data_2B22
# 
_entry.id   2B22 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2B22         
RCSB  RCSB034578   
WWPDB D_1000034578 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZTA 'X-ray structure of the GCN4 leucine zipper'                                                                 unspecified 
PDB 1GCM 'Crystal structure of Gcn4 Leucine Zipper Core Mutant P-Li'                                                  unspecified 
PDB 1GCL 'Crystal structure of the Gcn4 Leucine Zipper Core Mutant P-Li'                                              unspecified 
PDB 2B1F 'Crystal structure of antiparallel four-stranded coiled coil specified by a 3-3-1 hydrophobic heptad repeat' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2B22 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Deng, Y.'         1 
'Liu, J.'          2 
'Zheng, Q.'        3 
'Eliezer, D.'      4 
'Kallenbach, N.R.' 5 
'Lu, M.'           6 
# 
_citation.id                        primary 
_citation.title                     'Antiparallel four-stranded coiled coil specified by a 3-3-1 hydrophobic heptad repeat.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            14 
_citation.page_first                247 
_citation.page_last                 255 
_citation.year                      2006 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16472744 
_citation.pdbx_database_id_DOI      10.1016/j.str.2005.10.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Deng, Y.'         1 
primary 'Liu, J.'          2 
primary 'Zheng, Q.'        3 
primary 'Eliezer, D.'      4 
primary 'Kallenbach, N.R.' 5 
primary 'Lu, M.'           6 
# 
_cell.entry_id           2B22 
_cell.length_a           45.985 
_cell.length_b           45.985 
_cell.length_c           52.987 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2B22 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'General control protein GCN4' 3986.699 1 ? ? ? ? 
2 non-polymer syn 'SODIUM ION'                   22.990   2 ? ? ? ? 
3 water       nat water                          18.015   5 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Amino acid biosynthesis regulatory protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MKVKQLEDVVEELLSVNYHLENVVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   MKVKQLEDVVEELLSVNYHLENVVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LYS n 
1 3  VAL n 
1 4  LYS n 
1 5  GLN n 
1 6  LEU n 
1 7  GLU n 
1 8  ASP n 
1 9  VAL n 
1 10 VAL n 
1 11 GLU n 
1 12 GLU n 
1 13 LEU n 
1 14 LEU n 
1 15 SER n 
1 16 VAL n 
1 17 ASN n 
1 18 TYR n 
1 19 HIS n 
1 20 LEU n 
1 21 GLU n 
1 22 ASN n 
1 23 VAL n 
1 24 VAL n 
1 25 ALA n 
1 26 ARG n 
1 27 LEU n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 VAL n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 'GCN4, AAS3, ARG9' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21/pLysis 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   KQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           251 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2B22 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 34 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03069 
_struct_ref_seq.db_align_beg                  251 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  281 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2B22 MET A 1  ? UNP P03069 ?   ?   'CLONING ARTIFACT' 0  1 
1 2B22 LYS A 2  ? UNP P03069 ?   ?   'CLONING ARTIFACT' 1  2 
1 2B22 VAL A 3  ? UNP P03069 ?   ?   'CLONING ARTIFACT' 2  3 
1 2B22 VAL A 9  ? UNP P03069 LYS 256 ENGINEERED         8  4 
1 2B22 VAL A 16 ? UNP P03069 LYS 263 ENGINEERED         15 5 
1 2B22 VAL A 23 ? UNP P03069 GLU 270 ENGINEERED         22 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2B22 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.9 
_exptl_crystal.density_percent_sol   30 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'PEG 400, cadmium chloride, sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
# 
_reflns.entry_id                     2B22 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             34.7 
_reflns.number_all                   2063 
_reflns.number_obs                   2063 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        41.3 
_reflns.pdbx_redundancy              8.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.392 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.5 
_reflns_shell.pdbx_redundancy        9.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      199 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2B22 
_refine.ls_number_reflns_obs                     2063 
_refine.ls_number_reflns_all                     2063 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.7 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.23075 
_refine.ls_R_factor_all                          0.23075 
_refine.ls_R_factor_R_work                       0.22369 
_refine.ls_R_factor_R_free                       0.27629 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 13.8 
_refine.ls_number_reflns_R_free                  284 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.B_iso_mean                               54.231 
_refine.aniso_B[1][1]                            0.91 
_refine.aniso_B[2][2]                            0.91 
_refine.aniso_B[3][3]                            -1.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2B1F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.262 
_refine.pdbx_overall_ESU_R_Free                  0.217 
_refine.overall_SU_ML                            0.128 
_refine.overall_SU_B                             4.723 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        237 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               244 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        34.7 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.042  0.022  ? 238 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          3.173  2.001  ? 321 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.392  5.000  ? 28  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       57.326 26.364 ? 11  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       24.811 15.000 ? 50  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.355 15.000 ? 1   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.245  0.200  ? 42  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012  0.020  ? 163 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.320  0.200  ? 96  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.340  0.200  ? 162 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.030  0.200  ? 6   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.637  0.200  ? 1   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.364  0.200  ? 38  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.371  0.200  ? 2   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 0.202  0.200  ? 2   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.982  1.500  ? 144 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.165  2.000  ? 235 'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.273  3.000  ? 95  'X-RAY DIFFRACTION' ? 
r_scangle_it                 11.925 4.500  ? 86  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.999 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_R_work             120 
_refine_ls_shell.R_factor_R_work                  0.303 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             17 
_refine_ls_shell.number_reflns_obs                137 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2B22 
_struct.title                     'Antiparallel four-stranded coiled coil specified by a 3-3-1 hydrophobic heptad repeat' 
_struct.pdbx_descriptor           'General control protein GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2B22 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
_struct_keywords.text            
'Coiled coils, protein design, antiparallel tetramer, Ala coils, protein structure, BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a tetramer.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        3 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       VAL 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        31 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         2 
_struct_conf.end_auth_comp_id        VAL 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         30 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B NA  .  NA  ? ? ? 1_555 A ARG 26 NH2 ? ? A NA  34 A ARG 25 1_555  ? ? ? ? ? ? ? 1.813 ? 
metalc2 metalc ? ? B NA  .  NA  ? ? ? 1_555 A GLU 12 OE1 ? ? A NA  34 A GLU 11 16_555 ? ? ? ? ? ? ? 2.306 ? 
metalc3 metalc ? ? B NA  .  NA  ? ? ? 1_555 A GLU 12 OE2 ? ? A NA  34 A GLU 11 16_555 ? ? ? ? ? ? ? 2.143 ? 
metalc4 metalc ? ? A GLU 11 OE1 ? ? ? 1_555 C NA  .  NA  ? ? A GLU 10 A NA  35 1_555  ? ? ? ? ? ? ? 2.817 ? 
metalc5 metalc ? ? A GLU 11 OE2 ? ? ? 1_555 C NA  .  NA  ? ? A GLU 10 A NA  35 1_555  ? ? ? ? ? ? ? 2.758 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 34' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA A 35' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 LYS A 4  ? LYS A 3  . ? 5_555  ? 
2 AC1 3 GLU A 12 ? GLU A 11 . ? 16_555 ? 
3 AC1 3 ARG A 26 ? ARG A 25 . ? 1_555  ? 
4 AC2 2 GLU A 11 ? GLU A 10 . ? 1_555  ? 
5 AC2 2 HIS A 19 ? HIS A 18 . ? 5_555  ? 
# 
_database_PDB_matrix.entry_id          2B22 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2B22 
_atom_sites.fract_transf_matrix[1][1]   0.021746 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021746 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018873 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . VAL A 1 3  ? 19.040 3.909   36.036 1.00 75.72 ? 2  VAL A N   1 
ATOM   2   C  CA  . VAL A 1 3  ? 18.138 3.199   35.104 1.00 76.58 ? 2  VAL A CA  1 
ATOM   3   C  C   . VAL A 1 3  ? 17.298 4.064   34.153 1.00 76.28 ? 2  VAL A C   1 
ATOM   4   O  O   . VAL A 1 3  ? 17.068 3.621   32.997 1.00 77.04 ? 2  VAL A O   1 
ATOM   5   C  CB  . VAL A 1 3  ? 17.062 2.235   35.782 1.00 77.37 ? 2  VAL A CB  1 
ATOM   6   C  CG1 . VAL A 1 3  ? 17.582 0.782   36.005 1.00 78.27 ? 2  VAL A CG1 1 
ATOM   7   C  CG2 . VAL A 1 3  ? 16.369 2.883   37.015 1.00 78.12 ? 2  VAL A CG2 1 
ATOM   8   N  N   . LYS A 1 4  ? 16.750 5.203   34.614 1.00 73.84 ? 3  LYS A N   1 
ATOM   9   C  CA  . LYS A 1 4  ? 15.642 5.793   33.846 1.00 70.63 ? 3  LYS A CA  1 
ATOM   10  C  C   . LYS A 1 4  ? 16.306 6.279   32.603 1.00 68.33 ? 3  LYS A C   1 
ATOM   11  O  O   . LYS A 1 4  ? 15.783 6.234   31.541 1.00 65.82 ? 3  LYS A O   1 
ATOM   12  C  CB  . LYS A 1 4  ? 14.981 6.906   34.571 1.00 70.35 ? 3  LYS A CB  1 
ATOM   13  C  CG  . LYS A 1 4  ? 14.077 7.654   33.752 1.00 72.78 ? 3  LYS A CG  1 
ATOM   14  C  CD  . LYS A 1 4  ? 12.632 7.300   34.084 1.00 83.64 ? 3  LYS A CD  1 
ATOM   15  C  CE  . LYS A 1 4  ? 11.930 6.421   32.928 1.00 89.47 ? 3  LYS A CE  1 
ATOM   16  N  NZ  . LYS A 1 4  ? 10.612 7.018   32.307 1.00 86.28 ? 3  LYS A NZ  1 
ATOM   17  N  N   . GLN A 1 5  ? 17.558 6.632   32.740 1.00 67.62 ? 4  GLN A N   1 
ATOM   18  C  CA  . GLN A 1 5  ? 18.337 7.057   31.562 1.00 65.20 ? 4  GLN A CA  1 
ATOM   19  C  C   . GLN A 1 5  ? 18.678 5.844   30.652 1.00 61.63 ? 4  GLN A C   1 
ATOM   20  O  O   . GLN A 1 5  ? 18.677 5.976   29.425 1.00 60.61 ? 4  GLN A O   1 
ATOM   21  C  CB  . GLN A 1 5  ? 19.625 7.803   31.994 1.00 66.14 ? 4  GLN A CB  1 
ATOM   22  C  CG  . GLN A 1 5  ? 19.477 9.316   32.395 1.00 73.18 ? 4  GLN A CG  1 
ATOM   23  C  CD  . GLN A 1 5  ? 20.357 9.705   33.654 1.00 85.45 ? 4  GLN A CD  1 
ATOM   24  O  OE1 . GLN A 1 5  ? 19.833 9.814   34.804 1.00 91.51 ? 4  GLN A OE1 1 
ATOM   25  N  NE2 . GLN A 1 5  ? 21.698 9.935   33.431 1.00 91.31 ? 4  GLN A NE2 1 
ATOM   26  N  N   . LEU A 1 6  ? 18.978 4.719   31.269 1.00 57.29 ? 5  LEU A N   1 
ATOM   27  C  CA  . LEU A 1 6  ? 19.240 3.563   30.530 1.00 58.06 ? 5  LEU A CA  1 
ATOM   28  C  C   . LEU A 1 6  ? 18.042 3.065   29.701 1.00 57.04 ? 5  LEU A C   1 
ATOM   29  O  O   . LEU A 1 6  ? 18.197 2.482   28.646 1.00 56.03 ? 5  LEU A O   1 
ATOM   30  C  CB  . LEU A 1 6  ? 19.775 2.440   31.449 1.00 59.00 ? 5  LEU A CB  1 
ATOM   31  C  CG  . LEU A 1 6  ? 21.187 2.476   32.048 1.00 63.73 ? 5  LEU A CG  1 
ATOM   32  C  CD1 . LEU A 1 6  ? 21.496 1.109   32.518 1.00 71.18 ? 5  LEU A CD1 1 
ATOM   33  C  CD2 . LEU A 1 6  ? 22.381 2.944   31.141 1.00 66.83 ? 5  LEU A CD2 1 
ATOM   34  N  N   . GLU A 1 7  ? 16.854 3.166   30.231 1.00 55.04 ? 6  GLU A N   1 
ATOM   35  C  CA  . GLU A 1 7  ? 15.729 2.585   29.526 1.00 55.91 ? 6  GLU A CA  1 
ATOM   36  C  C   . GLU A 1 7  ? 15.333 3.569   28.384 1.00 54.34 ? 6  GLU A C   1 
ATOM   37  O  O   . GLU A 1 7  ? 14.854 3.239   27.316 1.00 53.93 ? 6  GLU A O   1 
ATOM   38  C  CB  . GLU A 1 7  ? 14.613 2.431   30.590 1.00 54.66 ? 6  GLU A CB  1 
ATOM   39  C  CG  . GLU A 1 7  ? 13.638 3.579   30.505 1.00 62.17 ? 6  GLU A CG  1 
ATOM   40  C  CD  . GLU A 1 7  ? 12.376 3.248   29.637 1.00 67.92 ? 6  GLU A CD  1 
ATOM   41  O  OE1 . GLU A 1 7  ? 11.725 2.286   30.055 1.00 73.59 ? 6  GLU A OE1 1 
ATOM   42  O  OE2 . GLU A 1 7  ? 12.029 3.940   28.643 1.00 62.93 ? 6  GLU A OE2 1 
ATOM   43  N  N   . ASP A 1 8  ? 15.557 4.840   28.568 1.00 53.34 ? 7  ASP A N   1 
ATOM   44  C  CA  . ASP A 1 8  ? 15.436 5.643   27.419 1.00 55.31 ? 7  ASP A CA  1 
ATOM   45  C  C   . ASP A 1 8  ? 16.493 5.367   26.296 1.00 54.85 ? 7  ASP A C   1 
ATOM   46  O  O   . ASP A 1 8  ? 16.120 5.408   25.091 1.00 54.22 ? 7  ASP A O   1 
ATOM   47  C  CB  . ASP A 1 8  ? 15.478 7.069   27.876 1.00 58.25 ? 7  ASP A CB  1 
ATOM   48  C  CG  . ASP A 1 8  ? 14.561 7.305   29.148 1.00 66.77 ? 7  ASP A CG  1 
ATOM   49  O  OD1 . ASP A 1 8  ? 13.282 7.078   29.107 1.00 79.29 ? 7  ASP A OD1 1 
ATOM   50  O  OD2 . ASP A 1 8  ? 15.133 7.724   30.191 1.00 72.37 ? 7  ASP A OD2 1 
ATOM   51  N  N   . VAL A 1 9  ? 17.789 5.114   26.620 1.00 52.60 ? 8  VAL A N   1 
ATOM   52  C  CA  . VAL A 1 9  ? 18.681 4.599   25.571 1.00 49.73 ? 8  VAL A CA  1 
ATOM   53  C  C   . VAL A 1 9  ? 18.149 3.315   24.917 1.00 46.31 ? 8  VAL A C   1 
ATOM   54  O  O   . VAL A 1 9  ? 18.205 3.198   23.701 1.00 47.57 ? 8  VAL A O   1 
ATOM   55  C  CB  . VAL A 1 9  ? 20.198 4.584   25.825 1.00 49.88 ? 8  VAL A CB  1 
ATOM   56  C  CG1 . VAL A 1 9  ? 20.533 5.276   27.024 1.00 53.95 ? 8  VAL A CG1 1 
ATOM   57  C  CG2 . VAL A 1 9  ? 20.859 3.188   25.476 1.00 52.56 ? 8  VAL A CG2 1 
ATOM   58  N  N   . VAL A 1 10 ? 17.651 2.368   25.701 1.00 43.47 ? 9  VAL A N   1 
ATOM   59  C  CA  . VAL A 1 10 ? 17.142 1.159   25.149 1.00 43.70 ? 9  VAL A CA  1 
ATOM   60  C  C   . VAL A 1 10 ? 16.041 1.458   24.213 1.00 43.93 ? 9  VAL A C   1 
ATOM   61  O  O   . VAL A 1 10 ? 16.023 0.947   23.150 1.00 42.06 ? 9  VAL A O   1 
ATOM   62  C  CB  . VAL A 1 10 ? 16.612 0.179   26.245 1.00 46.65 ? 9  VAL A CB  1 
ATOM   63  C  CG1 . VAL A 1 10 ? 15.954 -0.999  25.541 1.00 46.14 ? 9  VAL A CG1 1 
ATOM   64  C  CG2 . VAL A 1 10 ? 17.781 -0.288  27.121 1.00 47.68 ? 9  VAL A CG2 1 
ATOM   65  N  N   . GLU A 1 11 ? 15.112 2.338   24.576 1.00 44.98 ? 10 GLU A N   1 
ATOM   66  C  CA  . GLU A 1 11 ? 14.063 2.747   23.630 1.00 47.68 ? 10 GLU A CA  1 
ATOM   67  C  C   . GLU A 1 11 ? 14.607 3.252   22.314 1.00 45.42 ? 10 GLU A C   1 
ATOM   68  O  O   . GLU A 1 11 ? 14.138 2.794   21.238 1.00 43.87 ? 10 GLU A O   1 
ATOM   69  C  CB  . GLU A 1 11 ? 13.157 3.876   24.194 1.00 47.46 ? 10 GLU A CB  1 
ATOM   70  C  CG  . GLU A 1 11 ? 12.195 3.220   25.114 1.00 55.95 ? 10 GLU A CG  1 
ATOM   71  C  CD  . GLU A 1 11 ? 11.198 4.194   25.673 1.00 61.38 ? 10 GLU A CD  1 
ATOM   72  O  OE1 . GLU A 1 11 ? 10.698 3.835   26.776 1.00 73.48 ? 10 GLU A OE1 1 
ATOM   73  O  OE2 . GLU A 1 11 ? 10.960 5.266   25.054 1.00 66.27 ? 10 GLU A OE2 1 
ATOM   74  N  N   . GLU A 1 12 ? 15.462 4.227   22.330 1.00 42.02 ? 11 GLU A N   1 
ATOM   75  C  CA  . GLU A 1 12 ? 16.063 4.687   21.089 1.00 43.62 ? 11 GLU A CA  1 
ATOM   76  C  C   . GLU A 1 12 ? 16.817 3.581   20.285 1.00 39.07 ? 11 GLU A C   1 
ATOM   77  O  O   . GLU A 1 12 ? 16.819 3.572   19.083 1.00 39.46 ? 11 GLU A O   1 
ATOM   78  C  CB  . GLU A 1 12 ? 17.033 5.894   21.353 1.00 43.75 ? 11 GLU A CB  1 
ATOM   79  C  CG  . GLU A 1 12 ? 16.468 7.413   21.193 1.00 60.80 ? 11 GLU A CG  1 
ATOM   80  C  CD  . GLU A 1 12 ? 17.666 8.644   21.203 1.00 74.86 ? 11 GLU A CD  1 
ATOM   81  O  OE1 . GLU A 1 12 ? 18.214 9.063   20.103 1.00 76.15 ? 11 GLU A OE1 1 
ATOM   82  O  OE2 . GLU A 1 12 ? 18.031 9.246   22.292 1.00 78.38 ? 11 GLU A OE2 1 
ATOM   83  N  N   . LEU A 1 13 ? 17.515 2.686   20.965 1.00 39.54 ? 12 LEU A N   1 
ATOM   84  C  CA  . LEU A 1 13 ? 18.165 1.546   20.233 1.00 40.35 ? 12 LEU A CA  1 
ATOM   85  C  C   . LEU A 1 13 ? 17.168 0.558   19.468 1.00 39.39 ? 12 LEU A C   1 
ATOM   86  O  O   . LEU A 1 13 ? 17.380 0.056   18.381 1.00 39.94 ? 12 LEU A O   1 
ATOM   87  C  CB  . LEU A 1 13 ? 19.111 0.737   21.144 1.00 39.88 ? 12 LEU A CB  1 
ATOM   88  C  CG  . LEU A 1 13 ? 20.509 1.408   21.462 1.00 44.68 ? 12 LEU A CG  1 
ATOM   89  C  CD1 . LEU A 1 13 ? 21.130 0.511   22.592 1.00 45.10 ? 12 LEU A CD1 1 
ATOM   90  C  CD2 . LEU A 1 13 ? 21.381 1.668   20.092 1.00 43.96 ? 12 LEU A CD2 1 
ATOM   91  N  N   . LEU A 1 14 ? 16.076 0.261   20.141 1.00 38.00 ? 13 LEU A N   1 
ATOM   92  C  CA  . LEU A 1 14 ? 15.010 -0.502  19.561 1.00 38.32 ? 13 LEU A CA  1 
ATOM   93  C  C   . LEU A 1 14 ? 14.595 0.181   18.367 1.00 38.27 ? 13 LEU A C   1 
ATOM   94  O  O   . LEU A 1 14 ? 14.370 -0.499  17.394 1.00 40.17 ? 13 LEU A O   1 
ATOM   95  C  CB  . LEU A 1 14 ? 13.762 -0.594  20.529 1.00 41.45 ? 13 LEU A CB  1 
ATOM   96  C  CG  . LEU A 1 14 ? 13.913 -1.582  21.676 1.00 48.87 ? 13 LEU A CG  1 
ATOM   97  C  CD1 . LEU A 1 14 ? 12.668 -1.383  22.729 1.00 51.12 ? 13 LEU A CD1 1 
ATOM   98  C  CD2 . LEU A 1 14 ? 13.999 -3.043  21.087 1.00 53.43 ? 13 LEU A CD2 1 
ATOM   99  N  N   . SER A 1 15 ? 14.286 1.484   18.401 1.00 39.52 ? 14 SER A N   1 
ATOM   100 C  CA  . SER A 1 15 ? 13.835 2.133   17.171 1.00 39.60 ? 14 SER A CA  1 
ATOM   101 C  C   . SER A 1 15 ? 14.891 2.217   16.098 1.00 39.19 ? 14 SER A C   1 
ATOM   102 O  O   . SER A 1 15 ? 14.551 1.999   14.955 1.00 39.62 ? 14 SER A O   1 
ATOM   103 C  CB  . SER A 1 15 ? 13.544 3.614   17.444 1.00 42.61 ? 14 SER A CB  1 
ATOM   104 O  OG  . SER A 1 15 ? 12.641 3.747   18.590 1.00 55.18 ? 14 SER A OG  1 
ATOM   105 N  N   . VAL A 1 16 ? 16.149 2.527   16.454 1.00 37.59 ? 15 VAL A N   1 
ATOM   106 C  CA  . VAL A 1 16 ? 17.187 2.555   15.462 1.00 38.95 ? 15 VAL A CA  1 
ATOM   107 C  C   . VAL A 1 16 ? 17.312 1.146   14.801 1.00 34.55 ? 15 VAL A C   1 
ATOM   108 O  O   . VAL A 1 16 ? 17.509 0.964   13.570 1.00 37.14 ? 15 VAL A O   1 
ATOM   109 C  CB  . VAL A 1 16 ? 18.521 3.042   16.115 1.00 39.77 ? 15 VAL A CB  1 
ATOM   110 C  CG1 . VAL A 1 16 ? 19.716 2.731   15.300 1.00 46.97 ? 15 VAL A CG1 1 
ATOM   111 C  CG2 . VAL A 1 16 ? 18.369 4.543   16.293 1.00 50.21 ? 15 VAL A CG2 1 
ATOM   112 N  N   . ASN A 1 17 ? 17.228 0.127   15.605 1.00 34.03 ? 16 ASN A N   1 
ATOM   113 C  CA  . ASN A 1 17 ? 17.426 -1.200  15.055 1.00 34.47 ? 16 ASN A CA  1 
ATOM   114 C  C   . ASN A 1 17 ? 16.281 -1.596  14.031 1.00 36.35 ? 16 ASN A C   1 
ATOM   115 O  O   . ASN A 1 17 ? 16.450 -2.233  12.986 1.00 35.13 ? 16 ASN A O   1 
ATOM   116 C  CB  . ASN A 1 17 ? 17.331 -2.101  16.285 1.00 37.25 ? 16 ASN A CB  1 
ATOM   117 C  CG  . ASN A 1 17 ? 17.583 -3.548  15.935 1.00 47.86 ? 16 ASN A CG  1 
ATOM   118 O  OD1 . ASN A 1 17 ? 18.617 -3.886  15.331 1.00 52.71 ? 16 ASN A OD1 1 
ATOM   119 N  ND2 . ASN A 1 17 ? 16.578 -4.422  16.236 1.00 56.67 ? 16 ASN A ND2 1 
ATOM   120 N  N   . TYR A 1 18 ? 15.050 -1.183  14.385 1.00 33.63 ? 17 TYR A N   1 
ATOM   121 C  CA  . TYR A 1 18 ? 13.872 -1.488  13.475 1.00 35.23 ? 17 TYR A CA  1 
ATOM   122 C  C   . TYR A 1 18 ? 14.014 -0.743  12.234 1.00 32.74 ? 17 TYR A C   1 
ATOM   123 O  O   . TYR A 1 18 ? 13.806 -1.234  11.121 1.00 34.51 ? 17 TYR A O   1 
ATOM   124 C  CB  . TYR A 1 18 ? 12.605 -0.967  14.172 1.00 36.04 ? 17 TYR A CB  1 
ATOM   125 C  CG  . TYR A 1 18 ? 11.359 -1.265  13.253 1.00 35.72 ? 17 TYR A CG  1 
ATOM   126 C  CD1 . TYR A 1 18 ? 11.020 -2.606  12.944 1.00 40.27 ? 17 TYR A CD1 1 
ATOM   127 C  CD2 . TYR A 1 18 ? 10.649 -0.253  12.727 1.00 40.72 ? 17 TYR A CD2 1 
ATOM   128 C  CE1 . TYR A 1 18 ? 9.939  -2.895  12.152 1.00 48.56 ? 17 TYR A CE1 1 
ATOM   129 C  CE2 . TYR A 1 18 ? 9.494  -0.500  11.893 1.00 42.41 ? 17 TYR A CE2 1 
ATOM   130 C  CZ  . TYR A 1 18 ? 9.157  -1.850  11.640 1.00 45.34 ? 17 TYR A CZ  1 
ATOM   131 O  OH  . TYR A 1 18 ? 8.062  -2.269  10.797 1.00 56.88 ? 17 TYR A OH  1 
ATOM   132 N  N   . HIS A 1 19 ? 14.378 0.518   12.398 1.00 34.79 ? 18 HIS A N   1 
ATOM   133 C  CA  . HIS A 1 19 ? 14.588 1.391   11.226 1.00 35.63 ? 18 HIS A CA  1 
ATOM   134 C  C   . HIS A 1 19 ? 15.728 0.909   10.268 1.00 37.31 ? 18 HIS A C   1 
ATOM   135 O  O   . HIS A 1 19 ? 15.551 0.777   9.032  1.00 36.52 ? 18 HIS A O   1 
ATOM   136 C  CB  . HIS A 1 19 ? 14.982 2.734   11.680 1.00 38.86 ? 18 HIS A CB  1 
ATOM   137 C  CG  . HIS A 1 19 ? 14.833 3.696   10.573 1.00 47.28 ? 18 HIS A CG  1 
ATOM   138 N  ND1 . HIS A 1 19 ? 15.420 4.937   10.564 1.00 58.85 ? 18 HIS A ND1 1 
ATOM   139 C  CD2 . HIS A 1 19 ? 14.297 3.520   9.328  1.00 54.26 ? 18 HIS A CD2 1 
ATOM   140 C  CE1 . HIS A 1 19 ? 15.202 5.503   9.383  1.00 54.68 ? 18 HIS A CE1 1 
ATOM   141 N  NE2 . HIS A 1 19 ? 14.523 4.665   8.621  1.00 53.05 ? 18 HIS A NE2 1 
ATOM   142 N  N   . LEU A 1 20 ? 16.840 0.490   10.848 1.00 34.87 ? 19 LEU A N   1 
ATOM   143 C  CA  . LEU A 1 20 ? 17.872 -0.216  9.995  1.00 33.88 ? 19 LEU A CA  1 
ATOM   144 C  C   . LEU A 1 20 ? 17.318 -1.514  9.327  1.00 37.11 ? 19 LEU A C   1 
ATOM   145 O  O   . LEU A 1 20 ? 17.621 -1.848  8.160  1.00 36.53 ? 19 LEU A O   1 
ATOM   146 C  CB  . LEU A 1 20 ? 19.038 -0.635  10.911 1.00 33.53 ? 19 LEU A CB  1 
ATOM   147 C  CG  . LEU A 1 20 ? 20.238 -1.251  10.076 1.00 39.06 ? 19 LEU A CG  1 
ATOM   148 C  CD1 . LEU A 1 20 ? 20.818 -0.279  9.084  1.00 37.25 ? 19 LEU A CD1 1 
ATOM   149 C  CD2 . LEU A 1 20 ? 21.229 -1.709  11.204 1.00 39.15 ? 19 LEU A CD2 1 
ATOM   150 N  N   . GLU A 1 21 ? 16.506 -2.294  10.045 1.00 37.16 ? 20 GLU A N   1 
ATOM   151 C  CA  . GLU A 1 21 ? 16.089 -3.462  9.358  1.00 40.24 ? 20 GLU A CA  1 
ATOM   152 C  C   . GLU A 1 21 ? 15.179 -3.196  8.214  1.00 39.23 ? 20 GLU A C   1 
ATOM   153 O  O   . GLU A 1 21 ? 15.229 -3.890  7.209  1.00 39.19 ? 20 GLU A O   1 
ATOM   154 C  CB  . GLU A 1 21 ? 15.617 -4.576  10.314 1.00 43.00 ? 20 GLU A CB  1 
ATOM   155 C  CG  . GLU A 1 21 ? 14.431 -4.244  11.087 1.00 57.70 ? 20 GLU A CG  1 
ATOM   156 C  CD  . GLU A 1 21 ? 13.950 -5.470  11.878 1.00 72.10 ? 20 GLU A CD  1 
ATOM   157 O  OE1 . GLU A 1 21 ? 14.688 -5.930  12.855 1.00 77.63 ? 20 GLU A OE1 1 
ATOM   158 O  OE2 . GLU A 1 21 ? 12.851 -5.933  11.493 1.00 70.57 ? 20 GLU A OE2 1 
ATOM   159 N  N   . ASN A 1 22 ? 14.418 -2.113  8.271  1.00 37.63 ? 21 ASN A N   1 
ATOM   160 C  CA  . ASN A 1 22 ? 13.561 -1.798  7.129  1.00 39.83 ? 21 ASN A CA  1 
ATOM   161 C  C   . ASN A 1 22 ? 14.322 -1.219  5.970  1.00 41.11 ? 21 ASN A C   1 
ATOM   162 O  O   . ASN A 1 22 ? 14.053 -1.524  4.817  1.00 40.71 ? 21 ASN A O   1 
ATOM   163 C  CB  . ASN A 1 22 ? 12.594 -0.623  7.521  1.00 40.59 ? 21 ASN A CB  1 
ATOM   164 C  CG  . ASN A 1 22 ? 11.382 -1.130  8.235  1.00 51.24 ? 21 ASN A CG  1 
ATOM   165 O  OD1 . ASN A 1 22 ? 11.018 -2.270  8.077  1.00 56.27 ? 21 ASN A OD1 1 
ATOM   166 N  ND2 . ASN A 1 22 ? 10.759 -0.285  9.060  1.00 55.57 ? 21 ASN A ND2 1 
ATOM   167 N  N   . VAL A 1 23 ? 15.300 -0.367  6.247  1.00 38.00 ? 22 VAL A N   1 
ATOM   168 C  CA  . VAL A 1 23 ? 16.174 0.114   5.160  1.00 41.39 ? 22 VAL A CA  1 
ATOM   169 C  C   . VAL A 1 23 ? 17.019 -1.058  4.539  1.00 39.19 ? 22 VAL A C   1 
ATOM   170 O  O   . VAL A 1 23 ? 17.195 -1.051  3.314  1.00 41.61 ? 22 VAL A O   1 
ATOM   171 C  CB  . VAL A 1 23 ? 17.158 1.234   5.705  1.00 45.80 ? 22 VAL A CB  1 
ATOM   172 C  CG1 . VAL A 1 23 ? 17.871 2.023   4.551  1.00 47.00 ? 22 VAL A CG1 1 
ATOM   173 C  CG2 . VAL A 1 23 ? 16.295 2.242   6.381  1.00 46.94 ? 22 VAL A CG2 1 
ATOM   174 N  N   . VAL A 1 24 ? 17.583 -1.946  5.337  1.00 38.72 ? 23 VAL A N   1 
ATOM   175 C  CA  . VAL A 1 24 ? 18.263 -3.113  4.740  1.00 42.67 ? 23 VAL A CA  1 
ATOM   176 C  C   . VAL A 1 24 ? 17.384 -4.041  3.827  1.00 45.79 ? 23 VAL A C   1 
ATOM   177 O  O   . VAL A 1 24 ? 17.861 -4.542  2.769  1.00 47.64 ? 23 VAL A O   1 
ATOM   178 C  CB  . VAL A 1 24 ? 19.006 -3.960  5.762  1.00 43.01 ? 23 VAL A CB  1 
ATOM   179 C  CG1 . VAL A 1 24 ? 19.721 -5.177  5.017  1.00 48.26 ? 23 VAL A CG1 1 
ATOM   180 C  CG2 . VAL A 1 24 ? 20.074 -3.046  6.535  1.00 40.61 ? 23 VAL A CG2 1 
ATOM   181 N  N   . ALA A 1 25 ? 16.166 -4.375  4.282  1.00 46.43 ? 24 ALA A N   1 
ATOM   182 C  CA  . ALA A 1 25 ? 15.129 -5.057  3.438  1.00 45.85 ? 24 ALA A CA  1 
ATOM   183 C  C   . ALA A 1 25 ? 14.821 -4.303  2.175  1.00 46.56 ? 24 ALA A C   1 
ATOM   184 O  O   . ALA A 1 25 ? 14.665 -4.874  1.115  1.00 49.09 ? 24 ALA A O   1 
ATOM   185 C  CB  . ALA A 1 25 ? 13.875 -5.292  4.252  1.00 48.09 ? 24 ALA A CB  1 
ATOM   186 N  N   . ARG A 1 26 ? 14.677 -3.002  2.216  1.00 46.60 ? 25 ARG A N   1 
ATOM   187 C  CA  . ARG A 1 26 ? 14.488 -2.249  1.008  1.00 45.63 ? 25 ARG A CA  1 
ATOM   188 C  C   . ARG A 1 26 ? 15.737 -2.339  0.045  1.00 49.39 ? 25 ARG A C   1 
ATOM   189 O  O   . ARG A 1 26 ? 15.570 -2.528  -1.174 1.00 50.07 ? 25 ARG A O   1 
ATOM   190 C  CB  . ARG A 1 26 ? 14.073 -0.822  1.471  1.00 49.26 ? 25 ARG A CB  1 
ATOM   191 C  CG  . ARG A 1 26 ? 14.131 0.439   0.477  1.00 56.08 ? 25 ARG A CG  1 
ATOM   192 C  CD  . ARG A 1 26 ? 13.023 1.658   0.742  1.00 68.40 ? 25 ARG A CD  1 
ATOM   193 N  NE  . ARG A 1 26 ? 12.773 2.086   2.172  1.00 79.97 ? 25 ARG A NE  1 
ATOM   194 C  CZ  . ARG A 1 26 ? 11.732 1.757   2.986  1.00 85.07 ? 25 ARG A CZ  1 
ATOM   195 N  NH1 . ARG A 1 26 ? 10.711 0.976   2.630  1.00 85.59 ? 25 ARG A NH1 1 
ATOM   196 N  NH2 . ARG A 1 26 ? 11.713 2.243   4.229  1.00 92.14 ? 25 ARG A NH2 1 
ATOM   197 N  N   . LEU A 1 27 ? 16.975 -2.203  0.578  1.00 47.27 ? 26 LEU A N   1 
ATOM   198 C  CA  . LEU A 1 27 ? 18.222 -2.300  -0.166 1.00 48.99 ? 26 LEU A CA  1 
ATOM   199 C  C   . LEU A 1 27 ? 18.357 -3.651  -0.822 1.00 49.15 ? 26 LEU A C   1 
ATOM   200 O  O   . LEU A 1 27 ? 18.840 -3.774  -1.970 1.00 51.37 ? 26 LEU A O   1 
ATOM   201 C  CB  . LEU A 1 27 ? 19.380 -2.034  0.783  1.00 47.80 ? 26 LEU A CB  1 
ATOM   202 C  CG  . LEU A 1 27 ? 20.691 -2.013  0.058  1.00 50.84 ? 26 LEU A CG  1 
ATOM   203 C  CD1 . LEU A 1 27 ? 20.686 -0.994  -1.075 1.00 46.52 ? 26 LEU A CD1 1 
ATOM   204 C  CD2 . LEU A 1 27 ? 21.922 -1.749  0.986  1.00 44.79 ? 26 LEU A CD2 1 
ATOM   205 N  N   . LYS A 1 28 ? 17.991 -4.683  -0.092 1.00 50.35 ? 27 LYS A N   1 
ATOM   206 C  CA  . LYS A 1 28 ? 18.222 -5.976  -0.580 1.00 53.89 ? 27 LYS A CA  1 
ATOM   207 C  C   . LYS A 1 28 ? 17.311 -6.353  -1.739 1.00 57.42 ? 27 LYS A C   1 
ATOM   208 O  O   . LYS A 1 28 ? 17.633 -7.234  -2.493 1.00 61.03 ? 27 LYS A O   1 
ATOM   209 C  CB  . LYS A 1 28 ? 18.213 -7.001  0.540  1.00 54.67 ? 27 LYS A CB  1 
ATOM   210 C  CG  . LYS A 1 28 ? 17.235 -8.117  0.366  1.00 56.78 ? 27 LYS A CG  1 
ATOM   211 C  CD  . LYS A 1 28 ? 17.462 -9.325  1.439  1.00 68.57 ? 27 LYS A CD  1 
ATOM   212 C  CE  . LYS A 1 28 ? 16.924 -10.718 0.878  1.00 74.37 ? 27 LYS A CE  1 
ATOM   213 N  NZ  . LYS A 1 28 ? 17.263 -11.993 1.688  1.00 85.83 ? 27 LYS A NZ  1 
ATOM   214 N  N   . LYS A 1 29 ? 16.234 -5.671  -1.954 1.00 59.91 ? 28 LYS A N   1 
ATOM   215 C  CA  . LYS A 1 29 ? 15.384 -5.937  -3.032 1.00 62.05 ? 28 LYS A CA  1 
ATOM   216 C  C   . LYS A 1 29 ? 15.653 -4.894  -4.078 1.00 63.83 ? 28 LYS A C   1 
ATOM   217 O  O   . LYS A 1 29 ? 15.436 -5.140  -5.249 1.00 64.79 ? 28 LYS A O   1 
ATOM   218 C  CB  . LYS A 1 29 ? 13.969 -5.743  -2.543 1.00 62.30 ? 28 LYS A CB  1 
ATOM   219 C  CG  . LYS A 1 29 ? 13.256 -7.056  -2.394 1.00 68.45 ? 28 LYS A CG  1 
ATOM   220 C  CD  . LYS A 1 29 ? 12.523 -7.128  -1.060 1.00 78.07 ? 28 LYS A CD  1 
ATOM   221 C  CE  . LYS A 1 29 ? 13.607 -7.471  0.033  1.00 82.08 ? 28 LYS A CE  1 
ATOM   222 N  NZ  . LYS A 1 29 ? 13.244 -8.142  1.395  1.00 81.42 ? 28 LYS A NZ  1 
ATOM   223 N  N   . LEU A 1 30 ? 16.110 -3.703  -3.722 1.00 64.04 ? 29 LEU A N   1 
ATOM   224 C  CA  . LEU A 1 30 ? 16.672 -2.870  -4.793 1.00 65.19 ? 29 LEU A CA  1 
ATOM   225 C  C   . LEU A 1 30 ? 17.802 -3.561  -5.525 1.00 67.09 ? 29 LEU A C   1 
ATOM   226 O  O   . LEU A 1 30 ? 17.838 -3.594  -6.744 1.00 69.42 ? 29 LEU A O   1 
ATOM   227 C  CB  . LEU A 1 30 ? 17.174 -1.496  -4.326 1.00 63.47 ? 29 LEU A CB  1 
ATOM   228 C  CG  . LEU A 1 30 ? 15.929 -0.766  -3.945 1.00 64.67 ? 29 LEU A CG  1 
ATOM   229 C  CD1 . LEU A 1 30 ? 16.334 0.337   -2.988 1.00 67.85 ? 29 LEU A CD1 1 
ATOM   230 C  CD2 . LEU A 1 30 ? 15.242 -0.305  -5.192 1.00 58.36 ? 29 LEU A CD2 1 
ATOM   231 N  N   . VAL A 1 31 ? 18.751 -4.063  -4.768 1.00 68.90 ? 30 VAL A N   1 
ATOM   232 C  CA  . VAL A 1 31 ? 19.995 -4.587  -5.303 1.00 70.42 ? 30 VAL A CA  1 
ATOM   233 C  C   . VAL A 1 31 ? 19.801 -6.032  -5.911 1.00 72.43 ? 30 VAL A C   1 
ATOM   234 O  O   . VAL A 1 31 ? 20.695 -6.618  -6.607 1.00 72.98 ? 30 VAL A O   1 
ATOM   235 C  CB  . VAL A 1 31 ? 21.109 -4.499  -4.149 1.00 70.38 ? 30 VAL A CB  1 
ATOM   236 C  CG1 . VAL A 1 31 ? 22.327 -5.387  -4.429 1.00 71.18 ? 30 VAL A CG1 1 
ATOM   237 C  CG2 . VAL A 1 31 ? 21.522 -3.068  -3.930 1.00 67.23 ? 30 VAL A CG2 1 
HETATM 238 NA NA  . NA  B 2 .  ? 12.323 3.676   5.157  1.00 53.55 ? 34 NA  A NA  1 
HETATM 239 NA NA  . NA  C 2 .  ? 8.719  5.828   26.561 1.00 56.23 ? 35 NA  A NA  1 
HETATM 240 O  O   . HOH D 3 .  ? 13.979 -3.153  17.341 1.00 41.20 ? 36 HOH A O   1 
HETATM 241 O  O   . HOH D 3 .  ? 16.151 -6.518  6.746  1.00 54.57 ? 37 HOH A O   1 
HETATM 242 O  O   . HOH D 3 .  ? 15.949 -14.164 3.000  1.00 67.55 ? 38 HOH A O   1 
HETATM 243 O  O   . HOH D 3 .  ? 9.907  -0.914  -2.715 1.00 69.83 ? 39 HOH A O   1 
HETATM 244 O  O   . HOH D 3 .  ? 11.546 -3.100  -2.501 1.00 72.09 ? 40 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  ?  ?   ?   A . n 
A 1 2  LYS 2  1  ?  ?   ?   A . n 
A 1 3  VAL 3  2  2  VAL VAL A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  LEU 6  5  5  LEU LEU A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 LEU 13 12 12 LEU LEU A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 VAL 16 15 15 VAL VAL A . n 
A 1 17 ASN 17 16 16 ASN ASN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 LEU 20 19 19 LEU LEU A . n 
A 1 21 GLU 21 20 20 GLU GLU A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 VAL 23 22 22 VAL VAL A . n 
A 1 24 VAL 24 23 23 VAL VAL A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 LEU 27 26 26 LEU LEU A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 VAL 31 30 30 VAL VAL A . n 
A 1 32 GLY 32 31 ?  ?   ?   A . n 
A 1 33 GLU 33 32 ?  ?   ?   A . n 
A 1 34 ARG 34 33 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1 34 1 NA  NA  A . 
C 2 NA  1 35 2 NA  NA  A . 
D 3 HOH 1 36 3 HOH WAT A . 
D 3 HOH 2 37 4 HOH WAT A . 
D 3 HOH 3 38 5 HOH WAT A . 
D 3 HOH 4 39 6 HOH WAT A . 
D 3 HOH 5 40 7 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6690 ? 
1 MORE         -128 ? 
1 'SSA (A^2)'  6790 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 7_545  y+1/2,x-1/2,-z+1/2   0.0000000000  1.0000000000  0.0000000000 22.9925000000 1.0000000000  
0.0000000000  0.0000000000 -22.9925000000 0.0000000000 0.0000000000 -1.0000000000 26.4935000000 
3 'crystal symmetry operation' 10_655 -x+1,-y,z            -1.0000000000 0.0000000000  0.0000000000 45.9850000000 0.0000000000  
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
4 'crystal symmetry operation' 16_555 -y+1/2,-x+1/2,-z+1/2 0.0000000000  -1.0000000000 0.0000000000 22.9925000000 -1.0000000000 
0.0000000000  0.0000000000 22.9925000000  0.0000000000 0.0000000000 -1.0000000000 26.4935000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NH2 ? A ARG 26 ? A ARG 25 ? 1_555  NA ? B NA . ? A NA 34 ? 1_555 OE1 ? A GLU 12 ? A GLU 11 ? 16_555 152.4 ? 
2 NH2 ? A ARG 26 ? A ARG 25 ? 1_555  NA ? B NA . ? A NA 34 ? 1_555 OE2 ? A GLU 12 ? A GLU 11 ? 16_555 118.0 ? 
3 OE1 ? A GLU 12 ? A GLU 11 ? 16_555 NA ? B NA . ? A NA 34 ? 1_555 OE2 ? A GLU 12 ? A GLU 11 ? 16_555 59.3  ? 
4 OE1 ? A GLU 11 ? A GLU 10 ? 1_555  NA ? C NA . ? A NA 35 ? 1_555 OE2 ? A GLU 11 ? A GLU 10 ? 1_555  47.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-31 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LYS 
_pdbx_validate_close_contact.auth_seq_id_1    3 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    7 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A GLU 11 ? ? CD A GLU 11 ? ? 1.718 1.515 0.203 0.015 N 
2 1 CG A ARG 25 ? ? CD A ARG 25 ? ? 1.668 1.515 0.153 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG1 A VAL 8  ? ? CB A VAL 8  ? ? CG2 A VAL 8  ? ? 121.04 110.90 10.14 1.60 N 
2 1 NE  A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 124.55 120.30 4.25  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 0  ? A MET 1  
2 1 Y 1 A LYS 1  ? A LYS 2  
3 1 Y 1 A GLY 31 ? A GLY 32 
4 1 Y 1 A GLU 32 ? A GLU 33 
5 1 Y 1 A ARG 33 ? A ARG 34 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION' NA  
3 water        HOH 
#