data_2AZ0
# 
_entry.id   2AZ0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AZ0         
NDB   PR0181       
RCSB  RCSB034471   
WWPDB D_1000034471 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2AZ2 
_pdbx_database_related.details        'Flock House virus B2-dsRNA Complex (P4122)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AZ0 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chao, J.A.'       1 
'Lee, J.H.'        2 
'Chapados, B.R.'   3 
'Debler, E.W.'     4 
'Schneemann, A.'   5 
'Williamson, J.R.' 6 
# 
_citation.id                        primary 
_citation.title                     'Dual modes of RNA-silencing suppression by Flock House virus protein B2.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            12 
_citation.page_first                952 
_citation.page_last                 957 
_citation.year                      2005 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16228003 
_citation.pdbx_database_id_DOI      10.1038/nsmb1005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chao, J.A.'       1 
primary 'Lee, J.H.'        2 
primary 'Chapados, B.R.'   3 
primary 'Debler, E.W.'     4 
primary 'Schneemann, A.'   5 
primary 'Williamson, J.R.' 6 
# 
_cell.entry_id           2AZ0 
_cell.length_a           50.261 
_cell.length_b           86.232 
_cell.length_c           94.338 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2AZ0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(5BU)P*GP*C)-3'" 6000.171 2  ? ? ? ? 
2 polymer man 'B2 protein'                                                                 8036.355 2  ? ? ? ? 
3 water   nat water                                                                        18.015   23 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no yes 'GCA(5BU)GGACGCG(5BU)CCA(5BU)GC'                                          GCAUGGACGCGUCCAUGC C,D ? 
2 'polypeptide(L)'   no no  MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKA 
MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKA A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  G   n 
1 2  C   n 
1 3  A   n 
1 4  5BU n 
1 5  G   n 
1 6  G   n 
1 7  A   n 
1 8  C   n 
1 9  G   n 
1 10 C   n 
1 11 G   n 
1 12 5BU n 
1 13 C   n 
1 14 C   n 
1 15 A   n 
1 16 5BU n 
1 17 G   n 
1 18 C   n 
2 1  MET n 
2 2  PRO n 
2 3  SER n 
2 4  LYS n 
2 5  LEU n 
2 6  ALA n 
2 7  LEU n 
2 8  ILE n 
2 9  GLN n 
2 10 GLU n 
2 11 LEU n 
2 12 PRO n 
2 13 ASP n 
2 14 ARG n 
2 15 ILE n 
2 16 GLN n 
2 17 THR n 
2 18 ALA n 
2 19 VAL n 
2 20 GLU n 
2 21 ALA n 
2 22 ALA n 
2 23 MET n 
2 24 GLY n 
2 25 MET n 
2 26 SER n 
2 27 TYR n 
2 28 GLN n 
2 29 ASP n 
2 30 ALA n 
2 31 PRO n 
2 32 ASN n 
2 33 ASN n 
2 34 VAL n 
2 35 ARG n 
2 36 ARG n 
2 37 ASP n 
2 38 LEU n 
2 39 ASP n 
2 40 ASN n 
2 41 LEU n 
2 42 HIS n 
2 43 ALA n 
2 44 CYS n 
2 45 LEU n 
2 46 ASN n 
2 47 LYS n 
2 48 ALA n 
2 49 LYS n 
2 50 LEU n 
2 51 THR n 
2 52 VAL n 
2 53 SER n 
2 54 ARG n 
2 55 MET n 
2 56 VAL n 
2 57 THR n 
2 58 SER n 
2 59 LEU n 
2 60 LEU n 
2 61 GLU n 
2 62 LYS n 
2 63 PRO n 
2 64 SER n 
2 65 VAL n 
2 66 VAL n 
2 67 ALA n 
2 68 TYR n 
2 69 LEU n 
2 70 GLU n 
2 71 GLY n 
2 72 LYS n 
2 73 ALA n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Alphanodavirus 
_entity_src_gen.pdbx_gene_src_gene                 B2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Flock house virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B2_FHV P68831 2 MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKA 1 ? 
2 PDB 2AZ0   2AZ0   1 ?                                                                         ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AZ0 A 1 ? 73 ? P68831 1 ? 73 ? 1 73 
2 1 2AZ0 B 1 ? 73 ? P68831 1 ? 73 ? 1 73 
3 2 2AZ0 C 1 ? 18 ? 2AZ0   1 ? 18 ? 1 18 
4 2 2AZ0 D 1 ? 18 ? 2AZ0   1 ? 18 ? 1 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5BU 'RNA linking'       n "5-BROMO-URIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O9 P' 403.077 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                              ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'     149.211 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2AZ0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.64 
_exptl_crystal.density_percent_sol   66.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    'PEG 3350, magnesium sulfate, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9190 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9190 
# 
_reflns.entry_id                     2AZ0 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.55 
_reflns.d_resolution_low             34.4 
_reflns.number_all                   ? 
_reflns.number_obs                   13519 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AZ0 
_refine.ls_d_res_high                            2.60 
_refine.ls_d_res_low                             34.4 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     13157 
_refine.ls_number_reflns_obs                     13054 
_refine.ls_number_reflns_R_free                  632 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.242 
_refine.ls_R_factor_obs                          0.242 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.269 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1081 
_refine_hist.pdbx_number_atoms_nucleic_acid   768 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               1872 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        34.4 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d  0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2AZ0 
_struct.title                     'Flock House virus B2-dsRNA Complex (P212121)' 
_struct.pdbx_descriptor           'lock House virus B2/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AZ0 
_struct_keywords.pdbx_keywords   'Viral protein/RNA' 
_struct_keywords.text            'protein-rna complex, four-helix bundle, Viral protein-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER C 3  ? GLU C 10 ? SER A 3  GLU A 10 1 ? 8  
HELX_P HELX_P2 2 GLU C 10 ? ALA C 21 ? GLU A 10 ALA A 21 1 ? 12 
HELX_P HELX_P3 3 ALA C 22 ? MET C 25 ? ALA A 22 MET A 25 5 ? 4  
HELX_P HELX_P4 4 PRO C 31 ? LEU C 60 ? PRO A 31 LEU A 60 1 ? 30 
HELX_P HELX_P5 5 LYS C 62 ? GLY C 71 ? LYS A 62 GLY A 71 1 ? 10 
HELX_P HELX_P6 6 SER D 3  ? GLU D 10 ? SER B 3  GLU B 10 1 ? 8  
HELX_P HELX_P7 7 GLU D 10 ? MET D 25 ? GLU B 10 MET B 25 1 ? 16 
HELX_P HELX_P8 8 PRO D 31 ? GLU D 61 ? PRO B 31 GLU B 61 1 ? 31 
HELX_P HELX_P9 9 LYS D 62 ? GLY D 71 ? LYS B 62 GLY B 71 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A A   3  "O3'" ? ? ? 1_555 A 5BU 4  P  ? ? C A   3  C 5BU 4  1_555 ? ? ? ? ? ? ?            1.612 ? 
covale2  covale ? ? A 5BU 4  "O3'" ? ? ? 1_555 A G   5  P  ? ? C 5BU 4  C G   5  1_555 ? ? ? ? ? ? ?            1.606 ? 
covale3  covale ? ? A G   11 "O3'" ? ? ? 1_555 A 5BU 12 P  ? ? C G   11 C 5BU 12 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale4  covale ? ? A 5BU 12 "O3'" ? ? ? 1_555 A C   13 P  ? ? C 5BU 12 C C   13 1_555 ? ? ? ? ? ? ?            1.600 ? 
covale5  covale ? ? A A   15 "O3'" ? ? ? 1_555 A 5BU 16 P  ? ? C A   15 C 5BU 16 1_555 ? ? ? ? ? ? ?            1.600 ? 
covale6  covale ? ? A 5BU 16 "O3'" ? ? ? 1_555 A G   17 P  ? ? C 5BU 16 C G   17 1_555 ? ? ? ? ? ? ?            1.603 ? 
covale7  covale ? ? B A   3  "O3'" ? ? ? 1_555 B 5BU 4  P  ? ? D A   3  D 5BU 4  1_555 ? ? ? ? ? ? ?            1.609 ? 
covale8  covale ? ? B 5BU 4  "O3'" ? ? ? 1_555 B G   5  P  ? ? D 5BU 4  D G   5  1_555 ? ? ? ? ? ? ?            1.602 ? 
covale9  covale ? ? B G   11 "O3'" ? ? ? 1_555 B 5BU 12 P  ? ? D G   11 D 5BU 12 1_555 ? ? ? ? ? ? ?            1.610 ? 
covale10 covale ? ? B 5BU 12 "O3'" ? ? ? 1_555 B C   13 P  ? ? D 5BU 12 D C   13 1_555 ? ? ? ? ? ? ?            1.604 ? 
covale11 covale ? ? B A   15 "O3'" ? ? ? 1_555 B 5BU 16 P  ? ? D A   15 D 5BU 16 1_555 ? ? ? ? ? ? ?            1.599 ? 
covale12 covale ? ? B 5BU 16 "O3'" ? ? ? 1_555 B G   17 P  ? ? D 5BU 16 D G   17 1_555 ? ? ? ? ? ? ?            1.603 ? 
hydrog1  hydrog ? ? A G   1  N1    ? ? ? 1_555 B C   18 N3 ? ? C G   1  D C   18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A G   1  N2    ? ? ? 1_555 B C   18 O2 ? ? C G   1  D C   18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A G   1  O6    ? ? ? 1_555 B C   18 N4 ? ? C G   1  D C   18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A C   2  N3    ? ? ? 1_555 B G   17 N1 ? ? C C   2  D G   17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A C   2  N4    ? ? ? 1_555 B G   17 O6 ? ? C C   2  D G   17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A C   2  O2    ? ? ? 1_555 B G   17 N2 ? ? C C   2  D G   17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A A   3  N1    ? ? ? 1_555 B 5BU 16 N3 ? ? C A   3  D 5BU 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A A   3  N6    ? ? ? 1_555 B 5BU 16 O4 ? ? C A   3  D 5BU 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A 5BU 4  N3    ? ? ? 1_555 B A   15 N1 ? ? C 5BU 4  D A   15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A 5BU 4  O4    ? ? ? 1_555 B A   15 N6 ? ? C 5BU 4  D A   15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A G   5  N1    ? ? ? 1_555 B C   14 N3 ? ? C G   5  D C   14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A G   5  N2    ? ? ? 1_555 B C   14 O2 ? ? C G   5  D C   14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A G   5  O6    ? ? ? 1_555 B C   14 N4 ? ? C G   5  D C   14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A G   6  N1    ? ? ? 1_555 B C   13 N3 ? ? C G   6  D C   13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A G   6  N2    ? ? ? 1_555 B C   13 O2 ? ? C G   6  D C   13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A G   6  O6    ? ? ? 1_555 B C   13 N4 ? ? C G   6  D C   13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A A   7  N1    ? ? ? 1_555 B 5BU 12 N3 ? ? C A   7  D 5BU 12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A A   7  N6    ? ? ? 1_555 B 5BU 12 O4 ? ? C A   7  D 5BU 12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A C   8  N3    ? ? ? 1_555 B G   11 N1 ? ? C C   8  D G   11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A C   8  N4    ? ? ? 1_555 B G   11 O6 ? ? C C   8  D G   11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A C   8  O2    ? ? ? 1_555 B G   11 N2 ? ? C C   8  D G   11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A G   9  N1    ? ? ? 1_555 B C   10 N3 ? ? C G   9  D C   10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A G   9  N2    ? ? ? 1_555 B C   10 O2 ? ? C G   9  D C   10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A G   9  O6    ? ? ? 1_555 B C   10 N4 ? ? C G   9  D C   10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A C   10 N3    ? ? ? 1_555 B G   9  N1 ? ? C C   10 D G   9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A C   10 N4    ? ? ? 1_555 B G   9  O6 ? ? C C   10 D G   9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A C   10 O2    ? ? ? 1_555 B G   9  N2 ? ? C C   10 D G   9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A G   11 N1    ? ? ? 1_555 B C   8  N3 ? ? C G   11 D C   8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A G   11 N2    ? ? ? 1_555 B C   8  O2 ? ? C G   11 D C   8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A G   11 O6    ? ? ? 1_555 B C   8  N4 ? ? C G   11 D C   8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A 5BU 12 N3    ? ? ? 1_555 B A   7  N1 ? ? C 5BU 12 D A   7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A 5BU 12 O4    ? ? ? 1_555 B A   7  N6 ? ? C 5BU 12 D A   7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A C   13 N3    ? ? ? 1_555 B G   6  N1 ? ? C C   13 D G   6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A C   13 N4    ? ? ? 1_555 B G   6  O6 ? ? C C   13 D G   6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A C   13 O2    ? ? ? 1_555 B G   6  N2 ? ? C C   13 D G   6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A C   14 N3    ? ? ? 1_555 B G   5  N1 ? ? C C   14 D G   5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A C   14 N4    ? ? ? 1_555 B G   5  O6 ? ? C C   14 D G   5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A C   14 O2    ? ? ? 1_555 B G   5  N2 ? ? C C   14 D G   5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A A   15 N1    ? ? ? 1_555 B 5BU 4  N3 ? ? C A   15 D 5BU 4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A A   15 N6    ? ? ? 1_555 B 5BU 4  O4 ? ? C A   15 D 5BU 4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A 5BU 16 N3    ? ? ? 1_555 B A   3  N1 ? ? C 5BU 16 D A   3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A 5BU 16 O4    ? ? ? 1_555 B A   3  N6 ? ? C 5BU 16 D A   3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A G   17 N1    ? ? ? 1_555 B C   2  N3 ? ? C G   17 D C   2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A G   17 N2    ? ? ? 1_555 B C   2  O2 ? ? C G   17 D C   2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A G   17 O6    ? ? ? 1_555 B C   2  N4 ? ? C G   17 D C   2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A C   18 N3    ? ? ? 1_555 B G   1  N1 ? ? C C   18 D G   1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A C   18 N4    ? ? ? 1_555 B G   1  O6 ? ? C C   18 D G   1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? A C   18 O2    ? ? ? 1_555 B G   1  N2 ? ? C C   18 D G   1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_database_PDB_matrix.entry_id          2AZ0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AZ0 
_atom_sites.fract_transf_matrix[1][1]   0.019896 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011597 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010600 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . G   A 1 1  ? -8.170  -7.418 -22.862 1.00 50.23 ? 1  G   C "O5'" 1 
ATOM   2    C  "C5'" . G   A 1 1  ? -7.457  -8.636 -22.794 1.00 47.69 ? 1  G   C "C5'" 1 
ATOM   3    C  "C4'" . G   A 1 1  ? -6.044  -8.442 -23.281 1.00 48.44 ? 1  G   C "C4'" 1 
ATOM   4    O  "O4'" . G   A 1 1  ? -6.078  -7.802 -24.581 1.00 48.08 ? 1  G   C "O4'" 1 
ATOM   5    C  "C3'" . G   A 1 1  ? -5.195  -7.504 -22.445 1.00 48.74 ? 1  G   C "C3'" 1 
ATOM   6    O  "O3'" . G   A 1 1  ? -4.632  -8.160 -21.326 1.00 50.13 ? 1  G   C "O3'" 1 
ATOM   7    C  "C2'" . G   A 1 1  ? -4.141  -7.043 -23.440 1.00 47.79 ? 1  G   C "C2'" 1 
ATOM   8    O  "O2'" . G   A 1 1  ? -3.124  -8.000 -23.643 1.00 47.17 ? 1  G   C "O2'" 1 
ATOM   9    C  "C1'" . G   A 1 1  ? -4.977  -6.916 -24.709 1.00 46.21 ? 1  G   C "C1'" 1 
ATOM   10   N  N9    . G   A 1 1  ? -5.507  -5.576 -24.927 1.00 44.30 ? 1  G   C N9    1 
ATOM   11   C  C8    . G   A 1 1  ? -6.822  -5.187 -24.849 1.00 43.13 ? 1  G   C C8    1 
ATOM   12   N  N7    . G   A 1 1  ? -7.005  -3.934 -25.166 1.00 42.63 ? 1  G   C N7    1 
ATOM   13   C  C5    . G   A 1 1  ? -5.731  -3.464 -25.454 1.00 42.77 ? 1  G   C C5    1 
ATOM   14   C  C6    . G   A 1 1  ? -5.297  -2.177 -25.865 1.00 43.13 ? 1  G   C C6    1 
ATOM   15   O  O6    . G   A 1 1  ? -5.977  -1.168 -26.082 1.00 44.92 ? 1  G   C O6    1 
ATOM   16   N  N1    . G   A 1 1  ? -3.920  -2.130 -26.030 1.00 43.38 ? 1  G   C N1    1 
ATOM   17   C  C2    . G   A 1 1  ? -3.066  -3.188 -25.835 1.00 44.00 ? 1  G   C C2    1 
ATOM   18   N  N2    . G   A 1 1  ? -1.771  -2.939 -26.050 1.00 44.14 ? 1  G   C N2    1 
ATOM   19   N  N3    . G   A 1 1  ? -3.455  -4.397 -25.460 1.00 43.14 ? 1  G   C N3    1 
ATOM   20   C  C4    . G   A 1 1  ? -4.792  -4.462 -25.291 1.00 43.22 ? 1  G   C C4    1 
ATOM   21   P  P     . C   A 1 2  ? -4.550  -7.385 -19.928 1.00 52.62 ? 2  C   C P     1 
ATOM   22   O  OP1   . C   A 1 2  ? -4.177  -8.398 -18.910 1.00 53.16 ? 2  C   C OP1   1 
ATOM   23   O  OP2   . C   A 1 2  ? -5.798  -6.592 -19.750 1.00 51.88 ? 2  C   C OP2   1 
ATOM   24   O  "O5'" . C   A 1 2  ? -3.324  -6.384 -20.131 1.00 50.70 ? 2  C   C "O5'" 1 
ATOM   25   C  "C5'" . C   A 1 2  ? -1.998  -6.886 -20.253 1.00 49.11 ? 2  C   C "C5'" 1 
ATOM   26   C  "C4'" . C   A 1 2  ? -1.027  -5.771 -20.583 1.00 49.39 ? 2  C   C "C4'" 1 
ATOM   27   O  "O4'" . C   A 1 2  ? -1.333  -5.220 -21.896 1.00 48.86 ? 2  C   C "O4'" 1 
ATOM   28   C  "C3'" . C   A 1 2  ? -1.072  -4.558 -19.676 1.00 49.88 ? 2  C   C "C3'" 1 
ATOM   29   O  "O3'" . C   A 1 2  ? -0.368  -4.749 -18.467 1.00 52.96 ? 2  C   C "O3'" 1 
ATOM   30   C  "C2'" . C   A 1 2  ? -0.461  -3.480 -20.555 1.00 48.27 ? 2  C   C "C2'" 1 
ATOM   31   O  "O2'" . C   A 1 2  ? 0.941   -3.628 -20.645 1.00 48.13 ? 2  C   C "O2'" 1 
ATOM   32   C  "C1'" . C   A 1 2  ? -1.081  -3.823 -21.903 1.00 45.27 ? 2  C   C "C1'" 1 
ATOM   33   N  N1    . C   A 1 2  ? -2.356  -3.115 -22.094 1.00 42.75 ? 2  C   C N1    1 
ATOM   34   C  C2    . C   A 1 2  ? -2.324  -1.846 -22.659 1.00 42.47 ? 2  C   C C2    1 
ATOM   35   O  O2    . C   A 1 2  ? -1.227  -1.358 -22.950 1.00 44.51 ? 2  C   C O2    1 
ATOM   36   N  N3    . C   A 1 2  ? -3.482  -1.176 -22.866 1.00 40.46 ? 2  C   C N3    1 
ATOM   37   C  C4    . C   A 1 2  ? -4.640  -1.727 -22.514 1.00 38.59 ? 2  C   C C4    1 
ATOM   38   N  N4    . C   A 1 2  ? -5.753  -1.023 -22.735 1.00 35.75 ? 2  C   C N4    1 
ATOM   39   C  C5    . C   A 1 2  ? -4.706  -3.024 -21.918 1.00 39.31 ? 2  C   C C5    1 
ATOM   40   C  C6    . C   A 1 2  ? -3.549  -3.678 -21.731 1.00 40.91 ? 2  C   C C6    1 
ATOM   41   P  P     . A   A 1 3  ? -0.986  -4.165 -17.105 1.00 54.43 ? 3  A   C P     1 
ATOM   42   O  OP1   . A   A 1 3  ? -0.155  -4.742 -16.012 1.00 53.79 ? 3  A   C OP1   1 
ATOM   43   O  OP2   . A   A 1 3  ? -2.458  -4.389 -17.109 1.00 52.50 ? 3  A   C OP2   1 
ATOM   44   O  "O5'" . A   A 1 3  ? -0.713  -2.597 -17.225 1.00 51.01 ? 3  A   C "O5'" 1 
ATOM   45   C  "C5'" . A   A 1 3  ? 0.618   -2.116 -17.216 1.00 46.13 ? 3  A   C "C5'" 1 
ATOM   46   C  "C4'" . A   A 1 3  ? 0.705   -0.687 -17.707 1.00 43.79 ? 3  A   C "C4'" 1 
ATOM   47   O  "O4'" . A   A 1 3  ? 0.062   -0.583 -19.008 1.00 41.83 ? 3  A   C "O4'" 1 
ATOM   48   C  "C3'" . A   A 1 3  ? -0.027  0.360  -16.881 1.00 43.22 ? 3  A   C "C3'" 1 
ATOM   49   O  "O3'" . A   A 1 3  ? 0.716   0.746  -15.729 1.00 44.92 ? 3  A   C "O3'" 1 
ATOM   50   C  "C2'" . A   A 1 3  ? -0.200  1.490  -17.891 1.00 41.59 ? 3  A   C "C2'" 1 
ATOM   51   O  "O2'" . A   A 1 3  ? 0.985   2.220  -18.132 1.00 41.52 ? 3  A   C "O2'" 1 
ATOM   52   C  "C1'" . A   A 1 3  ? -0.497  0.710  -19.162 1.00 38.82 ? 3  A   C "C1'" 1 
ATOM   53   N  N9    . A   A 1 3  ? -1.928  0.612  -19.420 1.00 35.66 ? 3  A   C N9    1 
ATOM   54   C  C8    . A   A 1 3  ? -2.822  -0.398 -19.160 1.00 35.10 ? 3  A   C C8    1 
ATOM   55   N  N7    . A   A 1 3  ? -4.053  -0.109 -19.506 1.00 32.64 ? 3  A   C N7    1 
ATOM   56   C  C5    . A   A 1 3  ? -3.957  1.173  -20.030 1.00 31.55 ? 3  A   C C5    1 
ATOM   57   C  C6    . A   A 1 3  ? -4.908  2.049  -20.563 1.00 31.37 ? 3  A   C C6    1 
ATOM   58   N  N6    . A   A 1 3  ? -6.201  1.754  -20.664 1.00 31.14 ? 3  A   C N6    1 
ATOM   59   N  N1    . A   A 1 3  ? -4.483  3.256  -20.994 1.00 31.58 ? 3  A   C N1    1 
ATOM   60   C  C2    . A   A 1 3  ? -3.182  3.549  -20.892 1.00 32.79 ? 3  A   C C2    1 
ATOM   61   N  N3    . A   A 1 3  ? -2.192  2.807  -20.410 1.00 32.54 ? 3  A   C N3    1 
ATOM   62   C  C4    . A   A 1 3  ? -2.655  1.621  -19.990 1.00 32.46 ? 3  A   C C4    1 
HETATM 63   P  P     . 5BU A 1 4  ? -0.052  1.340  -14.442 1.00 45.69 ? 4  5BU C P     1 
HETATM 64   O  OP1   . 5BU A 1 4  ? 1.001   1.538  -13.409 1.00 45.71 ? 4  5BU C OP1   1 
HETATM 65   O  OP2   . 5BU A 1 4  ? -1.241  0.498  -14.129 1.00 42.96 ? 4  5BU C OP2   1 
HETATM 66   O  "O5'" . 5BU A 1 4  ? -0.554  2.775  -14.939 1.00 45.24 ? 4  5BU C "O5'" 1 
HETATM 67   C  "C5'" . 5BU A 1 4  ? 0.385   3.766  -15.360 1.00 40.16 ? 4  5BU C "C5'" 1 
HETATM 68   C  "C4'" . 5BU A 1 4  ? -0.311  5.042  -15.800 1.00 38.32 ? 4  5BU C "C4'" 1 
HETATM 69   O  "O4'" . 5BU A 1 4  ? -1.007  4.822  -17.059 1.00 37.12 ? 4  5BU C "O4'" 1 
HETATM 70   C  "C3'" . 5BU A 1 4  ? -1.405  5.565  -14.882 1.00 38.21 ? 4  5BU C "C3'" 1 
HETATM 71   O  "O3'" . 5BU A 1 4  ? -0.890  6.295  -13.784 1.00 38.50 ? 4  5BU C "O3'" 1 
HETATM 72   C  "C2'" . 5BU A 1 4  ? -2.214  6.442  -15.824 1.00 38.25 ? 4  5BU C "C2'" 1 
HETATM 73   O  "O2'" . 5BU A 1 4  ? -1.560  7.668  -16.083 1.00 38.28 ? 4  5BU C "O2'" 1 
HETATM 74   C  "C1'" . 5BU A 1 4  ? -2.185  5.610  -17.101 1.00 35.24 ? 4  5BU C "C1'" 1 
HETATM 75   N  N1    . 5BU A 1 4  ? -3.359  4.733  -17.228 1.00 33.65 ? 4  5BU C N1    1 
HETATM 76   C  C2    . 5BU A 1 4  ? -4.485  5.270  -17.841 1.00 32.70 ? 4  5BU C C2    1 
HETATM 77   O  O2    . 5BU A 1 4  ? -4.531  6.419  -18.247 1.00 34.52 ? 4  5BU C O2    1 
HETATM 78   N  N3    . 5BU A 1 4  ? -5.550  4.414  -17.962 1.00 31.13 ? 4  5BU C N3    1 
HETATM 79   C  C4    . 5BU A 1 4  ? -5.611  3.102  -17.540 1.00 32.50 ? 4  5BU C C4    1 
HETATM 80   O  O4    . 5BU A 1 4  ? -6.646  2.461  -17.721 1.00 31.94 ? 4  5BU C O4    1 
HETATM 81   C  C5    . 5BU A 1 4  ? -4.414  2.616  -16.905 1.00 32.37 ? 4  5BU C C5    1 
HETATM 82   C  C6    . 5BU A 1 4  ? -3.355  3.431  -16.769 1.00 32.46 ? 4  5BU C C6    1 
HETATM 83   BR BR    . 5BU A 1 4  ? -4.315  0.821  -16.319 0.28 32.46 ? 4  5BU C BR    1 
ATOM   84   P  P     . G   A 1 5  ? -1.715  6.348  -12.407 1.00 36.39 ? 5  G   C P     1 
ATOM   85   O  OP1   . G   A 1 5  ? -0.777  6.966  -11.445 1.00 36.17 ? 5  G   C OP1   1 
ATOM   86   O  OP2   . G   A 1 5  ? -2.312  5.022  -12.105 1.00 33.71 ? 5  G   C OP2   1 
ATOM   87   O  "O5'" . G   A 1 5  ? -2.889  7.374  -12.724 1.00 35.65 ? 5  G   C "O5'" 1 
ATOM   88   C  "C5'" . G   A 1 5  ? -2.601  8.735  -13.022 1.00 34.14 ? 5  G   C "C5'" 1 
ATOM   89   C  "C4'" . G   A 1 5  ? -3.864  9.476  -13.390 1.00 34.25 ? 5  G   C "C4'" 1 
ATOM   90   O  "O4'" . G   A 1 5  ? -4.325  9.020  -14.693 1.00 36.10 ? 5  G   C "O4'" 1 
ATOM   91   C  "C3'" . G   A 1 5  ? -5.048  9.187  -12.484 1.00 33.68 ? 5  G   C "C3'" 1 
ATOM   92   O  "O3'" . G   A 1 5  ? -5.031  9.953  -11.288 1.00 33.09 ? 5  G   C "O3'" 1 
ATOM   93   C  "C2'" . G   A 1 5  ? -6.223  9.544  -13.373 1.00 34.82 ? 5  G   C "C2'" 1 
ATOM   94   O  "O2'" . G   A 1 5  ? -6.436  10.931 -13.421 1.00 40.24 ? 5  G   C "O2'" 1 
ATOM   95   C  "C1'" . G   A 1 5  ? -5.740  9.052  -14.738 1.00 34.63 ? 5  G   C "C1'" 1 
ATOM   96   N  N9    . G   A 1 5  ? -6.251  7.712  -14.985 1.00 35.52 ? 5  G   C N9    1 
ATOM   97   C  C8    . G   A 1 5  ? -5.647  6.513  -14.701 1.00 36.46 ? 5  G   C C8    1 
ATOM   98   N  N7    . G   A 1 5  ? -6.429  5.486  -14.913 1.00 37.71 ? 5  G   C N7    1 
ATOM   99   C  C5    . G   A 1 5  ? -7.604  6.044  -15.401 1.00 36.55 ? 5  G   C C5    1 
ATOM   100  C  C6    . G   A 1 5  ? -8.823  5.432  -15.797 1.00 38.16 ? 5  G   C C6    1 
ATOM   101  O  O6    . G   A 1 5  ? -9.127  4.230  -15.790 1.00 40.15 ? 5  G   C O6    1 
ATOM   102  N  N1    . G   A 1 5  ? -9.747  6.373  -16.229 1.00 38.18 ? 5  G   C N1    1 
ATOM   103  C  C2    . G   A 1 5  ? -9.534  7.721  -16.271 1.00 37.88 ? 5  G   C C2    1 
ATOM   104  N  N2    . G   A 1 5  ? -10.545 8.462  -16.714 1.00 37.92 ? 5  G   C N2    1 
ATOM   105  N  N3    . G   A 1 5  ? -8.411  8.303  -15.903 1.00 37.33 ? 5  G   C N3    1 
ATOM   106  C  C4    . G   A 1 5  ? -7.498  7.411  -15.479 1.00 36.06 ? 5  G   C C4    1 
ATOM   107  P  P     . G   A 1 6  ? -5.800  9.402  -9.985  1.00 32.76 ? 6  G   C P     1 
ATOM   108  O  OP1   . G   A 1 6  ? -5.320  10.202 -8.841  1.00 31.07 ? 6  G   C OP1   1 
ATOM   109  O  OP2   . G   A 1 6  ? -5.694  7.922  -9.936  1.00 33.28 ? 6  G   C OP2   1 
ATOM   110  O  "O5'" . G   A 1 6  ? -7.318  9.769  -10.283 1.00 30.31 ? 6  G   C "O5'" 1 
ATOM   111  C  "C5'" . G   A 1 6  ? -7.664  11.110 -10.541 1.00 30.38 ? 6  G   C "C5'" 1 
ATOM   112  C  "C4'" . G   A 1 6  ? -9.063  11.213 -11.073 1.00 32.74 ? 6  G   C "C4'" 1 
ATOM   113  O  "O4'" . G   A 1 6  ? -9.148  10.548 -12.363 1.00 33.54 ? 6  G   C "O4'" 1 
ATOM   114  C  "C3'" . G   A 1 6  ? -10.131 10.531 -10.243 1.00 31.28 ? 6  G   C "C3'" 1 
ATOM   115  O  "O3'" . G   A 1 6  ? -10.536 11.356 -9.167  1.00 31.95 ? 6  G   C "O3'" 1 
ATOM   116  C  "C2'" . G   A 1 6  ? -11.239 10.333 -11.267 1.00 32.55 ? 6  G   C "C2'" 1 
ATOM   117  O  "O2'" . G   A 1 6  ? -11.950 11.527 -11.510 1.00 32.14 ? 6  G   C "O2'" 1 
ATOM   118  C  "C1'" . G   A 1 6  ? -10.434 9.973  -12.516 1.00 33.80 ? 6  G   C "C1'" 1 
ATOM   119  N  N9    . G   A 1 6  ? -10.288 8.530  -12.628 1.00 36.99 ? 6  G   C N9    1 
ATOM   120  C  C8    . G   A 1 6  ? -9.221  7.766  -12.227 1.00 38.10 ? 6  G   C C8    1 
ATOM   121  N  N7    . G   A 1 6  ? -9.424  6.487  -12.380 1.00 39.40 ? 6  G   C N7    1 
ATOM   122  C  C5    . G   A 1 6  ? -10.696 6.405  -12.932 1.00 38.57 ? 6  G   C C5    1 
ATOM   123  C  C6    . G   A 1 6  ? -11.457 5.278  -13.310 1.00 38.65 ? 6  G   C C6    1 
ATOM   124  O  O6    . G   A 1 6  ? -11.153 4.082  -13.231 1.00 39.84 ? 6  G   C O6    1 
ATOM   125  N  N1    . G   A 1 6  ? -12.690 5.647  -13.832 1.00 39.81 ? 6  G   C N1    1 
ATOM   126  C  C2    . G   A 1 6  ? -13.131 6.935  -13.977 1.00 39.70 ? 6  G   C C2    1 
ATOM   127  N  N2    . G   A 1 6  ? -14.345 7.089  -14.516 1.00 39.47 ? 6  G   C N2    1 
ATOM   128  N  N3    . G   A 1 6  ? -12.432 7.995  -13.623 1.00 39.32 ? 6  G   C N3    1 
ATOM   129  C  C4    . G   A 1 6  ? -11.232 7.657  -13.111 1.00 37.88 ? 6  G   C C4    1 
ATOM   130  P  P     . A   A 1 7  ? -11.282 10.703 -7.909  1.00 31.68 ? 7  A   C P     1 
ATOM   131  O  OP1   . A   A 1 7  ? -11.502 11.789 -6.933  1.00 29.79 ? 7  A   C OP1   1 
ATOM   132  O  OP2   . A   A 1 7  ? -10.541 9.492  -7.503  1.00 31.97 ? 7  A   C OP2   1 
ATOM   133  O  "O5'" . A   A 1 7  ? -12.686 10.255 -8.500  1.00 32.96 ? 7  A   C "O5'" 1 
ATOM   134  C  "C5'" . A   A 1 7  ? -13.610 11.229 -8.956  1.00 36.85 ? 7  A   C "C5'" 1 
ATOM   135  C  "C4'" . A   A 1 7  ? -14.884 10.562 -9.383  1.00 38.90 ? 7  A   C "C4'" 1 
ATOM   136  O  "O4'" . A   A 1 7  ? -14.631 9.776  -10.576 1.00 39.31 ? 7  A   C "O4'" 1 
ATOM   137  C  "C3'" . A   A 1 7  ? -15.455 9.570  -8.387  1.00 39.14 ? 7  A   C "C3'" 1 
ATOM   138  O  "O3'" . A   A 1 7  ? -16.229 10.229 -7.401  1.00 39.63 ? 7  A   C "O3'" 1 
ATOM   139  C  "C2'" . A   A 1 7  ? -16.295 8.683  -9.290  1.00 39.72 ? 7  A   C "C2'" 1 
ATOM   140  O  "O2'" . A   A 1 7  ? -17.511 9.323  -9.618  1.00 40.01 ? 7  A   C "O2'" 1 
ATOM   141  C  "C1'" . A   A 1 7  ? -15.397 8.583  -10.529 1.00 39.31 ? 7  A   C "C1'" 1 
ATOM   142  N  N9    . A   A 1 7  ? -14.462 7.456  -10.424 1.00 38.86 ? 7  A   C N9    1 
ATOM   143  C  C8    . A   A 1 7  ? -13.190 7.474  -9.899  1.00 37.70 ? 7  A   C C8    1 
ATOM   144  N  N7    . A   A 1 7  ? -12.607 6.298  -9.885  1.00 37.05 ? 7  A   C N7    1 
ATOM   145  C  C5    . A   A 1 7  ? -13.553 5.451  -10.445 1.00 36.76 ? 7  A   C C5    1 
ATOM   146  C  C6    . A   A 1 7  ? -13.552 4.068  -10.699 1.00 36.20 ? 7  A   C C6    1 
ATOM   147  N  N6    . A   A 1 7  ? -12.530 3.257  -10.411 1.00 34.99 ? 7  A   C N6    1 
ATOM   148  N  N1    . A   A 1 7  ? -14.656 3.535  -11.269 1.00 35.75 ? 7  A   C N1    1 
ATOM   149  C  C2    . A   A 1 7  ? -15.676 4.342  -11.561 1.00 35.78 ? 7  A   C C2    1 
ATOM   150  N  N3    . A   A 1 7  ? -15.797 5.652  -11.371 1.00 37.94 ? 7  A   C N3    1 
ATOM   151  C  C4    . A   A 1 7  ? -14.691 6.153  -10.799 1.00 36.83 ? 7  A   C C4    1 
ATOM   152  P  P     . C   A 1 8  ? -16.477 9.531  -5.978  1.00 41.59 ? 8  C   C P     1 
ATOM   153  O  OP1   . C   A 1 8  ? -17.384 10.451 -5.257  1.00 40.43 ? 8  C   C OP1   1 
ATOM   154  O  OP2   . C   A 1 8  ? -15.194 9.125  -5.351  1.00 40.83 ? 8  C   C OP2   1 
ATOM   155  O  "O5'" . C   A 1 8  ? -17.294 8.217  -6.341  1.00 43.42 ? 8  C   C "O5'" 1 
ATOM   156  C  "C5'" . C   A 1 8  ? -18.596 8.319  -6.896  1.00 45.69 ? 8  C   C "C5'" 1 
ATOM   157  C  "C4'" . C   A 1 8  ? -19.105 6.964  -7.322  1.00 47.77 ? 8  C   C "C4'" 1 
ATOM   158  O  "O4'" . C   A 1 8  ? -18.225 6.425  -8.352  1.00 47.12 ? 8  C   C "O4'" 1 
ATOM   159  C  "C3'" . C   A 1 8  ? -19.080 5.891  -6.245  1.00 49.45 ? 8  C   C "C3'" 1 
ATOM   160  O  "O3'" . C   A 1 8  ? -20.196 5.948  -5.368  1.00 54.03 ? 8  C   C "O3'" 1 
ATOM   161  C  "C2'" . C   A 1 8  ? -19.077 4.616  -7.072  1.00 48.77 ? 8  C   C "C2'" 1 
ATOM   162  O  "O2'" . C   A 1 8  ? -20.358 4.311  -7.575  1.00 50.21 ? 8  C   C "O2'" 1 
ATOM   163  C  "C1'" . C   A 1 8  ? -18.163 5.012  -8.229  1.00 47.45 ? 8  C   C "C1'" 1 
ATOM   164  N  N1    . C   A 1 8  ? -16.782 4.589  -7.954  1.00 47.10 ? 8  C   C N1    1 
ATOM   165  C  C2    . C   A 1 8  ? -16.441 3.263  -8.234  1.00 47.28 ? 8  C   C C2    1 
ATOM   166  O  O2    . C   A 1 8  ? -17.303 2.525  -8.747  1.00 48.07 ? 8  C   C O2    1 
ATOM   167  N  N3    . C   A 1 8  ? -15.193 2.821  -7.942  1.00 45.83 ? 8  C   C N3    1 
ATOM   168  C  C4    . C   A 1 8  ? -14.300 3.654  -7.400  1.00 44.94 ? 8  C   C C4    1 
ATOM   169  N  N4    . C   A 1 8  ? -13.080 3.174  -7.128  1.00 44.16 ? 8  C   C N4    1 
ATOM   170  C  C5    . C   A 1 8  ? -14.616 5.015  -7.118  1.00 44.79 ? 8  C   C C5    1 
ATOM   171  C  C6    . C   A 1 8  ? -15.857 5.440  -7.413  1.00 46.24 ? 8  C   C C6    1 
ATOM   172  P  P     . G   A 1 9  ? -20.078 5.322  -3.885  1.00 58.17 ? 9  G   C P     1 
ATOM   173  O  OP1   . G   A 1 9  ? -21.305 5.743  -3.158  1.00 57.62 ? 9  G   C OP1   1 
ATOM   174  O  OP2   . G   A 1 9  ? -18.739 5.643  -3.323  1.00 56.49 ? 9  G   C OP2   1 
ATOM   175  O  "O5'" . G   A 1 9  ? -20.156 3.741  -4.107  1.00 60.59 ? 9  G   C "O5'" 1 
ATOM   176  C  "C5'" . G   A 1 9  ? -21.380 3.129  -4.514  1.00 63.27 ? 9  G   C "C5'" 1 
ATOM   177  C  "C4'" . G   A 1 9  ? -21.197 1.644  -4.776  1.00 64.85 ? 9  G   C "C4'" 1 
ATOM   178  O  "O4'" . G   A 1 9  ? -20.189 1.457  -5.809  1.00 64.20 ? 9  G   C "O4'" 1 
ATOM   179  C  "C3'" . G   A 1 9  ? -20.685 0.800  -3.614  1.00 66.63 ? 9  G   C "C3'" 1 
ATOM   180  O  "O3'" . G   A 1 9  ? -21.718 0.395  -2.718  1.00 69.32 ? 9  G   C "O3'" 1 
ATOM   181  C  "C2'" . G   A 1 9  ? -20.086 -0.400 -4.333  1.00 65.94 ? 9  G   C "C2'" 1 
ATOM   182  O  "O2'" . G   A 1 9  ? -21.081 -1.313 -4.758  1.00 66.50 ? 9  G   C "O2'" 1 
ATOM   183  C  "C1'" . G   A 1 9  ? -19.458 0.267  -5.555  1.00 63.79 ? 9  G   C "C1'" 1 
ATOM   184  N  N9    . G   A 1 9  ? -18.054 0.598  -5.335  1.00 61.33 ? 9  G   C N9    1 
ATOM   185  C  C8    . G   A 1 9  ? -17.513 1.825  -5.045  1.00 60.50 ? 9  G   C C8    1 
ATOM   186  N  N7    . G   A 1 9  ? -16.215 1.790  -4.895  1.00 59.63 ? 9  G   C N7    1 
ATOM   187  C  C5    . G   A 1 9  ? -15.882 0.458  -5.099  1.00 60.09 ? 9  G   C C5    1 
ATOM   188  C  C6    . G   A 1 9  ? -14.618 -0.195 -5.066  1.00 60.17 ? 9  G   C C6    1 
ATOM   189  O  O6    . G   A 1 9  ? -13.502 0.291  -4.838  1.00 60.48 ? 9  G   C O6    1 
ATOM   190  N  N1    . G   A 1 9  ? -14.739 -1.554 -5.335  1.00 60.75 ? 9  G   C N1    1 
ATOM   191  C  C2    . G   A 1 9  ? -15.920 -2.205 -5.602  1.00 61.41 ? 9  G   C C2    1 
ATOM   192  N  N2    . G   A 1 9  ? -15.832 -3.518 -5.846  1.00 61.61 ? 9  G   C N2    1 
ATOM   193  N  N3    . G   A 1 9  ? -17.100 -1.611 -5.631  1.00 61.10 ? 9  G   C N3    1 
ATOM   194  C  C4    . G   A 1 9  ? -17.007 -0.290 -5.374  1.00 60.85 ? 9  G   C C4    1 
ATOM   195  P  P     . C   A 1 10 ? -21.350 0.037  -1.190  1.00 71.03 ? 10 C   C P     1 
ATOM   196  O  OP1   . C   A 1 10 ? -22.633 -0.278 -0.505  1.00 71.43 ? 10 C   C OP1   1 
ATOM   197  O  OP2   . C   A 1 10 ? -20.463 1.098  -0.645  1.00 70.31 ? 10 C   C OP2   1 
ATOM   198  O  "O5'" . C   A 1 10 ? -20.486 -1.297 -1.291  1.00 71.33 ? 10 C   C "O5'" 1 
ATOM   199  C  "C5'" . C   A 1 10 ? -21.112 -2.552 -1.529  1.00 71.86 ? 10 C   C "C5'" 1 
ATOM   200  C  "C4'" . C   A 1 10 ? -20.098 -3.671 -1.458  1.00 72.37 ? 10 C   C "C4'" 1 
ATOM   201  O  "O4'" . C   A 1 10 ? -19.094 -3.465 -2.491  1.00 71.39 ? 10 C   C "O4'" 1 
ATOM   202  C  "C3'" . C   A 1 10 ? -19.281 -3.734 -0.173  1.00 72.64 ? 10 C   C "C3'" 1 
ATOM   203  O  "O3'" . C   A 1 10 ? -19.954 -4.425 0.870   1.00 73.86 ? 10 C   C "O3'" 1 
ATOM   204  C  "C2'" . C   A 1 10 ? -18.032 -4.481 -0.616  1.00 71.70 ? 10 C   C "C2'" 1 
ATOM   205  O  "O2'" . C   A 1 10 ? -18.184 -5.886 -0.654  1.00 71.28 ? 10 C   C "O2'" 1 
ATOM   206  C  "C1'" . C   A 1 10 ? -17.834 -3.921 -2.024  1.00 70.49 ? 10 C   C "C1'" 1 
ATOM   207  N  N1    . C   A 1 10 ? -16.886 -2.806 -1.999  1.00 68.52 ? 10 C   C N1    1 
ATOM   208  C  C2    . C   A 1 10 ? -15.548 -3.107 -2.146  1.00 68.53 ? 10 C   C C2    1 
ATOM   209  O  O2    . C   A 1 10 ? -15.232 -4.289 -2.342  1.00 68.85 ? 10 C   C O2    1 
ATOM   210  N  N3    . C   A 1 10 ? -14.629 -2.120 -2.071  1.00 68.57 ? 10 C   C N3    1 
ATOM   211  C  C4    . C   A 1 10 ? -15.021 -0.865 -1.860  1.00 67.58 ? 10 C   C C4    1 
ATOM   212  N  N4    . C   A 1 10 ? -14.072 0.074  -1.777  1.00 68.13 ? 10 C   C N4    1 
ATOM   213  C  C5    . C   A 1 10 ? -16.397 -0.521 -1.723  1.00 66.89 ? 10 C   C C5    1 
ATOM   214  C  C6    . C   A 1 10 ? -17.290 -1.515 -1.804  1.00 67.54 ? 10 C   C C6    1 
ATOM   215  P  P     . G   A 1 11 ? -19.588 -4.099 2.400   1.00 76.23 ? 11 G   C P     1 
ATOM   216  O  OP1   . G   A 1 11 ? -20.530 -4.905 3.218   1.00 75.76 ? 11 G   C OP1   1 
ATOM   217  O  OP2   . G   A 1 11 ? -19.546 -2.622 2.572   1.00 76.18 ? 11 G   C OP2   1 
ATOM   218  O  "O5'" . G   A 1 11 ? -18.115 -4.684 2.588   1.00 73.74 ? 11 G   C "O5'" 1 
ATOM   219  C  "C5'" . G   A 1 11 ? -17.917 -6.085 2.591   1.00 73.24 ? 11 G   C "C5'" 1 
ATOM   220  C  "C4'" . G   A 1 11 ? -16.450 -6.445 2.505   1.00 73.68 ? 11 G   C "C4'" 1 
ATOM   221  O  "O4'" . G   A 1 11 ? -15.856 -5.800 1.342   1.00 73.53 ? 11 G   C "O4'" 1 
ATOM   222  C  "C3'" . G   A 1 11 ? -15.576 -5.960 3.652   1.00 74.18 ? 11 G   C "C3'" 1 
ATOM   223  O  "O3'" . G   A 1 11 ? -15.644 -6.817 4.785   1.00 75.57 ? 11 G   C "O3'" 1 
ATOM   224  C  "C2'" . G   A 1 11 ? -14.186 -5.975 3.028   1.00 73.82 ? 11 G   C "C2'" 1 
ATOM   225  O  "O2'" . G   A 1 11 ? -13.617 -7.272 2.984   1.00 71.99 ? 11 G   C "O2'" 1 
ATOM   226  C  "C1'" . G   A 1 11 ? -14.491 -5.510 1.607   1.00 72.65 ? 11 G   C "C1'" 1 
ATOM   227  N  N9    . G   A 1 11 ? -14.214 -4.092 1.388   1.00 71.62 ? 11 G   C N9    1 
ATOM   228  C  C8    . G   A 1 11 ? -15.100 -3.049 1.274   1.00 71.53 ? 11 G   C C8    1 
ATOM   229  N  N7    . G   A 1 11 ? -14.509 -1.898 1.080   1.00 71.21 ? 11 G   C N7    1 
ATOM   230  C  C5    . G   A 1 11 ? -13.154 -2.206 1.065   1.00 70.53 ? 11 G   C C5    1 
ATOM   231  C  C6    . G   A 1 11 ? -12.007 -1.370 0.891   1.00 70.03 ? 11 G   C C6    1 
ATOM   232  O  O6    . G   A 1 11 ? -11.956 -0.149 0.701   1.00 70.47 ? 11 G   C O6    1 
ATOM   233  N  N1    . G   A 1 11 ? -10.829 -2.103 0.955   1.00 69.35 ? 11 G   C N1    1 
ATOM   234  C  C2    . G   A 1 11 ? -10.755 -3.456 1.153   1.00 69.85 ? 11 G   C C2    1 
ATOM   235  N  N2    . G   A 1 11 ? -9.531  -3.989 1.179   1.00 70.66 ? 11 G   C N2    1 
ATOM   236  N  N3    . G   A 1 11 ? -11.804 -4.238 1.312   1.00 69.92 ? 11 G   C N3    1 
ATOM   237  C  C4    . G   A 1 11 ? -12.960 -3.553 1.256   1.00 70.47 ? 11 G   C C4    1 
HETATM 238  P  P     . 5BU A 1 12 ? -15.125 -6.289 6.214   1.00 75.46 ? 12 5BU C P     1 
HETATM 239  O  OP1   . 5BU A 1 12 ? -15.492 -7.328 7.210   1.00 75.64 ? 12 5BU C OP1   1 
HETATM 240  O  OP2   . 5BU A 1 12 ? -15.603 -4.894 6.404   1.00 75.38 ? 12 5BU C OP2   1 
HETATM 241  O  "O5'" . 5BU A 1 12 ? -13.538 -6.285 6.057   1.00 72.79 ? 12 5BU C "O5'" 1 
HETATM 242  C  "C5'" . 5BU A 1 12 ? -12.836 -7.504 5.861   1.00 70.63 ? 12 5BU C "C5'" 1 
HETATM 243  C  "C4'" . 5BU A 1 12 ? -11.349 -7.263 5.837   1.00 69.84 ? 12 5BU C "C4'" 1 
HETATM 244  O  "O4'" . 5BU A 1 12 ? -10.997 -6.525 4.636   1.00 70.50 ? 12 5BU C "O4'" 1 
HETATM 245  C  "C3'" . 5BU A 1 12 ? -10.818 -6.390 6.957   1.00 69.51 ? 12 5BU C "C3'" 1 
HETATM 246  O  "O3'" . 5BU A 1 12 ? -10.617 -7.094 8.163   1.00 68.57 ? 12 5BU C "O3'" 1 
HETATM 247  C  "C2'" . 5BU A 1 12 ? -9.518  -5.861 6.372   1.00 69.99 ? 12 5BU C "C2'" 1 
HETATM 248  O  "O2'" . 5BU A 1 12 ? -8.446  -6.780 6.456   1.00 70.19 ? 12 5BU C "O2'" 1 
HETATM 249  C  "C1'" . 5BU A 1 12 ? -9.923  -5.637 4.916   1.00 69.76 ? 12 5BU C "C1'" 1 
HETATM 250  N  N1    . 5BU A 1 12 ? -10.376 -4.254 4.707   1.00 68.98 ? 12 5BU C N1    1 
HETATM 251  C  C2    . 5BU A 1 12 ? -9.404  -3.312 4.442   1.00 68.38 ? 12 5BU C C2    1 
HETATM 252  O  O2    . 5BU A 1 12 ? -8.218  -3.596 4.368   1.00 67.40 ? 12 5BU C O2    1 
HETATM 253  N  N3    . 5BU A 1 12 ? -9.868  -2.028 4.271   1.00 67.91 ? 12 5BU C N3    1 
HETATM 254  C  C4    . 5BU A 1 12 ? -11.181 -1.602 4.338   1.00 67.63 ? 12 5BU C C4    1 
HETATM 255  O  O4    . 5BU A 1 12 ? -11.448 -0.411 4.170   1.00 67.72 ? 12 5BU C O4    1 
HETATM 256  C  C5    . 5BU A 1 12 ? -12.126 -2.633 4.613   1.00 67.01 ? 12 5BU C C5    1 
HETATM 257  C  C6    . 5BU A 1 12 ? -11.709 -3.896 4.782   1.00 67.60 ? 12 5BU C C6    1 
HETATM 258  BR BR    . 5BU A 1 12 ? -13.943 -2.205 4.745   0.32 63.74 ? 12 5BU C BR    1 
ATOM   259  P  P     . C   A 1 13 ? -10.833 -6.327 9.551   1.00 69.21 ? 13 C   C P     1 
ATOM   260  O  OP1   . C   A 1 13 ? -10.804 -7.342 10.632  1.00 70.10 ? 13 C   C OP1   1 
ATOM   261  O  OP2   . C   A 1 13 ? -12.029 -5.457 9.385   1.00 68.65 ? 13 C   C OP2   1 
ATOM   262  O  "O5'" . C   A 1 13 ? -9.537  -5.408 9.689   1.00 66.16 ? 13 C   C "O5'" 1 
ATOM   263  C  "C5'" . C   A 1 13 ? -8.246  -5.996 9.705   1.00 61.84 ? 13 C   C "C5'" 1 
ATOM   264  C  "C4'" . C   A 1 13 ? -7.169  -4.965 9.428   1.00 60.30 ? 13 C   C "C4'" 1 
ATOM   265  O  "O4'" . C   A 1 13 ? -7.387  -4.369 8.111   1.00 60.56 ? 13 C   C "O4'" 1 
ATOM   266  C  "C3'" . C   A 1 13 ? -7.117  -3.758 10.356  1.00 57.84 ? 13 C   C "C3'" 1 
ATOM   267  O  "O3'" . C   A 1 13 ? -6.437  -4.011 11.577  1.00 55.45 ? 13 C   C "O3'" 1 
ATOM   268  C  "C2'" . C   A 1 13 ? -6.370  -2.741 9.503   1.00 58.59 ? 13 C   C "C2'" 1 
ATOM   269  O  "O2'" . C   A 1 13 ? -4.980  -2.992 9.440   1.00 57.63 ? 13 C   C "O2'" 1 
ATOM   270  C  "C1'" . C   A 1 13 ? -6.965  -3.010 8.126   1.00 59.06 ? 13 C   C "C1'" 1 
ATOM   271  N  N1    . C   A 1 13 ? -8.107  -2.111 7.855   1.00 59.20 ? 13 C   C N1    1 
ATOM   272  C  C2    . C   A 1 13 ? -7.831  -0.755 7.602   1.00 58.21 ? 13 C   C C2    1 
ATOM   273  O  O2    . C   A 1 13 ? -6.649  -0.370 7.613   1.00 56.70 ? 13 C   C O2    1 
ATOM   274  N  N3    . C   A 1 13 ? -8.854  0.096  7.357   1.00 58.21 ? 13 C   C N3    1 
ATOM   275  C  C4    . C   A 1 13 ? -10.111 -0.353 7.363   1.00 57.62 ? 13 C   C C4    1 
ATOM   276  N  N4    . C   A 1 13 ? -11.084 0.529  7.116   1.00 57.73 ? 13 C   C N4    1 
ATOM   277  C  C5    . C   A 1 13 ? -10.424 -1.723 7.620   1.00 57.54 ? 13 C   C C5    1 
ATOM   278  C  C6    . C   A 1 13 ? -9.400  -2.560 7.856   1.00 58.40 ? 13 C   C C6    1 
ATOM   279  P  P     . C   A 1 14 ? -6.698  -3.056 12.844  1.00 53.91 ? 14 C   C P     1 
ATOM   280  O  OP1   . C   A 1 14 ? -5.905  -3.593 13.971  1.00 55.55 ? 14 C   C OP1   1 
ATOM   281  O  OP2   . C   A 1 14 ? -8.163  -2.865 13.003  1.00 53.13 ? 14 C   C OP2   1 
ATOM   282  O  "O5'" . C   A 1 14 ? -6.026  -1.665 12.450  1.00 53.86 ? 14 C   C "O5'" 1 
ATOM   283  C  "C5'" . C   A 1 14 ? -4.605  -1.533 12.408  1.00 52.71 ? 14 C   C "C5'" 1 
ATOM   284  C  "C4'" . C   A 1 14 ? -4.198  -0.083 12.224  1.00 52.07 ? 14 C   C "C4'" 1 
ATOM   285  O  "O4'" . C   A 1 14 ? -4.612  0.383  10.908  1.00 51.60 ? 14 C   C "O4'" 1 
ATOM   286  C  "C3'" . C   A 1 14 ? -4.825  0.915  13.185  1.00 51.58 ? 14 C   C "C3'" 1 
ATOM   287  O  "O3'" . C   A 1 14 ? -4.126  0.974  14.425  1.00 49.22 ? 14 C   C "O3'" 1 
ATOM   288  C  "C2'" . C   A 1 14 ? -4.715  2.219  12.404  1.00 51.63 ? 14 C   C "C2'" 1 
ATOM   289  O  "O2'" . C   A 1 14 ? -3.421  2.785  12.459  1.00 52.11 ? 14 C   C "O2'" 1 
ATOM   290  C  "C1'" . C   A 1 14 ? -4.991  1.745  10.979  1.00 50.70 ? 14 C   C "C1'" 1 
ATOM   291  N  N1    . C   A 1 14 ? -6.411  1.860  10.620  1.00 50.76 ? 14 C   C N1    1 
ATOM   292  C  C2    . C   A 1 14 ? -6.876  3.082  10.129  1.00 50.94 ? 14 C   C C2    1 
ATOM   293  O  O2    . C   A 1 14 ? -6.077  4.022  10.010  1.00 51.65 ? 14 C   C O2    1 
ATOM   294  N  N3    . C   A 1 14 ? -8.180  3.209  9.800   1.00 50.26 ? 14 C   C N3    1 
ATOM   295  C  C4    . C   A 1 14 ? -9.008  2.176  9.950   1.00 49.90 ? 14 C   C C4    1 
ATOM   296  N  N4    . C   A 1 14 ? -10.285 2.351  9.615   1.00 49.65 ? 14 C   C N4    1 
ATOM   297  C  C5    . C   A 1 14 ? -8.562  0.919  10.449  1.00 49.14 ? 14 C   C C5    1 
ATOM   298  C  C6    . C   A 1 14 ? -7.266  0.806  10.766  1.00 50.52 ? 14 C   C C6    1 
ATOM   299  P  P     . A   A 1 15 ? -4.881  1.523  15.734  1.00 48.62 ? 15 A   C P     1 
ATOM   300  O  OP1   . A   A 1 15 ? -3.937  1.392  16.871  1.00 49.74 ? 15 A   C OP1   1 
ATOM   301  O  OP2   . A   A 1 15 ? -6.212  0.871  15.807  1.00 48.62 ? 15 A   C OP2   1 
ATOM   302  O  "O5'" . A   A 1 15 ? -5.104  3.079  15.441  1.00 48.70 ? 15 A   C "O5'" 1 
ATOM   303  C  "C5'" . A   A 1 15 ? -3.990  3.966  15.312  1.00 46.39 ? 15 A   C "C5'" 1 
ATOM   304  C  "C4'" . A   A 1 15 ? -4.438  5.367  14.924  1.00 44.38 ? 15 A   C "C4'" 1 
ATOM   305  O  "O4'" . A   A 1 15 ? -5.065  5.338  13.613  1.00 44.21 ? 15 A   C "O4'" 1 
ATOM   306  C  "C3'" . A   A 1 15 ? -5.498  5.997  15.814  1.00 43.74 ? 15 A   C "C3'" 1 
ATOM   307  O  "O3'" . A   A 1 15 ? -4.929  6.617  16.954  1.00 42.13 ? 15 A   C "O3'" 1 
ATOM   308  C  "C2'" . A   A 1 15 ? -6.132  7.031  14.895  1.00 43.84 ? 15 A   C "C2'" 1 
ATOM   309  O  "O2'" . A   A 1 15 ? -5.387  8.225  14.793  1.00 44.14 ? 15 A   C "O2'" 1 
ATOM   310  C  "C1'" . A   A 1 15 ? -6.101  6.302  13.558  1.00 43.66 ? 15 A   C "C1'" 1 
ATOM   311  N  N9    . A   A 1 15 ? -7.359  5.632  13.265  1.00 44.08 ? 15 A   C N9    1 
ATOM   312  C  C8    . A   A 1 15 ? -7.720  4.328  13.478  1.00 45.14 ? 15 A   C C8    1 
ATOM   313  N  N7    . A   A 1 15 ? -8.939  4.048  13.079  1.00 45.47 ? 15 A   C N7    1 
ATOM   314  C  C5    . A   A 1 15 ? -9.408  5.255  12.572  1.00 44.28 ? 15 A   C C5    1 
ATOM   315  C  C6    . A   A 1 15 ? -10.631 5.634  11.991  1.00 43.09 ? 15 A   C C6    1 
ATOM   316  N  N6    . A   A 1 15 ? -11.651 4.801  11.797  1.00 44.02 ? 15 A   C N6    1 
ATOM   317  N  N1    . A   A 1 15 ? -10.770 6.916  11.607  1.00 41.90 ? 15 A   C N1    1 
ATOM   318  C  C2    . A   A 1 15 ? -9.752  7.749  11.788  1.00 42.45 ? 15 A   C C2    1 
ATOM   319  N  N3    . A   A 1 15 ? -8.556  7.516  12.313  1.00 43.30 ? 15 A   C N3    1 
ATOM   320  C  C4    . A   A 1 15 ? -8.447  6.236  12.689  1.00 43.99 ? 15 A   C C4    1 
HETATM 321  P  P     . 5BU A 1 16 ? -5.822  6.815  18.267  1.00 41.34 ? 16 5BU C P     1 
HETATM 322  O  OP1   . 5BU A 1 16 ? -4.922  7.340  19.326  1.00 39.38 ? 16 5BU C OP1   1 
HETATM 323  O  OP2   . 5BU A 1 16 ? -6.558  5.540  18.471  1.00 39.86 ? 16 5BU C OP2   1 
HETATM 324  O  "O5'" . 5BU A 1 16 ? -6.875  7.951  17.878  1.00 41.16 ? 16 5BU C "O5'" 1 
HETATM 325  C  "C5'" . 5BU A 1 16 ? -6.434  9.272  17.586  1.00 38.07 ? 16 5BU C "C5'" 1 
HETATM 326  C  "C4'" . 5BU A 1 16 ? -7.588  10.159 17.169  1.00 35.47 ? 16 5BU C "C4'" 1 
HETATM 327  O  "O4'" . 5BU A 1 16 ? -8.147  9.694  15.907  1.00 33.61 ? 16 5BU C "O4'" 1 
HETATM 328  C  "C3'" . 5BU A 1 16 ? -8.787  10.121 18.098  1.00 35.91 ? 16 5BU C "C3'" 1 
HETATM 329  O  "O3'" . 5BU A 1 16 ? -8.617  10.913 19.261  1.00 37.35 ? 16 5BU C "O3'" 1 
HETATM 330  C  "C2'" . 5BU A 1 16 ? -9.911  10.613 17.198  1.00 34.99 ? 16 5BU C "C2'" 1 
HETATM 331  O  "O2'" . 5BU A 1 16 ? -9.888  12.010 17.001  1.00 35.37 ? 16 5BU C "O2'" 1 
HETATM 332  C  "C1'" . 5BU A 1 16 ? -9.541  9.952  15.881  1.00 33.15 ? 16 5BU C "C1'" 1 
HETATM 333  N  N1    . 5BU A 1 16 ? -10.271 8.697  15.677  1.00 34.10 ? 16 5BU C N1    1 
HETATM 334  C  C2    . 5BU A 1 16 ? -11.525 8.787  15.090  1.00 34.06 ? 16 5BU C C2    1 
HETATM 335  O  O2    . 5BU A 1 16 ? -12.037 9.853  14.778  1.00 33.54 ? 16 5BU C O2    1 
HETATM 336  N  N3    . 5BU A 1 16 ? -12.155 7.586  14.881  1.00 32.55 ? 16 5BU C N3    1 
HETATM 337  C  C4    . 5BU A 1 16 ? -11.675 6.338  15.197  1.00 33.62 ? 16 5BU C C4    1 
HETATM 338  O  O4    . 5BU A 1 16 ? -12.354 5.348  14.913  1.00 33.25 ? 16 5BU C O4    1 
HETATM 339  C  C5    . 5BU A 1 16 ? -10.374 6.332  15.823  1.00 33.01 ? 16 5BU C C5    1 
HETATM 340  C  C6    . 5BU A 1 16 ? -9.739  7.484  16.036  1.00 33.58 ? 16 5BU C C6    1 
HETATM 341  BR BR    . 5BU A 1 16 ? -9.563  4.704  16.341  0.25 35.34 ? 16 5BU C BR    1 
ATOM   342  P  P     . G   A 1 17 ? -9.542  10.630 20.539  1.00 35.25 ? 17 G   C P     1 
ATOM   343  O  OP1   . G   A 1 17 ? -9.055  11.489 21.637  1.00 34.85 ? 17 G   C OP1   1 
ATOM   344  O  OP2   . G   A 1 17 ? -9.645  9.162  20.728  1.00 33.87 ? 17 G   C OP2   1 
ATOM   345  O  "O5'" . G   A 1 17 ? -10.956 11.195 20.097  1.00 35.52 ? 17 G   C "O5'" 1 
ATOM   346  C  "C5'" . G   A 1 17 ? -11.118 12.581 19.856  1.00 32.90 ? 17 G   C "C5'" 1 
ATOM   347  C  "C4'" . G   A 1 17 ? -12.490 12.859 19.308  1.00 33.49 ? 17 G   C "C4'" 1 
ATOM   348  O  "O4'" . G   A 1 17 ? -12.659 12.113 18.076  1.00 33.79 ? 17 G   C "O4'" 1 
ATOM   349  C  "C3'" . G   A 1 17 ? -13.638 12.363 20.168  1.00 33.72 ? 17 G   C "C3'" 1 
ATOM   350  O  "O3'" . G   A 1 17 ? -13.948 13.268 21.207  1.00 33.80 ? 17 G   C "O3'" 1 
ATOM   351  C  "C2'" . G   A 1 17 ? -14.765 12.238 19.156  1.00 33.94 ? 17 G   C "C2'" 1 
ATOM   352  O  "O2'" . G   A 1 17 ? -15.329 13.491 18.820  1.00 35.17 ? 17 G   C "O2'" 1 
ATOM   353  C  "C1'" . G   A 1 17 ? -14.008 11.707 17.946  1.00 32.32 ? 17 G   C "C1'" 1 
ATOM   354  N  N9    . G   A 1 17 ? -14.048 10.258 17.833  1.00 32.89 ? 17 G   C N9    1 
ATOM   355  C  C8    . G   A 1 17 ? -13.082 9.357  18.212  1.00 34.68 ? 17 G   C C8    1 
ATOM   356  N  N7    . G   A 1 17 ? -13.405 8.119  17.942  1.00 35.47 ? 17 G   C N7    1 
ATOM   357  C  C5    . G   A 1 17 ? -14.663 8.214  17.360  1.00 34.28 ? 17 G   C C5    1 
ATOM   358  C  C6    . G   A 1 17 ? -15.522 7.207  16.859  1.00 34.92 ? 17 G   C C6    1 
ATOM   359  O  O6    . G   A 1 17 ? -15.340 5.986  16.824  1.00 36.08 ? 17 G   C O6    1 
ATOM   360  N  N1    . G   A 1 17 ? -16.702 7.746  16.359  1.00 35.75 ? 17 G   C N1    1 
ATOM   361  C  C2    . G   A 1 17 ? -17.015 9.084  16.342  1.00 34.67 ? 17 G   C C2    1 
ATOM   362  N  N2    . G   A 1 17 ? -18.199 9.415  15.801  1.00 34.34 ? 17 G   C N2    1 
ATOM   363  N  N3    . G   A 1 17 ? -16.226 10.028 16.813  1.00 33.20 ? 17 G   C N3    1 
ATOM   364  C  C4    . G   A 1 17 ? -15.075 9.527  17.298  1.00 33.71 ? 17 G   C C4    1 
ATOM   365  P  P     . C   A 1 18 ? -14.640 12.718 22.542  1.00 35.23 ? 18 C   C P     1 
ATOM   366  O  OP1   . C   A 1 18 ? -14.630 13.842 23.508  1.00 31.99 ? 18 C   C OP1   1 
ATOM   367  O  OP2   . C   A 1 18 ? -14.012 11.424 22.909  1.00 34.14 ? 18 C   C OP2   1 
ATOM   368  O  "O5'" . C   A 1 18 ? -16.133 12.419 22.079  1.00 34.72 ? 18 C   C "O5'" 1 
ATOM   369  C  "C5'" . C   A 1 18 ? -16.987 13.473 21.672  1.00 35.47 ? 18 C   C "C5'" 1 
ATOM   370  C  "C4'" . C   A 1 18 ? -18.295 12.919 21.180  1.00 36.29 ? 18 C   C "C4'" 1 
ATOM   371  O  "O4'" . C   A 1 18 ? -18.036 12.083 20.028  1.00 37.00 ? 18 C   C "O4'" 1 
ATOM   372  C  "C3'" . C   A 1 18 ? -19.014 11.998 22.149  1.00 35.97 ? 18 C   C "C3'" 1 
ATOM   373  O  "O3'" . C   A 1 18 ? -19.761 12.710 23.129  1.00 37.48 ? 18 C   C "O3'" 1 
ATOM   374  C  "C2'" . C   A 1 18 ? -19.877 11.161 21.217  1.00 37.30 ? 18 C   C "C2'" 1 
ATOM   375  O  "O2'" . C   A 1 18 ? -21.032 11.862 20.805  1.00 38.12 ? 18 C   C "O2'" 1 
ATOM   376  C  "C1'" . C   A 1 18 ? -18.939 10.989 20.018  1.00 37.03 ? 18 C   C "C1'" 1 
ATOM   377  N  N1    . C   A 1 18 ? -18.154 9.744  20.038  1.00 36.00 ? 18 C   C N1    1 
ATOM   378  C  C2    . C   A 1 18 ? -18.709 8.601  19.474  1.00 35.40 ? 18 C   C C2    1 
ATOM   379  O  O2    . C   A 1 18 ? -19.851 8.669  19.000  1.00 36.55 ? 18 C   C O2    1 
ATOM   380  N  N3    . C   A 1 18 ? -17.992 7.454  19.464  1.00 33.11 ? 18 C   C N3    1 
ATOM   381  C  C4    . C   A 1 18 ? -16.769 7.429  20.004  1.00 32.08 ? 18 C   C C4    1 
ATOM   382  N  N4    . C   A 1 18 ? -16.092 6.277  19.980  1.00 31.70 ? 18 C   C N4    1 
ATOM   383  C  C5    . C   A 1 18 ? -16.185 8.581  20.596  1.00 31.91 ? 18 C   C C5    1 
ATOM   384  C  C6    . C   A 1 18 ? -16.904 9.707  20.591  1.00 34.38 ? 18 C   C C6    1 
ATOM   385  O  "O5'" . G   B 1 1  ? -20.964 -1.439 15.758  1.00 51.68 ? 1  G   D "O5'" 1 
ATOM   386  C  "C5'" . G   B 1 1  ? -22.377 -1.712 15.718  1.00 50.96 ? 1  G   D "C5'" 1 
ATOM   387  C  "C4'" . G   B 1 1  ? -23.182 -0.466 16.006  1.00 49.26 ? 1  G   D "C4'" 1 
ATOM   388  O  "O4'" . G   B 1 1  ? -22.860 0.008  17.335  1.00 48.66 ? 1  G   D "O4'" 1 
ATOM   389  C  "C3'" . G   B 1 1  ? -22.913 0.726  15.108  1.00 49.16 ? 1  G   D "C3'" 1 
ATOM   390  O  "O3'" . G   B 1 1  ? -23.669 0.655  13.917  1.00 50.85 ? 1  G   D "O3'" 1 
ATOM   391  C  "C2'" . G   B 1 1  ? -23.343 1.886  15.988  1.00 47.82 ? 1  G   D "C2'" 1 
ATOM   392  O  "O2'" . G   B 1 1  ? -24.750 1.987  16.058  1.00 47.40 ? 1  G   D "O2'" 1 
ATOM   393  C  "C1'" . G   B 1 1  ? -22.819 1.423  17.343  1.00 45.42 ? 1  G   D "C1'" 1 
ATOM   394  N  N9    . G   B 1 1  ? -21.427 1.790  17.564  1.00 41.29 ? 1  G   D N9    1 
ATOM   395  C  C8    . G   B 1 1  ? -20.351 0.941  17.508  1.00 40.58 ? 1  G   D C8    1 
ATOM   396  N  N7    . G   B 1 1  ? -19.223 1.519  17.817  1.00 39.95 ? 1  G   D N7    1 
ATOM   397  C  C5    . G   B 1 1  ? -19.575 2.834  18.074  1.00 39.06 ? 1  G   D C5    1 
ATOM   398  C  C6    . G   B 1 1  ? -18.775 3.923  18.466  1.00 39.29 ? 1  G   D C6    1 
ATOM   399  O  O6    . G   B 1 1  ? -17.555 3.943  18.671  1.00 41.28 ? 1  G   D O6    1 
ATOM   400  N  N1    . G   B 1 1  ? -19.532 5.083  18.622  1.00 39.05 ? 1  G   D N1    1 
ATOM   401  C  C2    . G   B 1 1  ? -20.890 5.172  18.417  1.00 38.45 ? 1  G   D C2    1 
ATOM   402  N  N2    . G   B 1 1  ? -21.435 6.378  18.595  1.00 38.06 ? 1  G   D N2    1 
ATOM   403  N  N3    . G   B 1 1  ? -21.650 4.151  18.059  1.00 37.78 ? 1  G   D N3    1 
ATOM   404  C  C4    . G   B 1 1  ? -20.932 3.021  17.907  1.00 39.38 ? 1  G   D C4    1 
ATOM   405  P  P     . C   B 1 2  ? -23.046 1.235  12.562  1.00 52.45 ? 2  C   D P     1 
ATOM   406  O  OP1   . C   B 1 2  ? -24.056 0.989  11.497  1.00 52.34 ? 2  C   D OP1   1 
ATOM   407  O  OP2   . C   B 1 2  ? -21.662 0.706  12.404  1.00 51.77 ? 2  C   D OP2   1 
ATOM   408  O  "O5'" . C   B 1 2  ? -22.970 2.802  12.853  1.00 51.06 ? 2  C   D "O5'" 1 
ATOM   409  C  "C5'" . C   B 1 2  ? -24.166 3.554  12.999  1.00 48.19 ? 2  C   D "C5'" 1 
ATOM   410  C  "C4'" . C   B 1 2  ? -23.862 5.004  13.297  1.00 46.92 ? 2  C   D "C4'" 1 
ATOM   411  O  "O4'" . C   B 1 2  ? -23.216 5.100  14.595  1.00 46.20 ? 2  C   D "O4'" 1 
ATOM   412  C  "C3'" . C   B 1 2  ? -22.884 5.693  12.360  1.00 46.39 ? 2  C   D "C3'" 1 
ATOM   413  O  "O3'" . C   B 1 2  ? -23.490 6.179  11.178  1.00 46.41 ? 2  C   D "O3'" 1 
ATOM   414  C  "C2'" . C   B 1 2  ? -22.386 6.838  13.222  1.00 46.36 ? 2  C   D "C2'" 1 
ATOM   415  O  "O2'" . C   B 1 2  ? -23.344 7.871  13.291  1.00 47.64 ? 2  C   D "O2'" 1 
ATOM   416  C  "C1'" . C   B 1 2  ? -22.275 6.157  14.582  1.00 43.95 ? 2  C   D "C1'" 1 
ATOM   417  N  N1    . C   B 1 2  ? -20.932 5.599  14.768  1.00 41.32 ? 2  C   D N1    1 
ATOM   418  C  C2    . C   B 1 2  ? -19.949 6.420  15.307  1.00 41.17 ? 2  C   D C2    1 
ATOM   419  O  O2    . C   B 1 2  ? -20.251 7.580  15.619  1.00 44.71 ? 2  C   D O2    1 
ATOM   420  N  N3    . C   B 1 2  ? -18.703 5.940  15.476  1.00 39.05 ? 2  C   D N3    1 
ATOM   421  C  C4    . C   B 1 2  ? -18.422 4.690  15.131  1.00 38.08 ? 2  C   D C4    1 
ATOM   422  N  N4    . C   B 1 2  ? -17.176 4.259  15.325  1.00 37.46 ? 2  C   D N4    1 
ATOM   423  C  C5    . C   B 1 2  ? -19.407 3.824  14.573  1.00 37.91 ? 2  C   D C5    1 
ATOM   424  C  C6    . C   B 1 2  ? -20.639 4.315  14.413  1.00 38.44 ? 2  C   D C6    1 
ATOM   425  P  P     . A   B 1 3  ? -22.617 6.292  9.835   1.00 47.74 ? 3  A   D P     1 
ATOM   426  O  OP1   . A   B 1 3  ? -23.546 6.752  8.771   1.00 48.75 ? 3  A   D OP1   1 
ATOM   427  O  OP2   . A   B 1 3  ? -21.865 5.026  9.653   1.00 48.20 ? 3  A   D OP2   1 
ATOM   428  O  "O5'" . A   B 1 3  ? -21.567 7.456  10.148  1.00 46.42 ? 3  A   D "O5'" 1 
ATOM   429  C  "C5'" . A   B 1 3  ? -22.014 8.798  10.301  1.00 42.86 ? 3  A   D "C5'" 1 
ATOM   430  C  "C4'" . A   B 1 3  ? -20.859 9.743  10.565  1.00 41.10 ? 3  A   D "C4'" 1 
ATOM   431  O  "O4'" . A   B 1 3  ? -20.304 9.486  11.884  1.00 40.29 ? 3  A   D "O4'" 1 
ATOM   432  C  "C3'" . A   B 1 3  ? -19.660 9.643  9.633   1.00 39.62 ? 3  A   D "C3'" 1 
ATOM   433  O  "O3'" . A   B 1 3  ? -19.863 10.371 8.430   1.00 38.42 ? 3  A   D "O3'" 1 
ATOM   434  C  "C2'" . A   B 1 3  ? -18.565 10.265 10.480  1.00 39.00 ? 3  A   D "C2'" 1 
ATOM   435  O  "O2'" . A   B 1 3  ? -18.705 11.667 10.515  1.00 38.54 ? 3  A   D "O2'" 1 
ATOM   436  C  "C1'" . A   B 1 3  ? -18.910 9.726  11.865  1.00 39.37 ? 3  A   D "C1'" 1 
ATOM   437  N  N9    . A   B 1 3  ? -18.201 8.480  12.138  1.00 40.57 ? 3  A   D N9    1 
ATOM   438  C  C8    . A   B 1 3  ? -18.578 7.182  11.885  1.00 40.36 ? 3  A   D C8    1 
ATOM   439  N  N7    . A   B 1 3  ? -17.671 6.293  12.227  1.00 39.56 ? 3  A   D N7    1 
ATOM   440  C  C5    . A   B 1 3  ? -16.635 7.060  12.748  1.00 39.53 ? 3  A   D C5    1 
ATOM   441  C  C6    . A   B 1 3  ? -15.380 6.724  13.286  1.00 38.47 ? 3  A   D C6    1 
ATOM   442  N  N6    . A   B 1 3  ? -14.930 5.479  13.400  1.00 37.72 ? 3  A   D N6    1 
ATOM   443  N  N1    . A   B 1 3  ? -14.589 7.731  13.709  1.00 38.29 ? 3  A   D N1    1 
ATOM   444  C  C2    . A   B 1 3  ? -15.032 8.981  13.601  1.00 38.29 ? 3  A   D C2    1 
ATOM   445  N  N3    . A   B 1 3  ? -16.187 9.425  13.118  1.00 39.15 ? 3  A   D N3    1 
ATOM   446  C  C4    . A   B 1 3  ? -16.951 8.403  12.703  1.00 39.87 ? 3  A   D C4    1 
HETATM 447  P  P     . 5BU B 1 4  ? -18.908 10.109 7.162   1.00 38.13 ? 4  5BU D P     1 
HETATM 448  O  OP1   . 5BU B 1 4  ? -19.422 10.997 6.094   1.00 34.80 ? 4  5BU D OP1   1 
HETATM 449  O  OP2   . 5BU B 1 4  ? -18.780 8.649  6.905   1.00 38.15 ? 4  5BU D OP2   1 
HETATM 450  O  "O5'" . 5BU B 1 4  ? -17.487 10.657 7.633   1.00 37.72 ? 4  5BU D "O5'" 1 
HETATM 451  C  "C5'" . 5BU B 1 4  ? -17.277 12.057 7.788   1.00 35.26 ? 4  5BU D "C5'" 1 
HETATM 452  C  "C4'" . 5BU B 1 4  ? -15.828 12.350 8.055   1.00 33.82 ? 4  5BU D "C4'" 1 
HETATM 453  O  "O4'" . 5BU B 1 4  ? -15.468 11.866 9.377   1.00 34.01 ? 4  5BU D "O4'" 1 
HETATM 454  C  "C3'" . 5BU B 1 4  ? -14.862 11.640 7.132   1.00 34.21 ? 4  5BU D "C3'" 1 
HETATM 455  O  "O3'" . 5BU B 1 4  ? -14.723 12.325 5.900   1.00 32.77 ? 4  5BU D "O3'" 1 
HETATM 456  C  "C2'" . 5BU B 1 4  ? -13.585 11.634 7.962   1.00 35.20 ? 4  5BU D "C2'" 1 
HETATM 457  O  "O2'" . 5BU B 1 4  ? -12.906 12.865 7.944   1.00 38.28 ? 4  5BU D "O2'" 1 
HETATM 458  C  "C1'" . 5BU B 1 4  ? -14.134 11.392 9.368   1.00 34.32 ? 4  5BU D "C1'" 1 
HETATM 459  N  N1    . 5BU B 1 4  ? -14.136 9.955  9.673   1.00 34.59 ? 4  5BU D N1    1 
HETATM 460  C  C2    . 5BU B 1 4  ? -13.008 9.434  10.278  1.00 34.85 ? 4  5BU D C2    1 
HETATM 461  O  O2    . 5BU B 1 4  ? -12.065 10.125 10.625  1.00 35.62 ? 4  5BU D O2    1 
HETATM 462  N  N3    . 5BU B 1 4  ? -13.026 8.075  10.466  1.00 34.93 ? 4  5BU D N3    1 
HETATM 463  C  C4    . 5BU B 1 4  ? -14.044 7.205  10.131  1.00 36.15 ? 4  5BU D C4    1 
HETATM 464  O  O4    . 5BU B 1 4  ? -13.906 5.993  10.345  1.00 35.81 ? 4  5BU D O4    1 
HETATM 465  C  C5    . 5BU B 1 4  ? -15.190 7.831  9.536   1.00 35.30 ? 4  5BU D C5    1 
HETATM 466  C  C6    . 5BU B 1 4  ? -15.200 9.149  9.338   1.00 34.67 ? 4  5BU D C6    1 
HETATM 467  BR BR    . 5BU B 1 4  ? -16.661 6.794  9.022   0.31 35.35 ? 4  5BU D BR    1 
ATOM   468  P  P     . G   B 1 5  ? -14.129 11.554 4.628   1.00 31.28 ? 5  G   D P     1 
ATOM   469  O  OP1   . G   B 1 5  ? -14.250 12.504 3.502   1.00 32.69 ? 5  G   D OP1   1 
ATOM   470  O  OP2   . G   B 1 5  ? -14.757 10.222 4.518   1.00 32.22 ? 5  G   D OP2   1 
ATOM   471  O  "O5'" . G   B 1 5  ? -12.597 11.366 4.995   1.00 28.32 ? 5  G   D "O5'" 1 
ATOM   472  C  "C5'" . G   B 1 5  ? -11.796 12.504 5.202   1.00 29.53 ? 5  G   D "C5'" 1 
ATOM   473  C  "C4'" . G   B 1 5  ? -10.441 12.120 5.712   1.00 30.68 ? 5  G   D "C4'" 1 
ATOM   474  O  "O4'" . G   B 1 5  ? -10.573 11.584 7.049   1.00 32.69 ? 5  G   D "O4'" 1 
ATOM   475  C  "C3'" . G   B 1 5  ? -9.724  11.026 4.945   1.00 31.04 ? 5  G   D "C3'" 1 
ATOM   476  O  "O3'" . G   B 1 5  ? -9.078  11.500 3.775   1.00 31.59 ? 5  G   D "O3'" 1 
ATOM   477  C  "C2'" . G   B 1 5  ? -8.747  10.508 5.987   1.00 32.96 ? 5  G   D "C2'" 1 
ATOM   478  O  "O2'" . G   B 1 5  ? -7.637  11.362 6.165   1.00 33.60 ? 5  G   D "O2'" 1 
ATOM   479  C  "C1'" . G   B 1 5  ? -9.610  10.557 7.246   1.00 35.04 ? 5  G   D "C1'" 1 
ATOM   480  N  N9    . G   B 1 5  ? -10.297 9.279  7.430   1.00 37.90 ? 5  G   D N9    1 
ATOM   481  C  C8    . G   B 1 5  ? -11.577 8.935  7.051   1.00 38.15 ? 5  G   D C8    1 
ATOM   482  N  N7    . G   B 1 5  ? -11.868 7.687  7.301   1.00 38.12 ? 5  G   D N7    1 
ATOM   483  C  C5    . G   B 1 5  ? -10.717 7.182  7.890   1.00 40.16 ? 5  G   D C5    1 
ATOM   484  C  C6    . G   B 1 5  ? -10.424 5.879  8.371   1.00 41.90 ? 5  G   D C6    1 
ATOM   485  O  O6    . G   B 1 5  ? -11.146 4.870  8.359   1.00 45.92 ? 5  G   D O6    1 
ATOM   486  N  N1    . G   B 1 5  ? -9.138  5.808  8.902   1.00 41.33 ? 5  G   D N1    1 
ATOM   487  C  C2    . G   B 1 5  ? -8.246  6.852  8.954   1.00 40.67 ? 5  G   D C2    1 
ATOM   488  N  N2    . G   B 1 5  ? -7.057  6.591  9.497   1.00 42.56 ? 5  G   D N2    1 
ATOM   489  N  N3    . G   B 1 5  ? -8.503  8.065  8.505   1.00 39.94 ? 5  G   D N3    1 
ATOM   490  C  C4    . G   B 1 5  ? -9.747  8.158  7.990   1.00 39.06 ? 5  G   D C4    1 
ATOM   491  P  P     . G   B 1 6  ? -8.836  10.490 2.553   1.00 32.89 ? 6  G   D P     1 
ATOM   492  O  OP1   . G   B 1 6  ? -8.348  11.275 1.388   1.00 35.08 ? 6  G   D OP1   1 
ATOM   493  O  OP2   . G   B 1 6  ? -10.045 9.646  2.407   1.00 33.51 ? 6  G   D OP2   1 
ATOM   494  O  "O5'" . G   B 1 6  ? -7.644  9.579  3.073   1.00 33.15 ? 6  G   D "O5'" 1 
ATOM   495  C  "C5'" . G   B 1 6  ? -6.383  10.158 3.356   1.00 36.09 ? 6  G   D "C5'" 1 
ATOM   496  C  "C4'" . G   B 1 6  ? -5.441  9.129  3.907   1.00 37.86 ? 6  G   D "C4'" 1 
ATOM   497  O  "O4'" . G   B 1 6  ? -5.946  8.658  5.182   1.00 40.42 ? 6  G   D "O4'" 1 
ATOM   498  C  "C3'" . G   B 1 6  ? -5.287  7.868  3.081   1.00 39.88 ? 6  G   D "C3'" 1 
ATOM   499  O  "O3'" . G   B 1 6  ? -4.346  8.039  2.041   1.00 42.48 ? 6  G   D "O3'" 1 
ATOM   500  C  "C2'" . G   B 1 6  ? -4.797  6.882  4.127   1.00 41.98 ? 6  G   D "C2'" 1 
ATOM   501  O  "O2'" . G   B 1 6  ? -3.432  7.105  4.432   1.00 41.18 ? 6  G   D "O2'" 1 
ATOM   502  C  "C1'" . G   B 1 6  ? -5.658  7.276  5.327   1.00 41.16 ? 6  G   D "C1'" 1 
ATOM   503  N  N9    . G   B 1 6  ? -6.923  6.543  5.322   1.00 41.72 ? 6  G   D N9    1 
ATOM   504  C  C8    . G   B 1 6  ? -8.137  6.996  4.871   1.00 41.67 ? 6  G   D C8    1 
ATOM   505  N  N7    . G   B 1 6  ? -9.086  6.104  4.965   1.00 41.31 ? 6  G   D N7    1 
ATOM   506  C  C5    . G   B 1 6  ? -8.464  4.995  5.514   1.00 41.51 ? 6  G   D C5    1 
ATOM   507  C  C6    . G   B 1 6  ? -8.989  3.718  5.848   1.00 42.42 ? 6  G   D C6    1 
ATOM   508  O  O6    . G   B 1 6  ? -10.147 3.292  5.713   1.00 43.79 ? 6  G   D O6    1 
ATOM   509  N  N1    . G   B 1 6  ? -8.012  2.896  6.392   1.00 43.83 ? 6  G   D N1    1 
ATOM   510  C  C2    . G   B 1 6  ? -6.701  3.249  6.586   1.00 43.30 ? 6  G   D C2    1 
ATOM   511  N  N2    . G   B 1 6  ? -5.920  2.313  7.122   1.00 44.37 ? 6  G   D N2    1 
ATOM   512  N  N3    . G   B 1 6  ? -6.197  4.432  6.276   1.00 42.43 ? 6  G   D N3    1 
ATOM   513  C  C4    . G   B 1 6  ? -7.129  5.250  5.750   1.00 41.55 ? 6  G   D C4    1 
ATOM   514  P  P     . A   B 1 7  ? -4.398  7.079  0.759   1.00 43.48 ? 7  A   D P     1 
ATOM   515  O  OP1   . A   B 1 7  ? -3.354  7.575  -0.166  1.00 44.56 ? 7  A   D OP1   1 
ATOM   516  O  OP2   . A   B 1 7  ? -5.800  6.952  0.288   1.00 42.56 ? 7  A   D OP2   1 
ATOM   517  O  "O5'" . A   B 1 7  ? -3.905  5.677  1.322   1.00 45.93 ? 7  A   D "O5'" 1 
ATOM   518  C  "C5'" . A   B 1 7  ? -2.565  5.525  1.792   1.00 50.00 ? 7  A   D "C5'" 1 
ATOM   519  C  "C4'" . A   B 1 7  ? -2.306  4.096  2.223   1.00 52.31 ? 7  A   D "C4'" 1 
ATOM   520  O  "O4'" . A   B 1 7  ? -3.069  3.804  3.429   1.00 52.20 ? 7  A   D "O4'" 1 
ATOM   521  C  "C3'" . A   B 1 7  ? -2.715  3.005  1.247   1.00 53.88 ? 7  A   D "C3'" 1 
ATOM   522  O  "O3'" . A   B 1 7  ? -1.772  2.778  0.209   1.00 55.84 ? 7  A   D "O3'" 1 
ATOM   523  C  "C2'" . A   B 1 7  ? -2.879  1.811  2.172   1.00 53.67 ? 7  A   D "C2'" 1 
ATOM   524  O  "O2'" . A   B 1 7  ? -1.621  1.291  2.558   1.00 54.22 ? 7  A   D "O2'" 1 
ATOM   525  C  "C1'" . A   B 1 7  ? -3.544  2.469  3.380   1.00 51.90 ? 7  A   D "C1'" 1 
ATOM   526  N  N9    . A   B 1 7  ? -4.999  2.520  3.224   1.00 51.68 ? 7  A   D N9    1 
ATOM   527  C  C8    . A   B 1 7  ? -5.761  3.544  2.715   1.00 50.75 ? 7  A   D C8    1 
ATOM   528  N  N7    . A   B 1 7  ? -7.049  3.299  2.721   1.00 49.41 ? 7  A   D N7    1 
ATOM   529  C  C5    . A   B 1 7  ? -7.143  2.027  3.264   1.00 50.28 ? 7  A   D C5    1 
ATOM   530  C  C6    . A   B 1 7  ? -8.241  1.194  3.542   1.00 51.33 ? 7  A   D C6    1 
ATOM   531  N  N6    . A   B 1 7  ? -9.510  1.528  3.312   1.00 50.68 ? 7  A   D N6    1 
ATOM   532  N  N1    . A   B 1 7  ? -7.986  -0.015 4.077   1.00 52.63 ? 7  A   D N1    1 
ATOM   533  C  C2    . A   B 1 7  ? -6.715  -0.357 4.317   1.00 54.07 ? 7  A   D C2    1 
ATOM   534  N  N3    . A   B 1 7  ? -5.601  0.336  4.104   1.00 53.69 ? 7  A   D N3    1 
ATOM   535  C  C4    . A   B 1 7  ? -5.888  1.533  3.571   1.00 51.76 ? 7  A   D C4    1 
ATOM   536  P  P     . C   B 1 8  ? -2.298  2.273  -1.227  1.00 59.51 ? 8  C   D P     1 
ATOM   537  O  OP1   . C   B 1 8  ? -1.123  2.208  -2.135  1.00 58.39 ? 8  C   D OP1   1 
ATOM   538  O  OP2   . C   B 1 8  ? -3.486  3.069  -1.628  1.00 58.19 ? 8  C   D OP2   1 
ATOM   539  O  "O5'" . C   B 1 8  ? -2.804  0.792  -0.931  1.00 60.03 ? 8  C   D "O5'" 1 
ATOM   540  C  "C5'" . C   B 1 8  ? -1.904  -0.194 -0.438  1.00 61.99 ? 8  C   D "C5'" 1 
ATOM   541  C  "C4'" . C   B 1 8  ? -2.638  -1.475 -0.132  1.00 62.34 ? 8  C   D "C4'" 1 
ATOM   542  O  "O4'" . C   B 1 8  ? -3.592  -1.229 0.934   1.00 61.68 ? 8  C   D "O4'" 1 
ATOM   543  C  "C3'" . C   B 1 8  ? -3.499  -2.009 -1.261  1.00 64.70 ? 8  C   D "C3'" 1 
ATOM   544  O  "O3'" . C   B 1 8  ? -2.748  -2.725 -2.230  1.00 68.00 ? 8  C   D "O3'" 1 
ATOM   545  C  "C2'" . C   B 1 8  ? -4.507  -2.868 -0.511  1.00 64.23 ? 8  C   D "C2'" 1 
ATOM   546  O  "O2'" . C   B 1 8  ? -3.975  -4.112 -0.103  1.00 66.77 ? 8  C   D "O2'" 1 
ATOM   547  C  "C1'" . C   B 1 8  ? -4.754  -2.012 0.728   1.00 61.70 ? 8  C   D "C1'" 1 
ATOM   548  N  N1    . C   B 1 8  ? -5.908  -1.122 0.536   1.00 59.99 ? 8  C   D N1    1 
ATOM   549  C  C2    . C   B 1 8  ? -7.125  -1.525 1.051   1.00 59.32 ? 8  C   D C2    1 
ATOM   550  O  O2    . C   B 1 8  ? -7.170  -2.588 1.677   1.00 61.79 ? 8  C   D O2    1 
ATOM   551  N  N3    . C   B 1 8  ? -8.221  -0.754 0.859   1.00 56.77 ? 8  C   D N3    1 
ATOM   552  C  C4    . C   B 1 8  ? -8.121  0.386  0.183   1.00 54.87 ? 8  C   D C4    1 
ATOM   553  N  N4    . C   B 1 8  ? -9.229  1.104  0.019   1.00 54.25 ? 8  C   D N4    1 
ATOM   554  C  C5    . C   B 1 8  ? -6.880  0.836  -0.351  1.00 55.03 ? 8  C   D C5    1 
ATOM   555  C  C6    . C   B 1 8  ? -5.805  0.059  -0.149  1.00 58.35 ? 8  C   D C6    1 
ATOM   556  P  P     . G   B 1 9  ? -3.292  -2.819 -3.743  1.00 71.04 ? 9  G   D P     1 
ATOM   557  O  OP1   . G   B 1 9  ? -2.161  -3.328 -4.559  1.00 69.99 ? 9  G   D OP1   1 
ATOM   558  O  OP2   . G   B 1 9  ? -3.956  -1.545 -4.126  1.00 70.60 ? 9  G   D OP2   1 
ATOM   559  O  "O5'" . G   B 1 9  ? -4.429  -3.929 -3.652  1.00 69.94 ? 9  G   D "O5'" 1 
ATOM   560  C  "C5'" . G   B 1 9  ? -4.116  -5.234 -3.189  1.00 69.82 ? 9  G   D "C5'" 1 
ATOM   561  C  "C4'" . G   B 1 9  ? -5.374  -6.032 -2.970  1.00 69.43 ? 9  G   D "C4'" 1 
ATOM   562  O  "O4'" . G   B 1 9  ? -6.135  -5.435 -1.887  1.00 68.36 ? 9  G   D "O4'" 1 
ATOM   563  C  "C3'" . G   B 1 9  ? -6.347  -6.030 -4.134  1.00 69.60 ? 9  G   D "C3'" 1 
ATOM   564  O  "O3'" . G   B 1 9  ? -5.994  -6.957 -5.149  1.00 71.17 ? 9  G   D "O3'" 1 
ATOM   565  C  "C2'" . G   B 1 9  ? -7.663  -6.363 -3.449  1.00 68.42 ? 9  G   D "C2'" 1 
ATOM   566  O  "O2'" . G   B 1 9  ? -7.792  -7.736 -3.154  1.00 68.04 ? 9  G   D "O2'" 1 
ATOM   567  C  "C1'" . G   B 1 9  ? -7.522  -5.576 -2.149  1.00 67.05 ? 9  G   D "C1'" 1 
ATOM   568  N  N9    . G   B 1 9  ? -8.119  -4.251 -2.267  1.00 65.16 ? 9  G   D N9    1 
ATOM   569  C  C8    . G   B 1 9  ? -7.490  -3.052 -2.521  1.00 64.33 ? 9  G   D C8    1 
ATOM   570  N  N7    . G   B 1 9  ? -8.321  -2.044 -2.582  1.00 63.00 ? 9  G   D N7    1 
ATOM   571  C  C5    . G   B 1 9  ? -9.567  -2.614 -2.350  1.00 62.66 ? 9  G   D C5    1 
ATOM   572  C  C6    . G   B 1 9  ? -10.860 -2.025 -2.294  1.00 61.94 ? 9  G   D C6    1 
ATOM   573  O  O6    . G   B 1 9  ? -11.177 -0.840 -2.440  1.00 61.89 ? 9  G   D O6    1 
ATOM   574  N  N1    . G   B 1 9  ? -11.843 -2.975 -2.038  1.00 61.91 ? 9  G   D N1    1 
ATOM   575  C  C2    . G   B 1 9  ? -11.616 -4.318 -1.861  1.00 62.67 ? 9  G   D C2    1 
ATOM   576  N  N2    . G   B 1 9  ? -12.690 -5.080 -1.621  1.00 62.68 ? 9  G   D N2    1 
ATOM   577  N  N3    . G   B 1 9  ? -10.423 -4.876 -1.912  1.00 62.87 ? 9  G   D N3    1 
ATOM   578  C  C4    . G   B 1 9  ? -9.454  -3.974 -2.156  1.00 63.45 ? 9  G   D C4    1 
ATOM   579  P  P     . C   B 1 10 ? -6.424  -6.661 -6.669  1.00 73.54 ? 10 C   D P     1 
ATOM   580  O  OP1   . C   B 1 10 ? -5.740  -7.662 -7.529  1.00 73.63 ? 10 C   D OP1   1 
ATOM   581  O  OP2   . C   B 1 10 ? -6.267  -5.210 -6.966  1.00 72.95 ? 10 C   D OP2   1 
ATOM   582  O  "O5'" . C   B 1 10 ? -7.980  -6.983 -6.667  1.00 73.07 ? 10 C   D "O5'" 1 
ATOM   583  C  "C5'" . C   B 1 10 ? -8.447  -8.254 -6.249  1.00 73.76 ? 10 C   D "C5'" 1 
ATOM   584  C  "C4'" . C   B 1 10 ? -9.946  -8.267 -6.239  1.00 74.43 ? 10 C   D "C4'" 1 
ATOM   585  O  "O4'" . C   B 1 10 ? -10.417 -7.395 -5.176  1.00 74.95 ? 10 C   D "O4'" 1 
ATOM   586  C  "C3'" . C   B 1 10 ? -10.578 -7.687 -7.490  1.00 75.31 ? 10 C   D "C3'" 1 
ATOM   587  O  "O3'" . C   B 1 10 ? -10.654 -8.624 -8.552  1.00 75.93 ? 10 C   D "O3'" 1 
ATOM   588  C  "C2'" . C   B 1 10 ? -11.952 -7.274 -6.986  1.00 75.70 ? 10 C   D "C2'" 1 
ATOM   589  O  "O2'" . C   B 1 10 ? -12.832 -8.379 -6.903  1.00 75.88 ? 10 C   D "O2'" 1 
ATOM   590  C  "C1'" . C   B 1 10 ? -11.612 -6.747 -5.587  1.00 75.00 ? 10 C   D "C1'" 1 
ATOM   591  N  N1    . C   B 1 10 ? -11.393 -5.287 -5.583  1.00 73.83 ? 10 C   D N1    1 
ATOM   592  C  C2    . C   B 1 10 ? -12.477 -4.457 -5.297  1.00 73.41 ? 10 C   D C2    1 
ATOM   593  O  O2    . C   B 1 10 ? -13.566 -4.979 -5.024  1.00 73.36 ? 10 C   D O2    1 
ATOM   594  N  N3    . C   B 1 10 ? -12.312 -3.111 -5.326  1.00 73.15 ? 10 C   D N3    1 
ATOM   595  C  C4    . C   B 1 10 ? -11.117 -2.590 -5.620  1.00 73.11 ? 10 C   D C4    1 
ATOM   596  N  N4    . C   B 1 10 ? -11.005 -1.257 -5.643  1.00 71.76 ? 10 C   D N4    1 
ATOM   597  C  C5    . C   B 1 10 ? -9.987  -3.414 -5.904  1.00 72.78 ? 10 C   D C5    1 
ATOM   598  C  C6    . C   B 1 10 ? -10.167 -4.746 -5.871  1.00 73.58 ? 10 C   D C6    1 
ATOM   599  P  P     . G   B 1 11 ? -10.680 -8.094 -10.068 1.00 77.06 ? 11 G   D P     1 
ATOM   600  O  OP1   . G   B 1 11 ? -10.744 -9.291 -10.948 1.00 76.88 ? 11 G   D OP1   1 
ATOM   601  O  OP2   . G   B 1 11 ? -9.562  -7.126 -10.227 1.00 76.33 ? 11 G   D OP2   1 
ATOM   602  O  "O5'" . G   B 1 11 ? -12.074 -7.319 -10.171 1.00 73.81 ? 11 G   D "O5'" 1 
ATOM   603  C  "C5'" . G   B 1 11 ? -13.294 -8.043 -10.065 1.00 69.75 ? 11 G   D "C5'" 1 
ATOM   604  C  "C4'" . G   B 1 11 ? -14.504 -7.123 -10.029 1.00 67.18 ? 11 G   D "C4'" 1 
ATOM   605  O  "O4'" . G   B 1 11 ? -14.450 -6.274 -8.844  1.00 65.58 ? 11 G   D "O4'" 1 
ATOM   606  C  "C3'" . G   B 1 11 ? -14.647 -6.124 -11.173 1.00 64.75 ? 11 G   D "C3'" 1 
ATOM   607  O  "O3'" . G   B 1 11 ? -15.242 -6.695 -12.331 1.00 64.56 ? 11 G   D "O3'" 1 
ATOM   608  C  "C2'" . G   B 1 11 ? -15.563 -5.069 -10.567 1.00 63.90 ? 11 G   D "C2'" 1 
ATOM   609  O  "O2'" . G   B 1 11 ? -16.926 -5.438 -10.590 1.00 60.43 ? 11 G   D "O2'" 1 
ATOM   610  C  "C1'" . G   B 1 11 ? -15.070 -5.029 -9.123  1.00 63.76 ? 11 G   D "C1'" 1 
ATOM   611  N  N9    . G   B 1 11 ? -14.144 -3.925 -8.891  1.00 63.70 ? 11 G   D N9    1 
ATOM   612  C  C8    . G   B 1 11 ? -12.771 -3.950 -8.793  1.00 63.81 ? 11 G   D C8    1 
ATOM   613  N  N7    . G   B 1 11 ? -12.249 -2.762 -8.624  1.00 62.86 ? 11 G   D N7    1 
ATOM   614  C  C5    . G   B 1 11 ? -13.346 -1.907 -8.599  1.00 62.87 ? 11 G   D C5    1 
ATOM   615  C  C6    . G   B 1 11 ? -13.421 -0.493 -8.442  1.00 62.36 ? 11 G   D C6    1 
ATOM   616  O  O6    . G   B 1 11 ? -12.496 0.320  -8.279  1.00 62.79 ? 11 G   D O6    1 
ATOM   617  N  N1    . G   B 1 11 ? -14.739 -0.045 -8.483  1.00 61.23 ? 11 G   D N1    1 
ATOM   618  C  C2    . G   B 1 11 ? -15.842 -0.847 -8.648  1.00 61.41 ? 11 G   D C2    1 
ATOM   619  N  N2    . G   B 1 11 ? -17.031 -0.238 -8.665  1.00 60.85 ? 11 G   D N2    1 
ATOM   620  N  N3    . G   B 1 11 ? -15.786 -2.154 -8.787  1.00 62.27 ? 11 G   D N3    1 
ATOM   621  C  C4    . G   B 1 11 ? -14.518 -2.613 -8.755  1.00 62.88 ? 11 G   D C4    1 
HETATM 622  P  P     . 5BU B 1 12 ? -15.144 -5.923 -13.741 1.00 64.37 ? 12 5BU D P     1 
HETATM 623  O  OP1   . 5BU B 1 12 ? -15.750 -6.811 -14.757 1.00 66.39 ? 12 5BU D OP1   1 
HETATM 624  O  OP2   . 5BU B 1 12 ? -13.751 -5.433 -13.935 1.00 63.90 ? 12 5BU D OP2   1 
HETATM 625  O  "O5'" . 5BU B 1 12 ? -16.131 -4.679 -13.577 1.00 62.51 ? 12 5BU D "O5'" 1 
HETATM 626  C  "C5'" . 5BU B 1 12 ? -17.543 -4.870 -13.603 1.00 58.40 ? 12 5BU D "C5'" 1 
HETATM 627  C  "C4'" . 5BU B 1 12 ? -18.274 -3.548 -13.474 1.00 56.67 ? 12 5BU D "C4'" 1 
HETATM 628  O  "O4'" . 5BU B 1 12 ? -17.883 -2.909 -12.228 1.00 57.15 ? 12 5BU D "O4'" 1 
HETATM 629  C  "C3'" . 5BU B 1 12 ? -17.976 -2.492 -14.526 1.00 55.91 ? 12 5BU D "C3'" 1 
HETATM 630  O  "O3'" . 5BU B 1 12 ? -18.755 -2.642 -15.695 1.00 55.49 ? 12 5BU D "O3'" 1 
HETATM 631  C  "C2'" . 5BU B 1 12 ? -18.358 -1.210 -13.808 1.00 54.96 ? 12 5BU D "C2'" 1 
HETATM 632  O  "O2'" . 5BU B 1 12 ? -19.764 -1.048 -13.787 1.00 52.28 ? 12 5BU D "O2'" 1 
HETATM 633  C  "C1'" . 5BU B 1 12 ? -17.847 -1.499 -12.399 1.00 54.74 ? 12 5BU D "C1'" 1 
HETATM 634  N  N1    . 5BU B 1 12 ? -16.468 -1.029 -12.184 1.00 52.77 ? 12 5BU D N1    1 
HETATM 635  C  C2    . 5BU B 1 12 ? -16.283 0.318  -11.959 1.00 51.76 ? 12 5BU D C2    1 
HETATM 636  O  O2    . 5BU B 1 12 ? -17.204 1.113  -11.939 1.00 52.17 ? 12 5BU D O2    1 
HETATM 637  N  N3    . 5BU B 1 12 ? -14.977 0.703  -11.761 1.00 51.02 ? 12 5BU D N3    1 
HETATM 638  C  C4    . 5BU B 1 12 ? -13.860 -0.107 -11.772 1.00 49.72 ? 12 5BU D C4    1 
HETATM 639  O  O4    . 5BU B 1 12 ? -12.747 0.393  -11.588 1.00 48.18 ? 12 5BU D O4    1 
HETATM 640  C  C5    . 5BU B 1 12 ? -14.136 -1.488 -12.012 1.00 50.06 ? 12 5BU D C5    1 
HETATM 641  C  C6    . 5BU B 1 12 ? -15.398 -1.892 -12.204 1.00 51.89 ? 12 5BU D C6    1 
HETATM 642  BR BR    . 5BU B 1 12 ? -12.740 -2.739 -12.052 0.22 48.51 ? 12 5BU D BR    1 
ATOM   643  P  P     . C   B 1 13 ? -18.226 -2.015 -17.073 1.00 57.47 ? 13 C   D P     1 
ATOM   644  O  OP1   . C   B 1 13 ? -19.211 -2.390 -18.121 1.00 57.18 ? 13 C   D OP1   1 
ATOM   645  O  OP2   . C   B 1 13 ? -16.781 -2.371 -17.246 1.00 56.18 ? 13 C   D OP2   1 
ATOM   646  O  "O5'" . C   B 1 13 ? -18.329 -0.439 -16.850 1.00 56.21 ? 13 C   D "O5'" 1 
ATOM   647  C  "C5'" . C   B 1 13 ? -19.583 0.231  -16.954 1.00 53.98 ? 13 C   D "C5'" 1 
ATOM   648  C  "C4'" . C   B 1 13 ? -19.402 1.732  -16.844 1.00 51.65 ? 13 C   D "C4'" 1 
ATOM   649  O  "O4'" . C   B 1 13 ? -18.778 2.035  -15.568 1.00 51.85 ? 13 C   D "O4'" 1 
ATOM   650  C  "C3'" . C   B 1 13 ? -18.478 2.388  -17.859 1.00 51.09 ? 13 C   D "C3'" 1 
ATOM   651  O  "O3'" . C   B 1 13 ? -19.127 2.683  -19.092 1.00 48.73 ? 13 C   D "O3'" 1 
ATOM   652  C  "C2'" . C   B 1 13 ? -18.070 3.660  -17.133 1.00 51.18 ? 13 C   D "C2'" 1 
ATOM   653  O  "O2'" . C   B 1 13 ? -19.113 4.611  -17.133 1.00 52.53 ? 13 C   D "O2'" 1 
ATOM   654  C  "C1'" . C   B 1 13 ? -17.917 3.150  -15.707 1.00 50.21 ? 13 C   D "C1'" 1 
ATOM   655  N  N1    . C   B 1 13 ? -16.540 2.745  -15.385 1.00 48.45 ? 13 C   D N1    1 
ATOM   656  C  C2    . C   B 1 13 ? -15.620 3.737  -15.094 1.00 48.50 ? 13 C   D C2    1 
ATOM   657  O  O2    . C   B 1 13 ? -15.991 4.914  -15.132 1.00 51.05 ? 13 C   D O2    1 
ATOM   658  N  N3    . C   B 1 13 ? -14.353 3.400  -14.781 1.00 47.12 ? 13 C   D N3    1 
ATOM   659  C  C4    . C   B 1 13 ? -13.995 2.119  -14.760 1.00 46.31 ? 13 C   D C4    1 
ATOM   660  N  N4    . C   B 1 13 ? -12.735 1.829  -14.442 1.00 46.64 ? 13 C   D N4    1 
ATOM   661  C  C5    . C   B 1 13 ? -14.913 1.079  -15.063 1.00 46.49 ? 13 C   D C5    1 
ATOM   662  C  C6    . C   B 1 13 ? -16.167 1.434  -15.368 1.00 47.99 ? 13 C   D C6    1 
ATOM   663  P  P     . C   B 1 14 ? -18.248 2.872  -20.426 1.00 47.49 ? 14 C   D P     1 
ATOM   664  O  OP1   . C   B 1 14 ? -19.196 3.009  -21.556 1.00 50.54 ? 14 C   D OP1   1 
ATOM   665  O  OP2   . C   B 1 14 ? -17.202 1.821  -20.477 1.00 47.20 ? 14 C   D OP2   1 
ATOM   666  O  "O5'" . C   B 1 14 ? -17.533 4.282  -20.223 1.00 47.35 ? 14 C   D "O5'" 1 
ATOM   667  C  "C5'" . C   B 1 14 ? -18.300 5.468  -20.031 1.00 43.75 ? 14 C   D "C5'" 1 
ATOM   668  C  "C4'" . C   B 1 14 ? -17.403 6.638  -19.670 1.00 43.86 ? 14 C   D "C4'" 1 
ATOM   669  O  "O4'" . C   B 1 14 ? -16.771 6.398  -18.379 1.00 43.26 ? 14 C   D "O4'" 1 
ATOM   670  C  "C3'" . C   B 1 14 ? -16.226 6.867  -20.607 1.00 42.72 ? 14 C   D "C3'" 1 
ATOM   671  O  "O3'" . C   B 1 14 ? -16.595 7.616  -21.758 1.00 42.72 ? 14 C   D "O3'" 1 
ATOM   672  C  "C2'" . C   B 1 14 ? -15.253 7.638  -19.725 1.00 42.12 ? 14 C   D "C2'" 1 
ATOM   673  O  "O2'" . C   B 1 14 ? -15.587 9.001  -19.596 1.00 41.27 ? 14 C   D "O2'" 1 
ATOM   674  C  "C1'" . C   B 1 14 ? -15.472 6.968  -18.375 1.00 42.70 ? 14 C   D "C1'" 1 
ATOM   675  N  N1    . C   B 1 14 ? -14.476 5.932  -18.081 1.00 43.46 ? 14 C   D N1    1 
ATOM   676  C  C2    . C   B 1 14 ? -13.229 6.339  -17.610 1.00 43.92 ? 14 C   D C2    1 
ATOM   677  O  O2    . C   B 1 14 ? -13.011 7.548  -17.477 1.00 42.60 ? 14 C   D O2    1 
ATOM   678  N  N3    . C   B 1 14 ? -12.296 5.410  -17.312 1.00 45.05 ? 14 C   D N3    1 
ATOM   679  C  C4    . C   B 1 14 ? -12.570 4.116  -17.476 1.00 45.23 ? 14 C   D C4    1 
ATOM   680  N  N4    . C   B 1 14 ? -11.618 3.231  -17.161 1.00 45.37 ? 14 C   D N4    1 
ATOM   681  C  C5    . C   B 1 14 ? -13.833 3.672  -17.968 1.00 45.25 ? 14 C   D C5    1 
ATOM   682  C  C6    . C   B 1 14 ? -14.748 4.607  -18.256 1.00 44.25 ? 14 C   D C6    1 
ATOM   683  P  P     . A   B 1 15 ? -15.813 7.376  -23.138 1.00 43.93 ? 15 A   D P     1 
ATOM   684  O  OP1   . A   B 1 15 ? -16.524 8.151  -24.184 1.00 42.38 ? 15 A   D OP1   1 
ATOM   685  O  OP2   . A   B 1 15 ? -15.655 5.908  -23.289 1.00 44.52 ? 15 A   D OP2   1 
ATOM   686  O  "O5'" . A   B 1 15 ? -14.360 8.008  -22.899 1.00 42.08 ? 15 A   D "O5'" 1 
ATOM   687  C  "C5'" . A   B 1 15 ? -14.201 9.418  -22.786 1.00 39.76 ? 15 A   D "C5'" 1 
ATOM   688  C  "C4'" . A   B 1 15 ? -12.788 9.794  -22.392 1.00 38.04 ? 15 A   D "C4'" 1 
ATOM   689  O  "O4'" . A   B 1 15 ? -12.461 9.231  -21.091 1.00 36.44 ? 15 A   D "O4'" 1 
ATOM   690  C  "C3'" . A   B 1 15 ? -11.697 9.244  -23.292 1.00 38.69 ? 15 A   D "C3'" 1 
ATOM   691  O  "O3'" . A   B 1 15 ? -11.519 10.047 -24.442 1.00 39.85 ? 15 A   D "O3'" 1 
ATOM   692  C  "C2'" . A   B 1 15 ? -10.471 9.284  -22.391 1.00 37.07 ? 15 A   D "C2'" 1 
ATOM   693  O  "O2'" . A   B 1 15 ? -9.913  10.574 -22.296 1.00 35.87 ? 15 A   D "O2'" 1 
ATOM   694  C  "C1'" . A   B 1 15 ? -11.078 8.923  -21.041 1.00 34.97 ? 15 A   D "C1'" 1 
ATOM   695  N  N9    . A   B 1 15 ? -10.898 7.527  -20.668 1.00 32.86 ? 15 A   D N9    1 
ATOM   696  C  C8    . A   B 1 15 ? -11.774 6.478  -20.760 1.00 32.22 ? 15 A   D C8    1 
ATOM   697  N  N7    . A   B 1 15 ? -11.292 5.346  -20.297 1.00 32.94 ? 15 A   D N7    1 
ATOM   698  C  C5    . A   B 1 15 ? -10.008 5.676  -19.879 1.00 32.46 ? 15 A   D C5    1 
ATOM   699  C  C6    . A   B 1 15 ? -8.975  4.922  -19.290 1.00 32.07 ? 15 A   D C6    1 
ATOM   700  N  N6    . A   B 1 15 ? -9.073  3.622  -19.007 1.00 32.08 ? 15 A   D N6    1 
ATOM   701  N  N1    . A   B 1 15 ? -7.818  5.559  -19.001 1.00 31.38 ? 15 A   D N1    1 
ATOM   702  C  C2    . A   B 1 15 ? -7.713  6.860  -19.291 1.00 31.83 ? 15 A   D C2    1 
ATOM   703  N  N3    . A   B 1 15 ? -8.609  7.674  -19.843 1.00 32.50 ? 15 A   D N3    1 
ATOM   704  C  C4    . A   B 1 15 ? -9.750  7.013  -20.112 1.00 33.06 ? 15 A   D C4    1 
HETATM 705  P  P     . 5BU B 1 16 ? -10.810 9.416  -25.729 1.00 40.64 ? 16 5BU D P     1 
HETATM 706  O  OP1   . 5BU B 1 16 ? -10.925 10.419 -26.813 1.00 39.59 ? 16 5BU D OP1   1 
HETATM 707  O  OP2   . 5BU B 1 16 ? -11.317 8.038  -25.933 1.00 39.30 ? 16 5BU D OP2   1 
HETATM 708  O  "O5'" . 5BU B 1 16 ? -9.285  9.335  -25.300 1.00 40.46 ? 16 5BU D "O5'" 1 
HETATM 709  C  "C5'" . 5BU B 1 16 ? -8.560  10.525 -25.109 1.00 39.01 ? 16 5BU D "C5'" 1 
HETATM 710  C  "C4'" . 5BU B 1 16 ? -7.200  10.235 -24.550 1.00 39.68 ? 16 5BU D "C4'" 1 
HETATM 711  O  "O4'" . 5BU B 1 16 ? -7.335  9.506  -23.300 1.00 37.72 ? 16 5BU D "O4'" 1 
HETATM 712  C  "C3'" . 5BU B 1 16 ? -6.382  9.283  -25.399 1.00 40.60 ? 16 5BU D "C3'" 1 
HETATM 713  O  "O3'" . 5BU B 1 16 ? -5.757  9.942  -26.484 1.00 43.90 ? 16 5BU D "O3'" 1 
HETATM 714  C  "C2'" . 5BU B 1 16 ? -5.372  8.753  -24.399 1.00 39.61 ? 16 5BU D "C2'" 1 
HETATM 715  O  "O2'" . 5BU B 1 16 ? -4.341  9.686  -24.168 1.00 39.83 ? 16 5BU D "O2'" 1 
HETATM 716  C  "C1'" . 5BU B 1 16 ? -6.229  8.637  -23.144 1.00 37.63 ? 16 5BU D "C1'" 1 
HETATM 717  N  N1    . 5BU B 1 16 ? -6.685  7.263  -22.905 1.00 36.93 ? 16 5BU D N1    1 
HETATM 718  C  C2    . 5BU B 1 16 ? -5.787  6.430  -22.279 1.00 38.00 ? 16 5BU D C2    1 
HETATM 719  O  O2    . 5BU B 1 16 ? -4.674  6.805  -21.942 1.00 40.92 ? 16 5BU D O2    1 
HETATM 720  N  N3    . 5BU B 1 16 ? -6.227  5.146  -22.066 1.00 35.70 ? 16 5BU D N3    1 
HETATM 721  C  C4    . 5BU B 1 16 ? -7.443  4.625  -22.418 1.00 35.81 ? 16 5BU D C4    1 
HETATM 722  O  O4    . 5BU B 1 16 ? -7.695  3.456  -22.168 1.00 36.67 ? 16 5BU D O4    1 
HETATM 723  C  C5    . 5BU B 1 16 ? -8.316  5.534  -23.065 1.00 37.86 ? 16 5BU D C5    1 
HETATM 724  C  C6    . 5BU B 1 16 ? -7.923  6.804  -23.283 1.00 38.62 ? 16 5BU D C6    1 
HETATM 725  BR BR    . 5BU B 1 16 ? -10.006 4.934  -23.635 0.26 36.79 ? 16 5BU D BR    1 
ATOM   726  P  P     . G   B 1 17 ? -5.326  9.090  -27.771 1.00 46.84 ? 17 G   D P     1 
ATOM   727  O  OP1   . G   B 1 17 ? -4.977  10.068 -28.835 1.00 44.40 ? 17 G   D OP1   1 
ATOM   728  O  OP2   . G   B 1 17 ? -6.386  8.073  -28.016 1.00 45.23 ? 17 G   D OP2   1 
ATOM   729  O  "O5'" . G   B 1 17 ? -3.999  8.340  -27.303 1.00 44.14 ? 17 G   D "O5'" 1 
ATOM   730  C  "C5'" . G   B 1 17 ? -2.833  9.082  -26.986 1.00 42.62 ? 17 G   D "C5'" 1 
ATOM   731  C  "C4'" . G   B 1 17 ? -1.757  8.170  -26.462 1.00 43.19 ? 17 G   D "C4'" 1 
ATOM   732  O  "O4'" . G   B 1 17 ? -2.225  7.535  -25.245 1.00 43.94 ? 17 G   D "O4'" 1 
ATOM   733  C  "C3'" . G   B 1 17 ? -1.404  7.006  -27.366 1.00 44.88 ? 17 G   D "C3'" 1 
ATOM   734  O  "O3'" . G   B 1 17 ? -0.469  7.422  -28.353 1.00 49.02 ? 17 G   D "O3'" 1 
ATOM   735  C  "C2'" . G   B 1 17 ? -0.813  6.007  -26.377 1.00 44.15 ? 17 G   D "C2'" 1 
ATOM   736  O  "O2'" . G   B 1 17 ? 0.516   6.326  -26.014 1.00 44.56 ? 17 G   D "O2'" 1 
ATOM   737  C  "C1'" . G   B 1 17 ? -1.713  6.219  -25.159 1.00 41.70 ? 17 G   D "C1'" 1 
ATOM   738  N  N9    . G   B 1 17 ? -2.836  5.288  -25.065 1.00 40.27 ? 17 G   D N9    1 
ATOM   739  C  C8    . G   B 1 17 ? -4.126  5.493  -25.492 1.00 38.63 ? 17 G   D C8    1 
ATOM   740  N  N7    . G   B 1 17 ? -4.911  4.473  -25.259 1.00 38.45 ? 17 G   D N7    1 
ATOM   741  C  C5    . G   B 1 17 ? -4.090  3.536  -24.643 1.00 37.97 ? 17 G   D C5    1 
ATOM   742  C  C6    . G   B 1 17 ? -4.380  2.227  -24.148 1.00 37.83 ? 17 G   D C6    1 
ATOM   743  O  O6    . G   B 1 17 ? -5.460  1.620  -24.141 1.00 37.34 ? 17 G   D O6    1 
ATOM   744  N  N1    . G   B 1 17 ? -3.250  1.624  -23.610 1.00 38.47 ? 17 G   D N1    1 
ATOM   745  C  C2    . G   B 1 17 ? -2.005  2.199  -23.538 1.00 39.65 ? 17 G   D C2    1 
ATOM   746  N  N2    . G   B 1 17 ? -1.040  1.451  -22.981 1.00 38.48 ? 17 G   D N2    1 
ATOM   747  N  N3    . G   B 1 17 ? -1.725  3.416  -23.980 1.00 39.70 ? 17 G   D N3    1 
ATOM   748  C  C4    . G   B 1 17 ? -2.805  4.022  -24.518 1.00 39.14 ? 17 G   D C4    1 
ATOM   749  P  P     . C   B 1 18 ? -0.429  6.687  -29.784 1.00 50.37 ? 18 C   D P     1 
ATOM   750  O  OP1   . C   B 1 18 ? 0.593   7.398  -30.591 1.00 50.58 ? 18 C   D OP1   1 
ATOM   751  O  OP2   . C   B 1 18 ? -1.812  6.563  -30.308 1.00 50.91 ? 18 C   D OP2   1 
ATOM   752  O  "O5'" . C   B 1 18 ? 0.119   5.231  -29.432 1.00 50.09 ? 18 C   D "O5'" 1 
ATOM   753  C  "C5'" . C   B 1 18 ? 1.414   5.065  -28.860 1.00 48.37 ? 18 C   D "C5'" 1 
ATOM   754  C  "C4'" . C   B 1 18 ? 1.651   3.619  -28.478 1.00 48.55 ? 18 C   D "C4'" 1 
ATOM   755  O  "O4'" . C   B 1 18 ? 0.834   3.268  -27.322 1.00 48.80 ? 18 C   D "O4'" 1 
ATOM   756  C  "C3'" . C   B 1 18 ? 1.234   2.604  -29.532 1.00 48.42 ? 18 C   D "C3'" 1 
ATOM   757  O  "O3'" . C   B 1 18 ? 2.102   2.490  -30.659 1.00 48.48 ? 18 C   D "O3'" 1 
ATOM   758  C  "C2'" . C   B 1 18 ? 1.033   1.340  -28.708 1.00 48.66 ? 18 C   D "C2'" 1 
ATOM   759  O  "O2'" . C   B 1 18 ? 2.235   0.663  -28.416 1.00 51.29 ? 18 C   D "O2'" 1 
ATOM   760  C  "C1'" . C   B 1 18 ? 0.441   1.906  -27.415 1.00 47.79 ? 18 C   D "C1'" 1 
ATOM   761  N  N1    . C   B 1 18 ? -1.025  1.809  -27.392 1.00 45.83 ? 18 C   D N1    1 
ATOM   762  C  C2    . C   B 1 18 ? -1.588  0.621  -26.936 1.00 45.44 ? 18 C   D C2    1 
ATOM   763  O  O2    . C   B 1 18 ? -0.824  -0.280 -26.539 1.00 46.38 ? 18 C   D O2    1 
ATOM   764  N  N3    . C   B 1 18 ? -2.937  0.478  -26.937 1.00 43.88 ? 18 C   D N3    1 
ATOM   765  C  C4    . C   B 1 18 ? -3.711  1.479  -27.370 1.00 44.50 ? 18 C   D C4    1 
ATOM   766  N  N4    . C   B 1 18 ? -5.038  1.300  -27.357 1.00 43.13 ? 18 C   D N4    1 
ATOM   767  C  C5    . C   B 1 18 ? -3.160  2.711  -27.834 1.00 44.11 ? 18 C   D C5    1 
ATOM   768  C  C6    . C   B 1 18 ? -1.823  2.832  -27.824 1.00 45.18 ? 18 C   D C6    1 
ATOM   769  N  N     . PRO C 2 2  ? -3.190  35.276 11.490  1.00 51.61 ? 2  PRO A N     1 
ATOM   770  C  CA    . PRO C 2 2  ? -4.452  34.557 11.818  1.00 51.45 ? 2  PRO A CA    1 
ATOM   771  C  C     . PRO C 2 2  ? -4.239  33.407 12.808  1.00 50.66 ? 2  PRO A C     1 
ATOM   772  O  O     . PRO C 2 2  ? -3.206  32.729 12.774  1.00 52.15 ? 2  PRO A O     1 
ATOM   773  C  CB    . PRO C 2 2  ? -5.032  34.047 10.499  1.00 51.50 ? 2  PRO A CB    1 
ATOM   774  C  CG    . PRO C 2 2  ? -3.788  34.051 9.576   1.00 51.47 ? 2  PRO A CG    1 
ATOM   775  C  CD    . PRO C 2 2  ? -2.971  35.271 10.030  1.00 51.72 ? 2  PRO A CD    1 
ATOM   776  N  N     . SER C 2 3  ? -5.212  33.194 13.692  1.00 48.27 ? 3  SER A N     1 
ATOM   777  C  CA    . SER C 2 3  ? -5.113  32.128 14.682  1.00 46.14 ? 3  SER A CA    1 
ATOM   778  C  C     . SER C 2 3  ? -5.234  30.778 14.005  1.00 45.42 ? 3  SER A C     1 
ATOM   779  O  O     . SER C 2 3  ? -5.771  30.665 12.902  1.00 46.61 ? 3  SER A O     1 
ATOM   780  C  CB    . SER C 2 3  ? -6.221  32.242 15.728  1.00 47.14 ? 3  SER A CB    1 
ATOM   781  O  OG    . SER C 2 3  ? -7.477  31.837 15.201  1.00 47.53 ? 3  SER A OG    1 
ATOM   782  N  N     . LYS C 2 4  ? -4.747  29.747 14.678  1.00 43.54 ? 4  LYS A N     1 
ATOM   783  C  CA    . LYS C 2 4  ? -4.805  28.409 14.135  1.00 40.96 ? 4  LYS A CA    1 
ATOM   784  C  C     . LYS C 2 4  ? -6.239  27.960 13.890  1.00 39.88 ? 4  LYS A C     1 
ATOM   785  O  O     . LYS C 2 4  ? -6.519  27.335 12.873  1.00 41.91 ? 4  LYS A O     1 
ATOM   786  C  CB    . LYS C 2 4  ? -4.104  27.440 15.076  1.00 41.78 ? 4  LYS A CB    1 
ATOM   787  C  CG    . LYS C 2 4  ? -2.652  27.780 15.320  1.00 41.55 ? 4  LYS A CG    1 
ATOM   788  C  CD    . LYS C 2 4  ? -2.003  26.730 16.201  1.00 41.94 ? 4  LYS A CD    1 
ATOM   789  C  CE    . LYS C 2 4  ? -0.496  26.923 16.287  1.00 41.45 ? 4  LYS A CE    1 
ATOM   790  N  NZ    . LYS C 2 4  ? 0.145   25.781 16.992  1.00 41.78 ? 4  LYS A NZ    1 
ATOM   791  N  N     . LEU C 2 5  ? -7.155  28.283 14.798  1.00 37.79 ? 5  LEU A N     1 
ATOM   792  C  CA    . LEU C 2 5  ? -8.545  27.875 14.619  1.00 35.45 ? 5  LEU A CA    1 
ATOM   793  C  C     . LEU C 2 5  ? -9.072  28.427 13.310  1.00 35.39 ? 5  LEU A C     1 
ATOM   794  O  O     . LEU C 2 5  ? -9.855  27.787 12.625  1.00 36.24 ? 5  LEU A O     1 
ATOM   795  C  CB    . LEU C 2 5  ? -9.406  28.397 15.753  1.00 35.54 ? 5  LEU A CB    1 
ATOM   796  C  CG    . LEU C 2 5  ? -10.600 27.540 16.179  1.00 35.74 ? 5  LEU A CG    1 
ATOM   797  C  CD1   . LEU C 2 5  ? -11.407 28.332 17.186  1.00 36.67 ? 5  LEU A CD1   1 
ATOM   798  C  CD2   . LEU C 2 5  ? -11.470 27.173 15.000  1.00 35.53 ? 5  LEU A CD2   1 
ATOM   799  N  N     . ALA C 2 6  ? -8.629  29.627 12.966  1.00 36.64 ? 6  ALA A N     1 
ATOM   800  C  CA    . ALA C 2 6  ? -9.050  30.285 11.737  1.00 36.69 ? 6  ALA A CA    1 
ATOM   801  C  C     . ALA C 2 6  ? -8.406  29.604 10.548  1.00 37.70 ? 6  ALA A C     1 
ATOM   802  O  O     . ALA C 2 6  ? -9.053  29.373 9.522   1.00 38.99 ? 6  ALA A O     1 
ATOM   803  C  CB    . ALA C 2 6  ? -8.656  31.753 11.774  1.00 36.35 ? 6  ALA A CB    1 
ATOM   804  N  N     . LEU C 2 7  ? -7.122  29.288 10.681  1.00 38.68 ? 7  LEU A N     1 
ATOM   805  C  CA    . LEU C 2 7  ? -6.401  28.620 9.602   1.00 40.07 ? 7  LEU A CA    1 
ATOM   806  C  C     . LEU C 2 7  ? -7.153  27.375 9.121   1.00 40.87 ? 7  LEU A C     1 
ATOM   807  O  O     . LEU C 2 7  ? -7.195  27.105 7.919   1.00 42.00 ? 7  LEU A O     1 
ATOM   808  C  CB    . LEU C 2 7  ? -4.990  28.246 10.062  1.00 38.57 ? 7  LEU A CB    1 
ATOM   809  C  CG    . LEU C 2 7  ? -3.830  29.066 9.481   1.00 39.41 ? 7  LEU A CG    1 
ATOM   810  C  CD1   . LEU C 2 7  ? -4.209  30.530 9.257   1.00 38.04 ? 7  LEU A CD1   1 
ATOM   811  C  CD2   . LEU C 2 7  ? -2.656  28.957 10.438  1.00 38.65 ? 7  LEU A CD2   1 
ATOM   812  N  N     . ILE C 2 8  ? -7.750  26.628 10.052  1.00 40.31 ? 8  ILE A N     1 
ATOM   813  C  CA    . ILE C 2 8  ? -8.498  25.431 9.683   1.00 41.15 ? 8  ILE A CA    1 
ATOM   814  C  C     . ILE C 2 8  ? -9.919  25.777 9.215   1.00 41.74 ? 8  ILE A C     1 
ATOM   815  O  O     . ILE C 2 8  ? -10.407 25.196 8.248   1.00 42.42 ? 8  ILE A O     1 
ATOM   816  C  CB    . ILE C 2 8  ? -8.585  24.384 10.855  1.00 40.05 ? 8  ILE A CB    1 
ATOM   817  C  CG1   . ILE C 2 8  ? -7.253  23.667 11.052  1.00 38.90 ? 8  ILE A CG1   1 
ATOM   818  C  CG2   . ILE C 2 8  ? -9.572  23.291 10.505  1.00 39.97 ? 8  ILE A CG2   1 
ATOM   819  C  CD1   . ILE C 2 8  ? -6.120  24.559 11.426  1.00 41.02 ? 8  ILE A CD1   1 
ATOM   820  N  N     . GLN C 2 9  ? -10.586 26.718 9.877   1.00 41.68 ? 9  GLN A N     1 
ATOM   821  C  CA    . GLN C 2 9  ? -11.945 27.070 9.461   1.00 42.52 ? 9  GLN A CA    1 
ATOM   822  C  C     . GLN C 2 9  ? -11.985 27.673 8.065   1.00 42.20 ? 9  GLN A C     1 
ATOM   823  O  O     . GLN C 2 9  ? -12.994 27.569 7.372   1.00 42.73 ? 9  GLN A O     1 
ATOM   824  C  CB    . GLN C 2 9  ? -12.582 28.049 10.441  1.00 42.62 ? 9  GLN A CB    1 
ATOM   825  C  CG    . GLN C 2 9  ? -12.697 27.522 11.848  1.00 43.18 ? 9  GLN A CG    1 
ATOM   826  C  CD    . GLN C 2 9  ? -13.201 28.574 12.811  1.00 44.37 ? 9  GLN A CD    1 
ATOM   827  O  OE1   . GLN C 2 9  ? -12.807 29.745 12.733  1.00 43.72 ? 9  GLN A OE1   1 
ATOM   828  N  NE2   . GLN C 2 9  ? -14.061 28.163 13.739  1.00 43.33 ? 9  GLN A NE2   1 
ATOM   829  N  N     . GLU C 2 10 ? -10.888 28.301 7.652   1.00 42.12 ? 10 GLU A N     1 
ATOM   830  C  CA    . GLU C 2 10 ? -10.826 28.917 6.332   1.00 42.50 ? 10 GLU A CA    1 
ATOM   831  C  C     . GLU C 2 10 ? -10.498 27.923 5.210   1.00 40.87 ? 10 GLU A C     1 
ATOM   832  O  O     . GLU C 2 10 ? -10.691 28.223 4.027   1.00 39.62 ? 10 GLU A O     1 
ATOM   833  C  CB    . GLU C 2 10 ? -9.792  30.041 6.328   1.00 45.50 ? 10 GLU A CB    1 
ATOM   834  C  CG    . GLU C 2 10 ? -10.139 31.240 7.195   1.00 51.24 ? 10 GLU A CG    1 
ATOM   835  C  CD    . GLU C 2 10 ? -9.013  32.285 7.231   1.00 56.38 ? 10 GLU A CD    1 
ATOM   836  O  OE1   . GLU C 2 10 ? -9.198  33.363 7.855   1.00 57.39 ? 10 GLU A OE1   1 
ATOM   837  O  OE2   . GLU C 2 10 ? -7.936  32.027 6.635   1.00 59.11 ? 10 GLU A OE2   1 
ATOM   838  N  N     . LEU C 2 11 ? -10.010 26.742 5.572   1.00 39.19 ? 11 LEU A N     1 
ATOM   839  C  CA    . LEU C 2 11 ? -9.656  25.756 4.564   1.00 37.89 ? 11 LEU A CA    1 
ATOM   840  C  C     . LEU C 2 11 ? -10.730 25.503 3.518   1.00 37.95 ? 11 LEU A C     1 
ATOM   841  O  O     . LEU C 2 11 ? -10.504 25.743 2.340   1.00 39.61 ? 11 LEU A O     1 
ATOM   842  C  CB    . LEU C 2 11 ? -9.238  24.436 5.215   1.00 36.46 ? 11 LEU A CB    1 
ATOM   843  C  CG    . LEU C 2 11 ? -7.737  24.365 5.537   1.00 37.15 ? 11 LEU A CG    1 
ATOM   844  C  CD1   . LEU C 2 11 ? -7.398  23.043 6.214   1.00 35.88 ? 11 LEU A CD1   1 
ATOM   845  C  CD2   . LEU C 2 11 ? -6.940  24.519 4.244   1.00 36.49 ? 11 LEU A CD2   1 
ATOM   846  N  N     . PRO C 2 12 ? -11.920 25.036 3.926   1.00 37.86 ? 12 PRO A N     1 
ATOM   847  C  CA    . PRO C 2 12 ? -12.981 24.774 2.953   1.00 37.19 ? 12 PRO A CA    1 
ATOM   848  C  C     . PRO C 2 12 ? -13.256 25.919 1.976   1.00 38.01 ? 12 PRO A C     1 
ATOM   849  O  O     . PRO C 2 12 ? -13.531 25.682 0.801   1.00 37.78 ? 12 PRO A O     1 
ATOM   850  C  CB    . PRO C 2 12 ? -14.170 24.440 3.837   1.00 36.33 ? 12 PRO A CB    1 
ATOM   851  C  CG    . PRO C 2 12 ? -13.906 25.239 5.054   1.00 36.56 ? 12 PRO A CG    1 
ATOM   852  C  CD    . PRO C 2 12 ? -12.461 24.976 5.292   1.00 37.75 ? 12 PRO A CD    1 
ATOM   853  N  N     . ASP C 2 13 ? -13.170 27.157 2.452   1.00 39.56 ? 13 ASP A N     1 
ATOM   854  C  CA    . ASP C 2 13 ? -13.400 28.314 1.588   1.00 40.37 ? 13 ASP A CA    1 
ATOM   855  C  C     . ASP C 2 13 ? -12.232 28.575 0.665   1.00 39.56 ? 13 ASP A C     1 
ATOM   856  O  O     . ASP C 2 13 ? -12.430 28.807 -0.522  1.00 40.19 ? 13 ASP A O     1 
ATOM   857  C  CB    . ASP C 2 13 ? -13.642 29.566 2.414   1.00 44.49 ? 13 ASP A CB    1 
ATOM   858  C  CG    . ASP C 2 13 ? -14.900 29.480 3.223   1.00 49.97 ? 13 ASP A CG    1 
ATOM   859  O  OD1   . ASP C 2 13 ? -15.987 29.492 2.597   1.00 51.14 ? 13 ASP A OD1   1 
ATOM   860  O  OD2   . ASP C 2 13 ? -14.799 29.385 4.475   1.00 53.47 ? 13 ASP A OD2   1 
ATOM   861  N  N     . ARG C 2 14 ? -11.014 28.560 1.201   1.00 37.62 ? 14 ARG A N     1 
ATOM   862  C  CA    . ARG C 2 14 ? -9.852  28.800 0.362   1.00 36.32 ? 14 ARG A CA    1 
ATOM   863  C  C     . ARG C 2 14 ? -9.847  27.796 -0.777  1.00 35.63 ? 14 ARG A C     1 
ATOM   864  O  O     . ARG C 2 14 ? -9.563  28.151 -1.918  1.00 37.01 ? 14 ARG A O     1 
ATOM   865  C  CB    . ARG C 2 14 ? -8.573  28.704 1.177   1.00 36.60 ? 14 ARG A CB    1 
ATOM   866  C  CG    . ARG C 2 14 ? -8.525  29.707 2.309   1.00 39.20 ? 14 ARG A CG    1 
ATOM   867  C  CD    . ARG C 2 14 ? -7.273  29.531 3.142   1.00 41.64 ? 14 ARG A CD    1 
ATOM   868  N  NE    . ARG C 2 14 ? -6.102  29.920 2.378   1.00 45.17 ? 14 ARG A NE    1 
ATOM   869  C  CZ    . ARG C 2 14 ? -5.851  31.173 2.010   1.00 47.62 ? 14 ARG A CZ    1 
ATOM   870  N  NH1   . ARG C 2 14 ? -6.699  32.135 2.357   1.00 46.18 ? 14 ARG A NH1   1 
ATOM   871  N  NH2   . ARG C 2 14 ? -4.771  31.460 1.281   1.00 48.36 ? 14 ARG A NH2   1 
ATOM   872  N  N     . ILE C 2 15 ? -10.187 26.547 -0.476  1.00 34.39 ? 15 ILE A N     1 
ATOM   873  C  CA    . ILE C 2 15 ? -10.244 25.514 -1.503  1.00 34.17 ? 15 ILE A CA    1 
ATOM   874  C  C     . ILE C 2 15 ? -11.360 25.838 -2.500  1.00 34.65 ? 15 ILE A C     1 
ATOM   875  O  O     . ILE C 2 15 ? -11.232 25.611 -3.696  1.00 33.31 ? 15 ILE A O     1 
ATOM   876  C  CB    . ILE C 2 15 ? -10.466 24.142 -0.864  1.00 33.93 ? 15 ILE A CB    1 
ATOM   877  C  CG1   . ILE C 2 15 ? -9.169  23.705 -0.197  1.00 35.97 ? 15 ILE A CG1   1 
ATOM   878  C  CG2   . ILE C 2 15 ? -10.897 23.127 -1.898  1.00 32.45 ? 15 ILE A CG2   1 
ATOM   879  C  CD1   . ILE C 2 15 ? -9.168  22.281 0.241   1.00 39.32 ? 15 ILE A CD1   1 
ATOM   880  N  N     . GLN C 2 16 ? -12.460 26.368 -1.988  1.00 36.14 ? 16 GLN A N     1 
ATOM   881  C  CA    . GLN C 2 16 ? -13.579 26.779 -2.814  1.00 37.25 ? 16 GLN A CA    1 
ATOM   882  C  C     . GLN C 2 16 ? -13.015 27.743 -3.862  1.00 37.91 ? 16 GLN A C     1 
ATOM   883  O  O     . GLN C 2 16 ? -13.345 27.676 -5.047  1.00 38.04 ? 16 GLN A O     1 
ATOM   884  C  CB    . GLN C 2 16 ? -14.586 27.511 -1.932  1.00 39.99 ? 16 GLN A CB    1 
ATOM   885  C  CG    . GLN C 2 16 ? -15.719 28.190 -2.652  1.00 43.00 ? 16 GLN A CG    1 
ATOM   886  C  CD    . GLN C 2 16 ? -16.832 27.236 -2.924  1.00 46.39 ? 16 GLN A CD    1 
ATOM   887  O  OE1   . GLN C 2 16 ? -16.751 26.415 -3.832  1.00 50.27 ? 16 GLN A OE1   1 
ATOM   888  N  NE2   . GLN C 2 16 ? -17.880 27.315 -2.121  1.00 47.95 ? 16 GLN A NE2   1 
ATOM   889  N  N     . THR C 2 17 ? -12.146 28.638 -3.399  1.00 38.58 ? 17 THR A N     1 
ATOM   890  C  CA    . THR C 2 17 ? -11.519 29.653 -4.239  1.00 38.45 ? 17 THR A CA    1 
ATOM   891  C  C     . THR C 2 17 ? -10.520 29.108 -5.252  1.00 39.50 ? 17 THR A C     1 
ATOM   892  O  O     . THR C 2 17 ? -10.518 29.507 -6.413  1.00 40.36 ? 17 THR A O     1 
ATOM   893  C  CB    . THR C 2 17 ? -10.793 30.694 -3.371  1.00 37.76 ? 17 THR A CB    1 
ATOM   894  O  OG1   . THR C 2 17 ? -11.753 31.573 -2.781  1.00 34.98 ? 17 THR A OG1   1 
ATOM   895  C  CG2   . THR C 2 17 ? -9.795  31.490 -4.203  1.00 38.10 ? 17 THR A CG2   1 
ATOM   896  N  N     . ALA C 2 18 ? -9.655  28.213 -4.806  1.00 39.30 ? 18 ALA A N     1 
ATOM   897  C  CA    . ALA C 2 18 ? -8.661  27.651 -5.693  1.00 40.03 ? 18 ALA A CA    1 
ATOM   898  C  C     . ALA C 2 18 ? -9.313  27.004 -6.905  1.00 41.21 ? 18 ALA A C     1 
ATOM   899  O  O     . ALA C 2 18 ? -8.781  27.053 -8.027  1.00 42.79 ? 18 ALA A O     1 
ATOM   900  C  CB    . ALA C 2 18 ? -7.841  26.625 -4.947  1.00 38.80 ? 18 ALA A CB    1 
ATOM   901  N  N     . VAL C 2 19 ? -10.488 26.432 -6.675  1.00 40.68 ? 19 VAL A N     1 
ATOM   902  C  CA    . VAL C 2 19 ? -11.209 25.690 -7.697  1.00 41.03 ? 19 VAL A CA    1 
ATOM   903  C  C     . VAL C 2 19 ? -12.337 26.357 -8.486  1.00 42.41 ? 19 VAL A C     1 
ATOM   904  O  O     . VAL C 2 19 ? -12.608 25.974 -9.620  1.00 42.42 ? 19 VAL A O     1 
ATOM   905  C  CB    . VAL C 2 19 ? -11.761 24.402 -7.065  1.00 39.98 ? 19 VAL A CB    1 
ATOM   906  C  CG1   . VAL C 2 19 ? -12.661 23.695 -8.026  1.00 42.50 ? 19 VAL A CG1   1 
ATOM   907  C  CG2   . VAL C 2 19 ? -10.615 23.496 -6.659  1.00 38.93 ? 19 VAL A CG2   1 
ATOM   908  N  N     . GLU C 2 20 ? -12.994 27.348 -7.903  1.00 45.10 ? 20 GLU A N     1 
ATOM   909  C  CA    . GLU C 2 20 ? -14.114 27.996 -8.571  1.00 47.41 ? 20 GLU A CA    1 
ATOM   910  C  C     . GLU C 2 20 ? -13.920 28.426 -10.022 1.00 47.58 ? 20 GLU A C     1 
ATOM   911  O  O     . GLU C 2 20 ? -14.862 28.357 -10.809 1.00 49.09 ? 20 GLU A O     1 
ATOM   912  C  CB    . GLU C 2 20 ? -14.582 29.190 -7.755  1.00 50.07 ? 20 GLU A CB    1 
ATOM   913  C  CG    . GLU C 2 20 ? -13.575 30.295 -7.662  1.00 56.07 ? 20 GLU A CG    1 
ATOM   914  C  CD    . GLU C 2 20 ? -14.033 31.379 -6.716  1.00 60.46 ? 20 GLU A CD    1 
ATOM   915  O  OE1   . GLU C 2 20 ? -13.318 32.402 -6.594  1.00 63.38 ? 20 GLU A OE1   1 
ATOM   916  O  OE2   . GLU C 2 20 ? -15.109 31.203 -6.095  1.00 60.99 ? 20 GLU A OE2   1 
ATOM   917  N  N     . ALA C 2 21 ? -12.725 28.875 -10.389 1.00 47.30 ? 21 ALA A N     1 
ATOM   918  C  CA    . ALA C 2 21 ? -12.481 29.299 -11.771 1.00 46.23 ? 21 ALA A CA    1 
ATOM   919  C  C     . ALA C 2 21 ? -12.587 28.142 -12.775 1.00 46.54 ? 21 ALA A C     1 
ATOM   920  O  O     . ALA C 2 21 ? -13.306 28.236 -13.774 1.00 46.35 ? 21 ALA A O     1 
ATOM   921  C  CB    . ALA C 2 21 ? -11.122 29.942 -11.877 1.00 46.16 ? 21 ALA A CB    1 
ATOM   922  N  N     . ALA C 2 22 ? -11.870 27.053 -12.502 1.00 46.28 ? 22 ALA A N     1 
ATOM   923  C  CA    . ALA C 2 22 ? -11.870 25.884 -13.372 1.00 44.94 ? 22 ALA A CA    1 
ATOM   924  C  C     . ALA C 2 22 ? -13.264 25.321 -13.575 1.00 45.33 ? 22 ALA A C     1 
ATOM   925  O  O     . ALA C 2 22 ? -13.711 25.164 -14.710 1.00 45.27 ? 22 ALA A O     1 
ATOM   926  C  CB    . ALA C 2 22 ? -10.959 24.805 -12.804 1.00 43.80 ? 22 ALA A CB    1 
ATOM   927  N  N     . MET C 2 23 ? -13.961 25.009 -12.487 1.00 46.24 ? 23 MET A N     1 
ATOM   928  C  CA    . MET C 2 23 ? -15.296 24.448 -12.644 1.00 47.43 ? 23 MET A CA    1 
ATOM   929  C  C     . MET C 2 23 ? -16.398 25.481 -12.831 1.00 47.11 ? 23 MET A C     1 
ATOM   930  O  O     . MET C 2 23 ? -17.583 25.191 -12.679 1.00 47.26 ? 23 MET A O     1 
ATOM   931  C  CB    . MET C 2 23 ? -15.622 23.482 -11.505 1.00 47.61 ? 23 MET A CB    1 
ATOM   932  C  CG    . MET C 2 23 ? -15.374 23.975 -10.126 1.00 50.16 ? 23 MET A CG    1 
ATOM   933  S  SD    . MET C 2 23 ? -15.469 22.562 -8.997  1.00 54.59 ? 23 MET A SD    1 
ATOM   934  C  CE    . MET C 2 23 ? -17.182 22.054 -9.189  1.00 55.71 ? 23 MET A CE    1 
ATOM   935  N  N     . GLY C 2 24 ? -15.983 26.687 -13.195 1.00 47.00 ? 24 GLY A N     1 
ATOM   936  C  CA    . GLY C 2 24 ? -16.923 27.748 -13.457 1.00 47.03 ? 24 GLY A CA    1 
ATOM   937  C  C     . GLY C 2 24 ? -16.928 28.009 -14.954 1.00 48.25 ? 24 GLY A C     1 
ATOM   938  O  O     . GLY C 2 24 ? -17.818 28.695 -15.461 1.00 49.20 ? 24 GLY A O     1 
ATOM   939  N  N     . MET C 2 25 ? -15.939 27.460 -15.664 1.00 47.93 ? 25 MET A N     1 
ATOM   940  C  CA    . MET C 2 25 ? -15.836 27.646 -17.111 1.00 47.60 ? 25 MET A CA    1 
ATOM   941  C  C     . MET C 2 25 ? -16.746 26.705 -17.864 1.00 46.01 ? 25 MET A C     1 
ATOM   942  O  O     . MET C 2 25 ? -16.990 25.585 -17.422 1.00 45.71 ? 25 MET A O     1 
ATOM   943  C  CB    . MET C 2 25 ? -14.401 27.422 -17.609 1.00 49.97 ? 25 MET A CB    1 
ATOM   944  C  CG    . MET C 2 25 ? -13.935 25.975 -17.580 1.00 51.21 ? 25 MET A CG    1 
ATOM   945  S  SD    . MET C 2 25 ? -12.412 25.695 -18.530 1.00 54.34 ? 25 MET A SD    1 
ATOM   946  C  CE    . MET C 2 25 ? -12.850 24.239 -19.497 1.00 51.78 ? 25 MET A CE    1 
ATOM   947  N  N     . SER C 2 26 ? -17.217 27.163 -19.020 1.00 45.14 ? 26 SER A N     1 
ATOM   948  C  CA    . SER C 2 26 ? -18.114 26.378 -19.859 1.00 45.37 ? 26 SER A CA    1 
ATOM   949  C  C     . SER C 2 26 ? -17.431 25.700 -21.041 1.00 45.69 ? 26 SER A C     1 
ATOM   950  O  O     . SER C 2 26 ? -16.484 26.231 -21.625 1.00 45.45 ? 26 SER A O     1 
ATOM   951  C  CB    . SER C 2 26 ? -19.253 27.259 -20.377 1.00 45.32 ? 26 SER A CB    1 
ATOM   952  O  OG    . SER C 2 26 ? -18.755 28.444 -20.968 1.00 44.73 ? 26 SER A OG    1 
ATOM   953  N  N     . TYR C 2 27 ? -17.926 24.515 -21.380 1.00 45.01 ? 27 TYR A N     1 
ATOM   954  C  CA    . TYR C 2 27 ? -17.407 23.747 -22.498 1.00 44.89 ? 27 TYR A CA    1 
ATOM   955  C  C     . TYR C 2 27 ? -18.569 23.198 -23.323 1.00 45.43 ? 27 TYR A C     1 
ATOM   956  O  O     . TYR C 2 27 ? -18.646 22.007 -23.626 1.00 46.10 ? 27 TYR A O     1 
ATOM   957  C  CB    . TYR C 2 27 ? -16.478 22.619 -22.005 1.00 44.00 ? 27 TYR A CB    1 
ATOM   958  C  CG    . TYR C 2 27 ? -16.881 21.917 -20.723 1.00 44.12 ? 27 TYR A CG    1 
ATOM   959  C  CD1   . TYR C 2 27 ? -17.889 20.956 -20.707 1.00 43.31 ? 27 TYR A CD1   1 
ATOM   960  C  CD2   . TYR C 2 27 ? -16.231 22.201 -19.519 1.00 45.83 ? 27 TYR A CD2   1 
ATOM   961  C  CE1   . TYR C 2 27 ? -18.243 20.287 -19.517 1.00 44.43 ? 27 TYR A CE1   1 
ATOM   962  C  CE2   . TYR C 2 27 ? -16.579 21.540 -18.321 1.00 45.34 ? 27 TYR A CE2   1 
ATOM   963  C  CZ    . TYR C 2 27 ? -17.585 20.585 -18.329 1.00 45.03 ? 27 TYR A CZ    1 
ATOM   964  O  OH    . TYR C 2 27 ? -17.933 19.946 -17.153 1.00 44.27 ? 27 TYR A OH    1 
ATOM   965  N  N     . GLN C 2 28 ? -19.472 24.096 -23.697 1.00 45.53 ? 28 GLN A N     1 
ATOM   966  C  CA    . GLN C 2 28 ? -20.646 23.737 -24.480 1.00 46.96 ? 28 GLN A CA    1 
ATOM   967  C  C     . GLN C 2 28 ? -20.322 23.239 -25.898 1.00 47.53 ? 28 GLN A C     1 
ATOM   968  O  O     . GLN C 2 28 ? -20.993 22.356 -26.429 1.00 47.48 ? 28 GLN A O     1 
ATOM   969  C  CB    . GLN C 2 28 ? -21.581 24.940 -24.544 1.00 46.69 ? 28 GLN A CB    1 
ATOM   970  C  CG    . GLN C 2 28 ? -22.794 24.740 -25.408 1.00 48.43 ? 28 GLN A CG    1 
ATOM   971  C  CD    . GLN C 2 28 ? -23.721 25.936 -25.376 1.00 50.32 ? 28 GLN A CD    1 
ATOM   972  O  OE1   . GLN C 2 28 ? -23.309 27.049 -25.026 1.00 51.40 ? 28 GLN A OE1   1 
ATOM   973  N  NE2   . GLN C 2 28 ? -24.978 25.722 -25.754 1.00 50.95 ? 28 GLN A NE2   1 
ATOM   974  N  N     . ASP C 2 29 ? -19.287 23.796 -26.508 1.00 48.44 ? 29 ASP A N     1 
ATOM   975  C  CA    . ASP C 2 29 ? -18.909 23.401 -27.854 1.00 49.54 ? 29 ASP A CA    1 
ATOM   976  C  C     . ASP C 2 29 ? -18.012 22.168 -27.897 1.00 49.56 ? 29 ASP A C     1 
ATOM   977  O  O     . ASP C 2 29 ? -17.845 21.553 -28.949 1.00 51.34 ? 29 ASP A O     1 
ATOM   978  C  CB    . ASP C 2 29 ? -18.229 24.575 -28.562 1.00 51.39 ? 29 ASP A CB    1 
ATOM   979  C  CG    . ASP C 2 29 ? -17.099 25.179 -27.746 1.00 54.76 ? 29 ASP A CG    1 
ATOM   980  O  OD1   . ASP C 2 29 ? -17.270 25.357 -26.519 1.00 56.93 ? 29 ASP A OD1   1 
ATOM   981  O  OD2   . ASP C 2 29 ? -16.041 25.497 -28.334 1.00 58.03 ? 29 ASP A OD2   1 
ATOM   982  N  N     . ALA C 2 30 ? -17.448 21.797 -26.755 1.00 48.31 ? 30 ALA A N     1 
ATOM   983  C  CA    . ALA C 2 30 ? -16.562 20.640 -26.683 1.00 47.18 ? 30 ALA A CA    1 
ATOM   984  C  C     . ALA C 2 30 ? -17.181 19.328 -27.165 1.00 46.43 ? 30 ALA A C     1 
ATOM   985  O  O     . ALA C 2 30 ? -18.347 19.049 -26.916 1.00 46.25 ? 30 ALA A O     1 
ATOM   986  C  CB    . ALA C 2 30 ? -16.064 20.468 -25.264 1.00 46.60 ? 30 ALA A CB    1 
ATOM   987  N  N     . PRO C 2 31 ? -16.391 18.504 -27.873 1.00 46.11 ? 31 PRO A N     1 
ATOM   988  C  CA    . PRO C 2 31 ? -16.812 17.203 -28.405 1.00 45.26 ? 31 PRO A CA    1 
ATOM   989  C  C     . PRO C 2 31 ? -17.196 16.243 -27.273 1.00 45.06 ? 31 PRO A C     1 
ATOM   990  O  O     . PRO C 2 31 ? -16.702 16.353 -26.156 1.00 45.62 ? 31 PRO A O     1 
ATOM   991  C  CB    . PRO C 2 31 ? -15.573 16.726 -29.150 1.00 45.44 ? 31 PRO A CB    1 
ATOM   992  C  CG    . PRO C 2 31 ? -14.944 18.008 -29.598 1.00 45.33 ? 31 PRO A CG    1 
ATOM   993  C  CD    . PRO C 2 31 ? -15.052 18.858 -28.374 1.00 45.30 ? 31 PRO A CD    1 
ATOM   994  N  N     . ASN C 2 32 ? -18.058 15.286 -27.575 1.00 45.17 ? 32 ASN A N     1 
ATOM   995  C  CA    . ASN C 2 32 ? -18.527 14.321 -26.588 1.00 45.46 ? 32 ASN A CA    1 
ATOM   996  C  C     . ASN C 2 32 ? -17.474 13.660 -25.715 1.00 44.48 ? 32 ASN A C     1 
ATOM   997  O  O     . ASN C 2 32 ? -17.691 13.463 -24.522 1.00 44.87 ? 32 ASN A O     1 
ATOM   998  C  CB    . ASN C 2 32 ? -19.323 13.234 -27.288 1.00 49.03 ? 32 ASN A CB    1 
ATOM   999  C  CG    . ASN C 2 32 ? -20.742 13.168 -26.808 1.00 52.69 ? 32 ASN A CG    1 
ATOM   1000 O  OD1   . ASN C 2 32 ? -21.006 12.771 -25.670 1.00 54.26 ? 32 ASN A OD1   1 
ATOM   1001 N  ND2   . ASN C 2 32 ? -21.677 13.568 -27.670 1.00 53.46 ? 32 ASN A ND2   1 
ATOM   1002 N  N     . ASN C 2 33 ? -16.341 13.303 -26.306 1.00 43.01 ? 33 ASN A N     1 
ATOM   1003 C  CA    . ASN C 2 33 ? -15.283 12.641 -25.561 1.00 40.44 ? 33 ASN A CA    1 
ATOM   1004 C  C     . ASN C 2 33 ? -14.530 13.601 -24.641 1.00 39.89 ? 33 ASN A C     1 
ATOM   1005 O  O     . ASN C 2 33 ? -14.128 13.232 -23.545 1.00 39.69 ? 33 ASN A O     1 
ATOM   1006 C  CB    . ASN C 2 33 ? -14.317 11.932 -26.528 1.00 40.47 ? 33 ASN A CB    1 
ATOM   1007 C  CG    . ASN C 2 33 ? -13.451 12.898 -27.321 1.00 40.86 ? 33 ASN A CG    1 
ATOM   1008 O  OD1   . ASN C 2 33 ? -13.951 13.818 -27.974 1.00 40.54 ? 33 ASN A OD1   1 
ATOM   1009 N  ND2   . ASN C 2 33 ? -12.139 12.687 -27.269 1.00 41.81 ? 33 ASN A ND2   1 
ATOM   1010 N  N     . VAL C 2 34 ? -14.340 14.837 -25.075 1.00 40.16 ? 34 VAL A N     1 
ATOM   1011 C  CA    . VAL C 2 34 ? -13.649 15.802 -24.235 1.00 40.25 ? 34 VAL A CA    1 
ATOM   1012 C  C     . VAL C 2 34 ? -14.636 16.370 -23.224 1.00 40.76 ? 34 VAL A C     1 
ATOM   1013 O  O     . VAL C 2 34 ? -14.251 16.839 -22.164 1.00 41.65 ? 34 VAL A O     1 
ATOM   1014 C  CB    . VAL C 2 34 ? -13.039 16.941 -25.073 1.00 40.83 ? 34 VAL A CB    1 
ATOM   1015 C  CG1   . VAL C 2 34 ? -12.530 18.051 -24.166 1.00 39.59 ? 34 VAL A CG1   1 
ATOM   1016 C  CG2   . VAL C 2 34 ? -11.890 16.393 -25.909 1.00 40.40 ? 34 VAL A CG2   1 
ATOM   1017 N  N     . ARG C 2 35 ? -15.918 16.329 -23.553 1.00 41.80 ? 35 ARG A N     1 
ATOM   1018 C  CA    . ARG C 2 35 ? -16.925 16.817 -22.629 1.00 41.50 ? 35 ARG A CA    1 
ATOM   1019 C  C     . ARG C 2 35 ? -16.961 15.843 -21.453 1.00 42.15 ? 35 ARG A C     1 
ATOM   1020 O  O     . ARG C 2 35 ? -17.096 16.246 -20.299 1.00 43.10 ? 35 ARG A O     1 
ATOM   1021 C  CB    . ARG C 2 35 ? -18.291 16.866 -23.294 1.00 41.42 ? 35 ARG A CB    1 
ATOM   1022 C  CG    . ARG C 2 35 ? -19.336 17.554 -22.453 1.00 43.33 ? 35 ARG A CG    1 
ATOM   1023 C  CD    . ARG C 2 35 ? -20.706 16.960 -22.705 1.00 46.95 ? 35 ARG A CD    1 
ATOM   1024 N  NE    . ARG C 2 35 ? -20.848 15.634 -22.102 1.00 47.56 ? 35 ARG A NE    1 
ATOM   1025 C  CZ    . ARG C 2 35 ? -21.354 14.581 -22.737 1.00 47.72 ? 35 ARG A CZ    1 
ATOM   1026 N  NH1   . ARG C 2 35 ? -21.762 14.703 -23.998 1.00 46.47 ? 35 ARG A NH1   1 
ATOM   1027 N  NH2   . ARG C 2 35 ? -21.458 13.411 -22.110 1.00 47.02 ? 35 ARG A NH2   1 
ATOM   1028 N  N     . ARG C 2 36 ? -16.840 14.554 -21.740 1.00 42.26 ? 36 ARG A N     1 
ATOM   1029 C  CA    . ARG C 2 36 ? -16.843 13.580 -20.667 1.00 41.66 ? 36 ARG A CA    1 
ATOM   1030 C  C     . ARG C 2 36 ? -15.605 13.756 -19.798 1.00 41.88 ? 36 ARG A C     1 
ATOM   1031 O  O     . ARG C 2 36 ? -15.703 13.715 -18.577 1.00 44.25 ? 36 ARG A O     1 
ATOM   1032 C  CB    . ARG C 2 36 ? -16.911 12.165 -21.222 1.00 43.07 ? 36 ARG A CB    1 
ATOM   1033 C  CG    . ARG C 2 36 ? -18.242 11.857 -21.862 1.00 45.78 ? 36 ARG A CG    1 
ATOM   1034 C  CD    . ARG C 2 36 ? -18.445 10.367 -22.078 1.00 51.16 ? 36 ARG A CD    1 
ATOM   1035 N  NE    . ARG C 2 36 ? -19.823 10.081 -22.469 1.00 55.80 ? 36 ARG A NE    1 
ATOM   1036 C  CZ    . ARG C 2 36 ? -20.326 10.310 -23.680 1.00 59.01 ? 36 ARG A CZ    1 
ATOM   1037 N  NH1   . ARG C 2 36 ? -19.559 10.821 -24.645 1.00 58.77 ? 36 ARG A NH1   1 
ATOM   1038 N  NH2   . ARG C 2 36 ? -21.614 10.066 -23.914 1.00 60.77 ? 36 ARG A NH2   1 
ATOM   1039 N  N     . ASP C 2 37 ? -14.441 13.977 -20.402 1.00 41.02 ? 37 ASP A N     1 
ATOM   1040 C  CA    . ASP C 2 37 ? -13.233 14.161 -19.596 1.00 39.92 ? 37 ASP A CA    1 
ATOM   1041 C  C     . ASP C 2 37 ? -13.331 15.401 -18.704 1.00 39.03 ? 37 ASP A C     1 
ATOM   1042 O  O     . ASP C 2 37 ? -13.002 15.346 -17.521 1.00 38.37 ? 37 ASP A O     1 
ATOM   1043 C  CB    . ASP C 2 37 ? -11.969 14.223 -20.480 1.00 39.29 ? 37 ASP A CB    1 
ATOM   1044 C  CG    . ASP C 2 37 ? -11.527 12.828 -20.981 1.00 42.26 ? 37 ASP A CG    1 
ATOM   1045 O  OD1   . ASP C 2 37 ? -11.518 11.869 -20.173 1.00 40.00 ? 37 ASP A OD1   1 
ATOM   1046 O  OD2   . ASP C 2 37 ? -11.178 12.682 -22.180 1.00 44.45 ? 37 ASP A OD2   1 
ATOM   1047 N  N     . LEU C 2 38 ? -13.799 16.516 -19.253 1.00 38.22 ? 38 LEU A N     1 
ATOM   1048 C  CA    . LEU C 2 38 ? -13.923 17.724 -18.455 1.00 37.51 ? 38 LEU A CA    1 
ATOM   1049 C  C     . LEU C 2 38 ? -14.952 17.523 -17.346 1.00 39.01 ? 38 LEU A C     1 
ATOM   1050 O  O     . LEU C 2 38 ? -14.824 18.108 -16.260 1.00 39.83 ? 38 LEU A O     1 
ATOM   1051 C  CB    . LEU C 2 38 ? -14.296 18.916 -19.335 1.00 36.43 ? 38 LEU A CB    1 
ATOM   1052 C  CG    . LEU C 2 38 ? -13.205 19.332 -20.328 1.00 34.58 ? 38 LEU A CG    1 
ATOM   1053 C  CD1   . LEU C 2 38 ? -13.677 20.512 -21.167 1.00 33.70 ? 38 LEU A CD1   1 
ATOM   1054 C  CD2   . LEU C 2 38 ? -11.942 19.691 -19.567 1.00 32.78 ? 38 LEU A CD2   1 
ATOM   1055 N  N     . ASP C 2 39 ? -15.971 16.699 -17.601 1.00 38.44 ? 39 ASP A N     1 
ATOM   1056 C  CA    . ASP C 2 39 ? -16.967 16.424 -16.564 1.00 38.04 ? 39 ASP A CA    1 
ATOM   1057 C  C     . ASP C 2 39 ? -16.309 15.618 -15.450 1.00 36.87 ? 39 ASP A C     1 
ATOM   1058 O  O     . ASP C 2 39 ? -16.613 15.810 -14.272 1.00 36.88 ? 39 ASP A O     1 
ATOM   1059 C  CB    . ASP C 2 39 ? -18.157 15.636 -17.108 1.00 40.17 ? 39 ASP A CB    1 
ATOM   1060 C  CG    . ASP C 2 39 ? -19.175 16.520 -17.816 1.00 43.02 ? 39 ASP A CG    1 
ATOM   1061 O  OD1   . ASP C 2 39 ? -19.278 17.719 -17.470 1.00 44.43 ? 39 ASP A OD1   1 
ATOM   1062 O  OD2   . ASP C 2 39 ? -19.886 16.006 -18.710 1.00 44.64 ? 39 ASP A OD2   1 
ATOM   1063 N  N     . ASN C 2 40 ? -15.402 14.720 -15.824 1.00 35.78 ? 40 ASN A N     1 
ATOM   1064 C  CA    . ASN C 2 40 ? -14.697 13.909 -14.841 1.00 35.06 ? 40 ASN A CA    1 
ATOM   1065 C  C     . ASN C 2 40 ? -13.848 14.837 -13.961 1.00 35.05 ? 40 ASN A C     1 
ATOM   1066 O  O     . ASN C 2 40 ? -13.729 14.619 -12.759 1.00 35.81 ? 40 ASN A O     1 
ATOM   1067 C  CB    . ASN C 2 40 ? -13.824 12.858 -15.543 1.00 35.76 ? 40 ASN A CB    1 
ATOM   1068 C  CG    . ASN C 2 40 ? -13.557 11.621 -14.670 1.00 37.74 ? 40 ASN A CG    1 
ATOM   1069 O  OD1   . ASN C 2 40 ? -13.087 10.594 -15.156 1.00 37.35 ? 40 ASN A OD1   1 
ATOM   1070 N  ND2   . ASN C 2 40 ? -13.855 11.724 -13.382 1.00 39.24 ? 40 ASN A ND2   1 
ATOM   1071 N  N     . LEU C 2 41 ? -13.272 15.880 -14.555 1.00 33.92 ? 41 LEU A N     1 
ATOM   1072 C  CA    . LEU C 2 41 ? -12.471 16.846 -13.800 1.00 32.27 ? 41 LEU A CA    1 
ATOM   1073 C  C     . LEU C 2 41 ? -13.381 17.528 -12.756 1.00 33.04 ? 41 LEU A C     1 
ATOM   1074 O  O     . LEU C 2 41 ? -13.023 17.649 -11.579 1.00 33.13 ? 41 LEU A O     1 
ATOM   1075 C  CB    . LEU C 2 41 ? -11.897 17.892 -14.758 1.00 31.06 ? 41 LEU A CB    1 
ATOM   1076 C  CG    . LEU C 2 41 ? -10.731 18.810 -14.371 1.00 29.81 ? 41 LEU A CG    1 
ATOM   1077 C  CD1   . LEU C 2 41 ? -11.199 20.241 -14.397 1.00 28.84 ? 41 LEU A CD1   1 
ATOM   1078 C  CD2   . LEU C 2 41 ? -10.179 18.438 -13.017 1.00 28.32 ? 41 LEU A CD2   1 
ATOM   1079 N  N     . HIS C 2 42 ? -14.563 17.966 -13.192 1.00 32.83 ? 42 HIS A N     1 
ATOM   1080 C  CA    . HIS C 2 42 ? -15.531 18.616 -12.301 1.00 32.63 ? 42 HIS A CA    1 
ATOM   1081 C  C     . HIS C 2 42 ? -15.811 17.678 -11.119 1.00 32.10 ? 42 HIS A C     1 
ATOM   1082 O  O     . HIS C 2 42 ? -15.823 18.112 -9.967  1.00 34.30 ? 42 HIS A O     1 
ATOM   1083 C  CB    . HIS C 2 42 ? -16.820 18.949 -13.090 1.00 32.41 ? 42 HIS A CB    1 
ATOM   1084 C  CG    . HIS C 2 42 ? -17.851 19.731 -12.321 1.00 35.65 ? 42 HIS A CG    1 
ATOM   1085 N  ND1   . HIS C 2 42 ? -18.701 19.149 -11.399 1.00 36.33 ? 42 HIS A ND1   1 
ATOM   1086 C  CD2   . HIS C 2 42 ? -18.225 21.033 -12.397 1.00 35.72 ? 42 HIS A CD2   1 
ATOM   1087 C  CE1   . HIS C 2 42 ? -19.553 20.053 -10.950 1.00 34.12 ? 42 HIS A CE1   1 
ATOM   1088 N  NE2   . HIS C 2 42 ? -19.287 21.205 -11.540 1.00 34.51 ? 42 HIS A NE2   1 
ATOM   1089 N  N     . ALA C 2 43 ? -15.996 16.388 -11.394 1.00 30.38 ? 43 ALA A N     1 
ATOM   1090 C  CA    . ALA C 2 43 ? -16.277 15.416 -10.337 1.00 28.20 ? 43 ALA A CA    1 
ATOM   1091 C  C     . ALA C 2 43 ? -15.094 15.253 -9.388  1.00 30.01 ? 43 ALA A C     1 
ATOM   1092 O  O     . ALA C 2 43 ? -15.257 15.075 -8.179  1.00 31.51 ? 43 ALA A O     1 
ATOM   1093 C  CB    . ALA C 2 43 ? -16.624 14.087 -10.951 1.00 25.27 ? 43 ALA A CB    1 
ATOM   1094 N  N     . CYS C 2 44 ? -13.897 15.307 -9.950  1.00 30.35 ? 44 CYS A N     1 
ATOM   1095 C  CA    . CYS C 2 44 ? -12.683 15.167 -9.176  1.00 30.39 ? 44 CYS A CA    1 
ATOM   1096 C  C     . CYS C 2 44 ? -12.507 16.364 -8.239  1.00 30.44 ? 44 CYS A C     1 
ATOM   1097 O  O     . CYS C 2 44 ? -12.167 16.202 -7.067  1.00 30.27 ? 44 CYS A O     1 
ATOM   1098 C  CB    . CYS C 2 44 ? -11.495 15.044 -10.139 1.00 31.54 ? 44 CYS A CB    1 
ATOM   1099 S  SG    . CYS C 2 44 ? -9.859  14.983 -9.361  1.00 34.27 ? 44 CYS A SG    1 
ATOM   1100 N  N     . LEU C 2 45 ? -12.738 17.569 -8.756  1.00 30.89 ? 45 LEU A N     1 
ATOM   1101 C  CA    . LEU C 2 45 ? -12.593 18.782 -7.950  1.00 28.71 ? 45 LEU A CA    1 
ATOM   1102 C  C     . LEU C 2 45 ? -13.674 18.797 -6.891  1.00 29.43 ? 45 LEU A C     1 
ATOM   1103 O  O     . LEU C 2 45 ? -13.416 19.054 -5.714  1.00 29.72 ? 45 LEU A O     1 
ATOM   1104 C  CB    . LEU C 2 45 ? -12.718 20.019 -8.834  1.00 25.63 ? 45 LEU A CB    1 
ATOM   1105 C  CG    . LEU C 2 45 ? -11.614 20.148 -9.878  1.00 24.70 ? 45 LEU A CG    1 
ATOM   1106 C  CD1   . LEU C 2 45 ? -11.870 21.337 -10.751 1.00 24.04 ? 45 LEU A CD1   1 
ATOM   1107 C  CD2   . LEU C 2 45 ? -10.265 20.271 -9.178  1.00 23.41 ? 45 LEU A CD2   1 
ATOM   1108 N  N     . ASN C 2 46 ? -14.895 18.505 -7.317  1.00 29.75 ? 46 ASN A N     1 
ATOM   1109 C  CA    . ASN C 2 46 ? -16.015 18.474 -6.403  1.00 31.20 ? 46 ASN A CA    1 
ATOM   1110 C  C     . ASN C 2 46 ? -15.738 17.526 -5.224  1.00 31.40 ? 46 ASN A C     1 
ATOM   1111 O  O     . ASN C 2 46 ? -15.994 17.862 -4.069  1.00 33.47 ? 46 ASN A O     1 
ATOM   1112 C  CB    . ASN C 2 46 ? -17.268 18.052 -7.160  1.00 31.89 ? 46 ASN A CB    1 
ATOM   1113 C  CG    . ASN C 2 46 ? -18.504 18.159 -6.318  1.00 34.35 ? 46 ASN A CG    1 
ATOM   1114 O  OD1   . ASN C 2 46 ? -19.175 17.163 -6.064  1.00 37.53 ? 46 ASN A OD1   1 
ATOM   1115 N  ND2   . ASN C 2 46 ? -18.813 19.369 -5.864  1.00 35.38 ? 46 ASN A ND2   1 
ATOM   1116 N  N     . LYS C 2 47 ? -15.195 16.350 -5.503  1.00 31.89 ? 47 LYS A N     1 
ATOM   1117 C  CA    . LYS C 2 47 ? -14.899 15.396 -4.440  1.00 32.08 ? 47 LYS A CA    1 
ATOM   1118 C  C     . LYS C 2 47 ? -13.764 15.815 -3.522  1.00 31.59 ? 47 LYS A C     1 
ATOM   1119 O  O     . LYS C 2 47 ? -13.729 15.419 -2.362  1.00 33.35 ? 47 LYS A O     1 
ATOM   1120 C  CB    . LYS C 2 47 ? -14.546 14.036 -5.018  1.00 33.56 ? 47 LYS A CB    1 
ATOM   1121 C  CG    . LYS C 2 47 ? -14.169 13.035 -3.955  1.00 37.25 ? 47 LYS A CG    1 
ATOM   1122 C  CD    . LYS C 2 47 ? -13.626 11.770 -4.570  1.00 42.64 ? 47 LYS A CD    1 
ATOM   1123 C  CE    . LYS C 2 47 ? -13.195 10.806 -3.496  1.00 44.92 ? 47 LYS A CE    1 
ATOM   1124 N  NZ    . LYS C 2 47 ? -14.328 10.598 -2.574  1.00 48.40 ? 47 LYS A NZ    1 
ATOM   1125 N  N     . ALA C 2 48 ? -12.812 16.578 -4.041  1.00 31.54 ? 48 ALA A N     1 
ATOM   1126 C  CA    . ALA C 2 48 ? -11.688 17.023 -3.230  1.00 31.89 ? 48 ALA A CA    1 
ATOM   1127 C  C     . ALA C 2 48 ? -12.219 18.111 -2.316  1.00 33.16 ? 48 ALA A C     1 
ATOM   1128 O  O     . ALA C 2 48 ? -11.844 18.209 -1.145  1.00 34.34 ? 48 ALA A O     1 
ATOM   1129 C  CB    . ALA C 2 48 ? -10.586 17.567 -4.115  1.00 29.66 ? 48 ALA A CB    1 
ATOM   1130 N  N     . LYS C 2 49 ? -13.112 18.922 -2.873  1.00 33.86 ? 49 LYS A N     1 
ATOM   1131 C  CA    . LYS C 2 49 ? -13.753 20.024 -2.163  1.00 32.61 ? 49 LYS A CA    1 
ATOM   1132 C  C     . LYS C 2 49 ? -14.585 19.459 -1.009  1.00 31.59 ? 49 LYS A C     1 
ATOM   1133 O  O     . LYS C 2 49 ? -14.436 19.879 0.135   1.00 31.78 ? 49 LYS A O     1 
ATOM   1134 C  CB    . LYS C 2 49 ? -14.636 20.780 -3.154  1.00 34.24 ? 49 LYS A CB    1 
ATOM   1135 C  CG    . LYS C 2 49 ? -15.170 22.077 -2.671  1.00 34.34 ? 49 LYS A CG    1 
ATOM   1136 C  CD    . LYS C 2 49 ? -15.680 22.908 -3.836  1.00 35.87 ? 49 LYS A CD    1 
ATOM   1137 C  CE    . LYS C 2 49 ? -16.891 22.284 -4.511  1.00 37.90 ? 49 LYS A CE    1 
ATOM   1138 N  NZ    . LYS C 2 49 ? -17.528 23.234 -5.483  1.00 39.36 ? 49 LYS A NZ    1 
ATOM   1139 N  N     . LEU C 2 50 ? -15.446 18.492 -1.308  1.00 30.21 ? 50 LEU A N     1 
ATOM   1140 C  CA    . LEU C 2 50 ? -16.272 17.865 -0.280  1.00 30.94 ? 50 LEU A CA    1 
ATOM   1141 C  C     . LEU C 2 50 ? -15.471 17.118 0.785   1.00 30.88 ? 50 LEU A C     1 
ATOM   1142 O  O     . LEU C 2 50 ? -15.867 17.082 1.951   1.00 32.26 ? 50 LEU A O     1 
ATOM   1143 C  CB    . LEU C 2 50 ? -17.259 16.880 -0.901  1.00 31.96 ? 50 LEU A CB    1 
ATOM   1144 C  CG    . LEU C 2 50 ? -18.369 17.414 -1.802  1.00 33.79 ? 50 LEU A CG    1 
ATOM   1145 C  CD1   . LEU C 2 50 ? -19.276 16.262 -2.166  1.00 33.71 ? 50 LEU A CD1   1 
ATOM   1146 C  CD2   . LEU C 2 50 ? -19.155 18.497 -1.097  1.00 33.48 ? 50 LEU A CD2   1 
ATOM   1147 N  N     . THR C 2 51 ? -14.365 16.498 0.391   1.00 29.46 ? 51 THR A N     1 
ATOM   1148 C  CA    . THR C 2 51 ? -13.542 15.752 1.342   1.00 29.63 ? 51 THR A CA    1 
ATOM   1149 C  C     . THR C 2 51 ? -12.879 16.670 2.345   1.00 29.93 ? 51 THR A C     1 
ATOM   1150 O  O     . THR C 2 51 ? -12.949 16.439 3.545   1.00 30.64 ? 51 THR A O     1 
ATOM   1151 C  CB    . THR C 2 51 ? -12.465 14.940 0.631   1.00 28.35 ? 51 THR A CB    1 
ATOM   1152 O  OG1   . THR C 2 51 ? -13.084 13.843 -0.039  1.00 32.33 ? 51 THR A OG1   1 
ATOM   1153 C  CG2   . THR C 2 51 ? -11.463 14.416 1.605   1.00 25.05 ? 51 THR A CG2   1 
ATOM   1154 N  N     . VAL C 2 52 ? -12.221 17.711 1.863   1.00 29.88 ? 52 VAL A N     1 
ATOM   1155 C  CA    . VAL C 2 52 ? -11.597 18.642 2.784   1.00 30.65 ? 52 VAL A CA    1 
ATOM   1156 C  C     . VAL C 2 52 ? -12.700 19.167 3.708   1.00 30.74 ? 52 VAL A C     1 
ATOM   1157 O  O     . VAL C 2 52 ? -12.569 19.153 4.931   1.00 31.62 ? 52 VAL A O     1 
ATOM   1158 C  CB    . VAL C 2 52 ? -10.937 19.813 2.020   1.00 30.93 ? 52 VAL A CB    1 
ATOM   1159 C  CG1   . VAL C 2 52 ? -10.567 20.921 2.975   1.00 28.74 ? 52 VAL A CG1   1 
ATOM   1160 C  CG2   . VAL C 2 52 ? -9.695  19.307 1.287   1.00 30.37 ? 52 VAL A CG2   1 
ATOM   1161 N  N     . SER C 2 53 ? -13.802 19.602 3.109   1.00 31.94 ? 53 SER A N     1 
ATOM   1162 C  CA    . SER C 2 53 ? -14.933 20.135 3.860   1.00 31.65 ? 53 SER A CA    1 
ATOM   1163 C  C     . SER C 2 53 ? -15.383 19.202 4.988   1.00 32.38 ? 53 SER A C     1 
ATOM   1164 O  O     . SER C 2 53 ? -15.669 19.641 6.110   1.00 32.41 ? 53 SER A O     1 
ATOM   1165 C  CB    . SER C 2 53 ? -16.090 20.393 2.916   1.00 30.00 ? 53 SER A CB    1 
ATOM   1166 O  OG    . SER C 2 53 ? -17.134 21.010 3.627   1.00 34.87 ? 53 SER A OG    1 
ATOM   1167 N  N     . ARG C 2 54 ? -15.444 17.912 4.675   1.00 32.85 ? 54 ARG A N     1 
ATOM   1168 C  CA    . ARG C 2 54 ? -15.836 16.887 5.631   1.00 31.19 ? 54 ARG A CA    1 
ATOM   1169 C  C     . ARG C 2 54 ? -14.751 16.757 6.678   1.00 31.71 ? 54 ARG A C     1 
ATOM   1170 O  O     . ARG C 2 54 ? -15.033 16.710 7.868   1.00 34.48 ? 54 ARG A O     1 
ATOM   1171 C  CB    . ARG C 2 54 ? -16.007 15.554 4.911   1.00 31.38 ? 54 ARG A CB    1 
ATOM   1172 C  CG    . ARG C 2 54 ? -17.373 14.927 5.035   1.00 31.99 ? 54 ARG A CG    1 
ATOM   1173 C  CD    . ARG C 2 54 ? -17.888 14.410 3.700   1.00 30.89 ? 54 ARG A CD    1 
ATOM   1174 N  NE    . ARG C 2 54 ? -16.900 13.619 2.979   1.00 31.62 ? 54 ARG A NE    1 
ATOM   1175 C  CZ    . ARG C 2 54 ? -17.033 13.254 1.709   1.00 31.97 ? 54 ARG A CZ    1 
ATOM   1176 N  NH1   . ARG C 2 54 ? -18.115 13.604 1.029   1.00 32.38 ? 54 ARG A NH1   1 
ATOM   1177 N  NH2   . ARG C 2 54 ? -16.072 12.567 1.110   1.00 33.97 ? 54 ARG A NH2   1 
ATOM   1178 N  N     . MET C 2 55 ? -13.501 16.707 6.236   1.00 32.55 ? 55 MET A N     1 
ATOM   1179 C  CA    . MET C 2 55 ? -12.378 16.571 7.155   1.00 33.41 ? 55 MET A CA    1 
ATOM   1180 C  C     . MET C 2 55 ? -12.392 17.672 8.209   1.00 33.62 ? 55 MET A C     1 
ATOM   1181 O  O     . MET C 2 55 ? -12.304 17.401 9.405   1.00 35.56 ? 55 MET A O     1 
ATOM   1182 C  CB    . MET C 2 55 ? -11.063 16.622 6.385   1.00 36.02 ? 55 MET A CB    1 
ATOM   1183 C  CG    . MET C 2 55 ? -10.112 15.483 6.693   1.00 40.65 ? 55 MET A CG    1 
ATOM   1184 S  SD    . MET C 2 55 ? -9.456  15.496 8.369   1.00 47.17 ? 55 MET A SD    1 
ATOM   1185 C  CE    . MET C 2 55 ? -8.804  13.783 8.519   1.00 43.74 ? 55 MET A CE    1 
ATOM   1186 N  N     . VAL C 2 56 ? -12.504 18.921 7.773   1.00 32.72 ? 56 VAL A N     1 
ATOM   1187 C  CA    . VAL C 2 56 ? -12.517 20.026 8.716   1.00 30.39 ? 56 VAL A CA    1 
ATOM   1188 C  C     . VAL C 2 56 ? -13.705 19.937 9.670   1.00 30.95 ? 56 VAL A C     1 
ATOM   1189 O  O     . VAL C 2 56 ? -13.567 20.217 10.855  1.00 32.66 ? 56 VAL A O     1 
ATOM   1190 C  CB    . VAL C 2 56 ? -12.525 21.369 7.982   1.00 29.94 ? 56 VAL A CB    1 
ATOM   1191 C  CG1   . VAL C 2 56 ? -12.629 22.496 8.985   1.00 28.56 ? 56 VAL A CG1   1 
ATOM   1192 C  CG2   . VAL C 2 56 ? -11.251 21.509 7.145   1.00 26.85 ? 56 VAL A CG2   1 
ATOM   1193 N  N     . THR C 2 57 ? -14.871 19.544 9.172   1.00 31.23 ? 57 THR A N     1 
ATOM   1194 C  CA    . THR C 2 57 ? -16.023 19.412 10.050  1.00 31.58 ? 57 THR A CA    1 
ATOM   1195 C  C     . THR C 2 57 ? -15.721 18.349 11.114  1.00 33.13 ? 57 THR A C     1 
ATOM   1196 O  O     . THR C 2 57 ? -16.171 18.470 12.253  1.00 32.03 ? 57 THR A O     1 
ATOM   1197 C  CB    . THR C 2 57 ? -17.299 19.037 9.259   1.00 31.86 ? 57 THR A CB    1 
ATOM   1198 O  OG1   . THR C 2 57 ? -17.657 20.130 8.414   1.00 32.79 ? 57 THR A OG1   1 
ATOM   1199 C  CG2   . THR C 2 57 ? -18.471 18.751 10.197  1.00 30.76 ? 57 THR A CG2   1 
ATOM   1200 N  N     . SER C 2 58 ? -14.961 17.314 10.746  1.00 34.52 ? 58 SER A N     1 
ATOM   1201 C  CA    . SER C 2 58 ? -14.583 16.270 11.704  1.00 35.84 ? 58 SER A CA    1 
ATOM   1202 C  C     . SER C 2 58 ? -13.643 16.885 12.720  1.00 36.37 ? 58 SER A C     1 
ATOM   1203 O  O     . SER C 2 58 ? -13.773 16.654 13.917  1.00 39.38 ? 58 SER A O     1 
ATOM   1204 C  CB    . SER C 2 58 ? -13.832 15.121 11.040  1.00 37.26 ? 58 SER A CB    1 
ATOM   1205 O  OG    . SER C 2 58 ? -14.629 14.419 10.109  1.00 43.59 ? 58 SER A OG    1 
ATOM   1206 N  N     . LEU C 2 59 ? -12.678 17.658 12.244  1.00 34.19 ? 59 LEU A N     1 
ATOM   1207 C  CA    . LEU C 2 59 ? -11.752 18.276 13.162  1.00 34.54 ? 59 LEU A CA    1 
ATOM   1208 C  C     . LEU C 2 59 ? -12.439 19.225 14.128  1.00 35.39 ? 59 LEU A C     1 
ATOM   1209 O  O     . LEU C 2 59 ? -12.188 19.171 15.326  1.00 38.19 ? 59 LEU A O     1 
ATOM   1210 C  CB    . LEU C 2 59 ? -10.653 19.019 12.411  1.00 33.48 ? 59 LEU A CB    1 
ATOM   1211 C  CG    . LEU C 2 59 ? -9.614  18.153 11.701  1.00 34.37 ? 59 LEU A CG    1 
ATOM   1212 C  CD1   . LEU C 2 59 ? -8.728  19.065 10.877  1.00 35.14 ? 59 LEU A CD1   1 
ATOM   1213 C  CD2   . LEU C 2 59 ? -8.784  17.352 12.703  1.00 32.42 ? 59 LEU A CD2   1 
ATOM   1214 N  N     . LEU C 2 60 ? -13.317 20.090 13.647  1.00 34.87 ? 60 LEU A N     1 
ATOM   1215 C  CA    . LEU C 2 60 ? -13.944 21.017 14.579  1.00 36.24 ? 60 LEU A CA    1 
ATOM   1216 C  C     . LEU C 2 60 ? -15.031 20.422 15.490  1.00 37.22 ? 60 LEU A C     1 
ATOM   1217 O  O     . LEU C 2 60 ? -15.689 21.152 16.237  1.00 36.84 ? 60 LEU A O     1 
ATOM   1218 C  CB    . LEU C 2 60 ? -14.490 22.220 13.820  1.00 36.21 ? 60 LEU A CB    1 
ATOM   1219 C  CG    . LEU C 2 60 ? -13.464 22.895 12.919  1.00 36.63 ? 60 LEU A CG    1 
ATOM   1220 C  CD1   . LEU C 2 60 ? -14.063 24.152 12.341  1.00 39.27 ? 60 LEU A CD1   1 
ATOM   1221 C  CD2   . LEU C 2 60 ? -12.216 23.225 13.706  1.00 39.69 ? 60 LEU A CD2   1 
ATOM   1222 N  N     . GLU C 2 61 ? -15.225 19.106 15.436  1.00 37.55 ? 61 GLU A N     1 
ATOM   1223 C  CA    . GLU C 2 61 ? -16.223 18.472 16.294  1.00 38.33 ? 61 GLU A CA    1 
ATOM   1224 C  C     . GLU C 2 61 ? -15.511 17.632 17.345  1.00 38.72 ? 61 GLU A C     1 
ATOM   1225 O  O     . GLU C 2 61 ? -16.142 16.919 18.136  1.00 39.96 ? 61 GLU A O     1 
ATOM   1226 C  CB    . GLU C 2 61 ? -17.179 17.599 15.483  1.00 39.46 ? 61 GLU A CB    1 
ATOM   1227 C  CG    . GLU C 2 61 ? -17.944 18.373 14.420  1.00 45.21 ? 61 GLU A CG    1 
ATOM   1228 C  CD    . GLU C 2 61 ? -18.858 17.491 13.589  1.00 47.57 ? 61 GLU A CD    1 
ATOM   1229 O  OE1   . GLU C 2 61 ? -18.481 16.328 13.303  1.00 47.79 ? 61 GLU A OE1   1 
ATOM   1230 O  OE2   . GLU C 2 61 ? -19.950 17.972 13.209  1.00 50.95 ? 61 GLU A OE2   1 
ATOM   1231 N  N     . LYS C 2 62 ? -14.185 17.711 17.347  1.00 36.55 ? 62 LYS A N     1 
ATOM   1232 C  CA    . LYS C 2 62 ? -13.404 16.987 18.324  1.00 34.87 ? 62 LYS A CA    1 
ATOM   1233 C  C     . LYS C 2 62 ? -13.065 18.018 19.380  1.00 36.13 ? 62 LYS A C     1 
ATOM   1234 O  O     . LYS C 2 62 ? -12.209 18.874 19.163  1.00 37.55 ? 62 LYS A O     1 
ATOM   1235 C  CB    . LYS C 2 62 ? -12.128 16.434 17.690  1.00 32.94 ? 62 LYS A CB    1 
ATOM   1236 C  CG    . LYS C 2 62 ? -12.373 15.420 16.561  1.00 30.12 ? 62 LYS A CG    1 
ATOM   1237 C  CD    . LYS C 2 62 ? -11.064 14.903 16.002  1.00 26.38 ? 62 LYS A CD    1 
ATOM   1238 C  CE    . LYS C 2 62 ? -11.267 14.053 14.774  1.00 26.32 ? 62 LYS A CE    1 
ATOM   1239 N  NZ    . LYS C 2 62 ? -11.753 12.687 15.115  1.00 28.67 ? 62 LYS A NZ    1 
ATOM   1240 N  N     . PRO C 2 63 ? -13.762 17.985 20.525  1.00 37.26 ? 63 PRO A N     1 
ATOM   1241 C  CA    . PRO C 2 63 ? -13.478 18.956 21.585  1.00 38.82 ? 63 PRO A CA    1 
ATOM   1242 C  C     . PRO C 2 63 ? -11.991 19.085 21.903  1.00 39.79 ? 63 PRO A C     1 
ATOM   1243 O  O     . PRO C 2 63 ? -11.520 20.147 22.339  1.00 40.12 ? 63 PRO A O     1 
ATOM   1244 C  CB    . PRO C 2 63 ? -14.315 18.446 22.769  1.00 37.87 ? 63 PRO A CB    1 
ATOM   1245 C  CG    . PRO C 2 63 ? -14.773 17.054 22.355  1.00 37.35 ? 63 PRO A CG    1 
ATOM   1246 C  CD    . PRO C 2 63 ? -14.928 17.162 20.876  1.00 37.47 ? 63 PRO A CD    1 
ATOM   1247 N  N     . SER C 2 64 ? -11.250 18.008 21.672  1.00 39.78 ? 64 SER A N     1 
ATOM   1248 C  CA    . SER C 2 64 ? -9.813  18.024 21.912  1.00 39.80 ? 64 SER A CA    1 
ATOM   1249 C  C     . SER C 2 64 ? -9.085  18.908 20.895  1.00 40.13 ? 64 SER A C     1 
ATOM   1250 O  O     . SER C 2 64 ? -8.337  19.820 21.267  1.00 41.94 ? 64 SER A O     1 
ATOM   1251 C  CB    . SER C 2 64 ? -9.250  16.605 21.847  1.00 39.35 ? 64 SER A CB    1 
ATOM   1252 O  OG    . SER C 2 64 ? -9.578  15.987 20.621  1.00 40.94 ? 64 SER A OG    1 
ATOM   1253 N  N     . VAL C 2 65 ? -9.296  18.642 19.612  1.00 38.51 ? 65 VAL A N     1 
ATOM   1254 C  CA    . VAL C 2 65 ? -8.640  19.427 18.588  1.00 37.65 ? 65 VAL A CA    1 
ATOM   1255 C  C     . VAL C 2 65 ? -8.994  20.894 18.777  1.00 38.81 ? 65 VAL A C     1 
ATOM   1256 O  O     . VAL C 2 65 ? -8.114  21.752 18.774  1.00 40.05 ? 65 VAL A O     1 
ATOM   1257 C  CB    . VAL C 2 65 ? -9.052  18.967 17.174  1.00 36.02 ? 65 VAL A CB    1 
ATOM   1258 C  CG1   . VAL C 2 65 ? -8.535  19.944 16.131  1.00 34.39 ? 65 VAL A CG1   1 
ATOM   1259 C  CG2   . VAL C 2 65 ? -8.498  17.579 16.903  1.00 34.13 ? 65 VAL A CG2   1 
ATOM   1260 N  N     . VAL C 2 66 ? -10.278 21.182 18.960  1.00 38.94 ? 66 VAL A N     1 
ATOM   1261 C  CA    . VAL C 2 66 ? -10.731 22.563 19.140  1.00 39.16 ? 66 VAL A CA    1 
ATOM   1262 C  C     . VAL C 2 66 ? -10.047 23.279 20.309  1.00 39.37 ? 66 VAL A C     1 
ATOM   1263 O  O     . VAL C 2 66 ? -9.650  24.438 20.194  1.00 38.86 ? 66 VAL A O     1 
ATOM   1264 C  CB    . VAL C 2 66 ? -12.255 22.623 19.362  1.00 39.15 ? 66 VAL A CB    1 
ATOM   1265 C  CG1   . VAL C 2 66 ? -12.679 24.067 19.586  1.00 38.07 ? 66 VAL A CG1   1 
ATOM   1266 C  CG2   . VAL C 2 66 ? -12.980 22.021 18.162  1.00 37.47 ? 66 VAL A CG2   1 
ATOM   1267 N  N     . ALA C 2 67 ? -9.921  22.585 21.434  1.00 39.55 ? 67 ALA A N     1 
ATOM   1268 C  CA    . ALA C 2 67 ? -9.287  23.155 22.611  1.00 40.21 ? 67 ALA A CA    1 
ATOM   1269 C  C     . ALA C 2 67 ? -7.843  23.533 22.302  1.00 40.67 ? 67 ALA A C     1 
ATOM   1270 O  O     . ALA C 2 67 ? -7.393  24.619 22.655  1.00 39.93 ? 67 ALA A O     1 
ATOM   1271 C  CB    . ALA C 2 67 ? -9.336  22.164 23.754  1.00 41.20 ? 67 ALA A CB    1 
ATOM   1272 N  N     . TYR C 2 68 ? -7.115  22.633 21.645  1.00 40.95 ? 68 TYR A N     1 
ATOM   1273 C  CA    . TYR C 2 68 ? -5.728  22.910 21.283  1.00 40.50 ? 68 TYR A CA    1 
ATOM   1274 C  C     . TYR C 2 68 ? -5.621  24.104 20.343  1.00 41.46 ? 68 TYR A C     1 
ATOM   1275 O  O     . TYR C 2 68 ? -4.854  25.027 20.587  1.00 41.63 ? 68 TYR A O     1 
ATOM   1276 C  CB    . TYR C 2 68 ? -5.085  21.720 20.586  1.00 38.81 ? 68 TYR A CB    1 
ATOM   1277 C  CG    . TYR C 2 68 ? -3.768  22.097 19.959  1.00 37.80 ? 68 TYR A CG    1 
ATOM   1278 C  CD1   . TYR C 2 68 ? -2.668  22.397 20.752  1.00 38.65 ? 68 TYR A CD1   1 
ATOM   1279 C  CD2   . TYR C 2 68 ? -3.636  22.214 18.581  1.00 37.77 ? 68 TYR A CD2   1 
ATOM   1280 C  CE1   . TYR C 2 68 ? -1.460  22.808 20.195  1.00 39.63 ? 68 TYR A CE1   1 
ATOM   1281 C  CE2   . TYR C 2 68 ? -2.430  22.627 18.003  1.00 38.84 ? 68 TYR A CE2   1 
ATOM   1282 C  CZ    . TYR C 2 68 ? -1.344  22.922 18.822  1.00 40.17 ? 68 TYR A CZ    1 
ATOM   1283 O  OH    . TYR C 2 68 ? -0.141  23.323 18.284  1.00 39.51 ? 68 TYR A OH    1 
ATOM   1284 N  N     . LEU C 2 69 ? -6.382  24.072 19.255  1.00 42.82 ? 69 LEU A N     1 
ATOM   1285 C  CA    . LEU C 2 69 ? -6.354  25.145 18.273  1.00 44.16 ? 69 LEU A CA    1 
ATOM   1286 C  C     . LEU C 2 69 ? -6.583  26.532 18.867  1.00 47.20 ? 69 LEU A C     1 
ATOM   1287 O  O     . LEU C 2 69 ? -6.304  27.542 18.210  1.00 48.00 ? 69 LEU A O     1 
ATOM   1288 C  CB    . LEU C 2 69 ? -7.377  24.868 17.167  1.00 41.81 ? 69 LEU A CB    1 
ATOM   1289 C  CG    . LEU C 2 69 ? -7.081  23.607 16.359  1.00 38.79 ? 69 LEU A CG    1 
ATOM   1290 C  CD1   . LEU C 2 69 ? -8.201  23.308 15.386  1.00 35.81 ? 69 LEU A CD1   1 
ATOM   1291 C  CD2   . LEU C 2 69 ? -5.764  23.805 15.649  1.00 38.28 ? 69 LEU A CD2   1 
ATOM   1292 N  N     . GLU C 2 70 ? -7.077  26.596 20.104  1.00 50.46 ? 70 GLU A N     1 
ATOM   1293 C  CA    . GLU C 2 70 ? -7.300  27.895 20.748  1.00 52.96 ? 70 GLU A CA    1 
ATOM   1294 C  C     . GLU C 2 70 ? -6.684  28.085 22.151  1.00 53.87 ? 70 GLU A C     1 
ATOM   1295 O  O     . GLU C 2 70 ? -6.494  29.215 22.591  1.00 54.22 ? 70 GLU A O     1 
ATOM   1296 C  CB    . GLU C 2 70 ? -8.799  28.198 20.785  1.00 52.71 ? 70 GLU A CB    1 
ATOM   1297 C  CG    . GLU C 2 70 ? -9.630  27.120 21.430  1.00 55.02 ? 70 GLU A CG    1 
ATOM   1298 C  CD    . GLU C 2 70 ? -11.125 27.331 21.235  1.00 56.52 ? 70 GLU A CD    1 
ATOM   1299 O  OE1   . GLU C 2 70 ? -11.590 27.281 20.076  1.00 59.01 ? 70 GLU A OE1   1 
ATOM   1300 O  OE2   . GLU C 2 70 ? -11.839 27.541 22.238  1.00 56.46 ? 70 GLU A OE2   1 
ATOM   1301 N  N     . GLY C 2 71 ? -6.355  26.988 22.838  1.00 55.85 ? 71 GLY A N     1 
ATOM   1302 C  CA    . GLY C 2 71 ? -5.785  27.076 24.181  1.00 55.58 ? 71 GLY A CA    1 
ATOM   1303 C  C     . GLY C 2 71 ? -6.374  26.062 25.167  1.00 56.15 ? 71 GLY A C     1 
ATOM   1304 O  O     . GLY C 2 71 ? -7.563  26.200 25.553  1.00 54.93 ? 71 GLY A O     1 
ATOM   1305 N  N     . PRO D 2 2  ? -6.767  34.964 -19.351 1.00 66.17 ? 2  PRO B N     1 
ATOM   1306 C  CA    . PRO D 2 2  ? -6.498  33.586 -18.868 1.00 65.74 ? 2  PRO B CA    1 
ATOM   1307 C  C     . PRO D 2 2  ? -7.360  32.579 -19.637 1.00 65.53 ? 2  PRO B C     1 
ATOM   1308 O  O     . PRO D 2 2  ? -8.528  32.360 -19.296 1.00 65.55 ? 2  PRO B O     1 
ATOM   1309 C  CB    . PRO D 2 2  ? -6.841  33.574 -17.390 1.00 66.02 ? 2  PRO B CB    1 
ATOM   1310 C  CG    . PRO D 2 2  ? -7.959  34.626 -17.349 1.00 66.21 ? 2  PRO B CG    1 
ATOM   1311 C  CD    . PRO D 2 2  ? -7.500  35.726 -18.322 1.00 65.80 ? 2  PRO B CD    1 
ATOM   1312 N  N     . SER D 2 3  ? -6.783  31.971 -20.674 1.00 63.91 ? 3  SER B N     1 
ATOM   1313 C  CA    . SER D 2 3  ? -7.510  31.002 -21.494 1.00 61.82 ? 3  SER B CA    1 
ATOM   1314 C  C     . SER D 2 3  ? -7.978  29.789 -20.696 1.00 59.70 ? 3  SER B C     1 
ATOM   1315 O  O     . SER D 2 3  ? -7.712  29.665 -19.499 1.00 59.47 ? 3  SER B O     1 
ATOM   1316 C  CB    . SER D 2 3  ? -6.646  30.532 -22.674 1.00 62.08 ? 3  SER B CB    1 
ATOM   1317 O  OG    . SER D 2 3  ? -5.555  29.742 -22.237 1.00 61.97 ? 3  SER B OG    1 
ATOM   1318 N  N     . LYS D 2 4  ? -8.682  28.891 -21.372 1.00 57.25 ? 4  LYS B N     1 
ATOM   1319 C  CA    . LYS D 2 4  ? -9.175  27.700 -20.716 1.00 54.51 ? 4  LYS B CA    1 
ATOM   1320 C  C     . LYS D 2 4  ? -8.010  26.807 -20.347 1.00 53.11 ? 4  LYS B C     1 
ATOM   1321 O  O     . LYS D 2 4  ? -8.013  26.197 -19.284 1.00 54.40 ? 4  LYS B O     1 
ATOM   1322 C  CB    . LYS D 2 4  ? -10.161 26.956 -21.619 1.00 53.92 ? 4  LYS B CB    1 
ATOM   1323 C  CG    . LYS D 2 4  ? -11.468 27.705 -21.823 1.00 53.48 ? 4  LYS B CG    1 
ATOM   1324 C  CD    . LYS D 2 4  ? -12.472 26.903 -22.632 1.00 52.28 ? 4  LYS B CD    1 
ATOM   1325 C  CE    . LYS D 2 4  ? -13.752 27.696 -22.839 1.00 51.19 ? 4  LYS B CE    1 
ATOM   1326 N  NZ    . LYS D 2 4  ? -14.706 26.956 -23.699 1.00 52.89 ? 4  LYS B NZ    1 
ATOM   1327 N  N     . LEU D 2 5  ? -7.004  26.735 -21.211 1.00 51.20 ? 5  LEU B N     1 
ATOM   1328 C  CA    . LEU D 2 5  ? -5.851  25.899 -20.918 1.00 49.32 ? 5  LEU B CA    1 
ATOM   1329 C  C     . LEU D 2 5  ? -5.131  26.399 -19.668 1.00 48.58 ? 5  LEU B C     1 
ATOM   1330 O  O     . LEU D 2 5  ? -4.765  25.611 -18.798 1.00 48.81 ? 5  LEU B O     1 
ATOM   1331 C  CB    . LEU D 2 5  ? -4.885  25.883 -22.093 1.00 49.59 ? 5  LEU B CB    1 
ATOM   1332 C  CG    . LEU D 2 5  ? -3.673  24.994 -21.838 1.00 49.48 ? 5  LEU B CG    1 
ATOM   1333 C  CD1   . LEU D 2 5  ? -4.141  23.577 -21.649 1.00 50.83 ? 5  LEU B CD1   1 
ATOM   1334 C  CD2   . LEU D 2 5  ? -2.716  25.072 -22.997 1.00 50.09 ? 5  LEU B CD2   1 
ATOM   1335 N  N     . ALA D 2 6  ? -4.930  27.710 -19.578 1.00 46.63 ? 6  ALA B N     1 
ATOM   1336 C  CA    . ALA D 2 6  ? -4.266  28.289 -18.422 1.00 44.82 ? 6  ALA B CA    1 
ATOM   1337 C  C     . ALA D 2 6  ? -5.121  28.021 -17.193 1.00 45.00 ? 6  ALA B C     1 
ATOM   1338 O  O     . ALA D 2 6  ? -4.618  27.695 -16.116 1.00 45.11 ? 6  ALA B O     1 
ATOM   1339 C  CB    . ALA D 2 6  ? -4.100  29.775 -18.618 1.00 45.34 ? 6  ALA B CB    1 
ATOM   1340 N  N     . LEU D 2 7  ? -6.428  28.163 -17.370 1.00 44.58 ? 7  LEU B N     1 
ATOM   1341 C  CA    . LEU D 2 7  ? -7.391  27.940 -16.302 1.00 44.00 ? 7  LEU B CA    1 
ATOM   1342 C  C     . LEU D 2 7  ? -7.185  26.584 -15.621 1.00 44.22 ? 7  LEU B C     1 
ATOM   1343 O  O     . LEU D 2 7  ? -7.298  26.471 -14.402 1.00 46.62 ? 7  LEU B O     1 
ATOM   1344 C  CB    . LEU D 2 7  ? -8.798  28.011 -16.878 1.00 43.18 ? 7  LEU B CB    1 
ATOM   1345 C  CG    . LEU D 2 7  ? -9.841  28.792 -16.092 1.00 43.50 ? 7  LEU B CG    1 
ATOM   1346 C  CD1   . LEU D 2 7  ? -9.278  30.144 -15.668 1.00 42.63 ? 7  LEU B CD1   1 
ATOM   1347 C  CD2   . LEU D 2 7  ? -11.073 28.961 -16.971 1.00 41.02 ? 7  LEU B CD2   1 
ATOM   1348 N  N     . ILE D 2 8  ? -6.878  25.558 -16.407 1.00 42.49 ? 8  ILE B N     1 
ATOM   1349 C  CA    . ILE D 2 8  ? -6.663  24.227 -15.866 1.00 40.77 ? 8  ILE B CA    1 
ATOM   1350 C  C     . ILE D 2 8  ? -5.230  24.001 -15.409 1.00 42.16 ? 8  ILE B C     1 
ATOM   1351 O  O     . ILE D 2 8  ? -4.992  23.283 -14.443 1.00 43.54 ? 8  ILE B O     1 
ATOM   1352 C  CB    . ILE D 2 8  ? -7.045  23.168 -16.899 1.00 39.41 ? 8  ILE B CB    1 
ATOM   1353 C  CG1   . ILE D 2 8  ? -8.562  23.100 -16.998 1.00 39.07 ? 8  ILE B CG1   1 
ATOM   1354 C  CG2   . ILE D 2 8  ? -6.486  21.818 -16.523 1.00 37.58 ? 8  ILE B CG2   1 
ATOM   1355 C  CD1   . ILE D 2 8  ? -9.033  22.334 -18.183 1.00 41.16 ? 8  ILE B CD1   1 
ATOM   1356 N  N     . GLN D 2 9  ? -4.272  24.618 -16.088 1.00 42.88 ? 9  GLN B N     1 
ATOM   1357 C  CA    . GLN D 2 9  ? -2.873  24.450 -15.711 1.00 42.79 ? 9  GLN B CA    1 
ATOM   1358 C  C     . GLN D 2 9  ? -2.558  25.058 -14.354 1.00 41.98 ? 9  GLN B C     1 
ATOM   1359 O  O     . GLN D 2 9  ? -1.678  24.583 -13.646 1.00 42.10 ? 9  GLN B O     1 
ATOM   1360 C  CB    . GLN D 2 9  ? -1.958  25.059 -16.771 1.00 43.37 ? 9  GLN B CB    1 
ATOM   1361 C  CG    . GLN D 2 9  ? -1.915  24.259 -18.038 1.00 46.79 ? 9  GLN B CG    1 
ATOM   1362 C  CD    . GLN D 2 9  ? -0.986  24.852 -19.072 1.00 50.63 ? 9  GLN B CD    1 
ATOM   1363 O  OE1   . GLN D 2 9  ? -1.114  26.021 -19.452 1.00 51.42 ? 9  GLN B OE1   1 
ATOM   1364 N  NE2   . GLN D 2 9  ? -0.045  24.042 -19.545 1.00 52.40 ? 9  GLN B NE2   1 
ATOM   1365 N  N     . GLU D 2 10 ? -3.288  26.098 -13.985 1.00 42.08 ? 10 GLU B N     1 
ATOM   1366 C  CA    . GLU D 2 10 ? -3.061  26.756 -12.708 1.00 42.63 ? 10 GLU B CA    1 
ATOM   1367 C  C     . GLU D 2 10 ? -3.618  25.998 -11.498 1.00 42.08 ? 10 GLU B C     1 
ATOM   1368 O  O     . GLU D 2 10 ? -3.262  26.303 -10.360 1.00 42.26 ? 10 GLU B O     1 
ATOM   1369 C  CB    . GLU D 2 10 ? -3.668  28.158 -12.748 1.00 44.91 ? 10 GLU B CB    1 
ATOM   1370 C  CG    . GLU D 2 10 ? -3.320  28.920 -14.022 1.00 49.00 ? 10 GLU B CG    1 
ATOM   1371 C  CD    . GLU D 2 10 ? -3.705  30.396 -13.978 1.00 51.44 ? 10 GLU B CD    1 
ATOM   1372 O  OE1   . GLU D 2 10 ? -3.540  31.079 -15.015 1.00 51.42 ? 10 GLU B OE1   1 
ATOM   1373 O  OE2   . GLU D 2 10 ? -4.165  30.872 -12.912 1.00 53.29 ? 10 GLU B OE2   1 
ATOM   1374 N  N     . LEU D 2 11 ? -4.477  25.008 -11.729 1.00 41.50 ? 11 LEU B N     1 
ATOM   1375 C  CA    . LEU D 2 11 ? -5.082  24.271 -10.620 1.00 39.73 ? 11 LEU B CA    1 
ATOM   1376 C  C     . LEU D 2 11 ? -4.140  23.816 -9.513  1.00 39.20 ? 11 LEU B C     1 
ATOM   1377 O  O     . LEU D 2 11 ? -4.239  24.303 -8.386  1.00 40.91 ? 11 LEU B O     1 
ATOM   1378 C  CB    . LEU D 2 11 ? -5.896  23.086 -11.138 1.00 38.43 ? 11 LEU B CB    1 
ATOM   1379 C  CG    . LEU D 2 11 ? -7.272  23.520 -11.631 1.00 37.62 ? 11 LEU B CG    1 
ATOM   1380 C  CD1   . LEU D 2 11 ? -8.014  22.354 -12.221 1.00 37.77 ? 11 LEU B CD1   1 
ATOM   1381 C  CD2   . LEU D 2 11 ? -8.038  24.106 -10.470 1.00 36.94 ? 11 LEU B CD2   1 
ATOM   1382 N  N     . PRO D 2 12 ? -3.217  22.885 -9.801  1.00 37.84 ? 12 PRO B N     1 
ATOM   1383 C  CA    . PRO D 2 12 ? -2.322  22.464 -8.716  1.00 38.53 ? 12 PRO B CA    1 
ATOM   1384 C  C     . PRO D 2 12 ? -1.697  23.623 -7.917  1.00 39.37 ? 12 PRO B C     1 
ATOM   1385 O  O     . PRO D 2 12 ? -1.544  23.535 -6.692  1.00 39.47 ? 12 PRO B O     1 
ATOM   1386 C  CB    . PRO D 2 12 ? -1.290  21.588 -9.435  1.00 37.75 ? 12 PRO B CB    1 
ATOM   1387 C  CG    . PRO D 2 12 ? -1.352  22.058 -10.852 1.00 38.09 ? 12 PRO B CG    1 
ATOM   1388 C  CD    . PRO D 2 12 ? -2.817  22.272 -11.074 1.00 36.85 ? 12 PRO B CD    1 
ATOM   1389 N  N     . ASP D 2 13 ? -1.356  24.713 -8.597  1.00 40.10 ? 13 ASP B N     1 
ATOM   1390 C  CA    . ASP D 2 13 ? -0.779  25.856 -7.909  1.00 40.97 ? 13 ASP B CA    1 
ATOM   1391 C  C     . ASP D 2 13 ? -1.830  26.600 -7.093  1.00 38.93 ? 13 ASP B C     1 
ATOM   1392 O  O     . ASP D 2 13 ? -1.588  26.950 -5.946  1.00 37.54 ? 13 ASP B O     1 
ATOM   1393 C  CB    . ASP D 2 13 ? -0.123  26.816 -8.902  1.00 48.61 ? 13 ASP B CB    1 
ATOM   1394 C  CG    . ASP D 2 13 ? 0.349   28.117 -8.240  1.00 56.29 ? 13 ASP B CG    1 
ATOM   1395 O  OD1   . ASP D 2 13 ? 1.016   28.940 -8.913  1.00 61.32 ? 13 ASP B OD1   1 
ATOM   1396 O  OD2   . ASP D 2 13 ? 0.051   28.327 -7.040  1.00 61.07 ? 13 ASP B OD2   1 
ATOM   1397 N  N     . ARG D 2 14 ? -2.997  26.857 -7.672  1.00 38.02 ? 14 ARG B N     1 
ATOM   1398 C  CA    . ARG D 2 14 ? -4.030  27.558 -6.920  1.00 36.53 ? 14 ARG B CA    1 
ATOM   1399 C  C     . ARG D 2 14 ? -4.413  26.749 -5.697  1.00 35.50 ? 14 ARG B C     1 
ATOM   1400 O  O     . ARG D 2 14 ? -4.841  27.318 -4.694  1.00 35.40 ? 14 ARG B O     1 
ATOM   1401 C  CB    . ARG D 2 14 ? -5.259  27.823 -7.788  1.00 37.55 ? 14 ARG B CB    1 
ATOM   1402 C  CG    . ARG D 2 14 ? -5.080  28.988 -8.731  1.00 38.09 ? 14 ARG B CG    1 
ATOM   1403 C  CD    . ARG D 2 14 ? -6.151  29.015 -9.808  1.00 41.32 ? 14 ARG B CD    1 
ATOM   1404 N  NE    . ARG D 2 14 ? -7.477  29.389 -9.317  1.00 42.67 ? 14 ARG B NE    1 
ATOM   1405 C  CZ    . ARG D 2 14 ? -7.776  30.566 -8.773  1.00 43.78 ? 14 ARG B CZ    1 
ATOM   1406 N  NH1   . ARG D 2 14 ? -6.845  31.499 -8.633  1.00 44.98 ? 14 ARG B NH1   1 
ATOM   1407 N  NH2   . ARG D 2 14 ? -9.018  30.823 -8.393  1.00 44.99 ? 14 ARG B NH2   1 
ATOM   1408 N  N     . ILE D 2 15 ? -4.247  25.427 -5.776  1.00 34.12 ? 15 ILE B N     1 
ATOM   1409 C  CA    . ILE D 2 15 ? -4.558  24.544 -4.651  1.00 33.83 ? 15 ILE B CA    1 
ATOM   1410 C  C     . ILE D 2 15 ? -3.487  24.614 -3.564  1.00 34.72 ? 15 ILE B C     1 
ATOM   1411 O  O     . ILE D 2 15 ? -3.807  24.686 -2.380  1.00 34.76 ? 15 ILE B O     1 
ATOM   1412 C  CB    . ILE D 2 15 ? -4.743  23.086 -5.121  1.00 33.09 ? 15 ILE B CB    1 
ATOM   1413 C  CG1   . ILE D 2 15 ? -6.053  22.983 -5.893  1.00 34.48 ? 15 ILE B CG1   1 
ATOM   1414 C  CG2   . ILE D 2 15 ? -4.783  22.141 -3.940  1.00 29.66 ? 15 ILE B CG2   1 
ATOM   1415 C  CD1   . ILE D 2 15 ? -6.420  21.605 -6.285  1.00 36.16 ? 15 ILE B CD1   1 
ATOM   1416 N  N     . GLN D 2 16 ? -2.219  24.601 -3.968  1.00 36.07 ? 16 GLN B N     1 
ATOM   1417 C  CA    . GLN D 2 16 ? -1.116  24.699 -3.025  1.00 36.42 ? 16 GLN B CA    1 
ATOM   1418 C  C     . GLN D 2 16 ? -1.345  25.961 -2.207  1.00 37.13 ? 16 GLN B C     1 
ATOM   1419 O  O     . GLN D 2 16 ? -1.234  25.940 -0.987  1.00 40.08 ? 16 GLN B O     1 
ATOM   1420 C  CB    . GLN D 2 16 ? 0.210   24.833 -3.770  1.00 39.53 ? 16 GLN B CB    1 
ATOM   1421 C  CG    . GLN D 2 16 ? 1.459   24.277 -3.067  1.00 43.42 ? 16 GLN B CG    1 
ATOM   1422 C  CD    . GLN D 2 16 ? 1.543   24.592 -1.570  1.00 47.06 ? 16 GLN B CD    1 
ATOM   1423 O  OE1   . GLN D 2 16 ? 1.103   23.795 -0.733  1.00 49.34 ? 16 GLN B OE1   1 
ATOM   1424 N  NE2   . GLN D 2 16 ? 2.110   25.753 -1.230  1.00 46.92 ? 16 GLN B NE2   1 
ATOM   1425 N  N     . THR D 2 17 ? -1.677  27.060 -2.882  1.00 37.01 ? 17 THR B N     1 
ATOM   1426 C  CA    . THR D 2 17 ? -1.903  28.350 -2.218  1.00 37.63 ? 17 THR B CA    1 
ATOM   1427 C  C     . THR D 2 17 ? -2.929  28.307 -1.092  1.00 39.34 ? 17 THR B C     1 
ATOM   1428 O  O     . THR D 2 17 ? -2.665  28.745 0.027   1.00 39.55 ? 17 THR B O     1 
ATOM   1429 C  CB    . THR D 2 17 ? -2.375  29.429 -3.220  1.00 36.89 ? 17 THR B CB    1 
ATOM   1430 O  OG1   . THR D 2 17 ? -1.382  29.625 -4.231  1.00 39.16 ? 17 THR B OG1   1 
ATOM   1431 C  CG2   . THR D 2 17 ? -2.601  30.736 -2.520  1.00 34.59 ? 17 THR B CG2   1 
ATOM   1432 N  N     . ALA D 2 18 ? -4.110  27.788 -1.404  1.00 40.81 ? 18 ALA B N     1 
ATOM   1433 C  CA    . ALA D 2 18 ? -5.202  27.701 -0.440  1.00 41.19 ? 18 ALA B CA    1 
ATOM   1434 C  C     . ALA D 2 18 ? -4.864  26.827 0.755   1.00 41.57 ? 18 ALA B C     1 
ATOM   1435 O  O     . ALA D 2 18 ? -5.436  26.985 1.842   1.00 41.66 ? 18 ALA B O     1 
ATOM   1436 C  CB    . ALA D 2 18 ? -6.444  27.159 -1.132  1.00 39.32 ? 18 ALA B CB    1 
ATOM   1437 N  N     . VAL D 2 19 ? -3.917  25.920 0.547   1.00 42.21 ? 19 VAL B N     1 
ATOM   1438 C  CA    . VAL D 2 19 ? -3.510  24.957 1.559   1.00 42.13 ? 19 VAL B CA    1 
ATOM   1439 C  C     . VAL D 2 19 ? -2.203  25.179 2.324   1.00 42.92 ? 19 VAL B C     1 
ATOM   1440 O  O     . VAL D 2 19 ? -2.065  24.689 3.441   1.00 43.34 ? 19 VAL B O     1 
ATOM   1441 C  CB    . VAL D 2 19 ? -3.477  23.549 0.923   1.00 41.57 ? 19 VAL B CB    1 
ATOM   1442 C  CG1   . VAL D 2 19 ? -2.622  22.611 1.730   1.00 42.44 ? 19 VAL B CG1   1 
ATOM   1443 C  CG2   . VAL D 2 19 ? -4.879  23.013 0.821   1.00 40.49 ? 19 VAL B CG2   1 
ATOM   1444 N  N     . GLU D 2 20 ? -1.251  25.916 1.764   1.00 44.03 ? 20 GLU B N     1 
ATOM   1445 C  CA    . GLU D 2 20 ? 0.013   26.074 2.469   1.00 45.44 ? 20 GLU B CA    1 
ATOM   1446 C  C     . GLU D 2 20 ? -0.049  26.697 3.851   1.00 43.32 ? 20 GLU B C     1 
ATOM   1447 O  O     . GLU D 2 20 ? 0.700   26.300 4.734   1.00 43.50 ? 20 GLU B O     1 
ATOM   1448 C  CB    . GLU D 2 20 ? 1.040   26.808 1.606   1.00 49.77 ? 20 GLU B CB    1 
ATOM   1449 C  CG    . GLU D 2 20 ? 0.682   28.222 1.213   1.00 57.97 ? 20 GLU B CG    1 
ATOM   1450 C  CD    . GLU D 2 20 ? 1.729   28.831 0.279   1.00 62.06 ? 20 GLU B CD    1 
ATOM   1451 O  OE1   . GLU D 2 20 ? 1.489   29.952 -0.237  1.00 63.60 ? 20 GLU B OE1   1 
ATOM   1452 O  OE2   . GLU D 2 20 ? 2.788   28.182 0.068   1.00 62.24 ? 20 GLU B OE2   1 
ATOM   1453 N  N     . ALA D 2 21 ? -0.933  27.655 4.067   1.00 42.74 ? 21 ALA B N     1 
ATOM   1454 C  CA    . ALA D 2 21 ? -1.014  28.259 5.396   1.00 41.99 ? 21 ALA B CA    1 
ATOM   1455 C  C     . ALA D 2 21 ? -1.263  27.205 6.471   1.00 41.45 ? 21 ALA B C     1 
ATOM   1456 O  O     . ALA D 2 21 ? -0.487  27.069 7.412   1.00 41.40 ? 21 ALA B O     1 
ATOM   1457 C  CB    . ALA D 2 21 ? -2.117  29.299 5.436   1.00 42.96 ? 21 ALA B CB    1 
ATOM   1458 N  N     . ALA D 2 22 ? -2.354  26.462 6.328   1.00 41.91 ? 22 ALA B N     1 
ATOM   1459 C  CA    . ALA D 2 22 ? -2.706  25.424 7.291   1.00 41.82 ? 22 ALA B CA    1 
ATOM   1460 C  C     . ALA D 2 22 ? -1.606  24.382 7.418   1.00 42.21 ? 22 ALA B C     1 
ATOM   1461 O  O     . ALA D 2 22 ? -1.282  23.928 8.518   1.00 43.97 ? 22 ALA B O     1 
ATOM   1462 C  CB    . ALA D 2 22 ? -4.012  24.749 6.878   1.00 41.69 ? 22 ALA B CB    1 
ATOM   1463 N  N     . MET D 2 23 ? -1.014  24.008 6.296   1.00 41.84 ? 23 MET B N     1 
ATOM   1464 C  CA    . MET D 2 23 ? 0.023   22.998 6.329   1.00 42.44 ? 23 MET B CA    1 
ATOM   1465 C  C     . MET D 2 23 ? 1.365   23.433 6.883   1.00 42.54 ? 23 MET B C     1 
ATOM   1466 O  O     . MET D 2 23 ? 2.175   22.598 7.280   1.00 43.59 ? 23 MET B O     1 
ATOM   1467 C  CB    . MET D 2 23 ? 0.190   22.416 4.944   1.00 42.30 ? 23 MET B CB    1 
ATOM   1468 C  CG    . MET D 2 23 ? -1.068  21.755 4.485   1.00 42.96 ? 23 MET B CG    1 
ATOM   1469 S  SD    . MET D 2 23 ? -0.685  20.395 3.434   1.00 48.86 ? 23 MET B SD    1 
ATOM   1470 C  CE    . MET D 2 23 ? -0.299  19.118 4.641   1.00 46.33 ? 23 MET B CE    1 
ATOM   1471 N  N     . GLY D 2 24 ? 1.615   24.733 6.908   1.00 42.57 ? 24 GLY B N     1 
ATOM   1472 C  CA    . GLY D 2 24 ? 2.875   25.203 7.448   1.00 42.77 ? 24 GLY B CA    1 
ATOM   1473 C  C     . GLY D 2 24 ? 2.749   25.249 8.954   1.00 43.12 ? 24 GLY B C     1 
ATOM   1474 O  O     . GLY D 2 24 ? 3.740   25.239 9.684   1.00 43.52 ? 24 GLY B O     1 
ATOM   1475 N  N     . MET D 2 25 ? 1.501   25.293 9.411   1.00 43.98 ? 25 MET B N     1 
ATOM   1476 C  CA    . MET D 2 25 ? 1.175   25.347 10.833  1.00 42.86 ? 25 MET B CA    1 
ATOM   1477 C  C     . MET D 2 25 ? 1.821   24.215 11.604  1.00 42.28 ? 25 MET B C     1 
ATOM   1478 O  O     . MET D 2 25 ? 1.797   23.063 11.172  1.00 41.14 ? 25 MET B O     1 
ATOM   1479 C  CB    . MET D 2 25 ? -0.341  25.279 11.023  1.00 42.90 ? 25 MET B CB    1 
ATOM   1480 C  CG    . MET D 2 25 ? -0.789  25.159 12.468  1.00 43.77 ? 25 MET B CG    1 
ATOM   1481 S  SD    . MET D 2 25 ? -2.582  24.983 12.629  1.00 47.91 ? 25 MET B SD    1 
ATOM   1482 C  CE    . MET D 2 25 ? -2.733  23.245 13.049  1.00 43.88 ? 25 MET B CE    1 
ATOM   1483 N  N     . SER D 2 26 ? 2.392   24.554 12.755  1.00 41.97 ? 26 SER B N     1 
ATOM   1484 C  CA    . SER D 2 26 ? 3.030   23.561 13.601  1.00 42.98 ? 26 SER B CA    1 
ATOM   1485 C  C     . SER D 2 26 ? 2.119   23.211 14.773  1.00 42.77 ? 26 SER B C     1 
ATOM   1486 O  O     . SER D 2 26 ? 1.479   24.081 15.367  1.00 43.33 ? 26 SER B O     1 
ATOM   1487 C  CB    . SER D 2 26 ? 4.357   24.087 14.136  1.00 43.05 ? 26 SER B CB    1 
ATOM   1488 O  OG    . SER D 2 26 ? 4.136   25.239 14.919  1.00 44.68 ? 26 SER B OG    1 
ATOM   1489 N  N     . TYR D 2 27 ? 2.065   21.929 15.102  1.00 41.34 ? 27 TYR B N     1 
ATOM   1490 C  CA    . TYR D 2 27 ? 1.239   21.470 16.204  1.00 40.18 ? 27 TYR B CA    1 
ATOM   1491 C  C     . TYR D 2 27 ? 2.021   20.419 16.984  1.00 39.98 ? 27 TYR B C     1 
ATOM   1492 O  O     . TYR D 2 27 ? 1.445   19.512 17.588  1.00 40.34 ? 27 TYR B O     1 
ATOM   1493 C  CB    . TYR D 2 27 ? -0.066  20.892 15.649  1.00 38.79 ? 27 TYR B CB    1 
ATOM   1494 C  CG    . TYR D 2 27 ? 0.139   19.899 14.527  1.00 36.28 ? 27 TYR B CG    1 
ATOM   1495 C  CD1   . TYR D 2 27 ? 0.420   18.566 14.797  1.00 35.99 ? 27 TYR B CD1   1 
ATOM   1496 C  CD2   . TYR D 2 27 ? 0.069   20.298 13.196  1.00 35.41 ? 27 TYR B CD2   1 
ATOM   1497 C  CE1   . TYR D 2 27 ? 0.626   17.653 13.769  1.00 35.60 ? 27 TYR B CE1   1 
ATOM   1498 C  CE2   . TYR D 2 27 ? 0.276   19.394 12.162  1.00 34.45 ? 27 TYR B CE2   1 
ATOM   1499 C  CZ    . TYR D 2 27 ? 0.555   18.073 12.458  1.00 34.83 ? 27 TYR B CZ    1 
ATOM   1500 O  OH    . TYR D 2 27 ? 0.782   17.168 11.448  1.00 34.82 ? 27 TYR B OH    1 
ATOM   1501 N  N     . GLN D 2 28 ? 3.342   20.566 16.978  1.00 39.21 ? 28 GLN B N     1 
ATOM   1502 C  CA    . GLN D 2 28 ? 4.205   19.623 17.654  1.00 39.44 ? 28 GLN B CA    1 
ATOM   1503 C  C     . GLN D 2 28 ? 4.233   19.801 19.160  1.00 40.51 ? 28 GLN B C     1 
ATOM   1504 O  O     . GLN D 2 28 ? 4.903   19.057 19.870  1.00 42.07 ? 28 GLN B O     1 
ATOM   1505 C  CB    . GLN D 2 28 ? 5.607   19.700 17.056  1.00 39.49 ? 28 GLN B CB    1 
ATOM   1506 C  CG    . GLN D 2 28 ? 5.631   19.239 15.613  1.00 42.99 ? 28 GLN B CG    1 
ATOM   1507 C  CD    . GLN D 2 28 ? 5.067   17.819 15.438  1.00 45.70 ? 28 GLN B CD    1 
ATOM   1508 O  OE1   . GLN D 2 28 ? 4.411   17.506 14.433  1.00 45.63 ? 28 GLN B OE1   1 
ATOM   1509 N  NE2   . GLN D 2 28 ? 5.330   16.954 16.415  1.00 45.48 ? 28 GLN B NE2   1 
ATOM   1510 N  N     . ASP D 2 29 ? 3.484   20.776 19.653  1.00 40.74 ? 29 ASP B N     1 
ATOM   1511 C  CA    . ASP D 2 29 ? 3.426   21.017 21.081  1.00 41.05 ? 29 ASP B CA    1 
ATOM   1512 C  C     . ASP D 2 29 ? 2.087   20.532 21.600  1.00 40.03 ? 29 ASP B C     1 
ATOM   1513 O  O     . ASP D 2 29 ? 1.844   20.527 22.801  1.00 43.19 ? 29 ASP B O     1 
ATOM   1514 C  CB    . ASP D 2 29 ? 3.595   22.507 21.378  1.00 44.55 ? 29 ASP B CB    1 
ATOM   1515 C  CG    . ASP D 2 29 ? 2.435   23.345 20.863  1.00 49.01 ? 29 ASP B CG    1 
ATOM   1516 O  OD1   . ASP D 2 29 ? 1.971   23.107 19.727  1.00 51.16 ? 29 ASP B OD1   1 
ATOM   1517 O  OD2   . ASP D 2 29 ? 1.992   24.258 21.594  1.00 52.47 ? 29 ASP B OD2   1 
ATOM   1518 N  N     . ALA D 2 30 ? 1.221   20.106 20.691  1.00 37.76 ? 30 ALA B N     1 
ATOM   1519 C  CA    . ALA D 2 30 ? -0.104  19.617 21.064  1.00 36.64 ? 30 ALA B CA    1 
ATOM   1520 C  C     . ALA D 2 30 ? -0.080  18.184 21.596  1.00 35.01 ? 30 ALA B C     1 
ATOM   1521 O  O     . ALA D 2 30 ? 0.910   17.475 21.446  1.00 36.39 ? 30 ALA B O     1 
ATOM   1522 C  CB    . ALA D 2 30 ? -1.038  19.702 19.852  1.00 36.15 ? 30 ALA B CB    1 
ATOM   1523 N  N     . PRO D 2 31 ? -1.178  17.743 22.233  1.00 33.79 ? 31 PRO B N     1 
ATOM   1524 C  CA    . PRO D 2 31 ? -1.284  16.389 22.778  1.00 34.02 ? 31 PRO B CA    1 
ATOM   1525 C  C     . PRO D 2 31 ? -1.178  15.323 21.682  1.00 35.40 ? 31 PRO B C     1 
ATOM   1526 O  O     . PRO D 2 31 ? -1.428  15.592 20.507  1.00 35.69 ? 31 PRO B O     1 
ATOM   1527 C  CB    . PRO D 2 31 ? -2.655  16.404 23.438  1.00 32.59 ? 31 PRO B CB    1 
ATOM   1528 C  CG    . PRO D 2 31 ? -2.770  17.795 23.906  1.00 29.99 ? 31 PRO B CG    1 
ATOM   1529 C  CD    . PRO D 2 31 ? -2.301  18.564 22.709  1.00 32.51 ? 31 PRO B CD    1 
ATOM   1530 N  N     . ASN D 2 32 ? -0.829  14.103 22.065  1.00 37.33 ? 32 ASN B N     1 
ATOM   1531 C  CA    . ASN D 2 32 ? -0.683  13.040 21.083  1.00 38.63 ? 32 ASN B CA    1 
ATOM   1532 C  C     . ASN D 2 32 ? -1.916  12.776 20.216  1.00 37.70 ? 32 ASN B C     1 
ATOM   1533 O  O     . ASN D 2 32 ? -1.786  12.590 19.015  1.00 38.97 ? 32 ASN B O     1 
ATOM   1534 C  CB    . ASN D 2 32 ? -0.236  11.748 21.766  1.00 41.36 ? 32 ASN B CB    1 
ATOM   1535 C  CG    . ASN D 2 32 ? 0.155   10.664 20.766  1.00 47.87 ? 32 ASN B CG    1 
ATOM   1536 O  OD1   . ASN D 2 32 ? -0.701  10.003 20.161  1.00 50.27 ? 32 ASN B OD1   1 
ATOM   1537 N  ND2   . ASN D 2 32 ? 1.459   10.485 20.577  1.00 50.99 ? 32 ASN B ND2   1 
ATOM   1538 N  N     . ASN D 2 33 ? -3.110  12.764 20.791  1.00 37.87 ? 33 ASN B N     1 
ATOM   1539 C  CA    . ASN D 2 33 ? -4.284  12.490 19.975  1.00 37.87 ? 33 ASN B CA    1 
ATOM   1540 C  C     . ASN D 2 33 ? -4.573  13.625 19.012  1.00 37.98 ? 33 ASN B C     1 
ATOM   1541 O  O     . ASN D 2 33 ? -4.987  13.383 17.876  1.00 38.85 ? 33 ASN B O     1 
ATOM   1542 C  CB    . ASN D 2 33 ? -5.508  12.174 20.843  1.00 39.66 ? 33 ASN B CB    1 
ATOM   1543 C  CG    . ASN D 2 33 ? -5.935  13.333 21.698  1.00 42.37 ? 33 ASN B CG    1 
ATOM   1544 O  OD1   . ASN D 2 33 ? -5.124  13.936 22.405  1.00 44.24 ? 33 ASN B OD1   1 
ATOM   1545 N  ND2   . ASN D 2 33 ? -7.226  13.648 21.655  1.00 44.25 ? 33 ASN B ND2   1 
ATOM   1546 N  N     . VAL D 2 34 ? -4.341  14.859 19.445  1.00 37.23 ? 34 VAL B N     1 
ATOM   1547 C  CA    . VAL D 2 34 ? -4.553  16.005 18.569  1.00 37.00 ? 34 VAL B CA    1 
ATOM   1548 C  C     . VAL D 2 34 ? -3.489  15.974 17.473  1.00 38.59 ? 34 VAL B C     1 
ATOM   1549 O  O     . VAL D 2 34 ? -3.770  16.294 16.320  1.00 39.79 ? 34 VAL B O     1 
ATOM   1550 C  CB    . VAL D 2 34 ? -4.436  17.343 19.330  1.00 37.29 ? 34 VAL B CB    1 
ATOM   1551 C  CG1   . VAL D 2 34 ? -4.418  18.500 18.347  1.00 36.86 ? 34 VAL B CG1   1 
ATOM   1552 C  CG2   . VAL D 2 34 ? -5.607  17.504 20.287  1.00 38.34 ? 34 VAL B CG2   1 
ATOM   1553 N  N     . ARG D 2 35 ? -2.264  15.595 17.835  1.00 38.78 ? 35 ARG B N     1 
ATOM   1554 C  CA    . ARG D 2 35 ? -1.184  15.509 16.863  1.00 38.41 ? 35 ARG B CA    1 
ATOM   1555 C  C     . ARG D 2 35 ? -1.520  14.483 15.794  1.00 38.00 ? 35 ARG B C     1 
ATOM   1556 O  O     . ARG D 2 35 ? -1.158  14.638 14.631  1.00 39.16 ? 35 ARG B O     1 
ATOM   1557 C  CB    . ARG D 2 35 ? 0.120   15.114 17.544  1.00 40.33 ? 35 ARG B CB    1 
ATOM   1558 C  CG    . ARG D 2 35 ? 1.058   16.267 17.806  1.00 43.01 ? 35 ARG B CG    1 
ATOM   1559 C  CD    . ARG D 2 35 ? 2.379   15.756 18.345  1.00 45.39 ? 35 ARG B CD    1 
ATOM   1560 N  NE    . ARG D 2 35 ? 2.266   15.378 19.746  1.00 48.18 ? 35 ARG B NE    1 
ATOM   1561 C  CZ    . ARG D 2 35 ? 2.804   14.283 20.264  1.00 49.18 ? 35 ARG B CZ    1 
ATOM   1562 N  NH1   . ARG D 2 35 ? 3.492   13.453 19.489  1.00 49.94 ? 35 ARG B NH1   1 
ATOM   1563 N  NH2   . ARG D 2 35 ? 2.658   14.023 21.557  1.00 49.48 ? 35 ARG B NH2   1 
ATOM   1564 N  N     . ARG D 2 36 ? -2.215  13.429 16.186  1.00 37.29 ? 36 ARG B N     1 
ATOM   1565 C  CA    . ARG D 2 36 ? -2.588  12.400 15.235  1.00 38.45 ? 36 ARG B CA    1 
ATOM   1566 C  C     . ARG D 2 36 ? -3.654  12.866 14.267  1.00 38.00 ? 36 ARG B C     1 
ATOM   1567 O  O     . ARG D 2 36 ? -3.590  12.576 13.077  1.00 38.32 ? 36 ARG B O     1 
ATOM   1568 C  CB    . ARG D 2 36 ? -3.051  11.159 15.976  1.00 40.51 ? 36 ARG B CB    1 
ATOM   1569 C  CG    . ARG D 2 36 ? -1.884  10.389 16.525  1.00 43.20 ? 36 ARG B CG    1 
ATOM   1570 C  CD    . ARG D 2 36 ? -2.300  9.236  17.380  1.00 45.93 ? 36 ARG B CD    1 
ATOM   1571 N  NE    . ARG D 2 36 ? -1.210  8.276  17.489  1.00 49.84 ? 36 ARG B NE    1 
ATOM   1572 C  CZ    . ARG D 2 36 ? -1.209  7.238  18.315  1.00 51.51 ? 36 ARG B CZ    1 
ATOM   1573 N  NH1   . ARG D 2 36 ? -2.247  7.026  19.116  1.00 52.75 ? 36 ARG B NH1   1 
ATOM   1574 N  NH2   . ARG D 2 36 ? -0.178  6.404  18.323  1.00 53.15 ? 36 ARG B NH2   1 
ATOM   1575 N  N     . ASP D 2 37 ? -4.640  13.595 14.768  1.00 37.79 ? 37 ASP B N     1 
ATOM   1576 C  CA    . ASP D 2 37 ? -5.690  14.088 13.890  1.00 36.85 ? 37 ASP B CA    1 
ATOM   1577 C  C     . ASP D 2 37 ? -5.128  15.106 12.906  1.00 34.61 ? 37 ASP B C     1 
ATOM   1578 O  O     . ASP D 2 37 ? -5.496  15.100 11.737  1.00 36.12 ? 37 ASP B O     1 
ATOM   1579 C  CB    . ASP D 2 37 ? -6.841  14.681 14.710  1.00 39.37 ? 37 ASP B CB    1 
ATOM   1580 C  CG    . ASP D 2 37 ? -7.539  13.626 15.570  1.00 43.80 ? 37 ASP B CG    1 
ATOM   1581 O  OD1   . ASP D 2 37 ? -7.932  12.579 15.002  1.00 45.76 ? 37 ASP B OD1   1 
ATOM   1582 O  OD2   . ASP D 2 37 ? -7.696  13.829 16.804  1.00 45.53 ? 37 ASP B OD2   1 
ATOM   1583 N  N     . LEU D 2 38 ? -4.221  15.967 13.359  1.00 32.06 ? 38 LEU B N     1 
ATOM   1584 C  CA    . LEU D 2 38 ? -3.642  16.950 12.455  1.00 29.81 ? 38 LEU B CA    1 
ATOM   1585 C  C     . LEU D 2 38 ? -2.674  16.288 11.462  1.00 30.23 ? 38 LEU B C     1 
ATOM   1586 O  O     . LEU D 2 38 ? -2.390  16.842 10.402  1.00 30.67 ? 38 LEU B O     1 
ATOM   1587 C  CB    . LEU D 2 38 ? -2.984  18.079 13.246  1.00 28.39 ? 38 LEU B CB    1 
ATOM   1588 C  CG    . LEU D 2 38 ? -4.018  18.890 14.048  1.00 27.94 ? 38 LEU B CG    1 
ATOM   1589 C  CD1   . LEU D 2 38 ? -3.339  19.847 14.996  1.00 26.43 ? 38 LEU B CD1   1 
ATOM   1590 C  CD2   . LEU D 2 38 ? -4.921  19.644 13.100  1.00 26.05 ? 38 LEU B CD2   1 
ATOM   1591 N  N     . ASP D 2 39 ? -2.171  15.098 11.779  1.00 30.03 ? 39 ASP B N     1 
ATOM   1592 C  CA    . ASP D 2 39 ? -1.325  14.409 10.812  1.00 29.48 ? 39 ASP B CA    1 
ATOM   1593 C  C     . ASP D 2 39 ? -2.274  13.853 9.788   1.00 28.81 ? 39 ASP B C     1 
ATOM   1594 O  O     . ASP D 2 39 ? -1.964  13.812 8.598   1.00 29.54 ? 39 ASP B O     1 
ATOM   1595 C  CB    . ASP D 2 39 ? -0.573  13.235 11.413  1.00 31.88 ? 39 ASP B CB    1 
ATOM   1596 C  CG    . ASP D 2 39 ? 0.646   13.662 12.151  1.00 36.11 ? 39 ASP B CG    1 
ATOM   1597 O  OD1   . ASP D 2 39 ? 1.093   14.806 11.919  1.00 37.51 ? 39 ASP B OD1   1 
ATOM   1598 O  OD2   . ASP D 2 39 ? 1.168   12.853 12.951  1.00 39.65 ? 39 ASP B OD2   1 
ATOM   1599 N  N     . ASN D 2 40 ? -3.438  13.411 10.250  1.00 27.31 ? 40 ASN B N     1 
ATOM   1600 C  CA    . ASN D 2 40 ? -4.396  12.859 9.326   1.00 27.35 ? 40 ASN B CA    1 
ATOM   1601 C  C     . ASN D 2 40 ? -4.898  13.975 8.431   1.00 27.85 ? 40 ASN B C     1 
ATOM   1602 O  O     . ASN D 2 40 ? -5.244  13.737 7.266   1.00 28.12 ? 40 ASN B O     1 
ATOM   1603 C  CB    . ASN D 2 40 ? -5.547  12.192 10.059  1.00 28.86 ? 40 ASN B CB    1 
ATOM   1604 C  CG    . ASN D 2 40 ? -6.206  11.114 9.221   1.00 32.01 ? 40 ASN B CG    1 
ATOM   1605 O  OD1   . ASN D 2 40 ? -7.158  10.462 9.655   1.00 33.33 ? 40 ASN B OD1   1 
ATOM   1606 N  ND2   . ASN D 2 40 ? -5.696  10.919 8.003   1.00 31.08 ? 40 ASN B ND2   1 
ATOM   1607 N  N     . LEU D 2 41 ? -4.926  15.196 8.968   1.00 27.62 ? 41 LEU B N     1 
ATOM   1608 C  CA    . LEU D 2 41 ? -5.343  16.363 8.188   1.00 27.80 ? 41 LEU B CA    1 
ATOM   1609 C  C     . LEU D 2 41 ? -4.319  16.484 7.056   1.00 30.03 ? 41 LEU B C     1 
ATOM   1610 O  O     . LEU D 2 41 ? -4.676  16.505 5.880   1.00 31.34 ? 41 LEU B O     1 
ATOM   1611 C  CB    . LEU D 2 41 ? -5.295  17.627 9.039   1.00 26.34 ? 41 LEU B CB    1 
ATOM   1612 C  CG    . LEU D 2 41 ? -6.122  18.861 8.655   1.00 26.63 ? 41 LEU B CG    1 
ATOM   1613 C  CD1   . LEU D 2 41 ? -5.271  20.096 8.883   1.00 24.99 ? 41 LEU B CD1   1 
ATOM   1614 C  CD2   . LEU D 2 41 ? -6.607  18.799 7.212   1.00 25.74 ? 41 LEU B CD2   1 
ATOM   1615 N  N     . HIS D 2 42 ? -3.039  16.550 7.424   1.00 30.67 ? 42 HIS B N     1 
ATOM   1616 C  CA    . HIS D 2 42 ? -1.959  16.640 6.448   1.00 30.09 ? 42 HIS B CA    1 
ATOM   1617 C  C     . HIS D 2 42 ? -2.010  15.536 5.423   1.00 29.84 ? 42 HIS B C     1 
ATOM   1618 O  O     . HIS D 2 42 ? -1.783  15.774 4.243   1.00 31.28 ? 42 HIS B O     1 
ATOM   1619 C  CB    . HIS D 2 42 ? -0.601  16.567 7.134   1.00 31.74 ? 42 HIS B CB    1 
ATOM   1620 C  CG    . HIS D 2 42 ? -0.100  17.889 7.602   1.00 33.06 ? 42 HIS B CG    1 
ATOM   1621 N  ND1   . HIS D 2 42 ? 1.097   18.415 7.180   1.00 33.58 ? 42 HIS B ND1   1 
ATOM   1622 C  CD2   . HIS D 2 42 ? -0.658  18.815 8.418   1.00 34.08 ? 42 HIS B CD2   1 
ATOM   1623 C  CE1   . HIS D 2 42 ? 1.256   19.612 7.716   1.00 36.28 ? 42 HIS B CE1   1 
ATOM   1624 N  NE2   . HIS D 2 42 ? 0.205   19.878 8.471   1.00 34.95 ? 42 HIS B NE2   1 
ATOM   1625 N  N     . ALA D 2 43 ? -2.276  14.318 5.873   1.00 29.98 ? 43 ALA B N     1 
ATOM   1626 C  CA    . ALA D 2 43 ? -2.340  13.186 4.964   1.00 28.76 ? 43 ALA B CA    1 
ATOM   1627 C  C     . ALA D 2 43 ? -3.463  13.435 3.981   1.00 29.70 ? 43 ALA B C     1 
ATOM   1628 O  O     . ALA D 2 43 ? -3.316  13.245 2.774   1.00 31.52 ? 43 ALA B O     1 
ATOM   1629 C  CB    . ALA D 2 43 ? -2.603  11.926 5.741   1.00 28.23 ? 43 ALA B CB    1 
ATOM   1630 N  N     . CYS D 2 44 ? -4.584  13.892 4.514   1.00 29.21 ? 44 CYS B N     1 
ATOM   1631 C  CA    . CYS D 2 44 ? -5.758  14.165 3.711   1.00 29.99 ? 44 CYS B CA    1 
ATOM   1632 C  C     . CYS D 2 44 ? -5.521  15.233 2.646   1.00 30.65 ? 44 CYS B C     1 
ATOM   1633 O  O     . CYS D 2 44 ? -5.838  15.030 1.471   1.00 32.05 ? 44 CYS B O     1 
ATOM   1634 C  CB    . CYS D 2 44 ? -6.909  14.574 4.632   1.00 30.29 ? 44 CYS B CB    1 
ATOM   1635 S  SG    . CYS D 2 44 ? -8.432  14.917 3.759   1.00 34.20 ? 44 CYS B SG    1 
ATOM   1636 N  N     . LEU D 2 45 ? -4.966  16.374 3.052   1.00 31.41 ? 45 LEU B N     1 
ATOM   1637 C  CA    . LEU D 2 45 ? -4.695  17.463 2.118   1.00 30.14 ? 45 LEU B CA    1 
ATOM   1638 C  C     . LEU D 2 45 ? -3.631  17.103 1.092   1.00 30.99 ? 45 LEU B C     1 
ATOM   1639 O  O     . LEU D 2 45 ? -3.716  17.550 -0.047  1.00 31.91 ? 45 LEU B O     1 
ATOM   1640 C  CB    . LEU D 2 45 ? -4.281  18.724 2.868   1.00 29.76 ? 45 LEU B CB    1 
ATOM   1641 C  CG    . LEU D 2 45 ? -5.385  19.372 3.712   1.00 30.12 ? 45 LEU B CG    1 
ATOM   1642 C  CD1   . LEU D 2 45 ? -4.781  20.487 4.551   1.00 29.73 ? 45 LEU B CD1   1 
ATOM   1643 C  CD2   . LEU D 2 45 ? -6.506  19.913 2.814   1.00 28.53 ? 45 LEU B CD2   1 
ATOM   1644 N  N     . ASN D 2 46 ? -2.633  16.304 1.469   1.00 29.98 ? 46 ASN B N     1 
ATOM   1645 C  CA    . ASN D 2 46 ? -1.614  15.922 0.494   1.00 31.48 ? 46 ASN B CA    1 
ATOM   1646 C  C     . ASN D 2 46 ? -2.198  15.009 -0.566  1.00 33.18 ? 46 ASN B C     1 
ATOM   1647 O  O     . ASN D 2 46 ? -1.691  14.940 -1.696  1.00 33.47 ? 46 ASN B O     1 
ATOM   1648 C  CB    . ASN D 2 46 ? -0.431  15.226 1.155   1.00 32.17 ? 46 ASN B CB    1 
ATOM   1649 C  CG    . ASN D 2 46 ? 0.503   16.198 1.816   1.00 33.74 ? 46 ASN B CG    1 
ATOM   1650 O  OD1   . ASN D 2 46 ? 0.769   17.275 1.277   1.00 34.24 ? 46 ASN B OD1   1 
ATOM   1651 N  ND2   . ASN D 2 46 ? 1.019   15.831 2.988   1.00 34.90 ? 46 ASN B ND2   1 
ATOM   1652 N  N     . LYS D 2 47 ? -3.265  14.298 -0.207  1.00 34.36 ? 47 LYS B N     1 
ATOM   1653 C  CA    . LYS D 2 47 ? -3.903  13.412 -1.166  1.00 33.90 ? 47 LYS B CA    1 
ATOM   1654 C  C     . LYS D 2 47 ? -4.764  14.217 -2.116  1.00 33.93 ? 47 LYS B C     1 
ATOM   1655 O  O     . LYS D 2 47 ? -4.854  13.889 -3.297  1.00 35.78 ? 47 LYS B O     1 
ATOM   1656 C  CB    . LYS D 2 47 ? -4.763  12.364 -0.478  1.00 33.83 ? 47 LYS B CB    1 
ATOM   1657 C  CG    . LYS D 2 47 ? -5.313  11.362 -1.463  1.00 35.34 ? 47 LYS B CG    1 
ATOM   1658 C  CD    . LYS D 2 47 ? -6.139  10.316 -0.771  1.00 40.39 ? 47 LYS B CD    1 
ATOM   1659 C  CE    . LYS D 2 47 ? -6.763  9.371  -1.778  1.00 42.45 ? 47 LYS B CE    1 
ATOM   1660 N  NZ    . LYS D 2 47 ? -5.728  8.566  -2.468  1.00 44.11 ? 47 LYS B NZ    1 
ATOM   1661 N  N     . ALA D 2 48 ? -5.400  15.269 -1.607  1.00 33.34 ? 48 ALA B N     1 
ATOM   1662 C  CA    . ALA D 2 48 ? -6.235  16.109 -2.458  1.00 33.56 ? 48 ALA B CA    1 
ATOM   1663 C  C     . ALA D 2 48 ? -5.351  16.792 -3.493  1.00 34.24 ? 48 ALA B C     1 
ATOM   1664 O  O     . ALA D 2 48 ? -5.674  16.799 -4.676  1.00 36.43 ? 48 ALA B O     1 
ATOM   1665 C  CB    . ALA D 2 48 ? -6.972  17.142 -1.632  1.00 32.80 ? 48 ALA B CB    1 
ATOM   1666 N  N     . LYS D 2 49 ? -4.235  17.363 -3.053  1.00 34.98 ? 49 LYS B N     1 
ATOM   1667 C  CA    . LYS D 2 49 ? -3.316  18.021 -3.975  1.00 36.00 ? 49 LYS B CA    1 
ATOM   1668 C  C     . LYS D 2 49 ? -2.817  17.023 -5.008  1.00 36.22 ? 49 LYS B C     1 
ATOM   1669 O  O     . LYS D 2 49 ? -2.767  17.337 -6.202  1.00 38.40 ? 49 LYS B O     1 
ATOM   1670 C  CB    . LYS D 2 49 ? -2.091  18.581 -3.252  1.00 37.65 ? 49 LYS B CB    1 
ATOM   1671 C  CG    . LYS D 2 49 ? -2.344  19.726 -2.299  1.00 40.93 ? 49 LYS B CG    1 
ATOM   1672 C  CD    . LYS D 2 49 ? -1.022  20.203 -1.708  1.00 43.87 ? 49 LYS B CD    1 
ATOM   1673 C  CE    . LYS D 2 49 ? -0.079  20.670 -2.814  1.00 47.51 ? 49 LYS B CE    1 
ATOM   1674 N  NZ    . LYS D 2 49 ? 1.196   21.183 -2.238  1.00 50.87 ? 49 LYS B NZ    1 
ATOM   1675 N  N     . LEU D 2 50 ? -2.424  15.833 -4.551  1.00 34.33 ? 50 LEU B N     1 
ATOM   1676 C  CA    . LEU D 2 50 ? -1.928  14.809 -5.460  1.00 33.25 ? 50 LEU B CA    1 
ATOM   1677 C  C     . LEU D 2 50 ? -2.974  14.321 -6.442  1.00 32.57 ? 50 LEU B C     1 
ATOM   1678 O  O     . LEU D 2 50 ? -2.648  14.083 -7.599  1.00 32.72 ? 50 LEU B O     1 
ATOM   1679 C  CB    . LEU D 2 50 ? -1.359  13.620 -4.691  1.00 35.84 ? 50 LEU B CB    1 
ATOM   1680 C  CG    . LEU D 2 50 ? -0.008  13.860 -4.011  1.00 37.98 ? 50 LEU B CG    1 
ATOM   1681 C  CD1   . LEU D 2 50 ? 0.471   12.569 -3.356  1.00 37.37 ? 50 LEU B CD1   1 
ATOM   1682 C  CD2   . LEU D 2 50 ? 1.000   14.350 -5.043  1.00 36.13 ? 50 LEU B CD2   1 
ATOM   1683 N  N     . THR D 2 51 ? -4.218  14.157 -5.991  1.00 31.40 ? 51 THR B N     1 
ATOM   1684 C  CA    . THR D 2 51 ? -5.297  13.719 -6.883  1.00 31.83 ? 51 THR B CA    1 
ATOM   1685 C  C     . THR D 2 51 ? -5.504  14.735 -7.979  1.00 31.38 ? 51 THR B C     1 
ATOM   1686 O  O     . THR D 2 51 ? -5.500  14.394 -9.144  1.00 32.32 ? 51 THR B O     1 
ATOM   1687 C  CB    . THR D 2 51 ? -6.653  13.574 -6.167  1.00 32.63 ? 51 THR B CB    1 
ATOM   1688 O  OG1   . THR D 2 51 ? -6.625  12.425 -5.320  1.00 36.29 ? 51 THR B OG1   1 
ATOM   1689 C  CG2   . THR D 2 51 ? -7.768  13.408 -7.174  1.00 29.51 ? 51 THR B CG2   1 
ATOM   1690 N  N     . VAL D 2 52 ? -5.708  15.988 -7.597  1.00 32.20 ? 52 VAL B N     1 
ATOM   1691 C  CA    . VAL D 2 52 ? -5.905  17.049 -8.573  1.00 31.67 ? 52 VAL B CA    1 
ATOM   1692 C  C     . VAL D 2 52 ? -4.739  17.139 -9.555  1.00 32.22 ? 52 VAL B C     1 
ATOM   1693 O  O     . VAL D 2 52 ? -4.953  17.221 -10.758 1.00 35.33 ? 52 VAL B O     1 
ATOM   1694 C  CB    . VAL D 2 52 ? -6.078  18.395 -7.876  1.00 31.51 ? 52 VAL B CB    1 
ATOM   1695 C  CG1   . VAL D 2 52 ? -6.389  19.475 -8.900  1.00 29.84 ? 52 VAL B CG1   1 
ATOM   1696 C  CG2   . VAL D 2 52 ? -7.184  18.279 -6.824  1.00 29.98 ? 52 VAL B CG2   1 
ATOM   1697 N  N     . SER D 2 53 ? -3.509  17.123 -9.051  1.00 32.54 ? 53 SER B N     1 
ATOM   1698 C  CA    . SER D 2 53 ? -2.341  17.192 -9.925  1.00 33.29 ? 53 SER B CA    1 
ATOM   1699 C  C     . SER D 2 53 ? -2.332  16.043 -10.924 1.00 34.17 ? 53 SER B C     1 
ATOM   1700 O  O     . SER D 2 53 ? -2.090  16.236 -12.114 1.00 34.98 ? 53 SER B O     1 
ATOM   1701 C  CB    . SER D 2 53 ? -1.055  17.149 -9.106  1.00 32.31 ? 53 SER B CB    1 
ATOM   1702 O  OG    . SER D 2 53 ? -0.914  18.325 -8.332  1.00 37.11 ? 53 SER B OG    1 
ATOM   1703 N  N     . ARG D 2 54 ? -2.584  14.838 -10.430 1.00 35.12 ? 54 ARG B N     1 
ATOM   1704 C  CA    . ARG D 2 54 ? -2.611  13.667 -11.279 1.00 34.65 ? 54 ARG B CA    1 
ATOM   1705 C  C     . ARG D 2 54 ? -3.726  13.815 -12.303 1.00 35.82 ? 54 ARG B C     1 
ATOM   1706 O  O     . ARG D 2 54 ? -3.580  13.397 -13.454 1.00 36.75 ? 54 ARG B O     1 
ATOM   1707 C  CB    . ARG D 2 54 ? -2.818  12.418 -10.429 1.00 35.07 ? 54 ARG B CB    1 
ATOM   1708 C  CG    . ARG D 2 54 ? -1.679  11.424 -10.549 1.00 36.76 ? 54 ARG B CG    1 
ATOM   1709 C  CD    . ARG D 2 54 ? -1.192  10.963 -9.203  1.00 37.75 ? 54 ARG B CD    1 
ATOM   1710 N  NE    . ARG D 2 54 ? -2.281  10.424 -8.412  1.00 41.13 ? 54 ARG B NE    1 
ATOM   1711 C  CZ    . ARG D 2 54 ? -2.183  10.133 -7.122  1.00 43.40 ? 54 ARG B CZ    1 
ATOM   1712 N  NH1   . ARG D 2 54 ? -1.034  10.328 -6.490  1.00 46.31 ? 54 ARG B NH1   1 
ATOM   1713 N  NH2   . ARG D 2 54 ? -3.236  9.671  -6.456  1.00 44.99 ? 54 ARG B NH2   1 
ATOM   1714 N  N     . MET D 2 55 ? -4.836  14.422 -11.894 1.00 35.87 ? 55 MET B N     1 
ATOM   1715 C  CA    . MET D 2 55 ? -5.956  14.614 -12.805 1.00 36.56 ? 55 MET B CA    1 
ATOM   1716 C  C     . MET D 2 55 ? -5.560  15.585 -13.892 1.00 36.98 ? 55 MET B C     1 
ATOM   1717 O  O     . MET D 2 55 ? -5.730  15.301 -15.079 1.00 38.33 ? 55 MET B O     1 
ATOM   1718 C  CB    . MET D 2 55 ? -7.166  15.164 -12.074 1.00 38.03 ? 55 MET B CB    1 
ATOM   1719 C  CG    . MET D 2 55 ? -8.434  14.392 -12.359 1.00 42.32 ? 55 MET B CG    1 
ATOM   1720 S  SD    . MET D 2 55 ? -8.901  14.304 -14.108 1.00 47.75 ? 55 MET B SD    1 
ATOM   1721 C  CE    . MET D 2 55 ? -8.663  12.507 -14.483 1.00 45.34 ? 55 MET B CE    1 
ATOM   1722 N  N     . VAL D 2 56 ? -5.028  16.734 -13.488 1.00 35.98 ? 56 VAL B N     1 
ATOM   1723 C  CA    . VAL D 2 56 ? -4.605  17.740 -14.448 1.00 35.61 ? 56 VAL B CA    1 
ATOM   1724 C  C     . VAL D 2 56 ? -3.550  17.203 -15.420 1.00 36.70 ? 56 VAL B C     1 
ATOM   1725 O  O     . VAL D 2 56 ? -3.651  17.413 -16.628 1.00 38.11 ? 56 VAL B O     1 
ATOM   1726 C  CB    . VAL D 2 56 ? -4.076  18.976 -13.727 1.00 34.86 ? 56 VAL B CB    1 
ATOM   1727 C  CG1   . VAL D 2 56 ? -3.385  19.911 -14.709 1.00 34.97 ? 56 VAL B CG1   1 
ATOM   1728 C  CG2   . VAL D 2 56 ? -5.236  19.689 -13.052 1.00 33.90 ? 56 VAL B CG2   1 
ATOM   1729 N  N     . THR D 2 57 ? -2.543  16.505 -14.909 1.00 36.54 ? 57 THR B N     1 
ATOM   1730 C  CA    . THR D 2 57 ? -1.517  15.944 -15.779 1.00 36.77 ? 57 THR B CA    1 
ATOM   1731 C  C     . THR D 2 57 ? -2.119  14.930 -16.755 1.00 38.08 ? 57 THR B C     1 
ATOM   1732 O  O     . THR D 2 57 ? -1.805  14.937 -17.939 1.00 39.07 ? 57 THR B O     1 
ATOM   1733 C  CB    . THR D 2 57 ? -0.425  15.277 -14.957 1.00 36.17 ? 57 THR B CB    1 
ATOM   1734 O  OG1   . THR D 2 57 ? 0.252   16.279 -14.191 1.00 36.74 ? 57 THR B OG1   1 
ATOM   1735 C  CG2   . THR D 2 57 ? 0.562   14.561 -15.855 1.00 33.96 ? 57 THR B CG2   1 
ATOM   1736 N  N     . SER D 2 58 ? -2.984  14.058 -16.253 1.00 40.19 ? 58 SER B N     1 
ATOM   1737 C  CA    . SER D 2 58 ? -3.645  13.069 -17.094 1.00 42.11 ? 58 SER B CA    1 
ATOM   1738 C  C     . SER D 2 58 ? -4.444  13.779 -18.188 1.00 42.95 ? 58 SER B C     1 
ATOM   1739 O  O     . SER D 2 58 ? -4.494  13.327 -19.334 1.00 44.72 ? 58 SER B O     1 
ATOM   1740 C  CB    . SER D 2 58 ? -4.597  12.212 -16.258 1.00 42.70 ? 58 SER B CB    1 
ATOM   1741 O  OG    . SER D 2 58 ? -5.271  11.271 -17.074 1.00 45.74 ? 58 SER B OG    1 
ATOM   1742 N  N     . LEU D 2 59 ? -5.079  14.887 -17.824 1.00 42.56 ? 59 LEU B N     1 
ATOM   1743 C  CA    . LEU D 2 59 ? -5.868  15.655 -18.776 1.00 42.50 ? 59 LEU B CA    1 
ATOM   1744 C  C     . LEU D 2 59 ? -4.999  16.302 -19.832 1.00 43.29 ? 59 LEU B C     1 
ATOM   1745 O  O     . LEU D 2 59 ? -5.251  16.159 -21.028 1.00 44.83 ? 59 LEU B O     1 
ATOM   1746 C  CB    . LEU D 2 59 ? -6.658  16.745 -18.061 1.00 40.96 ? 59 LEU B CB    1 
ATOM   1747 C  CG    . LEU D 2 59 ? -8.100  16.431 -17.697 1.00 41.23 ? 59 LEU B CG    1 
ATOM   1748 C  CD1   . LEU D 2 59 ? -8.578  17.377 -16.609 1.00 43.18 ? 59 LEU B CD1   1 
ATOM   1749 C  CD2   . LEU D 2 59 ? -8.950  16.571 -18.932 1.00 42.33 ? 59 LEU B CD2   1 
ATOM   1750 N  N     . LEU D 2 60 ? -3.972  17.014 -19.386 1.00 43.50 ? 60 LEU B N     1 
ATOM   1751 C  CA    . LEU D 2 60 ? -3.091  17.710 -20.302 1.00 44.24 ? 60 LEU B CA    1 
ATOM   1752 C  C     . LEU D 2 60 ? -2.238  16.802 -21.189 1.00 45.35 ? 60 LEU B C     1 
ATOM   1753 O  O     . LEU D 2 60 ? -1.505  17.292 -22.051 1.00 45.49 ? 60 LEU B O     1 
ATOM   1754 C  CB    . LEU D 2 60 ? -2.207  18.689 -19.528 1.00 44.35 ? 60 LEU B CB    1 
ATOM   1755 C  CG    . LEU D 2 60 ? -2.944  19.861 -18.870 1.00 43.91 ? 60 LEU B CG    1 
ATOM   1756 C  CD1   . LEU D 2 60 ? -1.937  20.828 -18.267 1.00 42.34 ? 60 LEU B CD1   1 
ATOM   1757 C  CD2   . LEU D 2 60 ? -3.805  20.579 -19.903 1.00 43.71 ? 60 LEU B CD2   1 
ATOM   1758 N  N     . GLU D 2 61 ? -2.330  15.489 -20.987 1.00 45.63 ? 61 GLU B N     1 
ATOM   1759 C  CA    . GLU D 2 61 ? -1.577  14.544 -21.806 1.00 45.83 ? 61 GLU B CA    1 
ATOM   1760 C  C     . GLU D 2 61 ? -2.472  13.990 -22.901 1.00 45.77 ? 61 GLU B C     1 
ATOM   1761 O  O     . GLU D 2 61 ? -1.989  13.335 -23.817 1.00 48.33 ? 61 GLU B O     1 
ATOM   1762 C  CB    . GLU D 2 61 ? -1.050  13.378 -20.970 1.00 47.32 ? 61 GLU B CB    1 
ATOM   1763 C  CG    . GLU D 2 61 ? 0.009   13.749 -19.950 1.00 53.20 ? 61 GLU B CG    1 
ATOM   1764 C  CD    . GLU D 2 61 ? 0.499   12.539 -19.150 1.00 57.93 ? 61 GLU B CD    1 
ATOM   1765 O  OE1   . GLU D 2 61 ? -0.337  11.866 -18.504 1.00 59.58 ? 61 GLU B OE1   1 
ATOM   1766 O  OE2   . GLU D 2 61 ? 1.722   12.258 -19.164 1.00 61.11 ? 61 GLU B OE2   1 
ATOM   1767 N  N     . LYS D 2 62 ? -3.777  14.241 -22.797 1.00 44.51 ? 62 LYS B N     1 
ATOM   1768 C  CA    . LYS D 2 62 ? -4.749  13.767 -23.785 1.00 41.93 ? 62 LYS B CA    1 
ATOM   1769 C  C     . LYS D 2 62 ? -4.806  14.743 -24.960 1.00 42.68 ? 62 LYS B C     1 
ATOM   1770 O  O     . LYS D 2 62 ? -5.297  15.867 -24.820 1.00 41.80 ? 62 LYS B O     1 
ATOM   1771 C  CB    . LYS D 2 62 ? -6.144  13.682 -23.168 1.00 39.52 ? 62 LYS B CB    1 
ATOM   1772 C  CG    . LYS D 2 62 ? -6.283  12.775 -21.965 1.00 36.96 ? 62 LYS B CG    1 
ATOM   1773 C  CD    . LYS D 2 62 ? -7.712  12.861 -21.423 1.00 34.29 ? 62 LYS B CD    1 
ATOM   1774 C  CE    . LYS D 2 62 ? -7.887  12.061 -20.133 1.00 34.28 ? 62 LYS B CE    1 
ATOM   1775 N  NZ    . LYS D 2 62 ? -7.813  10.586 -20.331 1.00 33.93 ? 62 LYS B NZ    1 
ATOM   1776 N  N     . PRO D 2 63 ? -4.311  14.328 -26.139 1.00 43.13 ? 63 PRO B N     1 
ATOM   1777 C  CA    . PRO D 2 63 ? -4.342  15.227 -27.299 1.00 42.81 ? 63 PRO B CA    1 
ATOM   1778 C  C     . PRO D 2 63 ? -5.734  15.760 -27.638 1.00 42.68 ? 63 PRO B C     1 
ATOM   1779 O  O     . PRO D 2 63 ? -5.868  16.882 -28.121 1.00 43.48 ? 63 PRO B O     1 
ATOM   1780 C  CB    . PRO D 2 63 ? -3.729  14.380 -28.415 1.00 41.74 ? 63 PRO B CB    1 
ATOM   1781 C  CG    . PRO D 2 63 ? -3.981  12.960 -27.965 1.00 42.92 ? 63 PRO B CG    1 
ATOM   1782 C  CD    . PRO D 2 63 ? -3.710  13.031 -26.493 1.00 42.55 ? 63 PRO B CD    1 
ATOM   1783 N  N     . SER D 2 64 ? -6.767  14.970 -27.367 1.00 43.05 ? 64 SER B N     1 
ATOM   1784 C  CA    . SER D 2 64 ? -8.144  15.388 -27.643 1.00 43.21 ? 64 SER B CA    1 
ATOM   1785 C  C     . SER D 2 64 ? -8.581  16.589 -26.791 1.00 43.46 ? 64 SER B C     1 
ATOM   1786 O  O     . SER D 2 64 ? -9.204  17.524 -27.297 1.00 43.69 ? 64 SER B O     1 
ATOM   1787 C  CB    . SER D 2 64 ? -9.108  14.231 -27.389 1.00 44.20 ? 64 SER B CB    1 
ATOM   1788 O  OG    . SER D 2 64 ? -9.168  13.907 -26.007 1.00 46.59 ? 64 SER B OG    1 
ATOM   1789 N  N     . VAL D 2 65 ? -8.261  16.549 -25.498 1.00 42.36 ? 65 VAL B N     1 
ATOM   1790 C  CA    . VAL D 2 65 ? -8.615  17.621 -24.576 1.00 40.15 ? 65 VAL B CA    1 
ATOM   1791 C  C     . VAL D 2 65 ? -7.747  18.862 -24.750 1.00 40.52 ? 65 VAL B C     1 
ATOM   1792 O  O     . VAL D 2 65 ? -8.250  19.978 -24.698 1.00 42.02 ? 65 VAL B O     1 
ATOM   1793 C  CB    . VAL D 2 65 ? -8.515  17.147 -23.120 1.00 39.95 ? 65 VAL B CB    1 
ATOM   1794 C  CG1   . VAL D 2 65 ? -8.782  18.304 -22.176 1.00 38.22 ? 65 VAL B CG1   1 
ATOM   1795 C  CG2   . VAL D 2 65 ? -9.509  16.021 -22.879 1.00 39.00 ? 65 VAL B CG2   1 
ATOM   1796 N  N     . VAL D 2 66 ? -6.444  18.684 -24.948 1.00 40.66 ? 66 VAL B N     1 
ATOM   1797 C  CA    . VAL D 2 66 ? -5.560  19.836 -25.134 1.00 39.19 ? 66 VAL B CA    1 
ATOM   1798 C  C     . VAL D 2 66 ? -5.946  20.598 -26.405 1.00 39.73 ? 66 VAL B C     1 
ATOM   1799 O  O     . VAL D 2 66 ? -5.957  21.830 -26.425 1.00 39.57 ? 66 VAL B O     1 
ATOM   1800 C  CB    . VAL D 2 66 ? -4.093  19.409 -25.241 1.00 37.16 ? 66 VAL B CB    1 
ATOM   1801 C  CG1   . VAL D 2 66 ? -3.227  20.613 -25.479 1.00 36.00 ? 66 VAL B CG1   1 
ATOM   1802 C  CG2   . VAL D 2 66 ? -3.673  18.712 -23.986 1.00 34.81 ? 66 VAL B CG2   1 
ATOM   1803 N  N     . ALA D 2 67 ? -6.261  19.861 -27.465 1.00 40.27 ? 67 ALA B N     1 
ATOM   1804 C  CA    . ALA D 2 67 ? -6.662  20.488 -28.718 1.00 41.86 ? 67 ALA B CA    1 
ATOM   1805 C  C     . ALA D 2 67 ? -7.843  21.408 -28.452 1.00 42.73 ? 67 ALA B C     1 
ATOM   1806 O  O     . ALA D 2 67 ? -7.871  22.544 -28.905 1.00 43.13 ? 67 ALA B O     1 
ATOM   1807 C  CB    . ALA D 2 67 ? -7.045  19.434 -29.732 1.00 41.01 ? 67 ALA B CB    1 
ATOM   1808 N  N     . TYR D 2 68 ? -8.820  20.909 -27.707 1.00 45.05 ? 68 TYR B N     1 
ATOM   1809 C  CA    . TYR D 2 68 ? -9.996  21.699 -27.374 1.00 46.36 ? 68 TYR B CA    1 
ATOM   1810 C  C     . TYR D 2 68 ? -9.620  22.948 -26.582 1.00 48.16 ? 68 TYR B C     1 
ATOM   1811 O  O     . TYR D 2 68 ? -9.902  24.060 -27.006 1.00 48.97 ? 68 TYR B O     1 
ATOM   1812 C  CB    . TYR D 2 68 ? -10.990 20.872 -26.558 1.00 45.72 ? 68 TYR B CB    1 
ATOM   1813 C  CG    . TYR D 2 68 ? -12.139 21.699 -26.041 1.00 46.19 ? 68 TYR B CG    1 
ATOM   1814 C  CD1   . TYR D 2 68 ? -13.035 22.295 -26.922 1.00 46.27 ? 68 TYR B CD1   1 
ATOM   1815 C  CD2   . TYR D 2 68 ? -12.291 21.946 -24.681 1.00 45.69 ? 68 TYR B CD2   1 
ATOM   1816 C  CE1   . TYR D 2 68 ? -14.051 23.123 -26.469 1.00 46.62 ? 68 TYR B CE1   1 
ATOM   1817 C  CE2   . TYR D 2 68 ? -13.304 22.775 -24.215 1.00 46.88 ? 68 TYR B CE2   1 
ATOM   1818 C  CZ    . TYR D 2 68 ? -14.181 23.364 -25.117 1.00 47.11 ? 68 TYR B CZ    1 
ATOM   1819 O  OH    . TYR D 2 68 ? -15.178 24.208 -24.679 1.00 47.05 ? 68 TYR B OH    1 
ATOM   1820 N  N     . LEU D 2 69 ? -8.977  22.762 -25.433 1.00 50.38 ? 69 LEU B N     1 
ATOM   1821 C  CA    . LEU D 2 69 ? -8.590  23.886 -24.582 1.00 52.55 ? 69 LEU B CA    1 
ATOM   1822 C  C     . LEU D 2 69 ? -7.792  24.968 -25.302 1.00 55.33 ? 69 LEU B C     1 
ATOM   1823 O  O     . LEU D 2 69 ? -7.949  26.154 -25.013 1.00 54.19 ? 69 LEU B O     1 
ATOM   1824 C  CB    . LEU D 2 69 ? -7.805  23.377 -23.368 1.00 51.46 ? 69 LEU B CB    1 
ATOM   1825 C  CG    . LEU D 2 69 ? -8.615  22.480 -22.428 1.00 50.04 ? 69 LEU B CG    1 
ATOM   1826 C  CD1   . LEU D 2 69 ? -7.729  21.926 -21.317 1.00 48.17 ? 69 LEU B CD1   1 
ATOM   1827 C  CD2   . LEU D 2 69 ? -9.775  23.285 -21.859 1.00 48.93 ? 69 LEU B CD2   1 
ATOM   1828 N  N     . GLU D 2 70 ? -6.937  24.565 -26.236 1.00 59.67 ? 70 GLU B N     1 
ATOM   1829 C  CA    . GLU D 2 70 ? -6.138  25.524 -26.986 1.00 63.63 ? 70 GLU B CA    1 
ATOM   1830 C  C     . GLU D 2 70 ? -6.973  26.315 -27.991 1.00 65.82 ? 70 GLU B C     1 
ATOM   1831 O  O     . GLU D 2 70 ? -6.795  27.523 -28.130 1.00 66.89 ? 70 GLU B O     1 
ATOM   1832 C  CB    . GLU D 2 70 ? -4.989  24.813 -27.697 1.00 65.17 ? 70 GLU B CB    1 
ATOM   1833 C  CG    . GLU D 2 70 ? -3.770  24.628 -26.807 1.00 68.56 ? 70 GLU B CG    1 
ATOM   1834 C  CD    . GLU D 2 70 ? -2.690  23.777 -27.451 1.00 70.75 ? 70 GLU B CD    1 
ATOM   1835 O  OE1   . GLU D 2 70 ? -1.568  23.721 -26.900 1.00 71.56 ? 70 GLU B OE1   1 
ATOM   1836 O  OE2   . GLU D 2 70 ? -2.966  23.158 -28.501 1.00 71.79 ? 70 GLU B OE2   1 
ATOM   1837 N  N     . GLY D 2 71 ? -7.884  25.643 -28.685 1.00 67.84 ? 71 GLY B N     1 
ATOM   1838 C  CA    . GLY D 2 71 ? -8.721  26.338 -29.648 1.00 70.50 ? 71 GLY B CA    1 
ATOM   1839 C  C     . GLY D 2 71 ? -8.719  25.744 -31.047 1.00 72.68 ? 71 GLY B C     1 
ATOM   1840 O  O     . GLY D 2 71 ? -9.524  26.150 -31.889 1.00 72.55 ? 71 GLY B O     1 
ATOM   1841 N  N     . LYS D 2 72 ? -7.816  24.795 -31.301 1.00 74.65 ? 72 LYS B N     1 
ATOM   1842 C  CA    . LYS D 2 72 ? -7.719  24.137 -32.608 1.00 76.28 ? 72 LYS B CA    1 
ATOM   1843 C  C     . LYS D 2 72 ? -9.064  23.523 -33.023 1.00 76.83 ? 72 LYS B C     1 
ATOM   1844 O  O     . LYS D 2 72 ? -9.479  23.735 -34.186 1.00 77.38 ? 72 LYS B O     1 
ATOM   1845 C  CB    . LYS D 2 72 ? -6.673  23.020 -32.581 1.00 76.90 ? 72 LYS B CB    1 
ATOM   1846 C  CG    . LYS D 2 72 ? -5.294  23.392 -32.072 1.00 77.68 ? 72 LYS B CG    1 
ATOM   1847 C  CD    . LYS D 2 72 ? -4.453  22.119 -32.023 1.00 79.18 ? 72 LYS B CD    1 
ATOM   1848 C  CE    . LYS D 2 72 ? -3.231  22.256 -31.136 1.00 79.89 ? 72 LYS B CE    1 
ATOM   1849 N  NZ    . LYS D 2 72 ? -2.846  20.937 -30.543 1.00 79.66 ? 72 LYS B NZ    1 
HETATM 1850 O  O     . HOH E 3 .  ? -7.481  2.416  -12.811 1.00 39.19 ? 19 HOH C O     1 
HETATM 1851 O  O     . HOH E 3 .  ? -19.695 8.006  -11.144 1.00 36.79 ? 20 HOH C O     1 
HETATM 1852 O  O     . HOH E 3 .  ? -10.468 13.955 -5.904  1.00 38.23 ? 21 HOH C O     1 
HETATM 1853 O  O     . HOH F 3 .  ? -9.424  13.670 -3.409  1.00 42.23 ? 19 HOH D O     1 
HETATM 1854 O  O     . HOH F 3 .  ? -13.562 4.893  5.503   1.00 41.78 ? 20 HOH D O     1 
HETATM 1855 O  O     . HOH F 3 .  ? -10.460 11.368 -3.358  1.00 40.60 ? 21 HOH D O     1 
HETATM 1856 O  O     . HOH F 3 .  ? -9.011  12.392 -1.481  1.00 41.17 ? 22 HOH D O     1 
HETATM 1857 O  O     . HOH G 3 .  ? -19.508 14.702 -30.563 1.00 35.41 ? 74 HOH A O     1 
HETATM 1858 O  O     . HOH G 3 .  ? -22.879 10.913 -21.197 1.00 34.96 ? 75 HOH A O     1 
HETATM 1859 O  O     . HOH G 3 .  ? -7.459  30.198 -2.093  1.00 28.84 ? 76 HOH A O     1 
HETATM 1860 O  O     . HOH G 3 .  ? -21.841 18.939 -3.705  1.00 41.55 ? 77 HOH A O     1 
HETATM 1861 O  O     . HOH G 3 .  ? -13.098 22.183 23.455  1.00 48.98 ? 78 HOH A O     1 
HETATM 1862 O  O     . HOH G 3 .  ? -20.700 25.120 -10.146 1.00 37.82 ? 79 HOH A O     1 
HETATM 1863 O  O     . HOH G 3 .  ? -19.544 21.510 -6.657  1.00 50.21 ? 80 HOH A O     1 
HETATM 1864 O  O     . HOH G 3 .  ? -21.227 19.912 12.971  1.00 42.10 ? 81 HOH A O     1 
HETATM 1865 O  O     . HOH G 3 .  ? -19.231 27.080 -23.385 1.00 38.36 ? 82 HOH A O     1 
HETATM 1866 O  O     . HOH G 3 .  ? -17.282 22.015 -14.634 1.00 51.14 ? 83 HOH A O     1 
HETATM 1867 O  O     . HOH H 3 .  ? -6.420  29.741 -4.534  1.00 35.29 ? 74 HOH B O     1 
HETATM 1868 O  O     . HOH H 3 .  ? 2.329   11.588 16.077  1.00 45.22 ? 75 HOH B O     1 
HETATM 1869 O  O     . HOH H 3 .  ? 0.430   21.641 -23.883 1.00 35.54 ? 76 HOH B O     1 
HETATM 1870 O  O     . HOH H 3 .  ? 3.594   17.016 4.843   1.00 23.92 ? 77 HOH B O     1 
HETATM 1871 O  O     . HOH H 3 .  ? -7.436  28.291 -12.272 1.00 32.10 ? 78 HOH B O     1 
HETATM 1872 O  O     . HOH H 3 .  ? -7.861  11.169 -17.066 1.00 48.55 ? 79 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  G   1  1  1  G   GUA C . n 
A 1 2  C   2  2  2  C   CYT C . n 
A 1 3  A   3  3  3  A   ADE C . n 
A 1 4  5BU 4  4  4  5BU 5BU C . n 
A 1 5  G   5  5  5  G   GUA C . n 
A 1 6  G   6  6  6  G   GUA C . n 
A 1 7  A   7  7  7  A   ADE C . n 
A 1 8  C   8  8  8  C   CYT C . n 
A 1 9  G   9  9  9  G   GUA C . n 
A 1 10 C   10 10 10 C   CYT C . n 
A 1 11 G   11 11 11 G   GUA C . n 
A 1 12 5BU 12 12 12 5BU 5BU C . n 
A 1 13 C   13 13 13 C   CYT C . n 
A 1 14 C   14 14 14 C   CYT C . n 
A 1 15 A   15 15 15 A   ADE C . n 
A 1 16 5BU 16 16 16 5BU 5BU C . n 
A 1 17 G   17 17 17 G   GUA C . n 
A 1 18 C   18 18 18 C   CYT C . n 
B 1 1  G   1  1  1  G   GUA D . n 
B 1 2  C   2  2  2  C   CYT D . n 
B 1 3  A   3  3  3  A   ADE D . n 
B 1 4  5BU 4  4  4  5BU 5BU D . n 
B 1 5  G   5  5  5  G   GUA D . n 
B 1 6  G   6  6  6  G   GUA D . n 
B 1 7  A   7  7  7  A   ADE D . n 
B 1 8  C   8  8  8  C   CYT D . n 
B 1 9  G   9  9  9  G   GUA D . n 
B 1 10 C   10 10 10 C   CYT D . n 
B 1 11 G   11 11 11 G   GUA D . n 
B 1 12 5BU 12 12 12 5BU 5BU D . n 
B 1 13 C   13 13 13 C   CYT D . n 
B 1 14 C   14 14 14 C   CYT D . n 
B 1 15 A   15 15 15 A   ADE D . n 
B 1 16 5BU 16 16 16 5BU 5BU D . n 
B 1 17 G   17 17 17 G   GUA D . n 
B 1 18 C   18 18 18 C   CYT D . n 
C 2 1  MET 1  1  ?  ?   ?   A . n 
C 2 2  PRO 2  2  2  PRO PRO A . n 
C 2 3  SER 3  3  3  SER SER A . n 
C 2 4  LYS 4  4  4  LYS LYS A . n 
C 2 5  LEU 5  5  5  LEU LEU A . n 
C 2 6  ALA 6  6  6  ALA ALA A . n 
C 2 7  LEU 7  7  7  LEU LEU A . n 
C 2 8  ILE 8  8  8  ILE ILE A . n 
C 2 9  GLN 9  9  9  GLN GLN A . n 
C 2 10 GLU 10 10 10 GLU GLU A . n 
C 2 11 LEU 11 11 11 LEU LEU A . n 
C 2 12 PRO 12 12 12 PRO PRO A . n 
C 2 13 ASP 13 13 13 ASP ASP A . n 
C 2 14 ARG 14 14 14 ARG ARG A . n 
C 2 15 ILE 15 15 15 ILE ILE A . n 
C 2 16 GLN 16 16 16 GLN GLN A . n 
C 2 17 THR 17 17 17 THR THR A . n 
C 2 18 ALA 18 18 18 ALA ALA A . n 
C 2 19 VAL 19 19 19 VAL VAL A . n 
C 2 20 GLU 20 20 20 GLU GLU A . n 
C 2 21 ALA 21 21 21 ALA ALA A . n 
C 2 22 ALA 22 22 22 ALA ALA A . n 
C 2 23 MET 23 23 23 MET MET A . n 
C 2 24 GLY 24 24 24 GLY GLY A . n 
C 2 25 MET 25 25 25 MET MET A . n 
C 2 26 SER 26 26 26 SER SER A . n 
C 2 27 TYR 27 27 27 TYR TYR A . n 
C 2 28 GLN 28 28 28 GLN GLN A . n 
C 2 29 ASP 29 29 29 ASP ASP A . n 
C 2 30 ALA 30 30 30 ALA ALA A . n 
C 2 31 PRO 31 31 31 PRO PRO A . n 
C 2 32 ASN 32 32 32 ASN ASN A . n 
C 2 33 ASN 33 33 33 ASN ASN A . n 
C 2 34 VAL 34 34 34 VAL VAL A . n 
C 2 35 ARG 35 35 35 ARG ARG A . n 
C 2 36 ARG 36 36 36 ARG ARG A . n 
C 2 37 ASP 37 37 37 ASP ASP A . n 
C 2 38 LEU 38 38 38 LEU LEU A . n 
C 2 39 ASP 39 39 39 ASP ASP A . n 
C 2 40 ASN 40 40 40 ASN ASN A . n 
C 2 41 LEU 41 41 41 LEU LEU A . n 
C 2 42 HIS 42 42 42 HIS HIS A . n 
C 2 43 ALA 43 43 43 ALA ALA A . n 
C 2 44 CYS 44 44 44 CYS CYS A . n 
C 2 45 LEU 45 45 45 LEU LEU A . n 
C 2 46 ASN 46 46 46 ASN ASN A . n 
C 2 47 LYS 47 47 47 LYS LYS A . n 
C 2 48 ALA 48 48 48 ALA ALA A . n 
C 2 49 LYS 49 49 49 LYS LYS A . n 
C 2 50 LEU 50 50 50 LEU LEU A . n 
C 2 51 THR 51 51 51 THR THR A . n 
C 2 52 VAL 52 52 52 VAL VAL A . n 
C 2 53 SER 53 53 53 SER SER A . n 
C 2 54 ARG 54 54 54 ARG ARG A . n 
C 2 55 MET 55 55 55 MET MET A . n 
C 2 56 VAL 56 56 56 VAL VAL A . n 
C 2 57 THR 57 57 57 THR THR A . n 
C 2 58 SER 58 58 58 SER SER A . n 
C 2 59 LEU 59 59 59 LEU LEU A . n 
C 2 60 LEU 60 60 60 LEU LEU A . n 
C 2 61 GLU 61 61 61 GLU GLU A . n 
C 2 62 LYS 62 62 62 LYS LYS A . n 
C 2 63 PRO 63 63 63 PRO PRO A . n 
C 2 64 SER 64 64 64 SER SER A . n 
C 2 65 VAL 65 65 65 VAL VAL A . n 
C 2 66 VAL 66 66 66 VAL VAL A . n 
C 2 67 ALA 67 67 67 ALA ALA A . n 
C 2 68 TYR 68 68 68 TYR TYR A . n 
C 2 69 LEU 69 69 69 LEU LEU A . n 
C 2 70 GLU 70 70 70 GLU GLU A . n 
C 2 71 GLY 71 71 71 GLY GLY A . n 
C 2 72 LYS 72 72 ?  ?   ?   A . n 
C 2 73 ALA 73 73 ?  ?   ?   A . n 
D 2 1  MET 1  1  ?  ?   ?   B . n 
D 2 2  PRO 2  2  2  PRO PRO B . n 
D 2 3  SER 3  3  3  SER SER B . n 
D 2 4  LYS 4  4  4  LYS LYS B . n 
D 2 5  LEU 5  5  5  LEU LEU B . n 
D 2 6  ALA 6  6  6  ALA ALA B . n 
D 2 7  LEU 7  7  7  LEU LEU B . n 
D 2 8  ILE 8  8  8  ILE ILE B . n 
D 2 9  GLN 9  9  9  GLN GLN B . n 
D 2 10 GLU 10 10 10 GLU GLU B . n 
D 2 11 LEU 11 11 11 LEU LEU B . n 
D 2 12 PRO 12 12 12 PRO PRO B . n 
D 2 13 ASP 13 13 13 ASP ASP B . n 
D 2 14 ARG 14 14 14 ARG ARG B . n 
D 2 15 ILE 15 15 15 ILE ILE B . n 
D 2 16 GLN 16 16 16 GLN GLN B . n 
D 2 17 THR 17 17 17 THR THR B . n 
D 2 18 ALA 18 18 18 ALA ALA B . n 
D 2 19 VAL 19 19 19 VAL VAL B . n 
D 2 20 GLU 20 20 20 GLU GLU B . n 
D 2 21 ALA 21 21 21 ALA ALA B . n 
D 2 22 ALA 22 22 22 ALA ALA B . n 
D 2 23 MET 23 23 23 MET MET B . n 
D 2 24 GLY 24 24 24 GLY GLY B . n 
D 2 25 MET 25 25 25 MET MET B . n 
D 2 26 SER 26 26 26 SER SER B . n 
D 2 27 TYR 27 27 27 TYR TYR B . n 
D 2 28 GLN 28 28 28 GLN GLN B . n 
D 2 29 ASP 29 29 29 ASP ASP B . n 
D 2 30 ALA 30 30 30 ALA ALA B . n 
D 2 31 PRO 31 31 31 PRO PRO B . n 
D 2 32 ASN 32 32 32 ASN ASN B . n 
D 2 33 ASN 33 33 33 ASN ASN B . n 
D 2 34 VAL 34 34 34 VAL VAL B . n 
D 2 35 ARG 35 35 35 ARG ARG B . n 
D 2 36 ARG 36 36 36 ARG ARG B . n 
D 2 37 ASP 37 37 37 ASP ASP B . n 
D 2 38 LEU 38 38 38 LEU LEU B . n 
D 2 39 ASP 39 39 39 ASP ASP B . n 
D 2 40 ASN 40 40 40 ASN ASN B . n 
D 2 41 LEU 41 41 41 LEU LEU B . n 
D 2 42 HIS 42 42 42 HIS HIS B . n 
D 2 43 ALA 43 43 43 ALA ALA B . n 
D 2 44 CYS 44 44 44 CYS CYS B . n 
D 2 45 LEU 45 45 45 LEU LEU B . n 
D 2 46 ASN 46 46 46 ASN ASN B . n 
D 2 47 LYS 47 47 47 LYS LYS B . n 
D 2 48 ALA 48 48 48 ALA ALA B . n 
D 2 49 LYS 49 49 49 LYS LYS B . n 
D 2 50 LEU 50 50 50 LEU LEU B . n 
D 2 51 THR 51 51 51 THR THR B . n 
D 2 52 VAL 52 52 52 VAL VAL B . n 
D 2 53 SER 53 53 53 SER SER B . n 
D 2 54 ARG 54 54 54 ARG ARG B . n 
D 2 55 MET 55 55 55 MET MET B . n 
D 2 56 VAL 56 56 56 VAL VAL B . n 
D 2 57 THR 57 57 57 THR THR B . n 
D 2 58 SER 58 58 58 SER SER B . n 
D 2 59 LEU 59 59 59 LEU LEU B . n 
D 2 60 LEU 60 60 60 LEU LEU B . n 
D 2 61 GLU 61 61 61 GLU GLU B . n 
D 2 62 LYS 62 62 62 LYS LYS B . n 
D 2 63 PRO 63 63 63 PRO PRO B . n 
D 2 64 SER 64 64 64 SER SER B . n 
D 2 65 VAL 65 65 65 VAL VAL B . n 
D 2 66 VAL 66 66 66 VAL VAL B . n 
D 2 67 ALA 67 67 67 ALA ALA B . n 
D 2 68 TYR 68 68 68 TYR TYR B . n 
D 2 69 LEU 69 69 69 LEU LEU B . n 
D 2 70 GLU 70 70 70 GLU GLU B . n 
D 2 71 GLY 71 71 71 GLY GLY B . n 
D 2 72 LYS 72 72 72 LYS LYS B . n 
D 2 73 ALA 73 73 ?  ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 5BU 4  C 5BU 4  ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
2 A 5BU 12 C 5BU 12 ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
3 A 5BU 16 C 5BU 16 ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
4 B 5BU 4  D 5BU 4  ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
5 B 5BU 12 D 5BU 12 ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
6 B 5BU 16 D 5BU 16 ? U "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-10-11 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
PHASER phasing          .         ? 3 
CNS    refinement       1.1       ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1  ? C MET 1  
2 1 Y 1 A LYS 72 ? C LYS 72 
3 1 Y 1 A ALA 73 ? C ALA 73 
4 1 Y 1 B MET 1  ? D MET 1  
5 1 Y 1 B ALA 73 ? D ALA 73 
# 
_ndb_struct_conf_na.entry_id   2AZ0 
_ndb_struct_conf_na.feature    'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G   1  1_555 B C   18 1_555 -0.309 -0.126 0.089  -0.915  -10.793 -0.601 1  C_G1:C18_D   C 1  ? D 18 ? 19 1 
1 A C   2  1_555 B G   17 1_555 0.224  -0.108 -0.236 -0.266  -17.997 3.926  2  C_C2:G17_D   C 2  ? D 17 ? 19 1 
1 A A   3  1_555 B 5BU 16 1_555 0.183  -0.201 -0.063 -2.390  -13.592 -4.542 3  C_A3:5BU16_D C 3  ? D 16 ? 20 1 
1 A 5BU 4  1_555 B A   15 1_555 -0.022 -0.152 -0.141 1.689   -4.395  4.585  4  C_5BU4:A15_D C 4  ? D 15 ? 20 1 
1 A G   5  1_555 B C   14 1_555 -0.165 -0.077 0.190  -0.667  -7.189  1.988  5  C_G5:C14_D   C 5  ? D 14 ? 19 1 
1 A G   6  1_555 B C   13 1_555 -0.297 -0.107 0.391  6.640   -6.172  0.679  6  C_G6:C13_D   C 6  ? D 13 ? 19 1 
1 A A   7  1_555 B 5BU 12 1_555 -0.032 -0.038 0.159  5.937   -15.917 2.500  7  C_A7:5BU12_D C 7  ? D 12 ? 20 1 
1 A C   8  1_555 B G   11 1_555 0.290  -0.049 0.164  4.128   -16.272 3.272  8  C_C8:G11_D   C 8  ? D 11 ? 19 1 
1 A G   9  1_555 B C   10 1_555 -0.287 -0.115 -0.216 -8.454  -21.285 3.951  9  C_G9:C10_D   C 9  ? D 10 ? 19 1 
1 A C   10 1_555 B G   9  1_555 0.244  -0.076 -0.096 -0.231  -16.714 5.309  10 C_C10:G9_D   C 10 ? D 9  ? 19 1 
1 A G   11 1_555 B C   8  1_555 -0.167 -0.052 -0.706 -15.502 -16.721 6.489  11 C_G11:C8_D   C 11 ? D 8  ? 19 1 
1 A 5BU 12 1_555 B A   7  1_555 -0.103 -0.196 -0.200 -4.436  -16.177 1.684  12 C_5BU12:A7_D C 12 ? D 7  ? 20 1 
1 A C   13 1_555 B G   6  1_555 0.239  0.069  0.509  -7.552  -9.894  2.744  13 C_C13:G6_D   C 13 ? D 6  ? 19 1 
1 A C   14 1_555 B G   5  1_555 0.115  -0.101 -0.045 -2.702  -8.504  0.998  14 C_C14:G5_D   C 14 ? D 5  ? 19 1 
1 A A   15 1_555 B 5BU 4  1_555 0.138  -0.137 0.030  0.476   -6.587  2.320  15 C_A15:5BU4_D C 15 ? D 4  ? 20 1 
1 A 5BU 16 1_555 B A   3  1_555 -0.091 -0.176 0.098  1.062   -7.714  5.634  16 C_5BU16:A3_D C 16 ? D 3  ? 20 1 
1 A G   17 1_555 B C   2  1_555 -0.154 -0.177 -0.032 1.807   -16.311 2.351  17 C_G17:C2_D   C 17 ? D 2  ? 19 1 
1 A C   18 1_555 B G   1  1_555 0.367  -0.093 -0.177 7.169   -13.064 1.882  18 C_C18:G1_D   C 18 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G   1  1_555 B C   18 1_555 A C   2  1_555 B G   17 1_555 -0.115 -1.123 3.258 3.589  7.548  36.190 -2.735 0.642  2.949 11.955 
-5.684 37.111 1  CC_G1C2:G17C18_DD     C 1  ? D 18 ? C 2  ? D 17 ? 
1 A C   2  1_555 B G   17 1_555 A A   3  1_555 B 5BU 16 1_555 0.174  -1.371 3.380 0.266  11.804 29.428 -4.599 -0.272 2.649 22.146 
-0.499 31.660 2  CC_C2A3:5BU16G17_DD   C 2  ? D 17 ? C 3  ? D 16 ? 
1 A A   3  1_555 B 5BU 16 1_555 A 5BU 4  1_555 B A   15 1_555 0.473  -1.641 3.244 1.438  5.686  29.735 -4.230 -0.629 2.907 10.946 
-2.769 30.295 3  CC_A35BU4:A155BU16_DD C 3  ? D 16 ? C 4  ? D 15 ? 
1 A 5BU 4  1_555 B A   15 1_555 A G   5  1_555 B C   14 1_555 -0.146 -1.456 3.202 -1.742 14.482 29.438 -4.781 -0.006 2.262 26.543 
3.193  32.782 4  CC_5BU4G5:C14A15_DD   C 4  ? D 15 ? C 5  ? D 14 ? 
1 A G   5  1_555 B C   14 1_555 A G   6  1_555 B C   13 1_555 0.134  -1.654 3.060 0.264  3.927  28.046 -4.199 -0.219 2.808 8.052  
-0.542 28.316 5  CC_G5G6:C13C14_DD     C 5  ? D 14 ? C 6  ? D 13 ? 
1 A G   6  1_555 B C   13 1_555 A A   7  1_555 B 5BU 12 1_555 0.205  -1.551 3.290 2.912  7.463  35.073 -3.536 0.068  2.917 12.187 
-4.756 35.949 6  CC_G6A7:5BU12C13_DD   C 6  ? D 13 ? C 7  ? D 12 ? 
1 A A   7  1_555 B 5BU 12 1_555 A C   8  1_555 B G   11 1_555 0.630  -1.555 3.274 1.579  3.416  32.743 -3.313 -0.848 3.127 6.035  
-2.789 32.953 7  CC_A7C8:G115BU12_DD   C 7  ? D 12 ? C 8  ? D 11 ? 
1 A C   8  1_555 B G   11 1_555 A G   9  1_555 B C   10 1_555 -0.376 -1.690 3.398 3.216  15.058 27.847 -5.606 1.225  2.166 28.680 
-6.126 31.747 8  CC_C8G9:C10G11_DD     C 8  ? D 11 ? C 9  ? D 10 ? 
1 A G   9  1_555 B C   10 1_555 A C   10 1_555 B G   9  1_555 -0.018 -1.338 3.064 -1.036 6.080  34.849 -3.010 -0.108 2.798 10.055 
1.714  35.373 9  CC_G9C10:G9C10_DD     C 9  ? D 10 ? C 10 ? D 9  ? 
1 A C   10 1_555 B G   9  1_555 A G   11 1_555 B C   8  1_555 0.308  -1.457 3.576 3.611  18.220 25.774 -5.923 0.081  2.132 35.559 
-7.046 31.677 10 CC_C10G11:C8G9_DD     C 10 ? D 9  ? C 11 ? D 8  ? 
1 A G   11 1_555 B C   8  1_555 A 5BU 12 1_555 B A   7  1_555 -0.818 -1.348 3.077 -6.247 1.470  31.832 -2.658 0.415  3.113 2.646  
11.246 32.456 11 CC_G115BU12:A7C8_DD   C 11 ? D 8  ? C 12 ? D 7  ? 
1 A 5BU 12 1_555 B A   7  1_555 A C   13 1_555 B G   6  1_555 0.552  -1.430 3.295 -4.246 8.386  32.639 -3.722 -1.589 2.762 14.549 
7.366  33.930 12 CC_5BU12C13:G6A7_DD   C 12 ? D 7  ? C 13 ? D 6  ? 
1 A C   13 1_555 B G   6  1_555 A C   14 1_555 B G   5  1_555 -0.397 -1.754 3.027 2.665  7.418  33.119 -4.020 1.046  2.548 12.788 
-4.594 34.019 13 CC_C13C14:G5G6_DD     C 13 ? D 6  ? C 14 ? D 5  ? 
1 A C   14 1_555 B G   5  1_555 A A   15 1_555 B 5BU 4  1_555 -0.012 -1.374 3.243 0.361  7.853  27.589 -4.433 0.100  2.754 16.059 
-0.738 28.666 14 CC_C14A15:5BU4G5_DD   C 14 ? D 5  ? C 15 ? D 4  ? 
1 A A   15 1_555 B 5BU 4  1_555 A 5BU 16 1_555 B A   3  1_555 0.221  -1.525 3.408 -0.589 10.795 29.686 -4.738 -0.512 2.697 20.244 
1.104  31.552 15 CC_A155BU16:A35BU4_DD C 15 ? D 4  ? C 16 ? D 3  ? 
1 A 5BU 16 1_555 B A   3  1_555 A G   17 1_555 B C   2  1_555 -0.408 -1.374 3.170 -1.269 12.547 29.344 -4.535 0.537  2.411 23.451 
2.372  31.884 16 CC_5BU16G17:C2A3_DD   C 16 ? D 3  ? C 17 ? D 2  ? 
1 A G   17 1_555 B C   2  1_555 A C   18 1_555 B G   1  1_555 -0.136 -1.174 3.177 -0.605 4.213  35.182 -2.517 0.139  3.023 6.939  
0.996  35.430 17 CC_G17C18:G1C2_DD     C 17 ? D 2  ? C 18 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  19 15 HOH HOH C . 
E 3 HOH 2  20 16 HOH HOH C . 
E 3 HOH 3  21 21 HOH HOH C . 
F 3 HOH 1  19 10 HOH HOH D . 
F 3 HOH 2  20 11 HOH HOH D . 
F 3 HOH 3  21 22 HOH HOH D . 
F 3 HOH 4  22 23 HOH HOH D . 
G 3 HOH 1  74 1  HOH HOH A . 
G 3 HOH 2  75 2  HOH HOH A . 
G 3 HOH 3  76 4  HOH HOH A . 
G 3 HOH 4  77 5  HOH HOH A . 
G 3 HOH 5  78 8  HOH HOH A . 
G 3 HOH 6  79 9  HOH HOH A . 
G 3 HOH 7  80 12 HOH HOH A . 
G 3 HOH 8  81 14 HOH HOH A . 
G 3 HOH 9  82 17 HOH HOH A . 
G 3 HOH 10 83 19 HOH HOH A . 
H 3 HOH 1  74 3  HOH HOH B . 
H 3 HOH 2  75 6  HOH HOH B . 
H 3 HOH 3  76 7  HOH HOH B . 
H 3 HOH 4  77 13 HOH HOH B . 
H 3 HOH 5  78 18 HOH HOH B . 
H 3 HOH 6  79 20 HOH HOH B . 
#