    1 
ATOM   5753  C  C     . GLU B  2  405 ? -13.107 9.530   61.297  1.00 68.05  ? 405  GLU B C     1 
ATOM   5754  O  O     . GLU B  2  405 ? -12.996 8.357   61.650  1.00 68.65  ? 405  GLU B O     1 
ATOM   5755  C  CB    . GLU B  2  405 ? -12.818 9.268   58.824  1.00 71.42  ? 405  GLU B CB    1 
ATOM   5756  C  CG    . GLU B  2  405 ? -11.325 9.353   59.070  1.00 76.11  ? 405  GLU B CG    1 
ATOM   5757  C  CD    . GLU B  2  405 ? -10.534 8.459   58.105  1.00 79.71  ? 405  GLU B CD    1 
ATOM   5758  O  OE1   . GLU B  2  405 ? -10.799 7.227   58.034  1.00 81.75  ? 405  GLU B OE1   1 
ATOM   5759  O  OE2   . GLU B  2  405 ? -9.641  8.986   57.413  1.00 80.23  ? 405  GLU B OE2   1 
ATOM   5760  N  N     . LEU B  2  406 ? -12.740 10.541  62.071  1.00 67.08  ? 406  LEU B N     1 
ATOM   5761  C  CA    . LEU B  2  406 ? -12.219 10.282  63.416  1.00 67.08  ? 406  LEU B CA    1 
ATOM   5762  C  C     . LEU B  2  406 ? -13.345 10.512  64.414  1.00 66.97  ? 406  LEU B C     1 
ATOM   5763  O  O     . LEU B  2  406 ? -13.139 10.509  65.628  1.00 68.76  ? 406  LEU B O     1 
ATOM   5764  C  CB    . LEU B  2  406 ? -11.051 11.208  63.760  1.00 66.61  ? 406  LEU B CB    1 
ATOM   5765  C  CG    . LEU B  2  406 ? -9.670  10.898  63.184  1.00 67.25  ? 406  LEU B CG    1 
ATOM   5766  C  CD1   . LEU B  2  406 ? -8.714  12.024  63.523  1.00 67.52  ? 406  LEU B CD1   1 
ATOM   5767  C  CD2   . LEU B  2  406 ? -9.165  9.613   63.757  1.00 66.43  ? 406  LEU B CD2   1 
ATOM   5768  N  N     . ASN B  2  407 ? -14.540 10.709  63.886  1.00 65.04  ? 407  ASN B N     1 
ATOM   5769  C  CA    . ASN B  2  407 ? -15.716 10.951  64.706  1.00 63.31  ? 407  ASN B CA    1 
ATOM   5770  C  C     . ASN B  2  407 ? -15.875 10.029  65.917  1.00 62.20  ? 407  ASN B C     1 
ATOM   5771  O  O     . ASN B  2  407 ? -15.771 8.814   65.793  1.00 62.12  ? 407  ASN B O     1 
ATOM   5772  C  CB    . ASN B  2  407 ? -16.954 10.844  63.828  1.00 63.49  ? 407  ASN B CB    1 
ATOM   5773  C  CG    . ASN B  2  407 ? -18.222 10.934  64.615  1.00 63.34  ? 407  ASN B CG    1 
ATOM   5774  O  OD1   . ASN B  2  407 ? -18.459 11.909  65.313  1.00 63.93  ? 407  ASN B OD1   1 
ATOM   5775  N  ND2   . ASN B  2  407 ? -19.053 9.913   64.509  1.00 62.56  ? 407  ASN B ND2   1 
ATOM   5776  N  N     . GLY B  2  408 ? -16.131 10.610  67.081  1.00 61.02  ? 408  GLY B N     1 
ATOM   5777  C  CA    . GLY B  2  408 ? -16.326 9.806   68.276  1.00 60.05  ? 408  GLY B CA    1 
ATOM   5778  C  C     . GLY B  2  408 ? -15.098 9.442   69.096  1.00 59.24  ? 408  GLY B C     1 
ATOM   5779  O  O     . GLY B  2  408 ? -15.194 9.141   70.288  1.00 59.57  ? 408  GLY B O     1 
ATOM   5780  N  N     . GLN B  2  409 ? -13.939 9.472   68.472  1.00 57.82  ? 409  GLN B N     1 
ATOM   5781  C  CA    . GLN B  2  409 ? -12.723 9.128   69.185  1.00 56.52  ? 409  GLN B CA    1 
ATOM   5782  C  C     . GLN B  2  409 ? -12.145 10.283  70.001  1.00 56.60  ? 409  GLN B C     1 
ATOM   5783  O  O     . GLN B  2  409 ? -12.440 11.438  69.749  1.00 57.68  ? 409  GLN B O     1 
ATOM   5784  C  CB    . GLN B  2  409 ? -11.698 8.631   68.176  1.00 54.73  ? 409  GLN B CB    1 
ATOM   5785  C  CG    . GLN B  2  409 ? -12.232 7.485   67.380  1.00 52.76  ? 409  GLN B CG    1 
ATOM   5786  C  CD    . GLN B  2  409 ? -11.327 7.050   66.263  1.00 52.18  ? 409  GLN B CD    1 
ATOM   5787  O  OE1   . GLN B  2  409 ? -10.116 6.875   66.449  1.00 49.47  ? 409  GLN B OE1   1 
ATOM   5788  N  NE2   . GLN B  2  409 ? -11.915 6.849   65.083  1.00 50.38  ? 409  GLN B NE2   1 
ATOM   5789  N  N     . THR B  2  410 ? -11.330 9.962   70.985  1.00 56.13  ? 410  THR B N     1 
ATOM   5790  C  CA    . THR B  2  410 ? -10.696 10.981  71.790  1.00 56.53  ? 410  THR B CA    1 
ATOM   5791  C  C     . THR B  2  410 ? -9.271  10.541  71.988  1.00 55.92  ? 410  THR B C     1 
ATOM   5792  O  O     . THR B  2  410 ? -8.994  9.343   71.984  1.00 55.16  ? 410  THR B O     1 
ATOM   5793  C  CB    . THR B  2  410 ? -11.328 11.114  73.167  1.00 57.20  ? 410  THR B CB    1 
ATOM   5794  O  OG1   . THR B  2  410 ? -12.712 11.422  73.022  1.00 58.53  ? 410  THR B OG1   1 
ATOM   5795  C  CG2   . THR B  2  410 ? -10.641 12.220  73.958  1.00 57.47  ? 410  THR B CG2   1 
ATOM   5796  N  N     . PHE B  2  411 ? -8.374  11.508  72.167  1.00 55.52  ? 411  PHE B N     1 
ATOM   5797  C  CA    . PHE B  2  411 ? -6.958  11.229  72.376  1.00 54.58  ? 411  PHE B CA    1 
ATOM   5798  C  C     . PHE B  2  411 ? -6.485  12.032  73.571  1.00 54.87  ? 411  PHE B C     1 
ATOM   5799  O  O     . PHE B  2  411 ? -6.629  13.250  73.597  1.00 54.36  ? 411  PHE B O     1 
ATOM   5800  C  CB    . PHE B  2  411 ? -6.180  11.603  71.124  1.00 52.30  ? 411  PHE B CB    1 
ATOM   5801  C  CG    . PHE B  2  411 ? -6.600  10.834  69.916  1.00 50.02  ? 411  PHE B CG    1 
ATOM   5802  C  CD1   . PHE B  2  411 ? -5.982  9.648   69.587  1.00 48.75  ? 411  PHE B CD1   1 
ATOM   5803  C  CD2   . PHE B  2  411 ? -7.642  11.283  69.121  1.00 50.28  ? 411  PHE B CD2   1 
ATOM   5804  C  CE1   . PHE B  2  411 ? -6.389  8.922   68.491  1.00 49.54  ? 411  PHE B CE1   1 
ATOM   5805  C  CE2   . PHE B  2  411 ? -8.059  10.556  68.013  1.00 49.03  ? 411  PHE B CE2   1 
ATOM   5806  C  CZ    . PHE B  2  411 ? -7.433  9.380   67.701  1.00 50.28  ? 411  PHE B CZ    1 
ATOM   5807  N  N     . THR B  2  412 ? -5.919  11.337  74.553  1.00 55.32  ? 412  THR B N     1 
ATOM   5808  C  CA    . THR B  2  412 ? -5.467  11.967  75.788  1.00 57.10  ? 412  THR B CA    1 
ATOM   5809  C  C     . THR B  2  412 ? -3.965  11.947  75.933  1.00 58.16  ? 412  THR B C     1 
ATOM   5810  O  O     . THR B  2  412 ? -3.405  12.516  76.879  1.00 56.76  ? 412  THR B O     1 
ATOM   5811  C  CB    . THR B  2  412 ? -6.038  11.245  76.978  1.00 57.16  ? 412  THR B CB    1 
ATOM   5812  O  OG1   . THR B  2  412 ? -5.464  9.933   77.052  1.00 57.52  ? 412  THR B OG1   1 
ATOM   5813  C  CG2   . THR B  2  412 ? -7.545  11.142  76.837  1.00 56.94  ? 412  THR B CG2   1 
ATOM   5814  N  N     . ASP B  2  413 ? -3.333  11.274  74.976  1.00 58.71  ? 413  ASP B N     1 
ATOM   5815  C  CA    . ASP B  2  413 ? -1.891  11.101  74.906  1.00 59.13  ? 413  ASP B CA    1 
ATOM   5816  C  C     . ASP B  2  413 ? -1.151  12.348  74.426  1.00 59.09  ? 413  ASP B C     1 
ATOM   5817  O  O     . ASP B  2  413 ? -1.207  12.670  73.246  1.00 60.19  ? 413  ASP B O     1 
ATOM   5818  C  CB    . ASP B  2  413 ? -1.626  9.946   73.969  1.00 61.34  ? 413  ASP B CB    1 
ATOM   5819  C  CG    . ASP B  2  413 ? -0.223  9.923   73.486  1.00 64.36  ? 413  ASP B CG    1 
ATOM   5820  O  OD1   . ASP B  2  413 ? 0.684   10.089  74.327  1.00 66.52  ? 413  ASP B OD1   1 
ATOM   5821  O  OD2   . ASP B  2  413 ? -0.027  9.737   72.269  1.00 65.12  ? 413  ASP B OD2   1 
ATOM   5822  N  N     . PRO B  2  414 ? -0.427  13.047  75.316  1.00 57.96  ? 414  PRO B N     1 
ATOM   5823  C  CA    . PRO B  2  414 ? 0.302   14.261  74.952  1.00 57.83  ? 414  PRO B CA    1 
ATOM   5824  C  C     . PRO B  2  414 ? 0.787   14.383  73.505  1.00 58.24  ? 414  PRO B C     1 
ATOM   5825  O  O     . PRO B  2  414 ? 0.343   15.272  72.781  1.00 58.18  ? 414  PRO B O     1 
ATOM   5826  C  CB    . PRO B  2  414 ? 1.417   14.295  75.979  1.00 58.51  ? 414  PRO B CB    1 
ATOM   5827  C  CG    . PRO B  2  414 ? 0.714   13.847  77.176  1.00 58.26  ? 414  PRO B CG    1 
ATOM   5828  C  CD    . PRO B  2  414 ? -0.057  12.645  76.678  1.00 58.94  ? 414  PRO B CD    1 
ATOM   5829  N  N     . PRO B  2  415 ? 1.699   13.509  73.055  1.00 58.01  ? 415  PRO B N     1 
ATOM   5830  C  CA    . PRO B  2  415 ? 2.170   13.614  71.668  1.00 58.13  ? 415  PRO B CA    1 
ATOM   5831  C  C     . PRO B  2  415 ? 1.058   13.717  70.617  1.00 58.87  ? 415  PRO B C     1 
ATOM   5832  O  O     . PRO B  2  415 ? 1.020   14.665  69.834  1.00 59.07  ? 415  PRO B O     1 
ATOM   5833  C  CB    . PRO B  2  415 ? 3.002   12.360  71.507  1.00 56.54  ? 415  PRO B CB    1 
ATOM   5834  C  CG    . PRO B  2  415 ? 3.634   12.268  72.836  1.00 57.42  ? 415  PRO B CG    1 
ATOM   5835  C  CD    . PRO B  2  415 ? 2.482   12.503  73.782  1.00 56.91  ? 415  PRO B CD    1 
ATOM   5836  N  N     . THR B  2  416 ? 0.153   12.750  70.596  1.00 59.01  ? 416  THR B N     1 
ATOM   5837  C  CA    . THR B  2  416 ? -0.948  12.769  69.626  1.00 58.79  ? 416  THR B CA    1 
ATOM   5838  C  C     . THR B  2  416 ? -1.817  14.038  69.722  1.00 57.67  ? 416  THR B C     1 
ATOM   5839  O  O     . THR B  2  416 ? -2.277  14.573  68.712  1.00 55.41  ? 416  THR B O     1 
ATOM   5840  C  CB    . THR B  2  416 ? -1.829  11.522  69.810  1.00 59.66  ? 416  THR B CB    1 
ATOM   5841  O  OG1   . THR B  2  416 ? -1.041  10.352  69.585  1.00 59.80  ? 416  THR B OG1   1 
ATOM   5842  C  CG2   . THR B  2  416 ? -2.977  11.530  68.842  1.00 58.94  ? 416  THR B CG2   1 
ATOM   5843  N  N     . VAL B  2  417 ? -2.049  14.503  70.936  1.00 57.00  ? 417  VAL B N     1 
ATOM   5844  C  CA    . VAL B  2  417 ? -2.840  15.700  71.107  1.00 57.73  ? 417  VAL B CA    1 
ATOM   5845  C  C     . VAL B  2  417 ? -2.098  16.829  70.443  1.00 58.70  ? 417  VAL B C     1 
ATOM   5846  O  O     . VAL B  2  417 ? -2.684  17.578  69.674  1.00 59.57  ? 417  VAL B O     1 
ATOM   5847  C  CB    . VAL B  2  417 ? -3.007  16.060  72.554  1.00 56.43  ? 417  VAL B CB    1 
ATOM   5848  C  CG1   . VAL B  2  417 ? -4.002  17.172  72.680  1.00 56.59  ? 417  VAL B CG1   1 
ATOM   5849  C  CG2   . VAL B  2  417 ? -3.434  14.863  73.324  1.00 57.15  ? 417  VAL B CG2   1 
ATOM   5850  N  N     . LYS B  2  418 ? -0.808  16.952  70.750  1.00 60.08  ? 418  LYS B N     1 
ATOM   5851  C  CA    . LYS B  2  418 ? 0.035   17.998  70.163  1.00 61.20  ? 418  LYS B CA    1 
ATOM   5852  C  C     . LYS B  2  418 ? 0.050   17.906  68.631  1.00 60.82  ? 418  LYS B C     1 
ATOM   5853  O  O     . LYS B  2  418 ? -0.255  18.882  67.934  1.00 60.63  ? 418  LYS B O     1 
ATOM   5854  C  CB    . LYS B  2  418 ? 1.466   17.921  70.711  1.00 62.65  ? 418  LYS B CB    1 
ATOM   5855  C  CG    . LYS B  2  418 ? 1.613   18.541  72.084  1.00 64.65  ? 418  LYS B CG    1 
ATOM   5856  C  CD    . LYS B  2  418 ? 3.009   18.385  72.645  1.00 66.68  ? 418  LYS B CD    1 
ATOM   5857  C  CE    . LYS B  2  418 ? 3.236   16.961  73.139  1.00 69.53  ? 418  LYS B CE    1 
ATOM   5858  N  NZ    . LYS B  2  418 ? 4.480   16.834  73.964  1.00 71.52  ? 418  LYS B NZ    1 
ATOM   5859  N  N     . SER B  2  419 ? 0.396   16.741  68.108  1.00 59.14  ? 419  SER B N     1 
ATOM   5860  C  CA    . SER B  2  419 ? 0.400   16.560  66.669  1.00 57.64  ? 419  SER B CA    1 
ATOM   5861  C  C     . SER B  2  419 ? -0.873  17.163  66.093  1.00 56.95  ? 419  SER B C     1 
ATOM   5862  O  O     . SER B  2  419 ? -0.815  18.007  65.210  1.00 55.91  ? 419  SER B O     1 
ATOM   5863  C  CB    . SER B  2  419 ? 0.443   15.078  66.333  1.00 58.09  ? 419  SER B CB    1 
ATOM   5864  O  OG    . SER B  2  419 ? 0.259   14.889  64.948  1.00 58.03  ? 419  SER B OG    1 
ATOM   5865  N  N     . TYR B  2  420 ? -2.018  16.719  66.613  1.00 56.16  ? 420  TYR B N     1 
ATOM   5866  C  CA    . TYR B  2  420 ? -3.324  17.179  66.165  1.00 54.77  ? 420  TYR B CA    1 
ATOM   5867  C  C     . TYR B  2  420 ? -3.551  18.656  66.322  1.00 54.77  ? 420  TYR B C     1 
ATOM   5868  O  O     . TYR B  2  420 ? -4.303  19.255  65.550  1.00 54.86  ? 420  TYR B O     1 
ATOM   5869  C  CB    . TYR B  2  420 ? -4.423  16.428  66.884  1.00 54.67  ? 420  TYR B CB    1 
ATOM   5870  C  CG    . TYR B  2  420 ? -4.782  15.133  66.208  1.00 54.79  ? 420  TYR B CG    1 
ATOM   5871  C  CD1   . TYR B  2  420 ? -5.369  15.128  64.957  1.00 54.01  ? 420  TYR B CD1   1 
ATOM   5872  C  CD2   . TYR B  2  420 ? -4.520  13.912  66.812  1.00 54.78  ? 420  TYR B CD2   1 
ATOM   5873  C  CE1   . TYR B  2  420 ? -5.686  13.942  64.319  1.00 55.65  ? 420  TYR B CE1   1 
ATOM   5874  C  CE2   . TYR B  2  420 ? -4.834  12.715  66.182  1.00 54.92  ? 420  TYR B CE2   1 
ATOM   5875  C  CZ    . TYR B  2  420 ? -5.417  12.737  64.933  1.00 56.11  ? 420  TYR B CZ    1 
ATOM   5876  O  OH    . TYR B  2  420 ? -5.724  11.562  64.282  1.00 56.92  ? 420  TYR B OH    1 
ATOM   5877  N  N     . ALA B  2  421 ? -2.909  19.247  67.324  1.00 53.49  ? 421  ALA B N     1 
ATOM   5878  C  CA    . ALA B  2  421 ? -3.018  20.685  67.558  1.00 52.62  ? 421  ALA B CA    1 
ATOM   5879  C  C     . ALA B  2  421 ? -2.232  21.470  66.502  1.00 52.36  ? 421  ALA B C     1 
ATOM   5880  O  O     . ALA B  2  421 ? -2.699  22.490  66.028  1.00 52.51  ? 421  ALA B O     1 
ATOM   5881  C  CB    . ALA B  2  421 ? -2.513  21.018  68.926  1.00 52.20  ? 421  ALA B CB    1 
ATOM   5882  N  N     . ARG B  2  422 ? -1.047  20.991  66.140  1.00 50.90  ? 422  ARG B N     1 
ATOM   5883  C  CA    . ARG B  2  422 ? -0.247  21.653  65.126  1.00 50.15  ? 422  ARG B CA    1 
ATOM   5884  C  C     . ARG B  2  422 ? -0.905  21.611  63.752  1.00 49.39  ? 422  ARG B C     1 
ATOM   5885  O  O     . ARG B  2  422 ? -0.669  22.475  62.921  1.00 49.72  ? 422  ARG B O     1 
ATOM   5886  C  CB    . ARG B  2  422 ? 1.147   21.025  65.045  1.00 50.58  ? 422  ARG B CB    1 
ATOM   5887  C  CG    . ARG B  2  422 ? 2.031   21.395  66.224  1.00 54.13  ? 422  ARG B CG    1 
ATOM   5888  C  CD    . ARG B  2  422 ? 3.503   20.920  66.140  1.00 55.67  ? 422  ARG B CD    1 
ATOM   5889  N  NE    . ARG B  2  422 ? 3.676   19.565  66.630  1.00 56.06  ? 422  ARG B NE    1 
ATOM   5890  C  CZ    . ARG B  2  422 ? 3.547   18.486  65.874  1.00 56.33  ? 422  ARG B CZ    1 
ATOM   5891  N  NH1   . ARG B  2  422 ? 3.261   18.609  64.584  1.00 53.63  ? 422  ARG B NH1   1 
ATOM   5892  N  NH2   . ARG B  2  422 ? 3.651   17.286  66.426  1.00 56.45  ? 422  ARG B NH2   1 
ATOM   5893  N  N     . LYS B  2  423 ? -1.723  20.603  63.510  1.00 49.47  ? 423  LYS B N     1 
ATOM   5894  C  CA    . LYS B  2  423 ? -2.399  20.474  62.230  1.00 49.65  ? 423  LYS B CA    1 
ATOM   5895  C  C     . LYS B  2  423 ? -3.685  21.275  62.248  1.00 49.56  ? 423  LYS B C     1 
ATOM   5896  O  O     . LYS B  2  423 ? -4.279  21.541  61.209  1.00 49.47  ? 423  LYS B O     1 
ATOM   5897  C  CB    . LYS B  2  423 ? -2.694  19.006  61.933  1.00 49.19  ? 423  LYS B CB    1 
ATOM   5898  C  CG    . LYS B  2  423 ? -1.469  18.167  61.628  1.00 52.56  ? 423  LYS B CG    1 
ATOM   5899  C  CD    . LYS B  2  423 ? -0.784  18.609  60.327  1.00 54.83  ? 423  LYS B CD    1 
ATOM   5900  C  CE    . LYS B  2  423 ? 0.556   17.906  60.082  1.00 56.67  ? 423  LYS B CE    1 
ATOM   5901  N  NZ    . LYS B  2  423 ? 1.564   18.270  61.130  1.00 58.41  ? 423  LYS B NZ    1 
ATOM   5902  N  N     . ALA B  2  424 ? -4.107  21.650  63.447  1.00 49.41  ? 424  ALA B N     1 
ATOM   5903  C  CA    . ALA B  2  424 ? -5.316  22.425  63.646  1.00 48.42  ? 424  ALA B CA    1 
ATOM   5904  C  C     . ALA B  2  424 ? -5.059  23.840  63.171  1.00 48.47  ? 424  ALA B C     1 
ATOM   5905  O  O     . ALA B  2  424 ? -5.917  24.479  62.579  1.00 48.44  ? 424  ALA B O     1 
ATOM   5906  C  CB    . ALA B  2  424 ? -5.675  22.427  65.095  1.00 48.89  ? 424  ALA B CB    1 
ATOM   5907  N  N     . ILE B  2  425 ? -3.866  24.327  63.447  1.00 48.46  ? 425  ILE B N     1 
ATOM   5908  C  CA    . ILE B  2  425 ? -3.459  25.664  63.030  1.00 48.63  ? 425  ILE B CA    1 
ATOM   5909  C  C     . ILE B  2  425 ? -3.912  25.984  61.626  1.00 47.19  ? 425  ILE B C     1 
ATOM   5910  O  O     . ILE B  2  425 ? -4.288  27.100  61.351  1.00 45.19  ? 425  ILE B O     1 
ATOM   5911  C  CB    . ILE B  2  425 ? -1.921  25.807  63.083  1.00 49.62  ? 425  ILE B CB    1 
ATOM   5912  C  CG1   . ILE B  2  425 ? -1.499  26.283  64.460  1.00 51.47  ? 425  ILE B CG1   1 
ATOM   5913  C  CG2   . ILE B  2  425 ? -1.438  26.762  62.031  1.00 49.33  ? 425  ILE B CG2   1 
ATOM   5914  C  CD1   . ILE B  2  425 ? -0.038  26.567  64.549  1.00 52.94  ? 425  ILE B CD1   1 
ATOM   5915  N  N     . PHE B  2  426 ? -3.854  24.999  60.745  1.00 47.63  ? 426  PHE B N     1 
ATOM   5916  C  CA    . PHE B  2  426 ? -4.240  25.175  59.353  1.00 49.97  ? 426  PHE B CA    1 
ATOM   5917  C  C     . PHE B  2  426 ? -5.751  25.149  59.126  1.00 50.39  ? 426  PHE B C     1 
ATOM   5918  O  O     . PHE B  2  426 ? -6.210  25.151  57.980  1.00 50.57  ? 426  PHE B O     1 
ATOM   5919  C  CB    . PHE B  2  426 ? -3.617  24.089  58.475  1.00 51.22  ? 426  PHE B CB    1 
ATOM   5920  C  CG    . PHE B  2  426 ? -2.146  23.900  58.677  1.00 52.85  ? 426  PHE B CG    1 
ATOM   5921  C  CD1   . PHE B  2  426 ? -1.280  24.976  58.696  1.00 54.47  ? 426  PHE B CD1   1 
ATOM   5922  C  CD2   . PHE B  2  426 ? -1.617  22.625  58.787  1.00 53.26  ? 426  PHE B CD2   1 
ATOM   5923  C  CE1   . PHE B  2  426 ? 0.098   24.779  58.815  1.00 54.89  ? 426  PHE B CE1   1 
ATOM   5924  C  CE2   . PHE B  2  426 ? -0.247  22.422  58.907  1.00 54.33  ? 426  PHE B CE2   1 
ATOM   5925  C  CZ    . PHE B  2  426 ? 0.610   23.501  58.919  1.00 55.17  ? 426  PHE B CZ    1 
ATOM   5926  N  N     . GLY B  2  427 ? -6.524  25.116  60.204  1.00 49.88  ? 427  GLY B N     1 
ATOM   5927  C  CA    . GLY B  2  427 ? -7.967  25.063  60.063  1.00 48.64  ? 427  GLY B CA    1 
ATOM   5928  C  C     . GLY B  2  427 ? -8.445  23.623  60.111  1.00 47.83  ? 427  GLY B C     1 
ATOM   5929  O  O     . GLY B  2  427 ? -7.897  22.832  60.859  1.00 46.98  ? 427  GLY B O     1 
ATOM   5930  N  N     . GLU B  2  428 ? -9.446  23.272  59.312  1.00 48.73  ? 428  GLU B N     1 
ATOM   5931  C  CA    . GLU B  2  428 ? -9.960  21.903  59.311  1.00 48.85  ? 428  GLU B CA    1 
ATOM   5932  C  C     . GLU B  2  428 ? -8.889  20.859  59.012  1.00 49.18  ? 428  GLU B C     1 
ATOM   5933  O  O     . GLU B  2  428 ? -8.124  21.014  58.081  1.00 50.28  ? 428  GLU B O     1 
ATOM   5934  C  CB    . GLU B  2  428 ? -11.127 21.768  58.331  1.00 47.23  ? 428  GLU B CB    1 
ATOM   5935  C  CG    . GLU B  2  428 ? -12.463 22.279  58.887  1.00 46.81  ? 428  GLU B CG    1 
ATOM   5936  C  CD    . GLU B  2  428 ? -12.810 21.712  60.263  1.00 45.64  ? 428  GLU B CD    1 
ATOM   5937  O  OE1   . GLU B  2  428 ? -12.643 20.492  60.456  1.00 45.81  ? 428  GLU B OE1   1 
ATOM   5938  O  OE2   . GLU B  2  428 ? -13.258 22.477  61.147  1.00 44.00  ? 428  GLU B OE2   1 
ATOM   5939  N  N     . ILE B  2  429 ? -8.859  19.792  59.803  1.00 48.01  ? 429  ILE B N     1 
ATOM   5940  C  CA    . ILE B  2  429 ? -7.881  18.730  59.654  1.00 47.95  ? 429  ILE B CA    1 
ATOM   5941  C  C     . ILE B  2  429 ? -8.322  17.638  58.698  1.00 49.73  ? 429  ILE B C     1 
ATOM   5942  O  O     . ILE B  2  429 ? -9.386  17.084  58.867  1.00 48.86  ? 429  ILE B O     1 
ATOM   5943  C  CB    . ILE B  2  429 ? -7.590  18.102  61.005  1.00 46.77  ? 429  ILE B CB    1 
ATOM   5944  C  CG1   . ILE B  2  429 ? -6.949  19.134  61.934  1.00 46.18  ? 429  ILE B CG1   1 
ATOM   5945  C  CG2   . ILE B  2  429 ? -6.714  16.910  60.835  1.00 47.50  ? 429  ILE B CG2   1 
ATOM   5946  C  CD1   . ILE B  2  429 ? -6.581  18.631  63.309  1.00 42.74  ? 429  ILE B CD1   1 
ATOM   5947  N  N     . PHE B  2  430 ? -7.485  17.318  57.714  1.00 52.56  ? 430  PHE B N     1 
ATOM   5948  C  CA    . PHE B  2  430 ? -7.777  16.285  56.717  1.00 55.56  ? 430  PHE B CA    1 
ATOM   5949  C  C     . PHE B  2  430 ? -6.733  15.214  56.625  1.00 56.31  ? 430  PHE B C     1 
ATOM   5950  O  O     . PHE B  2  430 ? -5.652  15.337  57.189  1.00 56.26  ? 430  PHE B O     1 
ATOM   5951  C  CB    . PHE B  2  430 ? -7.882  16.883  55.334  1.00 57.37  ? 430  PHE B CB    1 
ATOM   5952  C  CG    . PHE B  2  430 ? -9.105  17.677  55.129  1.00 60.99  ? 430  PHE B CG    1 
ATOM   5953  C  CD1   . PHE B  2  430 ? -9.331  18.819  55.869  1.00 62.20  ? 430  PHE B CD1   1 
ATOM   5954  C  CD2   . PHE B  2  430 ? -10.044 17.282  54.195  1.00 61.99  ? 430  PHE B CD2   1 
ATOM   5955  C  CE1   . PHE B  2  430 ? -10.474 19.554  55.684  1.00 62.44  ? 430  PHE B CE1   1 
ATOM   5956  C  CE2   . PHE B  2  430 ? -11.189 18.014  54.006  1.00 62.75  ? 430  PHE B CE2   1 
ATOM   5957  C  CZ    . PHE B  2  430 ? -11.402 19.152  54.754  1.00 62.47  ? 430  PHE B CZ    1 
ATOM   5958  N  N     . GLU B  2  431 ? -7.056  14.170  55.864  1.00 57.26  ? 431  GLU B N     1 
ATOM   5959  C  CA    . GLU B  2  431 ? -6.145  13.039  55.647  1.00 58.61  ? 431  GLU B CA    1 
ATOM   5960  C  C     . GLU B  2  431 ? -5.658  12.986  54.212  1.00 57.70  ? 431  GLU B C     1 
ATOM   5961  O  O     . GLU B  2  431 ? -6.426  12.731  53.298  1.00 57.07  ? 431  GLU B O     1 
ATOM   5962  C  CB    . GLU B  2  431 ? -6.825  11.729  55.972  1.00 61.35  ? 431  GLU B CB    1 
ATOM   5963  C  CG    . GLU B  2  431 ? -5.959  10.535  55.660  1.00 63.55  ? 431  GLU B CG    1 
ATOM   5964  C  CD    . GLU B  2  431 ? -6.583  9.245   56.144  1.00 67.37  ? 431  GLU B CD    1 
ATOM   5965  O  OE1   . GLU B  2  431 ? -6.855  9.161   57.377  1.00 69.39  ? 431  GLU B OE1   1 
ATOM   5966  O  OE2   . GLU B  2  431 ? -6.804  8.322   55.307  1.00 67.33  ? 431  GLU B OE2   1 
ATOM   5967  N  N     . PHE B  2  432 ? -4.367  13.189  54.031  1.00 56.32  ? 432  PHE B N     1 
ATOM   5968  C  CA    . PHE B  2  432 ? -3.795  13.227  52.708  1.00 54.78  ? 432  PHE B CA    1 
ATOM   5969  C  C     . PHE B  2  432 ? -3.030  11.991  52.250  1.00 54.41  ? 432  PHE B C     1 
ATOM   5970  O  O     . PHE B  2  432 ? -2.465  11.253  53.047  1.00 53.53  ? 432  PHE B O     1 
ATOM   5971  C  CB    . PHE B  2  432 ? -2.849  14.427  52.605  1.00 54.47  ? 432  PHE B CB    1 
ATOM   5972  C  CG    . PHE B  2  432 ? -3.489  15.750  52.899  1.00 53.15  ? 432  PHE B CG    1 
ATOM   5973  C  CD1   . PHE B  2  432 ? -4.315  16.366  51.973  1.00 51.67  ? 432  PHE B CD1   1 
ATOM   5974  C  CD2   . PHE B  2  432 ? -3.253  16.386  54.107  1.00 52.61  ? 432  PHE B CD2   1 
ATOM   5975  C  CE1   . PHE B  2  432 ? -4.893  17.593  52.248  1.00 52.31  ? 432  PHE B CE1   1 
ATOM   5976  C  CE2   . PHE B  2  432 ? -3.832  17.621  54.390  1.00 53.08  ? 432  PHE B CE2   1 
ATOM   5977  C  CZ    . PHE B  2  432 ? -4.653  18.224  53.459  1.00 51.95  ? 432  PHE B CZ    1 
ATOM   5978  N  N     . ASP B  2  433 ? -3.011  11.791  50.940  1.00 53.94  ? 433  ASP B N     1 
ATOM   5979  C  CA    . ASP B  2  433 ? -2.260  10.709  50.335  1.00 53.77  ? 433  ASP B CA    1 
ATOM   5980  C  C     . ASP B  2  433 ? -1.032  11.397  49.768  1.00 54.39  ? 433  ASP B C     1 
ATOM   5981  O  O     . ASP B  2  433 ? -1.109  12.178  48.823  1.00 52.83  ? 433  ASP B O     1 
ATOM   5982  C  CB    . ASP B  2  433 ? -3.068  10.048  49.231  1.00 53.93  ? 433  ASP B CB    1 
ATOM   5983  C  CG    . ASP B  2  433 ? -2.194  9.376   48.194  1.00 54.64  ? 433  ASP B CG    1 
ATOM   5984  O  OD1   . ASP B  2  433 ? -1.028  9.065   48.500  1.00 54.18  ? 433  ASP B OD1   1 
ATOM   5985  O  OD2   . ASP B  2  433 ? -2.684  9.147   47.066  1.00 55.76  ? 433  ASP B OD2   1 
ATOM   5986  N  N     . THR B  2  434 ? 0.115   11.100  50.345  1.00 55.65  ? 434  THR B N     1 
ATOM   5987  C  CA    . THR B  2  434 ? 1.325   11.758  49.906  1.00 57.24  ? 434  THR B CA    1 
ATOM   5988  C  C     . THR B  2  434 ? 2.303   10.846  49.216  1.00 58.15  ? 434  THR B C     1 
ATOM   5989  O  O     . THR B  2  434 ? 3.411   11.257  48.946  1.00 59.08  ? 434  THR B O     1 
ATOM   5990  C  CB    . THR B  2  434 ? 2.023   12.331  51.090  1.00 58.13  ? 434  THR B CB    1 
ATOM   5991  O  OG1   . THR B  2  434 ? 2.691   11.267  51.773  1.00 60.24  ? 434  THR B OG1   1 
ATOM   5992  C  CG2   . THR B  2  434 ? 1.025   12.948  52.040  1.00 57.37  ? 434  THR B CG2   1 
ATOM   5993  N  N     . GLU B  2  435 ? 1.904   9.620   48.924  1.00 58.13  ? 435  GLU B N     1 
ATOM   5994  C  CA    . GLU B  2  435 ? 2.802   8.666   48.287  1.00 58.25  ? 435  GLU B CA    1 
ATOM   5995  C  C     . GLU B  2  435 ? 2.680   8.677   46.774  1.00 57.56  ? 435  GLU B C     1 
ATOM   5996  O  O     . GLU B  2  435 ? 3.667   8.611   46.040  1.00 57.69  ? 435  GLU B O     1 
ATOM   5997  C  CB    . GLU B  2  435 ? 2.482   7.269   48.805  1.00 60.92  ? 435  GLU B CB    1 
ATOM   5998  C  CG    . GLU B  2  435 ? 3.520   6.189   48.541  1.00 64.26  ? 435  GLU B CG    1 
ATOM   5999  C  CD    . GLU B  2  435 ? 4.517   6.026   49.683  1.00 66.18  ? 435  GLU B CD    1 
ATOM   6000  O  OE1   . GLU B  2  435 ? 5.303   5.040   49.647  1.00 68.72  ? 435  GLU B OE1   1 
ATOM   6001  O  OE2   . GLU B  2  435 ? 4.519   6.875   50.609  1.00 66.17  ? 435  GLU B OE2   1 
ATOM   6002  N  N     . THR B  2  436 ? 1.445   8.760   46.319  1.00 56.33  ? 436  THR B N     1 
ATOM   6003  C  CA    . THR B  2  436 ? 1.141   8.752   44.904  1.00 55.35  ? 436  THR B CA    1 
ATOM   6004  C  C     . THR B  2  436 ? 1.908   9.739   44.062  1.00 55.41  ? 436  THR B C     1 
ATOM   6005  O  O     . THR B  2  436 ? 2.434   9.388   43.029  1.00 56.18  ? 436  THR B O     1 
ATOM   6006  C  CB    . THR B  2  436 ? -0.313  9.022   44.691  1.00 53.80  ? 436  THR B CB    1 
ATOM   6007  O  OG1   . THR B  2  436 ? -1.060  8.276   45.645  1.00 54.43  ? 436  THR B OG1   1 
ATOM   6008  C  CG2   . THR B  2  436 ? -0.717  8.604   43.332  1.00 52.50  ? 436  THR B CG2   1 
ATOM   6009  N  N     . LEU B  2  437 ? 1.957   10.979  44.498  1.00 55.48  ? 437  LEU B N     1 
ATOM   6010  C  CA    . LEU B  2  437 ? 2.631   12.008  43.743  1.00 55.12  ? 437  LEU B CA    1 
ATOM   6011  C  C     . LEU B  2  437 ? 3.966   12.253  44.350  1.00 55.69  ? 437  LEU B C     1 
ATOM   6012  O  O     . LEU B  2  437 ? 4.701   13.116  43.902  1.00 57.49  ? 437  LEU B O     1 
ATOM   6013  C  CB    . LEU B  2  437 ? 1.820   13.294  43.783  1.00 53.57  ? 437  LEU B CB    1 
ATOM   6014  C  CG    . LEU B  2  437 ? 0.441   13.098  43.179  1.00 52.27  ? 437  LEU B CG    1 
ATOM   6015  C  CD1   . LEU B  2  437 ? -0.371  14.346  43.309  1.00 52.34  ? 437  LEU B CD1   1 
ATOM   6016  C  CD2   . LEU B  2  437 ? 0.614   12.708  41.734  1.00 50.83  ? 437  LEU B CD2   1 
ATOM   6017  N  N     . ASN B  2  438 ? 4.282   11.525  45.396  1.00 55.25  ? 438  ASN B N     1 
ATOM   6018  C  CA    . ASN B  2  438 ? 5.564   11.750  46.018  1.00 55.21  ? 438  ASN B CA    1 
ATOM   6019  C  C     . ASN B  2  438 ? 5.638   13.200  46.520  1.00 53.98  ? 438  ASN B C     1 
ATOM   6020  O  O     . ASN B  2  438 ? 6.616   13.899  46.293  1.00 53.44  ? 438  ASN B O     1 
ATOM   6021  C  CB    . ASN B  2  438 ? 6.648   11.495  44.983  1.00 57.10  ? 438  ASN B CB    1 
ATOM   6022  C  CG    . ASN B  2  438 ? 7.952   11.101  45.609  1.00 60.03  ? 438  ASN B CG    1 
ATOM   6023  O  OD1   . ASN B  2  438 ? 8.550   11.876  46.364  1.00 60.81  ? 438  ASN B OD1   1 
ATOM   6024  N  ND2   . ASN B  2  438 ? 8.398   9.876   45.326  1.00 60.90  ? 438  ASN B ND2   1 
ATOM   6025  N  N     . SER B  2  439 ? 4.602   13.638  47.218  1.00 53.13  ? 439  SER B N     1 
ATOM   6026  C  CA    . SER B  2  439 ? 4.541   14.996  47.727  1.00 53.78  ? 439  SER B CA    1 
ATOM   6027  C  C     . SER B  2  439 ? 5.617   15.262  48.746  1.00 53.63  ? 439  SER B C     1 
ATOM   6028  O  O     . SER B  2  439 ? 6.251   14.333  49.220  1.00 54.21  ? 439  SER B O     1 
ATOM   6029  C  CB    . SER B  2  439 ? 3.181   15.266  48.336  1.00 54.57  ? 439  SER B CB    1 
ATOM   6030  O  OG    . SER B  2  439 ? 2.175   15.092  47.362  1.00 57.11  ? 439  SER B OG    1 
ATOM   6031  N  N     . ASP B  2  440 ? 5.812   16.526  49.099  1.00 52.56  ? 440  ASP B N     1 
ATOM   6032  C  CA    . ASP B  2  440 ? 6.854   16.874  50.038  1.00 52.03  ? 440  ASP B CA    1 
ATOM   6033  C  C     . ASP B  2  440 ? 6.405   17.674  51.222  1.00 51.81  ? 440  ASP B C     1 
ATOM   6034  O  O     . ASP B  2  440 ? 7.220   18.077  52.026  1.00 51.62  ? 440  ASP B O     1 
ATOM   6035  C  CB    . ASP B  2  440 ? 7.963   17.615  49.323  1.00 53.50  ? 440  ASP B CB    1 
ATOM   6036  C  CG    . ASP B  2  440 ? 7.465   18.829  48.570  1.00 55.84  ? 440  ASP B CG    1 
ATOM   6037  O  OD1   . ASP B  2  440 ? 8.282   19.438  47.831  1.00 55.35  ? 440  ASP B OD1   1 
ATOM   6038  O  OD2   . ASP B  2  440 ? 6.267   19.169  48.715  1.00 56.95  ? 440  ASP B OD2   1 
ATOM   6039  N  N     . GLY B  2  441 ? 5.119   17.935  51.329  1.00 52.19  ? 441  GLY B N     1 
ATOM   6040  C  CA    . GLY B  2  441 ? 4.629   18.651  52.493  1.00 52.20  ? 441  GLY B CA    1 
ATOM   6041  C  C     . GLY B  2  441 ? 4.786   20.155  52.560  1.00 52.06  ? 441  GLY B C     1 
ATOM   6042  O  O     . GLY B  2  441 ? 4.738   20.747  53.642  1.00 52.90  ? 441  GLY B O     1 
ATOM   6043  N  N     . ILE B  2  442 ? 4.950   20.784  51.412  1.00 51.29  ? 442  ILE B N     1 
ATOM   6044  C  CA    . ILE B  2  442 ? 5.106   22.219  51.392  1.00 49.53  ? 442  ILE B CA    1 
ATOM   6045  C  C     . ILE B  2  442 ? 4.091   22.793  50.460  1.00 49.07  ? 442  ILE B C     1 
ATOM   6046  O  O     . ILE B  2  442 ? 4.051   22.431  49.290  1.00 47.11  ? 442  ILE B O     1 
ATOM   6047  C  CB    . ILE B  2  442 ? 6.478   22.611  50.905  1.00 50.07  ? 442  ILE B CB    1 
ATOM   6048  C  CG1   . ILE B  2  442 ? 7.535   21.720  51.533  1.00 48.63  ? 442  ILE B CG1   1 
ATOM   6049  C  CG2   . ILE B  2  442 ? 6.776   23.994  51.353  1.00 50.39  ? 442  ILE B CG2   1 
ATOM   6050  C  CD1   . ILE B  2  442 ? 8.817   21.767  50.829  1.00 49.08  ? 442  ILE B CD1   1 
ATOM   6051  N  N     . PHE B  2  443 ? 3.283   23.695  51.010  1.00 48.54  ? 443  PHE B N     1 
ATOM   6052  C  CA    . PHE B  2  443 ? 2.212   24.390  50.308  1.00 49.44  ? 443  PHE B CA    1 
ATOM   6053  C  C     . PHE B  2  443 ? 2.617   25.023  48.981  1.00 51.07  ? 443  PHE B C     1 
ATOM   6054  O  O     . PHE B  2  443 ? 3.723   25.549  48.844  1.00 51.23  ? 443  PHE B O     1 
ATOM   6055  C  CB    . PHE B  2  443 ? 1.650   25.490  51.198  1.00 47.58  ? 443  PHE B CB    1 
ATOM   6056  C  CG    . PHE B  2  443 ? 1.016   24.993  52.457  1.00 45.01  ? 443  PHE B CG    1 
ATOM   6057  C  CD1   . PHE B  2  443 ? -0.051  24.102  52.413  1.00 44.61  ? 443  PHE B CD1   1 
ATOM   6058  C  CD2   . PHE B  2  443 ? 1.468   25.431  53.681  1.00 42.53  ? 443  PHE B CD2   1 
ATOM   6059  C  CE1   . PHE B  2  443 ? -0.650  23.665  53.570  1.00 41.86  ? 443  PHE B CE1   1 
ATOM   6060  C  CE2   . PHE B  2  443 ? 0.875   24.998  54.833  1.00 42.31  ? 443  PHE B CE2   1 
ATOM   6061  C  CZ    . PHE B  2  443 ? -0.183  24.117  54.780  1.00 43.41  ? 443  PHE B CZ    1 
ATOM   6062  N  N     . ARG B  2  444 ? 1.703   24.979  48.016  1.00 51.86  ? 444  ARG B N     1 
ATOM   6063  C  CA    . ARG B  2  444 ? 1.927   25.562  46.703  1.00 52.58  ? 444  ARG B CA    1 
ATOM   6064  C  C     . ARG B  2  444 ? 0.635   26.287  46.352  1.00 53.05  ? 444  ARG B C     1 
ATOM   6065  O  O     . ARG B  2  444 ? -0.436  25.840  46.744  1.00 53.82  ? 444  ARG B O     1 
ATOM   6066  C  CB    . ARG B  2  444 ? 2.235   24.478  45.666  1.00 51.37  ? 444  ARG B CB    1 
ATOM   6067  C  CG    . ARG B  2  444 ? 3.348   23.537  46.042  1.00 48.28  ? 444  ARG B CG    1 
ATOM   6068  C  CD    . ARG B  2  444 ? 3.712   22.665  44.866  1.00 50.12  ? 444  ARG B CD    1 
ATOM   6069  N  NE    . ARG B  2  444 ? 4.556   21.528  45.223  1.00 54.74  ? 444  ARG B NE    1 
ATOM   6070  C  CZ    . ARG B  2  444 ? 5.696   21.602  45.911  1.00 57.37  ? 444  ARG B CZ    1 
ATOM   6071  N  NH1   . ARG B  2  444 ? 6.151   22.762  46.328  1.00 60.41  ? 444  ARG B NH1   1 
ATOM   6072  N  NH2   . ARG B  2  444 ? 6.397   20.516  46.194  1.00 57.05  ? 444  ARG B NH2   1 
ATOM   6073  N  N     . THR B  2  445 ? 0.728   27.395  45.617  1.00 53.22  ? 445  THR B N     1 
ATOM   6074  C  CA    . THR B  2  445 ? -0.463  28.180  45.272  1.00 52.36  ? 445  THR B CA    1 
ATOM   6075  C  C     . THR B  2  445 ? -1.396  27.561  44.238  1.00 50.51  ? 445  THR B C     1 
ATOM   6076  O  O     . THR B  2  445 ? -0.992  26.675  43.498  1.00 49.13  ? 445  THR B O     1 
ATOM   6077  C  CB    . THR B  2  445 ? -0.078  29.577  44.790  1.00 53.16  ? 445  THR B CB    1 
ATOM   6078  O  OG1   . THR B  2  445 ? -1.275  30.339  44.619  1.00 52.96  ? 445  THR B OG1   1 
ATOM   6079  C  CG2   . THR B  2  445 ? 0.712   29.512  43.468  1.00 50.93  ? 445  THR B CG2   1 
ATOM   6080  N  N     . SER B  2  446 ? -2.639  28.030  44.183  1.00 49.29  ? 446  SER B N     1 
ATOM   6081  C  CA    . SER B  2  446 ? -3.604  27.496  43.221  1.00 48.78  ? 446  SER B CA    1 
ATOM   6082  C  C     . SER B  2  446 ? -3.630  28.287  41.912  1.00 46.76  ? 446  SER B C     1 
ATOM   6083  O  O     . SER B  2  446 ? -2.925  29.275  41.773  1.00 46.58  ? 446  SER B O     1 
ATOM   6084  C  CB    . SER B  2  446 ? -5.005  27.473  43.839  1.00 49.52  ? 446  SER B CB    1 
ATOM   6085  O  OG    . SER B  2  446 ? -5.530  28.770  44.012  1.00 53.35  ? 446  SER B OG    1 
ATOM   6086  N  N     . PRO B  2  447 ? -4.429  27.847  40.928  1.00 45.71  ? 447  PRO B N     1 
ATOM   6087  C  CA    . PRO B  2  447 ? -4.535  28.531  39.645  1.00 46.00  ? 447  PRO B CA    1 
ATOM   6088  C  C     . PRO B  2  447 ? -4.895  29.974  39.867  1.00 47.96  ? 447  PRO B C     1 
ATOM   6089  O  O     . PRO B  2  447 ? -4.344  30.871  39.235  1.00 47.02  ? 447  PRO B O     1 
ATOM   6090  C  CB    . PRO B  2  447 ? -5.654  27.782  38.960  1.00 45.74  ? 447  PRO B CB    1 
ATOM   6091  C  CG    . PRO B  2  447 ? -5.428  26.418  39.418  1.00 46.90  ? 447  PRO B CG    1 
ATOM   6092  C  CD    . PRO B  2  447 ? -5.213  26.608  40.886  1.00 47.06  ? 447  PRO B CD    1 
ATOM   6093  N  N     . ARG B  2  448 ? -5.833  30.198  40.774  1.00 49.50  ? 448  ARG B N     1 
ATOM   6094  C  CA    . ARG B  2  448 ? -6.236  31.557  41.082  1.00 50.31  ? 448  ARG B CA    1 
ATOM   6095  C  C     . ARG B  2  448 ? -4.996  32.348  41.395  1.00 50.61  ? 448  ARG B C     1 
ATOM   6096  O  O     . ARG B  2  448 ? -4.888  33.506  41.026  1.00 53.97  ? 448  ARG B O     1 
ATOM   6097  C  CB    . ARG B  2  448 ? -7.161  31.588  42.287  1.00 51.56  ? 448  ARG B CB    1 
ATOM   6098  C  CG    . ARG B  2  448 ? -7.422  32.994  42.808  1.00 52.94  ? 448  ARG B CG    1 
ATOM   6099  C  CD    . ARG B  2  448 ? -8.330  32.918  43.992  1.00 55.50  ? 448  ARG B CD    1 
ATOM   6100  N  NE    . ARG B  2  448 ? -9.515  32.159  43.634  1.00 60.49  ? 448  ARG B NE    1 
ATOM   6101  C  CZ    . ARG B  2  448 ? -10.477 32.633  42.859  1.00 62.37  ? 448  ARG B CZ    1 
ATOM   6102  N  NH1   . ARG B  2  448 ? -10.375 33.858  42.388  1.00 64.10  ? 448  ARG B NH1   1 
ATOM   6103  N  NH2   . ARG B  2  448 ? -11.525 31.887  42.545  1.00 63.51  ? 448  ARG B NH2   1 
ATOM   6104  N  N     . GLY B  2  449 ? -4.064  31.711  42.081  1.00 49.81  ? 449  GLY B N     1 
ATOM   6105  C  CA    . GLY B  2  449 ? -2.840  32.375  42.440  1.00 50.35  ? 449  GLY B CA    1 
ATOM   6106  C  C     . GLY B  2  449 ? -1.990  32.663  41.223  1.00 52.38  ? 449  GLY B C     1 
ATOM   6107  O  O     . GLY B  2  449 ? -1.739  33.830  40.919  1.00 54.05  ? 449  GLY B O     1 
ATOM   6108  N  N     . TRP B  2  450 ? -1.555  31.623  40.518  1.00 50.43  ? 450  TRP B N     1 
ATOM   6109  C  CA    . TRP B  2  450 ? -0.706  31.824  39.347  1.00 49.82  ? 450  TRP B CA    1 
ATOM   6110  C  C     . TRP B  2  450 ? -1.270  32.785  38.316  1.00 48.51  ? 450  TRP B C     1 
ATOM   6111  O  O     . TRP B  2  450 ? -0.654  33.801  38.010  1.00 47.06  ? 450  TRP B O     1 
ATOM   6112  C  CB    . TRP B  2  450 ? -0.402  30.491  38.678  1.00 51.38  ? 450  TRP B CB    1 
ATOM   6113  C  CG    . TRP B  2  450 ? 0.515   29.624  39.468  1.00 53.55  ? 450  TRP B CG    1 
ATOM   6114  C  CD1   . TRP B  2  450 ? 0.180   28.528  40.176  1.00 53.20  ? 450  TRP B CD1   1 
ATOM   6115  C  CD2   . TRP B  2  450 ? 1.926   29.785  39.619  1.00 53.56  ? 450  TRP B CD2   1 
ATOM   6116  N  NE1   . TRP B  2  450 ? 1.287   27.990  40.757  1.00 53.22  ? 450  TRP B NE1   1 
ATOM   6117  C  CE2   . TRP B  2  450 ? 2.375   28.745  40.429  1.00 53.30  ? 450  TRP B CE2   1 
ATOM   6118  C  CE3   . TRP B  2  450 ? 2.851   30.712  39.146  1.00 54.13  ? 450  TRP B CE3   1 
ATOM   6119  C  CZ2   . TRP B  2  450 ? 3.707   28.596  40.777  1.00 54.86  ? 450  TRP B CZ2   1 
ATOM   6120  C  CZ3   . TRP B  2  450 ? 4.176   30.564  39.495  1.00 55.32  ? 450  TRP B CZ3   1 
ATOM   6121  C  CH2   . TRP B  2  450 ? 4.591   29.515  40.300  1.00 54.70  ? 450  TRP B CH2   1 
ATOM   6122  N  N     . PHE B  2  451 ? -2.438  32.456  37.782  1.00 47.78  ? 451  PHE B N     1 
ATOM   6123  C  CA    . PHE B  2  451 ? -3.070  33.295  36.788  1.00 45.28  ? 451  PHE B CA    1 
ATOM   6124  C  C     . PHE B  2  451 ? -2.891  34.720  37.208  1.00 45.66  ? 451  PHE B C     1 
ATOM   6125  O  O     . PHE B  2  451 ? -2.459  35.545  36.434  1.00 45.41  ? 451  PHE B O     1 
ATOM   6126  C  CB    . PHE B  2  451 ? -4.559  33.024  36.674  1.00 42.12  ? 451  PHE B CB    1 
ATOM   6127  C  CG    . PHE B  2  451 ? -5.233  33.890  35.652  1.00 39.31  ? 451  PHE B CG    1 
ATOM   6128  C  CD1   . PHE B  2  451 ? -5.536  33.396  34.402  1.00 37.53  ? 451  PHE B CD1   1 
ATOM   6129  C  CD2   . PHE B  2  451 ? -5.513  35.215  35.921  1.00 37.88  ? 451  PHE B CD2   1 
ATOM   6130  C  CE1   . PHE B  2  451 ? -6.100  34.199  33.447  1.00 35.73  ? 451  PHE B CE1   1 
ATOM   6131  C  CE2   . PHE B  2  451 ? -6.076  36.016  34.964  1.00 36.91  ? 451  PHE B CE2   1 
ATOM   6132  C  CZ    . PHE B  2  451 ? -6.368  35.503  33.729  1.00 36.10  ? 451  PHE B CZ    1 
ATOM   6133  N  N     . THR B  2  452 ? -3.230  35.010  38.444  1.00 44.73  ? 452  THR B N     1 
ATOM   6134  C  CA    . THR B  2  452 ? -3.100  36.359  38.933  1.00 46.30  ? 452  THR B CA    1 
ATOM   6135  C  C     . THR B  2  452 ? -1.675  36.868  38.885  1.00 47.04  ? 452  THR B C     1 
ATOM   6136  O  O     . THR B  2  452 ? -1.448  38.027  38.568  1.00 48.15  ? 452  THR B O     1 
ATOM   6137  C  CB    . THR B  2  452 ? -3.603  36.468  40.362  1.00 46.75  ? 452  THR B CB    1 
ATOM   6138  O  OG1   . THR B  2  452 ? -4.986  36.119  40.391  1.00 45.88  ? 452  THR B OG1   1 
ATOM   6139  C  CG2   . THR B  2  452 ? -3.411  37.885  40.895  1.00 46.77  ? 452  THR B CG2   1 
ATOM   6140  N  N     . PHE B  2  453 ? -0.716  36.012  39.205  1.00 46.46  ? 453  PHE B N     1 
ATOM   6141  C  CA    . PHE B  2  453 ? 0.674   36.435  39.203  1.00 45.84  ? 453  PHE B CA    1 
ATOM   6142  C  C     . PHE B  2  453 ? 1.142   36.751  37.811  1.00 46.25  ? 453  PHE B C     1 
ATOM   6143  O  O     . PHE B  2  453 ? 1.749   37.784  37.574  1.00 45.62  ? 453  PHE B O     1 
ATOM   6144  C  CB    . PHE B  2  453 ? 1.576   35.357  39.787  1.00 45.13  ? 453  PHE B CB    1 
ATOM   6145  C  CG    . PHE B  2  453 ? 3.049   35.572  39.500  1.00 43.06  ? 453  PHE B CG    1 
ATOM   6146  C  CD1   . PHE B  2  453 ? 3.757   36.587  40.115  1.00 41.68  ? 453  PHE B CD1   1 
ATOM   6147  C  CD2   . PHE B  2  453 ? 3.719   34.745  38.615  1.00 40.83  ? 453  PHE B CD2   1 
ATOM   6148  C  CE1   . PHE B  2  453 ? 5.094   36.760  39.850  1.00 39.86  ? 453  PHE B CE1   1 
ATOM   6149  C  CE2   . PHE B  2  453 ? 5.053   34.918  38.351  1.00 39.54  ? 453  PHE B CE2   1 
ATOM   6150  C  CZ    . PHE B  2  453 ? 5.740   35.922  38.966  1.00 39.73  ? 453  PHE B CZ    1 
ATOM   6151  N  N     . ALA B  2  454 ? 0.863   35.854  36.886  1.00 46.79  ? 454  ALA B N     1 
ATOM   6152  C  CA    . ALA B  2  454 ? 1.287   36.051  35.514  1.00 47.45  ? 454  ALA B CA    1 
ATOM   6153  C  C     . ALA B  2  454 ? 0.736   37.330  34.904  1.00 48.00  ? 454  ALA B C     1 
ATOM   6154  O  O     . ALA B  2  454 ? 1.474   38.138  34.350  1.00 47.28  ? 454  ALA B O     1 
ATOM   6155  C  CB    . ALA B  2  454 ? 0.877   34.871  34.693  1.00 48.23  ? 454  ALA B CB    1 
ATOM   6156  N  N     . HIS B  2  455 ? -0.566  37.513  35.013  1.00 48.97  ? 455  HIS B N     1 
ATOM   6157  C  CA    . HIS B  2  455 ? -1.196  38.684  34.442  1.00 49.83  ? 455  HIS B CA    1 
ATOM   6158  C  C     . HIS B  2  455 ? -0.917  39.983  35.155  1.00 49.02  ? 455  HIS B C     1 
ATOM   6159  O  O     . HIS B  2  455 ? -1.075  41.039  34.567  1.00 50.29  ? 455  HIS B O     1 
ATOM   6160  C  CB    . HIS B  2  455 ? -2.700  38.459  34.299  1.00 50.16  ? 455  HIS B CB    1 
ATOM   6161  C  CG    . HIS B  2  455 ? -3.043  37.427  33.278  1.00 50.93  ? 455  HIS B CG    1 
ATOM   6162  N  ND1   . HIS B  2  455 ? -2.841  36.082  33.483  1.00 52.05  ? 455  HIS B ND1   1 
ATOM   6163  C  CD2   . HIS B  2  455 ? -3.474  37.550  32.002  1.00 54.19  ? 455  HIS B CD2   1 
ATOM   6164  C  CE1   . HIS B  2  455 ? -3.127  35.422  32.375  1.00 54.70  ? 455  HIS B CE1   1 
ATOM   6165  N  NE2   . HIS B  2  455 ? -3.513  36.289  31.459  1.00 53.96  ? 455  HIS B NE2   1 
ATOM   6166  N  N     . ALA B  2  456 ? -0.505  39.931  36.406  1.00 47.59  ? 456  ALA B N     1 
ATOM   6167  C  CA    . ALA B  2  456 ? -0.198  41.169  37.093  1.00 48.37  ? 456  ALA B CA    1 
ATOM   6168  C  C     . ALA B  2  456 ? 1.183   41.620  36.640  1.00 49.63  ? 456  ALA B C     1 
ATOM   6169  O  O     . ALA B  2  456 ? 1.482   42.808  36.676  1.00 51.46  ? 456  ALA B O     1 
ATOM   6170  C  CB    . ALA B  2  456 ? -0.207  40.980  38.580  1.00 45.63  ? 456  ALA B CB    1 
ATOM   6171  N  N     . VAL B  2  457 ? 2.014   40.671  36.205  1.00 49.61  ? 457  VAL B N     1 
ATOM   6172  C  CA    . VAL B  2  457 ? 3.382   40.957  35.775  1.00 48.07  ? 457  VAL B CA    1 
ATOM   6173  C  C     . VAL B  2  457 ? 3.468   41.287  34.316  1.00 48.61  ? 457  VAL B C     1 
ATOM   6174  O  O     . VAL B  2  457 ? 4.240   42.149  33.925  1.00 49.59  ? 457  VAL B O     1 
ATOM   6175  C  CB    . VAL B  2  457 ? 4.315   39.781  36.103  1.00 46.52  ? 457  VAL B CB    1 
ATOM   6176  C  CG1   . VAL B  2  457 ? 5.642   39.919  35.385  1.00 45.78  ? 457  VAL B CG1   1 
ATOM   6177  C  CG2   . VAL B  2  457 ? 4.537   39.737  37.584  1.00 45.23  ? 457  VAL B CG2   1 
ATOM   6178  N  N     . PHE B  2  458 ? 2.696   40.589  33.502  1.00 48.08  ? 458  PHE B N     1 
ATOM   6179  C  CA    . PHE B  2  458 ? 2.685   40.896  32.082  1.00 47.42  ? 458  PHE B CA    1 
ATOM   6180  C  C     . PHE B  2  458 ? 2.083   42.296  31.950  1.00 47.83  ? 458  PHE B C     1 
ATOM   6181  O  O     . PHE B  2  458 ? 2.456   43.058  31.079  1.00 46.89  ? 458  PHE B O     1 
ATOM   6182  C  CB    . PHE B  2  458 ? 1.810   39.921  31.305  1.00 46.45  ? 458  PHE B CB    1 
ATOM   6183  C  CG    . PHE B  2  458 ? 2.423   38.580  31.094  1.00 46.95  ? 458  PHE B CG    1 
ATOM   6184  C  CD1   . PHE B  2  458 ? 3.771   38.448  30.838  1.00 47.29  ? 458  PHE B CD1   1 
ATOM   6185  C  CD2   . PHE B  2  458 ? 1.631   37.446  31.064  1.00 48.57  ? 458  PHE B CD2   1 
ATOM   6186  C  CE1   . PHE B  2  458 ? 4.321   37.208  30.550  1.00 46.68  ? 458  PHE B CE1   1 
ATOM   6187  C  CE2   . PHE B  2  458 ? 2.173   36.207  30.777  1.00 48.41  ? 458  PHE B CE2   1 
ATOM   6188  C  CZ    . PHE B  2  458 ? 3.524   36.093  30.520  1.00 47.66  ? 458  PHE B CZ    1 
ATOM   6189  N  N     . ALA B  2  459 ? 1.136   42.613  32.821  1.00 47.87  ? 459  ALA B N     1 
ATOM   6190  C  CA    . ALA B  2  459 ? 0.490   43.915  32.807  1.00 48.12  ? 459  ALA B CA    1 
ATOM   6191  C  C     . ALA B  2  459 ? 1.543   44.998  32.957  1.00 48.55  ? 459  ALA B C     1 
ATOM   6192  O  O     . ALA B  2  459 ? 1.606   45.921  32.147  1.00 48.44  ? 459  ALA B O     1 
ATOM   6193  C  CB    . ALA B  2  459 ? -0.518  44.018  33.918  1.00 46.80  ? 459  ALA B CB    1 
ATOM   6194  N  N     . LEU B  2  460 ? 2.370   44.872  33.989  1.00 49.20  ? 460  LEU B N     1 
ATOM   6195  C  CA    . LEU B  2  460 ? 3.433   45.827  34.260  1.00 50.08  ? 460  LEU B CA    1 
ATOM   6196  C  C     . LEU B  2  460 ? 4.516   45.828  33.163  1.00 52.01  ? 460  LEU B C     1 
ATOM   6197  O  O     . LEU B  2  460 ? 5.156   46.846  32.908  1.00 53.62  ? 460  LEU B O     1 
ATOM   6198  C  CB    . LEU B  2  460 ? 4.069   45.535  35.608  1.00 47.75  ? 460  LEU B CB    1 
ATOM   6199  C  CG    . LEU B  2  460 ? 4.582   46.766  36.330  1.00 46.79  ? 460  LEU B CG    1 
ATOM   6200  C  CD1   . LEU B  2  460 ? 3.426   47.522  36.862  1.00 48.30  ? 460  LEU B CD1   1 
ATOM   6201  C  CD2   . LEU B  2  460 ? 5.452   46.383  37.459  1.00 46.03  ? 460  LEU B CD2   1 
ATOM   6202  N  N     . LEU B  2  461 ? 4.726   44.697  32.517  1.00 51.73  ? 461  LEU B N     1 
ATOM   6203  C  CA    . LEU B  2  461 ? 5.707   44.644  31.446  1.00 52.53  ? 461  LEU B CA    1 
ATOM   6204  C  C     . LEU B  2  461 ? 5.177   45.283  30.157  1.00 54.78  ? 461  LEU B C     1 
ATOM   6205  O  O     . LEU B  2  461 ? 5.956   45.727  29.318  1.00 56.34  ? 461  LEU B O     1 
ATOM   6206  C  CB    . LEU B  2  461 ? 6.107   43.197  31.166  1.00 50.95  ? 461  LEU B CB    1 
ATOM   6207  C  CG    . LEU B  2  461 ? 7.093   42.523  32.107  1.00 49.85  ? 461  LEU B CG    1 
ATOM   6208  C  CD1   . LEU B  2  461 ? 7.256   41.117  31.643  1.00 48.31  ? 461  LEU B CD1   1 
ATOM   6209  C  CD2   . LEU B  2  461 ? 8.436   43.230  32.119  1.00 48.02  ? 461  LEU B CD2   1 
ATOM   6210  N  N     . PHE B  2  462 ? 3.856   45.318  29.995  1.00 56.29  ? 462  PHE B N     1 
ATOM   6211  C  CA    . PHE B  2  462 ? 3.231   45.894  28.795  1.00 54.80  ? 462  PHE B CA    1 
ATOM   6212  C  C     . PHE B  2  462 ? 3.019   47.383  28.942  1.00 55.25  ? 462  PHE B C     1 
ATOM   6213  O  O     . PHE B  2  462 ? 2.635   48.061  27.998  1.00 53.09  ? 462  PHE B O     1 
ATOM   6214  C  CB    . PHE B  2  462 ? 1.892   45.211  28.496  1.00 53.58  ? 462  PHE B CB    1 
ATOM   6215  C  CG    . PHE B  2  462 ? 1.996   44.116  27.496  1.00 51.15  ? 462  PHE B CG    1 
ATOM   6216  C  CD1   . PHE B  2  462 ? 1.371   44.228  26.274  1.00 49.92  ? 462  PHE B CD1   1 
ATOM   6217  C  CD2   . PHE B  2  462 ? 2.755   42.992  27.762  1.00 51.25  ? 462  PHE B CD2   1 
ATOM   6218  C  CE1   . PHE B  2  462 ? 1.499   43.250  25.331  1.00 51.04  ? 462  PHE B CE1   1 
ATOM   6219  C  CE2   . PHE B  2  462 ? 2.892   41.994  26.821  1.00 52.46  ? 462  PHE B CE2   1 
ATOM   6220  C  CZ    . PHE B  2  462 ? 2.262   42.123  25.598  1.00 52.74  ? 462  PHE B CZ    1 
ATOM   6221  N  N     . PHE B  2  463 ? 3.248   47.885  30.141  1.00 55.66  ? 463  PHE B N     1 
ATOM   6222  C  CA    . PHE B  2  463 ? 3.113   49.307  30.364  1.00 58.37  ? 463  PHE B CA    1 
ATOM   6223  C  C     . PHE B  2  463 ? 4.331   49.892  29.685  1.00 58.99  ? 463  PHE B C     1 
ATOM   6224  O  O     . PHE B  2  463 ? 4.260   50.921  29.023  1.00 60.30  ? 463  PHE B O     1 
ATOM   6225  C  CB    . PHE B  2  463 ? 3.156   49.613  31.850  1.00 61.00  ? 463  PHE B CB    1 
ATOM   6226  C  CG    . PHE B  2  463 ? 3.403   51.054  32.170  1.00 62.66  ? 463  PHE B CG    1 
ATOM   6227  C  CD1   . PHE B  2  463 ? 2.441   52.008  31.920  1.00 63.46  ? 463  PHE B CD1   1 
ATOM   6228  C  CD2   . PHE B  2  463 ? 4.598   51.452  32.759  1.00 63.86  ? 463  PHE B CD2   1 
ATOM   6229  C  CE1   . PHE B  2  463 ? 2.661   53.343  32.258  1.00 64.62  ? 463  PHE B CE1   1 
ATOM   6230  C  CE2   . PHE B  2  463 ? 4.823   52.780  33.096  1.00 64.34  ? 463  PHE B CE2   1 
ATOM   6231  C  CZ    . PHE B  2  463 ? 3.854   53.720  32.846  1.00 64.49  ? 463  PHE B CZ    1 
ATOM   6232  N  N     . PHE B  2  464 ? 5.460   49.222  29.842  1.00 58.37  ? 464  PHE B N     1 
ATOM   6233  C  CA    . PHE B  2  464 ? 6.681   49.701  29.217  1.00 56.60  ? 464  PHE B CA    1 
ATOM   6234  C  C     . PHE B  2  464 ? 6.562   49.635  27.727  1.00 55.38  ? 464  PHE B C     1 
ATOM   6235  O  O     . PHE B  2  464 ? 7.184   50.404  27.036  1.00 56.04  ? 464  PHE B O     1 
ATOM   6236  C  CB    . PHE B  2  464 ? 7.878   48.866  29.610  1.00 56.39  ? 464  PHE B CB    1 
ATOM   6237  C  CG    . PHE B  2  464 ? 9.158   49.394  29.062  1.00 55.96  ? 464  PHE B CG    1 
ATOM   6238  C  CD1   . PHE B  2  464 ? 9.896   50.325  29.781  1.00 55.51  ? 464  PHE B CD1   1 
ATOM   6239  C  CD2   . PHE B  2  464 ? 9.605   49.008  27.808  1.00 55.27  ? 464  PHE B CD2   1 
ATOM   6240  C  CE1   . PHE B  2  464 ? 11.059  50.866  29.264  1.00 54.58  ? 464  PHE B CE1   1 
ATOM   6241  C  CE2   . PHE B  2  464 ? 10.766  49.545  27.288  1.00 54.85  ? 464  PHE B CE2   1 
ATOM   6242  C  CZ    . PHE B  2  464 ? 11.493  50.477  28.020  1.00 54.02  ? 464  PHE B CZ    1 
ATOM   6243  N  N     . GLY B  2  465 ? 5.804   48.685  27.223  1.00 54.55  ? 465  GLY B N     1 
ATOM   6244  C  CA    . GLY B  2  465 ? 5.652   48.589  25.790  1.00 53.84  ? 465  GLY B CA    1 
ATOM   6245  C  C     . GLY B  2  465 ? 4.884   49.788  25.312  1.00 54.28  ? 465  GLY B C     1 
ATOM   6246  O  O     . GLY B  2  465 ? 5.242   50.403  24.324  1.00 54.82  ? 465  GLY B O     1 
ATOM   6247  N  N     . HIS B  2  466 ? 3.819   50.120  26.024  1.00 54.02  ? 466  HIS B N     1 
ATOM   6248  C  CA    . HIS B  2  466 ? 2.999   51.266  25.684  1.00 53.31  ? 466  HIS B CA    1 
ATOM   6249  C  C     . HIS B  2  466 ? 3.828   52.551  25.687  1.00 53.88  ? 466  HIS B C     1 
ATOM   6250  O  O     . HIS B  2  466 ? 3.906   53.259  24.688  1.00 53.24  ? 466  HIS B O     1 
ATOM   6251  C  CB    . HIS B  2  466 ? 1.866   51.388  26.678  1.00 51.75  ? 466  HIS B CB    1 
ATOM   6252  C  CG    . HIS B  2  466 ? 1.199   52.717  26.648  1.00 50.88  ? 466  HIS B CG    1 
ATOM   6253  N  ND1   . HIS B  2  466 ? 0.589   53.203  25.517  1.00 49.68  ? 466  HIS B ND1   1 
ATOM   6254  C  CD2   . HIS B  2  466 ? 1.053   53.667  27.600  1.00 50.61  ? 466  HIS B CD2   1 
ATOM   6255  C  CE1   . HIS B  2  466 ? 0.095   54.398  25.773  1.00 50.79  ? 466  HIS B CE1   1 
ATOM   6256  N  NE2   . HIS B  2  466 ? 0.361   54.703  27.030  1.00 50.58  ? 466  HIS B NE2   1 
ATOM   6257  N  N     . ILE B  2  467 ? 4.444   52.849  26.817  1.00 54.63  ? 467  ILE B N     1 
ATOM   6258  C  CA    . ILE B  2  467 ? 5.273   54.042  26.931  1.00 56.51  ? 467  ILE B CA    1 
ATOM   6259  C  C     . ILE B  2  467 ? 6.461   54.095  25.955  1.00 58.87  ? 467  ILE B C     1 
ATOM   6260  O  O     . ILE B  2  467 ? 7.055   55.147  25.760  1.00 59.63  ? 467  ILE B O     1 
ATOM   6261  C  CB    . ILE B  2  467 ? 5.759   54.201  28.382  1.00 55.26  ? 467  ILE B CB    1 
ATOM   6262  C  CG1   . ILE B  2  467 ? 4.811   55.153  29.102  1.00 56.55  ? 467  ILE B CG1   1 
ATOM   6263  C  CG2   . ILE B  2  467 ? 7.230   54.636  28.438  1.00 53.06  ? 467  ILE B CG2   1 
ATOM   6264  C  CD1   . ILE B  2  467 ? 5.228   55.457  30.527  1.00 59.54  ? 467  ILE B CD1   1 
ATOM   6265  N  N     . TRP B  2  468 ? 6.807   52.980  25.340  1.00 60.37  ? 468  TRP B N     1 
ATOM   6266  C  CA    . TRP B  2  468 ? 7.919   52.970  24.404  1.00 62.27  ? 468  TRP B CA    1 
ATOM   6267  C  C     . TRP B  2  468 ? 7.410   53.199  23.003  1.00 64.73  ? 468  TRP B C     1 
ATOM   6268  O  O     . TRP B  2  468 ? 7.820   54.160  22.355  1.00 66.77  ? 468  TRP B O     1 
ATOM   6269  C  CB    . TRP B  2  468 ? 8.667   51.653  24.469  1.00 61.33  ? 468  TRP B CB    1 
ATOM   6270  C  CG    . TRP B  2  468 ? 9.458   51.315  23.247  1.00 59.79  ? 468  TRP B CG    1 
ATOM   6271  C  CD1   . TRP B  2  468 ? 9.079   50.488  22.218  1.00 60.36  ? 468  TRP B CD1   1 
ATOM   6272  C  CD2   . TRP B  2  468 ? 10.799  51.708  22.971  1.00 58.67  ? 468  TRP B CD2   1 
ATOM   6273  N  NE1   . TRP B  2  468 ? 10.117  50.336  21.328  1.00 59.60  ? 468  TRP B NE1   1 
ATOM   6274  C  CE2   . TRP B  2  468 ? 11.184  51.074  21.766  1.00 58.78  ? 468  TRP B CE2   1 
ATOM   6275  C  CE3   . TRP B  2  468 ? 11.718  52.531  23.628  1.00 58.10  ? 468  TRP B CE3   1 
ATOM   6276  C  CZ2   . TRP B  2  468 ? 12.449  51.238  21.209  1.00 57.27  ? 468  TRP B CZ2   1 
ATOM   6277  C  CZ3   . TRP B  2  468 ? 12.978  52.695  23.072  1.00 58.51  ? 468  TRP B CZ3   1 
ATOM   6278  C  CH2   . TRP B  2  468 ? 13.330  52.049  21.873  1.00 58.35  ? 468  TRP B CH2   1 
ATOM   6279  N  N     . HIS B  2  469 ? 6.534   52.321  22.521  1.00 66.04  ? 469  HIS B N     1 
ATOM   6280  C  CA    . HIS B  2  469 ? 5.972   52.487  21.185  1.00 67.60  ? 469  HIS B CA    1 
ATOM   6281  C  C     . HIS B  2  469 ? 5.219   53.829  21.066  1.00 68.92  ? 469  HIS B C     1 
ATOM   6282  O  O     . HIS B  2  469 ? 5.285   54.509  20.025  1.00 69.24  ? 469  HIS B O     1 
ATOM   6283  C  CB    . HIS B  2  469 ? 5.060   51.311  20.852  1.00 67.53  ? 469  HIS B CB    1 
ATOM   6284  C  CG    . HIS B  2  469 ? 5.810   50.084  20.443  1.00 69.75  ? 469  HIS B CG    1 
ATOM   6285  N  ND1   . HIS B  2  469 ? 6.521   50.013  19.264  1.00 71.74  ? 469  HIS B ND1   1 
ATOM   6286  C  CD2   . HIS B  2  469 ? 6.017   48.903  21.072  1.00 71.13  ? 469  HIS B CD2   1 
ATOM   6287  C  CE1   . HIS B  2  469 ? 7.135   48.846  19.185  1.00 70.53  ? 469  HIS B CE1   1 
ATOM   6288  N  NE2   . HIS B  2  469 ? 6.847   48.153  20.270  1.00 70.28  ? 469  HIS B NE2   1 
ATOM   6289  N  N     . GLY B  2  470 ? 4.520   54.217  22.132  1.00 69.46  ? 470  GLY B N     1 
ATOM   6290  C  CA    . GLY B  2  470 ? 3.801   55.476  22.112  1.00 69.33  ? 470  GLY B CA    1 
ATOM   6291  C  C     . GLY B  2  470 ? 4.801   56.566  21.800  1.00 69.93  ? 470  GLY B C     1 
ATOM   6292  O  O     . GLY B  2  470 ? 4.659   57.299  20.827  1.00 70.53  ? 470  GLY B O     1 
ATOM   6293  N  N     . ALA B  2  471 ? 5.830   56.650  22.626  1.00 70.34  ? 471  ALA B N     1 
ATOM   6294  C  CA    . ALA B  2  471 ? 6.867   57.651  22.446  1.00 70.42  ? 471  ALA B CA    1 
ATOM   6295  C  C     . ALA B  2  471 ? 7.569   57.497  21.123  1.00 70.62  ? 471  ALA B C     1 
ATOM   6296  O  O     . ALA B  2  471 ? 8.072   58.468  20.586  1.00 71.46  ? 471  ALA B O     1 
ATOM   6297  C  CB    . ALA B  2  471 ? 7.876   57.564  23.551  1.00 70.28  ? 471  ALA B CB    1 
ATOM   6298  N  N     . ARG B  2  472 ? 7.619   56.289  20.589  1.00 70.20  ? 472  ARG B N     1 
ATOM   6299  C  CA    . ARG B  2  472 ? 8.302   56.112  19.316  1.00 70.52  ? 472  ARG B CA    1 
ATOM   6300  C  C     . ARG B  2  472 ? 7.431   56.573  18.169  1.00 70.47  ? 472  ARG B C     1 
ATOM   6301  O  O     . ARG B  2  472 ? 7.934   56.751  17.060  1.00 70.75  ? 472  ARG B O     1 
ATOM   6302  C  CB    . ARG B  2  472 ? 8.720   54.655  19.098  1.00 71.00  ? 472  ARG B CB    1 
ATOM   6303  C  CG    . ARG B  2  472 ? 9.600   54.439  17.879  1.00 70.50  ? 472  ARG B CG    1 
ATOM   6304  C  CD    . ARG B  2  472 ? 10.126  53.021  17.832  1.00 70.24  ? 472  ARG B CD    1 
ATOM   6305  N  NE    . ARG B  2  472 ? 11.034  52.802  16.707  1.00 72.75  ? 472  ARG B NE    1 
ATOM   6306  C  CZ    . ARG B  2  472 ? 10.644  52.594  15.446  1.00 74.33  ? 472  ARG B CZ    1 
ATOM   6307  N  NH1   . ARG B  2  472 ? 9.354   52.576  15.148  1.00 74.95  ? 472  ARG B NH1   1 
ATOM   6308  N  NH2   . ARG B  2  472 ? 11.539  52.389  14.474  1.00 74.25  ? 472  ARG B NH2   1 
ATOM   6309  N  N     . THR B  2  473 ? 6.134   56.756  18.426  1.00 70.17  ? 473  THR B N     1 
ATOM   6310  C  CA    . THR B  2  473 ? 5.204   57.232  17.391  1.00 69.97  ? 473  THR B CA    1 
ATOM   6311  C  C     . THR B  2  473 ? 5.302   58.756  17.336  1.00 69.23  ? 473  THR B C     1 
ATOM   6312  O  O     . THR B  2  473 ? 5.605   59.356  16.300  1.00 69.56  ? 473  THR B O     1 
ATOM   6313  C  CB    . THR B  2  473 ? 3.715   56.866  17.708  1.00 70.17  ? 473  THR B CB    1 
ATOM   6314  O  OG1   . THR B  2  473 ? 3.521   55.448  17.669  1.00 69.84  ? 473  THR B OG1   1 
ATOM   6315  C  CG2   . THR B  2  473 ? 2.795   57.492  16.697  1.00 69.57  ? 473  THR B CG2   1 
ATOM   6316  N  N     . LEU B  2  474 ? 5.060   59.367  18.481  1.00 68.21  ? 474  LEU B N     1 
ATOM   6317  C  CA    . LEU B  2  474 ? 5.107   60.805  18.584  1.00 67.56  ? 474  LEU B CA    1 
ATOM   6318  C  C     . LEU B  2  474 ? 6.521   61.324  18.574  1.00 67.11  ? 474  LEU B C     1 
ATOM   6319  O  O     . LEU B  2  474 ? 6.782   62.358  19.167  1.00 67.44  ? 474  LEU B O     1 
ATOM   6320  C  CB    . LEU B  2  474 ? 4.424   61.228  19.871  1.00 67.48  ? 474  LEU B CB    1 
ATOM   6321  C  CG    . LEU B  2  474 ? 3.026   60.644  20.079  1.00 67.52  ? 474  LEU B CG    1 
ATOM   6322  C  CD1   . LEU B  2  474 ? 2.483   61.149  21.379  1.00 67.11  ? 474  LEU B CD1   1 
ATOM   6323  C  CD2   . LEU B  2  474 ? 2.089   61.038  18.961  1.00 66.56  ? 474  LEU B CD2   1 
ATOM   6324  N  N     . PHE B  2  475 ? 7.433   60.636  17.898  1.00 66.92  ? 475  PHE B N     1 
ATOM   6325  C  CA    . PHE B  2  475 ? 8.820   61.082  17.886  1.00 67.33  ? 475  PHE B CA    1 
ATOM   6326  C  C     . PHE B  2  475 ? 9.660   60.530  16.739  1.00 68.57  ? 475  PHE B C     1 
ATOM   6327  O  O     . PHE B  2  475 ? 10.880  60.726  16.710  1.00 68.20  ? 475  PHE B O     1 
ATOM   6328  C  CB    . PHE B  2  475 ? 9.494   60.682  19.201  1.00 65.79  ? 475  PHE B CB    1 
ATOM   6329  C  CG    . PHE B  2  475 ? 9.373   61.694  20.303  1.00 64.50  ? 475  PHE B CG    1 
ATOM   6330  C  CD1   . PHE B  2  475 ? 10.236  62.783  20.359  1.00 64.07  ? 475  PHE B CD1   1 
ATOM   6331  C  CD2   . PHE B  2  475 ? 8.422   61.540  21.306  1.00 63.16  ? 475  PHE B CD2   1 
ATOM   6332  C  CE1   . PHE B  2  475 ? 10.151  63.699  21.402  1.00 63.86  ? 475  PHE B CE1   1 
ATOM   6333  C  CE2   . PHE B  2  475 ? 8.338   62.450  22.343  1.00 62.41  ? 475  PHE B CE2   1 
ATOM   6334  C  CZ    . PHE B  2  475 ? 9.201   63.531  22.394  1.00 62.92  ? 475  PHE B CZ    1 
ATOM   6335  N  N     . ARG B  2  476 ? 9.027   59.845  15.795  1.00 70.22  ? 476  ARG B N     1 
ATOM   6336  C  CA    . ARG B  2  476 ? 9.796   59.259  14.702  1.00 71.92  ? 476  ARG B CA    1 
ATOM   6337  C  C     . ARG B  2  476 ? 10.705  60.277  14.025  1.00 71.58  ? 476  ARG B C     1 
ATOM   6338  O  O     . ARG B  2  476 ? 11.852  59.979  13.724  1.00 72.03  ? 476  ARG B O     1 
ATOM   6339  C  CB    . ARG B  2  476 ? 8.887   58.585  13.664  1.00 73.68  ? 476  ARG B CB    1 
ATOM   6340  C  CG    . ARG B  2  476 ? 7.856   59.487  13.074  1.00 77.08  ? 476  ARG B CG    1 
ATOM   6341  C  CD    . ARG B  2  476 ? 7.620   59.220  11.583  1.00 80.22  ? 476  ARG B CD    1 
ATOM   6342  N  NE    . ARG B  2  476 ? 6.609   60.145  11.043  1.00 83.50  ? 476  ARG B NE    1 
ATOM   6343  C  CZ    . ARG B  2  476 ? 6.684   61.481  11.092  1.00 83.75  ? 476  ARG B CZ    1 
ATOM   6344  N  NH1   . ARG B  2  476 ? 7.730   62.101  11.650  1.00 84.18  ? 476  ARG B NH1   1 
ATOM   6345  N  NH2   . ARG B  2  476 ? 5.681   62.200  10.605  1.00 84.63  ? 476  ARG B NH2   1 
ATOM   6346  N  N     . ASP B  2  477 ? 10.207  61.480  13.808  1.00 71.17  ? 477  ASP B N     1 
ATOM   6347  C  CA    . ASP B  2  477 ? 11.002  62.512  13.166  1.00 70.63  ? 477  ASP B CA    1 
ATOM   6348  C  C     . ASP B  2  477 ? 12.380  62.678  13.796  1.00 70.42  ? 477  ASP B C     1 
ATOM   6349  O  O     . ASP B  2  477 ? 13.259  63.301  13.214  1.00 69.28  ? 477  ASP B O     1 
ATOM   6350  C  CB    . ASP B  2  477 ? 10.266  63.844  13.235  1.00 71.46  ? 477  ASP B CB    1 
ATOM   6351  C  CG    . ASP B  2  477 ? 10.113  64.357  14.663  1.00 73.90  ? 477  ASP B CG    1 
ATOM   6352  O  OD1   . ASP B  2  477 ? 9.398   63.703  15.459  1.00 74.72  ? 477  ASP B OD1   1 
ATOM   6353  O  OD2   . ASP B  2  477 ? 10.704  65.413  15.005  1.00 73.58  ? 477  ASP B OD2   1 
ATOM   6354  N  N     . VAL B  2  478 ? 12.581  62.133  14.985  1.00 71.13  ? 478  VAL B N     1 
ATOM   6355  C  CA    . VAL B  2  478 ? 13.873  62.280  15.635  1.00 72.10  ? 478  VAL B CA    1 
ATOM   6356  C  C     . VAL B  2  478 ? 14.480  60.954  16.024  1.00 74.20  ? 478  VAL B C     1 
ATOM   6357  O  O     . VAL B  2  478 ? 15.607  60.910  16.515  1.00 74.97  ? 478  VAL B O     1 
ATOM   6358  C  CB    . VAL B  2  478 ? 13.760  63.125  16.907  1.00 70.52  ? 478  VAL B CB    1 
ATOM   6359  C  CG1   . VAL B  2  478 ? 15.039  63.900  17.125  1.00 71.05  ? 478  VAL B CG1   1 
ATOM   6360  C  CG2   . VAL B  2  478 ? 12.595  64.049  16.807  1.00 70.24  ? 478  VAL B CG2   1 
ATOM   6361  N  N     . PHE B  2  479 ? 13.729  59.877  15.813  1.00 76.26  ? 479  PHE B N     1 
ATOM   6362  C  CA    . PHE B  2  479 ? 14.173  58.520  16.172  1.00 78.02  ? 479  PHE B CA    1 
ATOM   6363  C  C     . PHE B  2  479 ? 15.672  58.288  15.910  1.00 77.89  ? 479  PHE B C     1 
ATOM   6364  O  O     . PHE B  2  479 ? 16.345  57.604  16.684  1.00 77.81  ? 479  PHE B O     1 
ATOM   6365  C  CB    . PHE B  2  479 ? 13.317  57.476  15.414  1.00 80.01  ? 479  PHE B CB    1 
ATOM   6366  C  CG    . PHE B  2  479 ? 13.618  56.025  15.780  1.00 82.06  ? 479  PHE B CG    1 
ATOM   6367  C  CD1   . PHE B  2  479 ? 14.054  55.109  14.791  1.00 82.64  ? 479  PHE B CD1   1 
ATOM   6368  C  CD2   . PHE B  2  479 ? 13.445  55.561  17.108  1.00 82.71  ? 479  PHE B CD2   1 
ATOM   6369  C  CE1   . PHE B  2  479 ? 14.314  53.743  15.115  1.00 82.76  ? 479  PHE B CE1   1 
ATOM   6370  C  CE2   . PHE B  2  479 ? 13.697  54.201  17.453  1.00 82.19  ? 479  PHE B CE2   1 
ATOM   6371  C  CZ    . PHE B  2  479 ? 14.131  53.288  16.455  1.00 82.87  ? 479  PHE B CZ    1 
ATOM   6372  N  N     . SER B  2  480 ? 16.189  58.891  14.843  1.00 77.72  ? 480  SER B N     1 
ATOM   6373  C  CA    . SER B  2  480 ? 17.588  58.722  14.462  1.00 77.28  ? 480  SER B CA    1 
ATOM   6374  C  C     . SER B  2  480 ? 18.588  59.781  14.991  1.00 76.96  ? 480  SER B C     1 
ATOM   6375  O  O     . SER B  2  480 ? 19.759  59.773  14.617  1.00 76.64  ? 480  SER B O     1 
ATOM   6376  C  CB    . SER B  2  480 ? 17.644  58.648  12.938  1.00 77.37  ? 480  SER B CB    1 
ATOM   6377  O  OG    . SER B  2  480 ? 16.535  57.905  12.438  1.00 76.09  ? 480  SER B OG    1 
ATOM   6378  N  N     . GLY B  2  481 ? 18.129  60.673  15.861  1.00 77.22  ? 481  GLY B N     1 
ATOM   6379  C  CA    . GLY B  2  481 ? 19.002  61.698  16.406  1.00 77.43  ? 481  GLY B CA    1 
ATOM   6380  C  C     . GLY B  2  481 ? 18.433  63.092  16.224  1.00 78.65  ? 481  GLY B C     1 
ATOM   6381  O  O     . GLY B  2  481 ? 17.583  63.295  15.347  1.00 78.69  ? 481  GLY B O     1 
ATOM   6382  N  N     . ILE B  2  482 ? 18.880  64.043  17.052  1.00 79.95  ? 482  ILE B N     1 
ATOM   6383  C  CA    . ILE B  2  482 ? 18.425  65.443  16.965  1.00 81.91  ? 482  ILE B CA    1 
ATOM   6384  C  C     . ILE B  2  482 ? 18.871  66.074  15.595  1.00 83.40  ? 482  ILE B C     1 
ATOM   6385  O  O     . ILE B  2  482 ? 19.871  65.625  14.986  1.00 83.53  ? 482  ILE B O     1 
ATOM   6386  C  CB    . ILE B  2  482 ? 18.985  66.276  18.158  1.00 78.75  ? 482  ILE B CB    1 
ATOM   6387  N  N     . ASP B  2  483 ? 18.122  67.081  15.102  1.00 85.00  ? 483  ASP B N     1 
ATOM   6388  C  CA    . ASP B  2  483 ? 18.449  67.765  13.816  1.00 85.88  ? 483  ASP B CA    1 
ATOM   6389  C  C     . ASP B  2  483 ? 19.733  68.579  13.937  1.00 86.21  ? 483  ASP B C     1 
ATOM   6390  O  O     . ASP B  2  483 ? 19.766  69.612  14.625  1.00 86.00  ? 483  ASP B O     1 
ATOM   6391  C  CB    . ASP B  2  483 ? 17.315  68.706  13.367  1.00 85.58  ? 483  ASP B CB    1 
ATOM   6392  N  N     . PRO B  2  484 ? 20.801  68.128  13.254  1.00 86.83  ? 484  PRO B N     1 
ATOM   6393  C  CA    . PRO B  2  484 ? 22.105  68.800  13.279  1.00 87.63  ? 484  PRO B CA    1 
ATOM   6394  C  C     . PRO B  2  484 ? 21.948  70.320  13.126  1.00 89.09  ? 484  PRO B C     1 
ATOM   6395  O  O     . PRO B  2  484 ? 21.127  70.796  12.316  1.00 89.36  ? 484  PRO B O     1 
ATOM   6396  C  CB    . PRO B  2  484 ? 22.844  68.153  12.103  1.00 86.71  ? 484  PRO B CB    1 
ATOM   6397  C  CG    . PRO B  2  484 ? 22.257  66.780  12.056  1.00 86.08  ? 484  PRO B CG    1 
ATOM   6398  C  CD    . PRO B  2  484 ? 20.788  67.074  12.223  1.00 86.28  ? 484  PRO B CD    1 
ATOM   6399  N  N     . GLU B  2  485 ? 22.715  71.080  13.905  1.00 90.24  ? 485  GLU B N     1 
ATOM   6400  C  CA    . GLU B  2  485 ? 22.627  72.544  13.841  1.00 91.15  ? 485  GLU B CA    1 
ATOM   6401  C  C     . GLU B  2  485 ? 21.236  73.041  14.287  1.00 90.77  ? 485  GLU B C     1 
ATOM   6402  O  O     . GLU B  2  485 ? 20.225  72.842  13.586  1.00 89.90  ? 485  GLU B O     1 
ATOM   6403  C  CB    . GLU B  2  485 ? 22.930  73.054  12.411  1.00 91.85  ? 485  GLU B CB    1 
ATOM   6404  N  N     . LEU B  2  486 ? 21.202  73.681  15.458  1.00 90.34  ? 486  LEU B N     1 
ATOM   6405  C  CA    . LEU B  2  486 ? 19.962  74.223  16.023  1.00 89.28  ? 486  LEU B CA    1 
ATOM   6406  C  C     . LEU B  2  486 ? 20.318  75.456  16.893  1.00 89.30  ? 486  LEU B C     1 
ATOM   6407  O  O     . LEU B  2  486 ? 21.503  75.804  17.041  1.00 89.76  ? 486  LEU B O     1 
ATOM   6408  C  CB    . LEU B  2  486 ? 19.245  73.146  16.854  1.00 87.83  ? 486  LEU B CB    1 
ATOM   6409  N  N     . SER B  2  487 ? 19.309  76.120  17.451  1.00 89.43  ? 487  SER B N     1 
ATOM   6410  C  CA    . SER B  2  487 ? 19.534  77.261  18.330  1.00 88.95  ? 487  SER B CA    1 
ATOM   6411  C  C     . SER B  2  487 ? 18.237  77.590  19.066  1.00 88.00  ? 487  SER B C     1 
ATOM   6412  O  O     . SER B  2  487 ? 17.217  76.913  18.861  1.00 88.12  ? 487  SER B O     1 
ATOM   6413  C  CB    . SER B  2  487 ? 20.034  78.477  17.545  1.00 90.26  ? 487  SER B CB    1 
ATOM   6414  N  N     . PRO B  2  488 ? 18.252  78.616  19.938  1.00 85.72  ? 488  PRO B N     1 
ATOM   6415  C  CA    . PRO B  2  488 ? 17.063  79.009  20.694  1.00 84.39  ? 488  PRO B CA    1 
ATOM   6416  C  C     . PRO B  2  488 ? 16.511  77.779  21.441  1.00 84.27  ? 488  PRO B C     1 
ATOM   6417  O  O     . PRO B  2  488 ? 15.446  77.229  21.132  1.00 83.64  ? 488  PRO B O     1 
ATOM   6418  C  CB    . PRO B  2  488 ? 16.121  79.550  19.623  1.00 83.77  ? 488  PRO B CB    1 
ATOM   6419  N  N     . GLU B  2  489 ? 17.305  77.355  22.424  1.00 84.73  ? 489  GLU B N     1 
ATOM   6420  C  CA    . GLU B  2  489 ? 17.028  76.206  23.280  1.00 84.84  ? 489  GLU B CA    1 
ATOM   6421  C  C     . GLU B  2  489 ? 17.344  76.685  24.705  1.00 85.54  ? 489  GLU B C     1 
ATOM   6422  O  O     . GLU B  2  489 ? 16.453  77.034  25.457  1.00 86.83  ? 489  GLU B O     1 
ATOM   6423  C  CB    . GLU B  2  489 ? 17.971  75.023  22.935  1.00 83.83  ? 489  GLU B CB    1 
ATOM   6424  N  N     . ASP C  3  27  ? 44.704  87.107  46.760  1.00 74.08  ? 27   ASP C N     1 
ATOM   6425  C  CA    . ASP C  3  27  ? 44.955  86.676  45.345  1.00 75.19  ? 27   ASP C CA    1 
ATOM   6426  C  C     . ASP C  3  27  ? 43.624  86.523  44.570  1.00 74.97  ? 27   ASP C C     1 
ATOM   6427  O  O     . ASP C  3  27  ? 42.552  86.787  45.112  1.00 74.77  ? 27   ASP C O     1 
ATOM   6428  C  CB    . ASP C  3  27  ? 45.734  85.348  45.342  1.00 75.55  ? 27   ASP C CB    1 
ATOM   6429  C  CG    . ASP C  3  27  ? 46.950  85.359  44.398  1.00 75.61  ? 27   ASP C CG    1 
ATOM   6430  O  OD1   . ASP C  3  27  ? 46.749  85.458  43.171  1.00 75.60  ? 27   ASP C OD1   1 
ATOM   6431  O  OD2   . ASP C  3  27  ? 48.105  85.256  44.884  1.00 74.94  ? 27   ASP C OD2   1 
ATOM   6432  N  N     . GLN C  3  28  ? 43.706  86.116  43.308  1.00 75.56  ? 28   GLN C N     1 
ATOM   6433  C  CA    . GLN C  3  28  ? 42.530  85.937  42.455  1.00 75.93  ? 28   GLN C CA    1 
ATOM   6434  C  C     . GLN C  3  28  ? 42.571  84.593  41.730  1.00 76.59  ? 28   GLN C C     1 
ATOM   6435  O  O     . GLN C  3  28  ? 43.599  83.897  41.692  1.00 77.01  ? 28   GLN C O     1 
ATOM   6436  C  CB    . GLN C  3  28  ? 42.433  87.068  41.419  1.00 75.54  ? 28   GLN C CB    1 
ATOM   6437  N  N     . GLU C  3  29  ? 41.438  84.231  41.157  1.00 76.94  ? 29   GLU C N     1 
ATOM   6438  C  CA    . GLU C  3  29  ? 41.334  82.973  40.439  1.00 77.93  ? 29   GLU C CA    1 
ATOM   6439  C  C     . GLU C  3  29  ? 41.929  83.124  39.046  1.00 78.68  ? 29   GLU C C     1 
ATOM   6440  O  O     . GLU C  3  29  ? 42.823  82.361  38.673  1.00 78.62  ? 29   GLU C O     1 
ATOM   6441  C  CB    . GLU C  3  29  ? 39.861  82.544  40.374  1.00 77.99  ? 29   GLU C CB    1 
ATOM   6442  C  CG    . GLU C  3  29  ? 39.299  82.176  39.008  1.00 78.07  ? 29   GLU C CG    1 
ATOM   6443  C  CD    . GLU C  3  29  ? 39.503  80.713  38.646  1.00 78.27  ? 29   GLU C CD    1 
ATOM   6444  O  OE1   . GLU C  3  29  ? 40.589  80.368  38.130  1.00 78.25  ? 29   GLU C OE1   1 
ATOM   6445  O  OE2   . GLU C  3  29  ? 38.573  79.903  38.877  1.00 78.35  ? 29   GLU C OE2   1 
ATOM   6446  N  N     . SER C  3  30  ? 41.459  84.117  38.292  1.00 79.45  ? 30   SER C N     1 
ATOM   6447  C  CA    . SER C  3  30  ? 41.948  84.324  36.924  1.00 79.85  ? 30   SER C CA    1 
ATOM   6448  C  C     . SER C  3  30  ? 43.462  84.525  36.869  1.00 79.60  ? 30   SER C C     1 
ATOM   6449  O  O     . SER C  3  30  ? 44.043  84.744  35.804  1.00 79.28  ? 30   SER C O     1 
ATOM   6450  C  CB    . SER C  3  30  ? 41.246  85.518  36.283  1.00 80.68  ? 30   SER C CB    1 
ATOM   6451  O  OG    . SER C  3  30  ? 41.845  86.712  36.739  1.00 83.92  ? 30   SER C OG    1 
ATOM   6452  N  N     . SER C  3  31  ? 44.085  84.445  38.031  1.00 79.91  ? 31   SER C N     1 
ATOM   6453  C  CA    . SER C  3  31  ? 45.520  84.591  38.145  1.00 80.60  ? 31   SER C CA    1 
ATOM   6454  C  C     . SER C  3  31  ? 46.159  83.405  38.908  1.00 81.25  ? 31   SER C C     1 
ATOM   6455  O  O     . SER C  3  31  ? 47.221  82.930  38.497  1.00 82.33  ? 31   SER C O     1 
ATOM   6456  C  CB    . SER C  3  31  ? 45.853  85.928  38.831  1.00 79.78  ? 31   SER C CB    1 
ATOM   6457  O  OG    . SER C  3  31  ? 44.987  86.205  39.926  1.00 78.55  ? 31   SER C OG    1 
ATOM   6458  N  N     . GLY C  3  32  ? 45.511  82.917  39.982  1.00 81.05  ? 32   GLY C N     1 
ATOM   6459  C  CA    . GLY C  3  32  ? 46.054  81.819  40.780  1.00 78.51  ? 32   GLY C CA    1 
ATOM   6460  C  C     . GLY C  3  32  ? 45.516  80.437  40.454  1.00 78.37  ? 32   GLY C C     1 
ATOM   6461  O  O     . GLY C  3  32  ? 45.939  79.824  39.465  1.00 77.52  ? 32   GLY C O     1 
ATOM   6462  N  N     . PHE C  3  33  ? 44.587  79.948  41.292  1.00 77.77  ? 33   PHE C N     1 
ATOM   6463  C  CA    . PHE C  3  33  ? 43.944  78.624  41.130  1.00 76.46  ? 33   PHE C CA    1 
ATOM   6464  C  C     . PHE C  3  33  ? 42.438  78.721  40.909  1.00 76.37  ? 33   PHE C C     1 
ATOM   6465  O  O     . PHE C  3  33  ? 41.991  78.996  39.796  1.00 75.92  ? 33   PHE C O     1 
ATOM   6466  C  CB    . PHE C  3  33  ? 44.180  77.749  42.358  1.00 74.47  ? 33   PHE C CB    1 
ATOM   6467  C  CG    . PHE C  3  33  ? 45.388  76.885  42.256  1.00 73.46  ? 33   PHE C CG    1 
ATOM   6468  C  CD1   . PHE C  3  33  ? 45.452  75.875  41.310  1.00 73.31  ? 33   PHE C CD1   1 
ATOM   6469  C  CD2   . PHE C  3  33  ? 46.474  77.079  43.101  1.00 73.07  ? 33   PHE C CD2   1 
ATOM   6470  C  CE1   . PHE C  3  33  ? 46.586  75.063  41.202  1.00 72.18  ? 33   PHE C CE1   1 
ATOM   6471  C  CE2   . PHE C  3  33  ? 47.604  76.275  42.999  1.00 72.16  ? 33   PHE C CE2   1 
ATOM   6472  C  CZ    . PHE C  3  33  ? 47.654  75.263  42.041  1.00 72.01  ? 33   PHE C CZ    1 
ATOM   6473  N  N     . ALA C  3  34  ? 41.680  78.465  41.986  1.00 75.11  ? 34   ALA C N     1 
ATOM   6474  C  CA    . ALA C  3  34  ? 40.205  78.500  42.040  1.00 73.05  ? 34   ALA C CA    1 
ATOM   6475  C  C     . ALA C  3  34  ? 39.875  78.755  43.511  1.00 72.42  ? 34   ALA C C     1 
ATOM   6476  O  O     . ALA C  3  34  ? 40.626  78.328  44.391  1.00 71.54  ? 34   ALA C O     1 
ATOM   6477  C  CB    . ALA C  3  34  ? 39.619  77.160  41.594  1.00 72.63  ? 34   ALA C CB    1 
ATOM   6478  N  N     . TRP C  3  35  ? 38.765  79.433  43.793  1.00 72.18  ? 35   TRP C N     1 
ATOM   6479  C  CA    . TRP C  3  35  ? 38.415  79.767  45.195  1.00 71.24  ? 35   TRP C CA    1 
ATOM   6480  C  C     . TRP C  3  35  ? 38.420  78.581  46.183  1.00 71.04  ? 35   TRP C C     1 
ATOM   6481  O  O     . TRP C  3  35  ? 38.977  78.691  47.273  1.00 71.59  ? 35   TRP C O     1 
ATOM   6482  C  CB    . TRP C  3  35  ? 37.056  80.485  45.272  1.00 69.53  ? 35   TRP C CB    1 
ATOM   6483  C  CG    . TRP C  3  35  ? 35.917  79.534  45.324  1.00 67.96  ? 35   TRP C CG    1 
ATOM   6484  C  CD1   . TRP C  3  35  ? 35.294  78.937  44.266  1.00 68.49  ? 35   TRP C CD1   1 
ATOM   6485  C  CD2   . TRP C  3  35  ? 35.357  78.950  46.498  1.00 66.90  ? 35   TRP C CD2   1 
ATOM   6486  N  NE1   . TRP C  3  35  ? 34.386  78.010  44.715  1.00 67.61  ? 35   TRP C NE1   1 
ATOM   6487  C  CE2   . TRP C  3  35  ? 34.406  77.999  46.081  1.00 66.39  ? 35   TRP C CE2   1 
ATOM   6488  C  CE3   . TRP C  3  35  ? 35.576  79.131  47.861  1.00 66.83  ? 35   TRP C CE3   1 
ATOM   6489  C  CZ2   . TRP C  3  35  ? 33.676  77.237  46.975  1.00 65.27  ? 35   TRP C CZ2   1 
ATOM   6490  C  CZ3   . TRP C  3  35  ? 34.850  78.370  48.750  1.00 67.41  ? 35   TRP C CZ3   1 
ATOM   6491  C  CH2   . TRP C  3  35  ? 33.910  77.433  48.303  1.00 66.07  ? 35   TRP C CH2   1 
ATOM   6492  N  N     . TRP C  3  36  ? 37.798  77.467  45.810  1.00 69.95  ? 36   TRP C N     1 
ATOM   6493  C  CA    . TRP C  3  36  ? 37.747  76.285  46.665  1.00 68.50  ? 36   TRP C CA    1 
ATOM   6494  C  C     . TRP C  3  36  ? 39.099  75.554  46.711  1.00 68.74  ? 36   TRP C C     1 
ATOM   6495  O  O     . TRP C  3  36  ? 39.228  74.488  47.326  1.00 68.35  ? 36   TRP C O     1 
ATOM   6496  C  CB    . TRP C  3  36  ? 36.663  75.332  46.167  1.00 66.87  ? 36   TRP C CB    1 
ATOM   6497  C  CG    . TRP C  3  36  ? 36.694  75.128  44.698  1.00 64.78  ? 36   TRP C CG    1 
ATOM   6498  C  CD1   . TRP C  3  36  ? 35.938  75.770  43.771  1.00 63.46  ? 36   TRP C CD1   1 
ATOM   6499  C  CD2   . TRP C  3  36  ? 37.550  74.243  43.978  1.00 65.58  ? 36   TRP C CD2   1 
ATOM   6500  N  NE1   . TRP C  3  36  ? 36.264  75.344  42.517  1.00 64.49  ? 36   TRP C NE1   1 
ATOM   6501  C  CE2   . TRP C  3  36  ? 37.254  74.402  42.614  1.00 65.92  ? 36   TRP C CE2   1 
ATOM   6502  C  CE3   . TRP C  3  36  ? 38.547  73.327  44.354  1.00 67.00  ? 36   TRP C CE3   1 
ATOM   6503  C  CZ2   . TRP C  3  36  ? 37.916  73.674  41.615  1.00 67.22  ? 36   TRP C CZ2   1 
ATOM   6504  C  CZ3   . TRP C  3  36  ? 39.206  72.603  43.362  1.00 67.02  ? 36   TRP C CZ3   1 
ATOM   6505  C  CH2   . TRP C  3  36  ? 38.886  72.780  42.012  1.00 67.87  ? 36   TRP C CH2   1 
ATOM   6506  N  N     . ALA C  3  37  ? 40.091  76.120  46.030  1.00 69.00  ? 37   ALA C N     1 
ATOM   6507  C  CA    . ALA C  3  37  ? 41.438  75.564  46.009  1.00 68.94  ? 37   ALA C CA    1 
ATOM   6508  C  C     . ALA C  3  37  ? 42.363  76.661  46.580  1.00 68.32  ? 37   ALA C C     1 
ATOM   6509  O  O     . ALA C  3  37  ? 43.590  76.545  46.575  1.00 68.84  ? 37   ALA C O     1 
ATOM   6510  C  CB    . ALA C  3  37  ? 41.845  75.196  44.577  1.00 67.70  ? 37   ALA C CB    1 
ATOM   6511  N  N     . GLY C  3  38  ? 41.741  77.717  47.085  1.00 67.65  ? 38   GLY C N     1 
ATOM   6512  C  CA    . GLY C  3  38  ? 42.464  78.836  47.660  1.00 68.02  ? 38   GLY C CA    1 
ATOM   6513  C  C     . GLY C  3  38  ? 43.864  78.590  48.202  1.00 69.22  ? 38   GLY C C     1 
ATOM   6514  O  O     . GLY C  3  38  ? 44.834  79.057  47.623  1.00 71.22  ? 38   GLY C O     1 
ATOM   6515  N  N     . ASN C  3  39  ? 43.982  77.864  49.303  1.00 68.27  ? 39   ASN C N     1 
ATOM   6516  C  CA    . ASN C  3  39  ? 45.280  77.600  49.919  1.00 66.95  ? 39   ASN C CA    1 
ATOM   6517  C  C     . ASN C  3  39  ? 46.430  77.069  49.043  1.00 66.67  ? 39   ASN C C     1 
ATOM   6518  O  O     . ASN C  3  39  ? 47.555  76.907  49.503  1.00 65.49  ? 39   ASN C O     1 
ATOM   6519  C  CB    . ASN C  3  39  ? 45.064  76.692  51.116  1.00 67.02  ? 39   ASN C CB    1 
ATOM   6520  C  CG    . ASN C  3  39  ? 43.997  77.218  52.037  1.00 67.67  ? 39   ASN C CG    1 
ATOM   6521  O  OD1   . ASN C  3  39  ? 44.107  78.332  52.549  1.00 68.60  ? 39   ASN C OD1   1 
ATOM   6522  N  ND2   . ASN C  3  39  ? 42.956  76.423  52.264  1.00 68.12  ? 39   ASN C ND2   1 
ATOM   6523  N  N     . ALA C  3  40  ? 46.167  76.784  47.788  1.00 68.08  ? 40   ALA C N     1 
ATOM   6524  C  CA    . ALA C  3  40  ? 47.257  76.324  46.936  1.00 70.75  ? 40   ALA C CA    1 
ATOM   6525  C  C     . ALA C  3  40  ? 47.843  77.608  46.307  1.00 71.73  ? 40   ALA C C     1 
ATOM   6526  O  O     . ALA C  3  40  ? 48.966  77.625  45.777  1.00 72.91  ? 40   ALA C O     1 
ATOM   6527  C  CB    . ALA C  3  40  ? 46.736  75.348  45.861  1.00 70.76  ? 40   ALA C CB    1 
ATOM   6528  N  N     . ARG C  3  41  ? 47.068  78.687  46.393  1.00 71.11  ? 41   ARG C N     1 
ATOM   6529  C  CA    . ARG C  3  41  ? 47.491  79.973  45.872  1.00 70.49  ? 41   ARG C CA    1 
ATOM   6530  C  C     . ARG C  3  41  ? 48.675  80.410  46.719  1.00 71.37  ? 41   ARG C C     1 
ATOM   6531  O  O     . ARG C  3  41  ? 49.356  81.372  46.393  1.00 73.12  ? 41   ARG C O     1 
ATOM   6532  C  CB    . ARG C  3  41  ? 46.357  81.000  45.985  1.00 68.49  ? 41   ARG C CB    1 
ATOM   6533  C  CG    . ARG C  3  41  ? 45.186  80.774  45.044  1.00 66.10  ? 41   ARG C CG    1 
ATOM   6534  C  CD    . ARG C  3  41  ? 43.998  81.661  45.413  1.00 64.39  ? 41   ARG C CD    1 
ATOM   6535  N  NE    . ARG C  3  41  ? 42.950  81.624  44.385  1.00 64.73  ? 41   ARG C NE    1 
ATOM   6536  C  CZ    . ARG C  3  41  ? 41.791  82.282  44.453  1.00 64.84  ? 41   ARG C CZ    1 
ATOM   6537  N  NH1   . ARG C  3  41  ? 41.503  83.042  45.508  1.00 65.67  ? 41   ARG C NH1   1 
ATOM   6538  N  NH2   . ARG C  3  41  ? 40.922  82.190  43.454  1.00 63.84  ? 41   ARG C NH2   1 
ATOM   6539  N  N     . LEU C  3  42  ? 48.928  79.682  47.794  1.00 72.72  ? 42   LEU C N     1 
ATOM   6540  C  CA    . LEU C  3  42  ? 50.028  80.007  48.690  1.00 74.17  ? 42   LEU C CA    1 
ATOM   6541  C  C     . LEU C  3  42  ? 51.200  79.050  48.564  1.00 73.93  ? 42   LEU C C     1 
ATOM   6542  O  O     . LEU C  3  42  ? 52.143  79.122  49.357  1.00 74.20  ? 42   LEU C O     1 
ATOM   6543  C  CB    . LEU C  3  42  ? 49.545  79.979  50.139  1.00 75.23  ? 42   LEU C CB    1 
ATOM   6544  C  CG    . LEU C  3  42  ? 48.414  80.958  50.455  1.00 78.40  ? 42   LEU C CG    1 
ATOM   6545  C  CD1   . LEU C  3  42  ? 47.520  80.350  51.527  1.00 78.39  ? 42   LEU C CD1   1 
ATOM   6546  C  CD2   . LEU C  3  42  ? 48.993  82.325  50.867  1.00 78.23  ? 42   LEU C CD2   1 
ATOM   6547  N  N     . ILE C  3  43  ? 51.147  78.144  47.595  1.00 73.33  ? 43   ILE C N     1 
ATOM   6548  C  CA    . ILE C  3  43  ? 52.239  77.191  47.435  1.00 72.85  ? 43   ILE C CA    1 
ATOM   6549  C  C     . ILE C  3  43  ? 53.588  77.897  47.306  1.00 72.06  ? 43   ILE C C     1 
ATOM   6550  O  O     . ILE C  3  43  ? 54.631  77.339  47.670  1.00 71.38  ? 43   ILE C O     1 
ATOM   6551  C  CB    . ILE C  3  43  ? 51.998  76.281  46.224  1.00 72.69  ? 43   ILE C CB    1 
ATOM   6552  C  CG1   . ILE C  3  43  ? 50.838  75.330  46.538  1.00 71.43  ? 43   ILE C CG1   1 
ATOM   6553  C  CG2   . ILE C  3  43  ? 53.272  75.512  45.873  1.00 71.51  ? 43   ILE C CG2   1 
ATOM   6554  C  CD1   . ILE C  3  43  ? 50.388  74.520  45.336  1.00 70.69  ? 43   ILE C CD1   1 
ATOM   6555  N  N     . ASN C  3  44  ? 53.555  79.125  46.791  1.00 72.27  ? 44   ASN C N     1 
ATOM   6556  C  CA    . ASN C  3  44  ? 54.771  79.925  46.644  1.00 72.40  ? 44   ASN C CA    1 
ATOM   6557  C  C     . ASN C  3  44  ? 54.646  81.343  47.229  1.00 72.23  ? 44   ASN C C     1 
ATOM   6558  O  O     . ASN C  3  44  ? 54.638  82.342  46.512  1.00 71.16  ? 44   ASN C O     1 
ATOM   6559  C  CB    . ASN C  3  44  ? 55.188  79.994  45.182  1.00 72.06  ? 44   ASN C CB    1 
ATOM   6560  C  CG    . ASN C  3  44  ? 55.646  78.655  44.650  1.00 71.03  ? 44   ASN C CG    1 
ATOM   6561  O  OD1   . ASN C  3  44  ? 56.415  77.942  45.297  1.00 69.85  ? 44   ASN C OD1   1 
ATOM   6562  N  ND2   . ASN C  3  44  ? 55.185  78.313  43.452  1.00 71.87  ? 44   ASN C ND2   1 
ATOM   6563  N  N     . LEU C  3  45  ? 54.574  81.395  48.550  1.00 72.02  ? 45   LEU C N     1 
ATOM   6564  C  CA    . LEU C  3  45  ? 54.453  82.631  49.286  1.00 71.91  ? 45   LEU C CA    1 
ATOM   6565  C  C     . LEU C  3  45  ? 54.747  82.268  50.739  1.00 72.86  ? 45   LEU C C     1 
ATOM   6566  O  O     . LEU C  3  45  ? 53.967  82.591  51.636  1.00 72.35  ? 45   LEU C O     1 
ATOM   6567  C  CB    . LEU C  3  45  ? 53.030  83.165  49.137  1.00 71.33  ? 45   LEU C CB    1 
ATOM   6568  C  CG    . LEU C  3  45  ? 52.595  83.700  47.774  1.00 70.01  ? 45   LEU C CG    1 
ATOM   6569  C  CD1   . LEU C  3  45  ? 51.122  83.947  47.787  1.00 70.53  ? 45   LEU C CD1   1 
ATOM   6570  C  CD2   . LEU C  3  45  ? 53.323  84.987  47.456  1.00 69.48  ? 45   LEU C CD2   1 
ATOM   6571  N  N     . SER C  3  46  ? 55.876  81.587  50.951  1.00 74.62  ? 46   SER C N     1 
ATOM   6572  C  CA    . SER C  3  46  ? 56.303  81.128  52.278  1.00 76.70  ? 46   SER C CA    1 
ATOM   6573  C  C     . SER C  3  46  ? 55.920  82.047  53.438  1.00 76.79  ? 46   SER C C     1 
ATOM   6574  O  O     . SER C  3  46  ? 55.491  81.568  54.489  1.00 76.31  ? 46   SER C O     1 
ATOM   6575  C  CB    . SER C  3  46  ? 57.818  80.897  52.313  1.00 78.05  ? 46   SER C CB    1 
ATOM   6576  O  OG    . SER C  3  46  ? 58.513  82.123  52.171  1.00 82.11  ? 46   SER C OG    1 
ATOM   6577  N  N     . GLY C  3  47  ? 56.089  83.353  53.252  1.00 77.09  ? 47   GLY C N     1 
ATOM   6578  C  CA    . GLY C  3  47  ? 55.738  84.300  54.299  1.00 78.47  ? 47   GLY C CA    1 
ATOM   6579  C  C     . GLY C  3  47  ? 54.324  84.052  54.824  1.00 79.37  ? 47   GLY C C     1 
ATOM   6580  O  O     . GLY C  3  47  ? 54.110  83.887  56.036  1.00 79.65  ? 47   GLY C O     1 
ATOM   6581  N  N     . LYS C  3  48  ? 53.359  84.035  53.904  1.00 79.48  ? 48   LYS C N     1 
ATOM   6582  C  CA    . LYS C  3  48  ? 51.962  83.773  54.245  1.00 78.16  ? 48   LYS C CA    1 
ATOM   6583  C  C     . LYS C  3  48  ? 51.864  82.294  54.683  1.00 77.75  ? 48   LYS C C     1 
ATOM   6584  O  O     . LYS C  3  48  ? 51.287  81.968  55.727  1.00 77.37  ? 48   LYS C O     1 
ATOM   6585  C  CB    . LYS C  3  48  ? 51.081  84.018  53.016  1.00 77.55  ? 48   LYS C CB    1 
ATOM   6586  C  CG    . LYS C  3  48  ? 51.284  85.373  52.321  1.00 75.56  ? 48   LYS C CG    1 
ATOM   6587  C  CD    . LYS C  3  48  ? 50.693  86.553  53.099  1.00 75.62  ? 48   LYS C CD    1 
ATOM   6588  C  CE    . LYS C  3  48  ? 51.568  86.969  54.300  1.00 76.30  ? 48   LYS C CE    1 
ATOM   6589  N  NZ    . LYS C  3  48  ? 51.115  88.205  55.055  1.00 74.45  ? 48   LYS C NZ    1 
ATOM   6590  N  N     . LEU C  3  49  ? 52.447  81.414  53.874  1.00 76.84  ? 49   LEU C N     1 
ATOM   6591  C  CA    . LEU C  3  49  ? 52.461  79.979  54.154  1.00 75.94  ? 49   LEU C CA    1 
ATOM   6592  C  C     . LEU C  3  49  ? 53.029  79.686  55.545  1.00 76.27  ? 49   LEU C C     1 
ATOM   6593  O  O     . LEU C  3  49  ? 52.958  78.555  56.032  1.00 76.00  ? 49   LEU C O     1 
ATOM   6594  C  CB    . LEU C  3  49  ? 53.292  79.246  53.094  1.00 75.03  ? 49   LEU C CB    1 
ATOM   6595  C  CG    . LEU C  3  49  ? 53.291  77.723  53.152  1.00 73.17  ? 49   LEU C CG    1 
ATOM   6596  C  CD1   . LEU C  3  49  ? 51.880  77.257  53.329  1.00 72.14  ? 49   LEU C CD1   1 
ATOM   6597  C  CD2   . LEU C  3  49  ? 53.913  77.148  51.889  1.00 73.21  ? 49   LEU C CD2   1 
ATOM   6598  N  N     . LEU C  3  50  ? 53.611  80.696  56.172  1.00 75.96  ? 50   LEU C N     1 
ATOM   6599  C  CA    . LEU C  3  50  ? 54.139  80.519  57.507  1.00 75.90  ? 50   LEU C CA    1 
ATOM   6600  C  C     . LEU C  3  50  ? 53.000  80.877  58.436  1.00 75.68  ? 50   LEU C C     1 
ATOM   6601  O  O     . LEU C  3  50  ? 52.735  80.160  59.402  1.00 76.20  ? 50   LEU C O     1 
ATOM   6602  C  CB    . LEU C  3  50  ? 55.303  81.456  57.768  1.00 76.76  ? 50   LEU C CB    1 
ATOM   6603  C  CG    . LEU C  3  50  ? 55.851  81.306  59.187  1.00 78.31  ? 50   LEU C CG    1 
ATOM   6604  C  CD1   . LEU C  3  50  ? 56.534  79.921  59.284  1.00 78.77  ? 50   LEU C CD1   1 
ATOM   6605  C  CD2   . LEU C  3  50  ? 56.812  82.477  59.530  1.00 77.53  ? 50   LEU C CD2   1 
ATOM   6606  N  N     . GLY C  3  51  ? 52.338  81.999  58.138  1.00 75.74  ? 51   GLY C N     1 
ATOM   6607  C  CA    . GLY C  3  51  ? 51.196  82.452  58.924  1.00 75.29  ? 51   GLY C CA    1 
ATOM   6608  C  C     . GLY C  3  51  ? 50.071  81.413  58.914  1.00 75.40  ? 51   GLY C C     1 
ATOM   6609  O  O     . GLY C  3  51  ? 49.392  81.211  59.927  1.00 75.94  ? 51   GLY C O     1 
ATOM   6610  N  N     . ALA C  3  52  ? 49.874  80.764  57.766  1.00 73.85  ? 52   ALA C N     1 
ATOM   6611  C  CA    . ALA C  3  52  ? 48.874  79.709  57.629  1.00 72.48  ? 52   ALA C CA    1 
ATOM   6612  C  C     . ALA C  3  52  ? 49.212  78.643  58.677  1.00 71.81  ? 52   ALA C C     1 
ATOM   6613  O  O     . ALA C  3  52  ? 48.393  78.309  59.544  1.00 71.50  ? 52   ALA C O     1 
ATOM   6614  C  CB    . ALA C  3  52  ? 48.947  79.113  56.233  1.00 72.07  ? 52   ALA C CB    1 
ATOM   6615  N  N     . HIS C  3  53  ? 50.439  78.139  58.595  1.00 71.44  ? 53   HIS C N     1 
ATOM   6616  C  CA    . HIS C  3  53  ? 50.912  77.134  59.521  1.00 72.28  ? 53   HIS C CA    1 
ATOM   6617  C  C     . HIS C  3  53  ? 50.888  77.594  60.974  1.00 73.31  ? 53   HIS C C     1 
ATOM   6618  O  O     . HIS C  3  53  ? 50.508  76.827  61.855  1.00 74.98  ? 53   HIS C O     1 
ATOM   6619  C  CB    . HIS C  3  53  ? 52.318  76.659  59.121  1.00 71.04  ? 53   HIS C CB    1 
ATOM   6620  C  CG    . HIS C  3  53  ? 52.305  75.676  57.990  1.00 71.52  ? 53   HIS C CG    1 
ATOM   6621  N  ND1   . HIS C  3  53  ? 51.898  76.018  56.719  1.00 72.39  ? 53   HIS C ND1   1 
ATOM   6622  C  CD2   . HIS C  3  53  ? 52.518  74.337  57.965  1.00 71.00  ? 53   HIS C CD2   1 
ATOM   6623  C  CE1   . HIS C  3  53  ? 51.851  74.934  55.963  1.00 70.73  ? 53   HIS C CE1   1 
ATOM   6624  N  NE2   . HIS C  3  53  ? 52.220  73.900  56.696  1.00 70.86  ? 53   HIS C NE2   1 
ATOM   6625  N  N     . VAL C  3  54  ? 51.267  78.838  61.239  1.00 73.50  ? 54   VAL C N     1 
ATOM   6626  C  CA    . VAL C  3  54  ? 51.275  79.326  62.623  1.00 72.69  ? 54   VAL C CA    1 
ATOM   6627  C  C     . VAL C  3  54  ? 49.864  79.458  63.152  1.00 72.64  ? 54   VAL C C     1 
ATOM   6628  O  O     . VAL C  3  54  ? 49.547  78.888  64.181  1.00 72.91  ? 54   VAL C O     1 
ATOM   6629  C  CB    . VAL C  3  54  ? 51.999  80.708  62.772  1.00 73.01  ? 54   VAL C CB    1 
ATOM   6630  C  CG1   . VAL C  3  54  ? 51.883  81.213  64.219  1.00 71.44  ? 54   VAL C CG1   1 
ATOM   6631  C  CG2   . VAL C  3  54  ? 53.470  80.573  62.380  1.00 72.48  ? 54   VAL C CG2   1 
ATOM   6632  N  N     . ALA C  3  55  ? 49.025  80.209  62.443  1.00 73.20  ? 55   ALA C N     1 
ATOM   6633  C  CA    . ALA C  3  55  ? 47.630  80.427  62.831  1.00 73.84  ? 55   ALA C CA    1 
ATOM   6634  C  C     . ALA C  3  55  ? 46.945  79.091  63.172  1.00 74.52  ? 55   ALA C C     1 
ATOM   6635  O  O     . ALA C  3  55  ? 46.301  78.962  64.225  1.00 74.97  ? 55   ALA C O     1 
ATOM   6636  C  CB    . ALA C  3  55  ? 46.884  81.131  61.711  1.00 72.58  ? 55   ALA C CB    1 
ATOM   6637  N  N     . HIS C  3  56  ? 47.090  78.105  62.284  1.00 74.22  ? 56   HIS C N     1 
ATOM   6638  C  CA    . HIS C  3  56  ? 46.516  76.777  62.497  1.00 73.90  ? 56   HIS C CA    1 
ATOM   6639  C  C     . HIS C  3  56  ? 47.068  76.103  63.762  1.00 72.72  ? 56   HIS C C     1 
ATOM   6640  O  O     . HIS C  3  56  ? 46.319  75.663  64.630  1.00 73.65  ? 56   HIS C O     1 
ATOM   6641  C  CB    . HIS C  3  56  ? 46.802  75.877  61.291  1.00 75.36  ? 56   HIS C CB    1 
ATOM   6642  C  CG    . HIS C  3  56  ? 46.287  74.474  61.448  1.00 76.68  ? 56   HIS C CG    1 
ATOM   6643  N  ND1   . HIS C  3  56  ? 46.692  73.641  62.471  1.00 76.28  ? 56   HIS C ND1   1 
ATOM   6644  C  CD2   . HIS C  3  56  ? 45.376  73.769  60.729  1.00 76.60  ? 56   HIS C CD2   1 
ATOM   6645  C  CE1   . HIS C  3  56  ? 46.052  72.487  62.375  1.00 76.20  ? 56   HIS C CE1   1 
ATOM   6646  N  NE2   . HIS C  3  56  ? 45.247  72.538  61.327  1.00 76.27  ? 56   HIS C NE2   1 
ATOM   6647  N  N     . ALA C  3  57  ? 48.385  76.013  63.845  1.00 71.41  ? 57   ALA C N     1 
ATOM   6648  C  CA    . ALA C  3  57  ? 49.033  75.412  64.994  1.00 70.17  ? 57   ALA C CA    1 
ATOM   6649  C  C     . ALA C  3  57  ? 48.559  76.123  66.265  1.00 69.84  ? 57   ALA C C     1 
ATOM   6650  O  O     . ALA C  3  57  ? 49.024  75.830  67.363  1.00 70.10  ? 57   ALA C O     1 
ATOM   6651  C  CB    . ALA C  3  57  ? 50.547  75.509  64.850  1.00 68.83  ? 57   ALA C CB    1 
ATOM   6652  N  N     . GLY C  3  58  ? 47.633  77.059  66.105  1.00 69.40  ? 58   GLY C N     1 
ATOM   6653  C  CA    . GLY C  3  58  ? 47.098  77.781  67.245  1.00 70.22  ? 58   GLY C CA    1 
ATOM   6654  C  C     . GLY C  3  58  ? 45.703  77.251  67.545  1.00 70.87  ? 58   GLY C C     1 
ATOM   6655  O  O     . GLY C  3  58  ? 45.234  77.243  68.703  1.00 71.51  ? 58   GLY C O     1 
ATOM   6656  N  N     . LEU C  3  59  ? 45.030  76.807  66.489  1.00 69.79  ? 59   LEU C N     1 
ATOM   6657  C  CA    . LEU C  3  59  ? 43.695  76.254  66.650  1.00 69.03  ? 59   LEU C CA    1 
ATOM   6658  C  C     . LEU C  3  59  ? 43.786  74.960  67.449  1.00 68.63  ? 59   LEU C C     1 
ATOM   6659  O  O     . LEU C  3  59  ? 42.891  74.646  68.238  1.00 69.18  ? 59   LEU C O     1 
ATOM   6660  C  CB    . LEU C  3  59  ? 43.061  76.010  65.283  1.00 67.95  ? 59   LEU C CB    1 
ATOM   6661  C  CG    . LEU C  3  59  ? 42.556  77.299  64.629  1.00 69.01  ? 59   LEU C CG    1 
ATOM   6662  C  CD1   . LEU C  3  59  ? 42.360  77.108  63.158  1.00 67.62  ? 59   LEU C CD1   1 
ATOM   6663  C  CD2   . LEU C  3  59  ? 41.255  77.716  65.278  1.00 69.32  ? 59   LEU C CD2   1 
ATOM   6664  N  N     . ILE C  3  60  ? 44.888  74.232  67.259  1.00 69.19  ? 60   ILE C N     1 
ATOM   6665  C  CA    . ILE C  3  60  ? 45.115  72.971  67.968  1.00 70.00  ? 60   ILE C CA    1 
ATOM   6666  C  C     . ILE C  3  60  ? 45.316  73.198  69.473  1.00 70.86  ? 60   ILE C C     1 
ATOM   6667  O  O     . ILE C  3  60  ? 44.739  72.494  70.326  1.00 71.10  ? 60   ILE C O     1 
ATOM   6668  C  CB    . ILE C  3  60  ? 46.360  72.245  67.439  1.00 68.94  ? 60   ILE C CB    1 
ATOM   6669  C  CG1   . ILE C  3  60  ? 46.159  71.852  65.983  1.00 68.49  ? 60   ILE C CG1   1 
ATOM   6670  C  CG2   . ILE C  3  60  ? 46.641  71.030  68.294  1.00 66.76  ? 60   ILE C CG2   1 
ATOM   6671  C  CD1   . ILE C  3  60  ? 47.373  71.226  65.364  1.00 70.31  ? 60   ILE C CD1   1 
ATOM   6672  N  N     . VAL C  3  61  ? 46.164  74.170  69.785  1.00 70.64  ? 61   VAL C N     1 
ATOM   6673  C  CA    . VAL C  3  61  ? 46.441  74.506  71.172  1.00 69.53  ? 61   VAL C CA    1 
ATOM   6674  C  C     . VAL C  3  61  ? 45.159  75.063  71.764  1.00 68.84  ? 61   VAL C C     1 
ATOM   6675  O  O     . VAL C  3  61  ? 44.695  74.614  72.821  1.00 68.60  ? 61   VAL C O     1 
ATOM   6676  C  CB    . VAL C  3  61  ? 47.526  75.574  71.259  1.00 69.07  ? 61   VAL C CB    1 
ATOM   6677  C  CG1   . VAL C  3  61  ? 47.858  75.877  72.716  1.00 66.86  ? 61   VAL C CG1   1 
ATOM   6678  C  CG2   . VAL C  3  61  ? 48.734  75.109  70.488  1.00 67.36  ? 61   VAL C CG2   1 
ATOM   6679  N  N     . PHE C  3  62  ? 44.594  76.041  71.063  1.00 67.91  ? 62   PHE C N     1 
ATOM   6680  C  CA    . PHE C  3  62  ? 43.369  76.658  71.513  1.00 66.93  ? 62   PHE C CA    1 
ATOM   6681  C  C     . PHE C  3  62  ? 42.459  75.543  71.965  1.00 67.24  ? 62   PHE C C     1 
ATOM   6682  O  O     . PHE C  3  62  ? 42.012  75.527  73.101  1.00 67.46  ? 62   PHE C O     1 
ATOM   6683  C  CB    . PHE C  3  62  ? 42.717  77.426  70.388  1.00 65.29  ? 62   PHE C CB    1 
ATOM   6684  C  CG    . PHE C  3  62  ? 41.426  78.039  70.785  1.00 65.65  ? 62   PHE C CG    1 
ATOM   6685  C  CD1   . PHE C  3  62  ? 41.375  78.989  71.789  1.00 66.86  ? 62   PHE C CD1   1 
ATOM   6686  C  CD2   . PHE C  3  62  ? 40.244  77.651  70.181  1.00 67.33  ? 62   PHE C CD2   1 
ATOM   6687  C  CE1   . PHE C  3  62  ? 40.151  79.551  72.191  1.00 67.14  ? 62   PHE C CE1   1 
ATOM   6688  C  CE2   . PHE C  3  62  ? 39.012  78.203  70.569  1.00 67.23  ? 62   PHE C CE2   1 
ATOM   6689  C  CZ    . PHE C  3  62  ? 38.970  79.154  71.575  1.00 67.42  ? 62   PHE C CZ    1 
ATOM   6690  N  N     . TRP C  3  63  ? 42.216  74.594  71.070  1.00 67.34  ? 63   TRP C N     1 
ATOM   6691  C  CA    . TRP C  3  63  ? 41.364  73.459  71.380  1.00 67.55  ? 63   TRP C CA    1 
ATOM   6692  C  C     . TRP C  3  63  ? 41.857  72.711  72.608  1.00 67.66  ? 63   TRP C C     1 
ATOM   6693  O  O     . TRP C  3  63  ? 41.171  72.636  73.620  1.00 68.61  ? 63   TRP C O     1 
ATOM   6694  C  CB    . TRP C  3  63  ? 41.294  72.489  70.197  1.00 68.03  ? 63   TRP C CB    1 
ATOM   6695  C  CG    . TRP C  3  63  ? 40.329  71.347  70.437  1.00 69.48  ? 63   TRP C CG    1 
ATOM   6696  C  CD1   . TRP C  3  63  ? 38.969  71.392  70.368  1.00 69.77  ? 63   TRP C CD1   1 
ATOM   6697  C  CD2   . TRP C  3  63  ? 40.660  70.021  70.871  1.00 70.16  ? 63   TRP C CD2   1 
ATOM   6698  N  NE1   . TRP C  3  63  ? 38.433  70.184  70.739  1.00 69.73  ? 63   TRP C NE1   1 
ATOM   6699  C  CE2   . TRP C  3  63  ? 39.445  69.323  71.050  1.00 70.13  ? 63   TRP C CE2   1 
ATOM   6700  C  CE3   . TRP C  3  63  ? 41.871  69.357  71.130  1.00 70.79  ? 63   TRP C CE3   1 
ATOM   6701  C  CZ2   . TRP C  3  63  ? 39.395  67.999  71.471  1.00 70.52  ? 63   TRP C CZ2   1 
ATOM   6702  C  CZ3   . TRP C  3  63  ? 41.830  68.037  71.555  1.00 71.18  ? 63   TRP C CZ3   1 
ATOM   6703  C  CH2   . TRP C  3  63  ? 40.592  67.370  71.721  1.00 71.75  ? 63   TRP C CH2   1 
ATOM   6704  N  N     . ALA C  3  64  ? 43.046  72.155  72.515  1.00 67.94  ? 64   ALA C N     1 
ATOM   6705  C  CA    . ALA C  3  64  ? 43.597  71.416  73.636  1.00 68.54  ? 64   ALA C CA    1 
ATOM   6706  C  C     . ALA C  3  64  ? 43.212  72.141  74.916  1.00 68.14  ? 64   ALA C C     1 
ATOM   6707  O  O     . ALA C  3  64  ? 42.721  71.528  75.869  1.00 68.16  ? 64   ALA C O     1 
ATOM   6708  C  CB    . ALA C  3  64  ? 45.117  71.324  73.511  1.00 69.07  ? 64   ALA C CB    1 
ATOM   6709  N  N     . GLY C  3  65  ? 43.394  73.459  74.904  1.00 67.01  ? 65   GLY C N     1 
ATOM   6710  C  CA    . GLY C  3  65  ? 43.099  74.271  76.067  1.00 67.53  ? 65   GLY C CA    1 
ATOM   6711  C  C     . GLY C  3  65  ? 41.642  74.501  76.387  1.00 67.30  ? 65   GLY C C     1 
ATOM   6712  O  O     . GLY C  3  65  ? 41.177  74.174  77.471  1.00 66.88  ? 65   GLY C O     1 
ATOM   6713  N  N     . ALA C  3  66  ? 40.926  75.074  75.436  1.00 68.65  ? 66   ALA C N     1 
ATOM   6714  C  CA    . ALA C  3  66  ? 39.512  75.373  75.611  1.00 70.45  ? 66   ALA C CA    1 
ATOM   6715  C  C     . ALA C  3  66  ? 38.689  74.160  76.031  1.00 71.98  ? 66   ALA C C     1 
ATOM   6716  O  O     . ALA C  3  66  ? 37.781  74.283  76.853  1.00 73.06  ? 66   ALA C O     1 
ATOM   6717  C  CB    . ALA C  3  66  ? 38.946  75.954  74.329  1.00 70.44  ? 66   ALA C CB    1 
ATOM   6718  N  N     . MET C  3  67  ? 39.006  72.995  75.470  1.00 72.40  ? 67   MET C N     1 
ATOM   6719  C  CA    . MET C  3  67  ? 38.277  71.769  75.775  1.00 72.42  ? 67   MET C CA    1 
ATOM   6720  C  C     . MET C  3  67  ? 38.633  71.160  77.135  1.00 72.46  ? 67   MET C C     1 
ATOM   6721  O  O     . MET C  3  67  ? 37.769  70.607  77.815  1.00 73.56  ? 67   MET C O     1 
ATOM   6722  C  CB    . MET C  3  67  ? 38.491  70.729  74.664  1.00 72.76  ? 67   MET C CB    1 
ATOM   6723  C  CG    . MET C  3  67  ? 37.669  69.450  74.843  1.00 73.60  ? 67   MET C CG    1 
ATOM   6724  S  SD    . MET C  3  67  ? 35.908  69.491  74.311  1.00 73.52  ? 67   MET C SD    1 
ATOM   6725  C  CE    . MET C  3  67  ? 35.847  67.885  73.351  1.00 72.71  ? 67   MET C CE    1 
ATOM   6726  N  N     . THR C  3  68  ? 39.891  71.250  77.535  1.00 71.43  ? 68   THR C N     1 
ATOM   6727  C  CA    . THR C  3  68  ? 40.283  70.697  78.825  1.00 71.51  ? 68   THR C CA    1 
ATOM   6728  C  C     . THR C  3  68  ? 39.501  71.364  79.952  1.00 71.33  ? 68   THR C C     1 
ATOM   6729  O  O     . THR C  3  68  ? 39.186  70.733  80.962  1.00 70.96  ? 68   THR C O     1 
ATOM   6730  C  CB    . THR C  3  68  ? 41.793  70.888  79.071  1.00 72.64  ? 68   THR C CB    1 
ATOM   6731  O  OG1   . THR C  3  68  ? 42.520  70.066  78.153  1.00 74.72  ? 68   THR C OG1   1 
ATOM   6732  C  CG2   . THR C  3  68  ? 42.171  70.507  80.498  1.00 73.09  ? 68   THR C CG2   1 
ATOM   6733  N  N     . LEU C  3  69  ? 39.192  72.645  79.772  1.00 70.62  ? 69   LEU C N     1 
ATOM   6734  C  CA    . LEU C  3  69  ? 38.438  73.387  80.770  1.00 69.21  ? 69   LEU C CA    1 
ATOM   6735  C  C     . LEU C  3  69  ? 36.986  72.985  80.652  1.00 68.74  ? 69   LEU C C     1 
ATOM   6736  O  O     . LEU C  3  69  ? 36.271  72.924  81.652  1.00 68.66  ? 69   LEU C O     1 
ATOM   6737  C  CB    . LEU C  3  69  ? 38.596  74.887  80.561  1.00 69.32  ? 69   LEU C CB    1 
ATOM   6738  C  CG    . LEU C  3  69  ? 40.043  75.363  80.646  1.00 70.47  ? 69   LEU C CG    1 
ATOM   6739  C  CD1   . LEU C  3  69  ? 40.105  76.881  80.586  1.00 70.16  ? 69   LEU C CD1   1 
ATOM   6740  C  CD2   . LEU C  3  69  ? 40.650  74.855  81.935  1.00 70.92  ? 69   LEU C CD2   1 
ATOM   6741  N  N     . PHE C  3  70  ? 36.550  72.706  79.430  1.00 68.04  ? 70   PHE C N     1 
ATOM   6742  C  CA    . PHE C  3  70  ? 35.176  72.266  79.232  1.00 67.34  ? 70   PHE C CA    1 
ATOM   6743  C  C     . PHE C  3  70  ? 35.021  70.921  79.936  1.00 66.76  ? 70   PHE C C     1 
ATOM   6744  O  O     . PHE C  3  70  ? 33.985  70.651  80.540  1.00 66.92  ? 70   PHE C O     1 
ATOM   6745  C  CB    . PHE C  3  70  ? 34.856  72.099  77.756  1.00 67.72  ? 70   PHE C CB    1 
ATOM   6746  C  CG    . PHE C  3  70  ? 33.436  71.715  77.496  1.00 69.02  ? 70   PHE C CG    1 
ATOM   6747  C  CD1   . PHE C  3  70  ? 32.401  72.572  77.842  1.00 69.81  ? 70   PHE C CD1   1 
ATOM   6748  C  CD2   . PHE C  3  70  ? 33.128  70.487  76.931  1.00 68.78  ? 70   PHE C CD2   1 
ATOM   6749  C  CE1   . PHE C  3  70  ? 31.075  72.208  77.630  1.00 70.26  ? 70   PHE C CE1   1 
ATOM   6750  C  CE2   . PHE C  3  70  ? 31.814  70.121  76.718  1.00 69.93  ? 70   PHE C CE2   1 
ATOM   6751  C  CZ    . PHE C  3  70  ? 30.784  70.980  77.068  1.00 70.44  ? 70   PHE C CZ    1 
ATOM   6752  N  N     . GLU C  3  71  ? 36.048  70.080  79.859  1.00 64.79  ? 71   GLU C N     1 
ATOM   6753  C  CA    . GLU C  3  71  ? 35.971  68.794  80.522  1.00 63.36  ? 71   GLU C CA    1 
ATOM   6754  C  C     . GLU C  3  71  ? 35.866  69.092  82.004  1.00 63.65  ? 71   GLU C C     1 
ATOM   6755  O  O     . GLU C  3  71  ? 34.846  68.839  82.641  1.00 64.01  ? 71   GLU C O     1 
ATOM   6756  C  CB    . GLU C  3  71  ? 37.221  67.944  80.264  1.00 61.87  ? 71   GLU C CB    1 
ATOM   6757  C  CG    . GLU C  3  71  ? 37.510  67.613  78.806  1.00 61.66  ? 71   GLU C CG    1 
ATOM   6758  C  CD    . GLU C  3  71  ? 38.215  66.260  78.608  1.00 61.14  ? 71   GLU C CD    1 
ATOM   6759  O  OE1   . GLU C  3  71  ? 38.964  65.828  79.504  1.00 59.73  ? 71   GLU C OE1   1 
ATOM   6760  O  OE2   . GLU C  3  71  ? 38.031  65.634  77.542  1.00 60.47  ? 71   GLU C OE2   1 
ATOM   6761  N  N     . LEU C  3  72  ? 36.941  69.651  82.535  1.00 64.27  ? 72   LEU C N     1 
ATOM   6762  C  CA    . LEU C  3  72  ? 37.037  69.995  83.944  1.00 64.18  ? 72   LEU C CA    1 
ATOM   6763  C  C     . LEU C  3  72  ? 35.800  70.665  84.517  1.00 65.04  ? 72   LEU C C     1 
ATOM   6764  O  O     . LEU C  3  72  ? 35.360  70.329  85.618  1.00 64.52  ? 72   LEU C O     1 
ATOM   6765  C  CB    . LEU C  3  72  ? 38.236  70.913  84.172  1.00 62.93  ? 72   LEU C CB    1 
ATOM   6766  C  CG    . LEU C  3  72  ? 38.419  71.409  85.607  1.00 60.52  ? 72   LEU C CG    1 
ATOM   6767  C  CD1   . LEU C  3  72  ? 38.660  70.217  86.501  1.00 59.47  ? 72   LEU C CD1   1 
ATOM   6768  C  CD2   . LEU C  3  72  ? 39.580  72.375  85.688  1.00 59.31  ? 72   LEU C CD2   1 
ATOM   6769  N  N     . ALA C  3  73  ? 35.251  71.622  83.779  1.00 65.03  ? 73   ALA C N     1 
ATOM   6770  C  CA    . ALA C  3  73  ? 34.071  72.341  84.237  1.00 65.73  ? 73   ALA C CA    1 
ATOM   6771  C  C     . ALA C  3  73  ? 32.907  71.389  84.509  1.00 66.15  ? 73   ALA C C     1 
ATOM   6772  O  O     . ALA C  3  73  ? 31.986  71.714  85.250  1.00 66.30  ? 73   ALA C O     1 
ATOM   6773  C  CB    . ALA C  3  73  ? 33.675  73.372  83.207  1.00 65.20  ? 73   ALA C CB    1 
ATOM   6774  N  N     . HIS C  3  74  ? 32.967  70.211  83.910  1.00 66.91  ? 74   HIS C N     1 
ATOM   6775  C  CA    . HIS C  3  74  ? 31.926  69.218  84.062  1.00 68.09  ? 74   HIS C CA    1 
ATOM   6776  C  C     . HIS C  3  74  ? 32.437  68.052  84.879  1.00 68.73  ? 74   HIS C C     1 
ATOM   6777  O  O     . HIS C  3  74  ? 31.679  67.402  85.605  1.00 69.19  ? 74   HIS C O     1 
ATOM   6778  C  CB    . HIS C  3  74  ? 31.492  68.728  82.697  1.00 69.55  ? 74   HIS C CB    1 
ATOM   6779  C  CG    . HIS C  3  74  ? 30.928  69.809  81.834  1.00 72.71  ? 74   HIS C CG    1 
ATOM   6780  N  ND1   . HIS C  3  74  ? 31.428  71.095  81.832  1.00 74.36  ? 74   HIS C ND1   1 
ATOM   6781  C  CD2   . HIS C  3  74  ? 29.924  69.793  80.923  1.00 73.73  ? 74   HIS C CD2   1 
ATOM   6782  C  CE1   . HIS C  3  74  ? 30.759  71.826  80.957  1.00 74.25  ? 74   HIS C CE1   1 
ATOM   6783  N  NE2   . HIS C  3  74  ? 29.841  71.060  80.390  1.00 74.53  ? 74   HIS C NE2   1 
ATOM   6784  N  N     . PHE C  3  75  ? 33.728  67.786  84.768  1.00 68.86  ? 75   PHE C N     1 
ATOM   6785  C  CA    . PHE C  3  75  ? 34.304  66.672  85.489  1.00 69.19  ? 75   PHE C CA    1 
ATOM   6786  C  C     . PHE C  3  75  ? 33.839  66.605  86.947  1.00 69.29  ? 75   PHE C C     1 
ATOM   6787  O  O     . PHE C  3  75  ? 33.881  67.610  87.661  1.00 69.53  ? 75   PHE C O     1 
ATOM   6788  C  CB    . PHE C  3  75  ? 35.824  66.742  85.453  1.00 69.26  ? 75   PHE C CB    1 
ATOM   6789  C  CG    . PHE C  3  75  ? 36.467  65.695  86.295  1.00 69.50  ? 75   PHE C CG    1 
ATOM   6790  C  CD1   . PHE C  3  75  ? 36.654  64.412  85.798  1.00 69.44  ? 75   PHE C CD1   1 
ATOM   6791  C  CD2   . PHE C  3  75  ? 36.795  65.962  87.622  1.00 69.35  ? 75   PHE C CD2   1 
ATOM   6792  C  CE1   . PHE C  3  75  ? 37.154  63.403  86.609  1.00 70.53  ? 75   PHE C CE1   1 
ATOM   6793  C  CE2   . PHE C  3  75  ? 37.297  64.966  88.449  1.00 69.91  ? 75   PHE C CE2   1 
ATOM   6794  C  CZ    . PHE C  3  75  ? 37.479  63.679  87.948  1.00 70.58  ? 75   PHE C CZ    1 
ATOM   6795  N  N     . ILE C  3  76  ? 33.406  65.419  87.378  1.00 68.55  ? 76   ILE C N     1 
ATOM   6796  C  CA    . ILE C  3  76  ? 32.966  65.190  88.761  1.00 67.30  ? 76   ILE C CA    1 
ATOM   6797  C  C     . ILE C  3  76  ? 33.982  64.309  89.508  1.00 68.65  ? 76   ILE C C     1 
ATOM   6798  O  O     . ILE C  3  76  ? 34.002  63.091  89.350  1.00 67.65  ? 76   ILE C O     1 
ATOM   6799  C  CB    . ILE C  3  76  ? 31.602  64.506  88.819  1.00 65.17  ? 76   ILE C CB    1 
ATOM   6800  C  CG1   . ILE C  3  76  ? 30.591  65.289  87.973  1.00 63.42  ? 76   ILE C CG1   1 
ATOM   6801  C  CG2   . ILE C  3  76  ? 31.179  64.372  90.267  1.00 63.64  ? 76   ILE C CG2   1 
ATOM   6802  C  CD1   . ILE C  3  76  ? 29.189  64.713  87.948  1.00 60.97  ? 76   ILE C CD1   1 
ATOM   6803  N  N     . PRO C  3  77  ? 34.801  64.930  90.370  1.00 70.37  ? 77   PRO C N     1 
ATOM   6804  C  CA    . PRO C  3  77  ? 35.861  64.323  91.186  1.00 72.65  ? 77   PRO C CA    1 
ATOM   6805  C  C     . PRO C  3  77  ? 35.751  62.833  91.391  1.00 74.22  ? 77   PRO C C     1 
ATOM   6806  O  O     . PRO C  3  77  ? 36.728  62.101  91.161  1.00 74.47  ? 77   PRO C O     1 
ATOM   6807  C  CB    . PRO C  3  77  ? 35.791  65.093  92.511  1.00 72.60  ? 77   PRO C CB    1 
ATOM   6808  C  CG    . PRO C  3  77  ? 34.388  65.700  92.503  1.00 72.60  ? 77   PRO C CG    1 
ATOM   6809  C  CD    . PRO C  3  77  ? 34.280  66.120  91.058  1.00 71.93  ? 77   PRO C CD    1 
ATOM   6810  N  N     . GLU C  3  78  ? 34.575  62.375  91.817  1.00 75.63  ? 78   GLU C N     1 
ATOM   6811  C  CA    . GLU C  3  78  ? 34.420  60.949  92.041  1.00 77.60  ? 78   GLU C CA    1 
ATOM   6812  C  C     . GLU C  3  78  ? 33.226  60.278  91.423  1.00 76.92  ? 78   GLU C C     1 
ATOM   6813  O  O     . GLU C  3  78  ? 32.215  59.995  92.065  1.00 77.12  ? 78   GLU C O     1 
ATOM   6814  C  CB    . GLU C  3  78  ? 34.503  60.608  93.529  1.00 80.48  ? 78   GLU C CB    1 
ATOM   6815  C  CG    . GLU C  3  78  ? 35.967  60.584  94.107  1.00 85.24  ? 78   GLU C CG    1 
ATOM   6816  C  CD    . GLU C  3  78  ? 36.968  59.620  93.383  1.00 86.05  ? 78   GLU C CD    1 
ATOM   6817  O  OE1   . GLU C  3  78  ? 37.865  59.049  94.088  1.00 86.68  ? 78   GLU C OE1   1 
ATOM   6818  O  OE2   . GLU C  3  78  ? 36.877  59.459  92.133  1.00 85.94  ? 78   GLU C OE2   1 
ATOM   6819  N  N     . LYS C  3  79  ? 33.423  60.010  90.142  1.00 76.01  ? 79   LYS C N     1 
ATOM   6820  C  CA    . LYS C  3  79  ? 32.513  59.330  89.244  1.00 74.11  ? 79   LYS C CA    1 
ATOM   6821  C  C     . LYS C  3  79  ? 33.490  58.950  88.126  1.00 73.65  ? 79   LYS C C     1 
ATOM   6822  O  O     . LYS C  3  79  ? 34.232  59.802  87.628  1.00 73.60  ? 79   LYS C O     1 
ATOM   6823  C  CB    . LYS C  3  79  ? 31.448  60.271  88.703  1.00 74.12  ? 79   LYS C CB    1 
ATOM   6824  C  CG    . LYS C  3  79  ? 30.561  59.581  87.706  1.00 72.91  ? 79   LYS C CG    1 
ATOM   6825  C  CD    . LYS C  3  79  ? 29.476  60.474  87.187  1.00 74.10  ? 79   LYS C CD    1 
ATOM   6826  C  CE    . LYS C  3  79  ? 28.543  59.695  86.268  1.00 74.69  ? 79   LYS C CE    1 
ATOM   6827  N  NZ    . LYS C  3  79  ? 27.552  60.565  85.571  1.00 76.87  ? 79   LYS C NZ    1 
ATOM   6828  N  N     . PRO C  3  80  ? 33.512  57.672  87.726  1.00 72.34  ? 80   PRO C N     1 
ATOM   6829  C  CA    . PRO C  3  80  ? 34.428  57.224  86.676  1.00 70.29  ? 80   PRO C CA    1 
ATOM   6830  C  C     . PRO C  3  80  ? 34.613  58.261  85.569  1.00 70.34  ? 80   PRO C C     1 
ATOM   6831  O  O     . PRO C  3  80  ? 33.637  58.870  85.128  1.00 71.44  ? 80   PRO C O     1 
ATOM   6832  C  CB    . PRO C  3  80  ? 33.766  55.954  86.188  1.00 69.85  ? 80   PRO C CB    1 
ATOM   6833  C  CG    . PRO C  3  80  ? 33.125  55.426  87.424  1.00 70.98  ? 80   PRO C CG    1 
ATOM   6834  C  CD    . PRO C  3  80  ? 32.504  56.640  88.017  1.00 71.47  ? 80   PRO C CD    1 
ATOM   6835  N  N     . MET C  3  81  ? 35.853  58.487  85.136  1.00 68.80  ? 81   MET C N     1 
ATOM   6836  C  CA    . MET C  3  81  ? 36.081  59.451  84.057  1.00 66.44  ? 81   MET C CA    1 
ATOM   6837  C  C     . MET C  3  81  ? 35.364  58.977  82.806  1.00 65.49  ? 81   MET C C     1 
ATOM   6838  O  O     . MET C  3  81  ? 34.653  59.735  82.164  1.00 66.32  ? 81   MET C O     1 
ATOM   6839  C  CB    . MET C  3  81  ? 37.570  59.599  83.756  1.00 65.61  ? 81   MET C CB    1 
ATOM   6840  C  CG    . MET C  3  81  ? 38.245  60.650  84.592  1.00 67.10  ? 81   MET C CG    1 
ATOM   6841  S  SD    . MET C  3  81  ? 40.026  60.647  84.456  1.00 66.43  ? 81   MET C SD    1 
ATOM   6842  C  CE    . MET C  3  81  ? 40.435  59.909  86.024  1.00 68.68  ? 81   MET C CE    1 
ATOM   6843  N  N     . TYR C  3  82  ? 35.540  57.710  82.474  1.00 64.08  ? 82   TYR C N     1 
ATOM   6844  C  CA    . TYR C  3  82  ? 34.924  57.172  81.288  1.00 62.64  ? 82   TYR C CA    1 
ATOM   6845  C  C     . TYR C  3  82  ? 33.424  57.403  81.275  1.00 62.85  ? 82   TYR C C     1 
ATOM   6846  O  O     . TYR C  3  82  ? 32.810  57.498  80.202  1.00 64.08  ? 82   TYR C O     1 
ATOM   6847  C  CB    . TYR C  3  82  ? 35.279  55.688  81.134  1.00 60.21  ? 82   TYR C CB    1 
ATOM   6848  C  CG    . TYR C  3  82  ? 35.039  54.804  82.337  1.00 58.01  ? 82   TYR C CG    1 
ATOM   6849  C  CD1   . TYR C  3  82  ? 33.759  54.382  82.665  1.00 57.94  ? 82   TYR C CD1   1 
ATOM   6850  C  CD2   . TYR C  3  82  ? 36.107  54.317  83.101  1.00 57.17  ? 82   TYR C CD2   1 
ATOM   6851  C  CE1   . TYR C  3  82  ? 33.540  53.484  83.715  1.00 56.50  ? 82   TYR C CE1   1 
ATOM   6852  C  CE2   . TYR C  3  82  ? 35.901  53.427  84.150  1.00 56.08  ? 82   TYR C CE2   1 
ATOM   6853  C  CZ    . TYR C  3  82  ? 34.612  53.012  84.446  1.00 56.53  ? 82   TYR C CZ    1 
ATOM   6854  O  OH    . TYR C  3  82  ? 34.389  52.117  85.461  1.00 56.65  ? 82   TYR C OH    1 
ATOM   6855  N  N     . GLU C  3  83  ? 32.834  57.540  82.454  1.00 61.91  ? 83   GLU C N     1 
ATOM   6856  C  CA    . GLU C  3  83  ? 31.398  57.774  82.533  1.00 61.76  ? 83   GLU C CA    1 
ATOM   6857  C  C     . GLU C  3  83  ? 31.067  59.234  82.364  1.00 60.56  ? 83   GLU C C     1 
ATOM   6858  O  O     . GLU C  3  83  ? 29.923  59.614  82.562  1.00 61.27  ? 83   GLU C O     1 
ATOM   6859  C  CB    . GLU C  3  83  ? 30.836  57.311  83.881  1.00 62.93  ? 83   GLU C CB    1 
ATOM   6860  C  CG    . GLU C  3  83  ? 30.649  55.814  84.050  1.00 66.01  ? 83   GLU C CG    1 
ATOM   6861  C  CD    . GLU C  3  83  ? 30.068  55.484  85.400  1.00 68.19  ? 83   GLU C CD    1 
ATOM   6862  O  OE1   . GLU C  3  83  ? 29.082  56.144  85.766  1.00 68.82  ? 83   GLU C OE1   1 
ATOM   6863  O  OE2   . GLU C  3  83  ? 30.578  54.577  86.100  1.00 70.47  ? 83   GLU C OE2   1 
ATOM   6864  N  N     . GLN C  3  84  ? 32.057  60.047  82.002  1.00 59.88  ? 84   GLN C N     1 
ATOM   6865  C  CA    . GLN C  3  84  ? 31.853  61.488  81.850  1.00 59.06  ? 84   GLN C CA    1 
ATOM   6866  C  C     . GLN C  3  84  ? 32.348  62.075  80.526  1.00 58.76  ? 84   GLN C C     1 
ATOM   6867  O  O     . GLN C  3  84  ? 32.602  63.280  80.421  1.00 58.48  ? 84   GLN C O     1 
ATOM   6868  C  CB    . GLN C  3  84  ? 32.512  62.242  83.016  1.00 58.91  ? 84   GLN C CB    1 
ATOM   6869  C  CG    . GLN C  3  84  ? 31.986  61.881  84.391  1.00 58.54  ? 84   GLN C CG    1 
ATOM   6870  C  CD    . GLN C  3  84  ? 32.621  62.702  85.489  1.00 58.87  ? 84   GLN C CD    1 
ATOM   6871  O  OE1   . GLN C  3  84  ? 32.649  63.927  85.422  1.00 59.32  ? 84   GLN C OE1   1 
ATOM   6872  N  NE2   . GLN C  3  84  ? 33.131  62.031  86.511  1.00 58.31  ? 84   GLN C NE2   1 
ATOM   6873  N  N     . GLY C  3  85  ? 32.498  61.221  79.524  1.00 58.85  ? 85   GLY C N     1 
ATOM   6874  C  CA    . GLY C  3  85  ? 32.921  61.693  78.219  1.00 58.64  ? 85   GLY C CA    1 
ATOM   6875  C  C     . GLY C  3  85  ? 34.224  62.456  78.171  1.00 59.05  ? 85   GLY C C     1 
ATOM   6876  O  O     . GLY C  3  85  ? 34.420  63.296  77.297  1.00 59.38  ? 85   GLY C O     1 
ATOM   6877  N  N     . LEU C  3  86  ? 35.118  62.178  79.101  1.00 57.91  ? 86   LEU C N     1 
ATOM   6878  C  CA    . LEU C  3  86  ? 36.393  62.859  79.081  1.00 57.79  ? 86   LEU C CA    1 
ATOM   6879  C  C     . LEU C  3  86  ? 37.395  62.144  78.154  1.00 58.59  ? 86   LEU C C     1 
ATOM   6880  O  O     . LEU C  3  86  ? 37.369  60.926  78.037  1.00 58.59  ? 86   LEU C O     1 
ATOM   6881  C  CB    . LEU C  3  86  ? 36.963  62.948  80.498  1.00 58.33  ? 86   LEU C CB    1 
ATOM   6882  C  CG    . LEU C  3  86  ? 36.338  63.871  81.544  1.00 58.65  ? 86   LEU C CG    1 
ATOM   6883  C  CD1   . LEU C  3  86  ? 35.424  64.864  80.897  1.00 58.09  ? 86   LEU C CD1   1 
ATOM   6884  C  CD2   . LEU C  3  86  ? 35.575  63.061  82.534  1.00 58.93  ? 86   LEU C CD2   1 
ATOM   6885  N  N     . ILE C  3  87  ? 38.254  62.896  77.473  1.00 59.68  ? 87   ILE C N     1 
ATOM   6886  C  CA    . ILE C  3  87  ? 39.277  62.289  76.624  1.00 60.08  ? 87   ILE C CA    1 
ATOM   6887  C  C     . ILE C  3  87  ? 40.630  62.999  76.749  1.00 62.51  ? 87   ILE C C     1 
ATOM   6888  O  O     . ILE C  3  87  ? 41.667  62.418  76.422  1.00 63.22  ? 87   ILE C O     1 
ATOM   6889  C  CB    . ILE C  3  87  ? 38.873  62.253  75.171  1.00 58.09  ? 87   ILE C CB    1 
ATOM   6890  C  CG1   . ILE C  3  87  ? 38.655  63.661  74.642  1.00 57.93  ? 87   ILE C CG1   1 
ATOM   6891  C  CG2   . ILE C  3  87  ? 37.648  61.444  75.042  1.00 58.01  ? 87   ILE C CG2   1 
ATOM   6892  C  CD1   . ILE C  3  87  ? 38.253  63.707  73.165  1.00 58.31  ? 87   ILE C CD1   1 
ATOM   6893  N  N     . LEU C  3  88  ? 40.616  64.241  77.232  1.00 63.17  ? 88   LEU C N     1 
ATOM   6894  C  CA    . LEU C  3  88  ? 41.846  64.999  77.412  1.00 64.13  ? 88   LEU C CA    1 
ATOM   6895  C  C     . LEU C  3  88  ? 42.379  64.800  78.828  1.00 66.01  ? 88   LEU C C     1 
ATOM   6896  O  O     . LEU C  3  88  ? 43.553  64.449  79.037  1.00 66.70  ? 88   LEU C O     1 
ATOM   6897  C  CB    . LEU C  3  88  ? 41.597  66.474  77.171  1.00 62.97  ? 88   LEU C CB    1 
ATOM   6898  C  CG    . LEU C  3  88  ? 41.147  66.845  75.769  1.00 63.42  ? 88   LEU C CG    1 
ATOM   6899  C  CD1   . LEU C  3  88  ? 40.855  68.337  75.713  1.00 63.13  ? 88   LEU C CD1   1 
ATOM   6900  C  CD2   . LEU C  3  88  ? 42.221  66.460  74.781  1.00 62.47  ? 88   LEU C CD2   1 
ATOM   6901  N  N     . ILE C  3  89  ? 41.516  65.031  79.808  1.00 68.06  ? 89   ILE C N     1 
ATOM   6902  C  CA    . ILE C  3  89  ? 41.904  64.855  81.208  1.00 69.07  ? 89   ILE C CA    1 
ATOM   6903  C  C     . ILE C  3  89  ? 42.535  63.470  81.394  1.00 69.50  ? 89   ILE C C     1 
ATOM   6904  O  O     . ILE C  3  89  ? 43.561  63.335  82.046  1.00 69.94  ? 89   ILE C O     1 
ATOM   6905  C  CB    . ILE C  3  89  ? 40.680  65.042  82.152  1.00 69.34  ? 89   ILE C CB    1 
ATOM   6906  C  CG1   . ILE C  3  89  ? 40.241  66.524  82.134  1.00 68.66  ? 89   ILE C CG1   1 
ATOM   6907  C  CG2   . ILE C  3  89  ? 41.041  64.571  83.557  1.00 70.19  ? 89   ILE C CG2   1 
ATOM   6908  C  CD1   . ILE C  3  89  ? 39.031  66.869  83.014  1.00 68.46  ? 89   ILE C CD1   1 
ATOM   6909  N  N     . PRO C  3  90  ? 41.937  62.425  80.802  1.00 70.01  ? 90   PRO C N     1 
ATOM   6910  C  CA    . PRO C  3  90  ? 42.490  61.077  80.928  1.00 70.66  ? 90   PRO C CA    1 
ATOM   6911  C  C     . PRO C  3  90  ? 43.980  61.017  80.537  1.00 70.97  ? 90   PRO C C     1 
ATOM   6912  O  O     . PRO C  3  90  ? 44.757  60.273  81.131  1.00 72.00  ? 90   PRO C O     1 
ATOM   6913  C  CB    . PRO C  3  90  ? 41.621  60.274  79.964  1.00 70.17  ? 90   PRO C CB    1 
ATOM   6914  C  CG    . PRO C  3  90  ? 40.328  60.930  80.078  1.00 69.34  ? 90   PRO C CG    1 
ATOM   6915  C  CD    . PRO C  3  90  ? 40.687  62.380  80.024  1.00 70.24  ? 90   PRO C CD    1 
ATOM   6916  N  N     . HIS C  3  91  ? 44.366  61.794  79.532  1.00 71.10  ? 91   HIS C N     1 
ATOM   6917  C  CA    . HIS C  3  91  ? 45.753  61.816  79.079  1.00 70.22  ? 91   HIS C CA    1 
ATOM   6918  C  C     . HIS C  3  91  ? 46.659  62.399  80.139  1.00 69.27  ? 91   HIS C C     1 
ATOM   6919  O  O     . HIS C  3  91  ? 47.744  61.887  80.410  1.00 68.46  ? 91   HIS C O     1 
ATOM   6920  C  CB    . HIS C  3  91  ? 45.889  62.667  77.837  1.00 69.92  ? 91   HIS C CB    1 
ATOM   6921  C  CG    . HIS C  3  91  ? 45.596  61.937  76.577  1.00 70.19  ? 91   HIS C CG    1 
ATOM   6922  N  ND1   . HIS C  3  91  ? 44.325  61.547  76.221  1.00 70.61  ? 91   HIS C ND1   1 
ATOM   6923  C  CD2   . HIS C  3  91  ? 46.415  61.522  75.585  1.00 70.62  ? 91   HIS C CD2   1 
ATOM   6924  C  CE1   . HIS C  3  91  ? 44.374  60.924  75.057  1.00 71.64  ? 91   HIS C CE1   1 
ATOM   6925  N  NE2   . HIS C  3  91  ? 45.632  60.896  74.650  1.00 71.94  ? 91   HIS C NE2   1 
ATOM   6926  N  N     . ILE C  3  92  ? 46.207  63.497  80.720  1.00 68.42  ? 92   ILE C N     1 
ATOM   6927  C  CA    . ILE C  3  92  ? 46.968  64.188  81.738  1.00 67.23  ? 92   ILE C CA    1 
ATOM   6928  C  C     . ILE C  3  92  ? 47.103  63.318  82.964  1.00 67.57  ? 92   ILE C C     1 
ATOM   6929  O  O     . ILE C  3  92  ? 48.150  63.313  83.611  1.00 68.42  ? 92   ILE C O     1 
ATOM   6930  C  CB    . ILE C  3  92  ? 46.280  65.509  82.119  1.00 66.48  ? 92   ILE C CB    1 
ATOM   6931  C  CG1   . ILE C  3  92  ? 45.868  66.240  80.839  1.00 65.01  ? 92   ILE C CG1   1 
ATOM   6932  C  CG2   . ILE C  3  92  ? 47.218  66.366  82.974  1.00 65.23  ? 92   ILE C CG2   1 
ATOM   6933  C  CD1   . ILE C  3  92  ? 45.077  67.481  81.063  1.00 66.21  ? 92   ILE C CD1   1 
ATOM   6934  N  N     . ALA C  3  93  ? 46.046  62.578  83.280  1.00 67.50  ? 93   ALA C N     1 
ATOM   6935  C  CA    . ALA C  3  93  ? 46.059  61.701  84.453  1.00 67.97  ? 93   ALA C CA    1 
ATOM   6936  C  C     . ALA C  3  93  ? 47.102  60.612  84.275  1.00 67.69  ? 93   ALA C C     1 
ATOM   6937  O  O     . ALA C  3  93  ? 47.904  60.365  85.167  1.00 67.20  ? 93   ALA C O     1 
ATOM   6938  C  CB    . ALA C  3  93  ? 44.678  61.074  84.682  1.00 67.69  ? 93   ALA C CB    1 
ATOM   6939  N  N     . THR C  3  94  ? 47.101  59.977  83.113  1.00 66.85  ? 94   THR C N     1 
ATOM   6940  C  CA    . THR C  3  94  ? 48.053  58.915  82.852  1.00 66.69  ? 94   THR C CA    1 
ATOM   6941  C  C     . THR C  3  94  ? 49.494  59.338  83.069  1.00 66.11  ? 94   THR C C     1 
ATOM   6942  O  O     . THR C  3  94  ? 50.329  58.505  83.411  1.00 66.94  ? 94   THR C O     1 
ATOM   6943  C  CB    . THR C  3  94  ? 47.919  58.342  81.420  1.00 67.18  ? 94   THR C CB    1 
ATOM   6944  O  OG1   . THR C  3  94  ? 48.258  59.349  80.461  1.00 68.97  ? 94   THR C OG1   1 
ATOM   6945  C  CG2   . THR C  3  94  ? 46.493  57.867  81.169  1.00 68.91  ? 94   THR C CG2   1 
ATOM   6946  N  N     . LEU C  3  95  ? 49.800  60.615  82.873  1.00 66.30  ? 95   LEU C N     1 
ATOM   6947  C  CA    . LEU C  3  95  ? 51.169  61.102  83.067  1.00 67.01  ? 95   LEU C CA    1 
ATOM   6948  C  C     . LEU C  3  95  ? 51.496  61.229  84.543  1.00 69.01  ? 95   LEU C C     1 
ATOM   6949  O  O     . LEU C  3  95  ? 52.630  61.544  84.912  1.00 67.56  ? 95   LEU C O     1 
ATOM   6950  C  CB    . LEU C  3  95  ? 51.361  62.460  82.404  1.00 64.89  ? 95   LEU C CB    1 
ATOM   6951  C  CG    . LEU C  3  95  ? 51.265  62.435  80.883  1.00 65.88  ? 95   LEU C CG    1 
ATOM   6952  C  CD1   . LEU C  3  95  ? 51.273  63.837  80.348  1.00 65.44  ? 95   LEU C CD1   1 
ATOM   6953  C  CD2   . LEU C  3  95  ? 52.410  61.640  80.310  1.00 64.78  ? 95   LEU C CD2   1 
ATOM   6954  N  N     . GLY C  3  96  ? 50.493  60.978  85.382  1.00 71.39  ? 96   GLY C N     1 
ATOM   6955  C  CA    . GLY C  3  96  ? 50.660  61.085  86.828  1.00 73.70  ? 96   GLY C CA    1 
ATOM   6956  C  C     . GLY C  3  96  ? 50.342  62.486  87.355  1.00 74.00  ? 96   GLY C C     1 
ATOM   6957  O  O     . GLY C  3  96  ? 51.140  63.065  88.096  1.00 73.40  ? 96   GLY C O     1 
ATOM   6958  N  N     . TRP C  3  97  ? 49.181  63.022  86.981  1.00 74.85  ? 97   TRP C N     1 
ATOM   6959  C  CA    . TRP C  3  97  ? 48.784  64.358  87.408  1.00 74.86  ? 97   TRP C CA    1 
ATOM   6960  C  C     . TRP C  3  97  ? 47.410  64.475  88.061  1.00 74.23  ? 97   TRP C C     1 
ATOM   6961  O  O     . TRP C  3  97  ? 46.375  64.530  87.389  1.00 74.54  ? 97   TRP C O     1 
ATOM   6962  C  CB    . TRP C  3  97  ? 48.884  65.338  86.234  1.00 75.74  ? 97   TRP C CB    1 
ATOM   6963  C  CG    . TRP C  3  97  ? 50.180  66.104  86.249  1.00 78.38  ? 97   TRP C CG    1 
ATOM   6964  C  CD1   . TRP C  3  97  ? 50.799  66.628  87.350  1.00 79.34  ? 97   TRP C CD1   1 
ATOM   6965  C  CD2   . TRP C  3  97  ? 51.003  66.471  85.121  1.00 79.27  ? 97   TRP C CD2   1 
ATOM   6966  N  NE1   . TRP C  3  97  ? 51.952  67.297  86.982  1.00 79.81  ? 97   TRP C NE1   1 
ATOM   6967  C  CE2   . TRP C  3  97  ? 52.097  67.216  85.621  1.00 79.50  ? 97   TRP C CE2   1 
ATOM   6968  C  CE3   . TRP C  3  97  ? 50.922  66.246  83.740  1.00 80.48  ? 97   TRP C CE3   1 
ATOM   6969  C  CZ2   . TRP C  3  97  ? 53.096  67.733  84.791  1.00 79.46  ? 97   TRP C CZ2   1 
ATOM   6970  C  CZ3   . TRP C  3  97  ? 51.930  66.766  82.911  1.00 80.25  ? 97   TRP C CZ3   1 
ATOM   6971  C  CH2   . TRP C  3  97  ? 52.995  67.496  83.444  1.00 79.71  ? 97   TRP C CH2   1 
ATOM   6972  N  N     . GLY C  3  98  ? 47.423  64.521  89.390  1.00 73.27  ? 98   GLY C N     1 
ATOM   6973  C  CA    . GLY C  3  98  ? 46.201  64.656  90.163  1.00 72.35  ? 98   GLY C CA    1 
ATOM   6974  C  C     . GLY C  3  98  ? 45.401  63.381  90.229  1.00 72.07  ? 98   GLY C C     1 
ATOM   6975  O  O     . GLY C  3  98  ? 44.183  63.418  90.081  1.00 72.69  ? 98   GLY C O     1 
ATOM   6976  N  N     . VAL C  3  99  ? 46.074  62.262  90.476  1.00 70.76  ? 99   VAL C N     1 
ATOM   6977  C  CA    . VAL C  3  99  ? 45.392  60.988  90.508  1.00 69.57  ? 99   VAL C CA    1 
ATOM   6978  C  C     . VAL C  3  99  ? 45.508  60.193  91.774  1.00 69.70  ? 99   VAL C C     1 
ATOM   6979  O  O     . VAL C  3  99  ? 44.494  59.916  92.419  1.00 71.13  ? 99   VAL C O     1 
ATOM   6980  C  CB    . VAL C  3  99  ? 45.847  60.071  89.356  1.00 69.16  ? 99   VAL C CB    1 
ATOM   6981  C  CG1   . VAL C  3  99  ? 45.177  60.474  88.058  1.00 69.67  ? 99   VAL C CG1   1 
ATOM   6982  C  CG2   . VAL C  3  99  ? 47.361  60.152  89.208  1.00 71.23  ? 99   VAL C CG2   1 
ATOM   6983  N  N     . GLY C  3  100 ? 46.726  59.804  92.136  1.00 68.48  ? 100  GLY C N     1 
ATOM   6984  C  CA    . GLY C  3  100 ? 46.898  58.980  93.330  1.00 67.42  ? 100  GLY C CA    1 
ATOM   6985  C  C     . GLY C  3  100 ? 46.454  57.530  93.094  1.00 65.85  ? 100  GLY C C     1 
ATOM   6986  O  O     . GLY C  3  100 ? 46.195  57.155  91.947  1.00 65.27  ? 100  GLY C O     1 
ATOM   6987  N  N     . PRO C  3  101 ? 46.337  56.696  94.147  1.00 64.58  ? 101  PRO C N     1 
ATOM   6988  C  CA    . PRO C  3  101 ? 45.928  55.285  94.041  1.00 63.14  ? 101  PRO C CA    1 
ATOM   6989  C  C     . PRO C  3  101 ? 44.674  55.017  93.209  1.00 63.38  ? 101  PRO C C     1 
ATOM   6990  O  O     . PRO C  3  101 ? 43.706  55.763  93.282  1.00 63.37  ? 101  PRO C O     1 
ATOM   6991  C  CB    . PRO C  3  101 ? 45.750  54.878  95.488  1.00 62.65  ? 101  PRO C CB    1 
ATOM   6992  C  CG    . PRO C  3  101 ? 46.771  55.706  96.182  1.00 63.83  ? 101  PRO C CG    1 
ATOM   6993  C  CD    . PRO C  3  101 ? 46.577  57.058  95.553  1.00 64.16  ? 101  PRO C CD    1 
ATOM   6994  N  N     . GLY C  3  102 ? 44.702  53.946  92.420  1.00 64.04  ? 102  GLY C N     1 
ATOM   6995  C  CA    . GLY C  3  102 ? 43.575  53.587  91.568  1.00 64.82  ? 102  GLY C CA    1 
ATOM   6996  C  C     . GLY C  3  102 ? 43.005  54.693  90.673  1.00 66.37  ? 102  GLY C C     1 
ATOM   6997  O  O     . GLY C  3  102 ? 41.888  54.563  90.172  1.00 65.75  ? 102  GLY C O     1 
ATOM   6998  N  N     . GLY C  3  103 ? 43.765  55.760  90.445  1.00 67.63  ? 103  GLY C N     1 
ATOM   6999  C  CA    . GLY C  3  103 ? 43.257  56.846  89.633  1.00 68.36  ? 103  GLY C CA    1 
ATOM   7000  C  C     . GLY C  3  103 ? 42.136  57.516  90.419  1.00 70.23  ? 103  GLY C C     1 
ATOM   7001  O  O     . GLY C  3  103 ? 41.016  57.686  89.915  1.00 71.73  ? 103  GLY C O     1 
ATOM   7002  N  N     . GLU C  3  104 ? 42.441  57.908  91.654  1.00 69.33  ? 104  GLU C N     1 
ATOM   7003  C  CA    . GLU C  3  104 ? 41.461  58.540  92.523  1.00 69.23  ? 104  GLU C CA    1 
ATOM   7004  C  C     . GLU C  3  104 ? 41.186  60.025  92.322  1.00 69.34  ? 104  GLU C C     1 
ATOM   7005  O  O     . GLU C  3  104 ? 40.440  60.616  93.109  1.00 69.25  ? 104  GLU C O     1 
ATOM   7006  C  CB    . GLU C  3  104 ? 41.835  58.303  93.986  1.00 69.75  ? 104  GLU C CB    1 
ATOM   7007  N  N     . VAL C  3  105 ? 41.760  60.642  91.297  1.00 69.43  ? 105  VAL C N     1 
ATOM   7008  C  CA    . VAL C  3  105 ? 41.490  62.065  91.083  1.00 69.43  ? 105  VAL C CA    1 
ATOM   7009  C  C     . VAL C  3  105 ? 41.678  62.755  92.414  1.00 70.11  ? 105  VAL C C     1 
ATOM   7010  O  O     . VAL C  3  105 ? 40.697  63.100  93.068  1.00 70.39  ? 105  VAL C O     1 
ATOM   7011  C  CB    . VAL C  3  105 ? 40.026  62.293  90.666  1.00 69.52  ? 105  VAL C CB    1 
ATOM   7012  C  CG1   . VAL C  3  105 ? 39.772  63.774  90.449  1.00 70.07  ? 105  VAL C CG1   1 
ATOM   7013  C  CG2   . VAL C  3  105 ? 39.687  61.477  89.430  1.00 70.23  ? 105  VAL C CG2   1 
ATOM   7014  N  N     . VAL C  3  106 ? 42.931  62.939  92.821  1.00 70.42  ? 106  VAL C N     1 
ATOM   7015  C  CA    . VAL C  3  106 ? 43.243  63.563  94.097  1.00 70.64  ? 106  VAL C CA    1 
ATOM   7016  C  C     . VAL C  3  106 ? 43.247  65.084  94.082  1.00 71.65  ? 106  VAL C C     1 
ATOM   7017  O  O     . VAL C  3  106 ? 42.900  65.723  95.084  1.00 73.05  ? 106  VAL C O     1 
ATOM   7018  C  CB    . VAL C  3  106 ? 44.591  63.080  94.613  1.00 69.38  ? 106  VAL C CB    1 
ATOM   7019  C  CG1   . VAL C  3  106 ? 45.050  63.913  95.786  1.00 69.63  ? 106  VAL C CG1   1 
ATOM   7020  C  CG2   . VAL C  3  106 ? 44.461  61.652  95.030  1.00 69.67  ? 106  VAL C CG2   1 
ATOM   7021  N  N     . ASP C  3  107 ? 43.634  65.668  92.959  1.00 71.66  ? 107  ASP C N     1 
ATOM   7022  C  CA    . ASP C  3  107 ? 43.684  67.122  92.859  1.00 71.61  ? 107  ASP C CA    1 
ATOM   7023  C  C     . ASP C  3  107 ? 43.416  67.580  91.436  1.00 71.50  ? 107  ASP C C     1 
ATOM   7024  O  O     . ASP C  3  107 ? 44.123  67.210  90.498  1.00 72.69  ? 107  ASP C O     1 
ATOM   7025  C  CB    . ASP C  3  107 ? 45.039  67.634  93.333  1.00 71.45  ? 107  ASP C CB    1 
ATOM   7026  C  CG    . ASP C  3  107 ? 45.130  69.126  93.268  1.00 73.60  ? 107  ASP C CG    1 
ATOM   7027  O  OD1   . ASP C  3  107 ? 45.309  69.664  92.148  1.00 74.70  ? 107  ASP C OD1   1 
ATOM   7028  O  OD2   . ASP C  3  107 ? 44.995  69.768  94.337  1.00 74.69  ? 107  ASP C OD2   1 
ATOM   7029  N  N     . THR C  3  108 ? 42.406  68.416  91.284  1.00 70.25  ? 108  THR C N     1 
ATOM   7030  C  CA    . THR C  3  108 ? 42.009  68.882  89.974  1.00 68.97  ? 108  THR C CA    1 
ATOM   7031  C  C     . THR C  3  108 ? 42.913  69.916  89.297  1.00 68.36  ? 108  THR C C     1 
ATOM   7032  O  O     . THR C  3  108 ? 43.008  69.978  88.065  1.00 67.22  ? 108  THR C O     1 
ATOM   7033  C  CB    . THR C  3  108 ? 40.590  69.429  90.065  1.00 69.82  ? 108  THR C CB    1 
ATOM   7034  O  OG1   . THR C  3  108 ? 40.150  69.813  88.763  1.00 72.26  ? 108  THR C OG1   1 
ATOM   7035  C  CG2   . THR C  3  108 ? 40.529  70.627  91.008  1.00 70.31  ? 108  THR C CG2   1 
ATOM   7036  N  N     . PHE C  3  109 ? 43.581  70.717  90.112  1.00 68.57  ? 109  PHE C N     1 
ATOM   7037  C  CA    . PHE C  3  109 ? 44.449  71.782  89.626  1.00 68.44  ? 109  PHE C CA    1 
ATOM   7038  C  C     . PHE C  3  109 ? 45.337  71.477  88.428  1.00 65.83  ? 109  PHE C C     1 
ATOM   7039  O  O     . PHE C  3  109 ? 45.320  72.221  87.447  1.00 64.84  ? 109  PHE C O     1 
ATOM   7040  C  CB    . PHE C  3  109 ? 45.315  72.306  90.768  1.00 73.24  ? 109  PHE C CB    1 
ATOM   7041  C  CG    . PHE C  3  109 ? 45.812  73.724  90.554  1.00 78.00  ? 109  PHE C CG    1 
ATOM   7042  C  CD1   . PHE C  3  109 ? 44.904  74.800  90.482  1.00 79.44  ? 109  PHE C CD1   1 
ATOM   7043  C  CD2   . PHE C  3  109 ? 47.184  73.987  90.429  1.00 78.94  ? 109  PHE C CD2   1 
ATOM   7044  C  CE1   . PHE C  3  109 ? 45.356  76.128  90.289  1.00 80.83  ? 109  PHE C CE1   1 
ATOM   7045  C  CE2   . PHE C  3  109 ? 47.649  75.302  90.236  1.00 81.22  ? 109  PHE C CE2   1 
ATOM   7046  C  CZ    . PHE C  3  109 ? 46.729  76.382  90.166  1.00 81.54  ? 109  PHE C CZ    1 
ATOM   7047  N  N     . PRO C  3  110 ? 46.137  70.398  88.492  1.00 63.36  ? 110  PRO C N     1 
ATOM   7048  C  CA    . PRO C  3  110 ? 46.992  70.097  87.341  1.00 61.62  ? 110  PRO C CA    1 
ATOM   7049  C  C     . PRO C  3  110 ? 46.195  70.226  86.046  1.00 61.40  ? 110  PRO C C     1 
ATOM   7050  O  O     . PRO C  3  110 ? 46.720  70.707  85.047  1.00 60.52  ? 110  PRO C O     1 
ATOM   7051  C  CB    . PRO C  3  110 ? 47.434  68.671  87.618  1.00 61.16  ? 110  PRO C CB    1 
ATOM   7052  C  CG    . PRO C  3  110 ? 47.506  68.654  89.080  1.00 60.08  ? 110  PRO C CG    1 
ATOM   7053  C  CD    . PRO C  3  110 ? 46.249  69.334  89.498  1.00 61.25  ? 110  PRO C CD    1 
ATOM   7054  N  N     . PHE C  3  111 ? 44.923  69.810  86.084  1.00 61.34  ? 111  PHE C N     1 
ATOM   7055  C  CA    . PHE C  3  111 ? 44.032  69.885  84.927  1.00 60.53  ? 111  PHE C CA    1 
ATOM   7056  C  C     . PHE C  3  111 ? 43.778  71.342  84.548  1.00 60.83  ? 111  PHE C C     1 
ATOM   7057  O  O     . PHE C  3  111 ? 44.084  71.763  83.429  1.00 61.06  ? 111  PHE C O     1 
ATOM   7058  C  CB    . PHE C  3  111 ? 42.709  69.174  85.220  1.00 57.99  ? 111  PHE C CB    1 
ATOM   7059  C  CG    . PHE C  3  111 ? 42.872  67.729  85.507  1.00 56.19  ? 111  PHE C CG    1 
ATOM   7060  C  CD1   . PHE C  3  111 ? 42.145  67.128  86.513  1.00 56.54  ? 111  PHE C CD1   1 
ATOM   7061  C  CD2   . PHE C  3  111 ? 43.812  66.980  84.831  1.00 55.44  ? 111  PHE C CD2   1 
ATOM   7062  C  CE1   . PHE C  3  111 ? 42.357  65.799  86.854  1.00 54.20  ? 111  PHE C CE1   1 
ATOM   7063  C  CE2   . PHE C  3  111 ? 44.030  65.654  85.165  1.00 55.45  ? 111  PHE C CE2   1 
ATOM   7064  C  CZ    . PHE C  3  111 ? 43.300  65.068  86.182  1.00 54.37  ? 111  PHE C CZ    1 
ATOM   7065  N  N     . PHE C  3  112 ? 43.220  72.104  85.482  1.00 60.34  ? 112  PHE C N     1 
ATOM   7066  C  CA    . PHE C  3  112 ? 42.955  73.512  85.239  1.00 59.77  ? 112  PHE C CA    1 
ATOM   7067  C  C     . PHE C  3  112 ? 44.235  74.128  84.676  1.00 59.85  ? 112  PHE C C     1 
ATOM   7068  O  O     . PHE C  3  112 ? 44.225  74.792  83.640  1.00 56.86  ? 112  PHE C O     1 
ATOM   7069  C  CB    . PHE C  3  112 ? 42.552  74.200  86.550  1.00 59.66  ? 112  PHE C CB    1 
ATOM   7070  C  CG    . PHE C  3  112 ? 42.235  75.654  86.393  1.00 60.09  ? 112  PHE C CG    1 
ATOM   7071  C  CD1   . PHE C  3  112 ? 41.265  76.073  85.486  1.00 60.70  ? 112  PHE C CD1   1 
ATOM   7072  C  CD2   . PHE C  3  112 ? 42.947  76.609  87.098  1.00 61.10  ? 112  PHE C CD2   1 
ATOM   7073  C  CE1   . PHE C  3  112 ? 41.014  77.416  85.277  1.00 60.99  ? 112  PHE C CE1   1 
ATOM   7074  C  CE2   . PHE C  3  112 ? 42.704  77.966  86.896  1.00 62.19  ? 112  PHE C CE2   1 
ATOM   7075  C  CZ    . PHE C  3  112 ? 41.735  78.369  85.981  1.00 61.74  ? 112  PHE C CZ    1 
ATOM   7076  N  N     . VAL C  3  113 ? 45.334  73.878  85.380  1.00 61.44  ? 113  VAL C N     1 
ATOM   7077  C  CA    . VAL C  3  113 ? 46.673  74.350  85.008  1.00 63.71  ? 113  VAL C CA    1 
ATOM   7078  C  C     . VAL C  3  113 ? 47.017  74.078  83.540  1.00 64.91  ? 113  VAL C C     1 
ATOM   7079  O  O     . VAL C  3  113 ? 47.285  75.000  82.778  1.00 65.21  ? 113  VAL C O     1 
ATOM   7080  C  CB    . VAL C  3  113 ? 47.759  73.662  85.891  1.00 64.39  ? 113  VAL C CB    1 
ATOM   7081  C  CG1   . VAL C  3  113 ? 49.152  73.838  85.282  1.00 62.30  ? 113  VAL C CG1   1 
ATOM   7082  C  CG2   . VAL C  3  113 ? 47.706  74.229  87.302  1.00 64.21  ? 113  VAL C CG2   1 
ATOM   7083  N  N     . VAL C  3  114 ? 47.019  72.804  83.161  1.00 66.34  ? 114  VAL C N     1 
ATOM   7084  C  CA    . VAL C  3  114 ? 47.343  72.399  81.793  1.00 66.57  ? 114  VAL C CA    1 
ATOM   7085  C  C     . VAL C  3  114 ? 46.415  73.035  80.781  1.00 67.37  ? 114  VAL C C     1 
ATOM   7086  O  O     . VAL C  3  114 ? 46.869  73.601  79.785  1.00 67.37  ? 114  VAL C O     1 
ATOM   7087  C  CB    . VAL C  3  114 ? 47.268  70.867  81.625  1.00 65.49  ? 114  VAL C CB    1 
ATOM   7088  C  CG1   . VAL C  3  114 ? 47.345  70.489  80.173  1.00 63.42  ? 114  VAL C CG1   1 
ATOM   7089  C  CG2   . VAL C  3  114 ? 48.401  70.230  82.356  1.00 65.51  ? 114  VAL C CG2   1 
ATOM   7090  N  N     . GLY C  3  115 ? 45.118  72.934  81.038  1.00 68.02  ? 115  GLY C N     1 
ATOM   7091  C  CA    . GLY C  3  115 ? 44.133  73.490  80.129  1.00 68.84  ? 115  GLY C CA    1 
ATOM   7092  C  C     . GLY C  3  115 ? 44.362  74.946  79.750  1.00 69.31  ? 115  GLY C C     1 
ATOM   7093  O  O     . GLY C  3  115 ? 44.406  75.288  78.567  1.00 69.06  ? 115  GLY C O     1 
ATOM   7094  N  N     . VAL C  3  116 ? 44.526  75.809  80.746  1.00 69.40  ? 116  VAL C N     1 
ATOM   7095  C  CA    . VAL C  3  116 ? 44.709  77.230  80.472  1.00 69.59  ? 116  VAL C CA    1 
ATOM   7096  C  C     . VAL C  3  116 ? 46.003  77.601  79.763  1.00 69.58  ? 116  VAL C C     1 
ATOM   7097  O  O     . VAL C  3  116 ? 45.978  78.341  78.775  1.00 69.65  ? 116  VAL C O     1 
ATOM   7098  C  CB    . VAL C  3  116 ? 44.595  78.083  81.756  1.00 69.21  ? 116  VAL C CB    1 
ATOM   7099  C  CG1   . VAL C  3  116 ? 45.651  77.682  82.761  1.00 68.43  ? 116  VAL C CG1   1 
ATOM   7100  C  CG2   . VAL C  3  116 ? 44.726  79.547  81.391  1.00 68.05  ? 116  VAL C CG2   1 
ATOM   7101  N  N     . VAL C  3  117 ? 47.126  77.123  80.277  1.00 69.46  ? 117  VAL C N     1 
ATOM   7102  C  CA    . VAL C  3  117 ? 48.413  77.418  79.661  1.00 69.88  ? 117  VAL C CA    1 
ATOM   7103  C  C     . VAL C  3  117 ? 48.247  77.351  78.137  1.00 70.81  ? 117  VAL C C     1 
ATOM   7104  O  O     . VAL C  3  117 ? 48.600  78.283  77.405  1.00 71.05  ? 117  VAL C O     1 
ATOM   7105  C  CB    . VAL C  3  117 ? 49.467  76.401  80.120  1.00 69.97  ? 117  VAL C CB    1 
ATOM   7106  C  CG1   . VAL C  3  117 ? 50.761  76.611  79.380  1.00 69.49  ? 117  VAL C CG1   1 
ATOM   7107  C  CG2   . VAL C  3  117 ? 49.684  76.541  81.612  1.00 69.40  ? 117  VAL C CG2   1 
ATOM   7108  N  N     . HIS C  3  118 ? 47.700  76.243  77.663  1.00 71.39  ? 118  HIS C N     1 
ATOM   7109  C  CA    . HIS C  3  118 ? 47.465  76.075  76.234  1.00 72.02  ? 118  HIS C CA    1 
ATOM   7110  C  C     . HIS C  3  118 ? 46.591  77.220  75.714  1.00 72.96  ? 118  HIS C C     1 
ATOM   7111  O  O     . HIS C  3  118 ? 46.974  77.933  74.775  1.00 72.73  ? 118  HIS C O     1 
ATOM   7112  C  CB    . HIS C  3  118 ? 46.754  74.741  75.961  1.00 71.98  ? 118  HIS C CB    1 
ATOM   7113  C  CG    . HIS C  3  118 ? 47.671  73.559  75.925  1.00 72.18  ? 118  HIS C CG    1 
ATOM   7114  N  ND1   . HIS C  3  118 ? 48.336  73.094  77.038  1.00 72.34  ? 118  HIS C ND1   1 
ATOM   7115  C  CD2   . HIS C  3  118 ? 48.045  72.754  74.901  1.00 72.62  ? 118  HIS C CD2   1 
ATOM   7116  C  CE1   . HIS C  3  118 ? 49.079  72.053  76.701  1.00 72.68  ? 118  HIS C CE1   1 
ATOM   7117  N  NE2   . HIS C  3  118 ? 48.921  71.826  75.411  1.00 72.34  ? 118  HIS C NE2   1 
ATOM   7118  N  N     . LEU C  3  119 ? 45.416  77.384  76.330  1.00 73.36  ? 119  LEU C N     1 
ATOM   7119  C  CA    . LEU C  3  119 ? 44.443  78.419  75.946  1.00 73.20  ? 119  LEU C CA    1 
ATOM   7120  C  C     . LEU C  3  119 ? 45.053  79.800  75.750  1.00 73.45  ? 119  LEU C C     1 
ATOM   7121  O  O     . LEU C  3  119 ? 44.507  80.626  75.027  1.00 74.36  ? 119  LEU C O     1 
ATOM   7122  C  CB    . LEU C  3  119 ? 43.333  78.523  76.993  1.00 72.60  ? 119  LEU C CB    1 
ATOM   7123  C  CG    . LEU C  3  119 ? 42.244  79.525  76.615  1.00 71.23  ? 119  LEU C CG    1 
ATOM   7124  C  CD1   . LEU C  3  119 ? 41.616  79.109  75.299  1.00 70.29  ? 119  LEU C CD1   1 
ATOM   7125  C  CD2   . LEU C  3  119 ? 41.204  79.592  77.715  1.00 71.72  ? 119  LEU C CD2   1 
ATOM   7126  N  N     . ILE C  3  120 ? 46.178  80.045  76.407  1.00 73.03  ? 120  ILE C N     1 
ATOM   7127  C  CA    . ILE C  3  120 ? 46.873  81.316  76.309  1.00 71.53  ? 120  ILE C CA    1 
ATOM   7128  C  C     . ILE C  3  120 ? 47.890  81.263  75.165  1.00 71.21  ? 120  ILE C C     1 
ATOM   7129  O  O     . ILE C  3  120 ? 47.925  82.137  74.290  1.00 68.36  ? 120  ILE C O     1 
ATOM   7130  C  CB    . ILE C  3  120 ? 47.601  81.587  77.615  1.00 72.21  ? 120  ILE C CB    1 
ATOM   7131  C  CG1   . ILE C  3  120 ? 46.575  81.711  78.731  1.00 72.77  ? 120  ILE C CG1   1 
ATOM   7132  C  CG2   . ILE C  3  120 ? 48.496  82.800  77.491  1.00 71.57  ? 120  ILE C CG2   1 
ATOM   7133  C  CD1   . ILE C  3  120 ? 47.209  81.779  80.117  1.00 74.67  ? 120  ILE C CD1   1 
ATOM   7134  N  N     . SER C  3  121 ? 48.715  80.226  75.186  1.00 70.79  ? 121  SER C N     1 
ATOM   7135  C  CA    . SER C  3  121 ? 49.731  80.059  74.168  1.00 72.03  ? 121  SER C CA    1 
ATOM   7136  C  C     . SER C  3  121 ? 49.111  80.056  72.776  1.00 73.36  ? 121  SER C C     1 
ATOM   7137  O  O     . SER C  3  121 ? 49.823  80.102  71.762  1.00 74.20  ? 121  SER C O     1 
ATOM   7138  C  CB    . SER C  3  121 ? 50.475  78.765  74.425  1.00 71.44  ? 121  SER C CB    1 
ATOM   7139  O  OG    . SER C  3  121 ? 50.863  78.728  75.784  1.00 70.76  ? 121  SER C OG    1 
ATOM   7140  N  N     . SER C  3  122 ? 47.777  79.998  72.748  1.00 74.29  ? 122  SER C N     1 
ATOM   7141  C  CA    . SER C  3  122 ? 46.996  80.002  71.506  1.00 73.54  ? 122  SER C CA    1 
ATOM   7142  C  C     . SER C  3  122 ? 46.913  81.447  71.022  1.00 74.15  ? 122  SER C C     1 
ATOM   7143  O  O     . SER C  3  122 ? 46.916  81.715  69.804  1.00 74.81  ? 122  SER C O     1 
ATOM   7144  C  CB    . SER C  3  122 ? 45.585  79.481  71.767  1.00 72.27  ? 122  SER C CB    1 
ATOM   7145  O  OG    . SER C  3  122 ? 44.862  80.400  72.558  1.00 68.99  ? 122  SER C OG    1 
ATOM   7146  N  N     . ALA C  3  123 ? 46.831  82.374  71.981  1.00 73.08  ? 123  ALA C N     1 
ATOM   7147  C  CA    . ALA C  3  123 ? 46.765  83.800  71.660  1.00 71.36  ? 123  ALA C CA    1 
ATOM   7148  C  C     . ALA C  3  123 ? 48.082  84.181  71.016  1.00 70.61  ? 123  ALA C C     1 
ATOM   7149  O  O     . ALA C  3  123 ? 48.109  84.903  70.032  1.00 69.59  ? 123  ALA C O     1 
ATOM   7150  C  CB    . ALA C  3  123 ? 46.545  84.597  72.921  1.00 71.55  ? 123  ALA C CB    1 
ATOM   7151  N  N     . VAL C  3  124 ? 49.170  83.683  71.583  1.00 70.30  ? 124  VAL C N     1 
ATOM   7152  C  CA    . VAL C  3  124 ? 50.493  83.956  71.049  1.00 71.05  ? 124  VAL C CA    1 
ATOM   7153  C  C     . VAL C  3  124 ? 50.524  83.489  69.608  1.00 71.28  ? 124  VAL C C     1 
ATOM   7154  O  O     . VAL C  3  124 ? 50.580  84.286  68.676  1.00 70.99  ? 124  VAL C O     1 
ATOM   7155  C  CB    . VAL C  3  124 ? 51.573  83.190  71.818  1.00 71.50  ? 124  VAL C CB    1 
ATOM   7156  C  CG1   . VAL C  3  124 ? 52.925  83.456  71.201  1.00 71.72  ? 124  VAL C CG1   1 
ATOM   7157  C  CG2   . VAL C  3  124 ? 51.541  83.590  73.283  1.00 72.34  ? 124  VAL C CG2   1 
ATOM   7158  N  N     . LEU C  3  125 ? 50.493  82.178  69.435  1.00 72.40  ? 125  LEU C N     1 
ATOM   7159  C  CA    . LEU C  3  125 ? 50.514  81.587  68.103  1.00 73.60  ? 125  LEU C CA    1 
ATOM   7160  C  C     . LEU C  3  125 ? 49.509  82.258  67.180  1.00 74.75  ? 125  LEU C C     1 
ATOM   7161  O  O     . LEU C  3  125 ? 49.835  82.513  66.013  1.00 75.47  ? 125  LEU C O     1 
ATOM   7162  C  CB    . LEU C  3  125 ? 50.210  80.099  68.189  1.00 72.21  ? 125  LEU C CB    1 
ATOM   7163  C  CG    . LEU C  3  125 ? 51.207  79.280  69.004  1.00 71.40  ? 125  LEU C CG    1 
ATOM   7164  C  CD1   . LEU C  3  125 ? 50.701  77.868  69.118  1.00 70.15  ? 125  LEU C CD1   1 
ATOM   7165  C  CD2   . LEU C  3  125 ? 52.566  79.305  68.334  1.00 70.41  ? 125  LEU C CD2   1 
ATOM   7166  N  N     . GLY C  3  126 ? 48.303  82.529  67.705  1.00 75.82  ? 126  GLY C N     1 
ATOM   7167  C  CA    . GLY C  3  126 ? 47.238  83.171  66.938  1.00 76.02  ? 126  GLY C CA    1 
ATOM   7168  C  C     . GLY C  3  126 ? 47.664  84.534  66.414  1.00 76.74  ? 126  GLY C C     1 
ATOM   7169  O  O     . GLY C  3  126 ? 47.368  84.919  65.274  1.00 74.99  ? 126  GLY C O     1 
ATOM   7170  N  N     . PHE C  3  127 ? 48.376  85.260  67.269  1.00 77.84  ? 127  PHE C N     1 
ATOM   7171  C  CA    . PHE C  3  127 ? 48.893  86.576  66.930  1.00 78.44  ? 127  PHE C CA    1 
ATOM   7172  C  C     . PHE C  3  127 ? 49.905  86.443  65.784  1.00 77.37  ? 127  PHE C C     1 
ATOM   7173  O  O     . PHE C  3  127 ? 49.943  87.272  64.874  1.00 77.69  ? 127  PHE C O     1 
ATOM   7174  C  CB    . PHE C  3  127 ? 49.576  87.184  68.159  1.00 81.44  ? 127  PHE C CB    1 
ATOM   7175  C  CG    . PHE C  3  127 ? 49.896  88.653  68.015  1.00 84.37  ? 127  PHE C CG    1 
ATOM   7176  C  CD1   . PHE C  3  127 ? 48.879  89.618  68.152  1.00 85.07  ? 127  PHE C CD1   1 
ATOM   7177  C  CD2   . PHE C  3  127 ? 51.204  89.075  67.737  1.00 84.88  ? 127  PHE C CD2   1 
ATOM   7178  C  CE1   . PHE C  3  127 ? 49.151  90.975  68.019  1.00 85.60  ? 127  PHE C CE1   1 
ATOM   7179  C  CE2   . PHE C  3  127 ? 51.495  90.437  67.598  1.00 86.23  ? 127  PHE C CE2   1 
ATOM   7180  C  CZ    . PHE C  3  127 ? 50.466  91.392  67.740  1.00 86.74  ? 127  PHE C CZ    1 
ATOM   7181  N  N     . GLY C  3  128 ? 50.724  85.402  65.837  1.00 75.92  ? 128  GLY C N     1 
ATOM   7182  C  CA    . GLY C  3  128 ? 51.715  85.210  64.798  1.00 76.02  ? 128  GLY C CA    1 
ATOM   7183  C  C     . GLY C  3  128 ? 51.096  84.936  63.449  1.00 75.39  ? 128  GLY C C     1 
ATOM   7184  O  O     . GLY C  3  128 ? 51.451  85.557  62.441  1.00 74.26  ? 128  GLY C O     1 
ATOM   7185  N  N     . GLY C  3  129 ? 50.174  83.985  63.443  1.00 75.26  ? 129  GLY C N     1 
ATOM   7186  C  CA    . GLY C  3  129 ? 49.505  83.631  62.216  1.00 75.53  ? 129  GLY C CA    1 
ATOM   7187  C  C     . GLY C  3  129 ? 48.868  84.851  61.584  1.00 76.08  ? 129  GLY C C     1 
ATOM   7188  O  O     . GLY C  3  129 ? 49.291  85.261  60.503  1.00 77.46  ? 129  GLY C O     1 
ATOM   7189  N  N     . VAL C  3  130 ? 47.866  85.431  62.245  1.00 74.88  ? 130  VAL C N     1 
ATOM   7190  C  CA    . VAL C  3  130 ? 47.165  86.592  61.714  1.00 73.74  ? 130  VAL C CA    1 
ATOM   7191  C  C     . VAL C  3  130 ? 48.158  87.597  61.177  1.00 73.49  ? 130  VAL C C     1 
ATOM   7192  O  O     . VAL C  3  130 ? 47.988  88.133  60.076  1.00 72.70  ? 130  VAL C O     1 
ATOM   7193  C  CB    . VAL C  3  130 ? 46.307  87.225  62.788  1.00 73.50  ? 130  VAL C CB    1 
ATOM   7194  C  CG1   . VAL C  3  130 ? 45.549  88.404  62.225  1.00 73.60  ? 130  VAL C CG1   1 
ATOM   7195  C  CG2   . VAL C  3  130 ? 45.346  86.183  63.329  1.00 74.60  ? 130  VAL C CG2   1 
ATOM   7196  N  N     . TYR C  3  131 ? 49.214  87.829  61.951  1.00 74.71  ? 131  TYR C N     1 
ATOM   7197  C  CA    . TYR C  3  131 ? 50.271  88.755  61.547  1.00 75.96  ? 131  TYR C CA    1 
ATOM   7198  C  C     . TYR C  3  131 ? 51.017  88.307  60.266  1.00 75.81  ? 131  TYR C C     1 
ATOM   7199  O  O     . TYR C  3  131 ? 50.970  88.980  59.237  1.00 75.06  ? 131  TYR C O     1 
ATOM   7200  C  CB    . TYR C  3  131 ? 51.281  88.950  62.689  1.00 77.95  ? 131  TYR C CB    1 
ATOM   7201  C  CG    . TYR C  3  131 ? 52.590  89.517  62.178  1.00 80.72  ? 131  TYR C CG    1 
ATOM   7202  C  CD1   . TYR C  3  131 ? 52.641  90.789  61.590  1.00 81.48  ? 131  TYR C CD1   1 
ATOM   7203  C  CD2   . TYR C  3  131 ? 53.764  88.737  62.165  1.00 81.50  ? 131  TYR C CD2   1 
ATOM   7204  C  CE1   . TYR C  3  131 ? 53.825  91.264  60.993  1.00 81.61  ? 131  TYR C CE1   1 
ATOM   7205  C  CE2   . TYR C  3  131 ? 54.951  89.208  61.567  1.00 80.37  ? 131  TYR C CE2   1 
ATOM   7206  C  CZ    . TYR C  3  131 ? 54.967  90.466  60.983  1.00 80.67  ? 131  TYR C CZ    1 
ATOM   7207  O  OH    . TYR C  3  131 ? 56.094  90.919  60.351  1.00 79.49  ? 131  TYR C OH    1 
ATOM   7208  N  N     . HIS C  3  132 ? 51.701  87.174  60.347  1.00 75.53  ? 132  HIS C N     1 
ATOM   7209  C  CA    . HIS C  3  132 ? 52.458  86.633  59.225  1.00 76.02  ? 132  HIS C CA    1 
ATOM   7210  C  C     . HIS C  3  132 ? 51.719  86.366  57.924  1.00 76.13  ? 132  HIS C C     1 
ATOM   7211  O  O     . HIS C  3  132 ? 52.360  86.157  56.897  1.00 75.97  ? 132  HIS C O     1 
ATOM   7212  C  CB    . HIS C  3  132 ? 53.125  85.342  59.637  1.00 76.41  ? 132  HIS C CB    1 
ATOM   7213  C  CG    . HIS C  3  132 ? 54.525  85.523  60.108  1.00 77.03  ? 132  HIS C CG    1 
ATOM   7214  N  ND1   . HIS C  3  132 ? 55.496  86.093  59.319  1.00 76.12  ? 132  HIS C ND1   1 
ATOM   7215  C  CD2   . HIS C  3  132 ? 55.127  85.191  61.278  1.00 77.58  ? 132  HIS C CD2   1 
ATOM   7216  C  CE1   . HIS C  3  132 ? 56.640  86.102  59.982  1.00 78.01  ? 132  HIS C CE1   1 
ATOM   7217  N  NE2   . HIS C  3  132 ? 56.444  85.560  61.172  1.00 77.51  ? 132  HIS C NE2   1 
ATOM   7218  N  N     . ALA C  3  133 ? 50.390  86.346  57.972  1.00 77.15  ? 133  ALA C N     1 
ATOM   7219  C  CA    . ALA C  3  133 ? 49.563  86.093  56.791  1.00 78.01  ? 133  ALA C CA    1 
ATOM   7220  C  C     . ALA C  3  133 ? 48.821  87.371  56.366  1.00 79.07  ? 133  ALA C C     1 
ATOM   7221  O  O     . ALA C  3  133 ? 47.962  87.359  55.468  1.00 79.52  ? 133  ALA C O     1 
ATOM   7222  C  CB    . ALA C  3  133 ? 48.569  84.972  57.076  1.00 77.80  ? 133  ALA C CB    1 
ATOM   7223  N  N     . ILE C  3  134 ? 49.161  88.478  57.017  1.00 79.59  ? 134  ILE C N     1 
ATOM   7224  C  CA    . ILE C  3  134 ? 48.541  89.760  56.688  1.00 79.36  ? 134  ILE C CA    1 
ATOM   7225  C  C     . ILE C  3  134 ? 49.599  90.880  56.679  1.00 79.50  ? 134  ILE C C     1 
ATOM   7226  O  O     . ILE C  3  134 ? 50.086  91.254  55.606  1.00 80.70  ? 134  ILE C O     1 
ATOM   7227  C  CB    . ILE C  3  134 ? 47.424  90.113  57.678  1.00 78.57  ? 134  ILE C CB    1 
ATOM   7228  C  CG1   . ILE C  3  134 ? 46.361  89.027  57.665  1.00 77.37  ? 134  ILE C CG1   1 
ATOM   7229  C  CG2   . ILE C  3  134 ? 46.794  91.455  57.288  1.00 78.97  ? 134  ILE C CG2   1 
ATOM   7230  C  CD1   . ILE C  3  134 ? 45.324  89.249  58.710  1.00 76.36  ? 134  ILE C CD1   1 
ATOM   7231  N  N     . ARG C  3  135 ? 49.941  91.410  57.854  1.00 77.96  ? 135  ARG C N     1 
ATOM   7232  C  CA    . ARG C  3  135 ? 50.944  92.466  57.958  1.00 76.19  ? 135  ARG C CA    1 
ATOM   7233  C  C     . ARG C  3  135 ? 52.304  91.993  57.393  1.00 75.41  ? 135  ARG C C     1 
ATOM   7234  O  O     . ARG C  3  135 ? 52.734  92.443  56.321  1.00 73.83  ? 135  ARG C O     1 
ATOM   7235  C  CB    . ARG C  3  135 ? 51.103  92.891  59.421  1.00 75.01  ? 135  ARG C CB    1 
ATOM   7236  N  N     . GLY C  3  136 ? 52.962  91.081  58.115  1.00 75.78  ? 136  GLY C N     1 
ATOM   7237  C  CA    . GLY C  3  136 ? 54.261  90.556  57.701  1.00 74.35  ? 136  GLY C CA    1 
ATOM   7238  C  C     . GLY C  3  136 ? 54.470  90.358  56.205  1.00 74.11  ? 136  GLY C C     1 
ATOM   7239  O  O     . GLY C  3  136 ? 53.522  90.417  55.422  1.00 73.43  ? 136  GLY C O     1 
ATOM   7240  N  N     . PRO C  3  137 ? 55.721  90.109  55.783  1.00 73.72  ? 137  PRO C N     1 
ATOM   7241  C  CA    . PRO C  3  137 ? 56.057  89.900  54.369  1.00 73.20  ? 137  PRO C CA    1 
ATOM   7242  C  C     . PRO C  3  137 ? 55.441  88.622  53.827  1.00 73.53  ? 137  PRO C C     1 
ATOM   7243  O  O     . PRO C  3  137 ? 55.428  87.602  54.514  1.00 73.29  ? 137  PRO C O     1 
ATOM   7244  C  CB    . PRO C  3  137 ? 57.584  89.828  54.384  1.00 73.13  ? 137  PRO C CB    1 
ATOM   7245  C  CG    . PRO C  3  137 ? 57.884  89.240  55.740  1.00 72.78  ? 137  PRO C CG    1 
ATOM   7246  C  CD    . PRO C  3  137 ? 56.917  89.982  56.641  1.00 73.05  ? 137  PRO C CD    1 
ATOM   7247  N  N     . GLU C  3  138 ? 54.936  88.673  52.603  1.00 74.43  ? 138  GLU C N     1 
ATOM   7248  C  CA    . GLU C  3  138 ? 54.336  87.492  51.996  1.00 75.59  ? 138  GLU C CA    1 
ATOM   7249  C  C     . GLU C  3  138 ? 55.350  86.781  51.105  1.00 75.67  ? 138  GLU C C     1 
ATOM   7250  O  O     . GLU C  3  138 ? 55.089  86.448  49.947  1.00 76.32  ? 138  GLU C O     1 
ATOM   7251  C  CB    . GLU C  3  138 ? 53.068  87.857  51.201  1.00 76.35  ? 138  GLU C CB    1 
ATOM   7252  C  CG    . GLU C  3  138 ? 53.276  88.756  50.007  1.00 77.04  ? 138  GLU C CG    1 
ATOM   7253  C  CD    . GLU C  3  138 ? 52.079  88.765  49.065  1.00 79.10  ? 138  GLU C CD    1 
ATOM   7254  O  OE1   . GLU C  3  138 ? 51.814  87.731  48.398  1.00 79.78  ? 138  GLU C OE1   1 
ATOM   7255  O  OE2   . GLU C  3  138 ? 51.395  89.812  48.991  1.00 79.40  ? 138  GLU C OE2   1 
ATOM   7256  N  N     . THR C  3  139 ? 56.522  86.564  51.677  1.00 76.10  ? 139  THR C N     1 
ATOM   7257  C  CA    . THR C  3  139 ? 57.632  85.875  51.024  1.00 76.80  ? 139  THR C CA    1 
ATOM   7258  C  C     . THR C  3  139 ? 58.834  86.106  51.916  1.00 76.68  ? 139  THR C C     1 
ATOM   7259  O  O     . THR C  3  139 ? 59.114  87.240  52.304  1.00 77.04  ? 139  THR C O     1 
ATOM   7260  C  CB    . THR C  3  139 ? 57.939  86.429  49.630  1.00 75.97  ? 139  THR C CB    1 
ATOM   7261  O  OG1   . THR C  3  139 ? 58.927  85.600  49.011  1.00 76.54  ? 139  THR C OG1   1 
ATOM   7262  C  CG2   . THR C  3  139 ? 58.480  87.843  49.718  1.00 76.41  ? 139  THR C CG2   1 
ATOM   7263  N  N     . LEU C  3  140 ? 59.529  85.040  52.277  1.00 77.67  ? 140  LEU C N     1 
ATOM   7264  C  CA    . LEU C  3  140 ? 60.684  85.200  53.151  1.00 79.50  ? 140  LEU C CA    1 
ATOM   7265  C  C     . LEU C  3  140 ? 61.950  85.428  52.329  1.00 80.47  ? 140  LEU C C     1 
ATOM   7266  O  O     . LEU C  3  140 ? 63.046  85.598  52.875  1.00 79.56  ? 140  LEU C O     1 
ATOM   7267  C  CB    . LEU C  3  140 ? 60.823  83.979  54.072  1.00 78.48  ? 140  LEU C CB    1 
ATOM   7268  C  CG    . LEU C  3  140 ? 59.602  83.735  54.976  1.00 77.37  ? 140  LEU C CG    1 
ATOM   7269  C  CD1   . LEU C  3  140 ? 59.958  82.693  56.016  1.00 77.54  ? 140  LEU C CD1   1 
ATOM   7270  C  CD2   . LEU C  3  140 ? 59.177  85.027  55.671  1.00 76.97  ? 140  LEU C CD2   1 
ATOM   7271  N  N     . GLU C  3  141 ? 61.758  85.440  51.008  1.00 82.09  ? 141  GLU C N     1 
ATOM   7272  C  CA    . GLU C  3  141 ? 62.809  85.661  50.010  1.00 82.59  ? 141  GLU C CA    1 
ATOM   7273  C  C     . GLU C  3  141 ? 63.976  86.508  50.530  1.00 83.04  ? 141  GLU C C     1 
ATOM   7274  O  O     . GLU C  3  141 ? 65.016  85.981  50.941  1.00 83.41  ? 141  GLU C O     1 
ATOM   7275  C  CB    . GLU C  3  141 ? 62.195  86.344  48.773  1.00 82.89  ? 141  GLU C CB    1 
ATOM   7276  N  N     . GLU C  3  142 ? 63.787  87.820  50.505  1.00 84.03  ? 142  GLU C N     1 
ATOM   7277  C  CA    . GLU C  3  142 ? 64.801  88.762  50.967  1.00 85.49  ? 142  GLU C CA    1 
ATOM   7278  C  C     . GLU C  3  142 ? 64.609  89.204  52.436  1.00 85.24  ? 142  GLU C C     1 
ATOM   7279  O  O     . GLU C  3  142 ? 65.542  89.725  53.056  1.00 84.50  ? 142  GLU C O     1 
ATOM   7280  C  CB    . GLU C  3  142 ? 64.803  89.994  50.054  1.00 86.23  ? 142  GLU C CB    1 
ATOM   7281  C  CG    . GLU C  3  142 ? 63.399  90.611  49.866  1.00 89.71  ? 142  GLU C CG    1 
ATOM   7282  C  CD    . GLU C  3  142 ? 63.388  91.880  48.993  1.00 92.10  ? 142  GLU C CD    1 
ATOM   7283  O  OE1   . GLU C  3  142 ? 63.864  91.798  47.821  1.00 92.18  ? 142  GLU C OE1   1 
ATOM   7284  O  OE2   . GLU C  3  142 ? 62.898  92.956  49.470  1.00 91.89  ? 142  GLU C OE2   1 
ATOM   7285  N  N     . TYR C  3  143 ? 63.407  89.008  52.984  1.00 85.10  ? 143  TYR C N     1 
ATOM   7286  C  CA    . TYR C  3  143 ? 63.111  89.397  54.372  1.00 84.84  ? 143  TYR C CA    1 
ATOM   7287  C  C     . TYR C  3  143 ? 64.009  88.670  55.364  1.00 84.59  ? 143  TYR C C     1 
ATOM   7288  O  O     . TYR C  3  143 ? 64.079  89.036  56.544  1.00 84.72  ? 143  TYR C O     1 
ATOM   7289  C  CB    . TYR C  3  143 ? 61.644  89.105  54.728  1.00 85.33  ? 143  TYR C CB    1 
ATOM   7290  N  N     . SER C  3  144 ? 64.685  87.638  54.871  1.00 84.54  ? 144  SER C N     1 
ATOM   7291  C  CA    . SER C  3  144 ? 65.598  86.816  55.675  1.00 84.43  ? 144  SER C CA    1 
ATOM   7292  C  C     . SER C  3  144 ? 65.895  85.570  54.869  1.00 83.78  ? 144  SER C C     1 
ATOM   7293  O  O     . SER C  3  144 ? 65.020  84.719  54.696  1.00 84.32  ? 144  SER C O     1 
ATOM   7294  C  CB    . SER C  3  144 ? 64.966  86.406  57.015  1.00 83.95  ? 144  SER C CB    1 
ATOM   7295  N  N     . SER C  3  145 ? 67.128  85.467  54.386  1.00 82.85  ? 145  SER C N     1 
ATOM   7296  C  CA    . SER C  3  145 ? 67.550  84.335  53.581  1.00 81.74  ? 145  SER C CA    1 
ATOM   7297  C  C     . SER C  3  145 ? 67.693  83.008  54.325  1.00 80.53  ? 145  SER C C     1 
ATOM   7298  O  O     . SER C  3  145 ? 67.812  81.965  53.678  1.00 80.56  ? 145  SER C O     1 
ATOM   7299  C  CB    . SER C  3  145 ? 68.864  84.646  52.884  1.00 82.62  ? 145  SER C CB    1 
ATOM   7300  O  OG    . SER C  3  145 ? 69.155  83.641  51.920  1.00 84.94  ? 145  SER C OG    1 
ATOM   7301  N  N     . PHE C  3  146 ? 67.698  83.030  55.656  1.00 79.40  ? 146  PHE C N     1 
ATOM   7302  C  CA    . PHE C  3  146 ? 67.801  81.775  56.410  1.00 79.24  ? 146  PHE C CA    1 
ATOM   7303  C  C     . PHE C  3  146 ? 66.431  81.103  56.609  1.00 79.95  ? 146  PHE C C     1 
ATOM   7304  O  O     . PHE C  3  146 ? 66.312  79.866  56.666  1.00 79.89  ? 146  PHE C O     1 
ATOM   7305  C  CB    . PHE C  3  146 ? 68.427  82.002  57.780  1.00 76.45  ? 146  PHE C CB    1 
ATOM   7306  C  CG    . PHE C  3  146 ? 68.374  80.788  58.671  1.00 73.55  ? 146  PHE C CG    1 
ATOM   7307  C  CD1   . PHE C  3  146 ? 68.892  79.567  58.237  1.00 72.74  ? 146  PHE C CD1   1 
ATOM   7308  C  CD2   . PHE C  3  146 ? 67.821  80.870  59.942  1.00 70.56  ? 146  PHE C CD2   1 
ATOM   7309  C  CE1   . PHE C  3  146 ? 68.861  78.454  59.055  1.00 71.43  ? 146  PHE C CE1   1 
ATOM   7310  C  CE2   . PHE C  3  146 ? 67.783  79.768  60.770  1.00 70.44  ? 146  PHE C CE2   1 
ATOM   7311  C  CZ    . PHE C  3  146 ? 68.303  78.556  60.331  1.00 71.12  ? 146  PHE C CZ    1 
ATOM   7312  N  N     . PHE C  3  147 ? 65.410  81.939  56.722  1.00 80.42  ? 147  PHE C N     1 
ATOM   7313  C  CA    . PHE C  3  147 ? 64.052  81.478  56.904  1.00 80.46  ? 147  PHE C CA    1 
ATOM   7314  C  C     . PHE C  3  147 ? 63.400  81.209  55.564  1.00 80.22  ? 147  PHE C C     1 
ATOM   7315  O  O     . PHE C  3  147 ? 62.523  80.351  55.455  1.00 80.58  ? 147  PHE C O     1 
ATOM   7316  C  CB    . PHE C  3  147 ? 63.284  82.522  57.711  1.00 81.12  ? 147  PHE C CB    1 
ATOM   7317  C  CG    . PHE C  3  147 ? 63.738  82.598  59.122  1.00 81.23  ? 147  PHE C CG    1 
ATOM   7318  C  CD1   . PHE C  3  147 ? 65.073  82.845  59.407  1.00 81.95  ? 147  PHE C CD1   1 
ATOM   7319  C  CD2   . PHE C  3  147 ? 62.872  82.325  60.164  1.00 81.25  ? 147  PHE C CD2   1 
ATOM   7320  C  CE1   . PHE C  3  147 ? 65.542  82.810  60.713  1.00 82.38  ? 147  PHE C CE1   1 
ATOM   7321  C  CE2   . PHE C  3  147 ? 63.325  82.286  61.481  1.00 81.82  ? 147  PHE C CE2   1 
ATOM   7322  C  CZ    . PHE C  3  147 ? 64.663  82.527  61.759  1.00 81.99  ? 147  PHE C CZ    1 
ATOM   7323  N  N     . GLY C  3  148 ? 63.832  81.945  54.547  1.00 81.12  ? 148  GLY C N     1 
ATOM   7324  C  CA    . GLY C  3  148 ? 63.304  81.740  53.209  1.00 83.15  ? 148  GLY C CA    1 
ATOM   7325  C  C     . GLY C  3  148 ? 63.667  80.328  52.788  1.00 83.75  ? 148  GLY C C     1 
ATOM   7326  O  O     . GLY C  3  148 ? 64.644  79.750  53.308  1.00 83.61  ? 148  GLY C O     1 
ATOM   7327  N  N     . TYR C  3  149 ? 62.898  79.764  51.860  1.00 83.51  ? 149  TYR C N     1 
ATOM   7328  C  CA    . TYR C  3  149 ? 63.175  78.392  51.434  1.00 83.80  ? 149  TYR C CA    1 
ATOM   7329  C  C     . TYR C  3  149 ? 62.745  78.045  50.011  1.00 82.40  ? 149  TYR C C     1 
ATOM   7330  O  O     . TYR C  3  149 ? 61.827  78.657  49.441  1.00 82.08  ? 149  TYR C O     1 
ATOM   7331  C  CB    . TYR C  3  149 ? 62.532  77.388  52.419  1.00 86.30  ? 149  TYR C CB    1 
ATOM   7332  C  CG    . TYR C  3  149 ? 61.001  77.471  52.535  1.00 87.60  ? 149  TYR C CG    1 
ATOM   7333  C  CD1   . TYR C  3  149 ? 60.170  77.074  51.468  1.00 88.12  ? 149  TYR C CD1   1 
ATOM   7334  C  CD2   . TYR C  3  149 ? 60.388  77.940  53.706  1.00 86.99  ? 149  TYR C CD2   1 
ATOM   7335  C  CE1   . TYR C  3  149 ? 58.782  77.141  51.568  1.00 87.76  ? 149  TYR C CE1   1 
ATOM   7336  C  CE2   . TYR C  3  149 ? 59.001  78.005  53.809  1.00 87.96  ? 149  TYR C CE2   1 
ATOM   7337  C  CZ    . TYR C  3  149 ? 58.208  77.600  52.734  1.00 87.56  ? 149  TYR C CZ    1 
ATOM   7338  O  OH    . TYR C  3  149 ? 56.837  77.630  52.813  1.00 87.40  ? 149  TYR C OH    1 
ATOM   7339  N  N     . ASP C  3  150 ? 63.423  77.044  49.458  1.00 81.23  ? 150  ASP C N     1 
ATOM   7340  C  CA    . ASP C  3  150 ? 63.135  76.578  48.109  1.00 79.70  ? 150  ASP C CA    1 
ATOM   7341  C  C     . ASP C  3  150 ? 62.722  75.091  48.085  1.00 78.44  ? 150  ASP C C     1 
ATOM   7342  O  O     . ASP C  3  150 ? 63.481  74.202  48.495  1.00 78.33  ? 150  ASP C O     1 
ATOM   7343  C  CB    . ASP C  3  150 ? 64.337  76.804  47.203  1.00 79.28  ? 150  ASP C CB    1 
ATOM   7344  C  CG    . ASP C  3  150 ? 64.050  76.397  45.788  1.00 80.53  ? 150  ASP C CG    1 
ATOM   7345  O  OD1   . ASP C  3  150 ? 63.786  75.191  45.580  1.00 80.96  ? 150  ASP C OD1   1 
ATOM   7346  O  OD2   . ASP C  3  150 ? 64.067  77.262  44.878  1.00 80.97  ? 150  ASP C OD2   1 
ATOM   7347  N  N     . TRP C  3  151 ? 61.508  74.833  47.612  1.00 75.65  ? 151  TRP C N     1 
ATOM   7348  C  CA    . TRP C  3  151 ? 61.023  73.471  47.568  1.00 72.61  ? 151  TRP C CA    1 
ATOM   7349  C  C     . TRP C  3  151 ? 62.067  72.560  46.931  1.00 72.18  ? 151  TRP C C     1 
ATOM   7350  O  O     . TRP C  3  151 ? 62.620  71.690  47.602  1.00 71.33  ? 151  TRP C O     1 
ATOM   7351  C  CB    . TRP C  3  151 ? 59.688  73.401  46.810  1.00 71.38  ? 151  TRP C CB    1 
ATOM   7352  C  CG    . TRP C  3  151 ? 58.533  74.048  47.534  1.00 69.81  ? 151  TRP C CG    1 
ATOM   7353  C  CD1   . TRP C  3  151 ? 57.671  74.989  47.032  1.00 69.31  ? 151  TRP C CD1   1 
ATOM   7354  C  CD2   . TRP C  3  151 ? 58.122  73.815  48.892  1.00 69.34  ? 151  TRP C CD2   1 
ATOM   7355  N  NE1   . TRP C  3  151 ? 56.753  75.361  47.993  1.00 69.52  ? 151  TRP C NE1   1 
ATOM   7356  C  CE2   . TRP C  3  151 ? 57.008  74.658  49.145  1.00 69.21  ? 151  TRP C CE2   1 
ATOM   7357  C  CE3   . TRP C  3  151 ? 58.583  72.977  49.921  1.00 68.89  ? 151  TRP C CE3   1 
ATOM   7358  C  CZ2   . TRP C  3  151 ? 56.352  74.687  50.391  1.00 67.96  ? 151  TRP C CZ2   1 
ATOM   7359  C  CZ3   . TRP C  3  151 ? 57.928  73.005  51.157  1.00 67.45  ? 151  TRP C CZ3   1 
ATOM   7360  C  CH2   . TRP C  3  151 ? 56.827  73.855  51.378  1.00 67.54  ? 151  TRP C CH2   1 
ATOM   7361  N  N     . LYS C  3  152 ? 62.352  72.776  45.651  1.00 72.13  ? 152  LYS C N     1 
ATOM   7362  C  CA    . LYS C  3  152 ? 63.323  71.959  44.920  1.00 72.05  ? 152  LYS C CA    1 
ATOM   7363  C  C     . LYS C  3  152 ? 64.727  71.990  45.538  1.00 72.47  ? 152  LYS C C     1 
ATOM   7364  O  O     . LYS C  3  152 ? 65.602  71.171  45.201  1.00 72.37  ? 152  LYS C O     1 
ATOM   7365  C  CB    . LYS C  3  152 ? 63.392  72.409  43.468  1.00 71.22  ? 152  LYS C CB    1 
ATOM   7366  C  CG    . LYS C  3  152 ? 64.403  71.655  42.625  1.00 71.27  ? 152  LYS C CG    1 
ATOM   7367  C  CD    . LYS C  3  152 ? 64.065  70.183  42.482  1.00 69.37  ? 152  LYS C CD    1 
ATOM   7368  C  CE    . LYS C  3  152 ? 64.937  69.516  41.416  1.00 68.12  ? 152  LYS C CE    1 
ATOM   7369  N  NZ    . LYS C  3  152 ? 64.644  68.057  41.248  1.00 66.94  ? 152  LYS C NZ    1 
ATOM   7370  N  N     . ASP C  3  153 ? 64.934  72.935  46.449  1.00 71.88  ? 153  ASP C N     1 
ATOM   7371  C  CA    . ASP C  3  153 ? 66.210  73.076  47.135  1.00 71.18  ? 153  ASP C CA    1 
ATOM   7372  C  C     . ASP C  3  153 ? 66.359  71.823  47.966  1.00 70.68  ? 153  ASP C C     1 
ATOM   7373  O  O     . ASP C  3  153 ? 66.082  71.836  49.162  1.00 70.48  ? 153  ASP C O     1 
ATOM   7374  C  CB    . ASP C  3  153 ? 66.154  74.292  48.037  1.00 72.36  ? 153  ASP C CB    1 
ATOM   7375  C  CG    . ASP C  3  153 ? 67.429  74.517  48.780  1.00 73.92  ? 153  ASP C CG    1 
ATOM   7376  O  OD1   . ASP C  3  153 ? 68.152  73.522  49.031  1.00 74.20  ? 153  ASP C OD1   1 
ATOM   7377  O  OD2   . ASP C  3  153 ? 67.697  75.688  49.131  1.00 74.71  ? 153  ASP C OD2   1 
ATOM   7378  N  N     . LYS C  3  154 ? 66.797  70.743  47.325  1.00 71.29  ? 154  LYS C N     1 
ATOM   7379  C  CA    . LYS C  3  154 ? 66.946  69.451  47.992  1.00 73.42  ? 154  LYS C CA    1 
ATOM   7380  C  C     . LYS C  3  154 ? 67.840  69.514  49.227  1.00 74.98  ? 154  LYS C C     1 
ATOM   7381  O  O     . LYS C  3  154 ? 68.449  68.507  49.610  1.00 77.21  ? 154  LYS C O     1 
ATOM   7382  C  CB    . LYS C  3  154 ? 67.500  68.396  47.020  1.00 72.82  ? 154  LYS C CB    1 
ATOM   7383  C  CG    . LYS C  3  154 ? 66.847  68.412  45.644  1.00 74.88  ? 154  LYS C CG    1 
ATOM   7384  C  CD    . LYS C  3  154 ? 67.401  67.324  44.733  1.00 76.28  ? 154  LYS C CD    1 
ATOM   7385  C  CE    . LYS C  3  154 ? 66.821  67.454  43.306  1.00 78.56  ? 154  LYS C CE    1 
ATOM   7386  N  NZ    . LYS C  3  154 ? 67.372  66.506  42.241  1.00 80.58  ? 154  LYS C NZ    1 
ATOM   7387  N  N     . ASN C  3  155 ? 67.901  70.668  49.881  1.00 74.69  ? 155  ASN C N     1 
ATOM   7388  C  CA    . ASN C  3  155 ? 68.770  70.778  51.027  1.00 73.98  ? 155  ASN C CA    1 
ATOM   7389  C  C     . ASN C  3  155 ? 68.241  71.655  52.131  1.00 73.41  ? 155  ASN C C     1 
ATOM   7390  O  O     . ASN C  3  155 ? 68.309  71.274  53.299  1.00 73.80  ? 155  ASN C O     1 
ATOM   7391  C  CB    . ASN C  3  155 ? 70.124  71.287  50.574  1.00 75.37  ? 155  ASN C CB    1 
ATOM   7392  C  CG    . ASN C  3  155 ? 71.149  71.245  51.667  1.00 77.10  ? 155  ASN C CG    1 
ATOM   7393  O  OD1   . ASN C  3  155 ? 72.267  71.727  51.484  1.00 78.59  ? 155  ASN C OD1   1 
ATOM   7394  N  ND2   . ASN C  3  155 ? 70.786  70.666  52.816  1.00 77.34  ? 155  ASN C ND2   1 
ATOM   7395  N  N     . LYS C  3  156 ? 67.740  72.835  51.790  1.00 72.51  ? 156  LYS C N     1 
ATOM   7396  C  CA    . LYS C  3  156 ? 67.198  73.706  52.822  1.00 72.04  ? 156  LYS C CA    1 
ATOM   7397  C  C     . LYS C  3  156 ? 66.072  72.917  53.497  1.00 72.38  ? 156  LYS C C     1 
ATOM   7398  O  O     . LYS C  3  156 ? 65.690  73.193  54.640  1.00 71.59  ? 156  LYS C O     1 
ATOM   7399  C  CB    . LYS C  3  156 ? 66.658  74.999  52.214  1.00 71.36  ? 156  LYS C CB    1 
ATOM   7400  N  N     . MET C  3  157 ? 65.557  71.921  52.775  1.00 73.01  ? 157  MET C N     1 
ATOM   7401  C  CA    . MET C  3  157 ? 64.501  71.062  53.303  1.00 72.84  ? 157  MET C CA    1 
ATOM   7402  C  C     . MET C  3  157 ? 65.150  70.113  54.314  1.00 72.83  ? 157  MET C C     1 
ATOM   7403  O  O     . MET C  3  157 ? 64.723  70.035  55.461  1.00 73.40  ? 157  MET C O     1 
ATOM   7404  C  CB    . MET C  3  157 ? 63.844  70.266  52.182  1.00 72.87  ? 157  MET C CB    1 
ATOM   7405  C  CG    . MET C  3  157 ? 63.326  71.107  51.022  1.00 74.24  ? 157  MET C CG    1 
ATOM   7406  S  SD    . MET C  3  157 ? 62.306  72.522  51.509  1.00 74.37  ? 157  MET C SD    1 
ATOM   7407  C  CE    . MET C  3  157 ? 60.801  71.685  51.971  1.00 74.60  ? 157  MET C CE    1 
ATOM   7408  N  N     . THR C  3  158 ? 66.185  69.403  53.890  1.00 72.43  ? 158  THR C N     1 
ATOM   7409  C  CA    . THR C  3  158 ? 66.882  68.492  54.782  1.00 72.34  ? 158  THR C CA    1 
ATOM   7410  C  C     . THR C  3  158 ? 67.312  69.227  56.059  1.00 72.38  ? 158  THR C C     1 
ATOM   7411  O  O     . THR C  3  158 ? 67.553  68.625  57.107  1.00 71.59  ? 158  THR C O     1 
ATOM   7412  C  CB    . THR C  3  158 ? 68.124  67.916  54.079  1.00 72.77  ? 158  THR C CB    1 
ATOM   7413  O  OG1   . THR C  3  158 ? 67.714  67.287  52.859  1.00 73.39  ? 158  THR C OG1   1 
ATOM   7414  C  CG2   . THR C  3  158 ? 68.855  66.904  54.978  1.00 73.56  ? 158  THR C CG2   1 
ATOM   7415  N  N     . THR C  3  159 ? 67.392  70.540  55.973  1.00 72.83  ? 159  THR C N     1 
ATOM   7416  C  CA    . THR C  3  159 ? 67.805  71.339  57.125  1.00 73.51  ? 159  THR C CA    1 
ATOM   7417  C  C     . THR C  3  159 ? 66.648  71.553  58.095  1.00 72.08  ? 159  THR C C     1 
ATOM   7418  O  O     . THR C  3  159 ? 66.737  71.231  59.292  1.00 70.22  ? 159  THR C O     1 
ATOM   7419  C  CB    . THR C  3  159 ? 68.280  72.718  56.684  1.00 75.52  ? 159  THR C CB    1 
ATOM   7420  O  OG1   . THR C  3  159 ? 69.142  72.587  55.546  1.00 77.22  ? 159  THR C OG1   1 
ATOM   7421  C  CG2   . THR C  3  159 ? 69.011  73.405  57.830  1.00 76.43  ? 159  THR C CG2   1 
ATOM   7422  N  N     . ILE C  3  160 ? 65.581  72.144  57.552  1.00 71.65  ? 160  ILE C N     1 
ATOM   7423  C  CA    . ILE C  3  160 ? 64.357  72.443  58.291  1.00 71.28  ? 160  ILE C CA    1 
ATOM   7424  C  C     . ILE C  3  160 ? 63.869  71.163  58.961  1.00 71.09  ? 160  ILE C C     1 
ATOM   7425  O  O     . ILE C  3  160 ? 63.500  71.171  60.136  1.00 70.83  ? 160  ILE C O     1 
ATOM   7426  C  CB    . ILE C  3  160 ? 63.277  72.977  57.334  1.00 70.89  ? 160  ILE C CB    1 
ATOM   7427  C  CG1   . ILE C  3  160 ? 63.801  74.204  56.594  1.00 69.50  ? 160  ILE C CG1   1 
ATOM   7428  C  CG2   . ILE C  3  160 ? 62.039  73.341  58.103  1.00 70.73  ? 160  ILE C CG2   1 
ATOM   7429  C  CD1   . ILE C  3  160 ? 62.884  74.696  55.514  1.00 68.21  ? 160  ILE C CD1   1 
ATOM   7430  N  N     . LEU C  3  161 ? 63.871  70.078  58.188  1.00 71.01  ? 161  LEU C N     1 
ATOM   7431  C  CA    . LEU C  3  161 ? 63.490  68.757  58.663  1.00 71.97  ? 161  LEU C CA    1 
ATOM   7432  C  C     . LEU C  3  161 ? 64.364  68.492  59.901  1.00 72.85  ? 161  LEU C C     1 
ATOM   7433  O  O     . LEU C  3  161 ? 63.852  68.250  61.009  1.00 72.70  ? 161  LEU C O     1 
ATOM   7434  C  CB    . LEU C  3  161 ? 63.783  67.706  57.575  1.00 71.35  ? 161  LEU C CB    1 
ATOM   7435  C  CG    . LEU C  3  161 ? 63.586  66.225  57.927  1.00 70.92  ? 161  LEU C CG    1 
ATOM   7436  C  CD1   . LEU C  3  161 ? 62.112  66.021  58.245  1.00 71.19  ? 161  LEU C CD1   1 
ATOM   7437  C  CD2   . LEU C  3  161 ? 64.034  65.302  56.785  1.00 69.05  ? 161  LEU C CD2   1 
ATOM   7438  N  N     . GLY C  3  162 ? 65.683  68.563  59.697  1.00 73.25  ? 162  GLY C N     1 
ATOM   7439  C  CA    . GLY C  3  162 ? 66.636  68.356  60.773  1.00 73.07  ? 162  GLY C CA    1 
ATOM   7440  C  C     . GLY C  3  162 ? 66.262  69.035  62.082  1.00 73.07  ? 162  GLY C C     1 
ATOM   7441  O  O     . GLY C  3  162 ? 66.253  68.378  63.125  1.00 73.41  ? 162  GLY C O     1 
ATOM   7442  N  N     . PHE C  3  163 ? 65.956  70.335  62.039  1.00 72.60  ? 163  PHE C N     1 
ATOM   7443  C  CA    . PHE C  3  163 ? 65.586  71.088  63.246  1.00 71.72  ? 163  PHE C CA    1 
ATOM   7444  C  C     . PHE C  3  163 ? 64.450  70.388  63.952  1.00 71.09  ? 163  PHE C C     1 
ATOM   7445  O  O     . PHE C  3  163 ? 64.559  69.952  65.112  1.00 70.29  ? 163  PHE C O     1 
ATOM   7446  C  CB    . PHE C  3  163 ? 65.115  72.501  62.896  1.00 72.60  ? 163  PHE C CB    1 
ATOM   7447  C  CG    . PHE C  3  163 ? 66.150  73.333  62.207  1.00 74.60  ? 163  PHE C CG    1 
ATOM   7448  C  CD1   . PHE C  3  163 ? 67.468  73.373  62.679  1.00 75.29  ? 163  PHE C CD1   1 
ATOM   7449  C  CD2   . PHE C  3  163 ? 65.812  74.078  61.082  1.00 75.21  ? 163  PHE C CD2   1 
ATOM   7450  C  CE1   . PHE C  3  163 ? 68.435  74.141  62.033  1.00 76.21  ? 163  PHE C CE1   1 
ATOM   7451  C  CE2   . PHE C  3  163 ? 66.760  74.848  60.428  1.00 75.85  ? 163  PHE C CE2   1 
ATOM   7452  C  CZ    . PHE C  3  163 ? 68.079  74.881  60.901  1.00 76.78  ? 163  PHE C CZ    1 
ATOM   7453  N  N     . HIS C  3  164 ? 63.345  70.307  63.219  1.00 69.86  ? 164  HIS C N     1 
ATOM   7454  C  CA    . HIS C  3  164 ? 62.118  69.670  63.672  1.00 68.78  ? 164  HIS C CA    1 
ATOM   7455  C  C     . HIS C  3  164 ? 62.414  68.273  64.232  1.00 69.68  ? 164  HIS C C     1 
ATOM   7456  O  O     . HIS C  3  164 ? 61.933  67.920  65.313  1.00 70.17  ? 164  HIS C O     1 
ATOM   7457  C  CB    . HIS C  3  164 ? 61.155  69.660  62.490  1.00 67.31  ? 164  HIS C CB    1 
ATOM   7458  C  CG    . HIS C  3  164 ? 60.808  71.041  62.014  1.00 66.04  ? 164  HIS C CG    1 
ATOM   7459  N  ND1   . HIS C  3  164 ? 60.377  71.312  60.733  1.00 65.06  ? 164  HIS C ND1   1 
ATOM   7460  C  CD2   . HIS C  3  164 ? 60.800  72.230  62.669  1.00 65.98  ? 164  HIS C CD2   1 
ATOM   7461  C  CE1   . HIS C  3  164 ? 60.115  72.603  60.623  1.00 64.87  ? 164  HIS C CE1   1 
ATOM   7462  N  NE2   . HIS C  3  164 ? 60.362  73.183  61.784  1.00 63.81  ? 164  HIS C NE2   1 
ATOM   7463  N  N     . LEU C  3  165 ? 63.230  67.500  63.517  1.00 69.37  ? 165  LEU C N     1 
ATOM   7464  C  CA    . LEU C  3  165 ? 63.621  66.174  63.975  1.00 69.57  ? 165  LEU C CA    1 
ATOM   7465  C  C     . LEU C  3  165 ? 64.257  66.250  65.380  1.00 71.05  ? 165  LEU C C     1 
ATOM   7466  O  O     . LEU C  3  165 ? 64.195  65.291  66.167  1.00 70.66  ? 165  LEU C O     1 
ATOM   7467  C  CB    . LEU C  3  165 ? 64.602  65.552  62.975  1.00 68.37  ? 165  LEU C CB    1 
ATOM   7468  C  CG    . LEU C  3  165 ? 64.072  64.360  62.152  1.00 69.33  ? 165  LEU C CG    1 
ATOM   7469  C  CD1   . LEU C  3  165 ? 64.809  64.254  60.828  1.00 67.72  ? 165  LEU C CD1   1 
ATOM   7470  C  CD2   . LEU C  3  165 ? 64.212  63.069  62.960  1.00 68.72  ? 165  LEU C CD2   1 
ATOM   7471  N  N     . ILE C  3  166 ? 64.858  67.398  65.691  1.00 73.13  ? 166  ILE C N     1 
ATOM   7472  C  CA    . ILE C  3  166 ? 65.499  67.614  66.991  1.00 74.09  ? 166  ILE C CA    1 
ATOM   7473  C  C     . ILE C  3  166 ? 64.414  68.073  67.952  1.00 75.35  ? 166  ILE C C     1 
ATOM   7474  O  O     . ILE C  3  166 ? 64.378  67.647  69.117  1.00 76.28  ? 166  ILE C O     1 
ATOM   7475  C  CB    . ILE C  3  166 ? 66.592  68.723  66.931  1.00 74.35  ? 166  ILE C CB    1 
ATOM   7476  C  CG1   . ILE C  3  166 ? 67.606  68.404  65.826  1.00 74.36  ? 166  ILE C CG1   1 
ATOM   7477  C  CG2   . ILE C  3  166 ? 67.296  68.835  68.293  1.00 72.88  ? 166  ILE C CG2   1 
ATOM   7478  C  CD1   . ILE C  3  166 ? 68.485  69.566  65.445  1.00 74.06  ? 166  ILE C CD1   1 
ATOM   7479  N  N     . VAL C  3  167 ? 63.532  68.949  67.465  1.00 75.41  ? 167  VAL C N     1 
ATOM   7480  C  CA    . VAL C  3  167 ? 62.437  69.457  68.292  1.00 74.79  ? 167  VAL C CA    1 
ATOM   7481  C  C     . VAL C  3  167 ? 61.604  68.300  68.837  1.00 75.32  ? 167  VAL C C     1 
ATOM   7482  O  O     . VAL C  3  167 ? 61.280  68.294  70.025  1.00 75.65  ? 167  VAL C O     1 
ATOM   7483  C  CB    . VAL C  3  167 ? 61.525  70.408  67.505  1.00 74.62  ? 167  VAL C CB    1 
ATOM   7484  C  CG1   . VAL C  3  167 ? 60.245  70.680  68.293  1.00 72.62  ? 167  VAL C CG1   1 
ATOM   7485  C  CG2   . VAL C  3  167 ? 62.269  71.709  67.215  1.00 73.10  ? 167  VAL C CG2   1 
ATOM   7486  N  N     . LEU C  3  168 ? 61.258  67.340  67.975  1.00 74.89  ? 168  LEU C N     1 
ATOM   7487  C  CA    . LEU C  3  168 ? 60.506  66.164  68.410  1.00 75.19  ? 168  LEU C CA    1 
ATOM   7488  C  C     . LEU C  3  168 ? 61.300  65.420  69.491  1.00 75.15  ? 168  LEU C C     1 
ATOM   7489  O  O     . LEU C  3  168 ? 60.745  65.029  70.527  1.00 76.30  ? 168  LEU C O     1 
ATOM   7490  C  CB    . LEU C  3  168 ? 60.280  65.212  67.251  1.00 75.09  ? 168  LEU C CB    1 
ATOM   7491  C  CG    . LEU C  3  168 ? 59.262  65.577  66.170  1.00 76.73  ? 168  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C  3  168 ? 59.617  64.836  64.877  1.00 74.94  ? 168  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C  3  168 ? 57.839  65.244  66.650  1.00 76.83  ? 168  LEU C CD2   1 
ATOM   7494  N  N     . GLY C  3  169 ? 62.597  65.218  69.238  1.00 74.80  ? 169  GLY C N     1 
ATOM   7495  C  CA    . GLY C  3  169 ? 63.468  64.533  70.194  1.00 73.51  ? 169  GLY C CA    1 
ATOM   7496  C  C     . GLY C  3  169 ? 63.419  65.146  71.587  1.00 72.21  ? 169  GLY C C     1 
ATOM   7497  O  O     . GLY C  3  169 ? 63.318  64.440  72.586  1.00 71.53  ? 169  GLY C O     1 
ATOM   7498  N  N     . ILE C  3  170 ? 63.506  66.462  71.660  1.00 70.99  ? 170  ILE C N     1 
ATOM   7499  C  CA    . ILE C  3  170 ? 63.436  67.128  72.953  1.00 71.17  ? 170  ILE C CA    1 
ATOM   7500  C  C     . ILE C  3  170 ? 62.100  66.764  73.610  1.00 70.28  ? 170  ILE C C     1 
ATOM   7501  O  O     . ILE C  3  170 ? 62.029  66.504  74.815  1.00 69.35  ? 170  ILE C O     1 
ATOM   7502  C  CB    . ILE C  3  170 ? 63.511  68.682  72.796  1.00 72.45  ? 170  ILE C CB    1 
ATOM   7503  C  CG1   . ILE C  3  170 ? 64.928  69.118  72.374  1.00 73.45  ? 170  ILE C CG1   1 
ATOM   7504  C  CG2   . ILE C  3  170 ? 63.107  69.362  74.093  1.00 72.27  ? 170  ILE C CG2   1 
ATOM   7505  C  CD1   . ILE C  3  170 ? 66.041  68.662  73.326  1.00 75.20  ? 170  ILE C CD1   1 
ATOM   7506  N  N     . GLY C  3  171 ? 61.045  66.750  72.795  1.00 70.48  ? 171  GLY C N     1 
ATOM   7507  C  CA    . GLY C  3  171 ? 59.705  66.419  73.272  1.00 69.13  ? 171  GLY C CA    1 
ATOM   7508  C  C     . GLY C  3  171 ? 59.607  65.015  73.846  1.00 68.71  ? 171  GLY C C     1 
ATOM   7509  O  O     . GLY C  3  171 ? 59.025  64.797  74.916  1.00 69.31  ? 171  GLY C O     1 
ATOM   7510  N  N     . ALA C  3  172 ? 60.173  64.058  73.129  1.00 66.70  ? 172  ALA C N     1 
ATOM   7511  C  CA    . ALA C  3  172 ? 60.152  62.689  73.592  1.00 65.18  ? 172  ALA C CA    1 
ATOM   7512  C  C     . ALA C  3  172 ? 60.835  62.617  74.941  1.00 64.84  ? 172  ALA C C     1 
ATOM   7513  O  O     . ALA C  3  172 ? 60.302  62.056  75.893  1.00 64.83  ? 172  ALA C O     1 
ATOM   7514  C  CB    . ALA C  3  172 ? 60.869  61.798  72.600  1.00 64.84  ? 172  ALA C CB    1 
ATOM   7515  N  N     . LEU C  3  173 ? 62.017  63.203  75.017  1.00 64.87  ? 173  LEU C N     1 
ATOM   7516  C  CA    . LEU C  3  173 ? 62.783  63.183  76.243  1.00 65.45  ? 173  LEU C CA    1 
ATOM   7517  C  C     . LEU C  3  173 ? 62.047  63.835  77.410  1.00 65.69  ? 173  LEU C C     1 
ATOM   7518  O  O     . LEU C  3  173 ? 62.310  63.513  78.580  1.00 64.83  ? 173  LEU C O     1 
ATOM   7519  C  CB    . LEU C  3  173 ? 64.142  63.832  75.992  1.00 65.29  ? 173  LEU C CB    1 
ATOM   7520  C  CG    . LEU C  3  173 ? 64.945  62.947  75.043  1.00 64.50  ? 173  LEU C CG    1 
ATOM   7521  C  CD1   . LEU C  3  173 ? 66.287  63.576  74.760  1.00 64.01  ? 173  LEU C CD1   1 
ATOM   7522  C  CD2   . LEU C  3  173 ? 65.102  61.548  75.650  1.00 63.72  ? 173  LEU C CD2   1 
ATOM   7523  N  N     . LEU C  3  174 ? 61.113  64.732  77.086  1.00 65.68  ? 174  LEU C N     1 
ATOM   7524  C  CA    . LEU C  3  174 ? 60.329  65.402  78.118  1.00 66.21  ? 174  LEU C CA    1 
ATOM   7525  C  C     . LEU C  3  174 ? 59.526  64.359  78.872  1.00 66.57  ? 174  LEU C C     1 
ATOM   7526  O  O     . LEU C  3  174 ? 59.402  64.416  80.099  1.00 66.54  ? 174  LEU C O     1 
ATOM   7527  C  CB    . LEU C  3  174 ? 59.377  66.443  77.516  1.00 65.60  ? 174  LEU C CB    1 
ATOM   7528  C  CG    . LEU C  3  174 ? 59.956  67.770  76.972  1.00 65.80  ? 174  LEU C CG    1 
ATOM   7529  C  CD1   . LEU C  3  174 ? 58.802  68.663  76.474  1.00 63.49  ? 174  LEU C CD1   1 
ATOM   7530  C  CD2   . LEU C  3  174 ? 60.778  68.488  78.058  1.00 64.09  ? 174  LEU C CD2   1 
ATOM   7531  N  N     . LEU C  3  175 ? 58.984  63.401  78.132  1.00 67.12  ? 175  LEU C N     1 
ATOM   7532  C  CA    . LEU C  3  175 ? 58.210  62.327  78.747  1.00 67.47  ? 175  LEU C CA    1 
ATOM   7533  C  C     . LEU C  3  175 ? 59.105  61.590  79.754  1.00 68.70  ? 175  LEU C C     1 
ATOM   7534  O  O     . LEU C  3  175 ? 58.755  61.444  80.932  1.00 69.35  ? 175  LEU C O     1 
ATOM   7535  C  CB    . LEU C  3  175 ? 57.704  61.354  77.674  1.00 66.15  ? 175  LEU C CB    1 
ATOM   7536  C  CG    . LEU C  3  175 ? 56.890  60.158  78.159  1.00 64.92  ? 175  LEU C CG    1 
ATOM   7537  C  CD1   . LEU C  3  175 ? 55.514  60.585  78.621  1.00 63.78  ? 175  LEU C CD1   1 
ATOM   7538  C  CD2   . LEU C  3  175 ? 56.781  59.172  77.033  1.00 65.91  ? 175  LEU C CD2   1 
ATOM   7539  N  N     . VAL C  3  176 ? 60.267  61.147  79.290  1.00 69.39  ? 176  VAL C N     1 
ATOM   7540  C  CA    . VAL C  3  176 ? 61.189  60.434  80.156  1.00 70.29  ? 176  VAL C CA    1 
ATOM   7541  C  C     . VAL C  3  176 ? 61.413  61.224  81.433  1.00 71.30  ? 176  VAL C C     1 
ATOM   7542  O  O     . VAL C  3  176 ? 61.569  60.648  82.517  1.00 72.86  ? 176  VAL C O     1 
ATOM   7543  C  CB    . VAL C  3  176 ? 62.526  60.212  79.469  1.00 69.96  ? 176  VAL C CB    1 
ATOM   7544  C  CG1   . VAL C  3  176 ? 63.404  59.325  80.321  1.00 70.14  ? 176  VAL C CG1   1 
ATOM   7545  C  CG2   . VAL C  3  176 ? 62.296  59.577  78.130  1.00 71.44  ? 176  VAL C CG2   1 
ATOM   7546  N  N     . ALA C  3  177 ? 61.420  62.543  81.304  1.00 71.23  ? 177  ALA C N     1 
ATOM   7547  C  CA    . ALA C  3  177 ? 61.617  63.407  82.454  1.00 71.47  ? 177  ALA C CA    1 
ATOM   7548  C  C     . ALA C  3  177 ? 60.448  63.286  83.426  1.00 71.94  ? 177  ALA C C     1 
ATOM   7549  O  O     . ALA C  3  177 ? 60.632  63.027  84.630  1.00 71.91  ? 177  ALA C O     1 
ATOM   7550  C  CB    . ALA C  3  177 ? 61.750  64.835  81.995  1.00 71.65  ? 177  ALA C CB    1 
ATOM   7551  N  N     . LYS C  3  178 ? 59.241  63.473  82.896  1.00 72.20  ? 178  LYS C N     1 
ATOM   7552  C  CA    . LYS C  3  178 ? 58.038  63.410  83.723  1.00 71.44  ? 178  LYS C CA    1 
ATOM   7553  C  C     . LYS C  3  178 ? 57.940  62.073  84.438  1.00 71.45  ? 178  LYS C C     1 
ATOM   7554  O  O     . LYS C  3  178 ? 57.328  61.982  85.500  1.00 71.47  ? 178  LYS C O     1 
ATOM   7555  C  CB    . LYS C  3  178 ? 56.792  63.650  82.867  1.00 70.03  ? 178  LYS C CB    1 
ATOM   7556  C  CG    . LYS C  3  178 ? 55.494  63.590  83.653  1.00 69.73  ? 178  LYS C CG    1 
ATOM   7557  C  CD    . LYS C  3  178 ? 55.414  64.671  84.724  1.00 68.88  ? 178  LYS C CD    1 
ATOM   7558  C  CE    . LYS C  3  178 ? 54.085  64.639  85.510  1.00 69.43  ? 178  LYS C CE    1 
ATOM   7559  N  NZ    . LYS C  3  178 ? 53.862  63.430  86.366  1.00 68.83  ? 178  LYS C NZ    1 
ATOM   7560  N  N     . ALA C  3  179 ? 58.565  61.047  83.862  1.00 70.94  ? 179  ALA C N     1 
ATOM   7561  C  CA    . ALA C  3  179 ? 58.538  59.714  84.441  1.00 70.70  ? 179  ALA C CA    1 
ATOM   7562  C  C     . ALA C  3  179 ? 59.682  59.444  85.430  1.00 70.34  ? 179  ALA C C     1 
ATOM   7563  O  O     . ALA C  3  179 ? 59.443  59.126  86.599  1.00 70.30  ? 179  ALA C O     1 
ATOM   7564  C  CB    . ALA C  3  179 ? 58.553  58.672  83.329  1.00 71.22  ? 179  ALA C CB    1 
ATOM   7565  N  N     . MET C  3  180 ? 60.915  59.571  84.949  1.00 70.03  ? 180  MET C N     1 
ATOM   7566  C  CA    . MET C  3  180 ? 62.096  59.315  85.766  1.00 69.61  ? 180  MET C CA    1 
ATOM   7567  C  C     . MET C  3  180 ? 62.466  60.401  86.767  1.00 69.26  ? 180  MET C C     1 
ATOM   7568  O  O     . MET C  3  180 ? 63.245  60.133  87.689  1.00 68.80  ? 180  MET C O     1 
ATOM   7569  C  CB    . MET C  3  180 ? 63.309  59.073  84.884  1.00 70.03  ? 180  MET C CB    1 
ATOM   7570  C  CG    . MET C  3  180 ? 63.103  58.036  83.843  1.00 71.38  ? 180  MET C CG    1 
ATOM   7571  S  SD    . MET C  3  180 ? 64.593  57.877  82.894  1.00 73.35  ? 180  MET C SD    1 
ATOM   7572  C  CE    . MET C  3  180 ? 65.568  56.864  84.068  1.00 72.61  ? 180  MET C CE    1 
ATOM   7573  N  N     . PHE C  3  181 ? 61.922  61.609  86.598  1.00 68.79  ? 181  PHE C N     1 
ATOM   7574  C  CA    . PHE C  3  181 ? 62.251  62.713  87.497  1.00 68.42  ? 181  PHE C CA    1 
ATOM   7575  C  C     . PHE C  3  181 ? 61.110  63.525  88.134  1.00 70.28  ? 181  PHE C C     1 
ATOM   7576  O  O     . PHE C  3  181 ? 61.149  63.855  89.331  1.00 70.31  ? 181  PHE C O     1 
ATOM   7577  C  CB    . PHE C  3  181 ? 63.214  63.644  86.770  1.00 64.99  ? 181  PHE C CB    1 
ATOM   7578  C  CG    . PHE C  3  181 ? 64.384  62.921  86.190  1.00 63.06  ? 181  PHE C CG    1 
ATOM   7579  C  CD1   . PHE C  3  181 ? 65.173  62.091  86.998  1.00 62.09  ? 181  PHE C CD1   1 
ATOM   7580  C  CD2   . PHE C  3  181 ? 64.670  63.000  84.840  1.00 62.07  ? 181  PHE C CD2   1 
ATOM   7581  C  CE1   . PHE C  3  181 ? 66.226  61.345  86.467  1.00 60.60  ? 181  PHE C CE1   1 
ATOM   7582  C  CE2   . PHE C  3  181 ? 65.726  62.255  84.295  1.00 61.59  ? 181  PHE C CE2   1 
ATOM   7583  C  CZ    . PHE C  3  181 ? 66.504  61.425  85.112  1.00 60.59  ? 181  PHE C CZ    1 
ATOM   7584  N  N     . PHE C  3  182 ? 60.085  63.826  87.360  1.00 72.40  ? 182  PHE C N     1 
ATOM   7585  C  CA    . PHE C  3  182 ? 59.004  64.631  87.893  1.00 74.20  ? 182  PHE C CA    1 
ATOM   7586  C  C     . PHE C  3  182 ? 57.705  63.891  88.095  1.00 74.89  ? 182  PHE C C     1 
ATOM   7587  O  O     . PHE C  3  182 ? 56.890  63.815  87.176  1.00 76.50  ? 182  PHE C O     1 
ATOM   7588  C  CB    . PHE C  3  182 ? 58.790  65.820  86.972  1.00 75.18  ? 182  PHE C CB    1 
ATOM   7589  C  CG    . PHE C  3  182 ? 60.038  66.604  86.732  1.00 76.83  ? 182  PHE C CG    1 
ATOM   7590  C  CD1   . PHE C  3  182 ? 60.267  67.794  87.414  1.00 77.71  ? 182  PHE C CD1   1 
ATOM   7591  C  CD2   . PHE C  3  182 ? 61.015  66.131  85.858  1.00 77.95  ? 182  PHE C CD2   1 
ATOM   7592  C  CE1   . PHE C  3  182 ? 61.457  68.510  87.230  1.00 78.42  ? 182  PHE C CE1   1 
ATOM   7593  C  CE2   . PHE C  3  182 ? 62.206  66.833  85.666  1.00 78.01  ? 182  PHE C CE2   1 
ATOM   7594  C  CZ    . PHE C  3  182 ? 62.429  68.028  86.355  1.00 77.77  ? 182  PHE C CZ    1 
ATOM   7595  N  N     . GLY C  3  183 ? 57.521  63.337  89.293  1.00 74.20  ? 183  GLY C N     1 
ATOM   7596  C  CA    . GLY C  3  183 ? 56.287  62.636  89.637  1.00 73.17  ? 183  GLY C CA    1 
ATOM   7597  C  C     . GLY C  3  183 ? 55.990  61.246  89.095  1.00 71.69  ? 183  GLY C C     1 
ATOM   7598  O  O     . GLY C  3  183 ? 55.123  60.567  89.629  1.00 71.14  ? 183  GLY C O     1 
ATOM   7599  N  N     . GLY C  3  184 ? 56.695  60.807  88.065  1.00 70.77  ? 184  GLY C N     1 
ATOM   7600  C  CA    . GLY C  3  184 ? 56.402  59.500  87.504  1.00 70.04  ? 184  GLY C CA    1 
ATOM   7601  C  C     . GLY C  3  184 ? 55.162  59.521  86.609  1.00 69.60  ? 184  GLY C C     1 
ATOM   7602  O  O     . GLY C  3  184 ? 54.763  60.570  86.088  1.00 70.61  ? 184  GLY C O     1 
ATOM   7603  N  N     . LEU C  3  185 ? 54.561  58.352  86.411  1.00 68.08  ? 185  LEU C N     1 
ATOM   7604  C  CA    . LEU C  3  185 ? 53.349  58.213  85.583  1.00 65.61  ? 185  LEU C CA    1 
ATOM   7605  C  C     . LEU C  3  185 ? 52.340  57.283  86.277  1.00 65.43  ? 185  LEU C C     1 
ATOM   7606  O  O     . LEU C  3  185 ? 52.574  56.803  87.403  1.00 65.01  ? 185  LEU C O     1 
ATOM   7607  C  CB    . LEU C  3  185 ? 53.695  57.613  84.230  1.00 63.85  ? 185  LEU C CB    1 
ATOM   7608  C  CG    . LEU C  3  185 ? 54.768  58.339  83.444  1.00 62.64  ? 185  LEU C CG    1 
ATOM   7609  C  CD1   . LEU C  3  185 ? 55.271  57.471  82.293  1.00 59.79  ? 185  LEU C CD1   1 
ATOM   7610  C  CD2   . LEU C  3  185 ? 54.177  59.643  82.978  1.00 62.52  ? 185  LEU C CD2   1 
ATOM   7611  N  N     . TYR C  3  186 ? 51.213  57.040  85.627  1.00 64.02  ? 186  TYR C N     1 
ATOM   7612  C  CA    . TYR C  3  186 ? 50.252  56.142  86.233  1.00 62.24  ? 186  TYR C CA    1 
ATOM   7613  C  C     . TYR C  3  186 ? 50.733  54.741  85.894  1.00 62.69  ? 186  TYR C C     1 
ATOM   7614  O  O     . TYR C  3  186 ? 51.421  54.538  84.899  1.00 63.44  ? 186  TYR C O     1 
ATOM   7615  C  CB    . TYR C  3  186 ? 48.846  56.346  85.676  1.00 59.79  ? 186  TYR C CB    1 
ATOM   7616  C  CG    . TYR C  3  186 ? 47.836  55.569  86.477  1.00 59.41  ? 186  TYR C CG    1 
ATOM   7617  C  CD1   . TYR C  3  186 ? 47.325  56.073  87.671  1.00 59.08  ? 186  TYR C CD1   1 
ATOM   7618  C  CD2   . TYR C  3  186 ? 47.462  54.275  86.099  1.00 59.32  ? 186  TYR C CD2   1 
ATOM   7619  C  CE1   . TYR C  3  186 ? 46.478  55.315  88.466  1.00 58.22  ? 186  TYR C CE1   1 
ATOM   7620  C  CE2   . TYR C  3  186 ? 46.612  53.508  86.893  1.00 57.67  ? 186  TYR C CE2   1 
ATOM   7621  C  CZ    . TYR C  3  186 ? 46.132  54.043  88.072  1.00 57.72  ? 186  TYR C CZ    1 
ATOM   7622  O  OH    . TYR C  3  186 ? 45.321  53.303  88.871  1.00 58.46  ? 186  TYR C OH    1 
ATOM   7623  N  N     . ASP C  3  187 ? 50.384  53.775  86.722  1.00 62.89  ? 187  ASP C N     1 
ATOM   7624  C  CA    . ASP C  3  187 ? 50.788  52.414  86.471  1.00 63.05  ? 187  ASP C CA    1 
ATOM   7625  C  C     . ASP C  3  187 ? 49.657  51.503  86.882  1.00 63.74  ? 187  ASP C C     1 
ATOM   7626  O  O     . ASP C  3  187 ? 49.453  51.274  88.075  1.00 64.03  ? 187  ASP C O     1 
ATOM   7627  C  CB    . ASP C  3  187 ? 52.007  52.085  87.293  1.00 64.25  ? 187  ASP C CB    1 
ATOM   7628  C  CG    . ASP C  3  187 ? 52.590  50.772  86.921  1.00 66.91  ? 187  ASP C CG    1 
ATOM   7629  O  OD1   . ASP C  3  187 ? 51.821  49.878  86.501  1.00 67.02  ? 187  ASP C OD1   1 
ATOM   7630  O  OD2   . ASP C  3  187 ? 53.816  50.628  87.051  1.00 68.90  ? 187  ASP C OD2   1 
ATOM   7631  N  N     . THR C  3  188 ? 48.915  50.987  85.908  1.00 63.46  ? 188  THR C N     1 
ATOM   7632  C  CA    . THR C  3  188 ? 47.807  50.090  86.210  1.00 62.47  ? 188  THR C CA    1 
ATOM   7633  C  C     . THR C  3  188 ? 48.410  48.839  86.801  1.00 62.60  ? 188  THR C C     1 
ATOM   7634  O  O     . THR C  3  188 ? 47.879  48.266  87.756  1.00 62.94  ? 188  THR C O     1 
ATOM   7635  C  CB    . THR C  3  188 ? 47.058  49.687  84.963  1.00 62.41  ? 188  THR C CB    1 
ATOM   7636  O  OG1   . THR C  3  188 ? 46.921  50.825  84.114  1.00 64.21  ? 188  THR C OG1   1 
ATOM   7637  C  CG2   . THR C  3  188 ? 45.679  49.184  85.326  1.00 64.22  ? 188  THR C CG2   1 
ATOM   7638  N  N     . TRP C  3  189 ? 49.534  48.434  86.217  1.00 61.72  ? 189  TRP C N     1 
ATOM   7639  C  CA    . TRP C  3  189 ? 50.261  47.251  86.644  1.00 61.58  ? 189  TRP C CA    1 
ATOM   7640  C  C     . TRP C  3  189 ? 50.987  47.432  87.975  1.00 63.57  ? 189  TRP C C     1 
ATOM   7641  O  O     . TRP C  3  189 ? 51.696  46.530  88.441  1.00 64.51  ? 189  TRP C O     1 
ATOM   7642  C  CB    . TRP C  3  189 ? 51.250  46.847  85.571  1.00 58.28  ? 189  TRP C CB    1 
ATOM   7643  C  CG    . TRP C  3  189 ? 50.580  46.592  84.283  1.00 55.88  ? 189  TRP C CG    1 
ATOM   7644  C  CD1   . TRP C  3  189 ? 50.588  47.395  83.182  1.00 55.80  ? 189  TRP C CD1   1 
ATOM   7645  C  CD2   . TRP C  3  189 ? 49.785  45.455  83.944  1.00 54.04  ? 189  TRP C CD2   1 
ATOM   7646  N  NE1   . TRP C  3  189 ? 49.851  46.826  82.173  1.00 55.14  ? 189  TRP C NE1   1 
ATOM   7647  C  CE2   . TRP C  3  189 ? 49.347  45.634  82.617  1.00 53.50  ? 189  TRP C CE2   1 
ATOM   7648  C  CE3   . TRP C  3  189 ? 49.399  44.302  84.632  1.00 52.63  ? 189  TRP C CE3   1 
ATOM   7649  C  CZ2   . TRP C  3  189 ? 48.550  44.712  81.972  1.00 51.54  ? 189  TRP C CZ2   1 
ATOM   7650  C  CZ3   . TRP C  3  189 ? 48.608  43.389  83.992  1.00 51.43  ? 189  TRP C CZ3   1 
ATOM   7651  C  CH2   . TRP C  3  189 ? 48.189  43.596  82.675  1.00 51.98  ? 189  TRP C CH2   1 
ATOM   7652  N  N     . ALA C  3  190 ? 50.797  48.596  88.586  1.00 64.88  ? 190  ALA C N     1 
ATOM   7653  C  CA    . ALA C  3  190 ? 51.407  48.914  89.874  1.00 65.62  ? 190  ALA C CA    1 
ATOM   7654  C  C     . ALA C  3  190 ? 51.278  47.740  90.834  1.00 66.46  ? 190  ALA C C     1 
ATOM   7655  O  O     . ALA C  3  190 ? 50.173  47.306  91.133  1.00 66.63  ? 190  ALA C O     1 
ATOM   7656  C  CB    . ALA C  3  190 ? 50.736  50.133  90.465  1.00 66.07  ? 190  ALA C CB    1 
ATOM   7657  N  N     . PRO C  3  191 ? 52.418  47.205  91.316  1.00 68.24  ? 191  PRO C N     1 
ATOM   7658  C  CA    . PRO C  3  191 ? 52.488  46.072  92.249  1.00 68.49  ? 191  PRO C CA    1 
ATOM   7659  C  C     . PRO C  3  191 ? 51.458  46.145  93.360  1.00 68.78  ? 191  PRO C C     1 
ATOM   7660  O  O     . PRO C  3  191 ? 50.774  45.160  93.639  1.00 67.74  ? 191  PRO C O     1 
ATOM   7661  C  CB    . PRO C  3  191 ? 53.911  46.156  92.768  1.00 68.68  ? 191  PRO C CB    1 
ATOM   7662  C  CG    . PRO C  3  191 ? 54.653  46.525  91.520  1.00 68.88  ? 191  PRO C CG    1 
ATOM   7663  C  CD    . PRO C  3  191 ? 53.779  47.612  90.906  1.00 68.83  ? 191  PRO C CD    1 
ATOM   7664  N  N     . GLY C  3  192 ? 51.360  47.304  93.999  1.00 69.93  ? 192  GLY C N     1 
ATOM   7665  C  CA    . GLY C  3  192 ? 50.370  47.463  95.049  1.00 71.34  ? 192  GLY C CA    1 
ATOM   7666  C  C     . GLY C  3  192 ? 48.998  47.536  94.399  1.00 71.54  ? 192  GLY C C     1 
ATOM   7667  O  O     . GLY C  3  192 ? 47.992  47.066  94.940  1.00 71.67  ? 192  GLY C O     1 
ATOM   7668  N  N     . GLY C  3  193 ? 48.973  48.107  93.204  1.00 71.90  ? 193  GLY C N     1 
ATOM   7669  C  CA    . GLY C  3  193 ? 47.730  48.259  92.478  1.00 70.88  ? 193  GLY C CA    1 
ATOM   7670  C  C     . GLY C  3  193 ? 47.769  49.646  91.866  1.00 70.88  ? 193  GLY C C     1 
ATOM   7671  O  O     . GLY C  3  193 ? 48.475  50.545  92.358  1.00 69.93  ? 193  GLY C O     1 
ATOM   7672  N  N     . GLY C  3  194 ? 47.019  49.813  90.786  1.00 70.07  ? 194  GLY C N     1 
ATOM   7673  C  CA    . GLY C  3  194 ? 46.990  51.089  90.100  1.00 69.40  ? 194  GLY C CA    1 
ATOM   7674  C  C     . GLY C  3  194 ? 47.358  52.258  90.972  1.00 68.20  ? 194  GLY C C     1 
ATOM   7675  O  O     . GLY C  3  194 ? 46.777  52.453  92.027  1.00 68.66  ? 194  GLY C O     1 
ATOM   7676  N  N     . ASP C  3  195 ? 48.330  53.033  90.525  1.00 69.04  ? 195  ASP C N     1 
ATOM   7677  C  CA    . ASP C  3  195 ? 48.774  54.208  91.251  1.00 69.65  ? 195  ASP C CA    1 
ATOM   7678  C  C     . ASP C  3  195 ? 50.021  54.810  90.606  1.00 68.95  ? 195  ASP C C     1 
ATOM   7679  O  O     . ASP C  3  195 ? 50.788  54.103  89.953  1.00 68.75  ? 195  ASP C O     1 
ATOM   7680  C  CB    . ASP C  3  195 ? 49.037  53.829  92.710  1.00 71.41  ? 195  ASP C CB    1 
ATOM   7681  C  CG    . ASP C  3  195 ? 49.486  55.007  93.556  1.00 74.15  ? 195  ASP C CG    1 
ATOM   7682  O  OD1   . ASP C  3  195 ? 49.105  56.162  93.250  1.00 75.50  ? 195  ASP C OD1   1 
ATOM   7683  O  OD2   . ASP C  3  195 ? 50.214  54.768  94.544  1.00 75.84  ? 195  ASP C OD2   1 
ATOM   7684  N  N     . VAL C  3  196 ? 50.210  56.115  90.784  1.00 67.79  ? 196  VAL C N     1 
ATOM   7685  C  CA    . VAL C  3  196 ? 51.349  56.823  90.210  1.00 67.56  ? 196  VAL C CA    1 
ATOM   7686  C  C     . VAL C  3  196 ? 52.609  56.117  90.617  1.00 67.39  ? 196  VAL C C     1 
ATOM   7687  O  O     . VAL C  3  196 ? 52.699  55.619  91.730  1.00 67.58  ? 196  VAL C O     1 
ATOM   7688  C  CB    . VAL C  3  196 ? 51.429  58.279  90.705  1.00 67.03  ? 196  VAL C CB    1 
ATOM   7689  C  CG1   . VAL C  3  196 ? 52.632  58.944  90.100  1.00 66.24  ? 196  VAL C CG1   1 
ATOM   7690  C  CG2   . VAL C  3  196 ? 50.165  59.047  90.336  1.00 65.86  ? 196  VAL C CG2   1 
ATOM   7691  N  N     . ARG C  3  197 ? 53.585  56.067  89.724  1.00 68.85  ? 197  ARG C N     1 
ATOM   7692  C  CA    . ARG C  3  197 ? 54.841  55.385  90.034  1.00 70.83  ? 197  ARG C CA    1 
ATOM   7693  C  C     . ARG C  3  197 ? 55.987  55.957  89.224  1.00 72.49  ? 197  ARG C C     1 
ATOM   7694  O  O     . ARG C  3  197 ? 55.877  56.104  88.010  1.00 72.16  ? 197  ARG C O     1 
ATOM   7695  C  CB    . ARG C  3  197 ? 54.740  53.878  89.749  1.00 69.48  ? 197  ARG C CB    1 
ATOM   7696  C  CG    . ARG C  3  197 ? 55.593  53.007  90.665  1.00 68.39  ? 197  ARG C CG    1 
ATOM   7697  C  CD    . ARG C  3  197 ? 55.876  51.675  90.040  1.00 67.54  ? 197  ARG C CD    1 
ATOM   7698  N  NE    . ARG C  3  197 ? 56.787  51.842  88.918  1.00 68.60  ? 197  ARG C NE    1 
ATOM   7699  C  CZ    . ARG C  3  197 ? 56.916  50.987  87.903  1.00 69.57  ? 197  ARG C CZ    1 
ATOM   7700  N  NH1   . ARG C  3  197 ? 56.183  49.875  87.855  1.00 70.42  ? 197  ARG C NH1   1 
ATOM   7701  N  NH2   . ARG C  3  197 ? 57.774  51.254  86.920  1.00 68.60  ? 197  ARG C NH2   1 
ATOM   7702  N  N     . VAL C  3  198 ? 57.089  56.262  89.900  1.00 73.98  ? 198  VAL C N     1 
ATOM   7703  C  CA    . VAL C  3  198 ? 58.262  56.825  89.238  1.00 75.85  ? 198  VAL C CA    1 
ATOM   7704  C  C     . VAL C  3  198 ? 59.130  55.739  88.616  1.00 76.40  ? 198  VAL C C     1 
ATOM   7705  O  O     . VAL C  3  198 ? 59.714  54.921  89.326  1.00 76.48  ? 198  VAL C O     1 
ATOM   7706  C  CB    . VAL C  3  198 ? 59.112  57.653  90.236  1.00 76.57  ? 198  VAL C CB    1 
ATOM   7707  C  CG1   . VAL C  3  198 ? 60.482  57.940  89.645  1.00 76.32  ? 198  VAL C CG1   1 
ATOM   7708  C  CG2   . VAL C  3  198 ? 58.391  58.959  90.574  1.00 76.22  ? 198  VAL C CG2   1 
ATOM   7709  N  N     . ILE C  3  199 ? 59.205  55.725  87.289  1.00 78.13  ? 199  ILE C N     1 
ATOM   7710  C  CA    . ILE C  3  199 ? 60.025  54.731  86.600  1.00 79.88  ? 199  ILE C CA    1 
ATOM   7711  C  C     . ILE C  3  199 ? 61.462  55.115  86.809  1.00 80.79  ? 199  ILE C C     1 
ATOM   7712  O  O     . ILE C  3  199 ? 61.833  56.278  86.642  1.00 81.52  ? 199  ILE C O     1 
ATOM   7713  C  CB    . ILE C  3  199 ? 59.785  54.693  85.107  1.00 80.07  ? 199  ILE C CB    1 
ATOM   7714  C  CG1   . ILE C  3  199 ? 58.439  54.025  84.832  1.00 81.21  ? 199  ILE C CG1   1 
ATOM   7715  C  CG2   . ILE C  3  199 ? 60.924  53.955  84.429  1.00 80.13  ? 199  ILE C CG2   1 
ATOM   7716  C  CD1   . ILE C  3  199 ? 57.258  54.877  85.274  1.00 82.91  ? 199  ILE C CD1   1 
ATOM   7717  N  N     . THR C  3  200 ? 62.276  54.128  87.151  1.00 80.59  ? 200  THR C N     1 
ATOM   7718  C  CA    . THR C  3  200 ? 63.674  54.387  87.428  1.00 80.65  ? 200  THR C CA    1 
ATOM   7719  C  C     . THR C  3  200 ? 64.519  53.240  86.912  1.00 80.09  ? 200  THR C C     1 
ATOM   7720  O  O     . THR C  3  200 ? 65.628  52.995  87.398  1.00 80.47  ? 200  THR C O     1 
ATOM   7721  C  CB    . THR C  3  200 ? 63.887  54.552  88.949  1.00 81.50  ? 200  THR C CB    1 
ATOM   7722  O  OG1   . THR C  3  200 ? 63.349  53.403  89.628  1.00 82.80  ? 200  THR C OG1   1 
ATOM   7723  C  CG2   . THR C  3  200 ? 63.190  55.825  89.460  1.00 81.13  ? 200  THR C CG2   1 
ATOM   7724  N  N     . ASN C  3  201 ? 63.990  52.537  85.922  1.00 79.35  ? 201  ASN C N     1 
ATOM   7725  C  CA    . ASN C  3  201 ? 64.710  51.410  85.357  1.00 78.34  ? 201  ASN C CA    1 
ATOM   7726  C  C     . ASN C  3  201 ? 64.335  51.268  83.881  1.00 77.65  ? 201  ASN C C     1 
ATOM   7727  O  O     . ASN C  3  201 ? 64.081  50.163  83.378  1.00 78.28  ? 201  ASN C O     1 
ATOM   7728  C  CB    . ASN C  3  201 ? 64.345  50.156  86.147  1.00 78.16  ? 201  ASN C CB    1 
ATOM   7729  C  CG    . ASN C  3  201 ? 65.190  48.975  85.781  1.00 78.47  ? 201  ASN C CG    1 
ATOM   7730  O  OD1   . ASN C  3  201 ? 65.217  48.556  84.627  1.00 79.32  ? 201  ASN C OD1   1 
ATOM   7731  N  ND2   . ASN C  3  201 ? 65.892  48.423  86.760  1.00 79.65  ? 201  ASN C ND2   1 
ATOM   7732  N  N     . PRO C  3  202 ? 64.312  52.397  83.156  1.00 76.32  ? 202  PRO C N     1 
ATOM   7733  C  CA    . PRO C  3  202 ? 63.948  52.335  81.743  1.00 74.37  ? 202  PRO C CA    1 
ATOM   7734  C  C     . PRO C  3  202 ? 64.599  51.156  81.059  1.00 74.27  ? 202  PRO C C     1 
ATOM   7735  O  O     . PRO C  3  202 ? 65.721  50.765  81.383  1.00 72.16  ? 202  PRO C O     1 
ATOM   7736  C  CB    . PRO C  3  202 ? 64.442  53.666  81.199  1.00 74.80  ? 202  PRO C CB    1 
ATOM   7737  C  CG    . PRO C  3  202 ? 64.296  54.579  82.367  1.00 75.01  ? 202  PRO C CG    1 
ATOM   7738  C  CD    . PRO C  3  202 ? 64.815  53.738  83.508  1.00 75.92  ? 202  PRO C CD    1 
ATOM   7739  N  N     . THR C  3  203 ? 63.858  50.574  80.135  1.00 75.27  ? 203  THR C N     1 
ATOM   7740  C  CA    . THR C  3  203 ? 64.366  49.462  79.391  1.00 75.66  ? 203  THR C CA    1 
ATOM   7741  C  C     . THR C  3  203 ? 65.344  49.990  78.334  1.00 77.56  ? 203  THR C C     1 
ATOM   7742  O  O     . THR C  3  203 ? 64.993  50.675  77.363  1.00 78.01  ? 203  THR C O     1 
ATOM   7743  C  CB    . THR C  3  203 ? 63.225  48.664  78.740  1.00 75.24  ? 203  THR C CB    1 
ATOM   7744  O  OG1   . THR C  3  203 ? 62.229  48.390  79.729  1.00 74.55  ? 203  THR C OG1   1 
ATOM   7745  C  CG2   . THR C  3  203 ? 63.744  47.353  78.179  1.00 73.55  ? 203  THR C CG2   1 
ATOM   7746  N  N     . LEU C  3  204 ? 66.601  49.698  78.592  1.00 78.67  ? 204  LEU C N     1 
ATOM   7747  C  CA    . LEU C  3  204 ? 67.699  50.035  77.702  1.00 80.07  ? 204  LEU C CA    1 
ATOM   7748  C  C     . LEU C  3  204 ? 67.756  48.739  76.871  1.00 79.88  ? 204  LEU C C     1 
ATOM   7749  O  O     . LEU C  3  204 ? 66.872  47.875  77.003  1.00 80.61  ? 204  LEU C O     1 
ATOM   7750  C  CB    . LEU C  3  204 ? 68.975  50.183  78.548  1.00 81.50  ? 204  LEU C CB    1 
ATOM   7751  C  CG    . LEU C  3  204 ? 69.345  48.936  79.425  1.00 83.80  ? 204  LEU C CG    1 
ATOM   7752  C  CD1   . LEU C  3  204 ? 70.772  49.074  80.025  1.00 83.47  ? 204  LEU C CD1   1 
ATOM   7753  C  CD2   . LEU C  3  204 ? 68.313  48.712  80.571  1.00 84.46  ? 204  LEU C CD2   1 
ATOM   7754  N  N     . ASP C  3  205 ? 68.770  48.587  76.030  1.00 78.86  ? 205  ASP C N     1 
ATOM   7755  C  CA    . ASP C  3  205 ? 68.894  47.353  75.253  1.00 78.19  ? 205  ASP C CA    1 
ATOM   7756  C  C     . ASP C  3  205 ? 68.020  47.299  74.025  1.00 77.85  ? 205  ASP C C     1 
ATOM   7757  O  O     . ASP C  3  205 ? 66.804  47.312  74.120  1.00 78.84  ? 205  ASP C O     1 
ATOM   7758  C  CB    . ASP C  3  205 ? 68.575  46.135  76.133  1.00 76.99  ? 205  ASP C CB    1 
ATOM   7759  C  CG    . ASP C  3  205 ? 68.492  44.839  75.347  1.00 77.29  ? 205  ASP C CG    1 
ATOM   7760  O  OD1   . ASP C  3  205 ? 68.198  43.820  75.987  1.00 77.30  ? 205  ASP C OD1   1 
ATOM   7761  O  OD2   . ASP C  3  205 ? 68.718  44.823  74.112  1.00 76.42  ? 205  ASP C OD2   1 
ATOM   7762  N  N     . PRO C  3  206 ? 68.637  47.213  72.850  1.00 78.16  ? 206  PRO C N     1 
ATOM   7763  C  CA    . PRO C  3  206 ? 67.892  47.147  71.587  1.00 78.79  ? 206  PRO C CA    1 
ATOM   7764  C  C     . PRO C  3  206 ? 66.941  45.929  71.504  1.00 77.28  ? 206  PRO C C     1 
ATOM   7765  O  O     . PRO C  3  206 ? 65.772  46.070  71.115  1.00 75.28  ? 206  PRO C O     1 
ATOM   7766  C  CB    . PRO C  3  206 ? 69.008  47.098  70.536  1.00 80.07  ? 206  PRO C CB    1 
ATOM   7767  C  CG    . PRO C  3  206 ? 70.179  46.432  71.306  1.00 80.17  ? 206  PRO C CG    1 
ATOM   7768  C  CD    . PRO C  3  206 ? 70.092  47.170  72.616  1.00 78.73  ? 206  PRO C CD    1 
ATOM   7769  N  N     . ARG C  3  207 ? 67.451  44.757  71.869  1.00 76.40  ? 207  ARG C N     1 
ATOM   7770  C  CA    . ARG C  3  207 ? 66.657  43.535  71.842  1.00 77.51  ? 207  ARG C CA    1 
ATOM   7771  C  C     . ARG C  3  207 ? 65.213  43.830  72.248  1.00 75.79  ? 207  ARG C C     1 
ATOM   7772  O  O     . ARG C  3  207 ? 64.336  44.025  71.416  1.00 75.56  ? 207  ARG C O     1 
ATOM   7773  C  CB    . ARG C  3  207 ? 67.238  42.498  72.815  1.00 80.83  ? 207  ARG C CB    1 
ATOM   7774  C  CG    . ARG C  3  207 ? 68.739  42.252  72.701  1.00 85.16  ? 207  ARG C CG    1 
ATOM   7775  C  CD    . ARG C  3  207 ? 69.090  41.493  71.406  1.00 89.29  ? 207  ARG C CD    1 
ATOM   7776  N  NE    . ARG C  3  207 ? 70.535  41.253  71.254  1.00 92.04  ? 207  ARG C NE    1 
ATOM   7777  C  CZ    . ARG C  3  207 ? 71.142  40.817  70.140  1.00 91.76  ? 207  ARG C CZ    1 
ATOM   7778  N  NH1   . ARG C  3  207 ? 70.447  40.550  69.030  1.00 90.75  ? 207  ARG C NH1   1 
ATOM   7779  N  NH2   . ARG C  3  207 ? 72.467  40.675  70.132  1.00 92.59  ? 207  ARG C NH2   1 
ATOM   7780  N  N     . VAL C  3  208 ? 64.976  43.865  73.543  1.00 74.73  ? 208  VAL C N     1 
ATOM   7781  C  CA    . VAL C  3  208 ? 63.643  44.127  74.039  1.00 73.52  ? 208  VAL C CA    1 
ATOM   7782  C  C     . VAL C  3  208 ? 62.982  45.318  73.378  1.00 72.03  ? 208  VAL C C     1 
ATOM   7783  O  O     . VAL C  3  208 ? 61.867  45.211  72.890  1.00 72.83  ? 208  VAL C O     1 
ATOM   7784  C  CB    . VAL C  3  208 ? 63.651  44.355  75.552  1.00 73.65  ? 208  VAL C CB    1 
ATOM   7785  C  CG1   . VAL C  3  208 ? 62.301  44.938  76.002  1.00 74.15  ? 208  VAL C CG1   1 
ATOM   7786  C  CG2   . VAL C  3  208 ? 63.931  43.024  76.255  1.00 73.80  ? 208  VAL C CG2   1 
ATOM   7787  N  N     . ILE C  3  209 ? 63.647  46.456  73.368  1.00 70.25  ? 209  ILE C N     1 
ATOM   7788  C  CA    . ILE C  3  209 ? 63.032  47.623  72.757  1.00 68.83  ? 209  ILE C CA    1 
ATOM   7789  C  C     . ILE C  3  209 ? 62.613  47.309  71.330  1.00 68.32  ? 209  ILE C C     1 
ATOM   7790  O  O     . ILE C  3  209 ? 61.451  46.995  71.079  1.00 69.16  ? 209  ILE C O     1 
ATOM   7791  C  CB    . ILE C  3  209 ? 63.975  48.850  72.777  1.00 67.72  ? 209  ILE C CB    1 
ATOM   7792  C  CG1   . ILE C  3  209 ? 64.173  49.303  74.214  1.00 67.00  ? 209  ILE C CG1   1 
ATOM   7793  C  CG2   . ILE C  3  209 ? 63.376  50.006  71.986  1.00 65.15  ? 209  ILE C CG2   1 
ATOM   7794  C  CD1   . ILE C  3  209 ? 62.888  49.698  74.870  1.00 68.41  ? 209  ILE C CD1   1 
ATOM   7795  N  N     . PHE C  3  210 ? 63.553  47.370  70.401  1.00 67.19  ? 210  PHE C N     1 
ATOM   7796  C  CA    . PHE C  3  210 ? 63.239  47.111  69.013  1.00 66.55  ? 210  PHE C CA    1 
ATOM   7797  C  C     . PHE C  3  210 ? 62.450  45.809  68.742  1.00 65.88  ? 210  PHE C C     1 
ATOM   7798  O  O     . PHE C  3  210 ? 61.841  45.662  67.684  1.00 65.81  ? 210  PHE C O     1 
ATOM   7799  C  CB    . PHE C  3  210 ? 64.523  47.156  68.192  1.00 66.29  ? 210  PHE C CB    1 
ATOM   7800  C  CG    . PHE C  3  210 ? 65.180  48.511  68.177  1.00 65.72  ? 210  PHE C CG    1 
ATOM   7801  C  CD1   . PHE C  3  210 ? 65.948  48.942  69.253  1.00 65.66  ? 210  PHE C CD1   1 
ATOM   7802  C  CD2   . PHE C  3  210 ? 64.981  49.383  67.110  1.00 65.52  ? 210  PHE C CD2   1 
ATOM   7803  C  CE1   . PHE C  3  210 ? 66.501  50.231  69.265  1.00 65.41  ? 210  PHE C CE1   1 
ATOM   7804  C  CE2   . PHE C  3  210 ? 65.529  50.666  67.113  1.00 65.12  ? 210  PHE C CE2   1 
ATOM   7805  C  CZ    . PHE C  3  210 ? 66.287  51.091  68.190  1.00 64.75  ? 210  PHE C CZ    1 
ATOM   7806  N  N     . GLY C  3  211 ? 62.442  44.878  69.687  1.00 65.44  ? 211  GLY C N     1 
ATOM   7807  C  CA    . GLY C  3  211 ? 61.694  43.655  69.473  1.00 64.86  ? 211  GLY C CA    1 
ATOM   7808  C  C     . GLY C  3  211 ? 60.294  43.978  68.965  1.00 66.26  ? 211  GLY C C     1 
ATOM   7809  O  O     . GLY C  3  211 ? 59.891  43.552  67.874  1.00 65.74  ? 211  GLY C O     1 
ATOM   7810  N  N     . TYR C  3  212 ? 59.556  44.738  69.773  1.00 66.98  ? 212  TYR C N     1 
ATOM   7811  C  CA    . TYR C  3  212 ? 58.184  45.157  69.460  1.00 67.92  ? 212  TYR C CA    1 
ATOM   7812  C  C     . TYR C  3  212 ? 58.070  45.561  67.984  1.00 68.36  ? 212  TYR C C     1 
ATOM   7813  O  O     . TYR C  3  212 ? 56.995  45.438  67.368  1.00 70.05  ? 212  TYR C O     1 
ATOM   7814  C  CB    . TYR C  3  212 ? 57.772  46.358  70.346  1.00 67.15  ? 212  TYR C CB    1 
ATOM   7815  C  CG    . TYR C  3  212 ? 57.684  46.073  71.840  1.00 66.14  ? 212  TYR C CG    1 
ATOM   7816  C  CD1   . TYR C  3  212 ? 56.571  45.449  72.387  1.00 65.84  ? 212  TYR C CD1   1 
ATOM   7817  C  CD2   . TYR C  3  212 ? 58.713  46.438  72.706  1.00 65.55  ? 212  TYR C CD2   1 
ATOM   7818  C  CE1   . TYR C  3  212 ? 56.479  45.198  73.762  1.00 65.31  ? 212  TYR C CE1   1 
ATOM   7819  C  CE2   . TYR C  3  212 ? 58.630  46.193  74.083  1.00 65.05  ? 212  TYR C CE2   1 
ATOM   7820  C  CZ    . TYR C  3  212 ? 57.510  45.575  74.604  1.00 65.22  ? 212  TYR C CZ    1 
ATOM   7821  O  OH    . TYR C  3  212 ? 57.413  45.355  75.971  1.00 65.64  ? 212  TYR C OH    1 
ATOM   7822  N  N     . LEU C  3  213 ? 59.178  46.035  67.418  1.00 67.45  ? 213  LEU C N     1 
ATOM   7823  C  CA    . LEU C  3  213 ? 59.162  46.476  66.035  1.00 66.64  ? 213  LEU C CA    1 
ATOM   7824  C  C     . LEU C  3  213 ? 58.833  45.391  65.066  1.00 66.65  ? 213  LEU C C     1 
ATOM   7825  O  O     . LEU C  3  213 ? 58.044  45.619  64.161  1.00 67.38  ? 213  LEU C O     1 
ATOM   7826  C  CB    . LEU C  3  213 ? 60.485  47.112  65.651  1.00 66.31  ? 213  LEU C CB    1 
ATOM   7827  C  CG    . LEU C  3  213 ? 60.570  48.624  65.866  1.00 67.66  ? 213  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C  3  213 ? 61.962  49.084  65.486  1.00 67.85  ? 213  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C  3  213 ? 59.515  49.354  65.027  1.00 66.21  ? 213  LEU C CD2   1 
ATOM   7830  N  N     . LEU C  3  214 ? 59.425  44.216  65.225  1.00 66.37  ? 214  LEU C N     1 
ATOM   7831  C  CA    . LEU C  3  214 ? 59.114  43.135  64.298  1.00 67.26  ? 214  LEU C CA    1 
ATOM   7832  C  C     . LEU C  3  214 ? 58.412  41.971  64.995  1.00 67.49  ? 214  LEU C C     1 
ATOM   7833  O  O     . LEU C  3  214 ? 58.907  40.843  65.034  1.00 68.09  ? 214  LEU C O     1 
ATOM   7834  C  CB    . LEU C  3  214 ? 60.374  42.667  63.566  1.00 67.77  ? 214  LEU C CB    1 
ATOM   7835  C  CG    . LEU C  3  214 ? 61.578  42.099  64.316  1.00 69.21  ? 214  LEU C CG    1 
ATOM   7836  C  CD1   . LEU C  3  214 ? 62.669  41.815  63.280  1.00 68.94  ? 214  LEU C CD1   1 
ATOM   7837  C  CD2   . LEU C  3  214 ? 62.070  43.072  65.377  1.00 68.83  ? 214  LEU C CD2   1 
ATOM   7838  N  N     . LYS C  3  215 ? 57.234  42.282  65.529  1.00 67.04  ? 215  LYS C N     1 
ATOM   7839  C  CA    . LYS C  3  215 ? 56.369  41.360  66.250  1.00 66.45  ? 215  LYS C CA    1 
ATOM   7840  C  C     . LYS C  3  215 ? 55.080  41.404  65.449  1.00 67.13  ? 215  LYS C C     1 
ATOM   7841  O  O     . LYS C  3  215 ? 54.532  42.491  65.265  1.00 69.34  ? 215  LYS C O     1 
ATOM   7842  C  CB    . LYS C  3  215 ? 56.128  41.930  67.640  1.00 65.55  ? 215  LYS C CB    1 
ATOM   7843  C  CG    . LYS C  3  215 ? 55.625  40.981  68.687  1.00 64.41  ? 215  LYS C CG    1 
ATOM   7844  C  CD    . LYS C  3  215 ? 55.518  41.716  70.031  1.00 63.65  ? 215  LYS C CD    1 
ATOM   7845  C  CE    . LYS C  3  215 ? 55.319  40.758  71.194  1.00 62.90  ? 215  LYS C CE    1 
ATOM   7846  N  NZ    . LYS C  3  215 ? 55.283  41.479  72.488  1.00 62.19  ? 215  LYS C NZ    1 
ATOM   7847  N  N     . SER C  3  216 ? 54.592  40.257  64.976  1.00 66.15  ? 216  SER C N     1 
ATOM   7848  C  CA    . SER C  3  216 ? 53.358  40.211  64.175  1.00 64.63  ? 216  SER C CA    1 
ATOM   7849  C  C     . SER C  3  216 ? 52.229  41.099  64.702  1.00 64.22  ? 216  SER C C     1 
ATOM   7850  O  O     . SER C  3  216 ? 52.058  41.227  65.904  1.00 64.31  ? 216  SER C O     1 
ATOM   7851  C  CB    . SER C  3  216 ? 52.848  38.778  64.087  1.00 64.69  ? 216  SER C CB    1 
ATOM   7852  O  OG    . SER C  3  216 ? 51.584  38.717  63.440  1.00 64.81  ? 216  SER C OG    1 
ATOM   7853  N  N     . PRO C  3  217 ? 51.455  41.743  63.812  1.00 63.64  ? 217  PRO C N     1 
ATOM   7854  C  CA    . PRO C  3  217 ? 50.370  42.585  64.342  1.00 64.24  ? 217  PRO C CA    1 
ATOM   7855  C  C     . PRO C  3  217 ? 49.122  41.736  64.620  1.00 65.87  ? 217  PRO C C     1 
ATOM   7856  O  O     . PRO C  3  217 ? 48.100  42.222  65.109  1.00 67.04  ? 217  PRO C O     1 
ATOM   7857  C  CB    . PRO C  3  217 ? 50.143  43.582  63.222  1.00 63.27  ? 217  PRO C CB    1 
ATOM   7858  C  CG    . PRO C  3  217 ? 50.407  42.742  62.014  1.00 62.66  ? 217  PRO C CG    1 
ATOM   7859  C  CD    . PRO C  3  217 ? 51.662  42.001  62.380  1.00 61.56  ? 217  PRO C CD    1 
ATOM   7860  N  N     . PHE C  3  218 ? 49.223  40.451  64.321  1.00 65.52  ? 218  PHE C N     1 
ATOM   7861  C  CA    . PHE C  3  218 ? 48.118  39.538  64.516  1.00 65.30  ? 218  PHE C CA    1 
ATOM   7862  C  C     . PHE C  3  218 ? 47.821  39.074  65.940  1.00 65.67  ? 218  PHE C C     1 
ATOM   7863  O  O     . PHE C  3  218 ? 48.605  39.304  66.854  1.00 66.84  ? 218  PHE C O     1 
ATOM   7864  C  CB    . PHE C  3  218 ? 48.334  38.360  63.596  1.00 65.44  ? 218  PHE C CB    1 
ATOM   7865  C  CG    . PHE C  3  218 ? 48.079  38.692  62.173  1.00 65.34  ? 218  PHE C CG    1 
ATOM   7866  C  CD1   . PHE C  3  218 ? 46.780  38.942  61.733  1.00 66.58  ? 218  PHE C CD1   1 
ATOM   7867  C  CD2   . PHE C  3  218 ? 49.115  38.819  61.286  1.00 64.99  ? 218  PHE C CD2   1 
ATOM   7868  C  CE1   . PHE C  3  218 ? 46.516  39.322  60.409  1.00 65.80  ? 218  PHE C CE1   1 
ATOM   7869  C  CE2   . PHE C  3  218 ? 48.868  39.193  59.973  1.00 67.05  ? 218  PHE C CE2   1 
ATOM   7870  C  CZ    . PHE C  3  218 ? 47.556  39.447  59.529  1.00 66.00  ? 218  PHE C CZ    1 
ATOM   7871  N  N     . GLY C  3  219 ? 46.669  38.430  66.122  1.00 65.96  ? 219  GLY C N     1 
ATOM   7872  C  CA    . GLY C  3  219 ? 46.263  37.936  67.433  1.00 65.47  ? 219  GLY C CA    1 
ATOM   7873  C  C     . GLY C  3  219 ? 47.393  37.356  68.265  1.00 65.77  ? 219  GLY C C     1 
ATOM   7874  O  O     . GLY C  3  219 ? 48.287  36.703  67.740  1.00 64.43  ? 219  GLY C O     1 
ATOM   7875  N  N     . GLY C  3  220 ? 47.340  37.579  69.569  1.00 67.11  ? 220  GLY C N     1 
ATOM   7876  C  CA    . GLY C  3  220 ? 48.371  37.077  70.454  1.00 69.15  ? 220  GLY C CA    1 
ATOM   7877  C  C     . GLY C  3  220 ? 49.555  38.009  70.375  1.00 70.87  ? 220  GLY C C     1 
ATOM   7878  O  O     . GLY C  3  220 ? 49.541  39.088  70.959  1.00 72.46  ? 220  GLY C O     1 
ATOM   7879  N  N     . GLU C  3  221 ? 50.585  37.599  69.654  1.00 72.07  ? 221  GLU C N     1 
ATOM   7880  C  CA    . GLU C  3  221 ? 51.752  38.442  69.491  1.00 73.02  ? 221  GLU C CA    1 
ATOM   7881  C  C     . GLU C  3  221 ? 51.242  39.745  68.872  1.00 72.79  ? 221  GLU C C     1 
ATOM   7882  O  O     . GLU C  3  221 ? 51.101  39.788  67.664  1.00 75.47  ? 221  GLU C O     1 
ATOM   7883  C  CB    . GLU C  3  221 ? 52.732  37.768  68.524  1.00 73.65  ? 221  GLU C CB    1 
ATOM   7884  C  CG    . GLU C  3  221 ? 53.269  36.426  69.018  1.00 78.02  ? 221  GLU C CG    1 
ATOM   7885  C  CD    . GLU C  3  221 ? 54.453  36.539  70.016  1.00 80.74  ? 221  GLU C CD    1 
ATOM   7886  O  OE1   . GLU C  3  221 ? 55.606  36.810  69.577  1.00 82.19  ? 221  GLU C OE1   1 
ATOM   7887  O  OE2   . GLU C  3  221 ? 54.238  36.354  71.240  1.00 81.48  ? 221  GLU C OE2   1 
ATOM   7888  N  N     . GLY C  3  222 ? 50.942  40.792  69.641  1.00 70.99  ? 222  GLY C N     1 
ATOM   7889  C  CA    . GLY C  3  222 ? 50.481  42.028  69.003  1.00 70.85  ? 222  GLY C CA    1 
ATOM   7890  C  C     . GLY C  3  222 ? 51.655  42.743  68.335  1.00 71.57  ? 222  GLY C C     1 
ATOM   7891  O  O     . GLY C  3  222 ? 52.682  42.109  68.113  1.00 73.88  ? 222  GLY C O     1 
ATOM   7892  N  N     . TRP C  3  223 ? 51.569  44.024  68.005  1.00 71.37  ? 223  TRP C N     1 
ATOM   7893  C  CA    . TRP C  3  223 ? 52.755  44.652  67.390  1.00 70.30  ? 223  TRP C CA    1 
ATOM   7894  C  C     . TRP C  3  223 ? 53.389  45.626  68.389  1.00 68.66  ? 223  TRP C C     1 
ATOM   7895  O  O     . TRP C  3  223 ? 53.990  45.213  69.384  1.00 68.27  ? 223  TRP C O     1 
ATOM   7896  C  CB    . TRP C  3  223 ? 52.361  45.361  66.100  1.00 72.35  ? 223  TRP C CB    1 
ATOM   7897  C  CG    . TRP C  3  223 ? 53.500  46.005  65.351  1.00 74.04  ? 223  TRP C CG    1 
ATOM   7898  C  CD1   . TRP C  3  223 ? 54.666  45.422  64.987  1.00 74.37  ? 223  TRP C CD1   1 
ATOM   7899  C  CD2   . TRP C  3  223 ? 53.531  47.344  64.809  1.00 74.96  ? 223  TRP C CD2   1 
ATOM   7900  N  NE1   . TRP C  3  223 ? 55.422  46.303  64.247  1.00 75.41  ? 223  TRP C NE1   1 
ATOM   7901  C  CE2   . TRP C  3  223 ? 54.748  47.487  64.126  1.00 74.90  ? 223  TRP C CE2   1 
ATOM   7902  C  CE3   . TRP C  3  223 ? 52.640  48.431  64.837  1.00 75.84  ? 223  TRP C CE3   1 
ATOM   7903  C  CZ2   . TRP C  3  223 ? 55.107  48.666  63.476  1.00 75.43  ? 223  TRP C CZ2   1 
ATOM   7904  C  CZ3   . TRP C  3  223 ? 52.998  49.611  64.186  1.00 75.60  ? 223  TRP C CZ3   1 
ATOM   7905  C  CH2   . TRP C  3  223 ? 54.220  49.715  63.517  1.00 75.74  ? 223  TRP C CH2   1 
ATOM   7906  N  N     . ILE C  3  224 ? 53.271  46.914  68.119  1.00 66.02  ? 224  ILE C N     1 
ATOM   7907  C  CA    . ILE C  3  224 ? 53.783  47.911  69.036  1.00 63.26  ? 224  ILE C CA    1 
ATOM   7908  C  C     . ILE C  3  224 ? 52.745  47.938  70.142  1.00 61.69  ? 224  ILE C C     1 
ATOM   7909  O  O     . ILE C  3  224 ? 53.057  48.170  71.290  1.00 60.42  ? 224  ILE C O     1 
ATOM   7910  C  CB    . ILE C  3  224 ? 53.780  49.308  68.426  1.00 63.70  ? 224  ILE C CB    1 
ATOM   7911  C  CG1   . ILE C  3  224 ? 54.685  49.365  67.216  1.00 64.46  ? 224  ILE C CG1   1 
ATOM   7912  C  CG2   . ILE C  3  224 ? 54.245  50.315  69.444  1.00 63.26  ? 224  ILE C CG2   1 
ATOM   7913  C  CD1   . ILE C  3  224 ? 54.781  50.796  66.654  1.00 65.87  ? 224  ILE C CD1   1 
ATOM   7914  N  N     . VAL C  3  225 ? 51.498  47.696  69.770  1.00 61.03  ? 225  VAL C N     1 
ATOM   7915  C  CA    . VAL C  3  225 ? 50.395  47.746  70.716  1.00 60.56  ? 225  VAL C CA    1 
ATOM   7916  C  C     . VAL C  3  225 ? 50.526  46.765  71.896  1.00 60.50  ? 225  VAL C C     1 
ATOM   7917  O  O     . VAL C  3  225 ? 49.671  46.722  72.785  1.00 60.70  ? 225  VAL C O     1 
ATOM   7918  C  CB    . VAL C  3  225 ? 49.031  47.582  69.976  1.00 60.36  ? 225  VAL C CB    1 
ATOM   7919  C  CG1   . VAL C  3  225 ? 47.893  47.911  70.884  1.00 60.90  ? 225  VAL C CG1   1 
ATOM   7920  C  CG2   . VAL C  3  225 ? 48.971  48.514  68.805  1.00 59.02  ? 225  VAL C CG2   1 
ATOM   7921  N  N     . SER C  3  226 ? 51.590  45.976  71.914  1.00 59.63  ? 226  SER C N     1 
ATOM   7922  C  CA    . SER C  3  226 ? 51.786  45.096  73.055  1.00 59.90  ? 226  SER C CA    1 
ATOM   7923  C  C     . SER C  3  226 ? 52.176  46.075  74.164  1.00 60.63  ? 226  SER C C     1 
ATOM   7924  O  O     . SER C  3  226 ? 51.336  46.817  74.669  1.00 62.63  ? 226  SER C O     1 
ATOM   7925  C  CB    . SER C  3  226 ? 52.941  44.132  72.819  1.00 59.15  ? 226  SER C CB    1 
ATOM   7926  O  OG    . SER C  3  226 ? 52.849  43.514  71.554  1.00 59.36  ? 226  SER C OG    1 
ATOM   7927  N  N     . VAL C  3  227 ? 53.451  46.099  74.527  1.00 60.69  ? 227  VAL C N     1 
ATOM   7928  C  CA    . VAL C  3  227 ? 53.955  47.027  75.545  1.00 60.15  ? 227  VAL C CA    1 
ATOM   7929  C  C     . VAL C  3  227 ? 53.113  47.020  76.793  1.00 60.02  ? 227  VAL C C     1 
ATOM   7930  O  O     . VAL C  3  227 ? 52.267  47.886  76.966  1.00 60.40  ? 227  VAL C O     1 
ATOM   7931  C  CB    . VAL C  3  227 ? 53.978  48.474  75.022  1.00 59.43  ? 227  VAL C CB    1 
ATOM   7932  C  CG1   . VAL C  3  227 ? 54.828  49.328  75.935  1.00 60.32  ? 227  VAL C CG1   1 
ATOM   7933  C  CG2   . VAL C  3  227 ? 54.516  48.525  73.632  1.00 59.41  ? 227  VAL C CG2   1 
ATOM   7934  N  N     . ASN C  3  228 ? 53.361  46.071  77.682  1.00 59.78  ? 228  ASN C N     1 
ATOM   7935  C  CA    . ASN C  3  228 ? 52.577  45.990  78.900  1.00 60.37  ? 228  ASN C CA    1 
ATOM   7936  C  C     . ASN C  3  228 ? 53.200  46.572  80.152  1.00 60.61  ? 228  ASN C C     1 
ATOM   7937  O  O     . ASN C  3  228 ? 52.743  46.282  81.243  1.00 60.72  ? 228  ASN C O     1 
ATOM   7938  C  CB    . ASN C  3  228 ? 52.174  44.542  79.168  1.00 61.61  ? 228  ASN C CB    1 
ATOM   7939  C  CG    . ASN C  3  228 ? 53.335  43.588  79.041  1.00 62.61  ? 228  ASN C CG    1 
ATOM   7940  O  OD1   . ASN C  3  228 ? 54.402  43.812  79.613  1.00 63.93  ? 228  ASN C OD1   1 
ATOM   7941  N  ND2   . ASN C  3  228 ? 53.140  42.517  78.288  1.00 63.03  ? 228  ASN C ND2   1 
ATOM   7942  N  N     . ASN C  3  229 ? 54.236  47.385  80.012  1.00 62.32  ? 229  ASN C N     1 
ATOM   7943  C  CA    . ASN C  3  229 ? 54.878  47.984  81.183  1.00 64.32  ? 229  ASN C CA    1 
ATOM   7944  C  C     . ASN C  3  229 ? 55.561  49.307  80.863  1.00 65.43  ? 229  ASN C C     1 
ATOM   7945  O  O     . ASN C  3  229 ? 56.105  49.486  79.774  1.00 64.45  ? 229  ASN C O     1 
ATOM   7946  C  CB    . ASN C  3  229 ? 55.895  47.021  81.785  1.00 65.00  ? 229  ASN C CB    1 
ATOM   7947  C  CG    . ASN C  3  229 ? 56.998  46.666  80.820  1.00 65.44  ? 229  ASN C CG    1 
ATOM   7948  O  OD1   . ASN C  3  229 ? 56.778  45.978  79.814  1.00 64.74  ? 229  ASN C OD1   1 
ATOM   7949  N  ND2   . ASN C  3  229 ? 58.202  47.135  81.120  1.00 66.57  ? 229  ASN C ND2   1 
ATOM   7950  N  N     . LEU C  3  230 ? 55.541  50.221  81.830  1.00 66.85  ? 230  LEU C N     1 
ATOM   7951  C  CA    . LEU C  3  230 ? 56.111  51.552  81.649  1.00 68.53  ? 230  LEU C CA    1 
ATOM   7952  C  C     . LEU C  3  230 ? 57.627  51.610  81.524  1.00 70.56  ? 230  LEU C C     1 
ATOM   7953  O  O     . LEU C  3  230 ? 58.154  52.600  81.004  1.00 71.80  ? 230  LEU C O     1 
ATOM   7954  C  CB    . LEU C  3  230 ? 55.651  52.484  82.773  1.00 67.53  ? 230  LEU C CB    1 
ATOM   7955  C  CG    . LEU C  3  230 ? 54.169  52.853  82.817  1.00 65.48  ? 230  LEU C CG    1 
ATOM   7956  C  CD1   . LEU C  3  230 ? 53.860  53.616  84.060  1.00 65.38  ? 230  LEU C CD1   1 
ATOM   7957  C  CD2   . LEU C  3  230 ? 53.823  53.678  81.634  1.00 64.81  ? 230  LEU C CD2   1 
ATOM   7958  N  N     . GLU C  3  231 ? 58.330  50.576  82.000  1.00 71.36  ? 231  GLU C N     1 
ATOM   7959  C  CA    . GLU C  3  231 ? 59.797  50.532  81.882  1.00 71.61  ? 231  GLU C CA    1 
ATOM   7960  C  C     . GLU C  3  231 ? 60.105  50.671  80.385  1.00 72.23  ? 231  GLU C C     1 
ATOM   7961  O  O     . GLU C  3  231 ? 60.888  51.522  79.967  1.00 71.99  ? 231  GLU C O     1 
ATOM   7962  C  CB    . GLU C  3  231 ? 60.339  49.190  82.358  1.00 71.73  ? 231  GLU C CB    1 
ATOM   7963  C  CG    . GLU C  3  231 ? 59.592  48.594  83.521  1.00 74.19  ? 231  GLU C CG    1 
ATOM   7964  C  CD    . GLU C  3  231 ? 59.794  49.385  84.783  1.00 76.27  ? 231  GLU C CD    1 
ATOM   7965  O  OE1   . GLU C  3  231 ? 60.964  49.626  85.151  1.00 77.19  ? 231  GLU C OE1   1 
ATOM   7966  O  OE2   . GLU C  3  231 ? 58.787  49.764  85.417  1.00 77.49  ? 231  GLU C OE2   1 
ATOM   7967  N  N     . ASP C  3  232 ? 59.456  49.829  79.587  1.00 72.35  ? 232  ASP C N     1 
ATOM   7968  C  CA    . ASP C  3  232 ? 59.634  49.829  78.137  1.00 72.94  ? 232  ASP C CA    1 
ATOM   7969  C  C     . ASP C  3  232 ? 59.138  51.125  77.489  1.00 73.25  ? 232  ASP C C     1 
ATOM   7970  O  O     . ASP C  3  232 ? 59.817  51.684  76.633  1.00 74.11  ? 232  ASP C O     1 
ATOM   7971  C  CB    . ASP C  3  232 ? 58.912  48.617  77.507  1.00 72.66  ? 232  ASP C CB    1 
ATOM   7972  C  CG    . ASP C  3  232 ? 59.551  47.268  77.889  1.00 72.23  ? 232  ASP C CG    1 
ATOM   7973  O  OD1   . ASP C  3  232 ? 59.708  46.966  79.087  1.00 71.75  ? 232  ASP C OD1   1 
ATOM   7974  O  OD2   . ASP C  3  232 ? 59.890  46.495  76.979  1.00 72.40  ? 232  ASP C OD2   1 
ATOM   7975  N  N     . VAL C  3  233 ? 57.958  51.599  77.883  1.00 73.45  ? 233  VAL C N     1 
ATOM   7976  C  CA    . VAL C  3  233 ? 57.401  52.831  77.294  1.00 72.42  ? 233  VAL C CA    1 
ATOM   7977  C  C     . VAL C  3  233 ? 58.417  53.935  77.469  1.00 72.28  ? 233  VAL C C     1 
ATOM   7978  O  O     . VAL C  3  233 ? 58.674  54.689  76.539  1.00 71.04  ? 233  VAL C O     1 
ATOM   7979  C  CB    . VAL C  3  233 ? 56.078  53.275  77.977  1.00 71.78  ? 233  VAL C CB    1 
ATOM   7980  C  CG1   . VAL C  3  233 ? 55.652  54.636  77.441  1.00 69.19  ? 233  VAL C CG1   1 
ATOM   7981  C  CG2   . VAL C  3  233 ? 54.990  52.244  77.731  1.00 70.58  ? 233  VAL C CG2   1 
ATOM   7982  N  N     . VAL C  3  234 ? 58.985  54.010  78.674  1.00 72.32  ? 234  VAL C N     1 
ATOM   7983  C  CA    . VAL C  3  234 ? 59.991  55.009  79.001  1.00 73.36  ? 234  VAL C CA    1 
ATOM   7984  C  C     . VAL C  3  234 ? 61.306  54.693  78.248  1.00 74.56  ? 234  VAL C C     1 
ATOM   7985  O  O     . VAL C  3  234 ? 61.810  55.513  77.470  1.00 75.14  ? 234  VAL C O     1 
ATOM   7986  C  CB    . VAL C  3  234 ? 60.259  55.062  80.543  1.00 72.41  ? 234  VAL C CB    1 
ATOM   7987  C  CG1   . VAL C  3  234 ? 61.268  56.158  80.872  1.00 71.25  ? 234  VAL C CG1   1 
ATOM   7988  C  CG2   . VAL C  3  234 ? 58.961  55.315  81.305  1.00 70.46  ? 234  VAL C CG2   1 
ATOM   7989  N  N     . GLY C  3  235 ? 61.855  53.505  78.469  1.00 74.92  ? 235  GLY C N     1 
ATOM   7990  C  CA    . GLY C  3  235 ? 63.085  53.151  77.784  1.00 74.14  ? 235  GLY C CA    1 
ATOM   7991  C  C     . GLY C  3  235 ? 62.971  53.382  76.289  1.00 73.81  ? 235  GLY C C     1 
ATOM   7992  O  O     . GLY C  3  235 ? 63.869  53.941  75.659  1.00 73.30  ? 235  GLY C O     1 
ATOM   7993  N  N     . GLY C  3  236 ? 61.857  52.948  75.722  1.00 74.38  ? 236  GLY C N     1 
ATOM   7994  C  CA    . GLY C  3  236 ? 61.647  53.124  74.300  1.00 74.65  ? 236  GLY C CA    1 
ATOM   7995  C  C     . GLY C  3  236 ? 61.731  54.579  73.877  1.00 74.65  ? 236  GLY C C     1 
ATOM   7996  O  O     . GLY C  3  236 ? 62.224  54.878  72.795  1.00 74.55  ? 236  GLY C O     1 
ATOM   7997  N  N     . HIS C  3  237 ? 61.248  55.489  74.712  1.00 74.61  ? 237  HIS C N     1 
ATOM   7998  C  CA    . HIS C  3  237 ? 61.301  56.892  74.348  1.00 75.22  ? 237  HIS C CA    1 
ATOM   7999  C  C     . HIS C  3  237 ? 62.719  57.429  74.466  1.00 76.33  ? 237  HIS C C     1 
ATOM   8000  O  O     . HIS C  3  237 ? 63.156  58.225  73.622  1.00 76.91  ? 237  HIS C O     1 
ATOM   8001  C  CB    . HIS C  3  237 ? 60.328  57.709  75.205  1.00 74.57  ? 237  HIS C CB    1 
ATOM   8002  C  CG    . HIS C  3  237 ? 58.924  57.727  74.668  1.00 73.79  ? 237  HIS C CG    1 
ATOM   8003  N  ND1   . HIS C  3  237 ? 58.053  56.666  74.806  1.00 73.21  ? 237  HIS C ND1   1 
ATOM   8004  C  CD2   . HIS C  3  237 ? 58.257  58.667  73.955  1.00 72.79  ? 237  HIS C CD2   1 
ATOM   8005  C  CE1   . HIS C  3  237 ? 56.914  56.951  74.203  1.00 71.81  ? 237  HIS C CE1   1 
ATOM   8006  N  NE2   . HIS C  3  237 ? 57.012  58.160  73.677  1.00 72.13  ? 237  HIS C NE2   1 
ATOM   8007  N  N     . ILE C  3  238 ? 63.438  56.994  75.503  1.00 76.98  ? 238  ILE C N     1 
ATOM   8008  C  CA    . ILE C  3  238 ? 64.830  57.419  75.704  1.00 76.93  ? 238  ILE C CA    1 
ATOM   8009  C  C     . ILE C  3  238 ? 65.549  57.022  74.430  1.00 76.95  ? 238  ILE C C     1 
ATOM   8010  O  O     . ILE C  3  238 ? 66.310  57.786  73.844  1.00 76.19  ? 238  ILE C O     1 
ATOM   8011  C  CB    . ILE C  3  238 ? 65.512  56.675  76.890  1.00 77.23  ? 238  ILE C CB    1 
ATOM   8012  C  CG1   . ILE C  3  238 ? 64.888  57.102  78.233  1.00 76.86  ? 238  ILE C CG1   1 
ATOM   8013  C  CG2   . ILE C  3  238 ? 67.008  56.944  76.852  1.00 77.58  ? 238  ILE C CG2   1 
ATOM   8014  C  CD1   . ILE C  3  238 ? 65.568  56.501  79.477  1.00 76.01  ? 238  ILE C CD1   1 
ATOM   8015  N  N     . TRP C  3  239 ? 65.261  55.804  74.003  1.00 77.71  ? 239  TRP C N     1 
ATOM   8016  C  CA    . TRP C  3  239 ? 65.844  55.245  72.794  1.00 78.21  ? 239  TRP C CA    1 
ATOM   8017  C  C     . TRP C  3  239 ? 65.376  55.939  71.540  1.00 79.37  ? 239  TRP C C     1 
ATOM   8018  O  O     . TRP C  3  239 ? 65.712  55.484  70.448  1.00 80.52  ? 239  TRP C O     1 
ATOM   8019  C  CB    . TRP C  3  239 ? 65.495  53.767  72.684  1.00 76.15  ? 239  TRP C CB    1 
ATOM   8020  C  CG    . TRP C  3  239 ? 66.611  52.873  73.031  1.00 74.58  ? 239  TRP C CG    1 
ATOM   8021  C  CD1   . TRP C  3  239 ? 66.776  52.154  74.195  1.00 75.18  ? 239  TRP C CD1   1 
ATOM   8022  C  CD2   . TRP C  3  239 ? 67.680  52.499  72.171  1.00 73.65  ? 239  TRP C CD2   1 
ATOM   8023  N  NE1   . TRP C  3  239 ? 67.888  51.339  74.095  1.00 74.85  ? 239  TRP C NE1   1 
ATOM   8024  C  CE2   . TRP C  3  239 ? 68.457  51.530  72.859  1.00 74.10  ? 239  TRP C CE2   1 
ATOM   8025  C  CE3   . TRP C  3  239 ? 68.059  52.881  70.878  1.00 72.63  ? 239  TRP C CE3   1 
ATOM   8026  C  CZ2   . TRP C  3  239 ? 69.582  50.938  72.286  1.00 73.22  ? 239  TRP C CZ2   1 
ATOM   8027  C  CZ3   . TRP C  3  239 ? 69.172  52.297  70.314  1.00 71.94  ? 239  TRP C CZ3   1 
ATOM   8028  C  CH2   . TRP C  3  239 ? 69.921  51.331  71.017  1.00 72.86  ? 239  TRP C CH2   1 
ATOM   8029  N  N     . ILE C  3  240 ? 64.601  57.019  71.680  1.00 80.54  ? 240  ILE C N     1 
ATOM   8030  C  CA    . ILE C  3  240 ? 64.092  57.726  70.500  1.00 82.56  ? 240  ILE C CA    1 
ATOM   8031  C  C     . ILE C  3  240 ? 64.814  59.020  70.189  1.00 82.55  ? 240  ILE C C     1 
ATOM   8032  O  O     . ILE C  3  240 ? 65.224  59.218  69.047  1.00 84.37  ? 240  ILE C O     1 
ATOM   8033  C  CB    . ILE C  3  240 ? 62.548  58.027  70.572  1.00 82.69  ? 240  ILE C CB    1 
ATOM   8034  C  CG1   . ILE C  3  240 ? 61.754  56.878  69.935  1.00 83.60  ? 240  ILE C CG1   1 
ATOM   8035  C  CG2   . ILE C  3  240 ? 62.199  59.322  69.790  1.00 82.74  ? 240  ILE C CG2   1 
ATOM   8036  C  CD1   . ILE C  3  240 ? 62.006  56.706  68.435  1.00 83.78  ? 240  ILE C CD1   1 
ATOM   8037  N  N     . GLY C  3  241 ? 64.945  59.900  71.182  1.00 82.38  ? 241  GLY C N     1 
ATOM   8038  C  CA    . GLY C  3  241 ? 65.630  61.158  70.950  1.00 81.15  ? 241  GLY C CA    1 
ATOM   8039  C  C     . GLY C  3  241 ? 67.050  60.832  70.521  1.00 80.69  ? 241  GLY C C     1 
ATOM   8040  O  O     . GLY C  3  241 ? 67.572  61.339  69.508  1.00 79.97  ? 241  GLY C O     1 
ATOM   8041  N  N     . LEU C  3  242 ? 67.668  59.954  71.298  1.00 80.69  ? 242  LEU C N     1 
ATOM   8042  C  CA    . LEU C  3  242 ? 69.029  59.525  71.023  1.00 80.62  ? 242  LEU C CA    1 
ATOM   8043  C  C     . LEU C  3  242 ? 69.076  58.783  69.677  1.00 80.38  ? 242  LEU C C     1 
ATOM   8044  O  O     . LEU C  3  242 ? 69.951  57.928  69.446  1.00 82.02  ? 242  LEU C O     1 
ATOM   8045  C  CB    . LEU C  3  242 ? 69.514  58.637  72.178  1.00 79.90  ? 242  LEU C CB    1 
ATOM   8046  C  CG    . LEU C  3  242 ? 69.171  59.190  73.582  1.00 79.76  ? 242  LEU C CG    1 
ATOM   8047  C  CD1   . LEU C  3  242 ? 69.834  58.331  74.653  1.00 79.32  ? 242  LEU C CD1   1 
ATOM   8048  C  CD2   . LEU C  3  242 ? 69.615  60.647  73.722  1.00 77.81  ? 242  LEU C CD2   1 
ATOM   8049  N  N     . ILE C  3  243 ? 68.133  59.143  68.798  1.00 78.58  ? 243  ILE C N     1 
ATOM   8050  C  CA    . ILE C  3  243 ? 67.993  58.575  67.453  1.00 76.74  ? 243  ILE C CA    1 
ATOM   8051  C  C     . ILE C  3  243 ? 67.337  59.633  66.579  1.00 75.52  ? 243  ILE C C     1 
ATOM   8052  O  O     . ILE C  3  243 ? 67.752  59.906  65.457  1.00 74.45  ? 243  ILE C O     1 
ATOM   8053  C  CB    . ILE C  3  243 ? 67.042  57.329  67.415  1.00 77.10  ? 243  ILE C CB    1 
ATOM   8054  C  CG1   . ILE C  3  243 ? 67.659  56.152  68.172  1.00 77.53  ? 243  ILE C CG1   1 
ATOM   8055  C  CG2   . ILE C  3  243 ? 66.730  56.951  65.950  1.00 77.42  ? 243  ILE C CG2   1 
ATOM   8056  C  CD1   . ILE C  3  243 ? 66.952  54.812  67.918  1.00 76.97  ? 243  ILE C CD1   1 
ATOM   8057  N  N     . CYS C  3  244 ? 66.284  60.206  67.126  1.00 75.34  ? 244  CYS C N     1 
ATOM   8058  C  CA    . CYS C  3  244 ? 65.506  61.221  66.452  1.00 75.89  ? 244  CYS C CA    1 
ATOM   8059  C  C     . CYS C  3  244 ? 66.306  62.507  66.328  1.00 74.72  ? 244  CYS C C     1 
ATOM   8060  O  O     . CYS C  3  244 ? 66.192  63.222  65.329  1.00 73.23  ? 244  CYS C O     1 
ATOM   8061  C  CB    . CYS C  3  244 ? 64.216  61.475  67.242  1.00 77.53  ? 244  CYS C CB    1 
ATOM   8062  S  SG    . CYS C  3  244 ? 62.728  61.704  66.233  1.00 81.96  ? 244  CYS C SG    1 
ATOM   8063  N  N     . ILE C  3  245 ? 67.102  62.808  67.355  1.00 74.89  ? 245  ILE C N     1 
ATOM   8064  C  CA    . ILE C  3  245 ? 67.936  64.014  67.333  1.00 74.59  ? 245  ILE C CA    1 
ATOM   8065  C  C     . ILE C  3  245 ? 69.208  63.679  66.575  1.00 74.30  ? 245  ILE C C     1 
ATOM   8066  O  O     . ILE C  3  245 ? 69.787  64.539  65.919  1.00 74.32  ? 245  ILE C O     1 
ATOM   8067  C  CB    . ILE C  3  245 ? 68.342  64.505  68.735  1.00 74.11  ? 245  ILE C CB    1 
ATOM   8068  C  CG1   . ILE C  3  245 ? 67.130  64.569  69.665  1.00 72.76  ? 245  ILE C CG1   1 
ATOM   8069  C  CG2   . ILE C  3  245 ? 68.926  65.901  68.600  1.00 73.89  ? 245  ILE C CG2   1 
ATOM   8070  C  CD1   . ILE C  3  245 ? 67.467  65.028  71.052  1.00 70.33  ? 245  ILE C CD1   1 
ATOM   8071  N  N     . ALA C  3  246 ? 69.634  62.424  66.675  1.00 73.95  ? 246  ALA C N     1 
ATOM   8072  C  CA    . ALA C  3  246 ? 70.818  61.959  65.967  1.00 73.74  ? 246  ALA C CA    1 
ATOM   8073  C  C     . ALA C  3  246 ? 70.555  62.177  64.486  1.00 73.40  ? 246  ALA C C     1 
ATOM   8074  O  O     . ALA C  3  246 ? 71.484  62.370  63.691  1.00 73.93  ? 246  ALA C O     1 
ATOM   8075  C  CB    . ALA C  3  246 ? 71.062  60.477  66.241  1.00 74.57  ? 246  ALA C CB    1 
ATOM   8076  N  N     . GLY C  3  247 ? 69.278  62.139  64.126  1.00 72.19  ? 247  GLY C N     1 
ATOM   8077  C  CA    . GLY C  3  247 ? 68.893  62.350  62.745  1.00 71.27  ? 247  GLY C CA    1 
ATOM   8078  C  C     . GLY C  3  247 ? 68.717  63.828  62.478  1.00 70.86  ? 247  GLY C C     1 
ATOM   8079  O  O     . GLY C  3  247 ? 69.035  64.310  61.398  1.00 71.14  ? 247  GLY C O     1 
ATOM   8080  N  N     . GLY C  3  248 ? 68.206  64.546  63.467  1.00 72.11  ? 248  GLY C N     1 
ATOM   8081  C  CA    . GLY C  3  248 ? 67.986  65.970  63.308  1.00 73.08  ? 248  GLY C CA    1 
ATOM   8082  C  C     . GLY C  3  248 ? 69.289  66.649  62.943  1.00 74.08  ? 248  GLY C C     1 
ATOM   8083  O  O     . GLY C  3  248 ? 69.310  67.711  62.303  1.00 75.56  ? 248  GLY C O     1 
ATOM   8084  N  N     . ILE C  3  249 ? 70.390  66.032  63.349  1.00 72.89  ? 249  ILE C N     1 
ATOM   8085  C  CA    . ILE C  3  249 ? 71.696  66.588  63.042  1.00 71.65  ? 249  ILE C CA    1 
ATOM   8086  C  C     . ILE C  3  249 ? 72.150  66.150  61.653  1.00 71.13  ? 249  ILE C C     1 
ATOM   8087  O  O     . ILE C  3  249 ? 72.419  66.991  60.793  1.00 68.97  ? 249  ILE C O     1 
ATOM   8088  C  CB    . ILE C  3  249 ? 72.723  66.155  64.094  1.00 71.16  ? 249  ILE C CB    1 
ATOM   8089  C  CG1   . ILE C  3  249 ? 72.632  67.080  65.314  1.00 68.97  ? 249  ILE C CG1   1 
ATOM   8090  C  CG2   . ILE C  3  249 ? 74.109  66.173  63.495  1.00 71.00  ? 249  ILE C CG2   1 
ATOM   8091  C  CD1   . ILE C  3  249 ? 71.288  67.081  65.965  1.00 68.56  ? 249  ILE C CD1   1 
ATOM   8092  N  N     . TRP C  3  250 ? 72.225  64.835  61.453  1.00 72.24  ? 250  TRP C N     1 
ATOM   8093  C  CA    . TRP C  3  250 ? 72.626  64.255  60.174  1.00 74.08  ? 250  TRP C CA    1 
ATOM   8094  C  C     . TRP C  3  250 ? 71.984  64.947  58.978  1.00 75.46  ? 250  TRP C C     1 
ATOM   8095  O  O     . TRP C  3  250 ? 72.525  64.924  57.868  1.00 75.98  ? 250  TRP C O     1 
ATOM   8096  C  CB    . TRP C  3  250 ? 72.273  62.763  60.132  1.00 73.46  ? 250  TRP C CB    1 
ATOM   8097  C  CG    . TRP C  3  250 ? 72.372  62.121  58.752  1.00 74.13  ? 250  TRP C CG    1 
ATOM   8098  C  CD1   . TRP C  3  250 ? 71.531  62.316  57.683  1.00 75.05  ? 250  TRP C CD1   1 
ATOM   8099  C  CD2   . TRP C  3  250 ? 73.360  61.183  58.309  1.00 74.60  ? 250  TRP C CD2   1 
ATOM   8100  N  NE1   . TRP C  3  250 ? 71.937  61.561  56.608  1.00 74.05  ? 250  TRP C NE1   1 
ATOM   8101  C  CE2   . TRP C  3  250 ? 73.056  60.855  56.964  1.00 74.82  ? 250  TRP C CE2   1 
ATOM   8102  C  CE3   . TRP C  3  250 ? 74.475  60.581  58.916  1.00 74.84  ? 250  TRP C CE3   1 
ATOM   8103  C  CZ2   . TRP C  3  250 ? 73.831  59.952  56.219  1.00 74.24  ? 250  TRP C CZ2   1 
ATOM   8104  C  CZ3   . TRP C  3  250 ? 75.243  59.681  58.173  1.00 73.78  ? 250  TRP C CZ3   1 
ATOM   8105  C  CH2   . TRP C  3  250 ? 74.915  59.379  56.840  1.00 73.55  ? 250  TRP C CH2   1 
ATOM   8106  N  N     . HIS C  3  251 ? 70.826  65.552  59.194  1.00 77.65  ? 251  HIS C N     1 
ATOM   8107  C  CA    . HIS C  3  251 ? 70.122  66.229  58.104  1.00 79.47  ? 251  HIS C CA    1 
ATOM   8108  C  C     . HIS C  3  251 ? 70.523  67.706  57.935  1.00 79.55  ? 251  HIS C C     1 
ATOM   8109  O  O     . HIS C  3  251 ? 70.613  68.231  56.792  1.00 79.02  ? 251  HIS C O     1 
ATOM   8110  C  CB    . HIS C  3  251 ? 68.607  66.092  58.310  1.00 81.53  ? 251  HIS C CB    1 
ATOM   8111  C  CG    . HIS C  3  251 ? 68.078  64.725  57.979  1.00 83.00  ? 251  HIS C CG    1 
ATOM   8112  N  ND1   . HIS C  3  251 ? 68.310  64.110  56.765  1.00 83.16  ? 251  HIS C ND1   1 
ATOM   8113  C  CD2   . HIS C  3  251 ? 67.317  63.861  58.696  1.00 84.09  ? 251  HIS C CD2   1 
ATOM   8114  C  CE1   . HIS C  3  251 ? 67.714  62.930  56.749  1.00 83.70  ? 251  HIS C CE1   1 
ATOM   8115  N  NE2   . HIS C  3  251 ? 67.104  62.754  57.908  1.00 84.18  ? 251  HIS C NE2   1 
ATOM   8116  N  N     . ILE C  3  252 ? 70.768  68.377  59.064  1.00 78.85  ? 252  ILE C N     1 
ATOM   8117  C  CA    . ILE C  3  252 ? 71.178  69.769  58.984  1.00 77.69  ? 252  ILE C CA    1 
ATOM   8118  C  C     . ILE C  3  252 ? 72.595  69.756  58.482  1.00 77.36  ? 252  ILE C C     1 
ATOM   8119  O  O     . ILE C  3  252 ? 73.122  70.795  58.143  1.00 77.50  ? 252  ILE C O     1 
ATOM   8120  C  CB    . ILE C  3  252 ? 71.191  70.484  60.334  1.00 77.55  ? 252  ILE C CB    1 
ATOM   8121  C  CG1   . ILE C  3  252 ? 69.874  70.273  61.080  1.00 78.41  ? 252  ILE C CG1   1 
ATOM   8122  C  CG2   . ILE C  3  252 ? 71.346  71.972  60.092  1.00 76.52  ? 252  ILE C CG2   1 
ATOM   8123  C  CD1   . ILE C  3  252 ? 69.771  71.062  62.392  1.00 79.29  ? 252  ILE C CD1   1 
ATOM   8124  N  N     . LEU C  3  253 ? 73.201  68.575  58.419  1.00 76.47  ? 253  LEU C N     1 
ATOM   8125  C  CA    . LEU C  3  253 ? 74.574  68.452  57.953  1.00 75.68  ? 253  LEU C CA    1 
ATOM   8126  C  C     . LEU C  3  253 ? 74.770  67.717  56.628  1.00 76.82  ? 253  LEU C C     1 
ATOM   8127  O  O     . LEU C  3  253 ? 75.898  67.349  56.300  1.00 77.60  ? 253  LEU C O     1 
ATOM   8128  C  CB    . LEU C  3  253 ? 75.418  67.775  59.028  1.00 73.89  ? 253  LEU C CB    1 
ATOM   8129  C  CG    . LEU C  3  253 ? 75.503  68.519  60.360  1.00 72.98  ? 253  LEU C CG    1 
ATOM   8130  C  CD1   . LEU C  3  253 ? 76.164  67.663  61.407  1.00 71.86  ? 253  LEU C CD1   1 
ATOM   8131  C  CD2   . LEU C  3  253 ? 76.289  69.781  60.173  1.00 71.45  ? 253  LEU C CD2   1 
ATOM   8132  N  N     . THR C  3  254 ? 73.696  67.488  55.866  1.00 77.48  ? 254  THR C N     1 
ATOM   8133  C  CA    . THR C  3  254 ? 73.821  66.787  54.574  1.00 77.30  ? 254  THR C CA    1 
ATOM   8134  C  C     . THR C  3  254 ? 72.689  67.024  53.573  1.00 78.94  ? 254  THR C C     1 
ATOM   8135  O  O     . THR C  3  254 ? 71.754  67.813  53.813  1.00 80.65  ? 254  THR C O     1 
ATOM   8136  C  CB    . THR C  3  254 ? 73.900  65.261  54.744  1.00 75.01  ? 254  THR C CB    1 
ATOM   8137  O  OG1   . THR C  3  254 ? 74.444  64.950  56.023  1.00 73.32  ? 254  THR C OG1   1 
ATOM   8138  C  CG2   . THR C  3  254 ? 74.781  64.658  53.655  1.00 74.03  ? 254  THR C CG2   1 
ATOM   8139  N  N     . THR C  3  255 ? 72.794  66.302  52.455  1.00 78.92  ? 255  THR C N     1 
ATOM   8140  C  CA    . THR C  3  255 ? 71.829  66.337  51.359  1.00 78.39  ? 255  THR C CA    1 
ATOM   8141  C  C     . THR C  3  255 ? 71.502  64.916  50.854  1.00 78.31  ? 255  THR C C     1 
ATOM   8142  O  O     . THR C  3  255 ? 72.339  63.998  50.917  1.00 77.40  ? 255  THR C O     1 
ATOM   8143  C  CB    . THR C  3  255 ? 72.358  67.217  50.211  1.00 78.03  ? 255  THR C CB    1 
ATOM   8144  O  OG1   . THR C  3  255 ? 72.107  68.591  50.540  1.00 76.75  ? 255  THR C OG1   1 
ATOM   8145  C  CG2   . THR C  3  255 ? 71.698  66.858  48.882  1.00 76.37  ? 255  THR C CG2   1 
ATOM   8146  N  N     . PRO C  3  256 ? 70.263  64.719  50.364  1.00 78.42  ? 256  PRO C N     1 
ATOM   8147  C  CA    . PRO C  3  256 ? 69.847  63.405  49.863  1.00 78.05  ? 256  PRO C CA    1 
ATOM   8148  C  C     . PRO C  3  256 ? 70.871  62.812  48.902  1.00 77.57  ? 256  PRO C C     1 
ATOM   8149  O  O     . PRO C  3  256 ? 71.352  63.502  47.995  1.00 76.98  ? 256  PRO C O     1 
ATOM   8150  C  CB    . PRO C  3  256 ? 68.511  63.702  49.167  1.00 77.74  ? 256  PRO C CB    1 
ATOM   8151  C  CG    . PRO C  3  256 ? 67.939  64.803  50.010  1.00 77.61  ? 256  PRO C CG    1 
ATOM   8152  C  CD    . PRO C  3  256 ? 69.162  65.697  50.238  1.00 78.17  ? 256  PRO C CD    1 
ATOM   8153  N  N     . PHE C  3  257 ? 71.193  61.536  49.105  1.00 75.76  ? 257  PHE C N     1 
ATOM   8154  C  CA    . PHE C  3  257 ? 72.149  60.848  48.255  1.00 75.11  ? 257  PHE C CA    1 
ATOM   8155  C  C     . PHE C  3  257 ? 71.589  60.676  46.841  1.00 75.67  ? 257  PHE C C     1 
ATOM   8156  O  O     . PHE C  3  257 ? 70.556  61.253  46.488  1.00 76.25  ? 257  PHE C O     1 
ATOM   8157  C  CB    . PHE C  3  257 ? 72.494  59.482  48.842  1.00 74.63  ? 257  PHE C CB    1 
ATOM   8158  C  CG    . PHE C  3  257 ? 73.191  59.544  50.185  1.00 74.63  ? 257  PHE C CG    1 
ATOM   8159  C  CD1   . PHE C  3  257 ? 73.235  60.740  50.922  1.00 73.68  ? 257  PHE C CD1   1 
ATOM   8160  C  CD2   . PHE C  3  257 ? 73.750  58.383  50.745  1.00 73.87  ? 257  PHE C CD2   1 
ATOM   8161  C  CE1   . PHE C  3  257 ? 73.821  60.772  52.200  1.00 73.57  ? 257  PHE C CE1   1 
ATOM   8162  C  CE2   . PHE C  3  257 ? 74.336  58.405  52.018  1.00 72.78  ? 257  PHE C CE2   1 
ATOM   8163  C  CZ    . PHE C  3  257 ? 74.372  59.603  52.753  1.00 72.67  ? 257  PHE C CZ    1 
ATOM   8164  N  N     . GLY C  3  258 ? 72.276  59.880  46.031  1.00 76.42  ? 258  GLY C N     1 
ATOM   8165  C  CA    . GLY C  3  258 ? 71.850  59.658  44.654  1.00 75.74  ? 258  GLY C CA    1 
ATOM   8166  C  C     . GLY C  3  258 ? 70.473  59.043  44.481  1.00 74.97  ? 258  GLY C C     1 
ATOM   8167  O  O     . GLY C  3  258 ? 69.575  59.649  43.878  1.00 73.96  ? 258  GLY C O     1 
ATOM   8168  N  N     . TRP C  3  259 ? 70.318  57.831  45.002  1.00 74.62  ? 259  TRP C N     1 
ATOM   8169  C  CA    . TRP C  3  259 ? 69.052  57.132  44.903  1.00 75.15  ? 259  TRP C CA    1 
ATOM   8170  C  C     . TRP C  3  259 ? 67.939  57.993  45.467  1.00 75.46  ? 259  TRP C C     1 
ATOM   8171  O  O     . TRP C  3  259 ? 66.868  58.105  44.864  1.00 75.40  ? 259  TRP C O     1 
ATOM   8172  C  CB    . TRP C  3  259 ? 69.110  55.838  45.674  1.00 75.79  ? 259  TRP C CB    1 
ATOM   8173  C  CG    . TRP C  3  259 ? 69.645  56.003  47.047  1.00 77.41  ? 259  TRP C CG    1 
ATOM   8174  C  CD1   . TRP C  3  259 ? 70.944  56.221  47.395  1.00 77.74  ? 259  TRP C CD1   1 
ATOM   8175  C  CD2   . TRP C  3  259 ? 68.915  55.861  48.277  1.00 78.67  ? 259  TRP C CD2   1 
ATOM   8176  N  NE1   . TRP C  3  259 ? 71.080  56.205  48.768  1.00 78.85  ? 259  TRP C NE1   1 
ATOM   8177  C  CE2   . TRP C  3  259 ? 69.849  55.990  49.333  1.00 79.19  ? 259  TRP C CE2   1 
ATOM   8178  C  CE3   . TRP C  3  259 ? 67.560  55.633  48.591  1.00 78.89  ? 259  TRP C CE3   1 
ATOM   8179  C  CZ2   . TRP C  3  259 ? 69.471  55.901  50.683  1.00 79.30  ? 259  TRP C CZ2   1 
ATOM   8180  C  CZ3   . TRP C  3  259 ? 67.187  55.542  49.928  1.00 78.24  ? 259  TRP C CZ3   1 
ATOM   8181  C  CH2   . TRP C  3  259 ? 68.142  55.677  50.959  1.00 79.05  ? 259  TRP C CH2   1 
ATOM   8182  N  N     . ALA C  3  260 ? 68.192  58.586  46.630  1.00 75.22  ? 260  ALA C N     1 
ATOM   8183  C  CA    . ALA C  3  260 ? 67.217  59.458  47.255  1.00 75.29  ? 260  ALA C CA    1 
ATOM   8184  C  C     . ALA C  3  260 ? 66.646  60.450  46.229  1.00 76.28  ? 260  ALA C C     1 
ATOM   8185  O  O     . ALA C  3  260 ? 65.430  60.628  46.106  1.00 76.49  ? 260  ALA C O     1 
ATOM   8186  C  CB    . ALA C  3  260 ? 67.861  60.209  48.404  1.00 74.06  ? 260  ALA C CB    1 
ATOM   8187  N  N     . ARG C  3  261 ? 67.523  61.085  45.474  1.00 78.66  ? 261  ARG C N     1 
ATOM   8188  C  CA    . ARG C  3  261 ? 67.055  62.051  44.503  1.00 80.98  ? 261  ARG C CA    1 
ATOM   8189  C  C     . ARG C  3  261 ? 66.302  61.407  43.338  1.00 81.24  ? 261  ARG C C     1 
ATOM   8190  O  O     . ARG C  3  261 ? 65.200  61.843  42.991  1.00 81.11  ? 261  ARG C O     1 
ATOM   8191  C  CB    . ARG C  3  261 ? 68.228  62.872  43.973  1.00 83.73  ? 261  ARG C CB    1 
ATOM   8192  C  CG    . ARG C  3  261 ? 69.005  63.707  44.987  1.00 86.72  ? 261  ARG C CG    1 
ATOM   8193  C  CD    . ARG C  3  261 ? 70.032  64.538  44.193  1.00 90.78  ? 261  ARG C CD    1 
ATOM   8194  N  NE    . ARG C  3  261 ? 70.463  63.818  42.978  1.00 94.07  ? 261  ARG C NE    1 
ATOM   8195  C  CZ    . ARG C  3  261 ? 71.082  64.366  41.921  1.00 95.84  ? 261  ARG C CZ    1 
ATOM   8196  N  NH1   . ARG C  3  261 ? 71.373  65.671  41.900  1.00 96.50  ? 261  ARG C NH1   1 
ATOM   8197  N  NH2   . ARG C  3  261 ? 71.387  63.609  40.855  1.00 96.64  ? 261  ARG C NH2   1 
ATOM   8198  N  N     . ARG C  3  262 ? 66.895  60.382  42.726  1.00 81.35  ? 262  ARG C N     1 
ATOM   8199  C  CA    . ARG C  3  262 ? 66.248  59.684  41.597  1.00 81.29  ? 262  ARG C CA    1 
ATOM   8200  C  C     . ARG C  3  262 ? 65.078  58.770  42.051  1.00 80.81  ? 262  ARG C C     1 
ATOM   8201  O  O     . ARG C  3  262 ? 64.589  57.921  41.286  1.00 80.47  ? 262  ARG C O     1 
ATOM   8202  C  CB    . ARG C  3  262 ? 67.278  58.845  40.827  1.00 81.46  ? 262  ARG C CB    1 
ATOM   8203  C  CG    . ARG C  3  262 ? 68.372  59.626  40.122  1.00 81.25  ? 262  ARG C CG    1 
ATOM   8204  C  CD    . ARG C  3  262 ? 69.739  59.239  40.688  1.00 81.18  ? 262  ARG C CD    1 
ATOM   8205  N  NE    . ARG C  3  262 ? 69.731  57.846  41.104  1.00 82.29  ? 262  ARG C NE    1 
ATOM   8206  C  CZ    . ARG C  3  262 ? 70.756  57.212  41.661  1.00 82.64  ? 262  ARG C CZ    1 
ATOM   8207  N  NH1   . ARG C  3  262 ? 71.897  57.856  41.866  1.00 81.52  ? 262  ARG C NH1   1 
ATOM   8208  N  NH2   . ARG C  3  262 ? 70.629  55.931  42.029  1.00 82.88  ? 262  ARG C NH2   1 
ATOM   8209  N  N     . ALA C  3  263 ? 64.639  58.965  43.295  1.00 80.06  ? 263  ALA C N     1 
ATOM   8210  C  CA    . ALA C  3  263 ? 63.551  58.191  43.859  1.00 78.31  ? 263  ALA C CA    1 
ATOM   8211  C  C     . ALA C  3  263 ? 62.300  59.028  44.102  1.00 77.53  ? 263  ALA C C     1 
ATOM   8212  O  O     . ALA C  3  263 ? 61.219  58.698  43.598  1.00 77.97  ? 263  ALA C O     1 
ATOM   8213  C  CB    . ALA C  3  263 ? 63.992  57.544  45.159  1.00 77.99  ? 263  ALA C CB    1 
ATOM   8214  N  N     . PHE C  3  264 ? 62.434  60.119  44.847  1.00 76.26  ? 264  PHE C N     1 
ATOM   8215  C  CA    . PHE C  3  264 ? 61.254  60.930  45.174  1.00 75.44  ? 264  PHE C CA    1 
ATOM   8216  C  C     . PHE C  3  264 ? 61.016  62.092  44.256  1.00 74.47  ? 264  PHE C C     1 
ATOM   8217  O  O     . PHE C  3  264 ? 61.897  62.470  43.491  1.00 75.93  ? 264  PHE C O     1 
ATOM   8218  C  CB    . PHE C  3  264 ? 61.371  61.468  46.599  1.00 74.21  ? 264  PHE C CB    1 
ATOM   8219  C  CG    . PHE C  3  264 ? 61.841  60.444  47.577  1.00 74.09  ? 264  PHE C CG    1 
ATOM   8220  C  CD1   . PHE C  3  264 ? 60.956  59.844  48.459  1.00 73.83  ? 264  PHE C CD1   1 
ATOM   8221  C  CD2   . PHE C  3  264 ? 63.177  60.057  47.597  1.00 74.39  ? 264  PHE C CD2   1 
ATOM   8222  C  CE1   . PHE C  3  264 ? 61.401  58.869  49.356  1.00 74.14  ? 264  PHE C CE1   1 
ATOM   8223  C  CE2   . PHE C  3  264 ? 63.629  59.086  48.483  1.00 74.83  ? 264  PHE C CE2   1 
ATOM   8224  C  CZ    . PHE C  3  264 ? 62.743  58.488  49.368  1.00 74.56  ? 264  PHE C CZ    1 
ATOM   8225  N  N     . ILE C  3  265 ? 59.815  62.648  44.334  1.00 72.57  ? 265  ILE C N     1 
ATOM   8226  C  CA    . ILE C  3  265 ? 59.470  63.823  43.554  1.00 70.66  ? 265  ILE C CA    1 
ATOM   8227  C  C     . ILE C  3  265 ? 59.727  64.980  44.504  1.00 69.38  ? 265  ILE C C     1 
ATOM   8228  O  O     . ILE C  3  265 ? 59.193  65.009  45.606  1.00 70.17  ? 265  ILE C O     1 
ATOM   8229  C  CB    . ILE C  3  265 ? 57.977  63.797  43.090  1.00 69.91  ? 265  ILE C CB    1 
ATOM   8230  C  CG1   . ILE C  3  265 ? 57.903  63.355  41.630  1.00 70.54  ? 265  ILE C CG1   1 
ATOM   8231  C  CG2   . ILE C  3  265 ? 57.346  65.169  43.166  1.00 69.06  ? 265  ILE C CG2   1 
ATOM   8232  C  CD1   . ILE C  3  265 ? 58.629  62.060  41.341  1.00 71.69  ? 265  ILE C CD1   1 
ATOM   8233  N  N     . TRP C  3  266 ? 60.564  65.918  44.093  1.00 68.77  ? 266  TRP C N     1 
ATOM   8234  C  CA    . TRP C  3  266 ? 60.871  67.065  44.934  1.00 68.10  ? 266  TRP C CA    1 
ATOM   8235  C  C     . TRP C  3  266 ? 59.971  68.245  44.596  1.00 67.86  ? 266  TRP C C     1 
ATOM   8236  O  O     . TRP C  3  266 ? 60.325  69.119  43.809  1.00 66.23  ? 266  TRP C O     1 
ATOM   8237  C  CB    . TRP C  3  266 ? 62.342  67.409  44.771  1.00 66.88  ? 266  TRP C CB    1 
ATOM   8238  C  CG    . TRP C  3  266 ? 63.163  66.204  44.970  1.00 65.55  ? 266  TRP C CG    1 
ATOM   8239  C  CD1   . TRP C  3  266 ? 63.388  65.204  44.060  1.00 66.28  ? 266  TRP C CD1   1 
ATOM   8240  C  CD2   . TRP C  3  266 ? 63.809  65.802  46.179  1.00 63.80  ? 266  TRP C CD2   1 
ATOM   8241  N  NE1   . TRP C  3  266 ? 64.137  64.199  44.638  1.00 66.19  ? 266  TRP C NE1   1 
ATOM   8242  C  CE2   . TRP C  3  266 ? 64.409  64.542  45.935  1.00 63.78  ? 266  TRP C CE2   1 
ATOM   8243  C  CE3   . TRP C  3  266 ? 63.941  66.381  47.441  1.00 61.74  ? 266  TRP C CE3   1 
ATOM   8244  C  CZ2   . TRP C  3  266 ? 65.127  63.859  46.907  1.00 62.01  ? 266  TRP C CZ2   1 
ATOM   8245  C  CZ3   . TRP C  3  266 ? 64.657  65.701  48.410  1.00 61.90  ? 266  TRP C CZ3   1 
ATOM   8246  C  CH2   . TRP C  3  266 ? 65.243  64.451  48.138  1.00 61.91  ? 266  TRP C CH2   1 
ATOM   8247  N  N     . SER C  3  267 ? 58.796  68.242  45.202  1.00 68.65  ? 267  SER C N     1 
ATOM   8248  C  CA    . SER C  3  267 ? 57.802  69.270  44.981  1.00 70.43  ? 267  SER C CA    1 
ATOM   8249  C  C     . SER C  3  267 ? 57.151  69.594  46.307  1.00 71.35  ? 267  SER C C     1 
ATOM   8250  O  O     . SER C  3  267 ? 57.041  68.728  47.173  1.00 70.63  ? 267  SER C O     1 
ATOM   8251  C  CB    . SER C  3  267 ? 56.730  68.777  44.005  1.00 69.54  ? 267  SER C CB    1 
ATOM   8252  O  OG    . SER C  3  267 ? 55.568  69.581  44.078  1.00 70.91  ? 267  SER C OG    1 
ATOM   8253  N  N     . GLY C  3  268 ? 56.705  70.835  46.467  1.00 73.91  ? 268  GLY C N     1 
ATOM   8254  C  CA    . GLY C  3  268 ? 56.055  71.218  47.718  1.00 74.87  ? 268  GLY C CA    1 
ATOM   8255  C  C     . GLY C  3  268 ? 54.885  70.287  47.986  1.00 74.58  ? 268  GLY C C     1 
ATOM   8256  O  O     . GLY C  3  268 ? 54.782  69.676  49.055  1.00 73.76  ? 268  GLY C O     1 
ATOM   8257  N  N     . GLU C  3  269 ? 54.005  70.191  46.996  1.00 74.20  ? 269  GLU C N     1 
ATOM   8258  C  CA    . GLU C  3  269 ? 52.856  69.317  47.090  1.00 74.04  ? 269  GLU C CA    1 
ATOM   8259  C  C     . GLU C  3  269 ? 53.316  67.893  47.361  1.00 73.67  ? 269  GLU C C     1 
ATOM   8260  O  O     . GLU C  3  269 ? 52.757  67.212  48.214  1.00 73.86  ? 269  GLU C O     1 
ATOM   8261  C  CB    . GLU C  3  269 ? 52.042  69.362  45.798  1.00 73.92  ? 269  GLU C CB    1 
ATOM   8262  C  CG    . GLU C  3  269 ? 51.023  68.246  45.711  1.00 74.85  ? 269  GLU C CG    1 
ATOM   8263  C  CD    . GLU C  3  269 ? 49.896  68.546  44.744  1.00 75.64  ? 269  GLU C CD    1 
ATOM   8264  O  OE1   . GLU C  3  269 ? 50.176  68.995  43.608  1.00 75.76  ? 269  GLU C OE1   1 
ATOM   8265  O  OE2   . GLU C  3  269 ? 48.729  68.319  45.124  1.00 75.51  ? 269  GLU C OE2   1 
ATOM   8266  N  N     . ALA C  3  270 ? 54.329  67.436  46.636  1.00 72.98  ? 270  ALA C N     1 
ATOM   8267  C  CA    . ALA C  3  270 ? 54.826  66.084  46.859  1.00 72.19  ? 270  ALA C CA    1 
ATOM   8268  C  C     . ALA C  3  270 ? 55.331  65.933  48.301  1.00 71.97  ? 270  ALA C C     1 
ATOM   8269  O  O     . ALA C  3  270 ? 55.124  64.898  48.925  1.00 73.18  ? 270  ALA C O     1 
ATOM   8270  C  CB    . ALA C  3  270 ? 55.928  65.761  45.887  1.00 71.82  ? 270  ALA C CB    1 
ATOM   8271  N  N     . TYR C  3  271 ? 55.977  66.954  48.845  1.00 71.11  ? 271  TYR C N     1 
ATOM   8272  C  CA    . TYR C  3  271 ? 56.467  66.821  50.205  1.00 70.27  ? 271  TYR C CA    1 
ATOM   8273  C  C     . TYR C  3  271 ? 55.290  66.595  51.119  1.00 68.82  ? 271  TYR C C     1 
ATOM   8274  O  O     . TYR C  3  271 ? 55.362  65.795  52.063  1.00 68.85  ? 271  TYR C O     1 
ATOM   8275  C  CB    . TYR C  3  271 ? 57.265  68.060  50.647  1.00 72.06  ? 271  TYR C CB    1 
ATOM   8276  C  CG    . TYR C  3  271 ? 58.529  68.250  49.846  1.00 75.42  ? 271  TYR C CG    1 
ATOM   8277  C  CD1   . TYR C  3  271 ? 59.436  67.198  49.684  1.00 76.66  ? 271  TYR C CD1   1 
ATOM   8278  C  CD2   . TYR C  3  271 ? 58.758  69.431  49.132  1.00 77.76  ? 271  TYR C CD2   1 
ATOM   8279  C  CE1   . TYR C  3  271 ? 60.521  67.307  48.818  1.00 78.47  ? 271  TYR C CE1   1 
ATOM   8280  C  CE2   . TYR C  3  271 ? 59.854  69.549  48.254  1.00 78.92  ? 271  TYR C CE2   1 
ATOM   8281  C  CZ    . TYR C  3  271 ? 60.718  68.479  48.104  1.00 79.29  ? 271  TYR C CZ    1 
ATOM   8282  O  OH    . TYR C  3  271 ? 61.754  68.554  47.208  1.00 81.61  ? 271  TYR C OH    1 
ATOM   8283  N  N     . LEU C  3  272 ? 54.202  67.302  50.826  1.00 66.61  ? 272  LEU C N     1 
ATOM   8284  C  CA    . LEU C  3  272 ? 52.992  67.197  51.626  1.00 63.54  ? 272  LEU C CA    1 
ATOM   8285  C  C     . LEU C  3  272 ? 52.605  65.739  51.637  1.00 63.39  ? 272  LEU C C     1 
ATOM   8286  O  O     . LEU C  3  272 ? 52.612  65.098  52.683  1.00 61.52  ? 272  LEU C O     1 
ATOM   8287  C  CB    . LEU C  3  272 ? 51.860  68.041  51.014  1.00 61.57  ? 272  LEU C CB    1 
ATOM   8288  C  CG    . LEU C  3  272 ? 50.453  67.924  51.621  1.00 59.73  ? 272  LEU C CG    1 
ATOM   8289  C  CD1   . LEU C  3  272 ? 50.444  68.467  53.030  1.00 58.87  ? 272  LEU C CD1   1 
ATOM   8290  C  CD2   . LEU C  3  272 ? 49.451  68.674  50.774  1.00 58.66  ? 272  LEU C CD2   1 
ATOM   8291  N  N     . SER C  3  273 ? 52.303  65.221  50.451  1.00 63.88  ? 273  SER C N     1 
ATOM   8292  C  CA    . SER C  3  273 ? 51.881  63.841  50.266  1.00 65.26  ? 273  SER C CA    1 
ATOM   8293  C  C     . SER C  3  273 ? 52.567  62.861  51.207  1.00 66.11  ? 273  SER C C     1 
ATOM   8294  O  O     . SER C  3  273 ? 51.899  62.219  52.013  1.00 66.66  ? 273  SER C O     1 
ATOM   8295  C  CB    . SER C  3  273 ? 52.104  63.406  48.814  1.00 65.29  ? 273  SER C CB    1 
ATOM   8296  O  OG    . SER C  3  273 ? 53.428  62.965  48.590  1.00 66.12  ? 273  SER C OG    1 
ATOM   8297  N  N     . TYR C  3  274 ? 53.888  62.747  51.110  1.00 66.45  ? 274  TYR C N     1 
ATOM   8298  C  CA    . TYR C  3  274 ? 54.632  61.827  51.970  1.00 67.13  ? 274  TYR C CA    1 
ATOM   8299  C  C     . TYR C  3  274 ? 54.273  62.015  53.435  1.00 66.94  ? 274  TYR C C     1 
ATOM   8300  O  O     . TYR C  3  274 ? 54.107  61.044  54.170  1.00 66.19  ? 274  TYR C O     1 
ATOM   8301  C  CB    . TYR C  3  274 ? 56.135  62.031  51.836  1.00 67.71  ? 274  TYR C CB    1 
ATOM   8302  C  CG    . TYR C  3  274 ? 56.625  62.304  50.445  1.00 69.13  ? 274  TYR C CG    1 
ATOM   8303  C  CD1   . TYR C  3  274 ? 56.265  61.495  49.370  1.00 69.39  ? 274  TYR C CD1   1 
ATOM   8304  C  CD2   . TYR C  3  274 ? 57.465  63.383  50.204  1.00 70.52  ? 274  TYR C CD2   1 
ATOM   8305  C  CE1   . TYR C  3  274 ? 56.731  61.760  48.097  1.00 70.80  ? 274  TYR C CE1   1 
ATOM   8306  C  CE2   . TYR C  3  274 ? 57.934  63.657  48.934  1.00 71.35  ? 274  TYR C CE2   1 
ATOM   8307  C  CZ    . TYR C  3  274 ? 57.562  62.847  47.887  1.00 72.04  ? 274  TYR C CZ    1 
ATOM   8308  O  OH    . TYR C  3  274 ? 58.001  63.171  46.627  1.00 75.03  ? 274  TYR C OH    1 
ATOM   8309  N  N     . SER C  3  275 ? 54.180  63.273  53.864  1.00 67.37  ? 275  SER C N     1 
ATOM   8310  C  CA    . SER C  3  275 ? 53.836  63.590  55.253  1.00 66.84  ? 275  SER C CA    1 
ATOM   8311  C  C     . SER C  3  275 ? 52.334  63.297  55.504  1.00 66.42  ? 275  SER C C     1 
ATOM   8312  O  O     . SER C  3  275 ? 51.906  63.115  56.647  1.00 66.58  ? 275  SER C O     1 
ATOM   8313  C  CB    . SER C  3  275 ? 54.201  65.064  55.573  1.00 65.60  ? 275  SER C CB    1 
ATOM   8314  O  OG    . SER C  3  275 ? 55.579  65.339  55.310  1.00 63.65  ? 275  SER C OG    1 
ATOM   8315  N  N     . LEU C  3  276 ? 51.547  63.233  54.434  1.00 65.14  ? 276  LEU C N     1 
ATOM   8316  C  CA    . LEU C  3  276 ? 50.126  62.937  54.559  1.00 64.93  ? 276  LEU C CA    1 
ATOM   8317  C  C     . LEU C  3  276 ? 49.945  61.472  54.876  1.00 65.27  ? 276  LEU C C     1 
ATOM   8318  O  O     . LEU C  3  276 ? 49.269  61.137  55.844  1.00 67.00  ? 276  LEU C O     1 
ATOM   8319  C  CB    . LEU C  3  276 ? 49.390  63.265  53.274  1.00 63.10  ? 276  LEU C CB    1 
ATOM   8320  C  CG    . LEU C  3  276 ? 48.601  64.561  53.369  1.00 62.02  ? 276  LEU C CG    1 
ATOM   8321  C  CD1   . LEU C  3  276 ? 48.075  64.945  52.020  1.00 60.79  ? 276  LEU C CD1   1 
ATOM   8322  C  CD2   . LEU C  3  276 ? 47.478  64.365  54.345  1.00 62.50  ? 276  LEU C CD2   1 
ATOM   8323  N  N     . GLY C  3  277 ? 50.552  60.611  54.060  1.00 65.42  ? 277  GLY C N     1 
ATOM   8324  C  CA    . GLY C  3  277 ? 50.471  59.177  54.261  1.00 64.44  ? 277  GLY C CA    1 
ATOM   8325  C  C     . GLY C  3  277 ? 51.013  58.830  55.619  1.00 65.56  ? 277  GLY C C     1 
ATOM   8326  O  O     . GLY C  3  277 ? 50.491  57.953  56.298  1.00 67.03  ? 277  GLY C O     1 
ATOM   8327  N  N     . ALA C  3  278 ? 52.069  59.524  56.012  1.00 65.78  ? 278  ALA C N     1 
ATOM   8328  C  CA    . ALA C  3  278 ? 52.688  59.317  57.313  1.00 66.14  ? 278  ALA C CA    1 
ATOM   8329  C  C     . ALA C  3  278 ? 51.630  59.371  58.403  1.00 66.80  ? 278  ALA C C     1 
ATOM   8330  O  O     . ALA C  3  278 ? 51.382  58.378  59.074  1.00 66.88  ? 278  ALA C O     1 
ATOM   8331  C  CB    . ALA C  3  278 ? 53.724  60.384  57.560  1.00 66.11  ? 278  ALA C CB    1 
ATOM   8332  N  N     . LEU C  3  279 ? 51.023  60.539  58.578  1.00 67.74  ? 279  LEU C N     1 
ATOM   8333  C  CA    . LEU C  3  279 ? 49.981  60.730  59.576  1.00 68.64  ? 279  LEU C CA    1 
ATOM   8334  C  C     . LEU C  3  279 ? 48.960  59.611  59.467  1.00 69.94  ? 279  LEU C C     1 
ATOM   8335  O  O     . LEU C  3  279 ? 48.788  58.840  60.415  1.00 71.16  ? 279  LEU C O     1 
ATOM   8336  C  CB    . LEU C  3  279 ? 49.287  62.074  59.387  1.00 67.11  ? 279  LEU C CB    1 
ATOM   8337  C  CG    . LEU C  3  279 ? 50.178  63.306  59.496  1.00 66.79  ? 279  LEU C CG    1 
ATOM   8338  C  CD1   . LEU C  3  279 ? 49.305  64.478  59.865  1.00 65.34  ? 279  LEU C CD1   1 
ATOM   8339  C  CD2   . LEU C  3  279 ? 51.261  63.102  60.553  1.00 65.63  ? 279  LEU C CD2   1 
ATOM   8340  N  N     . SER C  3  280 ? 48.290  59.516  58.320  1.00 69.86  ? 280  SER C N     1 
ATOM   8341  C  CA    . SER C  3  280 ? 47.298  58.464  58.073  1.00 69.15  ? 280  SER C CA    1 
ATOM   8342  C  C     . SER C  3  280 ? 47.740  57.101  58.623  1.00 68.92  ? 280  SER C C     1 
ATOM   8343  O  O     . SER C  3  280 ? 46.997  56.459  59.363  1.00 69.78  ? 280  SER C O     1 
ATOM   8344  C  CB    . SER C  3  280 ? 47.023  58.341  56.566  1.00 68.89  ? 280  SER C CB    1 
ATOM   8345  O  OG    . SER C  3  280 ? 46.208  57.218  56.261  1.00 67.37  ? 280  SER C OG    1 
ATOM   8346  N  N     . MET C  3  281 ? 48.941  56.666  58.261  1.00 67.98  ? 281  MET C N     1 
ATOM   8347  C  CA    . MET C  3  281 ? 49.460  55.385  58.732  1.00 67.78  ? 281  MET C CA    1 
ATOM   8348  C  C     . MET C  3  281 ? 49.477  55.310  60.248  1.00 67.33  ? 281  MET C C     1 
ATOM   8349  O  O     . MET C  3  281 ? 49.166  54.286  60.833  1.00 67.71  ? 281  MET C O     1 
ATOM   8350  C  CB    . MET C  3  281 ? 50.879  55.151  58.215  1.00 68.30  ? 281  MET C CB    1 
ATOM   8351  C  CG    . MET C  3  281 ? 51.493  53.845  58.713  1.00 69.60  ? 281  MET C CG    1 
ATOM   8352  S  SD    . MET C  3  281 ? 53.272  53.655  58.436  1.00 68.98  ? 281  MET C SD    1 
ATOM   8353  C  CE    . MET C  3  281 ? 53.878  54.378  59.859  1.00 66.45  ? 281  MET C CE    1 
ATOM   8354  N  N     . MET C  3  282 ? 49.863  56.395  60.881  1.00 67.97  ? 282  MET C N     1 
ATOM   8355  C  CA    . MET C  3  282 ? 49.912  56.435  62.329  1.00 69.35  ? 282  MET C CA    1 
ATOM   8356  C  C     . MET C  3  282 ? 48.497  56.462  62.876  1.00 69.39  ? 282  MET C C     1 
ATOM   8357  O  O     . MET C  3  282 ? 48.202  55.907  63.939  1.00 68.74  ? 282  MET C O     1 
ATOM   8358  C  CB    . MET C  3  282 ? 50.645  57.684  62.791  1.00 70.82  ? 282  MET C CB    1 
ATOM   8359  C  CG    . MET C  3  282 ? 52.095  57.729  62.381  1.00 72.84  ? 282  MET C CG    1 
ATOM   8360  S  SD    . MET C  3  282 ? 52.843  59.279  62.863  1.00 75.80  ? 282  MET C SD    1 
ATOM   8361  C  CE    . MET C  3  282 ? 52.972  60.104  61.235  1.00 74.80  ? 282  MET C CE    1 
ATOM   8362  N  N     . GLY C  3  283 ? 47.621  57.118  62.126  1.00 69.32  ? 283  GLY C N     1 
ATOM   8363  C  CA    . GLY C  3  283 ? 46.224  57.243  62.524  1.00 67.56  ? 283  GLY C CA    1 
ATOM   8364  C  C     . GLY C  3  283 ? 45.574  55.913  62.810  1.00 65.87  ? 283  GLY C C     1 
ATOM   8365  O  O     . GLY C  3  283 ? 44.670  55.813  63.626  1.00 65.24  ? 283  GLY C O     1 
ATOM   8366  N  N     . PHE C  3  284 ? 46.030  54.895  62.106  1.00 64.70  ? 284  PHE C N     1 
ATOM   8367  C  CA    . PHE C  3  284 ? 45.517  53.580  6