data_2B2T
# 
_entry.id   2B2T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2B2T         
RCSB  RCSB034605   
WWPDB D_1000034605 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1kna 'Crystal structure of th Chromo Domain Of Hp1 Complexed With Histone H3 Tail Containing Dimethyllysine 9' unspecified 
PDB 1kne 'Crystal structure of the Chromo Domain Of Hp1 Complexed With Histone H3 Tail Containing Trimethyllysine 9' unspecified 
PDB 1q3l 'Crystal structure of the Chromodomain Of Hp1 Complexed With Histone H3 Tail Containing Monomethyllysine 9' unspecified 
PDB 1pdq 'Crystal structure of the polycomb Chromodomain Complexed With The Histone H3 Tail Containing Trimethyllysine 27' 
unspecified 
PDB 2B2U 
;Crystal structure of the tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and dimethylarginine 2
;
unspecified 
PDB 2B2V 'Crystal structure of human CHD1 chromodomains 1 and 2 bound to histone H3 resi 1-15 MeK4' unspecified 
PDB 2B2W 
'Crystal structures of the Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4' 
unspecified 
PDB 2B2Y 'Crystal structure of the tandem chromodomains of human CHD1' unspecified 
# 
_pdbx_database_status.entry_id                        2B2T 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Flanagan IV, J.F.'  1 
'Mi, L.-Z.'          2 
'Chruszcz, M.'       3 
'Cymborowski, M.'    4 
'Clines, K.L.'       5 
'Kim, Y.'            6 
'Minor, W.'          7 
'Rastinejad, F.'     8 
'Khorasanizadeh, S.' 9 
# 
_citation.id                        primary 
_citation.title                     'Double chromodomains cooperate to recognize the methylated histone H3 tail.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            438 
_citation.page_first                1181 
_citation.page_last                 1185 
_citation.year                      2005 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16372014 
_citation.pdbx_database_id_DOI      10.1038/nature04290 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Flanagan, J.F.'     1 
primary 'Mi, L.Z.'           2 
primary 'Chruszcz, M.'       3 
primary 'Cymborowski, M.'    4 
primary 'Clines, K.L.'       5 
primary 'Kim, Y.'            6 
primary 'Minor, W.'          7 
primary 'Rastinejad, F.'     8 
primary 'Khorasanizadeh, S.' 9 
# 
_cell.entry_id           2B2T 
_cell.length_a           111.986 
_cell.length_b           54.686 
_cell.length_c           100.989 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.15 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2B2T 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Chromodomain-helicase-DNA-binding protein 1' 22362.396 2   ? C436M 'residues 268-443' ? 
2 polymer man 'Chromodomain-helicase-DNA-binding protein 1' 13834.978 1   ? ?     'residues 268-373' ? 
3 polymer syn 'Histone H3 tail'                             2362.648  1   ? ?     'residues 1-19'    ? 
4 water   nat water                                         18.015    258 ? ?     ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 CHD-1 
2 CHD-1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;(MSE)KKHHHHHHEEEFETIERF(MSE)DCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHN
TWETEETLKQQNVRG(MSE)KKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGY
PDYYCKWQGLPYSECSWEDGALISKKFQA(MSE)IDEYFSRKK
;
;MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETL
KQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPY
SECSWEDGALISKKFQAMIDEYFSRKK
;
A,B ? 
2 'polypeptide(L)' no yes 
;(MSE)KKHHHHHHEEEFETIERF(MSE)DCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHN
TWETEETLKQQNVRG(MSE)KKLDNYKKKDQETKRWLKNASPEDVEY
;
;MKKHHHHHHEEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETL
KQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEY
;
C   ? 
3 'polypeptide(L)' no yes 'AR(TPO)(M3L)QTARKSTGGKAPRKQY' ARTKQTARKSTGGKAPRKQY D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   LYS n 
1 3   LYS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  GLU n 
1 11  GLU n 
1 12  GLU n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  ILE n 
1 17  GLU n 
1 18  ARG n 
1 19  PHE n 
1 20  MSE n 
1 21  ASP n 
1 22  CYS n 
1 23  ARG n 
1 24  ILE n 
1 25  GLY n 
1 26  ARG n 
1 27  LYS n 
1 28  GLY n 
1 29  ALA n 
1 30  THR n 
1 31  GLY n 
1 32  ALA n 
1 33  THR n 
1 34  THR n 
1 35  THR n 
1 36  ILE n 
1 37  TYR n 
1 38  ALA n 
1 39  VAL n 
1 40  GLU n 
1 41  ALA n 
1 42  ASP n 
1 43  GLY n 
1 44  ASP n 
1 45  PRO n 
1 46  ASN n 
1 47  ALA n 
1 48  GLY n 
1 49  PHE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  LYS n 
1 54  GLU n 
1 55  PRO n 
1 56  GLY n 
1 57  GLU n 
1 58  ILE n 
1 59  GLN n 
1 60  TYR n 
1 61  LEU n 
1 62  ILE n 
1 63  LYS n 
1 64  TRP n 
1 65  LYS n 
1 66  GLY n 
1 67  TRP n 
1 68  SER n 
1 69  HIS n 
1 70  ILE n 
1 71  HIS n 
1 72  ASN n 
1 73  THR n 
1 74  TRP n 
1 75  GLU n 
1 76  THR n 
1 77  GLU n 
1 78  GLU n 
1 79  THR n 
1 80  LEU n 
1 81  LYS n 
1 82  GLN n 
1 83  GLN n 
1 84  ASN n 
1 85  VAL n 
1 86  ARG n 
1 87  GLY n 
1 88  MSE n 
1 89  LYS n 
1 90  LYS n 
1 91  LEU n 
1 92  ASP n 
1 93  ASN n 
1 94  TYR n 
1 95  LYS n 
1 96  LYS n 
1 97  LYS n 
1 98  ASP n 
1 99  GLN n 
1 100 GLU n 
1 101 THR n 
1 102 LYS n 
1 103 ARG n 
1 104 TRP n 
1 105 LEU n 
1 106 LYS n 
1 107 ASN n 
1 108 ALA n 
1 109 SER n 
1 110 PRO n 
1 111 GLU n 
1 112 ASP n 
1 113 VAL n 
1 114 GLU n 
1 115 TYR n 
1 116 TYR n 
1 117 ASN n 
1 118 CYS n 
1 119 GLN n 
1 120 GLN n 
1 121 GLU n 
1 122 LEU n 
1 123 THR n 
1 124 ASP n 
1 125 ASP n 
1 126 LEU n 
1 127 HIS n 
1 128 LYS n 
1 129 GLN n 
1 130 TYR n 
1 131 GLN n 
1 132 ILE n 
1 133 VAL n 
1 134 GLY n 
1 135 ARG n 
1 136 ILE n 
1 137 ILE n 
1 138 ALA n 
1 139 HIS n 
1 140 SER n 
1 141 ASN n 
1 142 GLN n 
1 143 LYS n 
1 144 SER n 
1 145 ALA n 
1 146 ALA n 
1 147 GLY n 
1 148 TYR n 
1 149 PRO n 
1 150 ASP n 
1 151 TYR n 
1 152 TYR n 
1 153 CYS n 
1 154 LYS n 
1 155 TRP n 
1 156 GLN n 
1 157 GLY n 
1 158 LEU n 
1 159 PRO n 
1 160 TYR n 
1 161 SER n 
1 162 GLU n 
1 163 CYS n 
1 164 SER n 
1 165 TRP n 
1 166 GLU n 
1 167 ASP n 
1 168 GLY n 
1 169 ALA n 
1 170 LEU n 
1 171 ILE n 
1 172 SER n 
1 173 LYS n 
1 174 LYS n 
1 175 PHE n 
1 176 GLN n 
1 177 ALA n 
1 178 MSE n 
1 179 ILE n 
1 180 ASP n 
1 181 GLU n 
1 182 TYR n 
1 183 PHE n 
1 184 SER n 
1 185 ARG n 
1 186 LYS n 
1 187 LYS n 
2 1   MSE n 
2 2   LYS n 
2 3   LYS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  GLU n 
2 11  GLU n 
2 12  GLU n 
2 13  PHE n 
2 14  GLU n 
2 15  THR n 
2 16  ILE n 
2 17  GLU n 
2 18  ARG n 
2 19  PHE n 
2 20  MSE n 
2 21  ASP n 
2 22  CYS n 
2 23  ARG n 
2 24  ILE n 
2 25  GLY n 
2 26  ARG n 
2 27  LYS n 
2 28  GLY n 
2 29  ALA n 
2 30  THR n 
2 31  GLY n 
2 32  ALA n 
2 33  THR n 
2 34  THR n 
2 35  THR n 
2 36  ILE n 
2 37  TYR n 
2 38  ALA n 
2 39  VAL n 
2 40  GLU n 
2 41  ALA n 
2 42  ASP n 
2 43  GLY n 
2 44  ASP n 
2 45  PRO n 
2 46  ASN n 
2 47  ALA n 
2 48  GLY n 
2 49  PHE n 
2 50  GLU n 
2 51  LYS n 
2 52  ASN n 
2 53  LYS n 
2 54  GLU n 
2 55  PRO n 
2 56  GLY n 
2 57  GLU n 
2 58  ILE n 
2 59  GLN n 
2 60  TYR n 
2 61  LEU n 
2 62  ILE n 
2 63  LYS n 
2 64  TRP n 
2 65  LYS n 
2 66  GLY n 
2 67  TRP n 
2 68  SER n 
2 69  HIS n 
2 70  ILE n 
2 71  HIS n 
2 72  ASN n 
2 73  THR n 
2 74  TRP n 
2 75  GLU n 
2 76  THR n 
2 77  GLU n 
2 78  GLU n 
2 79  THR n 
2 80  LEU n 
2 81  LYS n 
2 82  GLN n 
2 83  GLN n 
2 84  ASN n 
2 85  VAL n 
2 86  ARG n 
2 87  GLY n 
2 88  MSE n 
2 89  LYS n 
2 90  LYS n 
2 91  LEU n 
2 92  ASP n 
2 93  ASN n 
2 94  TYR n 
2 95  LYS n 
2 96  LYS n 
2 97  LYS n 
2 98  ASP n 
2 99  GLN n 
2 100 GLU n 
2 101 THR n 
2 102 LYS n 
2 103 ARG n 
2 104 TRP n 
2 105 LEU n 
2 106 LYS n 
2 107 ASN n 
2 108 ALA n 
2 109 SER n 
2 110 PRO n 
2 111 GLU n 
2 112 ASP n 
2 113 VAL n 
2 114 GLU n 
2 115 TYR n 
3 1   ALA n 
3 2   ARG n 
3 3   TPO n 
3 4   M3L n 
3 5   GLN n 
3 6   THR n 
3 7   ALA n 
3 8   ARG n 
3 9   LYS n 
3 10  SER n 
3 11  THR n 
3 12  GLY n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  PRO n 
3 17  ARG n 
3 18  LYS n 
3 19  GLN n 
3 20  TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo CHD1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? 
2 1 sample ? ? ? human Homo CHD1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in Homo Sapiens (humans).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CHD1_HUMAN O14646 1 
;EEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMK
KLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGA
LISKKFQACIDEYFSRNQ
;
268 ? 
2 UNP CHD1_HUMAN O14646 2 
;EEEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMK
KLDNYKKKDQETKRWLKNASPEDVEY
;
268 ? 
3 UNP H31_HUMAN  P68431 3 ARTKQTARKSTGGKAPRKQ 2   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2B2T A 10 ? 185 ? O14646 268 ? 443 ? 10 185 
2 1 2B2T B 10 ? 185 ? O14646 268 ? 443 ? 10 185 
3 2 2B2T C 10 ? 115 ? O14646 268 ? 373 ? 10 115 
4 3 2B2T D 1  ? 19  ? P68431 1   ? 19  ? 1  19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2B2T MSE A 1   ? UNP O14646 ?   ?   'SEE REMARK 999'   1   1  
1 2B2T LYS A 2   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 2   2  
1 2B2T LYS A 3   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 3   3  
1 2B2T HIS A 4   ? UNP O14646 ?   ?   'EXPRESSION TAG'   4   4  
1 2B2T HIS A 5   ? UNP O14646 ?   ?   'EXPRESSION TAG'   5   5  
1 2B2T HIS A 6   ? UNP O14646 ?   ?   'EXPRESSION TAG'   6   6  
1 2B2T HIS A 7   ? UNP O14646 ?   ?   'EXPRESSION TAG'   7   7  
1 2B2T HIS A 8   ? UNP O14646 ?   ?   'EXPRESSION TAG'   8   8  
1 2B2T HIS A 9   ? UNP O14646 ?   ?   'EXPRESSION TAG'   9   9  
1 2B2T MSE A 20  ? UNP O14646 MET 278 'MODIFIED RESIDUE' 20  10 
1 2B2T MSE A 88  ? UNP O14646 MET 346 'MODIFIED RESIDUE' 88  11 
1 2B2T MSE A 178 ? UNP O14646 CYS 436 'SEE REMARK 999'   178 12 
1 2B2T LYS A 186 ? UNP O14646 ?   ?   'CLONING ARTIFACT' 186 13 
1 2B2T LYS A 187 ? UNP O14646 ?   ?   'CLONING ARTIFACT' 187 14 
2 2B2T MSE B 1   ? UNP O14646 ?   ?   'SEE REMARK 999'   1   15 
2 2B2T LYS B 2   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 2   16 
2 2B2T LYS B 3   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 3   17 
2 2B2T HIS B 4   ? UNP O14646 ?   ?   'EXPRESSION TAG'   4   18 
2 2B2T HIS B 5   ? UNP O14646 ?   ?   'EXPRESSION TAG'   5   19 
2 2B2T HIS B 6   ? UNP O14646 ?   ?   'EXPRESSION TAG'   6   20 
2 2B2T HIS B 7   ? UNP O14646 ?   ?   'EXPRESSION TAG'   7   21 
2 2B2T HIS B 8   ? UNP O14646 ?   ?   'EXPRESSION TAG'   8   22 
2 2B2T HIS B 9   ? UNP O14646 ?   ?   'EXPRESSION TAG'   9   23 
2 2B2T MSE B 20  ? UNP O14646 MET 278 'MODIFIED RESIDUE' 20  24 
2 2B2T MSE B 88  ? UNP O14646 MET 346 'MODIFIED RESIDUE' 88  25 
2 2B2T MSE B 178 ? UNP O14646 CYS 436 'SEE REMARK 999'   178 26 
2 2B2T LYS B 186 ? UNP O14646 ?   ?   'CLONING ARTIFACT' 186 27 
2 2B2T LYS B 187 ? UNP O14646 ?   ?   'CLONING ARTIFACT' 187 28 
3 2B2T MSE C 1   ? UNP O14646 ?   ?   'SEE REMARK 999'   1   29 
3 2B2T LYS C 2   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 2   30 
3 2B2T LYS C 3   ? UNP O14646 ?   ?   'CLONING ARTIFACT' 3   31 
3 2B2T HIS C 4   ? UNP O14646 ?   ?   'EXPRESSION TAG'   4   32 
3 2B2T HIS C 5   ? UNP O14646 ?   ?   'EXPRESSION TAG'   5   33 
3 2B2T HIS C 6   ? UNP O14646 ?   ?   'EXPRESSION TAG'   6   34 
3 2B2T HIS C 7   ? UNP O14646 ?   ?   'EXPRESSION TAG'   7   35 
3 2B2T HIS C 8   ? UNP O14646 ?   ?   'EXPRESSION TAG'   8   36 
3 2B2T HIS C 9   ? UNP O14646 ?   ?   'EXPRESSION TAG'   9   37 
3 2B2T MSE C 20  ? UNP O14646 MET 278 'MODIFIED RESIDUE' 20  38 
3 2B2T MSE C 88  ? UNP O14646 MET 346 'MODIFIED RESIDUE' 88  39 
4 2B2T TPO D 3   ? UNP P68431 THR 3   'MODIFIED RESIDUE' 3   40 
4 2B2T M3L D 4   ? UNP P68431 LYS 4   'MODIFIED RESIDUE' 4   41 
4 2B2T TYR D 20  ? UNP P68431 ?   ?   'SEE REMARK 999'   20  42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                  'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ?                  'C9 H21 N2 O2 1' 189.275 
MET 'L-peptide linking' y METHIONINE        ?                  'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE  ?                  'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE     ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE  PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2B2T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   49.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_details    
'4% PEG3350, 0.05M HEPES, pH 8.0, 10mM BTP, 12.5mM NaCl, 5mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 283K, pH 8.00' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100.0 ? 1 
2 ?     ? 1 
3 ?     ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-11-08 
_diffrn_detector.details                ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'DOUBLE CRYSTAL CRYSTAL DOUBLE CRYSTAL' MAD x-ray 
2 1 M ?                                       ?   x-ray 
3 1 M ?                                       ?   x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97926 1.0 
2 0.97939 1.0 
3 0.97240 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97926, 0.97939, 0.97240' 
# 
_reflns.entry_id                     2B2T 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.200 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   21731 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        15.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2,3 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   87.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.426 
_reflns_shell.meanI_over_sigI_obs    2.600 
_reflns_shell.pdbx_redundancy        2.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2B2T 
_refine.ls_number_reflns_obs                     19575 
_refine.ls_number_reflns_all                     21731 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          41.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    93.0 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.300 
_refine.ls_number_reflns_R_free                  1337 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               47.86 
_refine.aniso_B[1][1]                            6.79400 
_refine.aniso_B[2][2]                            -3.65400 
_refine.aniso_B[3][3]                            -3.14000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -3.54200 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.32 
_refine.solvent_model_param_bsol                 43.21 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3610 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             258 
_refine_hist.number_atoms_total               3868 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.88  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.49 
_refine_ls_shell.number_reflns_R_work             1964 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               87.70 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2B2T 
_struct.title                     
'Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and phosphothreonine 3' 
_struct.pdbx_descriptor           
'Chromodomain-helicase-DNA-binding protein 1, Histone H3 tail residues 1-19, phosphorylated on T3 and trimethylated on K4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2B2T 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
_struct_keywords.text            
;CHD, Chromodomain, three stranded antiparallel Beta sheet, alpha helix linker, histone H3, trimethyllysine, phosphothreonine, PEPTIDE BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 31  ? THR A 34  ? GLY A 31  THR A 34  5 ? 4  
HELX_P HELX_P2  2  THR A 35  ? GLY A 43  ? THR A 35  GLY A 43  1 ? 9  
HELX_P HELX_P3  3  SER A 68  ? ASN A 72  ? SER A 68  ASN A 72  5 ? 5  
HELX_P HELX_P4  4  THR A 76  ? GLN A 83  ? THR A 76  GLN A 83  1 ? 8  
HELX_P HELX_P5  5  MSE A 88  ? TRP A 104 ? MSE A 88  TRP A 104 1 ? 17 
HELX_P HELX_P6  6  SER A 109 ? TYR A 130 ? SER A 109 TYR A 130 1 ? 22 
HELX_P HELX_P7  7  PRO A 159 ? CYS A 163 ? PRO A 159 CYS A 163 5 ? 5  
HELX_P HELX_P8  8  ASP A 167 ? ARG A 185 ? ASP A 167 ARG A 185 1 ? 19 
HELX_P HELX_P9  9  THR B 35  ? GLY B 43  ? THR B 35  GLY B 43  1 ? 9  
HELX_P HELX_P10 10 SER B 68  ? ASN B 72  ? SER B 68  ASN B 72  5 ? 5  
HELX_P HELX_P11 11 THR B 76  ? GLN B 83  ? THR B 76  GLN B 83  1 ? 8  
HELX_P HELX_P12 12 MSE B 88  ? LEU B 105 ? MSE B 88  LEU B 105 1 ? 18 
HELX_P HELX_P13 13 SER B 109 ? TYR B 130 ? SER B 109 TYR B 130 1 ? 22 
HELX_P HELX_P14 14 PRO B 159 ? CYS B 163 ? PRO B 159 CYS B 163 5 ? 5  
HELX_P HELX_P15 15 ASP B 167 ? ARG B 185 ? ASP B 167 ARG B 185 1 ? 19 
HELX_P HELX_P16 16 GLY C 31  ? THR C 34  ? GLY C 31  THR C 34  5 ? 4  
HELX_P HELX_P17 17 THR C 35  ? GLY C 43  ? THR C 35  GLY C 43  1 ? 9  
HELX_P HELX_P18 18 SER C 68  ? ASN C 72  ? SER C 68  ASN C 72  5 ? 5  
HELX_P HELX_P19 19 THR C 76  ? ASN C 84  ? THR C 76  ASN C 84  1 ? 9  
HELX_P HELX_P20 20 MSE C 88  ? LYS C 95  ? MSE C 88  LYS C 95  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A PHE 19  C ? ? ? 1_555 A MSE 20  N ? ? A PHE 19  A MSE 20  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2  covale ? ? A MSE 20  C ? ? ? 1_555 A ASP 21  N ? ? A MSE 20  A ASP 21  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale3  covale ? ? A GLY 87  C ? ? ? 1_555 A MSE 88  N ? ? A GLY 87  A MSE 88  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4  covale ? ? A MSE 88  C ? ? ? 1_555 A LYS 89  N ? ? A MSE 88  A LYS 89  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale5  covale ? ? A ALA 177 C ? ? ? 1_555 A MSE 178 N ? ? A ALA 177 A MSE 178 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale6  covale ? ? A MSE 178 C ? ? ? 1_555 A ILE 179 N ? ? A MSE 178 A ILE 179 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale7  covale ? ? B PHE 19  C ? ? ? 1_555 B MSE 20  N ? ? B PHE 19  B MSE 20  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8  covale ? ? B MSE 20  C ? ? ? 1_555 B ASP 21  N ? ? B MSE 20  B ASP 21  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale9  covale ? ? B GLY 87  C ? ? ? 1_555 B MSE 88  N ? ? B GLY 87  B MSE 88  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale10 covale ? ? B MSE 88  C ? ? ? 1_555 B LYS 89  N ? ? B MSE 88  B LYS 89  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale11 covale ? ? B ALA 177 C ? ? ? 1_555 B MSE 178 N ? ? B ALA 177 B MSE 178 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale ? ? B MSE 178 C ? ? ? 1_555 B ILE 179 N ? ? B MSE 178 B ILE 179 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale13 covale ? ? C PHE 19  C ? ? ? 1_555 C MSE 20  N ? ? C PHE 19  C MSE 20  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale14 covale ? ? C MSE 20  C ? ? ? 1_555 C ASP 21  N ? ? C MSE 20  C ASP 21  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale15 covale ? ? C GLY 87  C ? ? ? 1_555 C MSE 88  N ? ? C GLY 87  C MSE 88  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale16 covale ? ? C MSE 88  C ? ? ? 1_555 C LYS 89  N ? ? C MSE 88  C LYS 89  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale17 covale ? ? D ARG 2   C ? ? ? 1_555 D TPO 3   N ? ? D ARG 2   D TPO 3   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale18 covale ? ? D TPO 3   C ? ? ? 1_555 D M3L 4   N ? ? D TPO 3   D M3L 4   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale19 covale ? ? D M3L 4   C ? ? ? 1_555 D GLN 5   N ? ? D M3L 4   D GLN 5   1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 16  ? ILE A 24  ? ILE A 16  ILE A 24  
A 2 ILE A 58  ? TRP A 64  ? ILE A 58  TRP A 64  
A 3 THR A 73  ? GLU A 75  ? THR A 73  GLU A 75  
B 1 VAL A 133 ? HIS A 139 ? VAL A 133 HIS A 139 
B 2 TYR A 151 ? TRP A 155 ? TYR A 151 TRP A 155 
B 3 SER A 164 ? GLU A 166 ? SER A 164 GLU A 166 
C 1 ILE B 16  ? GLY B 25  ? ILE B 16  GLY B 25  
C 2 GLU B 57  ? TRP B 64  ? GLU B 57  TRP B 64  
C 3 THR B 73  ? GLU B 75  ? THR B 73  GLU B 75  
D 1 VAL B 133 ? HIS B 139 ? VAL B 133 HIS B 139 
D 2 TYR B 151 ? TRP B 155 ? TYR B 151 TRP B 155 
D 3 SER B 164 ? GLU B 166 ? SER B 164 GLU B 166 
E 1 ILE C 16  ? GLY C 25  ? ILE C 16  GLY C 25  
E 2 GLU C 57  ? TRP C 64  ? GLU C 57  TRP C 64  
E 3 THR C 73  ? GLU C 75  ? THR C 73  GLU C 75  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 23  ? N ARG A 23  O GLN A 59  ? O GLN A 59  
A 2 3 N TYR A 60  ? N TYR A 60  O GLU A 75  ? O GLU A 75  
B 1 2 N ILE A 137 ? N ILE A 137 O TYR A 152 ? O TYR A 152 
B 2 3 N TYR A 151 ? N TYR A 151 O GLU A 166 ? O GLU A 166 
C 1 2 N ASP B 21  ? N ASP B 21  O LEU B 61  ? O LEU B 61  
C 2 3 N TYR B 60  ? N TYR B 60  O GLU B 75  ? O GLU B 75  
D 1 2 N ILE B 137 ? N ILE B 137 O TYR B 152 ? O TYR B 152 
D 2 3 N CYS B 153 ? N CYS B 153 O SER B 164 ? O SER B 164 
E 1 2 N ARG C 23  ? N ARG C 23  O GLN C 59  ? O GLN C 59  
E 2 3 N ILE C 62  ? N ILE C 62  O THR C 73  ? O THR C 73  
# 
_atom_sites.entry_id                    2B2T 
_atom_sites.fract_transf_matrix[1][1]   0.008930 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003635 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018286 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010691 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 11  ? -33.300 -19.640 -8.728  1.00 83.55  ? 11  GLU A N   1 
ATOM   2    C  CA  . GLU A 1 11  ? -32.270 -20.165 -9.615  1.00 82.03  ? 11  GLU A CA  1 
ATOM   3    C  C   . GLU A 1 11  ? -31.871 -19.136 -10.668 1.00 80.30  ? 11  GLU A C   1 
ATOM   4    O  O   . GLU A 1 11  ? -32.418 -19.117 -11.770 1.00 80.76  ? 11  GLU A O   1 
ATOM   5    C  CB  . GLU A 1 11  ? -32.744 -21.449 -10.278 1.00 82.52  ? 11  GLU A CB  1 
ATOM   6    N  N   . GLU A 1 12  ? -30.915 -18.281 -10.320 1.00 77.77  ? 12  GLU A N   1 
ATOM   7    C  CA  . GLU A 1 12  ? -30.533 -17.167 -11.180 1.00 73.85  ? 12  GLU A CA  1 
ATOM   8    C  C   . GLU A 1 12  ? -29.079 -17.288 -11.624 1.00 70.71  ? 12  GLU A C   1 
ATOM   9    O  O   . GLU A 1 12  ? -28.798 -17.621 -12.775 1.00 70.33  ? 12  GLU A O   1 
ATOM   10   C  CB  . GLU A 1 12  ? -30.764 -15.843 -10.467 1.00 74.71  ? 12  GLU A CB  1 
ATOM   11   N  N   . PHE A 1 13  ? -28.160 -17.014 -10.705 1.00 66.41  ? 13  PHE A N   1 
ATOM   12   C  CA  . PHE A 1 13  ? -26.766 -16.778 -11.062 1.00 61.08  ? 13  PHE A CA  1 
ATOM   13   C  C   . PHE A 1 13  ? -26.534 -15.318 -11.437 1.00 56.53  ? 13  PHE A C   1 
ATOM   14   O  O   . PHE A 1 13  ? -27.476 -14.530 -11.518 1.00 56.75  ? 13  PHE A O   1 
ATOM   15   C  CB  . PHE A 1 13  ? -26.314 -17.767 -12.138 1.00 63.44  ? 13  PHE A CB  1 
ATOM   16   C  CG  . PHE A 1 13  ? -26.261 -19.192 -11.668 1.00 65.79  ? 13  PHE A CG  1 
ATOM   17   C  CD1 . PHE A 1 13  ? -26.732 -20.218 -12.470 1.00 66.51  ? 13  PHE A CD1 1 
ATOM   18   C  CD2 . PHE A 1 13  ? -25.741 -19.507 -10.423 1.00 66.48  ? 13  PHE A CD2 1 
ATOM   19   C  CE1 . PHE A 1 13  ? -26.685 -21.531 -12.040 1.00 66.74  ? 13  PHE A CE1 1 
ATOM   20   C  CE2 . PHE A 1 13  ? -25.692 -20.817 -9.988  1.00 66.06  ? 13  PHE A CE2 1 
ATOM   21   C  CZ  . PHE A 1 13  ? -26.164 -21.830 -10.797 1.00 66.90  ? 13  PHE A CZ  1 
ATOM   22   N  N   . GLU A 1 14  ? -25.273 -14.965 -11.667 1.00 49.75  ? 14  GLU A N   1 
ATOM   23   C  CA  . GLU A 1 14  ? -24.934 -13.671 -12.247 1.00 43.70  ? 14  GLU A CA  1 
ATOM   24   C  C   . GLU A 1 14  ? -23.903 -13.895 -13.348 1.00 40.55  ? 14  GLU A C   1 
ATOM   25   O  O   . GLU A 1 14  ? -23.392 -15.002 -13.518 1.00 39.94  ? 14  GLU A O   1 
ATOM   26   C  CB  . GLU A 1 14  ? -24.397 -12.673 -11.220 1.00 43.04  ? 14  GLU A CB  1 
ATOM   27   C  CG  . GLU A 1 14  ? -25.383 -12.328 -10.115 1.00 43.85  ? 14  GLU A CG  1 
ATOM   28   C  CD  . GLU A 1 14  ? -26.590 -11.568 -10.628 1.00 44.41  ? 14  GLU A CD  1 
ATOM   29   O  OE1 . GLU A 1 14  ? -26.447 -10.820 -11.618 1.00 45.35  ? 14  GLU A OE1 1 
ATOM   30   O  OE2 . GLU A 1 14  ? -27.682 -11.718 -10.040 1.00 46.82  ? 14  GLU A OE2 1 
ATOM   31   N  N   . THR A 1 15  ? -23.602 -12.837 -14.094 1.00 37.15  ? 15  THR A N   1 
ATOM   32   C  CA  . THR A 1 15  ? -22.662 -12.924 -15.201 1.00 34.02  ? 15  THR A CA  1 
ATOM   33   C  C   . THR A 1 15  ? -21.695 -11.749 -15.266 1.00 32.06  ? 15  THR A C   1 
ATOM   34   O  O   . THR A 1 15  ? -22.102 -10.595 -15.154 1.00 31.20  ? 15  THR A O   1 
ATOM   35   C  CB  . THR A 1 15  ? -23.420 -12.983 -16.538 1.00 35.81  ? 15  THR A CB  1 
ATOM   36   O  OG1 . THR A 1 15  ? -24.193 -14.189 -16.591 1.00 37.30  ? 15  THR A OG1 1 
ATOM   37   C  CG2 . THR A 1 15  ? -22.451 -12.924 -17.722 1.00 35.13  ? 15  THR A CG2 1 
ATOM   38   N  N   . ILE A 1 16  ? -20.414 -12.057 -15.449 1.00 31.69  ? 16  ILE A N   1 
ATOM   39   C  CA  . ILE A 1 16  ? -19.380 -11.037 -15.570 1.00 30.67  ? 16  ILE A CA  1 
ATOM   40   C  C   . ILE A 1 16  ? -19.572 -10.366 -16.923 1.00 32.26  ? 16  ILE A C   1 
ATOM   41   O  O   . ILE A 1 16  ? -19.622 -11.052 -17.954 1.00 33.75  ? 16  ILE A O   1 
ATOM   42   C  CB  . ILE A 1 16  ? -17.963 -11.644 -15.607 1.00 30.33  ? 16  ILE A CB  1 
ATOM   43   C  CG1 . ILE A 1 16  ? -17.644 -12.389 -14.309 1.00 33.05  ? 16  ILE A CG1 1 
ATOM   44   C  CG2 . ILE A 1 16  ? -16.955 -10.542 -15.868 1.00 28.45  ? 16  ILE A CG2 1 
ATOM   45   C  CD1 . ILE A 1 16  ? -17.451 -11.490 -13.118 1.00 38.62  ? 16  ILE A CD1 1 
ATOM   46   N  N   . GLU A 1 17  ? -19.679 -9.045  -16.943 1.00 30.86  ? 17  GLU A N   1 
ATOM   47   C  CA  . GLU A 1 17  ? -19.822 -8.356  -18.218 1.00 30.78  ? 17  GLU A CA  1 
ATOM   48   C  C   . GLU A 1 17  ? -18.464 -7.756  -18.556 1.00 31.38  ? 17  GLU A C   1 
ATOM   49   O  O   . GLU A 1 17  ? -17.915 -7.973  -19.640 1.00 30.93  ? 17  GLU A O   1 
ATOM   50   C  CB  . GLU A 1 17  ? -20.877 -7.257  -18.134 1.00 30.79  ? 17  GLU A CB  1 
ATOM   51   C  CG  . GLU A 1 17  ? -21.086 -6.525  -19.448 1.00 32.99  ? 17  GLU A CG  1 
ATOM   52   C  CD  . GLU A 1 17  ? -22.111 -5.423  -19.343 1.00 35.93  ? 17  GLU A CD  1 
ATOM   53   O  OE1 . GLU A 1 17  ? -23.300 -5.741  -19.146 1.00 37.74  ? 17  GLU A OE1 1 
ATOM   54   O  OE2 . GLU A 1 17  ? -21.732 -4.234  -19.450 1.00 41.01  ? 17  GLU A OE2 1 
ATOM   55   N  N   . ARG A 1 18  ? -17.919 -6.999  -17.611 1.00 31.15  ? 18  ARG A N   1 
ATOM   56   C  CA  . ARG A 1 18  ? -16.621 -6.396  -17.817 1.00 29.74  ? 18  ARG A CA  1 
ATOM   57   C  C   . ARG A 1 18  ? -15.813 -6.241  -16.543 1.00 29.42  ? 18  ARG A C   1 
ATOM   58   O  O   . ARG A 1 18  ? -16.352 -6.001  -15.466 1.00 27.54  ? 18  ARG A O   1 
ATOM   59   C  CB  . ARG A 1 18  ? -16.751 -5.030  -18.500 1.00 28.48  ? 18  ARG A CB  1 
ATOM   60   C  CG  . ARG A 1 18  ? -15.427 -4.279  -18.517 1.00 33.69  ? 18  ARG A CG  1 
ATOM   61   C  CD  . ARG A 1 18  ? -15.148 -3.501  -19.791 1.00 37.59  ? 18  ARG A CD  1 
ATOM   62   N  NE  . ARG A 1 18  ? -15.714 -2.152  -19.793 1.00 39.60  ? 18  ARG A NE  1 
ATOM   63   C  CZ  . ARG A 1 18  ? -15.013 -1.044  -20.038 1.00 40.65  ? 18  ARG A CZ  1 
ATOM   64   N  NH1 . ARG A 1 18  ? -13.706 -1.116  -20.294 1.00 36.23  ? 18  ARG A NH1 1 
ATOM   65   N  NH2 . ARG A 1 18  ? -15.628 0.136   -20.044 1.00 41.53  ? 18  ARG A NH2 1 
ATOM   66   N  N   . PHE A 1 19  ? -14.506 -6.412  -16.696 1.00 31.31  ? 19  PHE A N   1 
ATOM   67   C  CA  . PHE A 1 19  ? -13.545 -6.245  -15.622 1.00 32.55  ? 19  PHE A CA  1 
ATOM   68   C  C   . PHE A 1 19  ? -13.093 -4.803  -15.666 1.00 34.34  ? 19  PHE A C   1 
ATOM   69   O  O   . PHE A 1 19  ? -12.577 -4.344  -16.685 1.00 33.60  ? 19  PHE A O   1 
ATOM   70   C  CB  . PHE A 1 19  ? -12.324 -7.131  -15.847 1.00 30.69  ? 19  PHE A CB  1 
ATOM   71   C  CG  . PHE A 1 19  ? -12.496 -8.511  -15.337 1.00 32.32  ? 19  PHE A CG  1 
ATOM   72   C  CD1 . PHE A 1 19  ? -12.184 -8.816  -14.017 1.00 33.01  ? 19  PHE A CD1 1 
ATOM   73   C  CD2 . PHE A 1 19  ? -13.002 -9.510  -16.159 1.00 32.35  ? 19  PHE A CD2 1 
ATOM   74   C  CE1 . PHE A 1 19  ? -12.375 -10.109 -13.513 1.00 35.08  ? 19  PHE A CE1 1 
ATOM   75   C  CE2 . PHE A 1 19  ? -13.201 -10.808 -15.674 1.00 35.61  ? 19  PHE A CE2 1 
ATOM   76   C  CZ  . PHE A 1 19  ? -12.886 -11.112 -14.345 1.00 34.62  ? 19  PHE A CZ  1 
HETATM 77   N  N   . MSE A 1 20  ? -13.302 -4.082  -14.574 1.00 37.27  ? 20  MSE A N   1 
HETATM 78   C  CA  . MSE A 1 20  ? -12.857 -2.709  -14.513 1.00 40.48  ? 20  MSE A CA  1 
HETATM 79   C  C   . MSE A 1 20  ? -11.482 -2.799  -13.840 1.00 42.79  ? 20  MSE A C   1 
HETATM 80   O  O   . MSE A 1 20  ? -10.569 -3.415  -14.385 1.00 48.46  ? 20  MSE A O   1 
HETATM 81   C  CB  . MSE A 1 20  ? -13.853 -1.867  -13.711 1.00 42.32  ? 20  MSE A CB  1 
HETATM 82   C  CG  . MSE A 1 20  ? -15.333 -1.968  -14.200 1.00 44.24  ? 20  MSE A CG  1 
HETATM 83   SE SE  . MSE A 1 20  ? -15.750 -1.573  -16.124 1.00 47.07  ? 20  MSE A SE  1 
HETATM 84   C  CE  . MSE A 1 20  ? -15.352 0.330   -16.148 1.00 45.25  ? 20  MSE A CE  1 
ATOM   85   N  N   . ASP A 1 21  ? -11.323 -2.257  -12.645 1.00 43.55  ? 21  ASP A N   1 
ATOM   86   C  CA  . ASP A 1 21  ? -10.016 -2.297  -11.982 1.00 42.50  ? 21  ASP A CA  1 
ATOM   87   C  C   . ASP A 1 21  ? -9.539  -3.610  -11.348 1.00 41.06  ? 21  ASP A C   1 
ATOM   88   O  O   . ASP A 1 21  ? -10.221 -4.627  -11.361 1.00 40.19  ? 21  ASP A O   1 
ATOM   89   C  CB  . ASP A 1 21  ? -9.958  -1.193  -10.924 1.00 42.37  ? 21  ASP A CB  1 
ATOM   90   C  CG  . ASP A 1 21  ? -8.689  -0.405  -10.993 1.00 42.20  ? 21  ASP A CG  1 
ATOM   91   O  OD1 . ASP A 1 21  ? -8.679  0.708   -10.431 1.00 47.30  ? 21  ASP A OD1 1 
ATOM   92   O  OD2 . ASP A 1 21  ? -7.711  -0.896  -11.607 1.00 41.64  ? 21  ASP A OD2 1 
ATOM   93   N  N   . CYS A 1 22  ? -8.337  -3.542  -10.788 1.00 40.51  ? 22  CYS A N   1 
ATOM   94   C  CA  . CYS A 1 22  ? -7.699  -4.650  -10.107 1.00 40.62  ? 22  CYS A CA  1 
ATOM   95   C  C   . CYS A 1 22  ? -7.088  -4.041  -8.840  1.00 38.99  ? 22  CYS A C   1 
ATOM   96   O  O   . CYS A 1 22  ? -6.755  -2.855  -8.828  1.00 38.87  ? 22  CYS A O   1 
ATOM   97   C  CB  . CYS A 1 22  ? -6.601  -5.223  -10.999 1.00 42.87  ? 22  CYS A CB  1 
ATOM   98   S  SG  . CYS A 1 22  ? -5.763  -6.631  -10.297 1.00 52.31  ? 22  CYS A SG  1 
ATOM   99   N  N   . ARG A 1 23  ? -6.964  -4.811  -7.764  1.00 35.43  ? 23  ARG A N   1 
ATOM   100  C  CA  . ARG A 1 23  ? -6.344  -4.266  -6.553  1.00 30.80  ? 23  ARG A CA  1 
ATOM   101  C  C   . ARG A 1 23  ? -5.943  -5.339  -5.559  1.00 32.31  ? 23  ARG A C   1 
ATOM   102  O  O   . ARG A 1 23  ? -6.274  -6.514  -5.707  1.00 30.65  ? 23  ARG A O   1 
ATOM   103  C  CB  . ARG A 1 23  ? -7.291  -3.304  -5.831  1.00 25.62  ? 23  ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 23  ? -8.252  -3.999  -4.866  1.00 20.04  ? 23  ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 23  ? -9.254  -3.035  -4.212  1.00 18.97  ? 23  ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 23  ? -10.122 -3.732  -3.264  1.00 15.49  ? 23  ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 23  ? -11.109 -3.165  -2.564  1.00 19.29  ? 23  ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 23  ? -11.381 -1.860  -2.682  1.00 14.26  ? 23  ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 23  ? -11.842 -3.920  -1.745  1.00 15.39  ? 23  ARG A NH2 1 
ATOM   110  N  N   . ILE A 1 24  ? -5.187  -4.924  -4.553  1.00 33.48  ? 24  ILE A N   1 
ATOM   111  C  CA  . ILE A 1 24  ? -4.825  -5.824  -3.479  1.00 35.04  ? 24  ILE A CA  1 
ATOM   112  C  C   . ILE A 1 24  ? -5.448  -5.146  -2.280  1.00 35.59  ? 24  ILE A C   1 
ATOM   113  O  O   . ILE A 1 24  ? -5.148  -3.985  -1.988  1.00 35.70  ? 24  ILE A O   1 
ATOM   114  C  CB  . ILE A 1 24  ? -3.314  -5.953  -3.324  1.00 35.99  ? 24  ILE A CB  1 
ATOM   115  C  CG1 . ILE A 1 24  ? -2.802  -6.876  -4.422  1.00 31.76  ? 24  ILE A CG1 1 
ATOM   116  C  CG2 . ILE A 1 24  ? -2.965  -6.527  -1.950  1.00 33.58  ? 24  ILE A CG2 1 
ATOM   117  C  CD1 . ILE A 1 24  ? -1.379  -6.820  -4.582  1.00 33.62  ? 24  ILE A CD1 1 
ATOM   118  N  N   . GLY A 1 25  ? -6.358  -5.848  -1.616  1.00 35.96  ? 25  GLY A N   1 
ATOM   119  C  CA  . GLY A 1 25  ? -7.019  -5.251  -0.480  1.00 37.09  ? 25  GLY A CA  1 
ATOM   120  C  C   . GLY A 1 25  ? -7.214  -6.227  0.645   1.00 38.40  ? 25  GLY A C   1 
ATOM   121  O  O   . GLY A 1 25  ? -6.856  -7.396  0.538   1.00 39.40  ? 25  GLY A O   1 
ATOM   122  N  N   . ARG A 1 26  ? -7.792  -5.731  1.729   1.00 39.33  ? 26  ARG A N   1 
ATOM   123  C  CA  . ARG A 1 26  ? -8.052  -6.546  2.900   1.00 40.77  ? 26  ARG A CA  1 
ATOM   124  C  C   . ARG A 1 26  ? -8.773  -7.835  2.527   1.00 40.97  ? 26  ARG A C   1 
ATOM   125  O  O   . ARG A 1 26  ? -9.704  -7.818  1.727   1.00 41.45  ? 26  ARG A O   1 
ATOM   126  C  CB  . ARG A 1 26  ? -8.889  -5.742  3.898   1.00 40.71  ? 26  ARG A CB  1 
ATOM   127  C  CG  . ARG A 1 26  ? -9.406  -6.534  5.094   1.00 42.96  ? 26  ARG A CG  1 
ATOM   128  C  CD  . ARG A 1 26  ? -9.811  -5.581  6.216   1.00 44.23  ? 26  ARG A CD  1 
ATOM   129  N  NE  . ARG A 1 26  ? -8.715  -4.660  6.528   1.00 43.95  ? 26  ARG A NE  1 
ATOM   130  C  CZ  . ARG A 1 26  ? -8.839  -3.338  6.580   1.00 43.54  ? 26  ARG A CZ  1 
ATOM   131  N  NH1 . ARG A 1 26  ? -10.016 -2.763  6.346   1.00 41.67  ? 26  ARG A NH1 1 
ATOM   132  N  NH2 . ARG A 1 26  ? -7.779  -2.584  6.850   1.00 44.72  ? 26  ARG A NH2 1 
ATOM   133  N  N   . LYS A 1 27  ? -8.329  -8.955  3.099   1.00 42.07  ? 27  LYS A N   1 
ATOM   134  C  CA  . LYS A 1 27  ? -8.962  -10.244 2.840   1.00 40.97  ? 27  LYS A CA  1 
ATOM   135  C  C   . LYS A 1 27  ? -10.386 -10.119 3.344   1.00 38.74  ? 27  LYS A C   1 
ATOM   136  O  O   . LYS A 1 27  ? -10.604 -9.666  4.468   1.00 37.33  ? 27  LYS A O   1 
ATOM   137  C  CB  . LYS A 1 27  ? -8.256  -11.382 3.594   1.00 43.49  ? 27  LYS A CB  1 
ATOM   138  C  CG  . LYS A 1 27  ? -6.876  -11.771 3.057   1.00 48.06  ? 27  LYS A CG  1 
ATOM   139  C  CD  . LYS A 1 27  ? -6.411  -13.102 3.658   1.00 51.47  ? 27  LYS A CD  1 
ATOM   140  C  CE  . LYS A 1 27  ? -5.131  -13.633 3.003   1.00 53.28  ? 27  LYS A CE  1 
ATOM   141  N  NZ  . LYS A 1 27  ? -3.924  -12.784 3.260   1.00 54.74  ? 27  LYS A NZ  1 
ATOM   142  N  N   . GLY A 1 28  ? -11.349 -10.494 2.508   1.00 36.22  ? 28  GLY A N   1 
ATOM   143  C  CA  . GLY A 1 28  ? -12.740 -10.408 2.911   1.00 35.41  ? 28  GLY A CA  1 
ATOM   144  C  C   . GLY A 1 28  ? -13.478 -9.156  2.468   1.00 34.66  ? 28  GLY A C   1 
ATOM   145  O  O   . GLY A 1 28  ? -14.697 -9.066  2.646   1.00 34.79  ? 28  GLY A O   1 
ATOM   146  N  N   . ALA A 1 29  ? -12.761 -8.183  1.908   1.00 33.74  ? 29  ALA A N   1 
ATOM   147  C  CA  . ALA A 1 29  ? -13.400 -6.944  1.445   1.00 31.96  ? 29  ALA A CA  1 
ATOM   148  C  C   . ALA A 1 29  ? -13.897 -7.179  0.014   1.00 31.67  ? 29  ALA A C   1 
ATOM   149  O  O   . ALA A 1 29  ? -13.317 -6.695  -0.969  1.00 27.46  ? 29  ALA A O   1 
ATOM   150  C  CB  . ALA A 1 29  ? -12.407 -5.785  1.483   1.00 32.58  ? 29  ALA A CB  1 
ATOM   151  N  N   . THR A 1 30  ? -14.978 -7.941  -0.079  1.00 31.25  ? 30  THR A N   1 
ATOM   152  C  CA  . THR A 1 30  ? -15.567 -8.304  -1.351  1.00 30.63  ? 30  THR A CA  1 
ATOM   153  C  C   . THR A 1 30  ? -17.070 -8.484  -1.186  1.00 30.57  ? 30  THR A C   1 
ATOM   154  O  O   . THR A 1 30  ? -17.587 -8.461  -0.062  1.00 29.62  ? 30  THR A O   1 
ATOM   155  C  CB  . THR A 1 30  ? -14.955 -9.630  -1.854  1.00 32.52  ? 30  THR A CB  1 
ATOM   156  O  OG1 . THR A 1 30  ? -14.988 -10.598 -0.797  1.00 34.55  ? 30  THR A OG1 1 
ATOM   157  C  CG2 . THR A 1 30  ? -13.520 -9.436  -2.290  1.00 28.70  ? 30  THR A CG2 1 
ATOM   158  N  N   . GLY A 1 31  ? -17.779 -8.647  -2.301  1.00 31.17  ? 31  GLY A N   1 
ATOM   159  C  CA  . GLY A 1 31  ? -19.217 -8.855  -2.212  1.00 29.67  ? 31  GLY A CA  1 
ATOM   160  C  C   . GLY A 1 31  ? -20.051 -7.587  -2.189  1.00 29.80  ? 31  GLY A C   1 
ATOM   161  O  O   . GLY A 1 31  ? -19.573 -6.509  -2.553  1.00 29.99  ? 31  GLY A O   1 
ATOM   162  N  N   . ALA A 1 32  ? -21.296 -7.717  -1.743  1.00 27.78  ? 32  ALA A N   1 
ATOM   163  C  CA  . ALA A 1 32  ? -22.231 -6.601  -1.706  1.00 28.82  ? 32  ALA A CA  1 
ATOM   164  C  C   . ALA A 1 32  ? -21.795 -5.414  -0.868  1.00 29.79  ? 32  ALA A C   1 
ATOM   165  O  O   . ALA A 1 32  ? -22.089 -4.265  -1.212  1.00 29.67  ? 32  ALA A O   1 
ATOM   166  C  CB  . ALA A 1 32  ? -23.590 -7.088  -1.237  1.00 27.88  ? 32  ALA A CB  1 
ATOM   167  N  N   . THR A 1 33  ? -21.085 -5.690  0.225   1.00 30.09  ? 33  THR A N   1 
ATOM   168  C  CA  . THR A 1 33  ? -20.618 -4.637  1.129   1.00 27.51  ? 33  THR A CA  1 
ATOM   169  C  C   . THR A 1 33  ? -19.578 -3.720  0.493   1.00 28.12  ? 33  THR A C   1 
ATOM   170  O  O   . THR A 1 33  ? -19.107 -2.773  1.139   1.00 28.23  ? 33  THR A O   1 
ATOM   171  C  CB  . THR A 1 33  ? -19.965 -5.219  2.411   1.00 27.63  ? 33  THR A CB  1 
ATOM   172  O  OG1 . THR A 1 33  ? -18.730 -5.847  2.057   1.00 25.52  ? 33  THR A OG1 1 
ATOM   173  C  CG2 . THR A 1 33  ? -20.884 -6.247  3.105   1.00 22.12  ? 33  THR A CG2 1 
ATOM   174  N  N   . THR A 1 34  ? -19.202 -3.992  -0.756  1.00 25.97  ? 34  THR A N   1 
ATOM   175  C  CA  . THR A 1 34  ? -18.191 -3.159  -1.404  1.00 25.38  ? 34  THR A CA  1 
ATOM   176  C  C   . THR A 1 34  ? -18.725 -2.247  -2.491  1.00 25.45  ? 34  THR A C   1 
ATOM   177  O  O   . THR A 1 34  ? -17.941 -1.604  -3.178  1.00 26.14  ? 34  THR A O   1 
ATOM   178  C  CB  . THR A 1 34  ? -17.044 -3.993  -2.031  1.00 24.17  ? 34  THR A CB  1 
ATOM   179  O  OG1 . THR A 1 34  ? -17.546 -4.717  -3.157  1.00 26.02  ? 34  THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 34  ? -16.449 -4.968  -1.012  1.00 19.92  ? 34  THR A CG2 1 
ATOM   181  N  N   . THR A 1 35  ? -20.042 -2.198  -2.670  1.00 26.24  ? 35  THR A N   1 
ATOM   182  C  CA  . THR A 1 35  ? -20.614 -1.310  -3.681  1.00 27.04  ? 35  THR A CA  1 
ATOM   183  C  C   . THR A 1 35  ? -20.491 0.107   -3.150  1.00 28.81  ? 35  THR A C   1 
ATOM   184  O  O   . THR A 1 35  ? -20.373 0.310   -1.941  1.00 29.43  ? 35  THR A O   1 
ATOM   185  C  CB  . THR A 1 35  ? -22.109 -1.603  -3.959  1.00 26.10  ? 35  THR A CB  1 
ATOM   186  O  OG1 . THR A 1 35  ? -22.834 -1.636  -2.728  1.00 24.39  ? 35  THR A OG1 1 
ATOM   187  C  CG2 . THR A 1 35  ? -22.273 -2.936  -4.688  1.00 26.40  ? 35  THR A CG2 1 
ATOM   188  N  N   . ILE A 1 36  ? -20.509 1.085   -4.047  1.00 30.44  ? 36  ILE A N   1 
ATOM   189  C  CA  . ILE A 1 36  ? -20.384 2.483   -3.645  1.00 29.62  ? 36  ILE A CA  1 
ATOM   190  C  C   . ILE A 1 36  ? -21.428 2.898   -2.632  1.00 30.55  ? 36  ILE A C   1 
ATOM   191  O  O   . ILE A 1 36  ? -21.129 3.642   -1.696  1.00 33.40  ? 36  ILE A O   1 
ATOM   192  C  CB  . ILE A 1 36  ? -20.491 3.452   -4.843  1.00 27.77  ? 36  ILE A CB  1 
ATOM   193  C  CG1 . ILE A 1 36  ? -20.381 4.896   -4.347  1.00 25.58  ? 36  ILE A CG1 1 
ATOM   194  C  CG2 . ILE A 1 36  ? -21.806 3.263   -5.535  1.00 25.21  ? 36  ILE A CG2 1 
ATOM   195  C  CD1 . ILE A 1 36  ? -19.456 5.788   -5.174  1.00 21.06  ? 36  ILE A CD1 1 
ATOM   196  N  N   . TYR A 1 37  ? -22.658 2.436   -2.803  1.00 29.41  ? 37  TYR A N   1 
ATOM   197  C  CA  . TYR A 1 37  ? -23.679 2.826   -1.852  1.00 30.64  ? 37  TYR A CA  1 
ATOM   198  C  C   . TYR A 1 37  ? -23.595 2.098   -0.521  1.00 32.36  ? 37  TYR A C   1 
ATOM   199  O  O   . TYR A 1 37  ? -24.031 2.624   0.499   1.00 33.33  ? 37  TYR A O   1 
ATOM   200  C  CB  . TYR A 1 37  ? -25.065 2.669   -2.462  1.00 28.65  ? 37  TYR A CB  1 
ATOM   201  C  CG  . TYR A 1 37  ? -25.360 1.316   -3.051  1.00 27.09  ? 37  TYR A CG  1 
ATOM   202  C  CD1 . TYR A 1 37  ? -25.989 0.324   -2.298  1.00 28.29  ? 37  TYR A CD1 1 
ATOM   203  C  CD2 . TYR A 1 37  ? -25.075 1.050   -4.381  1.00 26.64  ? 37  TYR A CD2 1 
ATOM   204  C  CE1 . TYR A 1 37  ? -26.337 -0.897  -2.862  1.00 26.41  ? 37  TYR A CE1 1 
ATOM   205  C  CE2 . TYR A 1 37  ? -25.414 -0.166  -4.958  1.00 26.82  ? 37  TYR A CE2 1 
ATOM   206  C  CZ  . TYR A 1 37  ? -26.050 -1.130  -4.198  1.00 26.06  ? 37  TYR A CZ  1 
ATOM   207  O  OH  . TYR A 1 37  ? -26.431 -2.309  -4.789  1.00 24.56  ? 37  TYR A OH  1 
ATOM   208  N  N   . ALA A 1 38  ? -23.046 0.890   -0.524  1.00 33.64  ? 38  ALA A N   1 
ATOM   209  C  CA  . ALA A 1 38  ? -22.911 0.142   0.713   1.00 34.32  ? 38  ALA A CA  1 
ATOM   210  C  C   . ALA A 1 38  ? -21.748 0.758   1.475   1.00 35.42  ? 38  ALA A C   1 
ATOM   211  O  O   . ALA A 1 38  ? -21.712 0.715   2.703   1.00 36.81  ? 38  ALA A O   1 
ATOM   212  C  CB  . ALA A 1 38  ? -22.637 -1.338  0.420   1.00 32.11  ? 38  ALA A CB  1 
ATOM   213  N  N   . VAL A 1 39  ? -20.806 1.337   0.734   1.00 36.97  ? 39  VAL A N   1 
ATOM   214  C  CA  . VAL A 1 39  ? -19.628 1.964   1.322   1.00 38.78  ? 39  VAL A CA  1 
ATOM   215  C  C   . VAL A 1 39  ? -19.947 3.341   1.884   1.00 41.03  ? 39  VAL A C   1 
ATOM   216  O  O   . VAL A 1 39  ? -19.376 3.750   2.903   1.00 44.28  ? 39  VAL A O   1 
ATOM   217  C  CB  . VAL A 1 39  ? -18.493 2.127   0.294   1.00 37.79  ? 39  VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 39  ? -17.429 3.056   0.848   1.00 37.54  ? 39  VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 39  ? -17.881 0.778   -0.026  1.00 38.23  ? 39  VAL A CG2 1 
ATOM   220  N  N   . GLU A 1 40  ? -20.841 4.058   1.211   1.00 41.14  ? 40  GLU A N   1 
ATOM   221  C  CA  . GLU A 1 40  ? -21.244 5.394   1.649   1.00 40.66  ? 40  GLU A CA  1 
ATOM   222  C  C   . GLU A 1 40  ? -22.180 5.319   2.860   1.00 41.00  ? 40  GLU A C   1 
ATOM   223  O  O   . GLU A 1 40  ? -22.230 6.240   3.673   1.00 41.45  ? 40  GLU A O   1 
ATOM   224  C  CB  . GLU A 1 40  ? -21.948 6.138   0.502   1.00 39.63  ? 40  GLU A CB  1 
ATOM   225  C  CG  . GLU A 1 40  ? -21.011 6.685   -0.577  1.00 38.21  ? 40  GLU A CG  1 
ATOM   226  C  CD  . GLU A 1 40  ? -21.747 7.118   -1.845  1.00 37.05  ? 40  GLU A CD  1 
ATOM   227  O  OE1 . GLU A 1 40  ? -21.117 7.721   -2.742  1.00 30.22  ? 40  GLU A OE1 1 
ATOM   228  O  OE2 . GLU A 1 40  ? -22.957 6.836   -1.950  1.00 37.85  ? 40  GLU A OE2 1 
ATOM   229  N  N   . ALA A 1 41  ? -22.917 4.217   2.974   1.00 40.29  ? 41  ALA A N   1 
ATOM   230  C  CA  . ALA A 1 41  ? -23.861 4.034   4.072   1.00 40.73  ? 41  ALA A CA  1 
ATOM   231  C  C   . ALA A 1 41  ? -23.285 3.355   5.308   1.00 41.83  ? 41  ALA A C   1 
ATOM   232  O  O   . ALA A 1 41  ? -23.567 3.776   6.430   1.00 43.00  ? 41  ALA A O   1 
ATOM   233  C  CB  . ALA A 1 41  ? -25.057 3.243   3.595   1.00 39.77  ? 41  ALA A CB  1 
ATOM   234  N  N   . ASP A 1 42  ? -22.499 2.300   5.104   1.00 40.76  ? 42  ASP A N   1 
ATOM   235  C  CA  . ASP A 1 42  ? -21.916 1.559   6.219   1.00 40.37  ? 42  ASP A CA  1 
ATOM   236  C  C   . ASP A 1 42  ? -20.383 1.556   6.259   1.00 39.03  ? 42  ASP A C   1 
ATOM   237  O  O   . ASP A 1 42  ? -19.790 0.832   7.047   1.00 40.31  ? 42  ASP A O   1 
ATOM   238  C  CB  . ASP A 1 42  ? -22.418 0.111   6.189   1.00 42.71  ? 42  ASP A CB  1 
ATOM   239  C  CG  . ASP A 1 42  ? -23.937 0.015   6.056   1.00 44.49  ? 42  ASP A CG  1 
ATOM   240  O  OD1 . ASP A 1 42  ? -24.655 0.514   6.953   1.00 45.71  ? 42  ASP A OD1 1 
ATOM   241  O  OD2 . ASP A 1 42  ? -24.413 -0.562  5.050   1.00 44.96  ? 42  ASP A OD2 1 
ATOM   242  N  N   . GLY A 1 43  ? -19.739 2.345   5.409   1.00 36.76  ? 43  GLY A N   1 
ATOM   243  C  CA  . GLY A 1 43  ? -18.287 2.386   5.408   1.00 34.00  ? 43  GLY A CA  1 
ATOM   244  C  C   . GLY A 1 43  ? -17.621 1.292   4.600   1.00 33.06  ? 43  GLY A C   1 
ATOM   245  O  O   . GLY A 1 43  ? -18.160 0.204   4.467   1.00 33.35  ? 43  GLY A O   1 
ATOM   246  N  N   . ASP A 1 44  ? -16.439 1.593   4.071   1.00 33.88  ? 44  ASP A N   1 
ATOM   247  C  CA  . ASP A 1 44  ? -15.648 0.664   3.266   1.00 35.83  ? 44  ASP A CA  1 
ATOM   248  C  C   . ASP A 1 44  ? -15.011 -0.440  4.114   1.00 37.01  ? 44  ASP A C   1 
ATOM   249  O  O   . ASP A 1 44  ? -14.357 -0.164  5.118   1.00 39.26  ? 44  ASP A O   1 
ATOM   250  C  CB  . ASP A 1 44  ? -14.531 1.432   2.556   1.00 35.60  ? 44  ASP A CB  1 
ATOM   251  C  CG  . ASP A 1 44  ? -13.807 0.592   1.521   1.00 38.49  ? 44  ASP A CG  1 
ATOM   252  O  OD1 . ASP A 1 44  ? -13.868 -0.653  1.598   1.00 39.20  ? 44  ASP A OD1 1 
ATOM   253  O  OD2 . ASP A 1 44  ? -13.160 1.183   0.629   1.00 40.57  ? 44  ASP A OD2 1 
ATOM   254  N  N   . PRO A 1 45  ? -15.201 -1.710  3.723   1.00 36.57  ? 45  PRO A N   1 
ATOM   255  C  CA  . PRO A 1 45  ? -14.616 -2.828  4.474   1.00 35.18  ? 45  PRO A CA  1 
ATOM   256  C  C   . PRO A 1 45  ? -13.123 -2.967  4.141   1.00 35.87  ? 45  PRO A C   1 
ATOM   257  O  O   . PRO A 1 45  ? -12.484 -3.968  4.458   1.00 35.42  ? 45  PRO A O   1 
ATOM   258  C  CB  . PRO A 1 45  ? -15.427 -4.019  3.980   1.00 35.51  ? 45  PRO A CB  1 
ATOM   259  C  CG  . PRO A 1 45  ? -15.675 -3.655  2.530   1.00 33.33  ? 45  PRO A CG  1 
ATOM   260  C  CD  . PRO A 1 45  ? -16.090 -2.203  2.653   1.00 35.29  ? 45  PRO A CD  1 
ATOM   261  N  N   . ASN A 1 46  ? -12.576 -1.945  3.495   1.00 36.36  ? 46  ASN A N   1 
ATOM   262  C  CA  . ASN A 1 46  ? -11.173 -1.933  3.086   1.00 37.40  ? 46  ASN A CA  1 
ATOM   263  C  C   . ASN A 1 46  ? -10.612 -0.581  3.546   1.00 40.67  ? 46  ASN A C   1 
ATOM   264  O  O   . ASN A 1 46  ? -9.539  -0.144  3.116   1.00 40.42  ? 46  ASN A O   1 
ATOM   265  C  CB  . ASN A 1 46  ? -11.118 -2.057  1.560   1.00 31.32  ? 46  ASN A CB  1 
ATOM   266  C  CG  . ASN A 1 46  ? -9.710  -2.235  1.020   1.00 29.60  ? 46  ASN A CG  1 
ATOM   267  O  OD1 . ASN A 1 46  ? -9.025  -3.207  1.348   1.00 29.24  ? 46  ASN A OD1 1 
ATOM   268  N  ND2 . ASN A 1 46  ? -9.278  -1.306  0.159   1.00 22.58  ? 46  ASN A ND2 1 
ATOM   269  N  N   . ALA A 1 47  ? -11.373 0.057   4.431   1.00 44.18  ? 47  ALA A N   1 
ATOM   270  C  CA  . ALA A 1 47  ? -11.069 1.367   4.994   1.00 47.48  ? 47  ALA A CA  1 
ATOM   271  C  C   . ALA A 1 47  ? -9.598  1.702   5.190   1.00 51.13  ? 47  ALA A C   1 
ATOM   272  O  O   . ALA A 1 47  ? -9.010  2.478   4.419   1.00 54.17  ? 47  ALA A O   1 
ATOM   273  C  CB  . ALA A 1 47  ? -11.809 1.533   6.311   1.00 45.21  ? 47  ALA A CB  1 
ATOM   274  N  N   . GLY A 1 48  ? -9.000  1.120   6.224   1.00 52.85  ? 48  GLY A N   1 
ATOM   275  C  CA  . GLY A 1 48  ? -7.659  1.490   6.636   1.00 55.17  ? 48  GLY A CA  1 
ATOM   276  C  C   . GLY A 1 48  ? -6.629  1.217   5.557   1.00 56.52  ? 48  GLY A C   1 
ATOM   277  O  O   . GLY A 1 48  ? -5.515  1.739   5.602   1.00 57.78  ? 48  GLY A O   1 
ATOM   278  N  N   . PHE A 1 49  ? -7.004  0.395   4.583   1.00 56.95  ? 49  PHE A N   1 
ATOM   279  C  CA  . PHE A 1 49  ? -6.223  -0.785  4.234   1.00 56.69  ? 49  PHE A CA  1 
ATOM   280  C  C   . PHE A 1 49  ? -4.772  -0.416  3.944   1.00 59.05  ? 49  PHE A C   1 
ATOM   281  O  O   . PHE A 1 49  ? -4.434  0.761   3.820   1.00 58.17  ? 49  PHE A O   1 
ATOM   282  C  CB  . PHE A 1 49  ? -6.836  -1.496  3.025   1.00 53.38  ? 49  PHE A CB  1 
ATOM   283  C  CG  . PHE A 1 49  ? -5.911  -2.478  2.366   1.00 48.37  ? 49  PHE A CG  1 
ATOM   284  C  CD1 . PHE A 1 49  ? -5.566  -3.659  3.001   1.00 47.81  ? 49  PHE A CD1 1 
ATOM   285  C  CD2 . PHE A 1 49  ? -5.385  -2.220  1.111   1.00 46.13  ? 49  PHE A CD2 1 
ATOM   286  C  CE1 . PHE A 1 49  ? -4.715  -4.565  2.397   1.00 46.97  ? 49  PHE A CE1 1 
ATOM   287  C  CE2 . PHE A 1 49  ? -4.533  -3.121  0.502   1.00 44.56  ? 49  PHE A CE2 1 
ATOM   288  C  CZ  . PHE A 1 49  ? -4.198  -4.295  1.145   1.00 44.44  ? 49  PHE A CZ  1 
ATOM   289  N  N   . GLU A 1 50  ? -3.919  -1.429  3.836   1.00 62.73  ? 50  GLU A N   1 
ATOM   290  C  CA  . GLU A 1 50  ? -2.524  -1.215  3.543   1.00 66.23  ? 50  GLU A CA  1 
ATOM   291  C  C   . GLU A 1 50  ? -1.972  0.118   3.995   1.00 68.71  ? 50  GLU A C   1 
ATOM   292  O  O   . GLU A 1 50  ? -1.753  1.059   3.229   1.00 67.88  ? 50  GLU A O   1 
ATOM   293  C  CB  . GLU A 1 50  ? -2.209  -1.422  2.073   1.00 66.56  ? 50  GLU A CB  1 
ATOM   294  C  CG  . GLU A 1 50  ? -0.714  -1.424  1.797   1.00 64.50  ? 50  GLU A CG  1 
ATOM   295  C  CD  . GLU A 1 50  ? -0.111  -2.812  1.784   1.00 63.68  ? 50  GLU A CD  1 
ATOM   296  O  OE1 . GLU A 1 50  ? 0.616   -3.103  0.815   1.00 63.21  ? 50  GLU A OE1 1 
ATOM   297  O  OE2 . GLU A 1 50  ? -0.354  -3.602  2.723   1.00 62.89  ? 50  GLU A OE2 1 
ATOM   298  N  N   . LYS A 1 51  ? -1.816  0.153   5.301   1.00 71.83  ? 51  LYS A N   1 
ATOM   299  C  CA  . LYS A 1 51  ? -1.195  1.202   6.062   1.00 74.78  ? 51  LYS A CA  1 
ATOM   300  C  C   . LYS A 1 51  ? -0.593  0.035   6.862   1.00 76.16  ? 51  LYS A C   1 
ATOM   301  O  O   . LYS A 1 51  ? -0.964  -0.222  8.013   1.00 77.65  ? 51  LYS A O   1 
ATOM   302  C  CB  . LYS A 1 51  ? -2.196  2.046   6.902   1.00 75.08  ? 51  LYS A CB  1 
ATOM   303  C  CG  . LYS A 1 51  ? -2.035  1.931   8.445   1.00 76.46  ? 51  LYS A CG  1 
ATOM   304  C  CD  . LYS A 1 51  ? -2.477  3.173   9.209   1.00 77.09  ? 51  LYS A CD  1 
ATOM   305  C  CE  . LYS A 1 51  ? -1.398  4.257   9.192   1.00 76.96  ? 51  LYS A CE  1 
ATOM   306  N  NZ  . LYS A 1 51  ? -1.875  5.534   9.805   1.00 77.03  ? 51  LYS A NZ  1 
ATOM   307  N  N   . ASN A 1 52  ? 0.216   -0.775  6.166   1.00 76.31  ? 52  ASN A N   1 
ATOM   308  C  CA  . ASN A 1 52  ? 0.894   -1.900  6.810   1.00 75.86  ? 52  ASN A CA  1 
ATOM   309  C  C   . ASN A 1 52  ? 0.256   -3.310  6.841   1.00 74.53  ? 52  ASN A C   1 
ATOM   310  O  O   . ASN A 1 52  ? 0.957   -4.291  7.070   1.00 73.53  ? 52  ASN A O   1 
ATOM   311  C  CB  . ASN A 1 52  ? 1.201   -1.469  8.240   1.00 77.99  ? 52  ASN A CB  1 
ATOM   312  C  CG  . ASN A 1 52  ? 1.991   -2.478  9.004   1.00 79.97  ? 52  ASN A CG  1 
ATOM   313  O  OD1 . ASN A 1 52  ? 1.578   -3.624  9.198   1.00 81.01  ? 52  ASN A OD1 1 
ATOM   314  N  ND2 . ASN A 1 52  ? 3.143   -2.051  9.467   1.00 79.40  ? 52  ASN A ND2 1 
ATOM   315  N  N   . LYS A 1 53  ? -1.043  -3.418  6.584   1.00 74.08  ? 53  LYS A N   1 
ATOM   316  C  CA  . LYS A 1 53  ? -1.780  -4.695  6.676   1.00 73.00  ? 53  LYS A CA  1 
ATOM   317  C  C   . LYS A 1 53  ? -1.405  -5.963  5.895   1.00 73.34  ? 53  LYS A C   1 
ATOM   318  O  O   . LYS A 1 53  ? -1.252  -5.933  4.670   1.00 71.77  ? 53  LYS A O   1 
ATOM   319  C  CB  . LYS A 1 53  ? -3.256  -4.405  6.445   1.00 71.90  ? 53  LYS A CB  1 
ATOM   320  C  CG  . LYS A 1 53  ? -3.636  -3.041  6.951   1.00 69.98  ? 53  LYS A CG  1 
ATOM   321  C  CD  . LYS A 1 53  ? -4.831  -3.074  7.867   1.00 68.40  ? 53  LYS A CD  1 
ATOM   322  C  CE  . LYS A 1 53  ? -4.990  -1.763  8.606   1.00 69.43  ? 53  LYS A CE  1 
ATOM   323  N  NZ  . LYS A 1 53  ? -5.805  -1.899  9.826   1.00 69.51  ? 53  LYS A NZ  1 
ATOM   324  N  N   . GLU A 1 54  ? -1.266  -7.074  6.611   1.00 74.48  ? 54  GLU A N   1 
ATOM   325  C  CA  . GLU A 1 54  ? -0.970  -8.359  5.984   1.00 76.01  ? 54  GLU A CA  1 
ATOM   326  C  C   . GLU A 1 54  ? -1.456  -8.411  4.537   1.00 76.56  ? 54  GLU A C   1 
ATOM   327  O  O   . GLU A 1 54  ? -2.602  -8.070  4.243   1.00 77.59  ? 54  GLU A O   1 
ATOM   328  C  CB  . GLU A 1 54  ? -1.586  -9.505  6.789   1.00 78.08  ? 54  GLU A CB  1 
ATOM   329  C  CG  . GLU A 1 54  ? -1.161  -10.890 6.325   1.00 80.47  ? 54  GLU A CG  1 
ATOM   330  C  CD  . GLU A 1 54  ? -0.780  -11.800 7.477   1.00 81.51  ? 54  GLU A CD  1 
ATOM   331  O  OE1 . GLU A 1 54  ? -0.750  -13.033 7.279   1.00 80.46  ? 54  GLU A OE1 1 
ATOM   332  O  OE2 . GLU A 1 54  ? -0.509  -11.284 8.582   1.00 81.62  ? 54  GLU A OE2 1 
ATOM   333  N  N   . PRO A 1 55  ? -0.575  -8.846  3.641   1.00 76.57  ? 55  PRO A N   1 
ATOM   334  C  CA  . PRO A 1 55  ? -0.775  -8.678  2.197   1.00 75.20  ? 55  PRO A CA  1 
ATOM   335  C  C   . PRO A 1 55  ? -2.137  -8.082  1.852   1.00 73.51  ? 55  PRO A C   1 
ATOM   336  O  O   . PRO A 1 55  ? -2.433  -6.952  2.240   1.00 75.56  ? 55  PRO A O   1 
ATOM   337  C  CB  . PRO A 1 55  ? -0.679  -10.110 1.667   1.00 76.31  ? 55  PRO A CB  1 
ATOM   338  C  CG  . PRO A 1 55  ? 0.198   -10.808 2.646   1.00 76.59  ? 55  PRO A CG  1 
ATOM   339  C  CD  . PRO A 1 55  ? -0.124  -10.206 3.984   1.00 77.18  ? 55  PRO A CD  1 
ATOM   340  N  N   . GLY A 1 56  ? -2.950  -8.839  1.121   1.00 70.12  ? 56  GLY A N   1 
ATOM   341  C  CA  . GLY A 1 56  ? -4.236  -8.377  0.711   1.00 64.95  ? 56  GLY A CA  1 
ATOM   342  C  C   . GLY A 1 56  ? -4.652  -9.661  0.082   1.00 61.60  ? 56  GLY A C   1 
ATOM   343  O  O   . GLY A 1 56  ? -4.271  -10.742 0.528   1.00 60.78  ? 56  GLY A O   1 
ATOM   344  N  N   . GLU A 1 57  ? -5.382  -9.532  -1.000  1.00 58.30  ? 57  GLU A N   1 
ATOM   345  C  CA  . GLU A 1 57  ? -5.885  -10.663 -1.722  1.00 54.25  ? 57  GLU A CA  1 
ATOM   346  C  C   . GLU A 1 57  ? -6.093  -9.899  -3.005  1.00 51.19  ? 57  GLU A C   1 
ATOM   347  O  O   . GLU A 1 57  ? -6.580  -8.765  -2.955  1.00 51.35  ? 57  GLU A O   1 
ATOM   348  C  CB  . GLU A 1 57  ? -7.200  -11.047 -1.077  1.00 53.97  ? 57  GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 57  ? -7.710  -12.400 -1.376  1.00 58.32  ? 57  GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 57  ? -8.880  -12.709 -0.486  1.00 61.33  ? 57  GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 57  ? -9.754  -11.818 -0.341  1.00 62.34  ? 57  GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 57  ? -8.923  -13.828 0.071   1.00 62.71  ? 57  GLU A OE2 1 
ATOM   353  N  N   . ILE A 1 58  ? -5.697  -10.443 -4.145  1.00 46.72  ? 58  ILE A N   1 
ATOM   354  C  CA  . ILE A 1 58  ? -5.915  -9.659  -5.344  1.00 43.29  ? 58  ILE A CA  1 
ATOM   355  C  C   . ILE A 1 58  ? -7.402  -9.722  -5.676  1.00 40.41  ? 58  ILE A C   1 
ATOM   356  O  O   . ILE A 1 58  ? -7.991  -10.792 -5.831  1.00 39.34  ? 58  ILE A O   1 
ATOM   357  C  CB  . ILE A 1 58  ? -5.033  -10.127 -6.516  1.00 44.20  ? 58  ILE A CB  1 
ATOM   358  C  CG1 . ILE A 1 58  ? -5.746  -11.174 -7.358  1.00 45.98  ? 58  ILE A CG1 1 
ATOM   359  C  CG2 . ILE A 1 58  ? -3.737  -10.687 -5.980  1.00 45.11  ? 58  ILE A CG2 1 
ATOM   360  C  CD1 . ILE A 1 58  ? -5.005  -11.486 -8.632  1.00 47.38  ? 58  ILE A CD1 1 
ATOM   361  N  N   . GLN A 1 59  ? -8.013  -8.547  -5.734  1.00 36.79  ? 59  GLN A N   1 
ATOM   362  C  CA  . GLN A 1 59  ? -9.427  -8.440  -6.002  1.00 33.69  ? 59  GLN A CA  1 
ATOM   363  C  C   . GLN A 1 59  ? -9.644  -7.743  -7.339  1.00 32.30  ? 59  GLN A C   1 
ATOM   364  O  O   . GLN A 1 59  ? -8.764  -7.035  -7.835  1.00 30.17  ? 59  GLN A O   1 
ATOM   365  C  CB  . GLN A 1 59  ? -10.083 -7.692  -4.839  1.00 32.71  ? 59  GLN A CB  1 
ATOM   366  C  CG  . GLN A 1 59  ? -9.656  -8.302  -3.499  1.00 31.05  ? 59  GLN A CG  1 
ATOM   367  C  CD  . GLN A 1 59  ? -10.080 -7.508  -2.275  1.00 31.78  ? 59  GLN A CD  1 
ATOM   368  O  OE1 . GLN A 1 59  ? -10.022 -6.269  -2.261  1.00 31.84  ? 59  GLN A OE1 1 
ATOM   369  N  NE2 . GLN A 1 59  ? -10.486 -8.221  -1.226  1.00 26.62  ? 59  GLN A NE2 1 
ATOM   370  N  N   . TYR A 1 60  ? -10.813 -7.976  -7.928  1.00 31.16  ? 60  TYR A N   1 
ATOM   371  C  CA  . TYR A 1 60  ? -11.180 -7.406  -9.224  1.00 27.61  ? 60  TYR A CA  1 
ATOM   372  C  C   . TYR A 1 60  ? -12.488 -6.638  -9.127  1.00 25.29  ? 60  TYR A C   1 
ATOM   373  O  O   . TYR A 1 60  ? -13.444 -7.107  -8.499  1.00 24.19  ? 60  TYR A O   1 
ATOM   374  C  CB  . TYR A 1 60  ? -11.358 -8.533  -10.230 1.00 25.86  ? 60  TYR A CB  1 
ATOM   375  C  CG  . TYR A 1 60  ? -10.151 -9.415  -10.348 1.00 27.72  ? 60  TYR A CG  1 
ATOM   376  C  CD1 . TYR A 1 60  ? -9.108  -9.073  -11.195 1.00 26.97  ? 60  TYR A CD1 1 
ATOM   377  C  CD2 . TYR A 1 60  ? -10.056 -10.615 -9.629  1.00 28.93  ? 60  TYR A CD2 1 
ATOM   378  C  CE1 . TYR A 1 60  ? -8.007  -9.901  -11.337 1.00 27.95  ? 60  TYR A CE1 1 
ATOM   379  C  CE2 . TYR A 1 60  ? -8.945  -11.452 -9.769  1.00 25.85  ? 60  TYR A CE2 1 
ATOM   380  C  CZ  . TYR A 1 60  ? -7.934  -11.087 -10.626 1.00 25.75  ? 60  TYR A CZ  1 
ATOM   381  O  OH  . TYR A 1 60  ? -6.851  -11.908 -10.824 1.00 28.58  ? 60  TYR A OH  1 
ATOM   382  N  N   . LEU A 1 61  ? -12.546 -5.467  -9.746  1.00 23.63  ? 61  LEU A N   1 
ATOM   383  C  CA  . LEU A 1 61  ? -13.784 -4.697  -9.711  1.00 23.85  ? 61  LEU A CA  1 
ATOM   384  C  C   . LEU A 1 61  ? -14.645 -5.199  -10.868 1.00 22.43  ? 61  LEU A C   1 
ATOM   385  O  O   . LEU A 1 61  ? -14.243 -5.130  -12.020 1.00 22.55  ? 61  LEU A O   1 
ATOM   386  C  CB  . LEU A 1 61  ? -13.495 -3.208  -9.859  1.00 22.53  ? 61  LEU A CB  1 
ATOM   387  C  CG  . LEU A 1 61  ? -14.722 -2.294  -9.927  1.00 23.58  ? 61  LEU A CG  1 
ATOM   388  C  CD1 . LEU A 1 61  ? -15.673 -2.571  -8.758  1.00 20.47  ? 61  LEU A CD1 1 
ATOM   389  C  CD2 . LEU A 1 61  ? -14.232 -0.836  -9.927  1.00 22.28  ? 61  LEU A CD2 1 
ATOM   390  N  N   . ILE A 1 62  ? -15.829 -5.707  -10.568 1.00 20.18  ? 62  ILE A N   1 
ATOM   391  C  CA  . ILE A 1 62  ? -16.666 -6.234  -11.629 1.00 21.61  ? 62  ILE A CA  1 
ATOM   392  C  C   . ILE A 1 62  ? -17.950 -5.504  -11.984 1.00 20.03  ? 62  ILE A C   1 
ATOM   393  O  O   . ILE A 1 62  ? -18.733 -5.107  -11.108 1.00 16.03  ? 62  ILE A O   1 
ATOM   394  C  CB  . ILE A 1 62  ? -17.026 -7.703  -11.342 1.00 25.11  ? 62  ILE A CB  1 
ATOM   395  C  CG1 . ILE A 1 62  ? -15.788 -8.577  -11.555 1.00 27.80  ? 62  ILE A CG1 1 
ATOM   396  C  CG2 . ILE A 1 62  ? -18.158 -8.159  -12.244 1.00 25.94  ? 62  ILE A CG2 1 
ATOM   397  C  CD1 . ILE A 1 62  ? -15.503 -9.477  -10.390 1.00 34.02  ? 62  ILE A CD1 1 
ATOM   398  N  N   . LYS A 1 63  ? -18.143 -5.345  -13.296 1.00 19.97  ? 63  LYS A N   1 
ATOM   399  C  CA  . LYS A 1 63  ? -19.337 -4.736  -13.880 1.00 20.66  ? 63  LYS A CA  1 
ATOM   400  C  C   . LYS A 1 63  ? -20.181 -5.958  -14.275 1.00 21.97  ? 63  LYS A C   1 
ATOM   401  O  O   . LYS A 1 63  ? -19.768 -6.796  -15.090 1.00 19.67  ? 63  LYS A O   1 
ATOM   402  C  CB  . LYS A 1 63  ? -18.974 -3.903  -15.125 1.00 21.00  ? 63  LYS A CB  1 
ATOM   403  C  CG  . LYS A 1 63  ? -20.166 -3.521  -16.033 1.00 21.46  ? 63  LYS A CG  1 
ATOM   404  C  CD  . LYS A 1 63  ? -21.184 -2.642  -15.321 1.00 22.69  ? 63  LYS A CD  1 
ATOM   405  C  CE  . LYS A 1 63  ? -22.396 -2.352  -16.194 1.00 26.75  ? 63  LYS A CE  1 
ATOM   406  N  NZ  . LYS A 1 63  ? -23.202 -3.554  -16.530 1.00 26.64  ? 63  LYS A NZ  1 
ATOM   407  N  N   . TRP A 1 64  ? -21.355 -6.065  -13.678 1.00 24.42  ? 64  TRP A N   1 
ATOM   408  C  CA  . TRP A 1 64  ? -22.236 -7.194  -13.926 1.00 28.48  ? 64  TRP A CA  1 
ATOM   409  C  C   . TRP A 1 64  ? -23.255 -7.005  -15.046 1.00 30.53  ? 64  TRP A C   1 
ATOM   410  O  O   . TRP A 1 64  ? -23.813 -5.918  -15.223 1.00 32.07  ? 64  TRP A O   1 
ATOM   411  C  CB  . TRP A 1 64  ? -22.967 -7.538  -12.629 1.00 29.94  ? 64  TRP A CB  1 
ATOM   412  C  CG  . TRP A 1 64  ? -22.047 -7.851  -11.495 1.00 30.01  ? 64  TRP A CG  1 
ATOM   413  C  CD1 . TRP A 1 64  ? -21.689 -7.024  -10.474 1.00 30.90  ? 64  TRP A CD1 1 
ATOM   414  C  CD2 . TRP A 1 64  ? -21.423 -9.111  -11.233 1.00 31.50  ? 64  TRP A CD2 1 
ATOM   415  N  NE1 . TRP A 1 64  ? -20.885 -7.694  -9.578  1.00 30.83  ? 64  TRP A NE1 1 
ATOM   416  C  CE2 . TRP A 1 64  ? -20.707 -8.979  -10.020 1.00 31.57  ? 64  TRP A CE2 1 
ATOM   417  C  CE3 . TRP A 1 64  ? -21.400 -10.343 -11.907 1.00 31.06  ? 64  TRP A CE3 1 
ATOM   418  C  CZ2 . TRP A 1 64  ? -19.977 -10.033 -9.460  1.00 28.82  ? 64  TRP A CZ2 1 
ATOM   419  C  CZ3 . TRP A 1 64  ? -20.671 -11.391 -11.350 1.00 32.83  ? 64  TRP A CZ3 1 
ATOM   420  C  CH2 . TRP A 1 64  ? -19.971 -11.225 -10.136 1.00 32.01  ? 64  TRP A CH2 1 
ATOM   421  N  N   . LYS A 1 65  ? -23.505 -8.078  -15.788 1.00 32.11  ? 65  LYS A N   1 
ATOM   422  C  CA  . LYS A 1 65  ? -24.472 -8.035  -16.876 1.00 32.10  ? 65  LYS A CA  1 
ATOM   423  C  C   . LYS A 1 65  ? -25.847 -7.806  -16.274 1.00 30.32  ? 65  LYS A C   1 
ATOM   424  O  O   . LYS A 1 65  ? -26.271 -8.532  -15.373 1.00 30.37  ? 65  LYS A O   1 
ATOM   425  C  CB  . LYS A 1 65  ? -24.471 -9.352  -17.656 1.00 36.75  ? 65  LYS A CB  1 
ATOM   426  C  CG  . LYS A 1 65  ? -25.456 -9.373  -18.825 1.00 42.81  ? 65  LYS A CG  1 
ATOM   427  C  CD  . LYS A 1 65  ? -25.239 -10.584 -19.739 1.00 47.52  ? 65  LYS A CD  1 
ATOM   428  C  CE  . LYS A 1 65  ? -25.974 -10.404 -21.080 1.00 51.61  ? 65  LYS A CE  1 
ATOM   429  N  NZ  . LYS A 1 65  ? -25.523 -11.357 -22.155 1.00 51.79  ? 65  LYS A NZ  1 
ATOM   430  N  N   . GLY A 1 66  ? -26.539 -6.788  -16.772 1.00 29.09  ? 66  GLY A N   1 
ATOM   431  C  CA  . GLY A 1 66  ? -27.865 -6.474  -16.274 1.00 26.63  ? 66  GLY A CA  1 
ATOM   432  C  C   . GLY A 1 66  ? -27.907 -5.576  -15.049 1.00 25.47  ? 66  GLY A C   1 
ATOM   433  O  O   . GLY A 1 66  ? -28.972 -5.388  -14.473 1.00 27.36  ? 66  GLY A O   1 
ATOM   434  N  N   . TRP A 1 67  ? -26.768 -5.037  -14.629 1.00 24.56  ? 67  TRP A N   1 
ATOM   435  C  CA  . TRP A 1 67  ? -26.738 -4.150  -13.466 1.00 26.17  ? 67  TRP A CA  1 
ATOM   436  C  C   . TRP A 1 67  ? -25.942 -2.928  -13.843 1.00 24.35  ? 67  TRP A C   1 
ATOM   437  O  O   . TRP A 1 67  ? -24.911 -3.049  -14.485 1.00 26.25  ? 67  TRP A O   1 
ATOM   438  C  CB  . TRP A 1 67  ? -26.051 -4.811  -12.260 1.00 25.90  ? 67  TRP A CB  1 
ATOM   439  C  CG  . TRP A 1 67  ? -26.742 -6.015  -11.731 1.00 28.80  ? 67  TRP A CG  1 
ATOM   440  C  CD1 . TRP A 1 67  ? -26.722 -7.274  -12.259 1.00 29.85  ? 67  TRP A CD1 1 
ATOM   441  C  CD2 . TRP A 1 67  ? -27.605 -6.072  -10.584 1.00 30.67  ? 67  TRP A CD2 1 
ATOM   442  N  NE1 . TRP A 1 67  ? -27.526 -8.112  -11.512 1.00 32.09  ? 67  TRP A NE1 1 
ATOM   443  C  CE2 . TRP A 1 67  ? -28.076 -7.398  -10.481 1.00 29.14  ? 67  TRP A CE2 1 
ATOM   444  C  CE3 . TRP A 1 67  ? -28.027 -5.129  -9.638  1.00 32.43  ? 67  TRP A CE3 1 
ATOM   445  C  CZ2 . TRP A 1 67  ? -28.947 -7.804  -9.474  1.00 31.25  ? 67  TRP A CZ2 1 
ATOM   446  C  CZ3 . TRP A 1 67  ? -28.894 -5.534  -8.633  1.00 33.58  ? 67  TRP A CZ3 1 
ATOM   447  C  CH2 . TRP A 1 67  ? -29.345 -6.864  -8.560  1.00 32.89  ? 67  TRP A CH2 1 
ATOM   448  N  N   . SER A 1 68  ? -26.402 -1.748  -13.454 1.00 25.14  ? 68  SER A N   1 
ATOM   449  C  CA  . SER A 1 68  ? -25.640 -0.550  -13.777 1.00 24.94  ? 68  SER A CA  1 
ATOM   450  C  C   . SER A 1 68  ? -24.388 -0.514  -12.910 1.00 24.45  ? 68  SER A C   1 
ATOM   451  O  O   . SER A 1 68  ? -24.298 -1.245  -11.911 1.00 23.28  ? 68  SER A O   1 
ATOM   452  C  CB  . SER A 1 68  ? -26.484 0.706   -13.555 1.00 25.34  ? 68  SER A CB  1 
ATOM   453  O  OG  . SER A 1 68  ? -27.261 0.595   -12.382 1.00 27.48  ? 68  SER A OG  1 
ATOM   454  N  N   . HIS A 1 69  ? -23.433 0.326   -13.309 1.00 23.07  ? 69  HIS A N   1 
ATOM   455  C  CA  . HIS A 1 69  ? -22.157 0.491   -12.622 1.00 24.97  ? 69  HIS A CA  1 
ATOM   456  C  C   . HIS A 1 69  ? -22.163 0.772   -11.102 1.00 27.08  ? 69  HIS A C   1 
ATOM   457  O  O   . HIS A 1 69  ? -21.148 0.528   -10.434 1.00 26.36  ? 69  HIS A O   1 
ATOM   458  C  CB  . HIS A 1 69  ? -21.340 1.573   -13.341 1.00 23.51  ? 69  HIS A CB  1 
ATOM   459  C  CG  . HIS A 1 69  ? -20.801 1.143   -14.671 1.00 21.88  ? 69  HIS A CG  1 
ATOM   460  N  ND1 . HIS A 1 69  ? -19.521 0.656   -14.839 1.00 23.48  ? 69  HIS A ND1 1 
ATOM   461  C  CD2 . HIS A 1 69  ? -21.389 1.076   -15.890 1.00 22.81  ? 69  HIS A CD2 1 
ATOM   462  C  CE1 . HIS A 1 69  ? -19.342 0.305   -16.102 1.00 21.45  ? 69  HIS A CE1 1 
ATOM   463  N  NE2 . HIS A 1 69  ? -20.462 0.549   -16.761 1.00 23.93  ? 69  HIS A NE2 1 
ATOM   464  N  N   . ILE A 1 70  ? -23.266 1.282   -10.547 1.00 27.46  ? 70  ILE A N   1 
ATOM   465  C  CA  . ILE A 1 70  ? -23.304 1.551   -9.104  1.00 28.52  ? 70  ILE A CA  1 
ATOM   466  C  C   . ILE A 1 70  ? -23.271 0.231   -8.364  1.00 27.48  ? 70  ILE A C   1 
ATOM   467  O  O   . ILE A 1 70  ? -22.892 0.170   -7.191  1.00 28.42  ? 70  ILE A O   1 
ATOM   468  C  CB  . ILE A 1 70  ? -24.604 2.226   -8.633  1.00 28.95  ? 70  ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 70  ? -25.791 1.507   -9.258  1.00 28.13  ? 70  ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 70  ? -24.574 3.687   -8.899  1.00 30.28  ? 70  ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 70  ? -27.091 1.839   -8.599  1.00 31.54  ? 70  ILE A CD1 1 
ATOM   472  N  N   . HIS A 1 71  ? -23.718 -0.817  -9.044  1.00 22.85  ? 71  HIS A N   1 
ATOM   473  C  CA  . HIS A 1 71  ? -23.759 -2.133  -8.445  1.00 21.17  ? 71  HIS A CA  1 
ATOM   474  C  C   . HIS A 1 71  ? -22.450 -2.876  -8.611  1.00 20.81  ? 71  HIS A C   1 
ATOM   475  O  O   . HIS A 1 71  ? -22.381 -4.068  -8.321  1.00 23.61  ? 71  HIS A O   1 
ATOM   476  C  CB  . HIS A 1 71  ? -24.894 -2.955  -9.059  1.00 21.54  ? 71  HIS A CB  1 
ATOM   477  C  CG  . HIS A 1 71  ? -26.243 -2.353  -8.856  1.00 20.05  ? 71  HIS A CG  1 
ATOM   478  N  ND1 . HIS A 1 71  ? -26.919 -2.444  -7.662  1.00 19.15  ? 71  HIS A ND1 1 
ATOM   479  C  CD2 . HIS A 1 71  ? -27.005 -1.579  -9.663  1.00 22.52  ? 71  HIS A CD2 1 
ATOM   480  C  CE1 . HIS A 1 71  ? -28.039 -1.746  -7.738  1.00 22.09  ? 71  HIS A CE1 1 
ATOM   481  N  NE2 . HIS A 1 71  ? -28.115 -1.210  -8.943  1.00 22.63  ? 71  HIS A NE2 1 
ATOM   482  N  N   . ASN A 1 72  ? -21.414 -2.198  -9.087  1.00 17.89  ? 72  ASN A N   1 
ATOM   483  C  CA  . ASN A 1 72  ? -20.139 -2.871  -9.253  1.00 20.82  ? 72  ASN A CA  1 
ATOM   484  C  C   . ASN A 1 72  ? -19.604 -3.353  -7.898  1.00 23.75  ? 72  ASN A C   1 
ATOM   485  O  O   . ASN A 1 72  ? -19.727 -2.658  -6.884  1.00 25.04  ? 72  ASN A O   1 
ATOM   486  C  CB  . ASN A 1 72  ? -19.129 -1.934  -9.907  1.00 19.37  ? 72  ASN A CB  1 
ATOM   487  C  CG  . ASN A 1 72  ? -19.407 -1.704  -11.392 1.00 23.17  ? 72  ASN A CG  1 
ATOM   488  O  OD1 . ASN A 1 72  ? -20.428 -2.157  -11.913 1.00 26.79  ? 72  ASN A OD1 1 
ATOM   489  N  ND2 . ASN A 1 72  ? -18.508 -0.997  -12.073 1.00 17.36  ? 72  ASN A ND2 1 
ATOM   490  N  N   . THR A 1 73  ? -19.010 -4.542  -7.880  1.00 24.89  ? 73  THR A N   1 
ATOM   491  C  CA  . THR A 1 73  ? -18.454 -5.096  -6.646  1.00 24.58  ? 73  THR A CA  1 
ATOM   492  C  C   . THR A 1 73  ? -17.047 -5.656  -6.855  1.00 26.70  ? 73  THR A C   1 
ATOM   493  O  O   . THR A 1 73  ? -16.717 -6.108  -7.960  1.00 27.71  ? 73  THR A O   1 
ATOM   494  C  CB  . THR A 1 73  ? -19.304 -6.252  -6.113  1.00 23.20  ? 73  THR A CB  1 
ATOM   495  O  OG1 . THR A 1 73  ? -19.254 -7.335  -7.045  1.00 23.10  ? 73  THR A OG1 1 
ATOM   496  C  CG2 . THR A 1 73  ? -20.724 -5.824  -5.903  1.00 21.66  ? 73  THR A CG2 1 
ATOM   497  N  N   . TRP A 1 74  ? -16.219 -5.608  -5.806  1.00 26.63  ? 74  TRP A N   1 
ATOM   498  C  CA  . TRP A 1 74  ? -14.871 -6.174  -5.881  1.00 26.32  ? 74  TRP A CA  1 
ATOM   499  C  C   . TRP A 1 74  ? -15.026 -7.651  -5.524  1.00 25.11  ? 74  TRP A C   1 
ATOM   500  O  O   . TRP A 1 74  ? -15.796 -7.998  -4.638  1.00 23.45  ? 74  TRP A O   1 
ATOM   501  C  CB  . TRP A 1 74  ? -13.922 -5.522  -4.876  1.00 25.03  ? 74  TRP A CB  1 
ATOM   502  C  CG  . TRP A 1 74  ? -13.584 -4.098  -5.182  1.00 24.14  ? 74  TRP A CG  1 
ATOM   503  C  CD1 . TRP A 1 74  ? -14.218 -2.985  -4.704  1.00 19.35  ? 74  TRP A CD1 1 
ATOM   504  C  CD2 . TRP A 1 74  ? -12.520 -3.625  -6.034  1.00 19.53  ? 74  TRP A CD2 1 
ATOM   505  N  NE1 . TRP A 1 74  ? -13.612 -1.853  -5.200  1.00 19.52  ? 74  TRP A NE1 1 
ATOM   506  C  CE2 . TRP A 1 74  ? -12.571 -2.215  -6.017  1.00 16.36  ? 74  TRP A CE2 1 
ATOM   507  C  CE3 . TRP A 1 74  ? -11.533 -4.259  -6.801  1.00 18.28  ? 74  TRP A CE3 1 
ATOM   508  C  CZ2 . TRP A 1 74  ? -11.677 -1.420  -6.734  1.00 15.26  ? 74  TRP A CZ2 1 
ATOM   509  C  CZ3 . TRP A 1 74  ? -10.636 -3.466  -7.521  1.00 20.57  ? 74  TRP A CZ3 1 
ATOM   510  C  CH2 . TRP A 1 74  ? -10.719 -2.052  -7.478  1.00 19.32  ? 74  TRP A CH2 1 
ATOM   511  N  N   . GLU A 1 75  ? -14.294 -8.514  -6.211  1.00 26.37  ? 75  GLU A N   1 
ATOM   512  C  CA  . GLU A 1 75  ? -14.394 -9.937  -5.961  1.00 28.81  ? 75  GLU A CA  1 
ATOM   513  C  C   . GLU A 1 75  ? -13.014 -10.559 -6.123  1.00 29.83  ? 75  GLU A C   1 
ATOM   514  O  O   . GLU A 1 75  ? -12.101 -9.930  -6.672  1.00 31.42  ? 75  GLU A O   1 
ATOM   515  C  CB  . GLU A 1 75  ? -15.350 -10.567 -6.980  1.00 29.99  ? 75  GLU A CB  1 
ATOM   516  C  CG  . GLU A 1 75  ? -16.745 -9.933  -7.057  1.00 32.28  ? 75  GLU A CG  1 
ATOM   517  C  CD  . GLU A 1 75  ? -17.695 -10.439 -5.981  1.00 34.88  ? 75  GLU A CD  1 
ATOM   518  O  OE1 . GLU A 1 75  ? -17.332 -11.410 -5.277  1.00 36.53  ? 75  GLU A OE1 1 
ATOM   519  O  OE2 . GLU A 1 75  ? -18.806 -9.869  -5.847  1.00 31.99  ? 75  GLU A OE2 1 
ATOM   520  N  N   . THR A 1 76  ? -12.855 -11.782 -5.623  1.00 30.05  ? 76  THR A N   1 
ATOM   521  C  CA  . THR A 1 76  ? -11.598 -12.514 -5.782  1.00 29.98  ? 76  THR A CA  1 
ATOM   522  C  C   . THR A 1 76  ? -11.914 -13.653 -6.727  1.00 31.55  ? 76  THR A C   1 
ATOM   523  O  O   . THR A 1 76  ? -13.084 -13.965 -6.967  1.00 30.35  ? 76  THR A O   1 
ATOM   524  C  CB  . THR A 1 76  ? -11.093 -13.123 -4.479  1.00 27.78  ? 76  THR A CB  1 
ATOM   525  O  OG1 . THR A 1 76  ? -12.118 -13.955 -3.918  1.00 27.49  ? 76  THR A OG1 1 
ATOM   526  C  CG2 . THR A 1 76  ? -10.691 -12.015 -3.497  1.00 24.24  ? 76  THR A CG2 1 
ATOM   527  N  N   . GLU A 1 77  ? -10.877 -14.272 -7.270  1.00 33.24  ? 77  GLU A N   1 
ATOM   528  C  CA  . GLU A 1 77  ? -11.074 -15.380 -8.188  1.00 36.98  ? 77  GLU A CA  1 
ATOM   529  C  C   . GLU A 1 77  ? -11.890 -16.471 -7.486  1.00 36.97  ? 77  GLU A C   1 
ATOM   530  O  O   . GLU A 1 77  ? -12.586 -17.263 -8.125  1.00 38.62  ? 77  GLU A O   1 
ATOM   531  C  CB  . GLU A 1 77  ? -9.713  -15.924 -8.630  1.00 39.41  ? 77  GLU A CB  1 
ATOM   532  C  CG  . GLU A 1 77  ? -9.781  -16.962 -9.722  1.00 43.36  ? 77  GLU A CG  1 
ATOM   533  C  CD  . GLU A 1 77  ? -8.401  -17.377 -10.207 1.00 46.83  ? 77  GLU A CD  1 
ATOM   534  O  OE1 . GLU A 1 77  ? -7.570  -16.487 -10.509 1.00 45.78  ? 77  GLU A OE1 1 
ATOM   535  O  OE2 . GLU A 1 77  ? -8.153  -18.597 -10.297 1.00 50.32  ? 77  GLU A OE2 1 
ATOM   536  N  N   . GLU A 1 78  ? -11.822 -16.487 -6.161  1.00 36.04  ? 78  GLU A N   1 
ATOM   537  C  CA  . GLU A 1 78  ? -12.530 -17.483 -5.379  1.00 36.28  ? 78  GLU A CA  1 
ATOM   538  C  C   . GLU A 1 78  ? -14.007 -17.141 -5.151  1.00 34.87  ? 78  GLU A C   1 
ATOM   539  O  O   . GLU A 1 78  ? -14.872 -18.020 -5.240  1.00 34.66  ? 78  GLU A O   1 
ATOM   540  C  CB  . GLU A 1 78  ? -11.810 -17.687 -4.040  1.00 38.34  ? 78  GLU A CB  1 
ATOM   541  C  CG  . GLU A 1 78  ? -12.323 -18.864 -3.226  1.00 43.89  ? 78  GLU A CG  1 
ATOM   542  C  CD  . GLU A 1 78  ? -11.561 -19.046 -1.924  1.00 47.31  ? 78  GLU A CD  1 
ATOM   543  O  OE1 . GLU A 1 78  ? -11.685 -18.175 -1.028  1.00 49.26  ? 78  GLU A OE1 1 
ATOM   544  O  OE2 . GLU A 1 78  ? -10.833 -20.059 -1.804  1.00 48.66  ? 78  GLU A OE2 1 
ATOM   545  N  N   . THR A 1 79  ? -14.313 -15.880 -4.850  1.00 32.40  ? 79  THR A N   1 
ATOM   546  C  CA  . THR A 1 79  ? -15.714 -15.523 -4.632  1.00 32.48  ? 79  THR A CA  1 
ATOM   547  C  C   . THR A 1 79  ? -16.458 -15.769 -5.933  1.00 30.65  ? 79  THR A C   1 
ATOM   548  O  O   . THR A 1 79  ? -17.586 -16.255 -5.937  1.00 30.61  ? 79  THR A O   1 
ATOM   549  C  CB  . THR A 1 79  ? -15.897 -14.040 -4.179  1.00 32.67  ? 79  THR A CB  1 
ATOM   550  O  OG1 . THR A 1 79  ? -15.317 -13.149 -5.145  1.00 34.10  ? 79  THR A OG1 1 
ATOM   551  C  CG2 . THR A 1 79  ? -15.241 -13.821 -2.818  1.00 29.98  ? 79  THR A CG2 1 
ATOM   552  N  N   . LEU A 1 80  ? -15.796 -15.450 -7.037  1.00 31.01  ? 80  LEU A N   1 
ATOM   553  C  CA  . LEU A 1 80  ? -16.347 -15.651 -8.372  1.00 31.13  ? 80  LEU A CA  1 
ATOM   554  C  C   . LEU A 1 80  ? -16.732 -17.123 -8.570  1.00 33.19  ? 80  LEU A C   1 
ATOM   555  O  O   . LEU A 1 80  ? -17.887 -17.447 -8.872  1.00 30.74  ? 80  LEU A O   1 
ATOM   556  C  CB  . LEU A 1 80  ? -15.307 -15.250 -9.409  1.00 28.00  ? 80  LEU A CB  1 
ATOM   557  C  CG  . LEU A 1 80  ? -15.540 -14.000 -10.258 1.00 30.82  ? 80  LEU A CG  1 
ATOM   558  C  CD1 . LEU A 1 80  ? -16.359 -12.957 -9.517  1.00 27.85  ? 80  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A 1 80  ? -14.182 -13.450 -10.660 1.00 26.74  ? 80  LEU A CD2 1 
ATOM   560  N  N   . LYS A 1 81  ? -15.752 -18.008 -8.391  1.00 37.03  ? 81  LYS A N   1 
ATOM   561  C  CA  . LYS A 1 81  ? -15.950 -19.450 -8.544  1.00 40.26  ? 81  LYS A CA  1 
ATOM   562  C  C   . LYS A 1 81  ? -16.991 -19.983 -7.566  1.00 41.29  ? 81  LYS A C   1 
ATOM   563  O  O   . LYS A 1 81  ? -17.763 -20.882 -7.896  1.00 40.60  ? 81  LYS A O   1 
ATOM   564  C  CB  . LYS A 1 81  ? -14.621 -20.188 -8.353  1.00 42.67  ? 81  LYS A CB  1 
ATOM   565  C  CG  . LYS A 1 81  ? -14.054 -20.792 -9.638  1.00 45.82  ? 81  LYS A CG  1 
ATOM   566  C  CD  . LYS A 1 81  ? -12.582 -20.437 -9.848  1.00 47.63  ? 81  LYS A CD  1 
ATOM   567  C  CE  . LYS A 1 81  ? -11.688 -20.994 -8.747  1.00 49.69  ? 81  LYS A CE  1 
ATOM   568  N  NZ  . LYS A 1 81  ? -10.301 -20.419 -8.806  1.00 49.33  ? 81  LYS A NZ  1 
ATOM   569  N  N   . GLN A 1 82  ? -17.014 -19.416 -6.366  1.00 42.14  ? 82  GLN A N   1 
ATOM   570  C  CA  . GLN A 1 82  ? -17.976 -19.823 -5.354  1.00 42.89  ? 82  GLN A CA  1 
ATOM   571  C  C   . GLN A 1 82  ? -19.395 -19.439 -5.748  1.00 44.24  ? 82  GLN A C   1 
ATOM   572  O  O   . GLN A 1 82  ? -20.310 -20.249 -5.644  1.00 44.52  ? 82  GLN A O   1 
ATOM   573  C  CB  . GLN A 1 82  ? -17.636 -19.179 -4.012  1.00 43.20  ? 82  GLN A CB  1 
ATOM   574  C  CG  . GLN A 1 82  ? -16.446 -19.798 -3.336  1.00 44.55  ? 82  GLN A CG  1 
ATOM   575  C  CD  . GLN A 1 82  ? -16.173 -19.184 -1.994  1.00 46.25  ? 82  GLN A CD  1 
ATOM   576  O  OE1 . GLN A 1 82  ? -16.670 -18.098 -1.685  1.00 46.95  ? 82  GLN A OE1 1 
ATOM   577  N  NE2 . GLN A 1 82  ? -15.380 -19.879 -1.175  1.00 46.82  ? 82  GLN A NE2 1 
ATOM   578  N  N   . GLN A 1 83  ? -19.580 -18.197 -6.188  1.00 45.64  ? 83  GLN A N   1 
ATOM   579  C  CA  . GLN A 1 83  ? -20.898 -17.712 -6.595  1.00 45.71  ? 83  GLN A CA  1 
ATOM   580  C  C   . GLN A 1 83  ? -21.299 -18.338 -7.928  1.00 44.88  ? 83  GLN A C   1 
ATOM   581  O  O   . GLN A 1 83  ? -22.379 -18.085 -8.448  1.00 44.32  ? 83  GLN A O   1 
ATOM   582  C  CB  . GLN A 1 83  ? -20.875 -16.186 -6.730  1.00 47.03  ? 83  GLN A CB  1 
ATOM   583  C  CG  . GLN A 1 83  ? -20.947 -15.408 -5.412  1.00 51.00  ? 83  GLN A CG  1 
ATOM   584  C  CD  . GLN A 1 83  ? -20.334 -14.005 -5.518  1.00 53.50  ? 83  GLN A CD  1 
ATOM   585  O  OE1 . GLN A 1 83  ? -20.582 -13.271 -6.479  1.00 56.12  ? 83  GLN A OE1 1 
ATOM   586  N  NE2 . GLN A 1 83  ? -19.536 -13.631 -4.524  1.00 55.58  ? 83  GLN A NE2 1 
ATOM   587  N  N   . ASN A 1 84  ? -20.413 -19.163 -8.468  1.00 45.60  ? 84  ASN A N   1 
ATOM   588  C  CA  . ASN A 1 84  ? -20.632 -19.835 -9.749  1.00 45.86  ? 84  ASN A CA  1 
ATOM   589  C  C   . ASN A 1 84  ? -21.256 -18.890 -10.763 1.00 43.17  ? 84  ASN A C   1 
ATOM   590  O  O   . ASN A 1 84  ? -22.392 -19.067 -11.190 1.00 43.89  ? 84  ASN A O   1 
ATOM   591  C  CB  . ASN A 1 84  ? -21.510 -21.079 -9.573  1.00 48.40  ? 84  ASN A CB  1 
ATOM   592  C  CG  . ASN A 1 84  ? -21.411 -22.023 -10.761 1.00 52.65  ? 84  ASN A CG  1 
ATOM   593  O  OD1 . ASN A 1 84  ? -20.355 -22.112 -11.404 1.00 53.77  ? 84  ASN A OD1 1 
ATOM   594  N  ND2 . ASN A 1 84  ? -22.498 -22.740 -11.054 1.00 53.24  ? 84  ASN A ND2 1 
ATOM   595  N  N   . VAL A 1 85  ? -20.487 -17.883 -11.148 1.00 40.56  ? 85  VAL A N   1 
ATOM   596  C  CA  . VAL A 1 85  ? -20.952 -16.889 -12.096 1.00 36.81  ? 85  VAL A CA  1 
ATOM   597  C  C   . VAL A 1 85  ? -20.557 -17.285 -13.516 1.00 36.34  ? 85  VAL A C   1 
ATOM   598  O  O   . VAL A 1 85  ? -19.605 -18.043 -13.715 1.00 34.13  ? 85  VAL A O   1 
ATOM   599  C  CB  . VAL A 1 85  ? -20.344 -15.490 -11.766 1.00 33.29  ? 85  VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 85  ? -20.632 -15.112 -10.332 1.00 31.48  ? 85  VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 85  ? -18.864 -15.498 -12.004 1.00 29.94  ? 85  VAL A CG2 1 
ATOM   602  N  N   . ARG A 1 86  ? -21.294 -16.778 -14.501 1.00 37.21  ? 86  ARG A N   1 
ATOM   603  C  CA  . ARG A 1 86  ? -20.977 -17.056 -15.900 1.00 37.78  ? 86  ARG A CA  1 
ATOM   604  C  C   . ARG A 1 86  ? -19.982 -15.977 -16.324 1.00 36.30  ? 86  ARG A C   1 
ATOM   605  O  O   . ARG A 1 86  ? -19.871 -14.937 -15.665 1.00 33.24  ? 86  ARG A O   1 
ATOM   606  C  CB  . ARG A 1 86  ? -22.223 -16.969 -16.778 1.00 39.31  ? 86  ARG A CB  1 
ATOM   607  C  CG  . ARG A 1 86  ? -23.442 -17.672 -16.217 1.00 46.41  ? 86  ARG A CG  1 
ATOM   608  C  CD  . ARG A 1 86  ? -24.116 -18.543 -17.279 1.00 53.53  ? 86  ARG A CD  1 
ATOM   609  N  NE  . ARG A 1 86  ? -24.159 -17.902 -18.595 1.00 57.51  ? 86  ARG A NE  1 
ATOM   610  C  CZ  . ARG A 1 86  ? -24.040 -18.560 -19.748 1.00 58.86  ? 86  ARG A CZ  1 
ATOM   611  N  NH1 . ARG A 1 86  ? -23.873 -19.880 -19.746 1.00 58.63  ? 86  ARG A NH1 1 
ATOM   612  N  NH2 . ARG A 1 86  ? -24.072 -17.901 -20.902 1.00 58.32  ? 86  ARG A NH2 1 
ATOM   613  N  N   . GLY A 1 87  ? -19.258 -16.231 -17.408 1.00 35.27  ? 87  GLY A N   1 
ATOM   614  C  CA  . GLY A 1 87  ? -18.283 -15.270 -17.888 1.00 36.84  ? 87  GLY A CA  1 
ATOM   615  C  C   . GLY A 1 87  ? -16.888 -15.458 -17.309 1.00 38.44  ? 87  GLY A C   1 
ATOM   616  O  O   . GLY A 1 87  ? -16.023 -14.593 -17.473 1.00 38.30  ? 87  GLY A O   1 
HETATM 617  N  N   . MSE A 1 88  ? -16.660 -16.582 -16.630 1.00 40.68  ? 88  MSE A N   1 
HETATM 618  C  CA  . MSE A 1 88  ? -15.357 -16.869 -16.025 1.00 41.87  ? 88  MSE A CA  1 
HETATM 619  C  C   . MSE A 1 88  ? -14.191 -16.770 -17.013 1.00 41.09  ? 88  MSE A C   1 
HETATM 620  O  O   . MSE A 1 88  ? -13.065 -16.482 -16.624 1.00 40.34  ? 88  MSE A O   1 
HETATM 621  C  CB  . MSE A 1 88  ? -15.364 -18.258 -15.389 1.00 45.86  ? 88  MSE A CB  1 
HETATM 622  C  CG  . MSE A 1 88  ? -16.057 -18.327 -14.044 1.00 52.95  ? 88  MSE A CG  1 
HETATM 623  SE SE  . MSE A 1 88  ? -15.147 -17.255 -12.704 1.00 61.24  ? 88  MSE A SE  1 
HETATM 624  C  CE  . MSE A 1 88  ? -13.708 -18.475 -12.279 1.00 60.02  ? 88  MSE A CE  1 
ATOM   625  N  N   . LYS A 1 89  ? -14.455 -17.014 -18.289 1.00 40.80  ? 89  LYS A N   1 
ATOM   626  C  CA  . LYS A 1 89  ? -13.403 -16.930 -19.292 1.00 41.06  ? 89  LYS A CA  1 
ATOM   627  C  C   . LYS A 1 89  ? -12.809 -15.521 -19.299 1.00 39.95  ? 89  LYS A C   1 
ATOM   628  O  O   . LYS A 1 89  ? -11.622 -15.331 -19.583 1.00 39.81  ? 89  LYS A O   1 
ATOM   629  C  CB  . LYS A 1 89  ? -13.973 -17.258 -20.666 1.00 44.81  ? 89  LYS A CB  1 
ATOM   630  C  CG  . LYS A 1 89  ? -12.929 -17.472 -21.738 1.00 48.94  ? 89  LYS A CG  1 
ATOM   631  C  CD  . LYS A 1 89  ? -12.018 -18.623 -21.359 1.00 53.99  ? 89  LYS A CD  1 
ATOM   632  C  CE  . LYS A 1 89  ? -11.177 -19.077 -22.540 1.00 56.68  ? 89  LYS A CE  1 
ATOM   633  N  NZ  . LYS A 1 89  ? -10.262 -20.189 -22.135 1.00 59.67  ? 89  LYS A NZ  1 
ATOM   634  N  N   . LYS A 1 90  ? -13.640 -14.535 -18.969 1.00 38.34  ? 90  LYS A N   1 
ATOM   635  C  CA  . LYS A 1 90  ? -13.202 -13.142 -18.926 1.00 37.28  ? 90  LYS A CA  1 
ATOM   636  C  C   . LYS A 1 90  ? -12.066 -12.918 -17.910 1.00 36.68  ? 90  LYS A C   1 
ATOM   637  O  O   . LYS A 1 90  ? -11.183 -12.078 -18.117 1.00 35.59  ? 90  LYS A O   1 
ATOM   638  C  CB  . LYS A 1 90  ? -14.390 -12.229 -18.606 1.00 37.63  ? 90  LYS A CB  1 
ATOM   639  C  CG  . LYS A 1 90  ? -15.554 -12.391 -19.560 1.00 37.92  ? 90  LYS A CG  1 
ATOM   640  C  CD  . LYS A 1 90  ? -16.002 -11.059 -20.133 1.00 40.33  ? 90  LYS A CD  1 
ATOM   641  C  CE  . LYS A 1 90  ? -17.116 -11.243 -21.170 1.00 41.13  ? 90  LYS A CE  1 
ATOM   642  N  NZ  . LYS A 1 90  ? -18.378 -11.819 -20.602 1.00 40.31  ? 90  LYS A NZ  1 
ATOM   643  N  N   . LEU A 1 91  ? -12.080 -13.661 -16.812 1.00 36.68  ? 91  LEU A N   1 
ATOM   644  C  CA  . LEU A 1 91  ? -11.021 -13.507 -15.832 1.00 37.69  ? 91  LEU A CA  1 
ATOM   645  C  C   . LEU A 1 91  ? -9.704  -13.944 -16.462 1.00 39.22  ? 91  LEU A C   1 
ATOM   646  O  O   . LEU A 1 91  ? -8.655  -13.339 -16.221 1.00 40.76  ? 91  LEU A O   1 
ATOM   647  C  CB  . LEU A 1 91  ? -11.299 -14.345 -14.591 1.00 37.89  ? 91  LEU A CB  1 
ATOM   648  C  CG  . LEU A 1 91  ? -10.176 -14.267 -13.551 1.00 40.20  ? 91  LEU A CG  1 
ATOM   649  C  CD1 . LEU A 1 91  ? -10.081 -12.850 -12.978 1.00 40.30  ? 91  LEU A CD1 1 
ATOM   650  C  CD2 . LEU A 1 91  ? -10.427 -15.278 -12.453 1.00 38.63  ? 91  LEU A CD2 1 
ATOM   651  N  N   . ASP A 1 92  ? -9.751  -14.982 -17.285 1.00 39.78  ? 92  ASP A N   1 
ATOM   652  C  CA  . ASP A 1 92  ? -8.530  -15.459 -17.922 1.00 42.30  ? 92  ASP A CA  1 
ATOM   653  C  C   . ASP A 1 92  ? -7.983  -14.438 -18.916 1.00 41.08  ? 92  ASP A C   1 
ATOM   654  O  O   . ASP A 1 92  ? -6.785  -14.165 -18.939 1.00 41.07  ? 92  ASP A O   1 
ATOM   655  C  CB  . ASP A 1 92  ? -8.792  -16.792 -18.620 1.00 46.38  ? 92  ASP A CB  1 
ATOM   656  C  CG  . ASP A 1 92  ? -9.224  -17.882 -17.645 1.00 53.00  ? 92  ASP A CG  1 
ATOM   657  O  OD1 . ASP A 1 92  ? -9.933  -17.560 -16.657 1.00 55.64  ? 92  ASP A OD1 1 
ATOM   658  O  OD2 . ASP A 1 92  ? -8.866  -19.063 -17.872 1.00 56.62  ? 92  ASP A OD2 1 
ATOM   659  N  N   . ASN A 1 93  ? -8.855  -13.860 -19.733 1.00 39.37  ? 93  ASN A N   1 
ATOM   660  C  CA  . ASN A 1 93  ? -8.394  -12.875 -20.704 1.00 38.47  ? 93  ASN A CA  1 
ATOM   661  C  C   . ASN A 1 93  ? -7.904  -11.623 -19.999 1.00 36.09  ? 93  ASN A C   1 
ATOM   662  O  O   . ASN A 1 93  ? -6.943  -11.003 -20.436 1.00 35.42  ? 93  ASN A O   1 
ATOM   663  C  CB  . ASN A 1 93  ? -9.511  -12.485 -21.670 1.00 41.14  ? 93  ASN A CB  1 
ATOM   664  C  CG  . ASN A 1 93  ? -10.207 -13.682 -22.260 1.00 44.36  ? 93  ASN A CG  1 
ATOM   665  O  OD1 . ASN A 1 93  ? -9.567  -14.591 -22.791 1.00 45.63  ? 93  ASN A OD1 1 
ATOM   666  N  ND2 . ASN A 1 93  ? -11.532 -13.693 -22.174 1.00 46.31  ? 93  ASN A ND2 1 
ATOM   667  N  N   . TYR A 1 94  ? -8.565  -11.244 -18.913 1.00 33.49  ? 94  TYR A N   1 
ATOM   668  C  CA  . TYR A 1 94  ? -8.153  -10.055 -18.202 1.00 31.49  ? 94  TYR A CA  1 
ATOM   669  C  C   . TYR A 1 94  ? -6.745  -10.228 -17.657 1.00 31.18  ? 94  TYR A C   1 
ATOM   670  O  O   . TYR A 1 94  ? -5.884  -9.353  -17.822 1.00 31.52  ? 94  TYR A O   1 
ATOM   671  C  CB  . TYR A 1 94  ? -9.103  -9.754  -17.054 1.00 32.01  ? 94  TYR A CB  1 
ATOM   672  C  CG  . TYR A 1 94  ? -8.769  -8.443  -16.389 1.00 34.39  ? 94  TYR A CG  1 
ATOM   673  C  CD1 . TYR A 1 94  ? -8.950  -7.241  -17.064 1.00 34.34  ? 94  TYR A CD1 1 
ATOM   674  C  CD2 . TYR A 1 94  ? -8.215  -8.407  -15.114 1.00 34.50  ? 94  TYR A CD2 1 
ATOM   675  C  CE1 . TYR A 1 94  ? -8.585  -6.044  -16.498 1.00 36.26  ? 94  TYR A CE1 1 
ATOM   676  C  CE2 . TYR A 1 94  ? -7.842  -7.206  -14.529 1.00 37.50  ? 94  TYR A CE2 1 
ATOM   677  C  CZ  . TYR A 1 94  ? -8.027  -6.023  -15.232 1.00 38.11  ? 94  TYR A CZ  1 
ATOM   678  O  OH  . TYR A 1 94  ? -7.612  -4.821  -14.693 1.00 39.57  ? 94  TYR A OH  1 
ATOM   679  N  N   . LYS A 1 95  ? -6.510  -11.361 -17.010 1.00 29.72  ? 95  LYS A N   1 
ATOM   680  C  CA  . LYS A 1 95  ? -5.204  -11.648 -16.443 1.00 29.36  ? 95  LYS A CA  1 
ATOM   681  C  C   . LYS A 1 95  ? -4.122  -11.708 -17.501 1.00 29.25  ? 95  LYS A C   1 
ATOM   682  O  O   . LYS A 1 95  ? -3.003  -11.241 -17.286 1.00 30.14  ? 95  LYS A O   1 
ATOM   683  C  CB  . LYS A 1 95  ? -5.264  -12.951 -15.644 1.00 29.30  ? 95  LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 95  ? -5.925  -12.743 -14.278 1.00 29.82  ? 95  LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 95  ? -6.487  -14.017 -13.678 1.00 29.58  ? 95  LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 95  ? -5.405  -15.008 -13.338 1.00 32.69  ? 95  LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 95  ? -6.026  -16.205 -12.679 1.00 37.22  ? 95  LYS A NZ  1 
ATOM   688  N  N   . LYS A 1 96  ? -4.448  -12.263 -18.657 1.00 30.28  ? 96  LYS A N   1 
ATOM   689  C  CA  . LYS A 1 96  ? -3.459  -12.351 -19.716 1.00 32.08  ? 96  LYS A CA  1 
ATOM   690  C  C   . LYS A 1 96  ? -3.154  -10.993 -20.331 1.00 33.66  ? 96  LYS A C   1 
ATOM   691  O  O   . LYS A 1 96  ? -2.001  -10.684 -20.642 1.00 35.22  ? 96  LYS A O   1 
ATOM   692  C  CB  . LYS A 1 96  ? -3.928  -13.315 -20.804 1.00 32.80  ? 96  LYS A CB  1 
ATOM   693  C  CG  . LYS A 1 96  ? -4.060  -14.747 -20.316 1.00 34.15  ? 96  LYS A CG  1 
ATOM   694  C  CD  . LYS A 1 96  ? -4.110  -15.720 -21.474 1.00 35.51  ? 96  LYS A CD  1 
ATOM   695  C  CE  . LYS A 1 96  ? -5.507  -16.202 -21.766 1.00 37.81  ? 96  LYS A CE  1 
ATOM   696  N  NZ  . LYS A 1 96  ? -5.484  -17.057 -22.998 1.00 41.78  ? 96  LYS A NZ  1 
ATOM   697  N  N   . LYS A 1 97  ? -4.184  -10.176 -20.505 1.00 34.63  ? 97  LYS A N   1 
ATOM   698  C  CA  . LYS A 1 97  ? -4.004  -8.865  -21.098 1.00 36.13  ? 97  LYS A CA  1 
ATOM   699  C  C   . LYS A 1 97  ? -3.233  -8.025  -20.114 1.00 36.24  ? 97  LYS A C   1 
ATOM   700  O  O   . LYS A 1 97  ? -2.365  -7.243  -20.500 1.00 36.44  ? 97  LYS A O   1 
ATOM   701  C  CB  . LYS A 1 97  ? -5.358  -8.220  -21.399 1.00 39.68  ? 97  LYS A CB  1 
ATOM   702  C  CG  . LYS A 1 97  ? -5.289  -7.056  -22.378 1.00 44.20  ? 97  LYS A CG  1 
ATOM   703  C  CD  . LYS A 1 97  ? -4.601  -7.468  -23.685 1.00 45.91  ? 97  LYS A CD  1 
ATOM   704  C  CE  . LYS A 1 97  ? -5.091  -6.617  -24.847 1.00 46.85  ? 97  LYS A CE  1 
ATOM   705  N  NZ  . LYS A 1 97  ? -6.574  -6.731  -25.008 1.00 46.77  ? 97  LYS A NZ  1 
ATOM   706  N  N   . ASP A 1 98  ? -3.538  -8.197  -18.833 1.00 36.34  ? 98  ASP A N   1 
ATOM   707  C  CA  . ASP A 1 98  ? -2.833  -7.448  -17.810 1.00 37.97  ? 98  ASP A CA  1 
ATOM   708  C  C   . ASP A 1 98  ? -1.336  -7.772  -17.868 1.00 38.24  ? 98  ASP A C   1 
ATOM   709  O  O   . ASP A 1 98  ? -0.495  -6.885  -17.700 1.00 41.04  ? 98  ASP A O   1 
ATOM   710  C  CB  . ASP A 1 98  ? -3.379  -7.776  -16.427 1.00 40.76  ? 98  ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 98  ? -2.724  -6.952  -15.340 1.00 44.22  ? 98  ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 98  ? -2.738  -5.709  -15.451 1.00 45.93  ? 98  ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 98  ? -2.195  -7.542  -14.375 1.00 48.82  ? 98  ASP A OD2 1 
ATOM   714  N  N   . GLN A 1 99  ? -1.000  -9.038  -18.103 1.00 35.85  ? 99  GLN A N   1 
ATOM   715  C  CA  . GLN A 1 99  ? 0.400   -9.446  -18.195 1.00 33.58  ? 99  GLN A CA  1 
ATOM   716  C  C   . GLN A 1 99  ? 1.049   -8.885  -19.458 1.00 33.16  ? 99  GLN A C   1 
ATOM   717  O  O   . GLN A 1 99  ? 2.179   -8.408  -19.430 1.00 31.68  ? 99  GLN A O   1 
ATOM   718  C  CB  . GLN A 1 99  ? 0.500   -10.972 -18.191 1.00 33.33  ? 99  GLN A CB  1 
ATOM   719  C  CG  . GLN A 1 99  ? 0.200   -11.588 -16.840 1.00 32.58  ? 99  GLN A CG  1 
ATOM   720  C  CD  . GLN A 1 99  ? 1.331   -11.364 -15.844 1.00 32.94  ? 99  GLN A CD  1 
ATOM   721  O  OE1 . GLN A 1 99  ? 2.469   -11.126 -16.233 1.00 30.48  ? 99  GLN A OE1 1 
ATOM   722  N  NE2 . GLN A 1 99  ? 1.014   -11.430 -14.555 1.00 31.79  ? 99  GLN A NE2 1 
ATOM   723  N  N   . GLU A 1 100 ? 0.336   -8.946  -20.575 1.00 35.80  ? 100 GLU A N   1 
ATOM   724  C  CA  . GLU A 1 100 ? 0.877   -8.415  -21.817 1.00 37.94  ? 100 GLU A CA  1 
ATOM   725  C  C   . GLU A 1 100 ? 1.192   -6.938  -21.600 1.00 39.94  ? 100 GLU A C   1 
ATOM   726  O  O   . GLU A 1 100 ? 2.237   -6.441  -22.018 1.00 39.68  ? 100 GLU A O   1 
ATOM   727  C  CB  . GLU A 1 100 ? -0.135  -8.583  -22.946 1.00 36.30  ? 100 GLU A CB  1 
ATOM   728  C  CG  . GLU A 1 100 ? 0.293   -7.960  -24.264 1.00 39.05  ? 100 GLU A CG  1 
ATOM   729  C  CD  . GLU A 1 100 ? -0.074  -8.821  -25.477 1.00 39.67  ? 100 GLU A CD  1 
ATOM   730  O  OE1 . GLU A 1 100 ? -1.157  -9.460  -25.453 1.00 38.36  ? 100 GLU A OE1 1 
ATOM   731  O  OE2 . GLU A 1 100 ? 0.720   -8.844  -26.451 1.00 37.04  ? 100 GLU A OE2 1 
ATOM   732  N  N   . THR A 1 101 ? 0.282   -6.247  -20.921 1.00 42.66  ? 101 THR A N   1 
ATOM   733  C  CA  . THR A 1 101 ? 0.450   -4.832  -20.632 1.00 45.61  ? 101 THR A CA  1 
ATOM   734  C  C   . THR A 1 101 ? 1.664   -4.605  -19.736 1.00 46.77  ? 101 THR A C   1 
ATOM   735  O  O   . THR A 1 101 ? 2.536   -3.801  -20.061 1.00 48.49  ? 101 THR A O   1 
ATOM   736  C  CB  . THR A 1 101 ? -0.811  -4.246  -19.961 1.00 47.02  ? 101 THR A CB  1 
ATOM   737  O  OG1 . THR A 1 101 ? -1.857  -4.109  -20.939 1.00 49.75  ? 101 THR A OG1 1 
ATOM   738  C  CG2 . THR A 1 101 ? -0.507  -2.885  -19.357 1.00 48.35  ? 101 THR A CG2 1 
ATOM   739  N  N   . LYS A 1 102 ? 1.738   -5.310  -18.614 1.00 46.84  ? 102 LYS A N   1 
ATOM   740  C  CA  . LYS A 1 102 ? 2.886   -5.143  -17.733 1.00 46.76  ? 102 LYS A CA  1 
ATOM   741  C  C   . LYS A 1 102 ? 4.201   -5.421  -18.470 1.00 48.23  ? 102 LYS A C   1 
ATOM   742  O  O   . LYS A 1 102 ? 5.196   -4.737  -18.257 1.00 48.49  ? 102 LYS A O   1 
ATOM   743  C  CB  . LYS A 1 102 ? 2.776   -6.064  -16.508 1.00 45.78  ? 102 LYS A CB  1 
ATOM   744  C  CG  . LYS A 1 102 ? 2.177   -5.408  -15.264 1.00 46.59  ? 102 LYS A CG  1 
ATOM   745  C  CD  . LYS A 1 102 ? 0.675   -5.619  -15.162 1.00 49.54  ? 102 LYS A CD  1 
ATOM   746  C  CE  . LYS A 1 102 ? -0.036  -4.395  -14.577 1.00 50.41  ? 102 LYS A CE  1 
ATOM   747  N  NZ  . LYS A 1 102 ? -0.009  -3.226  -15.523 1.00 50.74  ? 102 LYS A NZ  1 
ATOM   748  N  N   . ARG A 1 103 ? 4.209   -6.411  -19.357 1.00 51.00  ? 103 ARG A N   1 
ATOM   749  C  CA  . ARG A 1 103 ? 5.437   -6.756  -20.062 1.00 53.11  ? 103 ARG A CA  1 
ATOM   750  C  C   . ARG A 1 103 ? 6.003   -5.674  -20.976 1.00 56.19  ? 103 ARG A C   1 
ATOM   751  O  O   . ARG A 1 103 ? 7.179   -5.729  -21.332 1.00 56.15  ? 103 ARG A O   1 
ATOM   752  C  CB  . ARG A 1 103 ? 5.269   -8.060  -20.846 1.00 53.25  ? 103 ARG A CB  1 
ATOM   753  C  CG  . ARG A 1 103 ? 6.608   -8.684  -21.255 1.00 52.06  ? 103 ARG A CG  1 
ATOM   754  C  CD  . ARG A 1 103 ? 6.452   -10.062 -21.881 1.00 50.45  ? 103 ARG A CD  1 
ATOM   755  N  NE  . ARG A 1 103 ? 7.746   -10.635 -22.254 1.00 50.30  ? 103 ARG A NE  1 
ATOM   756  C  CZ  . ARG A 1 103 ? 8.546   -11.297 -21.422 1.00 49.42  ? 103 ARG A CZ  1 
ATOM   757  N  NH1 . ARG A 1 103 ? 8.183   -11.481 -20.161 1.00 49.29  ? 103 ARG A NH1 1 
ATOM   758  N  NH2 . ARG A 1 103 ? 9.713   -11.768 -21.846 1.00 48.13  ? 103 ARG A NH2 1 
ATOM   759  N  N   . TRP A 1 104 ? 5.189   -4.709  -21.390 1.00 59.55  ? 104 TRP A N   1 
ATOM   760  C  CA  . TRP A 1 104 ? 5.739   -3.640  -22.214 1.00 63.88  ? 104 TRP A CA  1 
ATOM   761  C  C   . TRP A 1 104 ? 5.853   -2.430  -21.285 1.00 65.94  ? 104 TRP A C   1 
ATOM   762  O  O   . TRP A 1 104 ? 5.152   -1.431  -21.413 1.00 66.89  ? 104 TRP A O   1 
ATOM   763  C  CB  . TRP A 1 104 ? 4.858   -3.299  -23.422 1.00 64.98  ? 104 TRP A CB  1 
ATOM   764  C  CG  . TRP A 1 104 ? 4.285   -4.469  -24.230 1.00 67.47  ? 104 TRP A CG  1 
ATOM   765  C  CD1 . TRP A 1 104 ? 2.971   -4.641  -24.545 1.00 67.74  ? 104 TRP A CD1 1 
ATOM   766  C  CD2 . TRP A 1 104 ? 4.993   -5.555  -24.880 1.00 67.40  ? 104 TRP A CD2 1 
ATOM   767  N  NE1 . TRP A 1 104 ? 2.805   -5.745  -25.341 1.00 67.53  ? 104 TRP A NE1 1 
ATOM   768  C  CE2 . TRP A 1 104 ? 4.022   -6.328  -25.566 1.00 67.44  ? 104 TRP A CE2 1 
ATOM   769  C  CE3 . TRP A 1 104 ? 6.340   -5.947  -24.951 1.00 67.76  ? 104 TRP A CE3 1 
ATOM   770  C  CZ2 . TRP A 1 104 ? 4.351   -7.470  -26.315 1.00 66.78  ? 104 TRP A CZ2 1 
ATOM   771  C  CZ3 . TRP A 1 104 ? 6.668   -7.093  -25.702 1.00 67.45  ? 104 TRP A CZ3 1 
ATOM   772  C  CH2 . TRP A 1 104 ? 5.671   -7.836  -26.372 1.00 66.45  ? 104 TRP A CH2 1 
ATOM   773  N  N   . LEU A 1 105 ? 6.731   -2.594  -20.308 1.00 69.25  ? 105 LEU A N   1 
ATOM   774  C  CA  . LEU A 1 105 ? 7.076   -1.607  -19.299 1.00 71.45  ? 105 LEU A CA  1 
ATOM   775  C  C   . LEU A 1 105 ? 8.539   -2.006  -19.158 1.00 72.95  ? 105 LEU A C   1 
ATOM   776  O  O   . LEU A 1 105 ? 9.259   -1.559  -18.263 1.00 72.57  ? 105 LEU A O   1 
ATOM   777  C  CB  . LEU A 1 105 ? 6.289   -1.858  -18.004 1.00 72.09  ? 105 LEU A CB  1 
ATOM   778  C  CG  . LEU A 1 105 ? 6.972   -2.356  -16.722 1.00 72.22  ? 105 LEU A CG  1 
ATOM   779  C  CD1 . LEU A 1 105 ? 7.647   -1.192  -15.995 1.00 72.87  ? 105 LEU A CD1 1 
ATOM   780  C  CD2 . LEU A 1 105 ? 5.926   -2.986  -15.815 1.00 70.92  ? 105 LEU A CD2 1 
ATOM   781  N  N   . LYS A 1 106 ? 8.938   -2.891  -20.077 1.00 74.55  ? 106 LYS A N   1 
ATOM   782  C  CA  . LYS A 1 106 ? 10.296  -3.404  -20.185 1.00 76.19  ? 106 LYS A CA  1 
ATOM   783  C  C   . LYS A 1 106 ? 11.123  -2.313  -19.562 1.00 77.20  ? 106 LYS A C   1 
ATOM   784  O  O   . LYS A 1 106 ? 11.795  -2.493  -18.541 1.00 78.19  ? 106 LYS A O   1 
ATOM   785  C  CB  . LYS A 1 106 ? 10.680  -3.547  -21.662 1.00 75.97  ? 106 LYS A CB  1 
ATOM   786  C  CG  . LYS A 1 106 ? 10.212  -4.826  -22.339 1.00 76.77  ? 106 LYS A CG  1 
ATOM   787  C  CD  . LYS A 1 106 ? 11.086  -6.001  -21.919 1.00 77.47  ? 106 LYS A CD  1 
ATOM   788  C  CE  . LYS A 1 106 ? 10.736  -7.275  -22.671 1.00 77.75  ? 106 LYS A CE  1 
ATOM   789  N  NZ  . LYS A 1 106 ? 11.682  -8.384  -22.325 1.00 77.59  ? 106 LYS A NZ  1 
ATOM   790  N  N   . ASN A 1 107 ? 11.035  -1.161  -20.207 1.00 77.31  ? 107 ASN A N   1 
ATOM   791  C  CA  . ASN A 1 107 ? 11.705  0.028   -19.752 1.00 77.29  ? 107 ASN A CA  1 
ATOM   792  C  C   . ASN A 1 107 ? 10.682  1.099   -20.061 1.00 76.42  ? 107 ASN A C   1 
ATOM   793  O  O   . ASN A 1 107 ? 10.139  1.735   -19.154 1.00 76.84  ? 107 ASN A O   1 
ATOM   794  C  CB  . ASN A 1 107 ? 12.989  0.277   -20.543 1.00 78.10  ? 107 ASN A CB  1 
ATOM   795  C  CG  . ASN A 1 107 ? 14.126  0.770   -19.661 1.00 78.93  ? 107 ASN A CG  1 
ATOM   796  O  OD1 . ASN A 1 107 ? 13.917  1.598   -18.769 1.00 78.93  ? 107 ASN A OD1 1 
ATOM   797  N  ND2 . ASN A 1 107 ? 15.336  0.268   -19.908 1.00 78.30  ? 107 ASN A ND2 1 
ATOM   798  N  N   . ALA A 1 108 ? 10.383  1.246   -21.351 1.00 74.15  ? 108 ALA A N   1 
ATOM   799  C  CA  . ALA A 1 108 ? 9.433   2.249   -21.810 1.00 71.89  ? 108 ALA A CA  1 
ATOM   800  C  C   . ALA A 1 108 ? 10.327  3.459   -21.526 1.00 70.16  ? 108 ALA A C   1 
ATOM   801  O  O   . ALA A 1 108 ? 11.435  3.318   -21.004 1.00 70.26  ? 108 ALA A O   1 
ATOM   802  C  CB  . ALA A 1 108 ? 8.017   1.893   -21.342 1.00 71.45  ? 108 ALA A CB  1 
ATOM   803  N  N   . SER A 1 109 ? 9.857   4.644   -21.892 1.00 67.61  ? 109 SER A N   1 
ATOM   804  C  CA  . SER A 1 109 ? 10.619  5.866   -21.684 1.00 65.84  ? 109 SER A CA  1 
ATOM   805  C  C   . SER A 1 109 ? 9.859   6.356   -20.457 1.00 65.03  ? 109 SER A C   1 
ATOM   806  O  O   . SER A 1 109 ? 8.743   5.914   -20.183 1.00 65.12  ? 109 SER A O   1 
ATOM   807  C  CB  . SER A 1 109 ? 10.421  6.873   -22.817 1.00 67.20  ? 109 SER A CB  1 
ATOM   808  O  OG  . SER A 1 109 ? 11.034  6.436   -24.020 1.00 67.42  ? 109 SER A OG  1 
ATOM   809  N  N   . PRO A 1 110 ? 10.464  7.273   -19.687 1.00 64.11  ? 110 PRO A N   1 
ATOM   810  C  CA  . PRO A 1 110 ? 9.779   7.793   -18.498 1.00 63.06  ? 110 PRO A CA  1 
ATOM   811  C  C   . PRO A 1 110 ? 8.562   8.552   -19.020 1.00 62.19  ? 110 PRO A C   1 
ATOM   812  O  O   . PRO A 1 110 ? 7.579   8.774   -18.309 1.00 62.49  ? 110 PRO A O   1 
ATOM   813  C  CB  . PRO A 1 110 ? 10.818  8.723   -17.880 1.00 62.38  ? 110 PRO A CB  1 
ATOM   814  C  CG  . PRO A 1 110 ? 12.118  8.107   -18.310 1.00 62.53  ? 110 PRO A CG  1 
ATOM   815  C  CD  . PRO A 1 110 ? 11.845  7.775   -19.755 1.00 63.55  ? 110 PRO A CD  1 
ATOM   816  N  N   . GLU A 1 111 ? 8.645   8.936   -20.289 1.00 60.91  ? 111 GLU A N   1 
ATOM   817  C  CA  . GLU A 1 111 ? 7.564   9.649   -20.933 1.00 59.86  ? 111 GLU A CA  1 
ATOM   818  C  C   . GLU A 1 111 ? 6.466   8.650   -21.313 1.00 57.16  ? 111 GLU A C   1 
ATOM   819  O  O   . GLU A 1 111 ? 5.294   9.011   -21.400 1.00 56.54  ? 111 GLU A O   1 
ATOM   820  C  CB  . GLU A 1 111 ? 8.089   10.416  -22.155 1.00 62.30  ? 111 GLU A CB  1 
ATOM   821  C  CG  . GLU A 1 111 ? 7.840   9.783   -23.509 1.00 67.82  ? 111 GLU A CG  1 
ATOM   822  C  CD  . GLU A 1 111 ? 7.751   10.835  -24.613 1.00 70.87  ? 111 GLU A CD  1 
ATOM   823  O  OE1 . GLU A 1 111 ? 7.960   12.031  -24.311 1.00 72.96  ? 111 GLU A OE1 1 
ATOM   824  O  OE2 . GLU A 1 111 ? 7.471   10.474  -25.779 1.00 72.19  ? 111 GLU A OE2 1 
ATOM   825  N  N   . ASP A 1 112 ? 6.848   7.391   -21.531 1.00 53.45  ? 112 ASP A N   1 
ATOM   826  C  CA  . ASP A 1 112 ? 5.871   6.356   -21.843 1.00 50.17  ? 112 ASP A CA  1 
ATOM   827  C  C   . ASP A 1 112 ? 5.117   6.047   -20.561 1.00 47.88  ? 112 ASP A C   1 
ATOM   828  O  O   . ASP A 1 112 ? 3.911   5.805   -20.580 1.00 46.57  ? 112 ASP A O   1 
ATOM   829  C  CB  . ASP A 1 112 ? 6.536   5.072   -22.343 1.00 50.10  ? 112 ASP A CB  1 
ATOM   830  C  CG  . ASP A 1 112 ? 6.887   5.133   -23.808 1.00 51.16  ? 112 ASP A CG  1 
ATOM   831  O  OD1 . ASP A 1 112 ? 6.201   5.876   -24.546 1.00 52.44  ? 112 ASP A OD1 1 
ATOM   832  O  OD2 . ASP A 1 112 ? 7.833   4.426   -24.228 1.00 51.12  ? 112 ASP A OD2 1 
ATOM   833  N  N   . VAL A 1 113 ? 5.836   6.045   -19.444 1.00 45.66  ? 113 VAL A N   1 
ATOM   834  C  CA  . VAL A 1 113 ? 5.206   5.784   -18.162 1.00 45.25  ? 113 VAL A CA  1 
ATOM   835  C  C   . VAL A 1 113 ? 4.399   7.009   -17.761 1.00 46.28  ? 113 VAL A C   1 
ATOM   836  O  O   . VAL A 1 113 ? 3.348   6.898   -17.125 1.00 46.59  ? 113 VAL A O   1 
ATOM   837  C  CB  . VAL A 1 113 ? 6.248   5.479   -17.063 1.00 44.23  ? 113 VAL A CB  1 
ATOM   838  C  CG1 . VAL A 1 113 ? 5.579   5.486   -15.678 1.00 42.54  ? 113 VAL A CG1 1 
ATOM   839  C  CG2 . VAL A 1 113 ? 6.884   4.128   -17.323 1.00 40.59  ? 113 VAL A CG2 1 
ATOM   840  N  N   . GLU A 1 114 ? 4.896   8.183   -18.136 1.00 48.07  ? 114 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 114 ? 4.206   9.429   -17.821 1.00 49.24  ? 114 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 114 ? 2.858   9.445   -18.535 1.00 48.80  ? 114 GLU A C   1 
ATOM   843  O  O   . GLU A 1 114 ? 1.836   9.821   -17.956 1.00 48.22  ? 114 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 114 ? 5.041   10.626  -18.273 1.00 50.06  ? 114 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 114 ? 4.384   11.973  -18.014 1.00 54.01  ? 114 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 114 ? 3.946   12.144  -16.565 1.00 56.63  ? 114 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 114 ? 4.736   11.797  -15.657 1.00 57.91  ? 114 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 114 ? 2.817   12.637  -16.336 1.00 57.45  ? 114 GLU A OE2 1 
ATOM   849  N  N   . TYR A 1 115 ? 2.870   9.022   -19.795 1.00 47.89  ? 115 TYR A N   1 
ATOM   850  C  CA  . TYR A 1 115 ? 1.660   8.978   -20.601 1.00 46.96  ? 115 TYR A CA  1 
ATOM   851  C  C   . TYR A 1 115 ? 0.696   7.945   -20.052 1.00 46.24  ? 115 TYR A C   1 
ATOM   852  O  O   . TYR A 1 115 ? -0.498  8.203   -19.928 1.00 46.88  ? 115 TYR A O   1 
ATOM   853  C  CB  . TYR A 1 115 ? 2.002   8.616   -22.039 1.00 48.54  ? 115 TYR A CB  1 
ATOM   854  C  CG  . TYR A 1 115 ? 0.823   8.677   -22.978 1.00 51.43  ? 115 TYR A CG  1 
ATOM   855  C  CD1 . TYR A 1 115 ? 0.221   9.894   -23.290 1.00 50.90  ? 115 TYR A CD1 1 
ATOM   856  C  CD2 . TYR A 1 115 ? 0.325   7.520   -23.584 1.00 52.44  ? 115 TYR A CD2 1 
ATOM   857  C  CE1 . TYR A 1 115 ? -0.846  9.965   -24.186 1.00 51.61  ? 115 TYR A CE1 1 
ATOM   858  C  CE2 . TYR A 1 115 ? -0.749  7.582   -24.485 1.00 51.79  ? 115 TYR A CE2 1 
ATOM   859  C  CZ  . TYR A 1 115 ? -1.323  8.811   -24.782 1.00 50.27  ? 115 TYR A CZ  1 
ATOM   860  O  OH  . TYR A 1 115 ? -2.358  8.899   -25.684 1.00 49.22  ? 115 TYR A OH  1 
ATOM   861  N  N   . TYR A 1 116 ? 1.215   6.771   -19.718 1.00 45.27  ? 116 TYR A N   1 
ATOM   862  C  CA  . TYR A 1 116 ? 0.370   5.713   -19.200 1.00 45.13  ? 116 TYR A CA  1 
ATOM   863  C  C   . TYR A 1 116 ? -0.364  6.105   -17.934 1.00 46.70  ? 116 TYR A C   1 
ATOM   864  O  O   . TYR A 1 116 ? -1.570  5.909   -17.830 1.00 49.07  ? 116 TYR A O   1 
ATOM   865  C  CB  . TYR A 1 116 ? 1.183   4.441   -18.955 1.00 41.49  ? 116 TYR A CB  1 
ATOM   866  C  CG  . TYR A 1 116 ? 0.408   3.362   -18.227 1.00 39.58  ? 116 TYR A CG  1 
ATOM   867  C  CD1 . TYR A 1 116 ? 0.330   3.357   -16.840 1.00 39.05  ? 116 TYR A CD1 1 
ATOM   868  C  CD2 . TYR A 1 116 ? -0.276  2.363   -18.927 1.00 38.69  ? 116 TYR A CD2 1 
ATOM   869  C  CE1 . TYR A 1 116 ? -0.412  2.385   -16.163 1.00 40.53  ? 116 TYR A CE1 1 
ATOM   870  C  CE2 . TYR A 1 116 ? -1.020  1.385   -18.259 1.00 38.00  ? 116 TYR A CE2 1 
ATOM   871  C  CZ  . TYR A 1 116 ? -1.084  1.402   -16.879 1.00 39.31  ? 116 TYR A CZ  1 
ATOM   872  O  OH  . TYR A 1 116 ? -1.803  0.442   -16.199 1.00 39.62  ? 116 TYR A OH  1 
ATOM   873  N  N   . ASN A 1 117 ? 0.350   6.656   -16.963 1.00 48.01  ? 117 ASN A N   1 
ATOM   874  C  CA  . ASN A 1 117 ? -0.297  7.034   -15.719 1.00 48.09  ? 117 ASN A CA  1 
ATOM   875  C  C   . ASN A 1 117 ? -1.331  8.141   -15.911 1.00 47.44  ? 117 ASN A C   1 
ATOM   876  O  O   . ASN A 1 117 ? -2.338  8.171   -15.210 1.00 47.94  ? 117 ASN A O   1 
ATOM   877  C  CB  . ASN A 1 117 ? 0.754   7.435   -14.675 1.00 49.42  ? 117 ASN A CB  1 
ATOM   878  C  CG  . ASN A 1 117 ? 1.504   6.229   -14.106 1.00 51.42  ? 117 ASN A CG  1 
ATOM   879  O  OD1 . ASN A 1 117 ? 0.891   5.271   -13.607 1.00 51.53  ? 117 ASN A OD1 1 
ATOM   880  N  ND2 . ASN A 1 117 ? 2.834   6.273   -14.173 1.00 50.59  ? 117 ASN A ND2 1 
ATOM   881  N  N   . CYS A 1 118 ? -1.091  9.048   -16.852 1.00 47.42  ? 118 CYS A N   1 
ATOM   882  C  CA  . CYS A 1 118 ? -2.044  10.130  -17.123 1.00 49.80  ? 118 CYS A CA  1 
ATOM   883  C  C   . CYS A 1 118 ? -3.303  9.572   -17.790 1.00 49.47  ? 118 CYS A C   1 
ATOM   884  O  O   . CYS A 1 118 ? -4.408  9.699   -17.263 1.00 47.67  ? 118 CYS A O   1 
ATOM   885  C  CB  . CYS A 1 118 ? -1.421  11.195  -18.038 1.00 51.23  ? 118 CYS A CB  1 
ATOM   886  S  SG  . CYS A 1 118 ? -0.076  12.174  -17.283 1.00 59.69  ? 118 CYS A SG  1 
ATOM   887  N  N   . GLN A 1 119 ? -3.116  8.953   -18.955 1.00 50.18  ? 119 GLN A N   1 
ATOM   888  C  CA  . GLN A 1 119 ? -4.213  8.359   -19.711 1.00 51.86  ? 119 GLN A CA  1 
ATOM   889  C  C   . GLN A 1 119 ? -4.987  7.327   -18.912 1.00 51.22  ? 119 GLN A C   1 
ATOM   890  O  O   . GLN A 1 119 ? -6.074  6.924   -19.307 1.00 54.17  ? 119 GLN A O   1 
ATOM   891  C  CB  . GLN A 1 119 ? -3.690  7.690   -20.989 1.00 54.48  ? 119 GLN A CB  1 
ATOM   892  C  CG  . GLN A 1 119 ? -3.161  8.652   -22.029 1.00 58.74  ? 119 GLN A CG  1 
ATOM   893  C  CD  . GLN A 1 119 ? -4.188  9.686   -22.404 1.00 61.18  ? 119 GLN A CD  1 
ATOM   894  O  OE1 . GLN A 1 119 ? -5.324  9.352   -22.751 1.00 63.38  ? 119 GLN A OE1 1 
ATOM   895  N  NE2 . GLN A 1 119 ? -3.800  10.956  -22.337 1.00 63.16  ? 119 GLN A NE2 1 
ATOM   896  N  N   . GLN A 1 120 ? -4.436  6.886   -17.792 1.00 49.37  ? 120 GLN A N   1 
ATOM   897  C  CA  . GLN A 1 120 ? -5.125  5.884   -17.000 1.00 48.50  ? 120 GLN A CA  1 
ATOM   898  C  C   . GLN A 1 120 ? -5.917  6.537   -15.870 1.00 48.25  ? 120 GLN A C   1 
ATOM   899  O  O   . GLN A 1 120 ? -6.753  5.902   -15.229 1.00 48.41  ? 120 GLN A O   1 
ATOM   900  C  CB  . GLN A 1 120 ? -4.111  4.875   -16.457 1.00 47.38  ? 120 GLN A CB  1 
ATOM   901  C  CG  . GLN A 1 120 ? -4.672  3.486   -16.257 1.00 49.72  ? 120 GLN A CG  1 
ATOM   902  C  CD  . GLN A 1 120 ? -5.005  2.775   -17.561 1.00 48.61  ? 120 GLN A CD  1 
ATOM   903  O  OE1 . GLN A 1 120 ? -5.114  3.389   -18.621 1.00 48.71  ? 120 GLN A OE1 1 
ATOM   904  N  NE2 . GLN A 1 120 ? -5.187  1.468   -17.475 1.00 50.09  ? 120 GLN A NE2 1 
ATOM   905  N  N   . GLU A 1 121 ? -5.655  7.820   -15.646 1.00 48.30  ? 121 GLU A N   1 
ATOM   906  C  CA  . GLU A 1 121 ? -6.344  8.581   -14.615 1.00 47.44  ? 121 GLU A CA  1 
ATOM   907  C  C   . GLU A 1 121 ? -7.598  9.192   -15.225 1.00 44.86  ? 121 GLU A C   1 
ATOM   908  O  O   . GLU A 1 121 ? -8.578  9.462   -14.520 1.00 43.80  ? 121 GLU A O   1 
ATOM   909  C  CB  . GLU A 1 121 ? -5.435  9.693   -14.089 1.00 50.32  ? 121 GLU A CB  1 
ATOM   910  C  CG  . GLU A 1 121 ? -5.337  9.749   -12.570 1.00 56.35  ? 121 GLU A CG  1 
ATOM   911  C  CD  . GLU A 1 121 ? -4.471  10.900  -12.085 1.00 59.45  ? 121 GLU A CD  1 
ATOM   912  O  OE1 . GLU A 1 121 ? -4.172  10.946  -10.872 1.00 60.94  ? 121 GLU A OE1 1 
ATOM   913  O  OE2 . GLU A 1 121 ? -4.096  11.760  -12.915 1.00 61.42  ? 121 GLU A OE2 1 
ATOM   914  N  N   . LEU A 1 122 ? -7.542  9.415   -16.539 1.00 42.65  ? 122 LEU A N   1 
ATOM   915  C  CA  . LEU A 1 122 ? -8.652  9.989   -17.298 1.00 39.83  ? 122 LEU A CA  1 
ATOM   916  C  C   . LEU A 1 122 ? -9.789  8.984   -17.418 1.00 38.34  ? 122 LEU A C   1 
ATOM   917  O  O   . LEU A 1 122 ? -10.949 9.337   -17.216 1.00 36.40  ? 122 LEU A O   1 
ATOM   918  C  CB  . LEU A 1 122 ? -8.191  10.398  -18.701 1.00 39.16  ? 122 LEU A CB  1 
ATOM   919  C  CG  . LEU A 1 122 ? -7.125  11.491  -18.831 1.00 40.15  ? 122 LEU A CG  1 
ATOM   920  C  CD1 . LEU A 1 122 ? -6.741  11.672  -20.297 1.00 39.00  ? 122 LEU A CD1 1 
ATOM   921  C  CD2 . LEU A 1 122 ? -7.664  12.803  -18.265 1.00 40.51  ? 122 LEU A CD2 1 
ATOM   922  N  N   . THR A 1 123 ? -9.458  7.734   -17.752 1.00 39.43  ? 123 THR A N   1 
ATOM   923  C  CA  . THR A 1 123 ? -10.474 6.687   -17.878 1.00 40.23  ? 123 THR A CA  1 
ATOM   924  C  C   . THR A 1 123 ? -10.931 6.310   -16.479 1.00 40.50  ? 123 THR A C   1 
ATOM   925  O  O   . THR A 1 123 ? -12.083 5.950   -16.259 1.00 38.84  ? 123 THR A O   1 
ATOM   926  C  CB  . THR A 1 123 ? -9.933  5.417   -18.590 1.00 40.40  ? 123 THR A CB  1 
ATOM   927  O  OG1 . THR A 1 123 ? -8.858  4.852   -17.830 1.00 40.65  ? 123 THR A OG1 1 
ATOM   928  C  CG2 . THR A 1 123 ? -9.441  5.755   -19.990 1.00 41.00  ? 123 THR A CG2 1 
ATOM   929  N  N   . ASP A 1 124 ? -10.018 6.412   -15.523 1.00 42.87  ? 124 ASP A N   1 
ATOM   930  C  CA  . ASP A 1 124 ? -10.352 6.095   -14.149 1.00 46.50  ? 124 ASP A CA  1 
ATOM   931  C  C   . ASP A 1 124 ? -11.535 6.966   -13.734 1.00 46.09  ? 124 ASP A C   1 
ATOM   932  O  O   . ASP A 1 124 ? -12.559 6.475   -13.255 1.00 46.15  ? 124 ASP A O   1 
ATOM   933  C  CB  . ASP A 1 124 ? -9.156  6.376   -13.241 1.00 52.51  ? 124 ASP A CB  1 
ATOM   934  C  CG  . ASP A 1 124 ? -8.949  5.291   -12.192 1.00 58.19  ? 124 ASP A CG  1 
ATOM   935  O  OD1 . ASP A 1 124 ? -8.121  4.376   -12.438 1.00 59.80  ? 124 ASP A OD1 1 
ATOM   936  O  OD2 . ASP A 1 124 ? -9.624  5.350   -11.133 1.00 60.92  ? 124 ASP A OD2 1 
ATOM   937  N  N   . ASP A 1 125 ? -11.382 8.270   -13.935 1.00 45.32  ? 125 ASP A N   1 
ATOM   938  C  CA  . ASP A 1 125 ? -12.427 9.222   -13.591 1.00 44.17  ? 125 ASP A CA  1 
ATOM   939  C  C   . ASP A 1 125 ? -13.670 8.978   -14.416 1.00 40.73  ? 125 ASP A C   1 
ATOM   940  O  O   . ASP A 1 125 ? -14.781 8.993   -13.894 1.00 40.73  ? 125 ASP A O   1 
ATOM   941  C  CB  . ASP A 1 125 ? -11.934 10.653  -13.804 1.00 48.35  ? 125 ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 125 ? -10.965 11.096  -12.727 1.00 52.05  ? 125 ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 125 ? -11.381 11.177  -11.549 1.00 55.67  ? 125 ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 125 ? -9.787  11.355  -13.055 1.00 54.65  ? 125 ASP A OD2 1 
ATOM   945  N  N   . LEU A 1 126 ? -13.481 8.765   -15.709 1.00 38.32  ? 126 LEU A N   1 
ATOM   946  C  CA  . LEU A 1 126 ? -14.604 8.497   -16.598 1.00 37.81  ? 126 LEU A CA  1 
ATOM   947  C  C   . LEU A 1 126 ? -15.541 7.475   -15.961 1.00 35.83  ? 126 LEU A C   1 
ATOM   948  O  O   . LEU A 1 126 ? -16.731 7.743   -15.762 1.00 37.08  ? 126 LEU A O   1 
ATOM   949  C  CB  . LEU A 1 126 ? -14.093 7.966   -17.937 1.00 39.64  ? 126 LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 126 ? -14.316 8.888   -19.133 1.00 43.81  ? 126 LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 126 ? -15.828 9.003   -19.362 1.00 47.37  ? 126 LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 126 ? -13.703 10.272  -18.887 1.00 43.11  ? 126 LEU A CD2 1 
ATOM   953  N  N   . HIS A 1 127 ? -14.981 6.320   -15.610 1.00 33.54  ? 127 HIS A N   1 
ATOM   954  C  CA  . HIS A 1 127 ? -15.724 5.217   -15.001 1.00 29.86  ? 127 HIS A CA  1 
ATOM   955  C  C   . HIS A 1 127 ? -16.457 5.590   -13.737 1.00 30.87  ? 127 HIS A C   1 
ATOM   956  O  O   . HIS A 1 127 ? -17.536 5.059   -13.465 1.00 29.29  ? 127 HIS A O   1 
ATOM   957  C  CB  . HIS A 1 127 ? -14.775 4.061   -14.719 1.00 28.25  ? 127 HIS A CB  1 
ATOM   958  C  CG  . HIS A 1 127 ? -14.088 3.554   -15.945 1.00 25.69  ? 127 HIS A CG  1 
ATOM   959  N  ND1 . HIS A 1 127 ? -12.922 2.826   -15.900 1.00 25.29  ? 127 HIS A ND1 1 
ATOM   960  C  CD2 . HIS A 1 127 ? -14.392 3.697   -17.256 1.00 24.19  ? 127 HIS A CD2 1 
ATOM   961  C  CE1 . HIS A 1 127 ? -12.532 2.547   -17.132 1.00 26.53  ? 127 HIS A CE1 1 
ATOM   962  N  NE2 . HIS A 1 127 ? -13.408 3.064   -17.973 1.00 26.05  ? 127 HIS A NE2 1 
ATOM   963  N  N   . LYS A 1 128 ? -15.872 6.492   -12.952 1.00 34.18  ? 128 LYS A N   1 
ATOM   964  C  CA  . LYS A 1 128 ? -16.518 6.932   -11.719 1.00 34.44  ? 128 LYS A CA  1 
ATOM   965  C  C   . LYS A 1 128 ? -17.842 7.599   -12.068 1.00 31.86  ? 128 LYS A C   1 
ATOM   966  O  O   . LYS A 1 128 ? -18.850 7.388   -11.392 1.00 31.00  ? 128 LYS A O   1 
ATOM   967  C  CB  . LYS A 1 128 ? -15.627 7.916   -10.950 1.00 38.89  ? 128 LYS A CB  1 
ATOM   968  C  CG  . LYS A 1 128 ? -14.430 7.261   -10.260 1.00 45.53  ? 128 LYS A CG  1 
ATOM   969  C  CD  . LYS A 1 128 ? -13.622 8.259   -9.418  1.00 51.16  ? 128 LYS A CD  1 
ATOM   970  C  CE  . LYS A 1 128 ? -14.447 8.806   -8.234  1.00 56.30  ? 128 LYS A CE  1 
ATOM   971  N  NZ  . LYS A 1 128 ? -13.659 9.703   -7.304  1.00 57.47  ? 128 LYS A NZ  1 
ATOM   972  N  N   . GLN A 1 129 ? -17.854 8.380   -13.142 1.00 29.64  ? 129 GLN A N   1 
ATOM   973  C  CA  . GLN A 1 129 ? -19.087 9.061   -13.525 1.00 31.81  ? 129 GLN A CA  1 
ATOM   974  C  C   . GLN A 1 129 ? -20.247 8.118   -13.867 1.00 29.52  ? 129 GLN A C   1 
ATOM   975  O  O   . GLN A 1 129 ? -21.411 8.479   -13.682 1.00 29.70  ? 129 GLN A O   1 
ATOM   976  C  CB  . GLN A 1 129 ? -18.837 10.022  -14.687 1.00 35.34  ? 129 GLN A CB  1 
ATOM   977  C  CG  . GLN A 1 129 ? -17.716 10.999  -14.439 1.00 39.85  ? 129 GLN A CG  1 
ATOM   978  C  CD  . GLN A 1 129 ? -17.683 12.104  -15.468 1.00 46.52  ? 129 GLN A CD  1 
ATOM   979  O  OE1 . GLN A 1 129 ? -18.120 11.920  -16.608 1.00 47.76  ? 129 GLN A OE1 1 
ATOM   980  N  NE2 . GLN A 1 129 ? -17.155 13.265  -15.078 1.00 49.51  ? 129 GLN A NE2 1 
ATOM   981  N  N   . TYR A 1 130 ? -19.951 6.916   -14.356 1.00 27.04  ? 130 TYR A N   1 
ATOM   982  C  CA  . TYR A 1 130 ? -21.030 5.981   -14.670 1.00 26.44  ? 130 TYR A CA  1 
ATOM   983  C  C   . TYR A 1 130 ? -21.864 5.654   -13.431 1.00 27.90  ? 130 TYR A C   1 
ATOM   984  O  O   . TYR A 1 130 ? -22.961 5.103   -13.540 1.00 29.06  ? 130 TYR A O   1 
ATOM   985  C  CB  . TYR A 1 130 ? -20.505 4.658   -15.198 1.00 23.79  ? 130 TYR A CB  1 
ATOM   986  C  CG  . TYR A 1 130 ? -19.602 4.698   -16.405 1.00 20.55  ? 130 TYR A CG  1 
ATOM   987  C  CD1 . TYR A 1 130 ? -19.491 5.826   -17.212 1.00 18.00  ? 130 TYR A CD1 1 
ATOM   988  C  CD2 . TYR A 1 130 ? -18.869 3.566   -16.749 1.00 21.02  ? 130 TYR A CD2 1 
ATOM   989  C  CE1 . TYR A 1 130 ? -18.650 5.811   -18.353 1.00 21.78  ? 130 TYR A CE1 1 
ATOM   990  C  CE2 . TYR A 1 130 ? -18.043 3.535   -17.867 1.00 22.26  ? 130 TYR A CE2 1 
ATOM   991  C  CZ  . TYR A 1 130 ? -17.929 4.649   -18.666 1.00 22.17  ? 130 TYR A CZ  1 
ATOM   992  O  OH  . TYR A 1 130 ? -17.094 4.562   -19.766 1.00 23.35  ? 130 TYR A OH  1 
ATOM   993  N  N   . GLN A 1 131 ? -21.349 5.980   -12.251 1.00 28.65  ? 131 GLN A N   1 
ATOM   994  C  CA  . GLN A 1 131 ? -22.073 5.688   -11.022 1.00 30.12  ? 131 GLN A CA  1 
ATOM   995  C  C   . GLN A 1 131 ? -22.932 6.834   -10.504 1.00 32.38  ? 131 GLN A C   1 
ATOM   996  O  O   . GLN A 1 131 ? -23.740 6.635   -9.606  1.00 33.21  ? 131 GLN A O   1 
ATOM   997  C  CB  . GLN A 1 131 ? -21.094 5.229   -9.941  1.00 29.21  ? 131 GLN A CB  1 
ATOM   998  C  CG  . GLN A 1 131 ? -20.561 3.831   -10.188 1.00 28.38  ? 131 GLN A CG  1 
ATOM   999  C  CD  . GLN A 1 131 ? -19.441 3.441   -9.234  1.00 30.05  ? 131 GLN A CD  1 
ATOM   1000 O  OE1 . GLN A 1 131 ? -19.269 2.253   -8.909  1.00 26.23  ? 131 GLN A OE1 1 
ATOM   1001 N  NE2 . GLN A 1 131 ? -18.658 4.433   -8.792  1.00 31.07  ? 131 GLN A NE2 1 
ATOM   1002 N  N   . ILE A 1 132 ? -22.779 8.031   -11.061 1.00 33.80  ? 132 ILE A N   1 
ATOM   1003 C  CA  . ILE A 1 132 ? -23.592 9.143   -10.599 1.00 35.42  ? 132 ILE A CA  1 
ATOM   1004 C  C   . ILE A 1 132 ? -24.703 9.470   -11.603 1.00 35.00  ? 132 ILE A C   1 
ATOM   1005 O  O   . ILE A 1 132 ? -24.486 9.479   -12.825 1.00 33.85  ? 132 ILE A O   1 
ATOM   1006 C  CB  . ILE A 1 132 ? -22.726 10.398  -10.315 1.00 38.36  ? 132 ILE A CB  1 
ATOM   1007 C  CG1 . ILE A 1 132 ? -22.748 11.342  -11.517 1.00 41.26  ? 132 ILE A CG1 1 
ATOM   1008 C  CG2 . ILE A 1 132 ? -21.284 9.971   -10.006 1.00 33.90  ? 132 ILE A CG2 1 
ATOM   1009 C  CD1 . ILE A 1 132 ? -22.105 12.687  -11.266 1.00 45.57  ? 132 ILE A CD1 1 
ATOM   1010 N  N   . VAL A 1 133 ? -25.897 9.721   -11.068 1.00 34.20  ? 133 VAL A N   1 
ATOM   1011 C  CA  . VAL A 1 133 ? -27.070 10.034  -11.882 1.00 35.59  ? 133 VAL A CA  1 
ATOM   1012 C  C   . VAL A 1 133 ? -26.993 11.423  -12.508 1.00 35.82  ? 133 VAL A C   1 
ATOM   1013 O  O   . VAL A 1 133 ? -26.899 12.430  -11.807 1.00 36.66  ? 133 VAL A O   1 
ATOM   1014 C  CB  . VAL A 1 133 ? -28.383 9.935   -11.045 1.00 35.12  ? 133 VAL A CB  1 
ATOM   1015 C  CG1 . VAL A 1 133 ? -29.554 10.489  -11.837 1.00 33.07  ? 133 VAL A CG1 1 
ATOM   1016 C  CG2 . VAL A 1 133 ? -28.662 8.480   -10.670 1.00 35.49  ? 133 VAL A CG2 1 
ATOM   1017 N  N   . GLY A 1 134 ? -27.040 11.470  -13.833 1.00 35.91  ? 134 GLY A N   1 
ATOM   1018 C  CA  . GLY A 1 134 ? -26.969 12.746  -14.519 1.00 36.92  ? 134 GLY A CA  1 
ATOM   1019 C  C   . GLY A 1 134 ? -28.340 13.364  -14.728 1.00 37.18  ? 134 GLY A C   1 
ATOM   1020 O  O   . GLY A 1 134 ? -28.452 14.566  -14.975 1.00 36.86  ? 134 GLY A O   1 
ATOM   1021 N  N   . ARG A 1 135 ? -29.383 12.543  -14.627 1.00 36.59  ? 135 ARG A N   1 
ATOM   1022 C  CA  . ARG A 1 135 ? -30.749 13.011  -14.807 1.00 34.97  ? 135 ARG A CA  1 
ATOM   1023 C  C   . ARG A 1 135 ? -31.751 11.890  -14.602 1.00 34.55  ? 135 ARG A C   1 
ATOM   1024 O  O   . ARG A 1 135 ? -31.566 10.794  -15.127 1.00 34.59  ? 135 ARG A O   1 
ATOM   1025 C  CB  . ARG A 1 135 ? -30.934 13.579  -16.220 1.00 33.39  ? 135 ARG A CB  1 
ATOM   1026 C  CG  . ARG A 1 135 ? -32.217 14.363  -16.404 1.00 34.49  ? 135 ARG A CG  1 
ATOM   1027 C  CD  . ARG A 1 135 ? -32.324 14.959  -17.822 1.00 37.95  ? 135 ARG A CD  1 
ATOM   1028 N  NE  . ARG A 1 135 ? -33.443 15.901  -17.946 1.00 39.66  ? 135 ARG A NE  1 
ATOM   1029 C  CZ  . ARG A 1 135 ? -33.347 17.225  -17.787 1.00 40.03  ? 135 ARG A CZ  1 
ATOM   1030 N  NH1 . ARG A 1 135 ? -32.179 17.793  -17.504 1.00 36.87  ? 135 ARG A NH1 1 
ATOM   1031 N  NH2 . ARG A 1 135 ? -34.429 17.989  -17.896 1.00 39.78  ? 135 ARG A NH2 1 
ATOM   1032 N  N   . ILE A 1 136 ? -32.795 12.161  -13.821 1.00 34.72  ? 136 ILE A N   1 
ATOM   1033 C  CA  . ILE A 1 136 ? -33.859 11.190  -13.603 1.00 36.26  ? 136 ILE A CA  1 
ATOM   1034 C  C   . ILE A 1 136 ? -34.753 11.441  -14.805 1.00 37.39  ? 136 ILE A C   1 
ATOM   1035 O  O   . ILE A 1 136 ? -34.944 12.590  -15.210 1.00 38.31  ? 136 ILE A O   1 
ATOM   1036 C  CB  . ILE A 1 136 ? -34.667 11.483  -12.339 1.00 38.30  ? 136 ILE A CB  1 
ATOM   1037 C  CG1 . ILE A 1 136 ? -33.731 11.767  -11.163 1.00 39.64  ? 136 ILE A CG1 1 
ATOM   1038 C  CG2 . ILE A 1 136 ? -35.557 10.297  -12.022 1.00 38.13  ? 136 ILE A CG2 1 
ATOM   1039 C  CD1 . ILE A 1 136 ? -32.841 10.605  -10.777 1.00 41.23  ? 136 ILE A CD1 1 
ATOM   1040 N  N   . ILE A 1 137 ? -35.324 10.390  -15.378 1.00 37.66  ? 137 ILE A N   1 
ATOM   1041 C  CA  . ILE A 1 137 ? -36.125 10.585  -16.578 1.00 35.66  ? 137 ILE A CA  1 
ATOM   1042 C  C   . ILE A 1 137 ? -37.573 10.122  -16.493 1.00 34.64  ? 137 ILE A C   1 
ATOM   1043 O  O   . ILE A 1 137 ? -38.385 10.466  -17.348 1.00 35.03  ? 137 ILE A O   1 
ATOM   1044 C  CB  . ILE A 1 137 ? -35.411 9.908   -17.771 1.00 36.92  ? 137 ILE A CB  1 
ATOM   1045 C  CG1 . ILE A 1 137 ? -35.368 10.859  -18.958 1.00 39.52  ? 137 ILE A CG1 1 
ATOM   1046 C  CG2 . ILE A 1 137 ? -36.089 8.628   -18.141 1.00 38.52  ? 137 ILE A CG2 1 
ATOM   1047 C  CD1 . ILE A 1 137 ? -34.390 12.005  -18.778 1.00 40.36  ? 137 ILE A CD1 1 
ATOM   1048 N  N   . ALA A 1 138 ? -37.896 9.359   -15.453 1.00 33.83  ? 138 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 138 ? -39.249 8.851   -15.257 1.00 31.66  ? 138 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 138 ? -39.292 8.129   -13.925 1.00 30.72  ? 138 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 138 ? -38.247 7.863   -13.346 1.00 30.90  ? 138 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 138 ? -39.604 7.873   -16.374 1.00 30.54  ? 138 ALA A CB  1 
ATOM   1053 N  N   . HIS A 1 139 ? -40.489 7.840   -13.422 1.00 29.32  ? 139 HIS A N   1 
ATOM   1054 C  CA  . HIS A 1 139 ? -40.601 7.082   -12.184 1.00 29.87  ? 139 HIS A CA  1 
ATOM   1055 C  C   . HIS A 1 139 ? -41.711 6.054   -12.297 1.00 31.76  ? 139 HIS A C   1 
ATOM   1056 O  O   . HIS A 1 139 ? -42.466 6.063   -13.265 1.00 31.95  ? 139 HIS A O   1 
ATOM   1057 C  CB  . HIS A 1 139 ? -40.817 7.978   -10.968 1.00 26.01  ? 139 HIS A CB  1 
ATOM   1058 C  CG  . HIS A 1 139 ? -42.144 8.668   -10.929 1.00 24.88  ? 139 HIS A CG  1 
ATOM   1059 N  ND1 . HIS A 1 139 ? -42.462 9.723   -11.759 1.00 22.06  ? 139 HIS A ND1 1 
ATOM   1060 C  CD2 . HIS A 1 139 ? -43.202 8.507   -10.099 1.00 21.46  ? 139 HIS A CD2 1 
ATOM   1061 C  CE1 . HIS A 1 139 ? -43.658 10.184  -11.434 1.00 22.84  ? 139 HIS A CE1 1 
ATOM   1062 N  NE2 . HIS A 1 139 ? -44.127 9.464   -10.429 1.00 21.23  ? 139 HIS A NE2 1 
ATOM   1063 N  N   . SER A 1 140 ? -41.800 5.163   -11.314 1.00 33.85  ? 140 SER A N   1 
ATOM   1064 C  CA  . SER A 1 140 ? -42.797 4.105   -11.338 1.00 33.55  ? 140 SER A CA  1 
ATOM   1065 C  C   . SER A 1 140 ? -44.101 4.508   -10.679 1.00 34.91  ? 140 SER A C   1 
ATOM   1066 O  O   . SER A 1 140 ? -44.138 5.365   -9.796  1.00 36.39  ? 140 SER A O   1 
ATOM   1067 C  CB  . SER A 1 140 ? -42.244 2.841   -10.658 1.00 34.70  ? 140 SER A CB  1 
ATOM   1068 O  OG  . SER A 1 140 ? -42.417 2.868   -9.249  1.00 35.84  ? 140 SER A OG  1 
ATOM   1069 N  N   . ASN A 1 141 ? -45.176 3.873   -11.116 1.00 35.30  ? 141 ASN A N   1 
ATOM   1070 C  CA  . ASN A 1 141 ? -46.499 4.141   -10.588 1.00 36.40  ? 141 ASN A CA  1 
ATOM   1071 C  C   . ASN A 1 141 ? -46.668 3.442   -9.240  1.00 37.47  ? 141 ASN A C   1 
ATOM   1072 O  O   . ASN A 1 141 ? -47.388 3.917   -8.366  1.00 39.07  ? 141 ASN A O   1 
ATOM   1073 C  CB  . ASN A 1 141 ? -47.549 3.657   -11.601 1.00 34.35  ? 141 ASN A CB  1 
ATOM   1074 C  CG  . ASN A 1 141 ? -48.943 3.622   -11.029 1.00 34.21  ? 141 ASN A CG  1 
ATOM   1075 O  OD1 . ASN A 1 141 ? -49.388 2.600   -10.509 1.00 37.49  ? 141 ASN A OD1 1 
ATOM   1076 N  ND2 . ASN A 1 141 ? -49.638 4.747   -11.101 1.00 33.87  ? 141 ASN A ND2 1 
ATOM   1077 N  N   . GLN A 1 142 ? -45.990 2.315   -9.072  1.00 39.22  ? 142 GLN A N   1 
ATOM   1078 C  CA  . GLN A 1 142 ? -46.078 1.566   -7.829  1.00 40.60  ? 142 GLN A CA  1 
ATOM   1079 C  C   . GLN A 1 142 ? -45.026 2.095   -6.872  1.00 39.40  ? 142 GLN A C   1 
ATOM   1080 O  O   . GLN A 1 142 ? -43.963 2.553   -7.296  1.00 37.99  ? 142 GLN A O   1 
ATOM   1081 C  CB  . GLN A 1 142 ? -45.850 0.073   -8.097  1.00 44.19  ? 142 GLN A CB  1 
ATOM   1082 C  CG  . GLN A 1 142 ? -46.190 -0.836  -6.922  1.00 49.32  ? 142 GLN A CG  1 
ATOM   1083 C  CD  . GLN A 1 142 ? -47.281 -1.844  -7.263  1.00 52.59  ? 142 GLN A CD  1 
ATOM   1084 O  OE1 . GLN A 1 142 ? -48.364 -1.848  -6.653  1.00 52.54  ? 142 GLN A OE1 1 
ATOM   1085 N  NE2 . GLN A 1 142 ? -47.003 -2.707  -8.249  1.00 53.02  ? 142 GLN A NE2 1 
ATOM   1086 N  N   . LYS A 1 143 ? -45.333 2.025   -5.583  1.00 38.95  ? 143 LYS A N   1 
ATOM   1087 C  CA  . LYS A 1 143 ? -44.439 2.500   -4.538  1.00 40.71  ? 143 LYS A CA  1 
ATOM   1088 C  C   . LYS A 1 143 ? -44.065 1.365   -3.582  1.00 40.44  ? 143 LYS A C   1 
ATOM   1089 O  O   . LYS A 1 143 ? -44.845 0.441   -3.362  1.00 38.71  ? 143 LYS A O   1 
ATOM   1090 C  CB  . LYS A 1 143 ? -45.125 3.624   -3.751  1.00 43.02  ? 143 LYS A CB  1 
ATOM   1091 C  CG  . LYS A 1 143 ? -44.634 5.042   -4.053  1.00 45.68  ? 143 LYS A CG  1 
ATOM   1092 C  CD  . LYS A 1 143 ? -45.772 6.074   -3.951  1.00 50.78  ? 143 LYS A CD  1 
ATOM   1093 C  CE  . LYS A 1 143 ? -46.640 5.922   -2.675  1.00 51.95  ? 143 LYS A CE  1 
ATOM   1094 N  NZ  . LYS A 1 143 ? -46.011 6.453   -1.419  1.00 54.70  ? 143 LYS A NZ  1 
ATOM   1095 N  N   . SER A 1 144 ? -42.864 1.439   -3.020  1.00 40.63  ? 144 SER A N   1 
ATOM   1096 C  CA  . SER A 1 144 ? -42.402 0.432   -2.067  1.00 41.19  ? 144 SER A CA  1 
ATOM   1097 C  C   . SER A 1 144 ? -43.214 0.601   -0.781  1.00 42.66  ? 144 SER A C   1 
ATOM   1098 O  O   . SER A 1 144 ? -43.895 1.616   -0.587  1.00 43.89  ? 144 SER A O   1 
ATOM   1099 C  CB  . SER A 1 144 ? -40.923 0.648   -1.748  1.00 41.19  ? 144 SER A CB  1 
ATOM   1100 O  OG  . SER A 1 144 ? -40.754 1.787   -0.911  1.00 39.48  ? 144 SER A OG  1 
ATOM   1101 N  N   . ALA A 1 145 ? -43.157 -0.385  0.105   1.00 43.05  ? 145 ALA A N   1 
ATOM   1102 C  CA  . ALA A 1 145 ? -43.894 -0.267  1.356   1.00 42.69  ? 145 ALA A CA  1 
ATOM   1103 C  C   . ALA A 1 145 ? -43.397 0.989   2.085   1.00 42.86  ? 145 ALA A C   1 
ATOM   1104 O  O   . ALA A 1 145 ? -44.128 1.592   2.867   1.00 43.63  ? 145 ALA A O   1 
ATOM   1105 C  CB  . ALA A 1 145 ? -43.680 -1.504  2.210   1.00 40.60  ? 145 ALA A CB  1 
ATOM   1106 N  N   . ALA A 1 146 ? -42.154 1.384   1.811   1.00 42.25  ? 146 ALA A N   1 
ATOM   1107 C  CA  . ALA A 1 146 ? -41.565 2.571   2.435   1.00 42.25  ? 146 ALA A CA  1 
ATOM   1108 C  C   . ALA A 1 146 ? -42.050 3.858   1.757   1.00 42.14  ? 146 ALA A C   1 
ATOM   1109 O  O   . ALA A 1 146 ? -41.729 4.964   2.200   1.00 41.66  ? 146 ALA A O   1 
ATOM   1110 C  CB  . ALA A 1 146 ? -40.043 2.493   2.374   1.00 39.88  ? 146 ALA A CB  1 
ATOM   1111 N  N   . GLY A 1 147 ? -42.819 3.706   0.683   1.00 41.37  ? 147 GLY A N   1 
ATOM   1112 C  CA  . GLY A 1 147 ? -43.341 4.863   -0.019  1.00 40.90  ? 147 GLY A CA  1 
ATOM   1113 C  C   . GLY A 1 147 ? -42.465 5.380   -1.144  1.00 40.86  ? 147 GLY A C   1 
ATOM   1114 O  O   . GLY A 1 147 ? -42.711 6.465   -1.672  1.00 41.00  ? 147 GLY A O   1 
ATOM   1115 N  N   . TYR A 1 148 ? -41.446 4.607   -1.514  1.00 40.31  ? 148 TYR A N   1 
ATOM   1116 C  CA  . TYR A 1 148 ? -40.533 4.989   -2.591  1.00 40.07  ? 148 TYR A CA  1 
ATOM   1117 C  C   . TYR A 1 148 ? -40.876 4.383   -3.952  1.00 39.78  ? 148 TYR A C   1 
ATOM   1118 O  O   . TYR A 1 148 ? -41.205 3.197   -4.057  1.00 40.85  ? 148 TYR A O   1 
ATOM   1119 C  CB  . TYR A 1 148 ? -39.109 4.539   -2.277  1.00 43.36  ? 148 TYR A CB  1 
ATOM   1120 C  CG  . TYR A 1 148 ? -38.351 5.374   -1.285  1.00 46.49  ? 148 TYR A CG  1 
ATOM   1121 C  CD1 . TYR A 1 148 ? -37.936 6.666   -1.603  1.00 48.13  ? 148 TYR A CD1 1 
ATOM   1122 C  CD2 . TYR A 1 148 ? -38.004 4.851   -0.039  1.00 49.30  ? 148 TYR A CD2 1 
ATOM   1123 C  CE1 . TYR A 1 148 ? -37.187 7.419   -0.708  1.00 50.48  ? 148 TYR A CE1 1 
ATOM   1124 C  CE2 . TYR A 1 148 ? -37.255 5.590   0.868   1.00 51.62  ? 148 TYR A CE2 1 
ATOM   1125 C  CZ  . TYR A 1 148 ? -36.847 6.874   0.526   1.00 53.53  ? 148 TYR A CZ  1 
ATOM   1126 O  OH  . TYR A 1 148 ? -36.077 7.590   1.420   1.00 57.24  ? 148 TYR A OH  1 
ATOM   1127 N  N   . PRO A 1 149 ? -40.836 5.200   -5.012  1.00 37.67  ? 149 PRO A N   1 
ATOM   1128 C  CA  . PRO A 1 149 ? -41.128 4.669   -6.342  1.00 37.39  ? 149 PRO A CA  1 
ATOM   1129 C  C   . PRO A 1 149 ? -39.747 4.307   -6.900  1.00 38.07  ? 149 PRO A C   1 
ATOM   1130 O  O   . PRO A 1 149 ? -38.726 4.599   -6.267  1.00 38.15  ? 149 PRO A O   1 
ATOM   1131 C  CB  . PRO A 1 149 ? -41.727 5.876   -7.058  1.00 36.96  ? 149 PRO A CB  1 
ATOM   1132 C  CG  . PRO A 1 149 ? -40.923 7.007   -6.496  1.00 33.78  ? 149 PRO A CG  1 
ATOM   1133 C  CD  . PRO A 1 149 ? -40.954 6.670   -5.010  1.00 36.16  ? 149 PRO A CD  1 
ATOM   1134 N  N   . ASP A 1 150 ? -39.683 3.668   -8.056  1.00 37.18  ? 150 ASP A N   1 
ATOM   1135 C  CA  . ASP A 1 150 ? -38.367 3.383   -8.597  1.00 38.15  ? 150 ASP A CA  1 
ATOM   1136 C  C   . ASP A 1 150 ? -38.091 4.464   -9.621  1.00 36.50  ? 150 ASP A C   1 
ATOM   1137 O  O   . ASP A 1 150 ? -39.024 5.061   -10.164 1.00 37.81  ? 150 ASP A O   1 
ATOM   1138 C  CB  . ASP A 1 150 ? -38.318 1.983   -9.218  1.00 40.19  ? 150 ASP A CB  1 
ATOM   1139 C  CG  . ASP A 1 150 ? -38.455 0.883   -8.168  1.00 44.29  ? 150 ASP A CG  1 
ATOM   1140 O  OD1 . ASP A 1 150 ? -38.225 1.172   -6.962  1.00 45.03  ? 150 ASP A OD1 1 
ATOM   1141 O  OD2 . ASP A 1 150 ? -38.784 -0.266  -8.543  1.00 46.19  ? 150 ASP A OD2 1 
ATOM   1142 N  N   . TYR A 1 151 ? -36.823 4.745   -9.872  1.00 33.91  ? 151 TYR A N   1 
ATOM   1143 C  CA  . TYR A 1 151 ? -36.491 5.770   -10.838 1.00 32.16  ? 151 TYR A CA  1 
ATOM   1144 C  C   . TYR A 1 151 ? -35.743 5.228   -12.033 1.00 31.83  ? 151 TYR A C   1 
ATOM   1145 O  O   . TYR A 1 151 ? -34.992 4.262   -11.915 1.00 34.03  ? 151 TYR A O   1 
ATOM   1146 C  CB  . TYR A 1 151 ? -35.669 6.867   -10.170 1.00 29.89  ? 151 TYR A CB  1 
ATOM   1147 C  CG  . TYR A 1 151 ? -36.442 7.610   -9.123  1.00 29.75  ? 151 TYR A CG  1 
ATOM   1148 C  CD1 . TYR A 1 151 ? -36.358 7.257   -7.773  1.00 31.41  ? 151 TYR A CD1 1 
ATOM   1149 C  CD2 . TYR A 1 151 ? -37.300 8.644   -9.485  1.00 31.08  ? 151 TYR A CD2 1 
ATOM   1150 C  CE1 . TYR A 1 151 ? -37.123 7.926   -6.801  1.00 30.10  ? 151 TYR A CE1 1 
ATOM   1151 C  CE2 . TYR A 1 151 ? -38.061 9.311   -8.535  1.00 31.73  ? 151 TYR A CE2 1 
ATOM   1152 C  CZ  . TYR A 1 151 ? -37.972 8.950   -7.200  1.00 32.18  ? 151 TYR A CZ  1 
ATOM   1153 O  OH  . TYR A 1 151 ? -38.755 9.617   -6.292  1.00 32.48  ? 151 TYR A OH  1 
ATOM   1154 N  N   . TYR A 1 152 ? -35.967 5.856   -13.187 1.00 31.40  ? 152 TYR A N   1 
ATOM   1155 C  CA  . TYR A 1 152 ? -35.308 5.489   -14.440 1.00 29.90  ? 152 TYR A CA  1 
ATOM   1156 C  C   . TYR A 1 152 ? -34.198 6.523   -14.565 1.00 30.85  ? 152 TYR A C   1 
ATOM   1157 O  O   . TYR A 1 152 ? -34.461 7.718   -14.766 1.00 31.72  ? 152 TYR A O   1 
ATOM   1158 C  CB  . TYR A 1 152 ? -36.280 5.608   -15.612 1.00 29.07  ? 152 TYR A CB  1 
ATOM   1159 C  CG  . TYR A 1 152 ? -35.781 4.929   -16.859 1.00 29.77  ? 152 TYR A CG  1 
ATOM   1160 C  CD1 . TYR A 1 152 ? -35.548 3.551   -16.875 1.00 30.18  ? 152 TYR A CD1 1 
ATOM   1161 C  CD2 . TYR A 1 152 ? -35.510 5.655   -18.014 1.00 25.97  ? 152 TYR A CD2 1 
ATOM   1162 C  CE1 . TYR A 1 152 ? -35.051 2.913   -18.008 1.00 28.84  ? 152 TYR A CE1 1 
ATOM   1163 C  CE2 . TYR A 1 152 ? -35.008 5.023   -19.164 1.00 28.88  ? 152 TYR A CE2 1 
ATOM   1164 C  CZ  . TYR A 1 152 ? -34.778 3.650   -19.144 1.00 27.65  ? 152 TYR A CZ  1 
ATOM   1165 O  OH  . TYR A 1 152 ? -34.221 3.016   -20.224 1.00 25.54  ? 152 TYR A OH  1 
ATOM   1166 N  N   . CYS A 1 153 ? -32.955 6.068   -14.451 1.00 29.33  ? 153 CYS A N   1 
ATOM   1167 C  CA  . CYS A 1 153 ? -31.831 6.985   -14.460 1.00 26.56  ? 153 CYS A CA  1 
ATOM   1168 C  C   . CYS A 1 153 ? -30.952 7.035   -15.674 1.00 27.12  ? 153 CYS A C   1 
ATOM   1169 O  O   . CYS A 1 153 ? -30.654 6.013   -16.298 1.00 27.74  ? 153 CYS A O   1 
ATOM   1170 C  CB  . CYS A 1 153 ? -30.930 6.693   -13.262 1.00 24.69  ? 153 CYS A CB  1 
ATOM   1171 S  SG  . CYS A 1 153 ? -31.819 6.486   -11.753 1.00 28.91  ? 153 CYS A SG  1 
ATOM   1172 N  N   . LYS A 1 154 ? -30.515 8.248   -15.987 1.00 26.49  ? 154 LYS A N   1 
ATOM   1173 C  CA  . LYS A 1 154 ? -29.588 8.453   -17.071 1.00 26.54  ? 154 LYS A CA  1 
ATOM   1174 C  C   . LYS A 1 154 ? -28.260 8.692   -16.344 1.00 27.15  ? 154 LYS A C   1 
ATOM   1175 O  O   . LYS A 1 154 ? -28.175 9.543   -15.440 1.00 27.67  ? 154 LYS A O   1 
ATOM   1176 C  CB  . LYS A 1 154 ? -30.002 9.665   -17.889 1.00 27.63  ? 154 LYS A CB  1 
ATOM   1177 C  CG  . LYS A 1 154 ? -29.309 9.730   -19.241 1.00 27.35  ? 154 LYS A CG  1 
ATOM   1178 C  CD  . LYS A 1 154 ? -28.163 10.686  -19.204 1.00 27.99  ? 154 LYS A CD  1 
ATOM   1179 C  CE  . LYS A 1 154 ? -27.201 10.438  -20.340 1.00 29.55  ? 154 LYS A CE  1 
ATOM   1180 N  NZ  . LYS A 1 154 ? -25.889 11.104  -20.016 1.00 33.11  ? 154 LYS A NZ  1 
ATOM   1181 N  N   . TRP A 1 155 ? -27.241 7.918   -16.714 1.00 27.17  ? 155 TRP A N   1 
ATOM   1182 C  CA  . TRP A 1 155 ? -25.918 8.003   -16.093 1.00 25.95  ? 155 TRP A CA  1 
ATOM   1183 C  C   . TRP A 1 155 ? -24.961 8.905   -16.834 1.00 28.90  ? 155 TRP A C   1 
ATOM   1184 O  O   . TRP A 1 155 ? -25.021 9.038   -18.054 1.00 32.52  ? 155 TRP A O   1 
ATOM   1185 C  CB  . TRP A 1 155 ? -25.278 6.616   -15.986 1.00 22.57  ? 155 TRP A CB  1 
ATOM   1186 C  CG  . TRP A 1 155 ? -26.160 5.627   -15.322 1.00 20.60  ? 155 TRP A CG  1 
ATOM   1187 C  CD1 . TRP A 1 155 ? -26.913 4.664   -15.928 1.00 19.09  ? 155 TRP A CD1 1 
ATOM   1188 C  CD2 . TRP A 1 155 ? -26.456 5.548   -13.921 1.00 19.77  ? 155 TRP A CD2 1 
ATOM   1189 N  NE1 . TRP A 1 155 ? -27.667 3.988   -14.987 1.00 20.20  ? 155 TRP A NE1 1 
ATOM   1190 C  CE2 . TRP A 1 155 ? -27.405 4.510   -13.749 1.00 17.87  ? 155 TRP A CE2 1 
ATOM   1191 C  CE3 . TRP A 1 155 ? -26.013 6.255   -12.795 1.00 17.43  ? 155 TRP A CE3 1 
ATOM   1192 C  CZ2 . TRP A 1 155 ? -27.921 4.164   -12.495 1.00 19.47  ? 155 TRP A CZ2 1 
ATOM   1193 C  CZ3 . TRP A 1 155 ? -26.528 5.916   -11.549 1.00 17.73  ? 155 TRP A CZ3 1 
ATOM   1194 C  CH2 . TRP A 1 155 ? -27.472 4.879   -11.407 1.00 20.93  ? 155 TRP A CH2 1 
ATOM   1195 N  N   . GLN A 1 156 ? -24.059 9.516   -16.086 1.00 31.58  ? 156 GLN A N   1 
ATOM   1196 C  CA  . GLN A 1 156 ? -23.075 10.403  -16.674 1.00 33.69  ? 156 GLN A CA  1 
ATOM   1197 C  C   . GLN A 1 156 ? -22.067 9.594   -17.455 1.00 35.24  ? 156 GLN A C   1 
ATOM   1198 O  O   . GLN A 1 156 ? -21.631 8.529   -17.010 1.00 35.79  ? 156 GLN A O   1 
ATOM   1199 C  CB  . GLN A 1 156 ? -22.362 11.171  -15.576 1.00 34.62  ? 156 GLN A CB  1 
ATOM   1200 C  CG  . GLN A 1 156 ? -23.324 11.736  -14.574 1.00 39.64  ? 156 GLN A CG  1 
ATOM   1201 C  CD  . GLN A 1 156 ? -23.026 13.179  -14.258 1.00 44.70  ? 156 GLN A CD  1 
ATOM   1202 O  OE1 . GLN A 1 156 ? -23.939 13.988  -14.117 1.00 48.22  ? 156 GLN A OE1 1 
ATOM   1203 N  NE2 . GLN A 1 156 ? -21.741 13.511  -14.135 1.00 45.35  ? 156 GLN A NE2 1 
ATOM   1204 N  N   . GLY A 1 157 ? -21.694 10.099  -18.625 1.00 36.09  ? 157 GLY A N   1 
ATOM   1205 C  CA  . GLY A 1 157 ? -20.704 9.414   -19.435 1.00 33.96  ? 157 GLY A CA  1 
ATOM   1206 C  C   . GLY A 1 157 ? -21.233 8.244   -20.236 1.00 32.90  ? 157 GLY A C   1 
ATOM   1207 O  O   . GLY A 1 157 ? -20.474 7.629   -20.974 1.00 34.08  ? 157 GLY A O   1 
ATOM   1208 N  N   . LEU A 1 158 ? -22.519 7.930   -20.096 1.00 32.05  ? 158 LEU A N   1 
ATOM   1209 C  CA  . LEU A 1 158 ? -23.120 6.823   -20.839 1.00 29.77  ? 158 LEU A CA  1 
ATOM   1210 C  C   . LEU A 1 158 ? -24.386 7.251   -21.574 1.00 29.86  ? 158 LEU A C   1 
ATOM   1211 O  O   . LEU A 1 158 ? -25.210 7.992   -21.024 1.00 29.73  ? 158 LEU A O   1 
ATOM   1212 C  CB  . LEU A 1 158 ? -23.474 5.669   -19.901 1.00 27.00  ? 158 LEU A CB  1 
ATOM   1213 C  CG  . LEU A 1 158 ? -22.335 4.987   -19.156 1.00 23.16  ? 158 LEU A CG  1 
ATOM   1214 C  CD1 . LEU A 1 158 ? -22.895 3.815   -18.356 1.00 23.68  ? 158 LEU A CD1 1 
ATOM   1215 C  CD2 . LEU A 1 158 ? -21.295 4.505   -20.138 1.00 21.86  ? 158 LEU A CD2 1 
ATOM   1216 N  N   . PRO A 1 159 ? -24.566 6.762   -22.818 1.00 30.35  ? 159 PRO A N   1 
ATOM   1217 C  CA  . PRO A 1 159 ? -25.716 7.052   -23.688 1.00 30.50  ? 159 PRO A CA  1 
ATOM   1218 C  C   . PRO A 1 159 ? -27.037 6.586   -23.089 1.00 30.92  ? 159 PRO A C   1 
ATOM   1219 O  O   . PRO A 1 159 ? -27.049 5.823   -22.119 1.00 31.23  ? 159 PRO A O   1 
ATOM   1220 C  CB  . PRO A 1 159 ? -25.367 6.314   -24.977 1.00 30.92  ? 159 PRO A CB  1 
ATOM   1221 C  CG  . PRO A 1 159 ? -24.568 5.157   -24.478 1.00 30.82  ? 159 PRO A CG  1 
ATOM   1222 C  CD  . PRO A 1 159 ? -23.661 5.800   -23.470 1.00 29.07  ? 159 PRO A CD  1 
ATOM   1223 N  N   . TYR A 1 160 ? -28.148 7.038   -23.666 1.00 30.27  ? 160 TYR A N   1 
ATOM   1224 C  CA  . TYR A 1 160 ? -29.451 6.677   -23.137 1.00 31.05  ? 160 TYR A CA  1 
ATOM   1225 C  C   . TYR A 1 160 ? -29.832 5.207   -23.146 1.00 32.96  ? 160 TYR A C   1 
ATOM   1226 O  O   . TYR A 1 160 ? -30.786 4.824   -22.460 1.00 32.83  ? 160 TYR A O   1 
ATOM   1227 C  CB  . TYR A 1 160 ? -30.550 7.481   -23.827 1.00 30.21  ? 160 TYR A CB  1 
ATOM   1228 C  CG  . TYR A 1 160 ? -30.791 8.811   -23.161 1.00 27.97  ? 160 TYR A CG  1 
ATOM   1229 C  CD1 . TYR A 1 160 ? -29.836 9.824   -23.227 1.00 26.50  ? 160 TYR A CD1 1 
ATOM   1230 C  CD2 . TYR A 1 160 ? -31.965 9.052   -22.458 1.00 26.92  ? 160 TYR A CD2 1 
ATOM   1231 C  CE1 . TYR A 1 160 ? -30.046 11.046  -22.614 1.00 26.38  ? 160 TYR A CE1 1 
ATOM   1232 C  CE2 . TYR A 1 160 ? -32.186 10.273  -21.835 1.00 27.74  ? 160 TYR A CE2 1 
ATOM   1233 C  CZ  . TYR A 1 160 ? -31.220 11.268  -21.924 1.00 27.44  ? 160 TYR A CZ  1 
ATOM   1234 O  OH  . TYR A 1 160 ? -31.439 12.501  -21.357 1.00 30.47  ? 160 TYR A OH  1 
ATOM   1235 N  N   . SER A 1 161 ? -29.110 4.392   -23.913 1.00 32.92  ? 161 SER A N   1 
ATOM   1236 C  CA  . SER A 1 161 ? -29.410 2.963   -23.971 1.00 33.33  ? 161 SER A CA  1 
ATOM   1237 C  C   . SER A 1 161 ? -28.810 2.302   -22.730 1.00 33.66  ? 161 SER A C   1 
ATOM   1238 O  O   . SER A 1 161 ? -28.852 1.085   -22.572 1.00 34.15  ? 161 SER A O   1 
ATOM   1239 C  CB  . SER A 1 161 ? -28.828 2.343   -25.245 1.00 28.44  ? 161 SER A CB  1 
ATOM   1240 O  OG  . SER A 1 161 ? -27.450 2.652   -25.351 1.00 33.22  ? 161 SER A OG  1 
ATOM   1241 N  N   . GLU A 1 162 ? -28.239 3.118   -21.851 1.00 33.26  ? 162 GLU A N   1 
ATOM   1242 C  CA  . GLU A 1 162 ? -27.656 2.603   -20.618 1.00 32.75  ? 162 GLU A CA  1 
ATOM   1243 C  C   . GLU A 1 162 ? -28.507 3.028   -19.404 1.00 31.01  ? 162 GLU A C   1 
ATOM   1244 O  O   . GLU A 1 162 ? -28.142 2.756   -18.268 1.00 30.73  ? 162 GLU A O   1 
ATOM   1245 C  CB  . GLU A 1 162 ? -26.218 3.112   -20.445 1.00 33.70  ? 162 GLU A CB  1 
ATOM   1246 C  CG  . GLU A 1 162 ? -25.374 3.079   -21.702 1.00 38.71  ? 162 GLU A CG  1 
ATOM   1247 C  CD  . GLU A 1 162 ? -25.102 1.674   -22.230 1.00 42.89  ? 162 GLU A CD  1 
ATOM   1248 O  OE1 . GLU A 1 162 ? -24.529 1.574   -23.341 1.00 44.24  ? 162 GLU A OE1 1 
ATOM   1249 O  OE2 . GLU A 1 162 ? -25.443 0.675   -21.549 1.00 44.19  ? 162 GLU A OE2 1 
ATOM   1250 N  N   . CYS A 1 163 ? -29.625 3.718   -19.635 1.00 30.14  ? 163 CYS A N   1 
ATOM   1251 C  CA  . CYS A 1 163 ? -30.494 4.125   -18.523 1.00 30.28  ? 163 CYS A CA  1 
ATOM   1252 C  C   . CYS A 1 163 ? -31.023 2.857   -17.850 1.00 28.86  ? 163 CYS A C   1 
ATOM   1253 O  O   . CYS A 1 163 ? -31.154 1.819   -18.489 1.00 29.07  ? 163 CYS A O   1 
ATOM   1254 C  CB  . CYS A 1 163 ? -31.691 4.950   -19.022 1.00 30.81  ? 163 CYS A CB  1 
ATOM   1255 S  SG  . CYS A 1 163 ? -31.322 6.607   -19.666 1.00 32.46  ? 163 CYS A SG  1 
ATOM   1256 N  N   . SER A 1 164 ? -31.342 2.930   -16.569 1.00 27.29  ? 164 SER A N   1 
ATOM   1257 C  CA  . SER A 1 164 ? -31.849 1.748   -15.890 1.00 27.74  ? 164 SER A CA  1 
ATOM   1258 C  C   . SER A 1 164 ? -32.783 2.109   -14.753 1.00 27.31  ? 164 SER A C   1 
ATOM   1259 O  O   . SER A 1 164 ? -32.667 3.177   -14.149 1.00 28.50  ? 164 SER A O   1 
ATOM   1260 C  CB  . SER A 1 164 ? -30.681 0.925   -15.340 1.00 29.54  ? 164 SER A CB  1 
ATOM   1261 O  OG  . SER A 1 164 ? -29.821 1.737   -14.545 1.00 30.50  ? 164 SER A OG  1 
ATOM   1262 N  N   . TRP A 1 165 ? -33.724 1.223   -14.466 1.00 27.64  ? 165 TRP A N   1 
ATOM   1263 C  CA  . TRP A 1 165 ? -34.639 1.455   -13.364 1.00 28.91  ? 165 TRP A CA  1 
ATOM   1264 C  C   . TRP A 1 165 ? -33.860 1.170   -12.081 1.00 28.90  ? 165 TRP A C   1 
ATOM   1265 O  O   . TRP A 1 165 ? -33.054 0.237   -12.021 1.00 29.12  ? 165 TRP A O   1 
ATOM   1266 C  CB  . TRP A 1 165 ? -35.871 0.551   -13.497 1.00 27.84  ? 165 TRP A CB  1 
ATOM   1267 C  CG  . TRP A 1 165 ? -36.801 1.025   -14.581 1.00 29.58  ? 165 TRP A CG  1 
ATOM   1268 C  CD1 . TRP A 1 165 ? -36.807 0.639   -15.900 1.00 27.20  ? 165 TRP A CD1 1 
ATOM   1269 C  CD2 . TRP A 1 165 ? -37.804 2.046   -14.461 1.00 30.38  ? 165 TRP A CD2 1 
ATOM   1270 N  NE1 . TRP A 1 165 ? -37.745 1.359   -16.602 1.00 25.24  ? 165 TRP A NE1 1 
ATOM   1271 C  CE2 . TRP A 1 165 ? -38.372 2.228   -15.746 1.00 28.90  ? 165 TRP A CE2 1 
ATOM   1272 C  CE3 . TRP A 1 165 ? -38.277 2.830   -13.391 1.00 30.39  ? 165 TRP A CE3 1 
ATOM   1273 C  CZ2 . TRP A 1 165 ? -39.388 3.159   -15.991 1.00 29.49  ? 165 TRP A CZ2 1 
ATOM   1274 C  CZ3 . TRP A 1 165 ? -39.291 3.759   -13.637 1.00 29.89  ? 165 TRP A CZ3 1 
ATOM   1275 C  CH2 . TRP A 1 165 ? -39.834 3.912   -14.929 1.00 30.26  ? 165 TRP A CH2 1 
ATOM   1276 N  N   . GLU A 1 166 ? -34.079 1.993   -11.062 1.00 28.95  ? 166 GLU A N   1 
ATOM   1277 C  CA  . GLU A 1 166 ? -33.361 1.831   -9.817  1.00 28.87  ? 166 GLU A CA  1 
ATOM   1278 C  C   . GLU A 1 166 ? -34.204 2.063   -8.611  1.00 29.92  ? 166 GLU A C   1 
ATOM   1279 O  O   . GLU A 1 166 ? -35.115 2.879   -8.616  1.00 29.26  ? 166 GLU A O   1 
ATOM   1280 C  CB  . GLU A 1 166 ? -32.177 2.774   -9.758  1.00 28.33  ? 166 GLU A CB  1 
ATOM   1281 C  CG  . GLU A 1 166 ? -31.170 2.578   -10.873 1.00 29.50  ? 166 GLU A CG  1 
ATOM   1282 C  CD  . GLU A 1 166 ? -30.300 1.343   -10.704 1.00 31.91  ? 166 GLU A CD  1 
ATOM   1283 O  OE1 . GLU A 1 166 ? -29.494 1.057   -11.612 1.00 30.19  ? 166 GLU A OE1 1 
ATOM   1284 O  OE2 . GLU A 1 166 ? -30.403 0.656   -9.665  1.00 30.43  ? 166 GLU A OE2 1 
ATOM   1285 N  N   . ASP A 1 167 ? -33.878 1.322   -7.560  1.00 32.60  ? 167 ASP A N   1 
ATOM   1286 C  CA  . ASP A 1 167 ? -34.552 1.460   -6.282  1.00 32.76  ? 167 ASP A CA  1 
ATOM   1287 C  C   . ASP A 1 167 ? -34.556 2.924   -5.889  1.00 31.60  ? 167 ASP A C   1 
ATOM   1288 O  O   . ASP A 1 167 ? -33.531 3.583   -5.931  1.00 32.27  ? 167 ASP A O   1 
ATOM   1289 C  CB  . ASP A 1 167 ? -33.826 0.632   -5.232  1.00 37.87  ? 167 ASP A CB  1 
ATOM   1290 C  CG  . ASP A 1 167 ? -34.537 0.631   -3.918  1.00 42.85  ? 167 ASP A CG  1 
ATOM   1291 O  OD1 . ASP A 1 167 ? -34.369 -0.340  -3.160  1.00 46.83  ? 167 ASP A OD1 1 
ATOM   1292 O  OD2 . ASP A 1 167 ? -35.266 1.599   -3.628  1.00 47.63  ? 167 ASP A OD2 1 
ATOM   1293 N  N   . GLY A 1 168 ? -35.727 3.442   -5.553  1.00 31.93  ? 168 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 168 ? -35.849 4.837   -5.165  1.00 33.62  ? 168 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 168 ? -35.206 5.202   -3.836  1.00 34.57  ? 168 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 168 ? -34.709 6.305   -3.671  1.00 33.40  ? 168 GLY A O   1 
ATOM   1297 N  N   . ALA A 1 169 ? -35.216 4.268   -2.888  1.00 35.56  ? 169 ALA A N   1 
ATOM   1298 C  CA  . ALA A 1 169 ? -34.596 4.492   -1.586  1.00 38.33  ? 169 ALA A CA  1 
ATOM   1299 C  C   . ALA A 1 169 ? -33.088 4.538   -1.789  1.00 40.14  ? 169 ALA A C   1 
ATOM   1300 O  O   . ALA A 1 169 ? -32.379 5.218   -1.039  1.00 41.74  ? 169 ALA A O   1 
ATOM   1301 C  CB  . ALA A 1 169 ? -34.967 3.365   -0.611  1.00 37.67  ? 169 ALA A CB  1 
ATOM   1302 N  N   . LEU A 1 170 ? -32.616 3.847   -2.825  1.00 38.56  ? 170 LEU A N   1 
ATOM   1303 C  CA  . LEU A 1 170 ? -31.202 3.812   -3.126  1.00 38.70  ? 170 LEU A CA  1 
ATOM   1304 C  C   . LEU A 1 170 ? -30.659 5.140   -3.619  1.00 40.22  ? 170 LEU A C   1 
ATOM   1305 O  O   . LEU A 1 170 ? -29.778 5.725   -2.982  1.00 40.61  ? 170 LEU A O   1 
ATOM   1306 C  CB  . LEU A 1 170 ? -30.893 2.731   -4.167  1.00 39.36  ? 170 LEU A CB  1 
ATOM   1307 C  CG  . LEU A 1 170 ? -29.413 2.448   -4.503  1.00 36.93  ? 170 LEU A CG  1 
ATOM   1308 C  CD1 . LEU A 1 170 ? -28.813 3.513   -5.387  1.00 34.94  ? 170 LEU A CD1 1 
ATOM   1309 C  CD2 . LEU A 1 170 ? -28.634 2.348   -3.216  1.00 39.11  ? 170 LEU A CD2 1 
ATOM   1310 N  N   . ILE A 1 171 ? -31.160 5.617   -4.757  1.00 41.05  ? 171 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 171 ? -30.651 6.865   -5.315  1.00 41.55  ? 171 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 171 ? -31.035 8.097   -4.502  1.00 41.59  ? 171 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 171 ? -30.430 9.158   -4.658  1.00 42.45  ? 171 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 171 ? -31.075 7.060   -6.806  1.00 41.72  ? 171 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 171 ? -32.277 7.990   -6.900  1.00 39.70  ? 171 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 171 ? -31.399 5.698   -7.458  1.00 40.53  ? 171 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 171 ? -32.485 8.511   -8.288  1.00 39.36  ? 171 ILE A CD1 1 
ATOM   1318 N  N   . SER A 1 172 ? -32.027 7.962   -3.629  1.00 41.49  ? 172 SER A N   1 
ATOM   1319 C  CA  . SER A 1 172 ? -32.437 9.083   -2.779  1.00 42.52  ? 172 SER A CA  1 
ATOM   1320 C  C   . SER A 1 172 ? -31.316 9.419   -1.788  1.00 43.47  ? 172 SER A C   1 
ATOM   1321 O  O   . SER A 1 172 ? -31.061 10.589  -1.499  1.00 43.77  ? 172 SER A O   1 
ATOM   1322 C  CB  . SER A 1 172 ? -33.707 8.736   -2.000  1.00 41.03  ? 172 SER A CB  1 
ATOM   1323 O  OG  . SER A 1 172 ? -33.511 7.572   -1.216  1.00 42.06  ? 172 SER A OG  1 
ATOM   1324 N  N   . LYS A 1 173 ? -30.642 8.385   -1.284  1.00 43.69  ? 173 LYS A N   1 
ATOM   1325 C  CA  . LYS A 1 173 ? -29.550 8.570   -0.332  1.00 42.86  ? 173 LYS A CA  1 
ATOM   1326 C  C   . LYS A 1 173 ? -28.405 9.404   -0.881  1.00 42.29  ? 173 LYS A C   1 
ATOM   1327 O  O   . LYS A 1 173 ? -27.608 9.926   -0.109  1.00 44.63  ? 173 LYS A O   1 
ATOM   1328 C  CB  . LYS A 1 173 ? -28.988 7.220   0.132   1.00 43.89  ? 173 LYS A CB  1 
ATOM   1329 C  CG  . LYS A 1 173 ? -29.967 6.366   0.927   1.00 47.59  ? 173 LYS A CG  1 
ATOM   1330 C  CD  . LYS A 1 173 ? -29.310 5.085   1.442   1.00 51.77  ? 173 LYS A CD  1 
ATOM   1331 C  CE  . LYS A 1 173 ? -28.866 4.143   0.297   1.00 54.34  ? 173 LYS A CE  1 
ATOM   1332 N  NZ  . LYS A 1 173 ? -28.273 2.842   0.771   1.00 51.90  ? 173 LYS A NZ  1 
ATOM   1333 N  N   . LYS A 1 174 ? -28.315 9.550   -2.198  1.00 41.34  ? 174 LYS A N   1 
ATOM   1334 C  CA  . LYS A 1 174 ? -27.216 10.324  -2.776  1.00 41.11  ? 174 LYS A CA  1 
ATOM   1335 C  C   . LYS A 1 174 ? -27.641 11.292  -3.874  1.00 42.02  ? 174 LYS A C   1 
ATOM   1336 O  O   . LYS A 1 174 ? -26.989 12.310  -4.103  1.00 42.22  ? 174 LYS A O   1 
ATOM   1337 C  CB  . LYS A 1 174 ? -26.154 9.367   -3.319  1.00 40.17  ? 174 LYS A CB  1 
ATOM   1338 C  CG  . LYS A 1 174 ? -24.877 10.010  -3.867  1.00 39.35  ? 174 LYS A CG  1 
ATOM   1339 C  CD  . LYS A 1 174 ? -23.919 8.902   -4.354  1.00 40.18  ? 174 LYS A CD  1 
ATOM   1340 C  CE  . LYS A 1 174 ? -22.623 9.447   -4.922  1.00 39.35  ? 174 LYS A CE  1 
ATOM   1341 N  NZ  . LYS A 1 174 ? -21.717 8.350   -5.380  1.00 41.78  ? 174 LYS A NZ  1 
ATOM   1342 N  N   . PHE A 1 175 ? -28.744 10.985  -4.548  1.00 43.19  ? 175 PHE A N   1 
ATOM   1343 C  CA  . PHE A 1 175 ? -29.216 11.838  -5.634  1.00 43.68  ? 175 PHE A CA  1 
ATOM   1344 C  C   . PHE A 1 175 ? -30.602 12.435  -5.414  1.00 44.29  ? 175 PHE A C   1 
ATOM   1345 O  O   . PHE A 1 175 ? -31.347 12.641  -6.373  1.00 45.06  ? 175 PHE A O   1 
ATOM   1346 C  CB  . PHE A 1 175 ? -29.192 11.049  -6.943  1.00 41.20  ? 175 PHE A CB  1 
ATOM   1347 C  CG  . PHE A 1 175 ? -27.905 10.330  -7.175  1.00 38.58  ? 175 PHE A CG  1 
ATOM   1348 C  CD1 . PHE A 1 175 ? -26.742 11.034  -7.441  1.00 36.84  ? 175 PHE A CD1 1 
ATOM   1349 C  CD2 . PHE A 1 175 ? -27.838 8.948   -7.066  1.00 39.22  ? 175 PHE A CD2 1 
ATOM   1350 C  CE1 . PHE A 1 175 ? -25.520 10.375  -7.592  1.00 36.92  ? 175 PHE A CE1 1 
ATOM   1351 C  CE2 . PHE A 1 175 ? -26.620 8.280   -7.213  1.00 38.78  ? 175 PHE A CE2 1 
ATOM   1352 C  CZ  . PHE A 1 175 ? -25.459 9.001   -7.477  1.00 36.31  ? 175 PHE A CZ  1 
ATOM   1353 N  N   . GLN A 1 176 ? -30.944 12.727  -4.162  1.00 44.55  ? 176 GLN A N   1 
ATOM   1354 C  CA  . GLN A 1 176 ? -32.247 13.316  -3.873  1.00 45.63  ? 176 GLN A CA  1 
ATOM   1355 C  C   . GLN A 1 176 ? -32.408 14.609  -4.682  1.00 45.20  ? 176 GLN A C   1 
ATOM   1356 O  O   . GLN A 1 176 ? -33.517 15.110  -4.875  1.00 44.31  ? 176 GLN A O   1 
ATOM   1357 C  CB  . GLN A 1 176 ? -32.382 13.632  -2.385  1.00 46.49  ? 176 GLN A CB  1 
ATOM   1358 C  CG  . GLN A 1 176 ? -33.773 14.096  -1.997  1.00 48.98  ? 176 GLN A CG  1 
ATOM   1359 C  CD  . GLN A 1 176 ? -34.771 12.952  -1.963  1.00 51.09  ? 176 GLN A CD  1 
ATOM   1360 O  OE1 . GLN A 1 176 ? -34.730 12.101  -1.074  1.00 54.28  ? 176 GLN A OE1 1 
ATOM   1361 N  NE2 . GLN A 1 176 ? -35.665 12.921  -2.934  1.00 51.87  ? 176 GLN A NE2 1 
ATOM   1362 N  N   . ALA A 1 177 ? -31.289 15.138  -5.161  1.00 44.81  ? 177 ALA A N   1 
ATOM   1363 C  CA  . ALA A 1 177 ? -31.304 16.367  -5.938  1.00 45.12  ? 177 ALA A CA  1 
ATOM   1364 C  C   . ALA A 1 177 ? -31.918 16.182  -7.328  1.00 44.80  ? 177 ALA A C   1 
ATOM   1365 O  O   . ALA A 1 177 ? -32.860 16.891  -7.673  1.00 43.76  ? 177 ALA A O   1 
ATOM   1366 C  CB  . ALA A 1 177 ? -29.892 16.929  -6.051  1.00 45.03  ? 177 ALA A CB  1 
HETATM 1367 N  N   . MSE A 1 178 ? -31.394 15.250  -8.128  1.00 45.63  ? 178 MSE A N   1 
HETATM 1368 C  CA  . MSE A 1 178 ? -31.954 15.025  -9.464  1.00 45.76  ? 178 MSE A CA  1 
HETATM 1369 C  C   . MSE A 1 178 ? -33.419 14.695  -9.287  1.00 43.46  ? 178 MSE A C   1 
HETATM 1370 O  O   . MSE A 1 178 ? -34.252 15.036  -10.121 1.00 43.48  ? 178 MSE A O   1 
HETATM 1371 C  CB  . MSE A 1 178 ? -31.301 13.842  -10.186 1.00 49.03  ? 178 MSE A CB  1 
HETATM 1372 C  CG  . MSE A 1 178 ? -29.813 13.923  -10.409 1.00 50.87  ? 178 MSE A CG  1 
HETATM 1373 SE SE  . MSE A 1 178 ? -29.197 15.628  -11.020 1.00 58.15  ? 178 MSE A SE  1 
HETATM 1374 C  CE  . MSE A 1 178 ? -29.855 15.696  -12.800 1.00 54.96  ? 178 MSE A CE  1 
ATOM   1375 N  N   . ILE A 1 179 ? -33.728 14.000  -8.202  1.00 41.56  ? 179 ILE A N   1 
ATOM   1376 C  CA  . ILE A 1 179 ? -35.108 13.652  -7.938  1.00 40.55  ? 179 ILE A CA  1 
ATOM   1377 C  C   . ILE A 1 179 ? -35.893 14.963  -7.825  1.00 42.61  ? 179 ILE A C   1 
ATOM   1378 O  O   . ILE A 1 179 ? -36.850 15.186  -8.567  1.00 43.64  ? 179 ILE A O   1 
ATOM   1379 C  CB  . ILE A 1 179 ? -35.240 12.830  -6.638  1.00 37.46  ? 179 ILE A CB  1 
ATOM   1380 C  CG1 . ILE A 1 179 ? -34.456 11.513  -6.785  1.00 38.48  ? 179 ILE A CG1 1 
ATOM   1381 C  CG2 . ILE A 1 179 ? -36.723 12.589  -6.319  1.00 31.73  ? 179 ILE A CG2 1 
ATOM   1382 C  CD1 . ILE A 1 179 ? -34.460 10.604  -5.535  1.00 35.55  ? 179 ILE A CD1 1 
ATOM   1383 N  N   . ASP A 1 180 ? -35.477 15.839  -6.912  1.00 43.56  ? 180 ASP A N   1 
ATOM   1384 C  CA  . ASP A 1 180 ? -36.162 17.115  -6.739  1.00 43.81  ? 180 ASP A CA  1 
ATOM   1385 C  C   . ASP A 1 180 ? -36.261 17.878  -8.065  1.00 43.48  ? 180 ASP A C   1 
ATOM   1386 O  O   . ASP A 1 180 ? -37.289 18.473  -8.367  1.00 43.25  ? 180 ASP A O   1 
ATOM   1387 C  CB  . ASP A 1 180 ? -35.456 17.988  -5.688  1.00 44.83  ? 180 ASP A CB  1 
ATOM   1388 C  CG  . ASP A 1 180 ? -35.604 17.440  -4.266  1.00 45.40  ? 180 ASP A CG  1 
ATOM   1389 O  OD1 . ASP A 1 180 ? -36.630 16.793  -3.959  1.00 47.09  ? 180 ASP A OD1 1 
ATOM   1390 O  OD2 . ASP A 1 180 ? -34.697 17.673  -3.443  1.00 45.96  ? 180 ASP A OD2 1 
ATOM   1391 N  N   . GLU A 1 181 ? -35.205 17.848  -8.867  1.00 42.78  ? 181 GLU A N   1 
ATOM   1392 C  CA  . GLU A 1 181 ? -35.237 18.554  -10.141 1.00 44.13  ? 181 GLU A CA  1 
ATOM   1393 C  C   . GLU A 1 181 ? -36.191 17.906  -11.120 1.00 44.32  ? 181 GLU A C   1 
ATOM   1394 O  O   . GLU A 1 181 ? -36.750 18.573  -11.991 1.00 45.69  ? 181 GLU A O   1 
ATOM   1395 C  CB  . GLU A 1 181 ? -33.847 18.614  -10.762 1.00 44.89  ? 181 GLU A CB  1 
ATOM   1396 C  CG  . GLU A 1 181 ? -32.978 19.704  -10.173 1.00 50.67  ? 181 GLU A CG  1 
ATOM   1397 C  CD  . GLU A 1 181 ? -31.565 19.669  -10.698 1.00 52.38  ? 181 GLU A CD  1 
ATOM   1398 O  OE1 . GLU A 1 181 ? -30.762 20.539  -10.294 1.00 54.75  ? 181 GLU A OE1 1 
ATOM   1399 O  OE2 . GLU A 1 181 ? -31.256 18.771  -11.512 1.00 53.51  ? 181 GLU A OE2 1 
ATOM   1400 N  N   . TYR A 1 182 ? -36.366 16.598  -10.983 1.00 43.27  ? 182 TYR A N   1 
ATOM   1401 C  CA  . TYR A 1 182 ? -37.256 15.849  -11.858 1.00 41.52  ? 182 TYR A CA  1 
ATOM   1402 C  C   . TYR A 1 182 ? -38.699 16.276  -11.566 1.00 42.09  ? 182 TYR A C   1 
ATOM   1403 O  O   . TYR A 1 182 ? -39.421 16.712  -12.466 1.00 40.87  ? 182 TYR A O   1 
ATOM   1404 C  CB  . TYR A 1 182 ? -37.044 14.346  -11.623 1.00 37.74  ? 182 TYR A CB  1 
ATOM   1405 C  CG  . TYR A 1 182 ? -38.112 13.427  -12.161 1.00 33.99  ? 182 TYR A CG  1 
ATOM   1406 C  CD1 . TYR A 1 182 ? -38.238 13.171  -13.531 1.00 34.31  ? 182 TYR A CD1 1 
ATOM   1407 C  CD2 . TYR A 1 182 ? -38.977 12.775  -11.287 1.00 33.48  ? 182 TYR A CD2 1 
ATOM   1408 C  CE1 . TYR A 1 182 ? -39.210 12.273  -14.010 1.00 31.75  ? 182 TYR A CE1 1 
ATOM   1409 C  CE2 . TYR A 1 182 ? -39.944 11.888  -11.746 1.00 32.52  ? 182 TYR A CE2 1 
ATOM   1410 C  CZ  . TYR A 1 182 ? -40.057 11.640  -13.104 1.00 31.95  ? 182 TYR A CZ  1 
ATOM   1411 O  OH  . TYR A 1 182 ? -41.025 10.759  -13.524 1.00 29.57  ? 182 TYR A OH  1 
ATOM   1412 N  N   . PHE A 1 183 ? -39.117 16.169  -10.309 1.00 43.16  ? 183 PHE A N   1 
ATOM   1413 C  CA  . PHE A 1 183 ? -40.470 16.568  -9.948  1.00 45.63  ? 183 PHE A CA  1 
ATOM   1414 C  C   . PHE A 1 183 ? -40.712 18.064  -10.162 1.00 46.40  ? 183 PHE A C   1 
ATOM   1415 O  O   . PHE A 1 183 ? -41.830 18.471  -10.456 1.00 46.42  ? 183 PHE A O   1 
ATOM   1416 C  CB  . PHE A 1 183 ? -40.782 16.185  -8.498  1.00 46.60  ? 183 PHE A CB  1 
ATOM   1417 C  CG  . PHE A 1 183 ? -41.068 14.717  -8.304  1.00 49.44  ? 183 PHE A CG  1 
ATOM   1418 C  CD1 . PHE A 1 183 ? -40.120 13.867  -7.732  1.00 50.09  ? 183 PHE A CD1 1 
ATOM   1419 C  CD2 . PHE A 1 183 ? -42.290 14.182  -8.696  1.00 50.10  ? 183 PHE A CD2 1 
ATOM   1420 C  CE1 . PHE A 1 183 ? -40.391 12.504  -7.555  1.00 49.43  ? 183 PHE A CE1 1 
ATOM   1421 C  CE2 . PHE A 1 183 ? -42.572 12.823  -8.523  1.00 50.58  ? 183 PHE A CE2 1 
ATOM   1422 C  CZ  . PHE A 1 183 ? -41.620 11.983  -7.951  1.00 50.05  ? 183 PHE A CZ  1 
ATOM   1423 N  N   . SER A 1 184 ? -39.667 18.876  -10.027 1.00 47.51  ? 184 SER A N   1 
ATOM   1424 C  CA  . SER A 1 184 ? -39.784 20.319  -10.223 1.00 48.88  ? 184 SER A CA  1 
ATOM   1425 C  C   . SER A 1 184 ? -40.111 20.676  -11.662 1.00 50.00  ? 184 SER A C   1 
ATOM   1426 O  O   . SER A 1 184 ? -40.857 21.628  -11.907 1.00 49.86  ? 184 SER A O   1 
ATOM   1427 C  CB  . SER A 1 184 ? -38.495 21.039  -9.814  1.00 48.95  ? 184 SER A CB  1 
ATOM   1428 O  OG  . SER A 1 184 ? -38.465 21.255  -8.418  1.00 49.71  ? 184 SER A OG  1 
ATOM   1429 N  N   . ARG A 1 185 ? -39.537 19.943  -12.613 1.00 52.03  ? 185 ARG A N   1 
ATOM   1430 C  CA  . ARG A 1 185 ? -39.819 20.201  -14.026 1.00 54.69  ? 185 ARG A CA  1 
ATOM   1431 C  C   . ARG A 1 185 ? -41.238 19.702  -14.294 1.00 56.23  ? 185 ARG A C   1 
ATOM   1432 O  O   . ARG A 1 185 ? -41.732 19.778  -15.415 1.00 56.79  ? 185 ARG A O   1 
ATOM   1433 C  CB  . ARG A 1 185 ? -38.825 19.467  -14.941 1.00 53.72  ? 185 ARG A CB  1 
ATOM   1434 C  CG  . ARG A 1 185 ? -37.404 20.018  -14.924 1.00 54.73  ? 185 ARG A CG  1 
ATOM   1435 C  CD  . ARG A 1 185 ? -36.537 19.346  -15.989 1.00 56.66  ? 185 ARG A CD  1 
ATOM   1436 N  NE  . ARG A 1 185 ? -36.330 17.921  -15.730 1.00 57.06  ? 185 ARG A NE  1 
ATOM   1437 C  CZ  . ARG A 1 185 ? -35.421 17.430  -14.892 1.00 56.14  ? 185 ARG A CZ  1 
ATOM   1438 N  NH1 . ARG A 1 185 ? -34.617 18.245  -14.225 1.00 55.23  ? 185 ARG A NH1 1 
ATOM   1439 N  NH2 . ARG A 1 185 ? -35.324 16.122  -14.714 1.00 54.88  ? 185 ARG A NH2 1 
ATOM   1440 N  N   . LYS A 1 186 ? -41.869 19.214  -13.225 1.00 58.53  ? 186 LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 186 ? -43.229 18.665  -13.200 1.00 61.25  ? 186 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 186 ? -42.879 17.253  -12.762 1.00 63.27  ? 186 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 186 ? -41.748 16.801  -12.953 1.00 62.84  ? 186 LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 186 ? -44.050 19.069  -14.430 1.00 61.26  ? 186 LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 186 ? -45.017 20.212  -14.159 1.00 61.52  ? 186 LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 186 ? -44.272 21.505  -13.884 1.00 62.71  ? 186 LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 186 ? -45.124 22.435  -13.053 1.00 63.12  ? 186 LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 186 ? -45.676 21.670  -11.901 1.00 62.90  ? 186 LYS A NZ  1 
ATOM   1449 N  N   . GLU B 1 10  ? -14.660 -26.647 -35.322 1.00 81.66  ? 10  GLU B N   1 
ATOM   1450 C  CA  . GLU B 1 10  ? -15.901 -26.722 -36.146 1.00 81.08  ? 10  GLU B CA  1 
ATOM   1451 C  C   . GLU B 1 10  ? -16.424 -25.336 -36.525 1.00 80.13  ? 10  GLU B C   1 
ATOM   1452 O  O   . GLU B 1 10  ? -17.148 -24.707 -35.750 1.00 79.96  ? 10  GLU B O   1 
ATOM   1453 C  CB  . GLU B 1 10  ? -16.983 -27.504 -35.387 1.00 80.90  ? 10  GLU B CB  1 
ATOM   1454 N  N   . GLU B 1 11  ? -16.042 -24.875 -37.716 1.00 78.95  ? 11  GLU B N   1 
ATOM   1455 C  CA  . GLU B 1 11  ? -16.459 -23.580 -38.263 1.00 77.70  ? 11  GLU B CA  1 
ATOM   1456 C  C   . GLU B 1 11  ? -15.939 -22.409 -37.425 1.00 76.93  ? 11  GLU B C   1 
ATOM   1457 O  O   . GLU B 1 11  ? -15.510 -22.577 -36.280 1.00 77.48  ? 11  GLU B O   1 
ATOM   1458 C  CB  . GLU B 1 11  ? -17.896 -23.670 -38.756 1.00 77.87  ? 11  GLU B CB  1 
ATOM   1459 N  N   . GLU B 1 12  ? -16.142 -21.202 -37.896 1.00 75.10  ? 12  GLU B N   1 
ATOM   1460 C  CA  . GLU B 1 12  ? -15.766 -20.003 -37.152 1.00 72.17  ? 12  GLU B CA  1 
ATOM   1461 C  C   . GLU B 1 12  ? -16.981 -19.100 -37.065 1.00 69.70  ? 12  GLU B C   1 
ATOM   1462 O  O   . GLU B 1 12  ? -17.680 -18.860 -38.051 1.00 69.84  ? 12  GLU B O   1 
ATOM   1463 C  CB  . GLU B 1 12  ? -14.600 -19.212 -37.721 1.00 72.32  ? 12  GLU B CB  1 
ATOM   1464 N  N   . PHE B 1 13  ? -17.215 -18.594 -35.865 1.00 66.53  ? 13  PHE B N   1 
ATOM   1465 C  CA  . PHE B 1 13  ? -18.317 -17.690 -35.631 1.00 63.14  ? 13  PHE B CA  1 
ATOM   1466 C  C   . PHE B 1 13  ? -17.684 -16.361 -35.264 1.00 61.10  ? 13  PHE B C   1 
ATOM   1467 O  O   . PHE B 1 13  ? -16.459 -16.237 -35.197 1.00 61.53  ? 13  PHE B O   1 
ATOM   1468 C  CB  . PHE B 1 13  ? -19.175 -18.196 -34.485 1.00 62.71  ? 13  PHE B CB  1 
ATOM   1469 N  N   . GLU B 1 14  ? -18.531 -15.367 -35.062 1.00 57.39  ? 14  GLU B N   1 
ATOM   1470 C  CA  . GLU B 1 14  ? -18.114 -14.040 -34.647 1.00 54.69  ? 14  GLU B CA  1 
ATOM   1471 C  C   . GLU B 1 14  ? -19.199 -13.793 -33.626 1.00 52.90  ? 14  GLU B C   1 
ATOM   1472 O  O   . GLU B 1 14  ? -20.291 -14.341 -33.761 1.00 53.19  ? 14  GLU B O   1 
ATOM   1473 C  CB  . GLU B 1 14  ? -18.224 -13.026 -35.793 1.00 54.21  ? 14  GLU B CB  1 
ATOM   1474 C  CG  . GLU B 1 14  ? -17.084 -13.051 -36.814 1.00 53.87  ? 14  GLU B CG  1 
ATOM   1475 C  CD  . GLU B 1 14  ? -15.708 -12.902 -36.176 1.00 54.31  ? 14  GLU B CD  1 
ATOM   1476 O  OE1 . GLU B 1 14  ? -15.601 -12.243 -35.119 1.00 53.97  ? 14  GLU B OE1 1 
ATOM   1477 O  OE2 . GLU B 1 14  ? -14.728 -13.441 -36.737 1.00 55.66  ? 14  GLU B OE2 1 
ATOM   1478 N  N   . THR B 1 15  ? -18.923 -13.004 -32.599 1.00 50.17  ? 15  THR B N   1 
ATOM   1479 C  CA  . THR B 1 15  ? -19.953 -12.770 -31.599 1.00 47.98  ? 15  THR B CA  1 
ATOM   1480 C  C   . THR B 1 15  ? -20.134 -11.298 -31.228 1.00 45.93  ? 15  THR B C   1 
ATOM   1481 O  O   . THR B 1 15  ? -19.160 -10.555 -31.080 1.00 46.31  ? 15  THR B O   1 
ATOM   1482 C  CB  . THR B 1 15  ? -19.677 -13.631 -30.343 1.00 46.17  ? 15  THR B CB  1 
ATOM   1483 O  OG1 . THR B 1 15  ? -20.466 -13.159 -29.249 1.00 46.57  ? 15  THR B OG1 1 
ATOM   1484 C  CG2 . THR B 1 15  ? -18.221 -13.582 -29.976 1.00 47.21  ? 15  THR B CG2 1 
ATOM   1485 N  N   . ILE B 1 16  ? -21.395 -10.887 -31.103 1.00 43.20  ? 16  ILE B N   1 
ATOM   1486 C  CA  . ILE B 1 16  ? -21.741 -9.512  -30.763 1.00 42.30  ? 16  ILE B CA  1 
ATOM   1487 C  C   . ILE B 1 16  ? -21.337 -9.162  -29.348 1.00 42.98  ? 16  ILE B C   1 
ATOM   1488 O  O   . ILE B 1 16  ? -21.694 -9.869  -28.408 1.00 43.69  ? 16  ILE B O   1 
ATOM   1489 C  CB  . ILE B 1 16  ? -23.261 -9.257  -30.843 1.00 42.48  ? 16  ILE B CB  1 
ATOM   1490 C  CG1 . ILE B 1 16  ? -23.780 -9.515  -32.255 1.00 42.78  ? 16  ILE B CG1 1 
ATOM   1491 C  CG2 . ILE B 1 16  ? -23.565 -7.836  -30.402 1.00 40.78  ? 16  ILE B CG2 1 
ATOM   1492 C  CD1 . ILE B 1 16  ? -23.194 -8.608  -33.285 1.00 49.08  ? 16  ILE B CD1 1 
ATOM   1493 N  N   . GLU B 1 17  ? -20.601 -8.069  -29.192 1.00 42.95  ? 17  GLU B N   1 
ATOM   1494 C  CA  . GLU B 1 17  ? -20.203 -7.624  -27.870 1.00 43.78  ? 17  GLU B CA  1 
ATOM   1495 C  C   . GLU B 1 17  ? -21.164 -6.518  -27.463 1.00 44.23  ? 17  GLU B C   1 
ATOM   1496 O  O   . GLU B 1 17  ? -21.763 -6.573  -26.396 1.00 45.68  ? 17  GLU B O   1 
ATOM   1497 C  CB  . GLU B 1 17  ? -18.767 -7.108  -27.892 1.00 45.73  ? 17  GLU B CB  1 
ATOM   1498 C  CG  . GLU B 1 17  ? -18.303 -6.443  -26.603 1.00 46.82  ? 17  GLU B CG  1 
ATOM   1499 C  CD  . GLU B 1 17  ? -16.789 -6.347  -26.531 1.00 48.72  ? 17  GLU B CD  1 
ATOM   1500 O  OE1 . GLU B 1 17  ? -16.149 -7.363  -26.170 1.00 48.30  ? 17  GLU B OE1 1 
ATOM   1501 O  OE2 . GLU B 1 17  ? -16.237 -5.268  -26.856 1.00 49.13  ? 17  GLU B OE2 1 
ATOM   1502 N  N   . ARG B 1 18  ? -21.331 -5.518  -28.324 1.00 44.97  ? 18  ARG B N   1 
ATOM   1503 C  CA  . ARG B 1 18  ? -22.248 -4.426  -28.022 1.00 43.81  ? 18  ARG B CA  1 
ATOM   1504 C  C   . ARG B 1 18  ? -22.845 -3.760  -29.251 1.00 44.34  ? 18  ARG B C   1 
ATOM   1505 O  O   . ARG B 1 18  ? -22.229 -3.714  -30.317 1.00 45.23  ? 18  ARG B O   1 
ATOM   1506 C  CB  . ARG B 1 18  ? -21.560 -3.352  -27.168 1.00 42.63  ? 18  ARG B CB  1 
ATOM   1507 C  CG  . ARG B 1 18  ? -22.502 -2.222  -26.757 1.00 41.88  ? 18  ARG B CG  1 
ATOM   1508 C  CD  . ARG B 1 18  ? -22.060 -1.520  -25.467 1.00 44.17  ? 18  ARG B CD  1 
ATOM   1509 N  NE  . ARG B 1 18  ? -20.904 -0.646  -25.655 1.00 42.58  ? 18  ARG B NE  1 
ATOM   1510 C  CZ  . ARG B 1 18  ? -20.871 0.641   -25.305 1.00 41.92  ? 18  ARG B CZ  1 
ATOM   1511 N  NH1 . ARG B 1 18  ? -21.936 1.216   -24.744 1.00 36.57  ? 18  ARG B NH1 1 
ATOM   1512 N  NH2 . ARG B 1 18  ? -19.769 1.352   -25.521 1.00 39.88  ? 18  ARG B NH2 1 
ATOM   1513 N  N   . PHE B 1 19  ? -24.063 -3.254  -29.082 1.00 45.11  ? 19  PHE B N   1 
ATOM   1514 C  CA  . PHE B 1 19  ? -24.767 -2.541  -30.134 1.00 44.74  ? 19  PHE B CA  1 
ATOM   1515 C  C   . PHE B 1 19  ? -24.428 -1.069  -29.992 1.00 44.85  ? 19  PHE B C   1 
ATOM   1516 O  O   . PHE B 1 19  ? -24.805 -0.437  -29.007 1.00 45.76  ? 19  PHE B O   1 
ATOM   1517 C  CB  . PHE B 1 19  ? -26.267 -2.767  -30.002 1.00 43.88  ? 19  PHE B CB  1 
ATOM   1518 C  CG  . PHE B 1 19  ? -26.711 -4.079  -30.560 1.00 45.62  ? 19  PHE B CG  1 
ATOM   1519 C  CD1 . PHE B 1 19  ? -26.769 -4.274  -31.941 1.00 46.42  ? 19  PHE B CD1 1 
ATOM   1520 C  CD2 . PHE B 1 19  ? -27.014 -5.144  -29.719 1.00 45.75  ? 19  PHE B CD2 1 
ATOM   1521 C  CE1 . PHE B 1 19  ? -27.122 -5.510  -32.478 1.00 46.92  ? 19  PHE B CE1 1 
ATOM   1522 C  CE2 . PHE B 1 19  ? -27.367 -6.388  -30.248 1.00 46.27  ? 19  PHE B CE2 1 
ATOM   1523 C  CZ  . PHE B 1 19  ? -27.420 -6.568  -31.628 1.00 46.37  ? 19  PHE B CZ  1 
HETATM 1524 N  N   . MSE B 1 20  ? -23.711 -0.535  -30.977 1.00 43.90  ? 20  MSE B N   1 
HETATM 1525 C  CA  . MSE B 1 20  ? -23.283 0.858   -30.960 1.00 44.65  ? 20  MSE B CA  1 
HETATM 1526 C  C   . MSE B 1 20  ? -24.296 1.844   -31.516 1.00 44.89  ? 20  MSE B C   1 
HETATM 1527 O  O   . MSE B 1 20  ? -24.321 2.998   -31.106 1.00 43.67  ? 20  MSE B O   1 
HETATM 1528 C  CB  . MSE B 1 20  ? -21.979 1.005   -31.741 1.00 46.04  ? 20  MSE B CB  1 
HETATM 1529 C  CG  . MSE B 1 20  ? -20.832 0.182   -31.191 1.00 50.35  ? 20  MSE B CG  1 
HETATM 1530 SE SE  . MSE B 1 20  ? -20.512 0.599   -29.318 1.00 54.90  ? 20  MSE B SE  1 
HETATM 1531 C  CE  . MSE B 1 20  ? -19.735 2.354   -29.565 1.00 53.36  ? 20  MSE B CE  1 
ATOM   1532 N  N   . ASP B 1 21  ? -25.124 1.398   -32.456 1.00 46.61  ? 21  ASP B N   1 
ATOM   1533 C  CA  . ASP B 1 21  ? -26.108 2.286   -33.068 1.00 48.51  ? 21  ASP B CA  1 
ATOM   1534 C  C   . ASP B 1 21  ? -26.973 1.565   -34.090 1.00 48.84  ? 21  ASP B C   1 
ATOM   1535 O  O   . ASP B 1 21  ? -26.651 0.463   -34.526 1.00 50.16  ? 21  ASP B O   1 
ATOM   1536 C  CB  . ASP B 1 21  ? -25.388 3.437   -33.775 1.00 49.04  ? 21  ASP B CB  1 
ATOM   1537 C  CG  . ASP B 1 21  ? -26.278 4.642   -33.985 1.00 48.99  ? 21  ASP B CG  1 
ATOM   1538 O  OD1 . ASP B 1 21  ? -27.512 4.506   -33.837 1.00 49.73  ? 21  ASP B OD1 1 
ATOM   1539 O  OD2 . ASP B 1 21  ? -25.738 5.726   -34.303 1.00 49.57  ? 21  ASP B OD2 1 
ATOM   1540 N  N   . CYS B 1 22  ? -28.080 2.201   -34.461 1.00 49.35  ? 22  CYS B N   1 
ATOM   1541 C  CA  . CYS B 1 22  ? -28.986 1.658   -35.468 1.00 49.78  ? 22  CYS B CA  1 
ATOM   1542 C  C   . CYS B 1 22  ? -29.421 2.836   -36.335 1.00 47.27  ? 22  CYS B C   1 
ATOM   1543 O  O   . CYS B 1 22  ? -29.488 3.974   -35.866 1.00 44.57  ? 22  CYS B O   1 
ATOM   1544 C  CB  . CYS B 1 22  ? -30.215 0.982   -34.830 1.00 51.28  ? 22  CYS B CB  1 
ATOM   1545 S  SG  . CYS B 1 22  ? -31.492 2.110   -34.198 1.00 60.28  ? 22  CYS B SG  1 
ATOM   1546 N  N   . ARG B 1 23  ? -29.706 2.552   -37.601 1.00 45.50  ? 23  ARG B N   1 
ATOM   1547 C  CA  . ARG B 1 23  ? -30.124 3.568   -38.563 1.00 41.86  ? 23  ARG B CA  1 
ATOM   1548 C  C   . ARG B 1 23  ? -30.920 2.868   -39.651 1.00 42.04  ? 23  ARG B C   1 
ATOM   1549 O  O   . ARG B 1 23  ? -31.069 1.642   -39.652 1.00 40.55  ? 23  ARG B O   1 
ATOM   1550 C  CB  . ARG B 1 23  ? -28.903 4.188   -39.230 1.00 37.87  ? 23  ARG B CB  1 
ATOM   1551 C  CG  . ARG B 1 23  ? -28.284 3.215   -40.221 1.00 33.77  ? 23  ARG B CG  1 
ATOM   1552 C  CD  . ARG B 1 23  ? -26.964 3.666   -40.821 1.00 32.63  ? 23  ARG B CD  1 
ATOM   1553 N  NE  . ARG B 1 23  ? -26.493 2.675   -41.792 1.00 30.35  ? 23  ARG B NE  1 
ATOM   1554 C  CZ  . ARG B 1 23  ? -25.290 2.678   -42.360 1.00 32.09  ? 23  ARG B CZ  1 
ATOM   1555 N  NH1 . ARG B 1 23  ? -24.409 3.621   -42.060 1.00 35.47  ? 23  ARG B NH1 1 
ATOM   1556 N  NH2 . ARG B 1 23  ? -24.969 1.745   -43.247 1.00 31.50  ? 23  ARG B NH2 1 
ATOM   1557 N  N   . ILE B 1 24  ? -31.420 3.663   -40.586 1.00 42.97  ? 24  ILE B N   1 
ATOM   1558 C  CA  . ILE B 1 24  ? -32.136 3.126   -41.733 1.00 42.69  ? 24  ILE B CA  1 
ATOM   1559 C  C   . ILE B 1 24  ? -31.117 3.337   -42.828 1.00 42.61  ? 24  ILE B C   1 
ATOM   1560 O  O   . ILE B 1 24  ? -30.586 4.436   -42.963 1.00 42.13  ? 24  ILE B O   1 
ATOM   1561 C  CB  . ILE B 1 24  ? -33.397 3.918   -42.029 1.00 41.76  ? 24  ILE B CB  1 
ATOM   1562 C  CG1 . ILE B 1 24  ? -34.353 3.794   -40.844 1.00 42.73  ? 24  ILE B CG1 1 
ATOM   1563 C  CG2 . ILE B 1 24  ? -34.061 3.377   -43.265 1.00 40.47  ? 24  ILE B CG2 1 
ATOM   1564 C  CD1 . ILE B 1 24  ? -35.383 4.883   -40.785 1.00 46.67  ? 24  ILE B CD1 1 
ATOM   1565 N  N   . GLY B 1 25  ? -30.800 2.277   -43.567 1.00 43.43  ? 25  GLY B N   1 
ATOM   1566 C  CA  . GLY B 1 25  ? -29.811 2.400   -44.619 1.00 44.95  ? 25  GLY B CA  1 
ATOM   1567 C  C   . GLY B 1 25  ? -30.132 1.608   -45.869 1.00 45.77  ? 25  GLY B C   1 
ATOM   1568 O  O   . GLY B 1 25  ? -31.024 0.771   -45.872 1.00 46.61  ? 25  GLY B O   1 
ATOM   1569 N  N   . ARG B 1 26  ? -29.392 1.882   -46.935 1.00 47.45  ? 26  ARG B N   1 
ATOM   1570 C  CA  . ARG B 1 26  ? -29.585 1.200   -48.204 1.00 50.38  ? 26  ARG B CA  1 
ATOM   1571 C  C   . ARG B 1 26  ? -29.432 -0.317  -48.087 1.00 52.02  ? 26  ARG B C   1 
ATOM   1572 O  O   . ARG B 1 26  ? -28.537 -0.815  -47.399 1.00 52.87  ? 26  ARG B O   1 
ATOM   1573 C  CB  . ARG B 1 26  ? -28.588 1.740   -49.242 1.00 50.73  ? 26  ARG B CB  1 
ATOM   1574 C  CG  . ARG B 1 26  ? -28.477 0.877   -50.501 1.00 51.16  ? 26  ARG B CG  1 
ATOM   1575 C  CD  . ARG B 1 26  ? -27.489 1.444   -51.512 1.00 51.29  ? 26  ARG B CD  1 
ATOM   1576 N  NE  . ARG B 1 26  ? -27.948 2.716   -52.068 1.00 52.75  ? 26  ARG B NE  1 
ATOM   1577 C  CZ  . ARG B 1 26  ? -27.489 3.909   -51.702 1.00 53.33  ? 26  ARG B CZ  1 
ATOM   1578 N  NH1 . ARG B 1 26  ? -26.543 4.008   -50.772 1.00 53.18  ? 26  ARG B NH1 1 
ATOM   1579 N  NH2 . ARG B 1 26  ? -27.980 5.009   -52.265 1.00 51.92  ? 26  ARG B NH2 1 
ATOM   1580 N  N   . LYS B 1 27  ? -30.312 -1.048  -48.764 1.00 53.40  ? 27  LYS B N   1 
ATOM   1581 C  CA  . LYS B 1 27  ? -30.252 -2.503  -48.746 1.00 53.98  ? 27  LYS B CA  1 
ATOM   1582 C  C   . LYS B 1 27  ? -28.863 -2.912  -49.205 1.00 53.98  ? 27  LYS B C   1 
ATOM   1583 O  O   . LYS B 1 27  ? -28.333 -2.363  -50.170 1.00 54.47  ? 27  LYS B O   1 
ATOM   1584 C  CB  . LYS B 1 27  ? -31.303 -3.105  -49.688 1.00 55.51  ? 27  LYS B CB  1 
ATOM   1585 C  CG  . LYS B 1 27  ? -32.738 -3.086  -49.151 1.00 57.12  ? 27  LYS B CG  1 
ATOM   1586 C  CD  . LYS B 1 27  ? -33.734 -3.681  -50.161 1.00 59.35  ? 27  LYS B CD  1 
ATOM   1587 C  CE  . LYS B 1 27  ? -33.363 -5.110  -50.577 1.00 60.15  ? 27  LYS B CE  1 
ATOM   1588 N  NZ  . LYS B 1 27  ? -34.226 -5.642  -51.682 1.00 60.15  ? 27  LYS B NZ  1 
ATOM   1589 N  N   . GLY B 1 28  ? -28.269 -3.867  -48.498 1.00 54.20  ? 28  GLY B N   1 
ATOM   1590 C  CA  . GLY B 1 28  ? -26.941 -4.336  -48.849 1.00 51.87  ? 28  GLY B CA  1 
ATOM   1591 C  C   . GLY B 1 28  ? -25.800 -3.483  -48.319 1.00 50.86  ? 28  GLY B C   1 
ATOM   1592 O  O   . GLY B 1 28  ? -24.633 -3.839  -48.495 1.00 51.18  ? 28  GLY B O   1 
ATOM   1593 N  N   . ALA B 1 29  ? -26.117 -2.361  -47.676 1.00 49.57  ? 29  ALA B N   1 
ATOM   1594 C  CA  . ALA B 1 29  ? -25.069 -1.485  -47.150 1.00 48.80  ? 29  ALA B CA  1 
ATOM   1595 C  C   . ALA B 1 29  ? -24.637 -1.950  -45.766 1.00 48.38  ? 29  ALA B C   1 
ATOM   1596 O  O   . ALA B 1 29  ? -24.776 -1.220  -44.780 1.00 45.85  ? 29  ALA B O   1 
ATOM   1597 C  CB  . ALA B 1 29  ? -25.562 -0.047  -47.095 1.00 47.76  ? 29  ALA B CB  1 
ATOM   1598 N  N   . THR B 1 30  ? -24.099 -3.166  -45.708 1.00 49.26  ? 30  THR B N   1 
ATOM   1599 C  CA  . THR B 1 30  ? -23.662 -3.757  -44.453 1.00 49.02  ? 30  THR B CA  1 
ATOM   1600 C  C   . THR B 1 30  ? -22.576 -4.800  -44.627 1.00 48.54  ? 30  THR B C   1 
ATOM   1601 O  O   . THR B 1 30  ? -22.470 -5.417  -45.680 1.00 47.82  ? 30  THR B O   1 
ATOM   1602 C  CB  . THR B 1 30  ? -24.817 -4.471  -43.766 1.00 50.14  ? 30  THR B CB  1 
ATOM   1603 O  OG1 . THR B 1 30  ? -25.276 -5.520  -44.626 1.00 49.66  ? 30  THR B OG1 1 
ATOM   1604 C  CG2 . THR B 1 30  ? -25.966 -3.508  -43.473 1.00 50.84  ? 30  THR B CG2 1 
ATOM   1605 N  N   . GLY B 1 31  ? -21.782 -4.987  -43.574 1.00 49.59  ? 31  GLY B N   1 
ATOM   1606 C  CA  . GLY B 1 31  ? -20.734 -5.993  -43.561 1.00 50.51  ? 31  GLY B CA  1 
ATOM   1607 C  C   . GLY B 1 31  ? -19.422 -5.812  -44.305 1.00 51.56  ? 31  GLY B C   1 
ATOM   1608 O  O   . GLY B 1 31  ? -19.355 -5.928  -45.542 1.00 55.24  ? 31  GLY B O   1 
ATOM   1609 N  N   . ALA B 1 32  ? -18.365 -5.525  -43.552 1.00 49.10  ? 32  ALA B N   1 
ATOM   1610 C  CA  . ALA B 1 32  ? -17.029 -5.402  -44.121 1.00 46.89  ? 32  ALA B CA  1 
ATOM   1611 C  C   . ALA B 1 32  ? -16.707 -4.432  -45.253 1.00 45.20  ? 32  ALA B C   1 
ATOM   1612 O  O   . ALA B 1 32  ? -15.581 -4.392  -45.747 1.00 44.65  ? 32  ALA B O   1 
ATOM   1613 C  CB  . ALA B 1 32  ? -16.744 -6.564  -45.061 1.00 46.97  ? 32  ALA B CB  1 
ATOM   1614 N  N   . THR B 1 33  ? -17.704 -3.652  -45.658 1.00 43.48  ? 33  THR B N   1 
ATOM   1615 C  CA  . THR B 1 33  ? -17.529 -2.681  -46.731 1.00 41.87  ? 33  THR B CA  1 
ATOM   1616 C  C   . THR B 1 33  ? -18.087 -1.494  -45.952 1.00 42.14  ? 33  THR B C   1 
ATOM   1617 O  O   . THR B 1 33  ? -18.290 -0.415  -46.508 1.00 42.21  ? 33  THR B O   1 
ATOM   1618 C  CB  . THR B 1 33  ? -18.293 -2.850  -48.057 1.00 40.54  ? 33  THR B CB  1 
ATOM   1619 O  OG1 . THR B 1 33  ? -19.611 -3.347  -47.793 1.00 36.87  ? 33  THR B OG1 1 
ATOM   1620 C  CG2 . THR B 1 33  ? -17.666 -3.952  -48.897 1.00 36.61  ? 33  THR B CG2 1 
ATOM   1621 N  N   . THR B 1 34  ? -18.334 -1.702  -44.663 1.00 41.92  ? 34  THR B N   1 
ATOM   1622 C  CA  . THR B 1 34  ? -18.892 -0.657  -43.811 1.00 42.64  ? 34  THR B CA  1 
ATOM   1623 C  C   . THR B 1 34  ? -17.908 -0.195  -42.733 1.00 41.76  ? 34  THR B C   1 
ATOM   1624 O  O   . THR B 1 34  ? -18.215 0.718   -41.981 1.00 41.62  ? 34  THR B O   1 
ATOM   1625 C  CB  . THR B 1 34  ? -20.181 -1.129  -43.127 1.00 42.16  ? 34  THR B CB  1 
ATOM   1626 O  OG1 . THR B 1 34  ? -20.019 -2.488  -42.713 1.00 45.76  ? 34  THR B OG1 1 
ATOM   1627 C  CG2 . THR B 1 34  ? -21.354 -1.034  -44.077 1.00 43.85  ? 34  THR B CG2 1 
ATOM   1628 N  N   . THR B 1 35  ? -16.736 -0.822  -42.652 1.00 40.81  ? 35  THR B N   1 
ATOM   1629 C  CA  . THR B 1 35  ? -15.738 -0.414  -41.669 1.00 42.08  ? 35  THR B CA  1 
ATOM   1630 C  C   . THR B 1 35  ? -15.206 0.923   -42.162 1.00 42.11  ? 35  THR B C   1 
ATOM   1631 O  O   . THR B 1 35  ? -15.045 1.110   -43.363 1.00 43.16  ? 35  THR B O   1 
ATOM   1632 C  CB  . THR B 1 35  ? -14.561 -1.425  -41.570 1.00 42.32  ? 35  THR B CB  1 
ATOM   1633 O  OG1 . THR B 1 35  ? -13.906 -1.540  -42.838 1.00 41.96  ? 35  THR B OG1 1 
ATOM   1634 C  CG2 . THR B 1 35  ? -15.061 -2.790  -41.144 1.00 41.02  ? 35  THR B CG2 1 
ATOM   1635 N  N   . ILE B 1 36  ? -14.930 1.853   -41.253 1.00 42.36  ? 36  ILE B N   1 
ATOM   1636 C  CA  . ILE B 1 36  ? -14.448 3.159   -41.687 1.00 43.23  ? 36  ILE B CA  1 
ATOM   1637 C  C   . ILE B 1 36  ? -13.180 3.084   -42.513 1.00 42.96  ? 36  ILE B C   1 
ATOM   1638 O  O   . ILE B 1 36  ? -12.972 3.939   -43.360 1.00 44.88  ? 36  ILE B O   1 
ATOM   1639 C  CB  . ILE B 1 36  ? -14.230 4.151   -40.505 1.00 42.71  ? 36  ILE B CB  1 
ATOM   1640 C  CG1 . ILE B 1 36  ? -13.006 3.763   -39.694 1.00 43.65  ? 36  ILE B CG1 1 
ATOM   1641 C  CG2 . ILE B 1 36  ? -15.465 4.191   -39.625 1.00 45.22  ? 36  ILE B CG2 1 
ATOM   1642 C  CD1 . ILE B 1 36  ? -11.792 4.519   -40.107 1.00 49.32  ? 36  ILE B CD1 1 
ATOM   1643 N  N   . TYR B 1 37  ? -12.332 2.082   -42.293 1.00 42.46  ? 37  TYR B N   1 
ATOM   1644 C  CA  . TYR B 1 37  ? -11.120 1.992   -43.102 1.00 41.58  ? 37  TYR B CA  1 
ATOM   1645 C  C   . TYR B 1 37  ? -11.466 1.531   -44.517 1.00 41.80  ? 37  TYR B C   1 
ATOM   1646 O  O   . TYR B 1 37  ? -10.768 1.854   -45.474 1.00 41.05  ? 37  TYR B O   1 
ATOM   1647 C  CB  . TYR B 1 37  ? -10.064 1.083   -42.444 1.00 40.11  ? 37  TYR B CB  1 
ATOM   1648 C  CG  . TYR B 1 37  ? -10.490 -0.313  -42.046 1.00 41.51  ? 37  TYR B CG  1 
ATOM   1649 C  CD1 . TYR B 1 37  ? -10.393 -1.380  -42.939 1.00 41.63  ? 37  TYR B CD1 1 
ATOM   1650 C  CD2 . TYR B 1 37  ? -10.901 -0.588  -40.742 1.00 41.16  ? 37  TYR B CD2 1 
ATOM   1651 C  CE1 . TYR B 1 37  ? -10.684 -2.685  -42.537 1.00 40.27  ? 37  TYR B CE1 1 
ATOM   1652 C  CE2 . TYR B 1 37  ? -11.197 -1.888  -40.332 1.00 40.37  ? 37  TYR B CE2 1 
ATOM   1653 C  CZ  . TYR B 1 37  ? -11.083 -2.930  -41.232 1.00 41.07  ? 37  TYR B CZ  1 
ATOM   1654 O  OH  . TYR B 1 37  ? -11.358 -4.216  -40.826 1.00 39.70  ? 37  TYR B OH  1 
ATOM   1655 N  N   . ALA B 1 38  ? -12.568 0.798   -44.644 1.00 41.96  ? 38  ALA B N   1 
ATOM   1656 C  CA  . ALA B 1 38  ? -13.026 0.336   -45.947 1.00 44.06  ? 38  ALA B CA  1 
ATOM   1657 C  C   . ALA B 1 38  ? -13.738 1.511   -46.614 1.00 45.44  ? 38  ALA B C   1 
ATOM   1658 O  O   . ALA B 1 38  ? -13.567 1.768   -47.813 1.00 45.28  ? 38  ALA B O   1 
ATOM   1659 C  CB  . ALA B 1 38  ? -13.989 -0.835  -45.788 1.00 42.24  ? 38  ALA B CB  1 
ATOM   1660 N  N   . VAL B 1 39  ? -14.543 2.218   -45.824 1.00 45.75  ? 39  VAL B N   1 
ATOM   1661 C  CA  . VAL B 1 39  ? -15.272 3.373   -46.324 1.00 46.29  ? 39  VAL B CA  1 
ATOM   1662 C  C   . VAL B 1 39  ? -14.282 4.413   -46.829 1.00 48.15  ? 39  VAL B C   1 
ATOM   1663 O  O   . VAL B 1 39  ? -14.465 4.993   -47.906 1.00 49.24  ? 39  VAL B O   1 
ATOM   1664 C  CB  . VAL B 1 39  ? -16.149 3.996   -45.229 1.00 43.97  ? 39  VAL B CB  1 
ATOM   1665 C  CG1 . VAL B 1 39  ? -16.671 5.340   -45.682 1.00 41.00  ? 39  VAL B CG1 1 
ATOM   1666 C  CG2 . VAL B 1 39  ? -17.303 3.069   -44.918 1.00 42.44  ? 39  VAL B CG2 1 
ATOM   1667 N  N   . GLU B 1 40  ? -13.229 4.634   -46.050 1.00 49.75  ? 40  GLU B N   1 
ATOM   1668 C  CA  . GLU B 1 40  ? -12.199 5.596   -46.422 1.00 51.89  ? 40  GLU B CA  1 
ATOM   1669 C  C   . GLU B 1 40  ? -11.502 5.112   -47.700 1.00 52.10  ? 40  GLU B C   1 
ATOM   1670 O  O   . GLU B 1 40  ? -11.149 5.910   -48.571 1.00 52.11  ? 40  GLU B O   1 
ATOM   1671 C  CB  . GLU B 1 40  ? -11.168 5.754   -45.280 1.00 51.92  ? 40  GLU B CB  1 
ATOM   1672 C  CG  . GLU B 1 40  ? -11.741 6.319   -43.966 1.00 53.72  ? 40  GLU B CG  1 
ATOM   1673 C  CD  . GLU B 1 40  ? -10.751 6.285   -42.781 1.00 55.33  ? 40  GLU B CD  1 
ATOM   1674 O  OE1 . GLU B 1 40  ? -10.015 5.275   -42.618 1.00 53.19  ? 40  GLU B OE1 1 
ATOM   1675 O  OE2 . GLU B 1 40  ? -10.731 7.271   -42.003 1.00 53.80  ? 40  GLU B OE2 1 
ATOM   1676 N  N   . ALA B 1 41  ? -11.335 3.796   -47.818 1.00 51.90  ? 41  ALA B N   1 
ATOM   1677 C  CA  . ALA B 1 41  ? -10.655 3.213   -48.971 1.00 51.67  ? 41  ALA B CA  1 
ATOM   1678 C  C   . ALA B 1 41  ? -11.474 3.084   -50.243 1.00 52.47  ? 41  ALA B C   1 
ATOM   1679 O  O   . ALA B 1 41  ? -10.994 3.424   -51.321 1.00 52.84  ? 41  ALA B O   1 
ATOM   1680 C  CB  . ALA B 1 41  ? -10.092 1.854   -48.602 1.00 50.47  ? 41  ALA B CB  1 
ATOM   1681 N  N   . ASP B 1 42  ? -12.704 2.595   -50.132 1.00 53.00  ? 42  ASP B N   1 
ATOM   1682 C  CA  . ASP B 1 42  ? -13.524 2.405   -51.322 1.00 52.76  ? 42  ASP B CA  1 
ATOM   1683 C  C   . ASP B 1 42  ? -14.816 3.206   -51.384 1.00 52.71  ? 42  ASP B C   1 
ATOM   1684 O  O   . ASP B 1 42  ? -15.459 3.254   -52.429 1.00 53.51  ? 42  ASP B O   1 
ATOM   1685 C  CB  . ASP B 1 42  ? -13.851 0.923   -51.485 1.00 52.51  ? 42  ASP B CB  1 
ATOM   1686 C  CG  . ASP B 1 42  ? -12.624 0.054   -51.405 1.00 52.72  ? 42  ASP B CG  1 
ATOM   1687 O  OD1 . ASP B 1 42  ? -11.645 0.351   -52.119 1.00 54.75  ? 42  ASP B OD1 1 
ATOM   1688 O  OD2 . ASP B 1 42  ? -12.637 -0.924  -50.630 1.00 52.82  ? 42  ASP B OD2 1 
ATOM   1689 N  N   . GLY B 1 43  ? -15.201 3.833   -50.280 1.00 51.87  ? 43  GLY B N   1 
ATOM   1690 C  CA  . GLY B 1 43  ? -16.433 4.600   -50.285 1.00 50.24  ? 43  GLY B CA  1 
ATOM   1691 C  C   . GLY B 1 43  ? -17.491 3.980   -49.396 1.00 49.39  ? 43  GLY B C   1 
ATOM   1692 O  O   . GLY B 1 43  ? -17.345 2.855   -48.930 1.00 50.03  ? 43  GLY B O   1 
ATOM   1693 N  N   . ASP B 1 44  ? -18.575 4.710   -49.181 1.00 49.43  ? 44  ASP B N   1 
ATOM   1694 C  CA  . ASP B 1 44  ? -19.646 4.252   -48.310 1.00 49.49  ? 44  ASP B CA  1 
ATOM   1695 C  C   . ASP B 1 44  ? -20.867 3.686   -49.042 1.00 50.08  ? 44  ASP B C   1 
ATOM   1696 O  O   . ASP B 1 44  ? -21.628 4.423   -49.666 1.00 50.96  ? 44  ASP B O   1 
ATOM   1697 C  CB  . ASP B 1 44  ? -20.064 5.413   -47.407 1.00 50.72  ? 44  ASP B CB  1 
ATOM   1698 C  CG  . ASP B 1 44  ? -21.057 5.001   -46.346 1.00 53.62  ? 44  ASP B CG  1 
ATOM   1699 O  OD1 . ASP B 1 44  ? -21.250 3.778   -46.155 1.00 55.30  ? 44  ASP B OD1 1 
ATOM   1700 O  OD2 . ASP B 1 44  ? -21.638 5.898   -45.693 1.00 55.94  ? 44  ASP B OD2 1 
ATOM   1701 N  N   . PRO B 1 45  ? -21.075 2.361   -48.960 1.00 49.59  ? 45  PRO B N   1 
ATOM   1702 C  CA  . PRO B 1 45  ? -22.202 1.679   -49.607 1.00 49.61  ? 45  PRO B CA  1 
ATOM   1703 C  C   . PRO B 1 45  ? -23.570 2.299   -49.290 1.00 49.23  ? 45  PRO B C   1 
ATOM   1704 O  O   . PRO B 1 45  ? -24.567 2.001   -49.951 1.00 50.12  ? 45  PRO B O   1 
ATOM   1705 C  CB  . PRO B 1 45  ? -22.088 0.250   -49.074 1.00 49.92  ? 45  PRO B CB  1 
ATOM   1706 C  CG  . PRO B 1 45  ? -20.622 0.082   -48.908 1.00 50.64  ? 45  PRO B CG  1 
ATOM   1707 C  CD  . PRO B 1 45  ? -20.220 1.390   -48.257 1.00 50.22  ? 45  PRO B CD  1 
ATOM   1708 N  N   . ASN B 1 46  ? -23.611 3.155   -48.276 1.00 47.10  ? 46  ASN B N   1 
ATOM   1709 C  CA  . ASN B 1 46  ? -24.846 3.804   -47.860 1.00 45.93  ? 46  ASN B CA  1 
ATOM   1710 C  C   . ASN B 1 46  ? -24.759 5.280   -48.222 1.00 46.82  ? 46  ASN B C   1 
ATOM   1711 O  O   . ASN B 1 46  ? -25.643 6.064   -47.882 1.00 45.43  ? 46  ASN B O   1 
ATOM   1712 C  CB  . ASN B 1 46  ? -25.028 3.637   -46.346 1.00 42.98  ? 46  ASN B CB  1 
ATOM   1713 C  CG  . ASN B 1 46  ? -26.304 4.277   -45.828 1.00 43.38  ? 46  ASN B CG  1 
ATOM   1714 O  OD1 . ASN B 1 46  ? -27.403 3.893   -46.220 1.00 42.35  ? 46  ASN B OD1 1 
ATOM   1715 N  ND2 . ASN B 1 46  ? -26.162 5.258   -44.935 1.00 43.29  ? 46  ASN B ND2 1 
ATOM   1716 N  N   . ALA B 1 47  ? -23.686 5.642   -48.923 1.00 48.79  ? 47  ALA B N   1 
ATOM   1717 C  CA  . ALA B 1 47  ? -23.442 7.025   -49.333 1.00 52.37  ? 47  ALA B CA  1 
ATOM   1718 C  C   . ALA B 1 47  ? -24.667 7.704   -49.930 1.00 55.32  ? 47  ALA B C   1 
ATOM   1719 O  O   . ALA B 1 47  ? -25.132 8.729   -49.426 1.00 56.87  ? 47  ALA B O   1 
ATOM   1720 C  CB  . ALA B 1 47  ? -22.301 7.077   -50.333 1.00 51.24  ? 47  ALA B CB  1 
ATOM   1721 N  N   . GLY B 1 48  ? -25.188 7.128   -51.008 1.00 56.60  ? 48  GLY B N   1 
ATOM   1722 C  CA  . GLY B 1 48  ? -26.344 7.684   -51.686 1.00 61.02  ? 48  GLY B CA  1 
ATOM   1723 C  C   . GLY B 1 48  ? -27.525 7.880   -50.756 1.00 64.00  ? 48  GLY B C   1 
ATOM   1724 O  O   . GLY B 1 48  ? -28.240 8.878   -50.847 1.00 64.00  ? 48  GLY B O   1 
ATOM   1725 N  N   . PHE B 1 49  ? -27.728 6.923   -49.856 1.00 66.64  ? 49  PHE B N   1 
ATOM   1726 C  CA  . PHE B 1 49  ? -29.069 6.458   -49.523 1.00 68.47  ? 49  PHE B CA  1 
ATOM   1727 C  C   . PHE B 1 49  ? -30.128 7.502   -49.184 1.00 71.38  ? 49  PHE B C   1 
ATOM   1728 O  O   . PHE B 1 49  ? -29.884 8.415   -48.396 1.00 71.90  ? 49  PHE B O   1 
ATOM   1729 C  CB  . PHE B 1 49  ? -29.053 5.680   -48.205 1.00 66.22  ? 49  PHE B CB  1 
ATOM   1730 C  CG  . PHE B 1 49  ? -30.411 5.219   -47.758 1.00 64.39  ? 49  PHE B CG  1 
ATOM   1731 C  CD1 . PHE B 1 49  ? -31.090 5.890   -46.755 1.00 63.13  ? 49  PHE B CD1 1 
ATOM   1732 C  CD2 . PHE B 1 49  ? -31.009 4.114   -48.340 1.00 63.52  ? 49  PHE B CD2 1 
ATOM   1733 C  CE1 . PHE B 1 49  ? -32.339 5.469   -46.341 1.00 62.59  ? 49  PHE B CE1 1 
ATOM   1734 C  CE2 . PHE B 1 49  ? -32.258 3.687   -47.931 1.00 63.26  ? 49  PHE B CE2 1 
ATOM   1735 C  CZ  . PHE B 1 49  ? -32.924 4.366   -46.930 1.00 63.07  ? 49  PHE B CZ  1 
ATOM   1736 N  N   . GLU B 1 50  ? -31.304 7.360   -49.786 1.00 74.53  ? 50  GLU B N   1 
ATOM   1737 C  CA  . GLU B 1 50  ? -32.369 8.341   -49.613 1.00 77.25  ? 50  GLU B CA  1 
ATOM   1738 C  C   . GLU B 1 50  ? -33.654 7.679   -49.125 1.00 78.41  ? 50  GLU B C   1 
ATOM   1739 O  O   . GLU B 1 50  ? -33.806 6.461   -49.209 1.00 79.25  ? 50  GLU B O   1 
ATOM   1740 C  CB  . GLU B 1 50  ? -32.627 9.088   -50.923 1.00 79.15  ? 50  GLU B CB  1 
ATOM   1741 C  CG  . GLU B 1 50  ? -32.185 10.542  -50.906 1.00 81.02  ? 50  GLU B CG  1 
ATOM   1742 C  CD  . GLU B 1 50  ? -32.141 11.154  -52.292 1.00 82.74  ? 50  GLU B CD  1 
ATOM   1743 O  OE1 . GLU B 1 50  ? -31.411 10.623  -53.155 1.00 83.95  ? 50  GLU B OE1 1 
ATOM   1744 O  OE2 . GLU B 1 50  ? -32.836 12.167  -52.519 1.00 83.10  ? 50  GLU B OE2 1 
ATOM   1745 N  N   . LYS B 1 51  ? -34.575 8.490   -48.616 1.00 79.20  ? 51  LYS B N   1 
ATOM   1746 C  CA  . LYS B 1 51  ? -35.921 8.023   -48.308 1.00 79.63  ? 51  LYS B CA  1 
ATOM   1747 C  C   . LYS B 1 51  ? -35.915 6.554   -47.899 1.00 80.00  ? 51  LYS B C   1 
ATOM   1748 O  O   . LYS B 1 51  ? -36.743 5.768   -48.360 1.00 79.70  ? 51  LYS B O   1 
ATOM   1749 C  CB  . LYS B 1 51  ? -36.843 8.241   -49.498 1.00 79.32  ? 51  LYS B CB  1 
ATOM   1750 N  N   . LYS B 1 53  ? -36.629 7.191   -52.380 1.00 68.79  ? 53  LYS B N   1 
ATOM   1751 C  CA  . LYS B 1 53  ? -35.948 6.889   -53.633 1.00 68.27  ? 53  LYS B CA  1 
ATOM   1752 C  C   . LYS B 1 53  ? -35.667 5.391   -53.737 1.00 67.57  ? 53  LYS B C   1 
ATOM   1753 O  O   . LYS B 1 53  ? -35.575 4.838   -54.834 1.00 67.99  ? 53  LYS B O   1 
ATOM   1754 C  CB  . LYS B 1 53  ? -34.641 7.681   -53.721 1.00 68.44  ? 53  LYS B CB  1 
ATOM   1755 N  N   . GLU B 1 54  ? -35.533 4.741   -52.585 1.00 66.41  ? 54  GLU B N   1 
ATOM   1756 C  CA  . GLU B 1 54  ? -35.264 3.309   -52.539 1.00 64.64  ? 54  GLU B CA  1 
ATOM   1757 C  C   . GLU B 1 54  ? -35.649 2.702   -51.197 1.00 64.24  ? 54  GLU B C   1 
ATOM   1758 O  O   . GLU B 1 54  ? -35.921 3.417   -50.231 1.00 63.24  ? 54  GLU B O   1 
ATOM   1759 C  CB  . GLU B 1 54  ? -33.785 3.038   -52.834 1.00 64.37  ? 54  GLU B CB  1 
ATOM   1760 C  CG  . GLU B 1 54  ? -32.809 4.009   -52.185 1.00 64.95  ? 54  GLU B CG  1 
ATOM   1761 C  CD  . GLU B 1 54  ? -31.354 3.571   -52.348 1.00 65.26  ? 54  GLU B CD  1 
ATOM   1762 O  OE1 . GLU B 1 54  ? -30.451 4.407   -52.130 1.00 64.48  ? 54  GLU B OE1 1 
ATOM   1763 O  OE2 . GLU B 1 54  ? -31.112 2.389   -52.688 1.00 65.57  ? 54  GLU B OE2 1 
ATOM   1764 N  N   . PRO B 1 55  ? -35.684 1.364   -51.124 1.00 64.87  ? 55  PRO B N   1 
ATOM   1765 C  CA  . PRO B 1 55  ? -36.039 0.621   -49.908 1.00 65.81  ? 55  PRO B CA  1 
ATOM   1766 C  C   . PRO B 1 55  ? -35.307 1.046   -48.632 1.00 66.09  ? 55  PRO B C   1 
ATOM   1767 O  O   . PRO B 1 55  ? -34.316 1.785   -48.667 1.00 67.38  ? 55  PRO B O   1 
ATOM   1768 C  CB  . PRO B 1 55  ? -35.723 -0.824  -50.284 1.00 66.91  ? 55  PRO B CB  1 
ATOM   1769 C  CG  . PRO B 1 55  ? -36.016 -0.854  -51.756 1.00 65.78  ? 55  PRO B CG  1 
ATOM   1770 C  CD  . PRO B 1 55  ? -35.388 0.437   -52.233 1.00 64.88  ? 55  PRO B CD  1 
ATOM   1771 N  N   . GLY B 1 56  ? -35.813 0.555   -47.506 1.00 64.61  ? 56  GLY B N   1 
ATOM   1772 C  CA  . GLY B 1 56  ? -35.229 0.863   -46.217 1.00 61.53  ? 56  GLY B CA  1 
ATOM   1773 C  C   . GLY B 1 56  ? -34.897 -0.430  -45.507 1.00 60.11  ? 56  GLY B C   1 
ATOM   1774 O  O   . GLY B 1 56  ? -35.533 -1.465  -45.719 1.00 59.48  ? 56  GLY B O   1 
ATOM   1775 N  N   . GLU B 1 57  ? -33.892 -0.365  -44.648 1.00 58.70  ? 57  GLU B N   1 
ATOM   1776 C  CA  . GLU B 1 57  ? -33.443 -1.530  -43.908 1.00 56.03  ? 57  GLU B CA  1 
ATOM   1777 C  C   . GLU B 1 57  ? -32.874 -1.044  -42.579 1.00 54.05  ? 57  GLU B C   1 
ATOM   1778 O  O   . GLU B 1 57  ? -31.953 -0.222  -42.567 1.00 53.82  ? 57  GLU B O   1 
ATOM   1779 C  CB  . GLU B 1 57  ? -32.365 -2.240  -44.729 1.00 55.33  ? 57  GLU B CB  1 
ATOM   1780 C  CG  . GLU B 1 57  ? -31.948 -3.593  -44.229 1.00 57.06  ? 57  GLU B CG  1 
ATOM   1781 C  CD  . GLU B 1 57  ? -30.971 -4.266  -45.176 1.00 58.46  ? 57  GLU B CD  1 
ATOM   1782 O  OE1 . GLU B 1 57  ? -29.884 -3.696  -45.416 1.00 59.53  ? 57  GLU B OE1 1 
ATOM   1783 O  OE2 . GLU B 1 57  ? -31.292 -5.361  -45.687 1.00 60.11  ? 57  GLU B OE2 1 
ATOM   1784 N  N   . ILE B 1 58  ? -33.440 -1.519  -41.469 1.00 51.46  ? 58  ILE B N   1 
ATOM   1785 C  CA  . ILE B 1 58  ? -32.938 -1.142  -40.149 1.00 48.75  ? 58  ILE B CA  1 
ATOM   1786 C  C   . ILE B 1 58  ? -31.572 -1.794  -40.009 1.00 47.53  ? 58  ILE B C   1 
ATOM   1787 O  O   . ILE B 1 58  ? -31.432 -3.000  -40.193 1.00 47.37  ? 58  ILE B O   1 
ATOM   1788 C  CB  . ILE B 1 58  ? -33.832 -1.669  -39.010 1.00 49.13  ? 58  ILE B CB  1 
ATOM   1789 C  CG1 . ILE B 1 58  ? -35.227 -1.048  -39.107 1.00 50.96  ? 58  ILE B CG1 1 
ATOM   1790 C  CG2 . ILE B 1 58  ? -33.192 -1.359  -37.662 1.00 45.61  ? 58  ILE B CG2 1 
ATOM   1791 C  CD1 . ILE B 1 58  ? -35.229 0.466   -39.008 1.00 55.02  ? 58  ILE B CD1 1 
ATOM   1792 N  N   . GLN B 1 59  ? -30.559 -0.997  -39.696 1.00 46.84  ? 59  GLN B N   1 
ATOM   1793 C  CA  . GLN B 1 59  ? -29.218 -1.532  -39.546 1.00 44.24  ? 59  GLN B CA  1 
ATOM   1794 C  C   . GLN B 1 59  ? -28.613 -1.174  -38.198 1.00 42.43  ? 59  GLN B C   1 
ATOM   1795 O  O   . GLN B 1 59  ? -28.810 -0.075  -37.671 1.00 41.68  ? 59  GLN B O   1 
ATOM   1796 C  CB  . GLN B 1 59  ? -28.345 -1.034  -40.685 1.00 45.51  ? 59  GLN B CB  1 
ATOM   1797 C  CG  . GLN B 1 59  ? -28.665 -1.711  -41.999 1.00 46.85  ? 59  GLN B CG  1 
ATOM   1798 C  CD  . GLN B 1 59  ? -28.317 -0.857  -43.195 1.00 48.66  ? 59  GLN B CD  1 
ATOM   1799 O  OE1 . GLN B 1 59  ? -27.762 0.241   -43.054 1.00 48.29  ? 59  GLN B OE1 1 
ATOM   1800 N  NE2 . GLN B 1 59  ? -28.645 -1.353  -44.389 1.00 49.80  ? 59  GLN B NE2 1 
ATOM   1801 N  N   . TYR B 1 60  ? -27.871 -2.124  -37.644 1.00 39.49  ? 60  TYR B N   1 
ATOM   1802 C  CA  . TYR B 1 60  ? -27.251 -1.957  -36.339 1.00 36.08  ? 60  TYR B CA  1 
ATOM   1803 C  C   . TYR B 1 60  ? -25.729 -1.922  -36.450 1.00 34.58  ? 60  TYR B C   1 
ATOM   1804 O  O   . TYR B 1 60  ? -25.131 -2.799  -37.072 1.00 33.66  ? 60  TYR B O   1 
ATOM   1805 C  CB  . TYR B 1 60  ? -27.685 -3.113  -35.439 1.00 34.44  ? 60  TYR B CB  1 
ATOM   1806 C  CG  . TYR B 1 60  ? -29.183 -3.336  -35.419 1.00 31.97  ? 60  TYR B CG  1 
ATOM   1807 C  CD1 . TYR B 1 60  ? -30.003 -2.620  -34.549 1.00 30.45  ? 60  TYR B CD1 1 
ATOM   1808 C  CD2 . TYR B 1 60  ? -29.787 -4.271  -36.274 1.00 33.56  ? 60  TYR B CD2 1 
ATOM   1809 C  CE1 . TYR B 1 60  ? -31.391 -2.828  -34.517 1.00 28.70  ? 60  TYR B CE1 1 
ATOM   1810 C  CE2 . TYR B 1 60  ? -31.178 -4.484  -36.256 1.00 30.05  ? 60  TYR B CE2 1 
ATOM   1811 C  CZ  . TYR B 1 60  ? -31.970 -3.762  -35.373 1.00 31.04  ? 60  TYR B CZ  1 
ATOM   1812 O  OH  . TYR B 1 60  ? -33.337 -3.981  -35.340 1.00 30.44  ? 60  TYR B OH  1 
ATOM   1813 N  N   . LEU B 1 61  ? -25.112 -0.894  -35.868 1.00 31.29  ? 61  LEU B N   1 
ATOM   1814 C  CA  . LEU B 1 61  ? -23.663 -0.764  -35.885 1.00 30.28  ? 61  LEU B CA  1 
ATOM   1815 C  C   . LEU B 1 61  ? -23.213 -1.736  -34.803 1.00 29.03  ? 61  LEU B C   1 
ATOM   1816 O  O   . LEU B 1 61  ? -23.773 -1.742  -33.706 1.00 28.89  ? 61  LEU B O   1 
ATOM   1817 C  CB  . LEU B 1 61  ? -23.255 0.668   -35.539 1.00 31.40  ? 61  LEU B CB  1 
ATOM   1818 C  CG  . LEU B 1 61  ? -21.754 0.965   -35.474 1.00 29.24  ? 61  LEU B CG  1 
ATOM   1819 C  CD1 . LEU B 1 61  ? -21.110 0.651   -36.801 1.00 27.82  ? 61  LEU B CD1 1 
ATOM   1820 C  CD2 . LEU B 1 61  ? -21.548 2.436   -35.107 1.00 28.67  ? 61  LEU B CD2 1 
ATOM   1821 N  N   . ILE B 1 62  ? -22.209 -2.548  -35.102 1.00 26.59  ? 62  ILE B N   1 
ATOM   1822 C  CA  . ILE B 1 62  ? -21.768 -3.564  -34.159 1.00 25.43  ? 62  ILE B CA  1 
ATOM   1823 C  C   . ILE B 1 62  ? -20.332 -3.503  -33.696 1.00 27.23  ? 62  ILE B C   1 
ATOM   1824 O  O   . ILE B 1 62  ? -19.422 -3.378  -34.510 1.00 27.45  ? 62  ILE B O   1 
ATOM   1825 C  CB  . ILE B 1 62  ? -21.919 -4.969  -34.762 1.00 25.27  ? 62  ILE B CB  1 
ATOM   1826 C  CG1 . ILE B 1 62  ? -23.333 -5.189  -35.305 1.00 26.40  ? 62  ILE B CG1 1 
ATOM   1827 C  CG2 . ILE B 1 62  ? -21.555 -6.004  -33.733 1.00 27.02  ? 62  ILE B CG2 1 
ATOM   1828 C  CD1 . ILE B 1 62  ? -24.440 -5.033  -34.285 1.00 23.92  ? 62  ILE B CD1 1 
ATOM   1829 N  N   . LYS B 1 63  ? -20.131 -3.613  -32.384 1.00 29.08  ? 63  LYS B N   1 
ATOM   1830 C  CA  . LYS B 1 63  ? -18.783 -3.675  -31.811 1.00 27.57  ? 63  LYS B CA  1 
ATOM   1831 C  C   . LYS B 1 63  ? -18.633 -5.181  -31.603 1.00 27.76  ? 63  LYS B C   1 
ATOM   1832 O  O   . LYS B 1 63  ? -19.445 -5.784  -30.899 1.00 25.06  ? 63  LYS B O   1 
ATOM   1833 C  CB  . LYS B 1 63  ? -18.716 -2.945  -30.461 1.00 28.12  ? 63  LYS B CB  1 
ATOM   1834 C  CG  . LYS B 1 63  ? -17.492 -3.318  -29.611 1.00 27.86  ? 63  LYS B CG  1 
ATOM   1835 C  CD  . LYS B 1 63  ? -16.176 -3.030  -30.339 1.00 28.28  ? 63  LYS B CD  1 
ATOM   1836 C  CE  . LYS B 1 63  ? -14.966 -3.391  -29.480 1.00 27.53  ? 63  LYS B CE  1 
ATOM   1837 N  NZ  . LYS B 1 63  ? -14.908 -4.858  -29.167 1.00 31.13  ? 63  LYS B NZ  1 
ATOM   1838 N  N   . TRP B 1 64  ? -17.626 -5.785  -32.227 1.00 30.31  ? 64  TRP B N   1 
ATOM   1839 C  CA  . TRP B 1 64  ? -17.402 -7.235  -32.134 1.00 35.15  ? 64  TRP B CA  1 
ATOM   1840 C  C   . TRP B 1 64  ? -16.457 -7.668  -31.014 1.00 37.17  ? 64  TRP B C   1 
ATOM   1841 O  O   . TRP B 1 64  ? -15.522 -6.941  -30.653 1.00 38.15  ? 64  TRP B O   1 
ATOM   1842 C  CB  . TRP B 1 64  ? -16.839 -7.774  -33.460 1.00 34.52  ? 64  TRP B CB  1 
ATOM   1843 C  CG  . TRP B 1 64  ? -17.713 -7.546  -34.657 1.00 36.56  ? 64  TRP B CG  1 
ATOM   1844 C  CD1 . TRP B 1 64  ? -17.565 -6.583  -35.612 1.00 34.13  ? 64  TRP B CD1 1 
ATOM   1845 C  CD2 . TRP B 1 64  ? -18.880 -8.291  -35.016 1.00 38.56  ? 64  TRP B CD2 1 
ATOM   1846 N  NE1 . TRP B 1 64  ? -18.567 -6.681  -36.543 1.00 36.05  ? 64  TRP B NE1 1 
ATOM   1847 C  CE2 . TRP B 1 64  ? -19.391 -7.719  -36.200 1.00 38.25  ? 64  TRP B CE2 1 
ATOM   1848 C  CE3 . TRP B 1 64  ? -19.545 -9.388  -34.451 1.00 39.23  ? 64  TRP B CE3 1 
ATOM   1849 C  CZ2 . TRP B 1 64  ? -20.538 -8.202  -36.828 1.00 39.65  ? 64  TRP B CZ2 1 
ATOM   1850 C  CZ3 . TRP B 1 64  ? -20.688 -9.869  -35.078 1.00 40.73  ? 64  TRP B CZ3 1 
ATOM   1851 C  CH2 . TRP B 1 64  ? -21.173 -9.276  -36.254 1.00 41.92  ? 64  TRP B CH2 1 
ATOM   1852 N  N   . LYS B 1 65  ? -16.685 -8.865  -30.479 1.00 39.60  ? 65  LYS B N   1 
ATOM   1853 C  CA  . LYS B 1 65  ? -15.823 -9.367  -29.423 1.00 40.08  ? 65  LYS B CA  1 
ATOM   1854 C  C   . LYS B 1 65  ? -14.497 -9.751  -30.061 1.00 39.71  ? 65  LYS B C   1 
ATOM   1855 O  O   . LYS B 1 65  ? -14.466 -10.403 -31.102 1.00 40.70  ? 65  LYS B O   1 
ATOM   1856 C  CB  . LYS B 1 65  ? -16.448 -10.580 -28.722 1.00 42.34  ? 65  LYS B CB  1 
ATOM   1857 C  CG  . LYS B 1 65  ? -15.703 -10.972 -27.442 1.00 47.12  ? 65  LYS B CG  1 
ATOM   1858 C  CD  . LYS B 1 65  ? -16.483 -11.918 -26.538 1.00 49.99  ? 65  LYS B CD  1 
ATOM   1859 C  CE  . LYS B 1 65  ? -16.509 -13.344 -27.073 1.00 52.62  ? 65  LYS B CE  1 
ATOM   1860 N  NZ  . LYS B 1 65  ? -17.186 -14.280 -26.115 1.00 54.97  ? 65  LYS B NZ  1 
ATOM   1861 N  N   . GLY B 1 66  ? -13.401 -9.311  -29.460 1.00 38.63  ? 66  GLY B N   1 
ATOM   1862 C  CA  . GLY B 1 66  ? -12.094 -9.640  -29.996 1.00 39.14  ? 66  GLY B CA  1 
ATOM   1863 C  C   . GLY B 1 66  ? -11.589 -8.718  -31.092 1.00 39.26  ? 66  GLY B C   1 
ATOM   1864 O  O   . GLY B 1 66  ? -10.505 -8.943  -31.637 1.00 39.89  ? 66  GLY B O   1 
ATOM   1865 N  N   . TRP B 1 67  ? -12.363 -7.694  -31.433 1.00 38.08  ? 67  TRP B N   1 
ATOM   1866 C  CA  . TRP B 1 67  ? -11.939 -6.752  -32.459 1.00 37.55  ? 67  TRP B CA  1 
ATOM   1867 C  C   . TRP B 1 67  ? -12.075 -5.324  -31.958 1.00 36.47  ? 67  TRP B C   1 
ATOM   1868 O  O   . TRP B 1 67  ? -13.045 -4.999  -31.275 1.00 36.14  ? 67  TRP B O   1 
ATOM   1869 C  CB  . TRP B 1 67  ? -12.782 -6.910  -33.714 1.00 41.37  ? 67  TRP B CB  1 
ATOM   1870 C  CG  . TRP B 1 67  ? -12.755 -8.276  -34.293 1.00 44.03  ? 67  TRP B CG  1 
ATOM   1871 C  CD1 . TRP B 1 67  ? -13.488 -9.356  -33.890 1.00 45.15  ? 67  TRP B CD1 1 
ATOM   1872 C  CD2 . TRP B 1 67  ? -11.939 -8.722  -35.377 1.00 45.28  ? 67  TRP B CD2 1 
ATOM   1873 N  NE1 . TRP B 1 67  ? -13.178 -10.452 -34.663 1.00 46.06  ? 67  TRP B NE1 1 
ATOM   1874 C  CE2 . TRP B 1 67  ? -12.229 -10.091 -35.581 1.00 46.07  ? 67  TRP B CE2 1 
ATOM   1875 C  CE3 . TRP B 1 67  ? -10.989 -8.101  -36.197 1.00 46.69  ? 67  TRP B CE3 1 
ATOM   1876 C  CZ2 . TRP B 1 67  ? -11.602 -10.848 -36.570 1.00 46.76  ? 67  TRP B CZ2 1 
ATOM   1877 C  CZ3 . TRP B 1 67  ? -10.364 -8.856  -37.186 1.00 48.54  ? 67  TRP B CZ3 1 
ATOM   1878 C  CH2 . TRP B 1 67  ? -10.676 -10.217 -37.361 1.00 48.36  ? 67  TRP B CH2 1 
ATOM   1879 N  N   . SER B 1 68  ? -11.109 -4.472  -32.288 1.00 34.80  ? 68  SER B N   1 
ATOM   1880 C  CA  . SER B 1 68  ? -11.176 -3.083  -31.863 1.00 34.68  ? 68  SER B CA  1 
ATOM   1881 C  C   . SER B 1 68  ? -12.272 -2.378  -32.650 1.00 34.30  ? 68  SER B C   1 
ATOM   1882 O  O   . SER B 1 68  ? -12.719 -2.857  -33.698 1.00 33.76  ? 68  SER B O   1 
ATOM   1883 C  CB  . SER B 1 68  ? -9.841  -2.362  -32.086 1.00 36.36  ? 68  SER B CB  1 
ATOM   1884 O  OG  . SER B 1 68  ? -9.639  -2.045  -33.455 1.00 37.25  ? 68  SER B OG  1 
ATOM   1885 N  N   . HIS B 1 69  ? -12.690 -1.232  -32.135 1.00 33.31  ? 69  HIS B N   1 
ATOM   1886 C  CA  . HIS B 1 69  ? -13.746 -0.445  -32.744 1.00 32.98  ? 69  HIS B CA  1 
ATOM   1887 C  C   . HIS B 1 69  ? -13.595 -0.099  -34.223 1.00 34.41  ? 69  HIS B C   1 
ATOM   1888 O  O   . HIS B 1 69  ? -14.598 0.109   -34.903 1.00 34.78  ? 69  HIS B O   1 
ATOM   1889 C  CB  . HIS B 1 69  ? -13.963 0.844   -31.951 1.00 32.27  ? 69  HIS B CB  1 
ATOM   1890 C  CG  . HIS B 1 69  ? -14.843 0.678   -30.752 1.00 31.01  ? 69  HIS B CG  1 
ATOM   1891 N  ND1 . HIS B 1 69  ? -14.400 0.114   -29.577 1.00 31.75  ? 69  HIS B ND1 1 
ATOM   1892 C  CD2 . HIS B 1 69  ? -16.147 0.986   -30.553 1.00 31.81  ? 69  HIS B CD2 1 
ATOM   1893 C  CE1 . HIS B 1 69  ? -15.392 0.080   -28.704 1.00 31.14  ? 69  HIS B CE1 1 
ATOM   1894 N  NE2 . HIS B 1 69  ? -16.464 0.602   -29.272 1.00 30.87  ? 69  HIS B NE2 1 
ATOM   1895 N  N   . ILE B 1 70  ? -12.374 -0.024  -34.739 1.00 34.22  ? 70  ILE B N   1 
ATOM   1896 C  CA  . ILE B 1 70  ? -12.244 0.311   -36.151 1.00 35.90  ? 70  ILE B CA  1 
ATOM   1897 C  C   . ILE B 1 70  ? -12.901 -0.759  -37.004 1.00 35.76  ? 70  ILE B C   1 
ATOM   1898 O  O   . ILE B 1 70  ? -13.262 -0.509  -38.153 1.00 36.57  ? 70  ILE B O   1 
ATOM   1899 C  CB  . ILE B 1 70  ? -10.785 0.399   -36.628 1.00 37.76  ? 70  ILE B CB  1 
ATOM   1900 C  CG1 . ILE B 1 70  ? -10.061 -0.899  -36.296 1.00 38.39  ? 70  ILE B CG1 1 
ATOM   1901 C  CG2 . ILE B 1 70  ? -10.102 1.620   -36.043 1.00 39.57  ? 70  ILE B CG2 1 
ATOM   1902 C  CD1 . ILE B 1 70  ? -8.748  -1.039  -37.020 1.00 42.34  ? 70  ILE B CD1 1 
ATOM   1903 N  N   . HIS B 1 71  ? -13.065 -1.951  -36.442 1.00 33.90  ? 71  HIS B N   1 
ATOM   1904 C  CA  . HIS B 1 71  ? -13.646 -3.057  -37.193 1.00 32.63  ? 71  HIS B CA  1 
ATOM   1905 C  C   . HIS B 1 71  ? -15.159 -3.125  -37.103 1.00 31.61  ? 71  HIS B C   1 
ATOM   1906 O  O   . HIS B 1 71  ? -15.769 -4.086  -37.564 1.00 31.01  ? 71  HIS B O   1 
ATOM   1907 C  CB  . HIS B 1 71  ? -13.045 -4.379  -36.718 1.00 32.69  ? 71  HIS B CB  1 
ATOM   1908 C  CG  . HIS B 1 71  ? -11.549 -4.407  -36.748 1.00 33.29  ? 71  HIS B CG  1 
ATOM   1909 N  ND1 . HIS B 1 71  ? -10.832 -4.375  -37.924 1.00 33.23  ? 71  HIS B ND1 1 
ATOM   1910 C  CD2 . HIS B 1 71  ? -10.633 -4.441  -35.749 1.00 33.62  ? 71  HIS B CD2 1 
ATOM   1911 C  CE1 . HIS B 1 71  ? -9.540  -4.387  -37.648 1.00 33.93  ? 71  HIS B CE1 1 
ATOM   1912 N  NE2 . HIS B 1 71  ? -9.392  -4.427  -36.337 1.00 34.23  ? 71  HIS B NE2 1 
ATOM   1913 N  N   . ASN B 1 72  ? -15.771 -2.113  -36.499 1.00 32.74  ? 72  ASN B N   1 
ATOM   1914 C  CA  . ASN B 1 72  ? -17.232 -2.097  -36.392 1.00 31.83  ? 72  ASN B CA  1 
ATOM   1915 C  C   . ASN B 1 72  ? -17.829 -2.086  -37.795 1.00 30.58  ? 72  ASN B C   1 
ATOM   1916 O  O   . ASN B 1 72  ? -17.291 -1.457  -38.711 1.00 28.00  ? 72  ASN B O   1 
ATOM   1917 C  CB  . ASN B 1 72  ? -17.732 -0.855  -35.644 1.00 31.34  ? 72  ASN B CB  1 
ATOM   1918 C  CG  . ASN B 1 72  ? -17.324 -0.839  -34.187 1.00 34.43  ? 72  ASN B CG  1 
ATOM   1919 O  OD1 . ASN B 1 72  ? -16.793 -1.823  -33.662 1.00 37.04  ? 72  ASN B OD1 1 
ATOM   1920 N  ND2 . ASN B 1 72  ? -17.581 0.280   -33.516 1.00 34.95  ? 72  ASN B ND2 1 
ATOM   1921 N  N   . THR B 1 73  ? -18.947 -2.777  -37.954 1.00 28.22  ? 73  THR B N   1 
ATOM   1922 C  CA  . THR B 1 73  ? -19.617 -2.833  -39.237 1.00 28.66  ? 73  THR B CA  1 
ATOM   1923 C  C   . THR B 1 73  ? -21.119 -2.700  -39.021 1.00 29.53  ? 73  THR B C   1 
ATOM   1924 O  O   . THR B 1 73  ? -21.636 -3.049  -37.955 1.00 30.95  ? 73  THR B O   1 
ATOM   1925 C  CB  . THR B 1 73  ? -19.367 -4.177  -39.927 1.00 28.10  ? 73  THR B CB  1 
ATOM   1926 O  OG1 . THR B 1 73  ? -19.872 -5.225  -39.095 1.00 29.54  ? 73  THR B OG1 1 
ATOM   1927 C  CG2 . THR B 1 73  ? -17.890 -4.395  -40.177 1.00 22.68  ? 73  THR B CG2 1 
ATOM   1928 N  N   . TRP B 1 74  ? -21.825 -2.175  -40.013 1.00 28.52  ? 74  TRP B N   1 
ATOM   1929 C  CA  . TRP B 1 74  ? -23.274 -2.078  -39.884 1.00 30.02  ? 74  TRP B CA  1 
ATOM   1930 C  C   . TRP B 1 74  ? -23.807 -3.450  -40.292 1.00 30.30  ? 74  TRP B C   1 
ATOM   1931 O  O   . TRP B 1 74  ? -23.233 -4.113  -41.156 1.00 30.89  ? 74  TRP B O   1 
ATOM   1932 C  CB  . TRP B 1 74  ? -23.852 -0.978  -40.791 1.00 26.64  ? 74  TRP B CB  1 
ATOM   1933 C  CG  . TRP B 1 74  ? -23.613 0.415   -40.276 1.00 25.68  ? 74  TRP B CG  1 
ATOM   1934 C  CD1 . TRP B 1 74  ? -22.519 1.220   -40.521 1.00 25.83  ? 74  TRP B CD1 1 
ATOM   1935 C  CD2 . TRP B 1 74  ? -24.457 1.146   -39.384 1.00 23.74  ? 74  TRP B CD2 1 
ATOM   1936 N  NE1 . TRP B 1 74  ? -22.639 2.401   -39.828 1.00 26.50  ? 74  TRP B NE1 1 
ATOM   1937 C  CE2 . TRP B 1 74  ? -23.816 2.385   -39.122 1.00 26.17  ? 74  TRP B CE2 1 
ATOM   1938 C  CE3 . TRP B 1 74  ? -25.691 0.877   -38.774 1.00 22.92  ? 74  TRP B CE3 1 
ATOM   1939 C  CZ2 . TRP B 1 74  ? -24.373 3.356   -38.272 1.00 23.71  ? 74  TRP B CZ2 1 
ATOM   1940 C  CZ3 . TRP B 1 74  ? -26.252 1.842   -37.929 1.00 25.08  ? 74  TRP B CZ3 1 
ATOM   1941 C  CH2 . TRP B 1 74  ? -25.588 3.070   -37.687 1.00 24.59  ? 74  TRP B CH2 1 
ATOM   1942 N  N   . GLU B 1 75  ? -24.887 -3.887  -39.664 1.00 32.48  ? 75  GLU B N   1 
ATOM   1943 C  CA  . GLU B 1 75  ? -25.448 -5.193  -39.984 1.00 36.81  ? 75  GLU B CA  1 
ATOM   1944 C  C   . GLU B 1 75  ? -26.951 -5.149  -39.803 1.00 37.79  ? 75  GLU B C   1 
ATOM   1945 O  O   . GLU B 1 75  ? -27.486 -4.221  -39.207 1.00 38.67  ? 75  GLU B O   1 
ATOM   1946 C  CB  . GLU B 1 75  ? -24.874 -6.279  -39.063 1.00 39.79  ? 75  GLU B CB  1 
ATOM   1947 C  CG  . GLU B 1 75  ? -23.368 -6.508  -39.155 1.00 43.08  ? 75  GLU B CG  1 
ATOM   1948 C  CD  . GLU B 1 75  ? -22.964 -7.326  -40.367 1.00 46.04  ? 75  GLU B CD  1 
ATOM   1949 O  OE1 . GLU B 1 75  ? -23.792 -8.139  -40.836 1.00 46.69  ? 75  GLU B OE1 1 
ATOM   1950 O  OE2 . GLU B 1 75  ? -21.811 -7.169  -40.837 1.00 46.82  ? 75  GLU B OE2 1 
ATOM   1951 N  N   . THR B 1 76  ? -27.627 -6.166  -40.313 1.00 39.42  ? 76  THR B N   1 
ATOM   1952 C  CA  . THR B 1 76  ? -29.070 -6.237  -40.199 1.00 41.23  ? 76  THR B CA  1 
ATOM   1953 C  C   . THR B 1 76  ? -29.409 -7.530  -39.487 1.00 42.10  ? 76  THR B C   1 
ATOM   1954 O  O   . THR B 1 76  ? -28.580 -8.436  -39.418 1.00 40.84  ? 76  THR B O   1 
ATOM   1955 C  CB  . THR B 1 76  ? -29.739 -6.228  -41.585 1.00 42.45  ? 76  THR B CB  1 
ATOM   1956 O  OG1 . THR B 1 76  ? -31.158 -6.284  -41.417 1.00 47.09  ? 76  THR B OG1 1 
ATOM   1957 C  CG2 . THR B 1 76  ? -29.298 -7.423  -42.407 1.00 42.34  ? 76  THR B CG2 1 
ATOM   1958 N  N   . GLU B 1 77  ? -30.619 -7.619  -38.951 1.00 43.60  ? 77  GLU B N   1 
ATOM   1959 C  CA  . GLU B 1 77  ? -31.021 -8.830  -38.255 1.00 46.87  ? 77  GLU B CA  1 
ATOM   1960 C  C   . GLU B 1 77  ? -30.833 -10.066 -39.132 1.00 48.23  ? 77  GLU B C   1 
ATOM   1961 O  O   . GLU B 1 77  ? -30.617 -11.171 -38.629 1.00 47.23  ? 77  GLU B O   1 
ATOM   1962 C  CB  . GLU B 1 77  ? -32.473 -8.725  -37.823 1.00 47.64  ? 77  GLU B CB  1 
ATOM   1963 C  CG  . GLU B 1 77  ? -32.873 -9.801  -36.854 1.00 50.48  ? 77  GLU B CG  1 
ATOM   1964 C  CD  . GLU B 1 77  ? -34.162 -9.467  -36.149 1.00 53.23  ? 77  GLU B CD  1 
ATOM   1965 O  OE1 . GLU B 1 77  ? -34.387 -8.265  -35.872 1.00 55.36  ? 77  GLU B OE1 1 
ATOM   1966 O  OE2 . GLU B 1 77  ? -34.941 -10.399 -35.857 1.00 54.76  ? 77  GLU B OE2 1 
ATOM   1967 N  N   . GLU B 1 78  ? -30.915 -9.868  -40.445 1.00 50.48  ? 78  GLU B N   1 
ATOM   1968 C  CA  . GLU B 1 78  ? -30.746 -10.964 -41.385 1.00 53.84  ? 78  GLU B CA  1 
ATOM   1969 C  C   . GLU B 1 78  ? -29.280 -11.342 -41.570 1.00 53.70  ? 78  GLU B C   1 
ATOM   1970 O  O   . GLU B 1 78  ? -28.930 -12.517 -41.470 1.00 54.55  ? 78  GLU B O   1 
ATOM   1971 C  CB  . GLU B 1 78  ? -31.395 -10.609 -42.727 1.00 56.79  ? 78  GLU B CB  1 
ATOM   1972 C  CG  . GLU B 1 78  ? -32.831 -11.122 -42.860 1.00 61.96  ? 78  GLU B CG  1 
ATOM   1973 C  CD  . GLU B 1 78  ? -33.614 -11.065 -41.542 1.00 66.37  ? 78  GLU B CD  1 
ATOM   1974 O  OE1 . GLU B 1 78  ? -34.523 -10.212 -41.413 1.00 67.82  ? 78  GLU B OE1 1 
ATOM   1975 O  OE2 . GLU B 1 78  ? -33.315 -11.878 -40.631 1.00 68.59  ? 78  GLU B OE2 1 
ATOM   1976 N  N   . THR B 1 79  ? -28.422 -10.360 -41.827 1.00 52.65  ? 79  THR B N   1 
ATOM   1977 C  CA  . THR B 1 79  ? -27.006 -10.655 -41.999 1.00 52.05  ? 79  THR B CA  1 
ATOM   1978 C  C   . THR B 1 79  ? -26.439 -11.366 -40.775 1.00 51.85  ? 79  THR B C   1 
ATOM   1979 O  O   . THR B 1 79  ? -25.622 -12.277 -40.908 1.00 51.85  ? 79  THR B O   1 
ATOM   1980 C  CB  . THR B 1 79  ? -26.192 -9.379  -42.277 1.00 52.29  ? 79  THR B CB  1 
ATOM   1981 O  OG1 . THR B 1 79  ? -26.585 -8.343  -41.366 1.00 51.70  ? 79  THR B OG1 1 
ATOM   1982 C  CG2 . THR B 1 79  ? -26.415 -8.923  -43.713 1.00 51.49  ? 79  THR B CG2 1 
ATOM   1983 N  N   . LEU B 1 80  ? -26.879 -10.965 -39.584 1.00 51.79  ? 80  LEU B N   1 
ATOM   1984 C  CA  . LEU B 1 80  ? -26.414 -11.600 -38.346 1.00 52.12  ? 80  LEU B CA  1 
ATOM   1985 C  C   . LEU B 1 80  ? -26.684 -13.104 -38.369 1.00 53.26  ? 80  LEU B C   1 
ATOM   1986 O  O   . LEU B 1 80  ? -25.806 -13.900 -38.057 1.00 52.77  ? 80  LEU B O   1 
ATOM   1987 C  CB  . LEU B 1 80  ? -27.103 -10.979 -37.127 1.00 50.39  ? 80  LEU B CB  1 
ATOM   1988 C  CG  . LEU B 1 80  ? -26.511 -9.722  -36.474 1.00 50.86  ? 80  LEU B CG  1 
ATOM   1989 C  CD1 . LEU B 1 80  ? -25.409 -9.129  -37.335 1.00 51.48  ? 80  LEU B CD1 1 
ATOM   1990 C  CD2 . LEU B 1 80  ? -27.619 -8.708  -36.233 1.00 49.26  ? 80  LEU B CD2 1 
ATOM   1991 N  N   . LYS B 1 81  ? -27.899 -13.489 -38.748 1.00 55.14  ? 81  LYS B N   1 
ATOM   1992 C  CA  . LYS B 1 81  ? -28.261 -14.901 -38.815 1.00 57.84  ? 81  LYS B CA  1 
ATOM   1993 C  C   . LYS B 1 81  ? -27.590 -15.677 -39.950 1.00 58.57  ? 81  LYS B C   1 
ATOM   1994 O  O   . LYS B 1 81  ? -27.300 -16.858 -39.789 1.00 58.94  ? 81  LYS B O   1 
ATOM   1995 C  CB  . LYS B 1 81  ? -29.784 -15.057 -38.900 1.00 59.39  ? 81  LYS B CB  1 
ATOM   1996 C  CG  . LYS B 1 81  ? -30.476 -14.749 -37.582 1.00 62.14  ? 81  LYS B CG  1 
ATOM   1997 C  CD  . LYS B 1 81  ? -31.972 -15.048 -37.594 1.00 65.03  ? 81  LYS B CD  1 
ATOM   1998 C  CE  . LYS B 1 81  ? -32.802 -13.851 -38.061 1.00 67.73  ? 81  LYS B CE  1 
ATOM   1999 N  NZ  . LYS B 1 81  ? -34.229 -13.959 -37.615 1.00 68.75  ? 81  LYS B NZ  1 
ATOM   2000 N  N   . GLN B 1 82  ? -27.332 -15.025 -41.084 1.00 59.48  ? 82  GLN B N   1 
ATOM   2001 C  CA  . GLN B 1 82  ? -26.687 -15.694 -42.215 1.00 61.00  ? 82  GLN B CA  1 
ATOM   2002 C  C   . GLN B 1 82  ? -25.265 -16.119 -41.853 1.00 61.32  ? 82  GLN B C   1 
ATOM   2003 O  O   . GLN B 1 82  ? -24.750 -17.109 -42.377 1.00 60.30  ? 82  GLN B O   1 
ATOM   2004 C  CB  . GLN B 1 82  ? -26.609 -14.769 -43.438 1.00 63.46  ? 82  GLN B CB  1 
ATOM   2005 C  CG  . GLN B 1 82  ? -25.520 -13.683 -43.317 1.00 67.29  ? 82  GLN B CG  1 
ATOM   2006 C  CD  . GLN B 1 82  ? -25.014 -13.150 -44.661 1.00 68.75  ? 82  GLN B CD  1 
ATOM   2007 O  OE1 . GLN B 1 82  ? -24.881 -11.935 -44.853 1.00 69.10  ? 82  GLN B OE1 1 
ATOM   2008 N  NE2 . GLN B 1 82  ? -24.751 -14.060 -45.602 1.00 68.14  ? 82  GLN B NE2 1 
ATOM   2009 N  N   . GLN B 1 83  ? -24.638 -15.355 -40.959 1.00 62.32  ? 83  GLN B N   1 
ATOM   2010 C  CA  . GLN B 1 83  ? -23.269 -15.617 -40.530 1.00 62.22  ? 83  GLN B CA  1 
ATOM   2011 C  C   . GLN B 1 83  ? -23.144 -16.440 -39.260 1.00 61.10  ? 83  GLN B C   1 
ATOM   2012 O  O   . GLN B 1 83  ? -22.034 -16.738 -38.832 1.00 61.35  ? 83  GLN B O   1 
ATOM   2013 C  CB  . GLN B 1 83  ? -22.521 -14.298 -40.356 1.00 64.42  ? 83  GLN B CB  1 
ATOM   2014 C  CG  . GLN B 1 83  ? -22.110 -13.651 -41.666 1.00 68.68  ? 83  GLN B CG  1 
ATOM   2015 C  CD  . GLN B 1 83  ? -22.267 -12.140 -41.644 1.00 71.57  ? 83  GLN B CD  1 
ATOM   2016 O  OE1 . GLN B 1 83  ? -21.280 -11.400 -41.575 1.00 72.95  ? 83  GLN B OE1 1 
ATOM   2017 N  NE2 . GLN B 1 83  ? -23.510 -11.671 -41.703 1.00 72.39  ? 83  GLN B NE2 1 
ATOM   2018 N  N   . ASN B 1 84  ? -24.275 -16.801 -38.657 1.00 60.50  ? 84  ASN B N   1 
ATOM   2019 C  CA  . ASN B 1 84  ? -24.278 -17.614 -37.441 1.00 60.12  ? 84  ASN B CA  1 
ATOM   2020 C  C   . ASN B 1 84  ? -23.739 -16.885 -36.215 1.00 59.86  ? 84  ASN B C   1 
ATOM   2021 O  O   . ASN B 1 84  ? -23.395 -17.517 -35.220 1.00 60.49  ? 84  ASN B O   1 
ATOM   2022 C  CB  . ASN B 1 84  ? -23.456 -18.885 -37.663 1.00 60.43  ? 84  ASN B CB  1 
ATOM   2023 C  CG  . ASN B 1 84  ? -24.024 -19.760 -38.753 1.00 60.09  ? 84  ASN B CG  1 
ATOM   2024 O  OD1 . ASN B 1 84  ? -25.107 -20.323 -38.602 1.00 60.78  ? 84  ASN B OD1 1 
ATOM   2025 N  ND2 . ASN B 1 84  ? -23.300 -19.875 -39.865 1.00 59.94  ? 84  ASN B ND2 1 
ATOM   2026 N  N   . VAL B 1 85  ? -23.656 -15.563 -36.297 1.00 59.11  ? 85  VAL B N   1 
ATOM   2027 C  CA  . VAL B 1 85  ? -23.166 -14.750 -35.196 1.00 58.14  ? 85  VAL B CA  1 
ATOM   2028 C  C   . VAL B 1 85  ? -23.841 -15.136 -33.878 1.00 59.30  ? 85  VAL B C   1 
ATOM   2029 O  O   . VAL B 1 85  ? -25.026 -15.481 -33.846 1.00 58.11  ? 85  VAL B O   1 
ATOM   2030 C  CB  . VAL B 1 85  ? -23.400 -13.256 -35.484 1.00 56.99  ? 85  VAL B CB  1 
ATOM   2031 C  CG1 . VAL B 1 85  ? -23.054 -12.417 -34.269 1.00 56.00  ? 85  VAL B CG1 1 
ATOM   2032 C  CG2 . VAL B 1 85  ? -22.554 -12.836 -36.665 1.00 55.88  ? 85  VAL B CG2 1 
ATOM   2033 N  N   . ARG B 1 86  ? -23.069 -15.076 -32.796 1.00 59.85  ? 86  ARG B N   1 
ATOM   2034 C  CA  . ARG B 1 86  ? -23.551 -15.431 -31.466 1.00 60.87  ? 86  ARG B CA  1 
ATOM   2035 C  C   . ARG B 1 86  ? -23.787 -14.186 -30.594 1.00 60.56  ? 86  ARG B C   1 
ATOM   2036 O  O   . ARG B 1 86  ? -23.292 -13.100 -30.899 1.00 58.80  ? 86  ARG B O   1 
ATOM   2037 C  CB  . ARG B 1 86  ? -22.535 -16.373 -30.809 1.00 62.01  ? 86  ARG B CB  1 
ATOM   2038 C  CG  . ARG B 1 86  ? -21.895 -17.317 -31.829 1.00 65.74  ? 86  ARG B CG  1 
ATOM   2039 C  CD  . ARG B 1 86  ? -21.136 -18.477 -31.205 1.00 68.38  ? 86  ARG B CD  1 
ATOM   2040 N  NE  . ARG B 1 86  ? -19.678 -18.325 -31.264 1.00 71.87  ? 86  ARG B NE  1 
ATOM   2041 C  CZ  . ARG B 1 86  ? -18.837 -19.296 -31.622 1.00 72.46  ? 86  ARG B CZ  1 
ATOM   2042 N  NH1 . ARG B 1 86  ? -17.528 -19.077 -31.642 1.00 71.56  ? 86  ARG B NH1 1 
ATOM   2043 N  NH2 . ARG B 1 86  ? -19.303 -20.484 -31.984 1.00 73.46  ? 86  ARG B NH2 1 
ATOM   2044 N  N   . GLY B 1 87  ? -24.560 -14.352 -29.524 1.00 60.26  ? 87  GLY B N   1 
ATOM   2045 C  CA  . GLY B 1 87  ? -24.852 -13.244 -28.633 1.00 61.14  ? 87  GLY B CA  1 
ATOM   2046 C  C   . GLY B 1 87  ? -26.047 -12.421 -29.082 1.00 62.51  ? 87  GLY B C   1 
ATOM   2047 O  O   . GLY B 1 87  ? -26.214 -11.269 -28.674 1.00 62.68  ? 87  GLY B O   1 
HETATM 2048 N  N   . MSE B 1 88  ? -26.890 -13.018 -29.916 1.00 63.62  ? 88  MSE B N   1 
HETATM 2049 C  CA  . MSE B 1 88  ? -28.069 -12.344 -30.445 1.00 65.02  ? 88  MSE B CA  1 
HETATM 2050 C  C   . MSE B 1 88  ? -29.120 -11.986 -29.404 1.00 63.89  ? 88  MSE B C   1 
HETATM 2051 O  O   . MSE B 1 88  ? -29.933 -11.089 -29.632 1.00 63.80  ? 88  MSE B O   1 
HETATM 2052 C  CB  . MSE B 1 88  ? -28.722 -13.212 -31.509 1.00 69.10  ? 88  MSE B CB  1 
HETATM 2053 C  CG  . MSE B 1 88  ? -27.805 -13.621 -32.631 1.00 73.12  ? 88  MSE B CG  1 
HETATM 2054 SE SE  . MSE B 1 88  ? -28.208 -12.672 -34.230 1.00 80.50  ? 88  MSE B SE  1 
HETATM 2055 C  CE  . MSE B 1 88  ? -30.148 -12.617 -34.099 1.00 76.19  ? 88  MSE B CE  1 
ATOM   2056 N  N   . LYS B 1 89  ? -29.129 -12.691 -28.277 1.00 62.70  ? 89  LYS B N   1 
ATOM   2057 C  CA  . LYS B 1 89  ? -30.106 -12.390 -27.236 1.00 61.23  ? 89  LYS B CA  1 
ATOM   2058 C  C   . LYS B 1 89  ? -29.967 -10.906 -26.940 1.00 58.21  ? 89  LYS B C   1 
ATOM   2059 O  O   . LYS B 1 89  ? -30.896 -10.259 -26.468 1.00 57.81  ? 89  LYS B O   1 
ATOM   2060 C  CB  . LYS B 1 89  ? -29.831 -13.200 -25.965 1.00 62.89  ? 89  LYS B CB  1 
ATOM   2061 C  CG  . LYS B 1 89  ? -28.997 -14.455 -26.187 1.00 66.31  ? 89  LYS B CG  1 
ATOM   2062 C  CD  . LYS B 1 89  ? -27.495 -14.137 -26.205 1.00 68.66  ? 89  LYS B CD  1 
ATOM   2063 C  CE  . LYS B 1 89  ? -27.013 -13.606 -24.842 1.00 68.45  ? 89  LYS B CE  1 
ATOM   2064 N  NZ  . LYS B 1 89  ? -25.558 -13.290 -24.829 1.00 67.85  ? 89  LYS B NZ  1 
ATOM   2065 N  N   . LYS B 1 90  ? -28.787 -10.377 -27.239 1.00 55.60  ? 90  LYS B N   1 
ATOM   2066 C  CA  . LYS B 1 90  ? -28.497 -8.971  -27.033 1.00 55.20  ? 90  LYS B CA  1 
ATOM   2067 C  C   . LYS B 1 90  ? -29.235 -8.078  -28.035 1.00 55.86  ? 90  LYS B C   1 
ATOM   2068 O  O   . LYS B 1 90  ? -29.334 -6.866  -27.838 1.00 56.16  ? 90  LYS B O   1 
ATOM   2069 C  CB  . LYS B 1 90  ? -26.991 -8.731  -27.147 1.00 54.01  ? 90  LYS B CB  1 
ATOM   2070 C  CG  . LYS B 1 90  ? -26.170 -9.394  -26.053 1.00 52.79  ? 90  LYS B CG  1 
ATOM   2071 C  CD  . LYS B 1 90  ? -24.817 -8.719  -25.915 1.00 52.08  ? 90  LYS B CD  1 
ATOM   2072 C  CE  . LYS B 1 90  ? -23.704 -9.573  -26.474 1.00 51.00  ? 90  LYS B CE  1 
ATOM   2073 N  NZ  . LYS B 1 90  ? -23.457 -10.778 -25.641 1.00 49.79  ? 90  LYS B NZ  1 
ATOM   2074 N  N   . LEU B 1 91  ? -29.750 -8.675  -29.106 1.00 55.58  ? 91  LEU B N   1 
ATOM   2075 C  CA  . LEU B 1 91  ? -30.470 -7.926  -30.129 1.00 53.90  ? 91  LEU B CA  1 
ATOM   2076 C  C   . LEU B 1 91  ? -31.878 -7.601  -29.639 1.00 54.15  ? 91  LEU B C   1 
ATOM   2077 O  O   . LEU B 1 91  ? -32.403 -6.518  -29.884 1.00 52.69  ? 91  LEU B O   1 
ATOM   2078 C  CB  . LEU B 1 91  ? -30.548 -8.751  -31.412 1.00 54.82  ? 91  LEU B CB  1 
ATOM   2079 C  CG  . LEU B 1 91  ? -30.666 -8.012  -32.749 1.00 54.39  ? 91  LEU B CG  1 
ATOM   2080 C  CD1 . LEU B 1 91  ? -30.905 -9.010  -33.875 1.00 54.61  ? 91  LEU B CD1 1 
ATOM   2081 C  CD2 . LEU B 1 91  ? -31.798 -7.028  -32.692 1.00 54.80  ? 91  LEU B CD2 1 
ATOM   2082 N  N   . ASP B 1 92  ? -32.484 -8.547  -28.934 1.00 55.23  ? 92  ASP B N   1 
ATOM   2083 C  CA  . ASP B 1 92  ? -33.835 -8.376  -28.407 1.00 56.34  ? 92  ASP B CA  1 
ATOM   2084 C  C   . ASP B 1 92  ? -33.919 -7.195  -27.430 1.00 55.55  ? 92  ASP B C   1 
ATOM   2085 O  O   . ASP B 1 92  ? -34.847 -6.381  -27.489 1.00 56.03  ? 92  ASP B O   1 
ATOM   2086 C  CB  . ASP B 1 92  ? -34.281 -9.655  -27.681 1.00 59.74  ? 92  ASP B CB  1 
ATOM   2087 C  CG  . ASP B 1 92  ? -34.216 -10.898 -28.562 1.00 62.89  ? 92  ASP B CG  1 
ATOM   2088 O  OD1 . ASP B 1 92  ? -33.212 -11.074 -29.293 1.00 63.81  ? 92  ASP B OD1 1 
ATOM   2089 O  OD2 . ASP B 1 92  ? -35.168 -11.712 -28.504 1.00 65.29  ? 92  ASP B OD2 1 
ATOM   2090 N  N   . ASN B 1 93  ? -32.948 -7.115  -26.526 1.00 54.03  ? 93  ASN B N   1 
ATOM   2091 C  CA  . ASN B 1 93  ? -32.909 -6.068  -25.512 1.00 52.10  ? 93  ASN B CA  1 
ATOM   2092 C  C   . ASN B 1 93  ? -32.691 -4.698  -26.130 1.00 51.31  ? 93  ASN B C   1 
ATOM   2093 O  O   . ASN B 1 93  ? -33.328 -3.713  -25.737 1.00 51.21  ? 93  ASN B O   1 
ATOM   2094 C  CB  . ASN B 1 93  ? -31.781 -6.338  -24.519 1.00 54.38  ? 93  ASN B CB  1 
ATOM   2095 C  CG  . ASN B 1 93  ? -31.681 -7.804  -24.116 1.00 56.25  ? 93  ASN B CG  1 
ATOM   2096 O  OD1 . ASN B 1 93  ? -32.408 -8.650  -24.645 1.00 55.95  ? 93  ASN B OD1 1 
ATOM   2097 N  ND2 . ASN B 1 93  ? -30.783 -8.114  -23.176 1.00 56.02  ? 93  ASN B ND2 1 
ATOM   2098 N  N   . TYR B 1 94  ? -31.771 -4.631  -27.086 1.00 48.56  ? 94  TYR B N   1 
ATOM   2099 C  CA  . TYR B 1 94  ? -31.479 -3.372  -27.755 1.00 47.13  ? 94  TYR B CA  1 
ATOM   2100 C  C   . TYR B 1 94  ? -32.733 -2.786  -28.409 1.00 46.37  ? 94  TYR B C   1 
ATOM   2101 O  O   . TYR B 1 94  ? -33.084 -1.627  -28.176 1.00 44.97  ? 94  TYR B O   1 
ATOM   2102 C  CB  . TYR B 1 94  ? -30.412 -3.577  -28.819 1.00 46.00  ? 94  TYR B CB  1 
ATOM   2103 C  CG  . TYR B 1 94  ? -29.939 -2.286  -29.425 1.00 45.23  ? 94  TYR B CG  1 
ATOM   2104 C  CD1 . TYR B 1 94  ? -29.064 -1.449  -28.731 1.00 44.72  ? 94  TYR B CD1 1 
ATOM   2105 C  CD2 . TYR B 1 94  ? -30.390 -1.880  -30.681 1.00 43.34  ? 94  TYR B CD2 1 
ATOM   2106 C  CE1 . TYR B 1 94  ? -28.651 -0.240  -29.272 1.00 44.96  ? 94  TYR B CE1 1 
ATOM   2107 C  CE2 . TYR B 1 94  ? -29.985 -0.679  -31.231 1.00 44.54  ? 94  TYR B CE2 1 
ATOM   2108 C  CZ  . TYR B 1 94  ? -29.119 0.139   -30.526 1.00 45.86  ? 94  TYR B CZ  1 
ATOM   2109 O  OH  . TYR B 1 94  ? -28.740 1.342   -31.078 1.00 47.80  ? 94  TYR B OH  1 
ATOM   2110 N  N   . LYS B 1 95  ? -33.395 -3.595  -29.234 1.00 46.01  ? 95  LYS B N   1 
ATOM   2111 C  CA  . LYS B 1 95  ? -34.614 -3.172  -29.918 1.00 46.83  ? 95  LYS B CA  1 
ATOM   2112 C  C   . LYS B 1 95  ? -35.605 -2.676  -28.881 1.00 46.42  ? 95  LYS B C   1 
ATOM   2113 O  O   . LYS B 1 95  ? -36.056 -1.532  -28.928 1.00 46.15  ? 95  LYS B O   1 
ATOM   2114 C  CB  . LYS B 1 95  ? -35.227 -4.341  -30.700 1.00 45.50  ? 95  LYS B CB  1 
ATOM   2115 C  CG  . LYS B 1 95  ? -34.382 -4.797  -31.874 1.00 46.40  ? 95  LYS B CG  1 
ATOM   2116 C  CD  . LYS B 1 95  ? -34.720 -6.215  -32.318 1.00 46.73  ? 95  LYS B CD  1 
ATOM   2117 C  CE  . LYS B 1 95  ? -36.008 -6.309  -33.104 1.00 47.30  ? 95  LYS B CE  1 
ATOM   2118 N  NZ  . LYS B 1 95  ? -36.152 -7.682  -33.687 1.00 48.01  ? 95  LYS B NZ  1 
ATOM   2119 N  N   . LYS B 1 96  ? -35.937 -3.551  -27.943 1.00 47.19  ? 96  LYS B N   1 
ATOM   2120 C  CA  . LYS B 1 96  ? -36.861 -3.203  -26.884 1.00 48.39  ? 96  LYS B CA  1 
ATOM   2121 C  C   . LYS B 1 96  ? -36.540 -1.799  -26.365 1.00 49.81  ? 96  LYS B C   1 
ATOM   2122 O  O   . LYS B 1 96  ? -37.376 -0.897  -26.412 1.00 48.59  ? 96  LYS B O   1 
ATOM   2123 C  CB  . LYS B 1 96  ? -36.730 -4.202  -25.745 1.00 48.76  ? 96  LYS B CB  1 
ATOM   2124 C  CG  . LYS B 1 96  ? -37.655 -3.889  -24.584 1.00 52.11  ? 96  LYS B CG  1 
ATOM   2125 C  CD  . LYS B 1 96  ? -37.171 -4.495  -23.277 1.00 50.16  ? 96  LYS B CD  1 
ATOM   2126 C  CE  . LYS B 1 96  ? -38.168 -4.213  -22.177 1.00 50.57  ? 96  LYS B CE  1 
ATOM   2127 N  NZ  . LYS B 1 96  ? -37.707 -4.778  -20.889 1.00 51.57  ? 96  LYS B NZ  1 
ATOM   2128 N  N   . LYS B 1 97  ? -35.311 -1.629  -25.886 1.00 51.37  ? 97  LYS B N   1 
ATOM   2129 C  CA  . LYS B 1 97  ? -34.835 -0.363  -25.339 1.00 52.43  ? 97  LYS B CA  1 
ATOM   2130 C  C   . LYS B 1 97  ? -35.035 0.796   -26.306 1.00 53.59  ? 97  LYS B C   1 
ATOM   2131 O  O   . LYS B 1 97  ? -35.535 1.857   -25.934 1.00 53.72  ? 97  LYS B O   1 
ATOM   2132 C  CB  . LYS B 1 97  ? -33.348 -0.481  -25.002 1.00 52.79  ? 97  LYS B CB  1 
ATOM   2133 C  CG  . LYS B 1 97  ? -32.917 0.321   -23.798 1.00 52.86  ? 97  LYS B CG  1 
ATOM   2134 C  CD  . LYS B 1 97  ? -33.552 -0.228  -22.532 1.00 52.63  ? 97  LYS B CD  1 
ATOM   2135 C  CE  . LYS B 1 97  ? -33.101 0.554   -21.309 1.00 52.80  ? 97  LYS B CE  1 
ATOM   2136 N  NZ  . LYS B 1 97  ? -31.623 0.653   -21.260 1.00 52.24  ? 97  LYS B NZ  1 
ATOM   2137 N  N   . ASP B 1 98  ? -34.642 0.581   -27.555 1.00 54.42  ? 98  ASP B N   1 
ATOM   2138 C  CA  . ASP B 1 98  ? -34.752 1.607   -28.582 1.00 56.00  ? 98  ASP B CA  1 
ATOM   2139 C  C   . ASP B 1 98  ? -36.194 2.023   -28.877 1.00 57.63  ? 98  ASP B C   1 
ATOM   2140 O  O   . ASP B 1 98  ? -36.498 3.215   -28.991 1.00 57.95  ? 98  ASP B O   1 
ATOM   2141 C  CB  . ASP B 1 98  ? -34.072 1.124   -29.864 1.00 55.80  ? 98  ASP B CB  1 
ATOM   2142 C  CG  . ASP B 1 98  ? -34.095 2.162   -30.963 1.00 56.25  ? 98  ASP B CG  1 
ATOM   2143 O  OD1 . ASP B 1 98  ? -33.576 3.283   -30.756 1.00 56.38  ? 98  ASP B OD1 1 
ATOM   2144 O  OD2 . ASP B 1 98  ? -34.637 1.847   -32.040 1.00 56.76  ? 98  ASP B OD2 1 
ATOM   2145 N  N   . GLN B 1 99  ? -37.086 1.048   -29.014 1.00 58.70  ? 99  GLN B N   1 
ATOM   2146 C  CA  . GLN B 1 99  ? -38.487 1.364   -29.280 1.00 59.78  ? 99  GLN B CA  1 
ATOM   2147 C  C   . GLN B 1 99  ? -38.996 2.197   -28.106 1.00 59.68  ? 99  GLN B C   1 
ATOM   2148 O  O   . GLN B 1 99  ? -39.733 3.171   -28.275 1.00 59.20  ? 99  GLN B O   1 
ATOM   2149 C  CB  . GLN B 1 99  ? -39.309 0.075   -29.410 1.00 59.80  ? 99  GLN B CB  1 
ATOM   2150 C  CG  . GLN B 1 99  ? -39.001 -0.752  -30.656 1.00 60.92  ? 99  GLN B CG  1 
ATOM   2151 C  CD  . GLN B 1 99  ? -39.378 -2.227  -30.493 1.00 63.35  ? 99  GLN B CD  1 
ATOM   2152 O  OE1 . GLN B 1 99  ? -40.275 -2.566  -29.715 1.00 64.25  ? 99  GLN B OE1 1 
ATOM   2153 N  NE2 . GLN B 1 99  ? -38.700 -3.107  -31.236 1.00 60.93  ? 99  GLN B NE2 1 
ATOM   2154 N  N   . GLU B 1 100 ? -38.570 1.807   -26.911 1.00 60.46  ? 100 GLU B N   1 
ATOM   2155 C  CA  . GLU B 1 100 ? -38.963 2.490   -25.693 1.00 60.84  ? 100 GLU B CA  1 
ATOM   2156 C  C   . GLU B 1 100 ? -38.540 3.957   -25.717 1.00 60.40  ? 100 GLU B C   1 
ATOM   2157 O  O   . GLU B 1 100 ? -39.331 4.825   -25.360 1.00 60.47  ? 100 GLU B O   1 
ATOM   2158 C  CB  . GLU B 1 100 ? -38.343 1.792   -24.477 1.00 62.92  ? 100 GLU B CB  1 
ATOM   2159 C  CG  . GLU B 1 100 ? -39.328 1.226   -23.424 1.00 66.64  ? 100 GLU B CG  1 
ATOM   2160 C  CD  . GLU B 1 100 ? -40.080 -0.031  -23.875 1.00 68.74  ? 100 GLU B CD  1 
ATOM   2161 O  OE1 . GLU B 1 100 ? -39.516 -0.833  -24.647 1.00 70.25  ? 100 GLU B OE1 1 
ATOM   2162 O  OE2 . GLU B 1 100 ? -41.235 -0.234  -23.437 1.00 69.66  ? 100 GLU B OE2 1 
ATOM   2163 N  N   . THR B 1 101 ? -37.312 4.251   -26.143 1.00 60.05  ? 101 THR B N   1 
ATOM   2164 C  CA  . THR B 1 101 ? -36.872 5.647   -26.149 1.00 60.39  ? 101 THR B CA  1 
ATOM   2165 C  C   . THR B 1 101 ? -37.453 6.467   -27.294 1.00 60.47  ? 101 THR B C   1 
ATOM   2166 O  O   . THR B 1 101 ? -37.709 7.660   -27.133 1.00 61.12  ? 101 THR B O   1 
ATOM   2167 C  CB  . THR B 1 101 ? -35.325 5.797   -26.164 1.00 60.60  ? 101 THR B CB  1 
ATOM   2168 O  OG1 . THR B 1 101 ? -34.878 6.052   -27.499 1.00 61.29  ? 101 THR B OG1 1 
ATOM   2169 C  CG2 . THR B 1 101 ? -34.650 4.545   -25.618 1.00 60.08  ? 101 THR B CG2 1 
ATOM   2170 N  N   . LYS B 1 102 ? -37.659 5.848   -28.451 1.00 60.84  ? 102 LYS B N   1 
ATOM   2171 C  CA  . LYS B 1 102 ? -38.249 6.582   -29.567 1.00 60.21  ? 102 LYS B CA  1 
ATOM   2172 C  C   . LYS B 1 102 ? -39.663 6.880   -29.119 1.00 59.79  ? 102 LYS B C   1 
ATOM   2173 O  O   . LYS B 1 102 ? -40.273 7.870   -29.519 1.00 59.60  ? 102 LYS B O   1 
ATOM   2174 C  CB  . LYS B 1 102 ? -38.250 5.737   -30.846 1.00 60.88  ? 102 LYS B CB  1 
ATOM   2175 C  CG  . LYS B 1 102 ? -36.861 5.597   -31.466 1.00 62.21  ? 102 LYS B CG  1 
ATOM   2176 C  CD  . LYS B 1 102 ? -36.234 6.974   -31.723 1.00 61.43  ? 102 LYS B CD  1 
ATOM   2177 C  CE  . LYS B 1 102 ? -34.763 6.871   -32.052 1.00 60.13  ? 102 LYS B CE  1 
ATOM   2178 N  NZ  . LYS B 1 102 ? -34.532 6.031   -33.250 1.00 61.01  ? 102 LYS B NZ  1 
ATOM   2179 N  N   . ARG B 1 103 ? -40.168 6.000   -28.264 1.00 59.68  ? 103 ARG B N   1 
ATOM   2180 C  CA  . ARG B 1 103 ? -41.496 6.149   -27.700 1.00 58.62  ? 103 ARG B CA  1 
ATOM   2181 C  C   . ARG B 1 103 ? -41.353 7.417   -26.860 1.00 56.53  ? 103 ARG B C   1 
ATOM   2182 O  O   . ARG B 1 103 ? -41.790 8.478   -27.274 1.00 56.46  ? 103 ARG B O   1 
ATOM   2183 C  CB  . ARG B 1 103 ? -41.828 4.929   -26.831 1.00 59.58  ? 103 ARG B CB  1 
ATOM   2184 C  CG  . ARG B 1 103 ? -43.281 4.495   -26.864 1.00 61.51  ? 103 ARG B CG  1 
ATOM   2185 C  CD  . ARG B 1 103 ? -43.462 3.093   -26.268 1.00 63.00  ? 103 ARG B CD  1 
ATOM   2186 N  NE  . ARG B 1 103 ? -43.215 2.020   -27.232 1.00 64.36  ? 103 ARG B NE  1 
ATOM   2187 C  CZ  . ARG B 1 103 ? -43.288 0.722   -26.942 1.00 64.70  ? 103 ARG B CZ  1 
ATOM   2188 N  NH1 . ARG B 1 103 ? -43.593 0.331   -25.713 1.00 65.02  ? 103 ARG B NH1 1 
ATOM   2189 N  NH2 . ARG B 1 103 ? -43.074 -0.185  -27.885 1.00 64.65  ? 103 ARG B NH2 1 
ATOM   2190 N  N   . TRP B 1 104 ? -40.690 7.307   -25.712 1.00 53.63  ? 104 TRP B N   1 
ATOM   2191 C  CA  . TRP B 1 104 ? -40.462 8.447   -24.820 1.00 50.97  ? 104 TRP B CA  1 
ATOM   2192 C  C   . TRP B 1 104 ? -40.227 9.766   -25.562 1.00 50.78  ? 104 TRP B C   1 
ATOM   2193 O  O   . TRP B 1 104 ? -40.730 10.814  -25.162 1.00 51.76  ? 104 TRP B O   1 
ATOM   2194 C  CB  . TRP B 1 104 ? -39.253 8.168   -23.917 1.00 46.13  ? 104 TRP B CB  1 
ATOM   2195 C  CG  . TRP B 1 104 ? -38.842 9.341   -23.055 1.00 41.07  ? 104 TRP B CG  1 
ATOM   2196 C  CD1 . TRP B 1 104 ? -39.475 9.806   -21.939 1.00 38.80  ? 104 TRP B CD1 1 
ATOM   2197 C  CD2 . TRP B 1 104 ? -37.711 10.191  -23.256 1.00 38.55  ? 104 TRP B CD2 1 
ATOM   2198 N  NE1 . TRP B 1 104 ? -38.808 10.890  -21.431 1.00 37.10  ? 104 TRP B NE1 1 
ATOM   2199 C  CE2 . TRP B 1 104 ? -37.719 11.149  -22.221 1.00 37.94  ? 104 TRP B CE2 1 
ATOM   2200 C  CE3 . TRP B 1 104 ? -36.687 10.239  -24.215 1.00 38.49  ? 104 TRP B CE3 1 
ATOM   2201 C  CZ2 . TRP B 1 104 ? -36.741 12.147  -22.114 1.00 37.12  ? 104 TRP B CZ2 1 
ATOM   2202 C  CZ3 . TRP B 1 104 ? -35.709 11.236  -24.111 1.00 37.02  ? 104 TRP B CZ3 1 
ATOM   2203 C  CH2 . TRP B 1 104 ? -35.748 12.175  -23.065 1.00 36.92  ? 104 TRP B CH2 1 
ATOM   2204 N  N   . LEU B 1 105 ? -39.464 9.704   -26.642 1.00 51.53  ? 105 LEU B N   1 
ATOM   2205 C  CA  . LEU B 1 105 ? -39.131 10.886  -27.429 1.00 53.78  ? 105 LEU B CA  1 
ATOM   2206 C  C   . LEU B 1 105 ? -40.366 11.585  -28.029 1.00 56.53  ? 105 LEU B C   1 
ATOM   2207 O  O   . LEU B 1 105 ? -40.287 12.734  -28.489 1.00 57.24  ? 105 LEU B O   1 
ATOM   2208 C  CB  . LEU B 1 105 ? -38.157 10.477  -28.542 1.00 52.20  ? 105 LEU B CB  1 
ATOM   2209 C  CG  . LEU B 1 105 ? -37.006 11.422  -28.908 1.00 51.31  ? 105 LEU B CG  1 
ATOM   2210 C  CD1 . LEU B 1 105 ? -36.133 11.709  -27.692 1.00 48.52  ? 105 LEU B CD1 1 
ATOM   2211 C  CD2 . LEU B 1 105 ? -36.182 10.779  -30.015 1.00 49.12  ? 105 LEU B CD2 1 
ATOM   2212 N  N   . LYS B 1 106 ? -41.505 10.896  -28.000 1.00 57.75  ? 106 LYS B N   1 
ATOM   2213 C  CA  . LYS B 1 106 ? -42.750 11.417  -28.561 1.00 57.51  ? 106 LYS B CA  1 
ATOM   2214 C  C   . LYS B 1 106 ? -43.350 12.565  -27.767 1.00 56.88  ? 106 LYS B C   1 
ATOM   2215 O  O   . LYS B 1 106 ? -43.799 13.554  -28.345 1.00 56.62  ? 106 LYS B O   1 
ATOM   2216 C  CB  . LYS B 1 106 ? -43.792 10.290  -28.695 1.00 59.29  ? 106 LYS B CB  1 
ATOM   2217 C  CG  . LYS B 1 106 ? -44.646 9.974   -27.436 1.00 61.13  ? 106 LYS B CG  1 
ATOM   2218 C  CD  . LYS B 1 106 ? -43.834 9.397   -26.262 1.00 61.38  ? 106 LYS B CD  1 
ATOM   2219 C  CE  . LYS B 1 106 ? -44.711 8.872   -25.115 1.00 60.43  ? 106 LYS B CE  1 
ATOM   2220 N  NZ  . LYS B 1 106 ? -45.494 7.647   -25.462 1.00 59.87  ? 106 LYS B NZ  1 
ATOM   2221 N  N   . ASN B 1 107 ? -43.353 12.428  -26.444 1.00 56.17  ? 107 ASN B N   1 
ATOM   2222 C  CA  . ASN B 1 107 ? -43.923 13.444  -25.569 1.00 54.38  ? 107 ASN B CA  1 
ATOM   2223 C  C   . ASN B 1 107 ? -42.909 14.083  -24.635 1.00 52.84  ? 107 ASN B C   1 
ATOM   2224 O  O   . ASN B 1 107 ? -43.290 14.743  -23.676 1.00 52.75  ? 107 ASN B O   1 
ATOM   2225 C  CB  . ASN B 1 107 ? -45.056 12.839  -24.735 1.00 55.25  ? 107 ASN B CB  1 
ATOM   2226 C  CG  . ASN B 1 107 ? -46.223 12.384  -25.581 1.00 55.39  ? 107 ASN B CG  1 
ATOM   2227 O  OD1 . ASN B 1 107 ? -47.065 11.619  -25.119 1.00 56.52  ? 107 ASN B OD1 1 
ATOM   2228 N  ND2 . ASN B 1 107 ? -46.278 12.847  -26.828 1.00 55.14  ? 107 ASN B ND2 1 
ATOM   2229 N  N   . ALA B 1 108 ? -41.623 13.898  -24.912 1.00 51.99  ? 108 ALA B N   1 
ATOM   2230 C  CA  . ALA B 1 108 ? -40.574 14.470  -24.069 1.00 52.14  ? 108 ALA B CA  1 
ATOM   2231 C  C   . ALA B 1 108 ? -40.604 16.000  -24.030 1.00 52.52  ? 108 ALA B C   1 
ATOM   2232 O  O   . ALA B 1 108 ? -40.824 16.647  -25.052 1.00 51.69  ? 108 ALA B O   1 
ATOM   2233 C  CB  . ALA B 1 108 ? -39.207 13.968  -24.528 1.00 51.38  ? 108 ALA B CB  1 
ATOM   2234 N  N   . SER B 1 109 ? -40.374 16.571  -22.847 1.00 53.38  ? 109 SER B N   1 
ATOM   2235 C  CA  . SER B 1 109 ? -40.349 18.030  -22.683 1.00 55.39  ? 109 SER B CA  1 
ATOM   2236 C  C   . SER B 1 109 ? -39.397 18.610  -23.722 1.00 55.62  ? 109 SER B C   1 
ATOM   2237 O  O   . SER B 1 109 ? -38.517 17.917  -24.223 1.00 55.93  ? 109 SER B O   1 
ATOM   2238 C  CB  . SER B 1 109 ? -39.804 18.418  -21.304 1.00 55.30  ? 109 SER B CB  1 
ATOM   2239 O  OG  . SER B 1 109 ? -40.461 17.731  -20.259 1.00 60.16  ? 109 SER B OG  1 
ATOM   2240 N  N   . PRO B 1 110 ? -39.558 19.897  -24.062 1.00 56.85  ? 110 PRO B N   1 
ATOM   2241 C  CA  . PRO B 1 110 ? -38.644 20.477  -25.055 1.00 55.67  ? 110 PRO B CA  1 
ATOM   2242 C  C   . PRO B 1 110 ? -37.262 20.513  -24.406 1.00 54.60  ? 110 PRO B C   1 
ATOM   2243 O  O   . PRO B 1 110 ? -36.223 20.375  -25.066 1.00 53.47  ? 110 PRO B O   1 
ATOM   2244 C  CB  . PRO B 1 110 ? -39.221 21.878  -25.278 1.00 55.15  ? 110 PRO B CB  1 
ATOM   2245 C  CG  . PRO B 1 110 ? -40.689 21.705  -24.956 1.00 56.04  ? 110 PRO B CG  1 
ATOM   2246 C  CD  . PRO B 1 110 ? -40.637 20.840  -23.718 1.00 56.50  ? 110 PRO B CD  1 
ATOM   2247 N  N   . GLU B 1 111 ? -37.289 20.687  -23.089 1.00 53.70  ? 111 GLU B N   1 
ATOM   2248 C  CA  . GLU B 1 111 ? -36.098 20.749  -22.267 1.00 52.90  ? 111 GLU B CA  1 
ATOM   2249 C  C   . GLU B 1 111 ? -35.427 19.372  -22.299 1.00 51.88  ? 111 GLU B C   1 
ATOM   2250 O  O   . GLU B 1 111 ? -34.263 19.244  -22.677 1.00 51.97  ? 111 GLU B O   1 
ATOM   2251 C  CB  . GLU B 1 111 ? -36.505 21.123  -20.839 1.00 55.29  ? 111 GLU B CB  1 
ATOM   2252 C  CG  . GLU B 1 111 ? -35.395 21.709  -19.979 1.00 60.06  ? 111 GLU B CG  1 
ATOM   2253 C  CD  . GLU B 1 111 ? -35.861 22.041  -18.560 1.00 62.49  ? 111 GLU B CD  1 
ATOM   2254 O  OE1 . GLU B 1 111 ? -36.941 22.661  -18.417 1.00 62.88  ? 111 GLU B OE1 1 
ATOM   2255 O  OE2 . GLU B 1 111 ? -35.143 21.690  -17.590 1.00 63.42  ? 111 GLU B OE2 1 
ATOM   2256 N  N   . ASP B 1 112 ? -36.181 18.342  -21.923 1.00 49.58  ? 112 ASP B N   1 
ATOM   2257 C  CA  . ASP B 1 112 ? -35.671 16.978  -21.905 1.00 48.11  ? 112 ASP B CA  1 
ATOM   2258 C  C   . ASP B 1 112 ? -35.071 16.548  -23.230 1.00 46.71  ? 112 ASP B C   1 
ATOM   2259 O  O   . ASP B 1 112 ? -34.029 15.896  -23.260 1.00 45.66  ? 112 ASP B O   1 
ATOM   2260 C  CB  . ASP B 1 112 ? -36.779 15.995  -21.521 1.00 47.73  ? 112 ASP B CB  1 
ATOM   2261 C  CG  . ASP B 1 112 ? -37.129 16.068  -20.060 1.00 47.55  ? 112 ASP B CG  1 
ATOM   2262 O  OD1 . ASP B 1 112 ? -36.193 16.224  -19.254 1.00 48.91  ? 112 ASP B OD1 1 
ATOM   2263 O  OD2 . ASP B 1 112 ? -38.325 15.962  -19.715 1.00 47.93  ? 112 ASP B OD2 1 
ATOM   2264 N  N   . VAL B 1 113 ? -35.739 16.904  -24.323 1.00 46.38  ? 113 VAL B N   1 
ATOM   2265 C  CA  . VAL B 1 113 ? -35.269 16.533  -25.647 1.00 44.19  ? 113 VAL B CA  1 
ATOM   2266 C  C   . VAL B 1 113 ? -33.932 17.195  -25.906 1.00 44.16  ? 113 VAL B C   1 
ATOM   2267 O  O   . VAL B 1 113 ? -33.017 16.567  -26.434 1.00 44.50  ? 113 VAL B O   1 
ATOM   2268 C  CB  . VAL B 1 113 ? -36.281 16.947  -26.744 1.00 43.05  ? 113 VAL B CB  1 
ATOM   2269 C  CG1 . VAL B 1 113 ? -35.716 16.641  -28.122 1.00 42.21  ? 113 VAL B CG1 1 
ATOM   2270 C  CG2 . VAL B 1 113 ? -37.588 16.201  -26.550 1.00 41.18  ? 113 VAL B CG2 1 
ATOM   2271 N  N   . GLU B 1 114 ? -33.810 18.460  -25.517 1.00 45.52  ? 114 GLU B N   1 
ATOM   2272 C  CA  . GLU B 1 114 ? -32.561 19.192  -25.723 1.00 46.89  ? 114 GLU B CA  1 
ATOM   2273 C  C   . GLU B 1 114 ? -31.399 18.546  -24.963 1.00 47.06  ? 114 GLU B C   1 
ATOM   2274 O  O   . GLU B 1 114 ? -30.297 18.388  -25.507 1.00 45.48  ? 114 GLU B O   1 
ATOM   2275 C  CB  . GLU B 1 114 ? -32.711 20.646  -25.282 1.00 48.80  ? 114 GLU B CB  1 
ATOM   2276 C  CG  . GLU B 1 114 ? -31.611 21.531  -25.830 1.00 54.02  ? 114 GLU B CG  1 
ATOM   2277 C  CD  . GLU B 1 114 ? -31.430 21.351  -27.342 1.00 58.61  ? 114 GLU B CD  1 
ATOM   2278 O  OE1 . GLU B 1 114 ? -32.356 21.699  -28.113 1.00 58.45  ? 114 GLU B OE1 1 
ATOM   2279 O  OE2 . GLU B 1 114 ? -30.358 20.854  -27.761 1.00 61.38  ? 114 GLU B OE2 1 
ATOM   2280 N  N   . TYR B 1 115 ? -31.652 18.193  -23.700 1.00 45.70  ? 115 TYR B N   1 
ATOM   2281 C  CA  . TYR B 1 115 ? -30.662 17.536  -22.855 1.00 44.66  ? 115 TYR B CA  1 
ATOM   2282 C  C   . TYR B 1 115 ? -30.292 16.217  -23.540 1.00 43.13  ? 115 TYR B C   1 
ATOM   2283 O  O   . TYR B 1 115 ? -29.125 15.819  -23.581 1.00 42.63  ? 115 TYR B O   1 
ATOM   2284 C  CB  . TYR B 1 115 ? -31.269 17.253  -21.476 1.00 48.25  ? 115 TYR B CB  1 
ATOM   2285 C  CG  . TYR B 1 115 ? -30.298 16.686  -20.464 1.00 51.31  ? 115 TYR B CG  1 
ATOM   2286 C  CD1 . TYR B 1 115 ? -29.510 17.526  -19.675 1.00 51.94  ? 115 TYR B CD1 1 
ATOM   2287 C  CD2 . TYR B 1 115 ? -30.136 15.310  -20.322 1.00 52.89  ? 115 TYR B CD2 1 
ATOM   2288 C  CE1 . TYR B 1 115 ? -28.581 17.006  -18.771 1.00 52.45  ? 115 TYR B CE1 1 
ATOM   2289 C  CE2 . TYR B 1 115 ? -29.205 14.779  -19.421 1.00 53.74  ? 115 TYR B CE2 1 
ATOM   2290 C  CZ  . TYR B 1 115 ? -28.432 15.634  -18.653 1.00 52.98  ? 115 TYR B CZ  1 
ATOM   2291 O  OH  . TYR B 1 115 ? -27.498 15.117  -17.786 1.00 52.82  ? 115 TYR B OH  1 
ATOM   2292 N  N   . TYR B 1 116 ? -31.302 15.549  -24.087 1.00 40.34  ? 116 TYR B N   1 
ATOM   2293 C  CA  . TYR B 1 116 ? -31.106 14.284  -24.773 1.00 38.16  ? 116 TYR B CA  1 
ATOM   2294 C  C   . TYR B 1 116 ? -30.131 14.434  -25.919 1.00 37.93  ? 116 TYR B C   1 
ATOM   2295 O  O   . TYR B 1 116 ? -29.194 13.655  -26.043 1.00 39.51  ? 116 TYR B O   1 
ATOM   2296 C  CB  . TYR B 1 116 ? -32.446 13.747  -25.299 1.00 37.06  ? 116 TYR B CB  1 
ATOM   2297 C  CG  . TYR B 1 116 ? -32.337 12.472  -26.122 1.00 36.43  ? 116 TYR B CG  1 
ATOM   2298 C  CD1 . TYR B 1 116 ? -31.988 12.516  -27.473 1.00 34.76  ? 116 TYR B CD1 1 
ATOM   2299 C  CD2 . TYR B 1 116 ? -32.578 11.223  -25.546 1.00 36.67  ? 116 TYR B CD2 1 
ATOM   2300 C  CE1 . TYR B 1 116 ? -31.881 11.359  -28.230 1.00 34.55  ? 116 TYR B CE1 1 
ATOM   2301 C  CE2 . TYR B 1 116 ? -32.470 10.053  -26.294 1.00 35.99  ? 116 TYR B CE2 1 
ATOM   2302 C  CZ  . TYR B 1 116 ? -32.121 10.126  -27.642 1.00 36.07  ? 116 TYR B CZ  1 
ATOM   2303 O  OH  . TYR B 1 116 ? -32.002 8.973   -28.401 1.00 33.70  ? 116 TYR B OH  1 
ATOM   2304 N  N   . ASN B 1 117 ? -30.350 15.443  -26.753 1.00 37.43  ? 117 ASN B N   1 
ATOM   2305 C  CA  . ASN B 1 117 ? -29.493 15.673  -27.906 1.00 38.36  ? 117 ASN B CA  1 
ATOM   2306 C  C   . ASN B 1 117 ? -28.063 16.088  -27.564 1.00 38.23  ? 117 ASN B C   1 
ATOM   2307 O  O   . ASN B 1 117 ? -27.126 15.729  -28.275 1.00 38.06  ? 117 ASN B O   1 
ATOM   2308 C  CB  . ASN B 1 117 ? -30.142 16.717  -28.831 1.00 40.64  ? 117 ASN B CB  1 
ATOM   2309 C  CG  . ASN B 1 117 ? -31.484 16.249  -29.388 1.00 41.67  ? 117 ASN B CG  1 
ATOM   2310 O  OD1 . ASN B 1 117 ? -32.514 16.882  -29.155 1.00 43.53  ? 117 ASN B OD1 1 
ATOM   2311 N  ND2 . ASN B 1 117 ? -31.472 15.138  -30.127 1.00 41.37  ? 117 ASN B ND2 1 
ATOM   2312 N  N   . CYS B 1 118 ? -27.886 16.848  -26.487 1.00 40.02  ? 118 CYS B N   1 
ATOM   2313 C  CA  . CYS B 1 118 ? -26.545 17.283  -26.090 1.00 43.20  ? 118 CYS B CA  1 
ATOM   2314 C  C   . CYS B 1 118 ? -25.709 16.116  -25.596 1.00 42.89  ? 118 CYS B C   1 
ATOM   2315 O  O   . CYS B 1 118 ? -24.516 16.048  -25.863 1.00 43.68  ? 118 CYS B O   1 
ATOM   2316 C  CB  . CYS B 1 118 ? -26.609 18.351  -24.998 1.00 44.14  ? 118 CYS B CB  1 
ATOM   2317 S  SG  . CYS B 1 118 ? -27.088 19.986  -25.599 1.00 54.33  ? 118 CYS B SG  1 
ATOM   2318 N  N   . GLN B 1 119 ? -26.349 15.199  -24.878 1.00 43.87  ? 119 GLN B N   1 
ATOM   2319 C  CA  . GLN B 1 119 ? -25.676 14.024  -24.343 1.00 44.43  ? 119 GLN B CA  1 
ATOM   2320 C  C   . GLN B 1 119 ? -25.277 13.016  -25.414 1.00 44.80  ? 119 GLN B C   1 
ATOM   2321 O  O   . GLN B 1 119 ? -24.165 12.479  -25.383 1.00 45.06  ? 119 GLN B O   1 
ATOM   2322 C  CB  . GLN B 1 119 ? -26.567 13.353  -23.307 1.00 46.61  ? 119 GLN B CB  1 
ATOM   2323 C  CG  . GLN B 1 119 ? -26.783 14.213  -22.078 1.00 50.07  ? 119 GLN B CG  1 
ATOM   2324 C  CD  . GLN B 1 119 ? -25.485 14.530  -21.363 1.00 53.11  ? 119 GLN B CD  1 
ATOM   2325 O  OE1 . GLN B 1 119 ? -24.452 13.914  -21.628 1.00 55.59  ? 119 GLN B OE1 1 
ATOM   2326 N  NE2 . GLN B 1 119 ? -25.530 15.504  -20.456 1.00 55.23  ? 119 GLN B NE2 1 
ATOM   2327 N  N   . GLN B 1 120 ? -26.176 12.760  -26.361 1.00 44.02  ? 120 GLN B N   1 
ATOM   2328 C  CA  . GLN B 1 120 ? -25.890 11.818  -27.438 1.00 45.15  ? 120 GLN B CA  1 
ATOM   2329 C  C   . GLN B 1 120 ? -24.817 12.392  -28.358 1.00 45.57  ? 120 GLN B C   1 
ATOM   2330 O  O   . GLN B 1 120 ? -24.045 11.649  -28.968 1.00 44.67  ? 120 GLN B O   1 
ATOM   2331 C  CB  . GLN B 1 120 ? -27.166 11.504  -28.228 1.00 45.09  ? 120 GLN B CB  1 
ATOM   2332 C  CG  . GLN B 1 120 ? -28.262 10.845  -27.391 1.00 45.52  ? 120 GLN B CG  1 
ATOM   2333 C  CD  . GLN B 1 120 ? -27.928 9.417   -26.980 1.00 47.48  ? 120 GLN B CD  1 
ATOM   2334 O  OE1 . GLN B 1 120 ? -28.489 8.894   -26.022 1.00 49.61  ? 120 GLN B OE1 1 
ATOM   2335 N  NE2 . GLN B 1 120 ? -27.026 8.777   -27.715 1.00 49.49  ? 120 GLN B NE2 1 
ATOM   2336 N  N   . GLU B 1 121 ? -24.758 13.716  -28.459 1.00 46.85  ? 121 GLU B N   1 
ATOM   2337 C  CA  . GLU B 1 121 ? -23.737 14.333  -29.291 1.00 48.17  ? 121 GLU B CA  1 
ATOM   2338 C  C   . GLU B 1 121 ? -22.382 13.990  -28.680 1.00 47.05  ? 121 GLU B C   1 
ATOM   2339 O  O   . GLU B 1 121 ? -21.505 13.441  -29.349 1.00 46.88  ? 121 GLU B O   1 
ATOM   2340 C  CB  . GLU B 1 121 ? -23.916 15.851  -29.347 1.00 50.75  ? 121 GLU B CB  1 
ATOM   2341 C  CG  . GLU B 1 121 ? -24.620 16.349  -30.610 1.00 56.20  ? 121 GLU B CG  1 
ATOM   2342 C  CD  . GLU B 1 121 ? -24.186 17.764  -31.012 1.00 59.20  ? 121 GLU B CD  1 
ATOM   2343 O  OE1 . GLU B 1 121 ? -24.461 18.727  -30.254 1.00 60.26  ? 121 GLU B OE1 1 
ATOM   2344 O  OE2 . GLU B 1 121 ? -23.560 17.912  -32.087 1.00 58.90  ? 121 GLU B OE2 1 
ATOM   2345 N  N   . LEU B 1 122 ? -22.235 14.306  -27.395 1.00 46.51  ? 122 LEU B N   1 
ATOM   2346 C  CA  . LEU B 1 122 ? -21.011 14.044  -26.641 1.00 44.82  ? 122 LEU B CA  1 
ATOM   2347 C  C   . LEU B 1 122 ? -20.642 12.563  -26.708 1.00 43.91  ? 122 LEU B C   1 
ATOM   2348 O  O   . LEU B 1 122 ? -19.516 12.190  -27.059 1.00 41.91  ? 122 LEU B O   1 
ATOM   2349 C  CB  . LEU B 1 122 ? -21.225 14.442  -25.189 1.00 45.47  ? 122 LEU B CB  1 
ATOM   2350 C  CG  . LEU B 1 122 ? -21.738 15.868  -24.976 1.00 48.40  ? 122 LEU B CG  1 
ATOM   2351 C  CD1 . LEU B 1 122 ? -22.011 16.083  -23.486 1.00 47.79  ? 122 LEU B CD1 1 
ATOM   2352 C  CD2 . LEU B 1 122 ? -20.725 16.883  -25.506 1.00 47.69  ? 122 LEU B CD2 1 
ATOM   2353 N  N   . THR B 1 123 ? -21.605 11.727  -26.346 1.00 43.17  ? 123 THR B N   1 
ATOM   2354 C  CA  . THR B 1 123 ? -21.434 10.288  -26.378 1.00 42.48  ? 123 THR B CA  1 
ATOM   2355 C  C   . THR B 1 123 ? -20.913 9.834   -27.733 1.00 41.96  ? 123 THR B C   1 
ATOM   2356 O  O   . THR B 1 123 ? -19.956 9.067   -27.814 1.00 41.66  ? 123 THR B O   1 
ATOM   2357 C  CB  . THR B 1 123 ? -22.772 9.595   -26.083 1.00 43.00  ? 123 THR B CB  1 
ATOM   2358 O  OG1 . THR B 1 123 ? -22.886 9.392   -24.667 1.00 44.45  ? 123 THR B OG1 1 
ATOM   2359 C  CG2 . THR B 1 123 ? -22.889 8.268   -26.837 1.00 44.08  ? 123 THR B CG2 1 
ATOM   2360 N  N   . ASP B 1 124 ? -21.543 10.325  -28.795 1.00 42.90  ? 124 ASP B N   1 
ATOM   2361 C  CA  . ASP B 1 124 ? -21.154 9.951   -30.141 1.00 43.82  ? 124 ASP B CA  1 
ATOM   2362 C  C   . ASP B 1 124 ? -19.747 10.381  -30.486 1.00 42.85  ? 124 ASP B C   1 
ATOM   2363 O  O   . ASP B 1 124 ? -19.088 9.761   -31.319 1.00 42.60  ? 124 ASP B O   1 
ATOM   2364 C  CB  . ASP B 1 124 ? -22.157 10.503  -31.148 1.00 46.62  ? 124 ASP B CB  1 
ATOM   2365 C  CG  . ASP B 1 124 ? -23.503 9.798   -31.064 1.00 51.88  ? 124 ASP B CG  1 
ATOM   2366 O  OD1 . ASP B 1 124 ? -23.532 8.538   -31.051 1.00 51.63  ? 124 ASP B OD1 1 
ATOM   2367 O  OD2 . ASP B 1 124 ? -24.537 10.500  -31.015 1.00 56.32  ? 124 ASP B OD2 1 
ATOM   2368 N  N   . ASP B 1 125 ? -19.275 11.442  -29.849 1.00 42.66  ? 125 ASP B N   1 
ATOM   2369 C  CA  . ASP B 1 125 ? -17.917 11.883  -30.103 1.00 44.02  ? 125 ASP B CA  1 
ATOM   2370 C  C   . ASP B 1 125 ? -16.932 10.899  -29.468 1.00 42.76  ? 125 ASP B C   1 
ATOM   2371 O  O   . ASP B 1 125 ? -15.909 10.566  -30.073 1.00 42.60  ? 125 ASP B O   1 
ATOM   2372 C  CB  . ASP B 1 125 ? -17.694 13.294  -29.555 1.00 48.25  ? 125 ASP B CB  1 
ATOM   2373 C  CG  . ASP B 1 125 ? -18.396 14.351  -30.387 1.00 53.85  ? 125 ASP B CG  1 
ATOM   2374 O  OD1 . ASP B 1 125 ? -18.368 14.228  -31.634 1.00 54.56  ? 125 ASP B OD1 1 
ATOM   2375 O  OD2 . ASP B 1 125 ? -18.967 15.303  -29.800 1.00 57.07  ? 125 ASP B OD2 1 
ATOM   2376 N  N   . LEU B 1 126 ? -17.244 10.426  -28.259 1.00 39.54  ? 126 LEU B N   1 
ATOM   2377 C  CA  . LEU B 1 126 ? -16.371 9.479   -27.575 1.00 38.77  ? 126 LEU B CA  1 
ATOM   2378 C  C   . LEU B 1 126 ? -16.208 8.193   -28.374 1.00 38.55  ? 126 LEU B C   1 
ATOM   2379 O  O   . LEU B 1 126 ? -15.099 7.689   -28.544 1.00 39.12  ? 126 LEU B O   1 
ATOM   2380 C  CB  . LEU B 1 126 ? -16.912 9.115   -26.188 1.00 38.41  ? 126 LEU B CB  1 
ATOM   2381 C  CG  . LEU B 1 126 ? -16.869 10.104  -25.026 1.00 38.80  ? 126 LEU B CG  1 
ATOM   2382 C  CD1 . LEU B 1 126 ? -15.818 11.156  -25.291 1.00 39.19  ? 126 LEU B CD1 1 
ATOM   2383 C  CD2 . LEU B 1 126 ? -18.237 10.739  -24.830 1.00 41.14  ? 126 LEU B CD2 1 
ATOM   2384 N  N   . HIS B 1 127 ? -17.321 7.654   -28.855 1.00 37.89  ? 127 HIS B N   1 
ATOM   2385 C  CA  . HIS B 1 127 ? -17.277 6.423   -29.618 1.00 37.45  ? 127 HIS B CA  1 
ATOM   2386 C  C   . HIS B 1 127 ? -16.446 6.589   -30.892 1.00 37.97  ? 127 HIS B C   1 
ATOM   2387 O  O   . HIS B 1 127 ? -15.868 5.624   -31.381 1.00 38.19  ? 127 HIS B O   1 
ATOM   2388 C  CB  . HIS B 1 127 ? -18.701 5.974   -29.947 1.00 36.61  ? 127 HIS B CB  1 
ATOM   2389 C  CG  . HIS B 1 127 ? -19.547 5.717   -28.735 1.00 36.91  ? 127 HIS B CG  1 
ATOM   2390 N  ND1 . HIS B 1 127 ? -20.886 5.402   -28.817 1.00 35.91  ? 127 HIS B ND1 1 
ATOM   2391 C  CD2 . HIS B 1 127 ? -19.250 5.752   -27.413 1.00 38.43  ? 127 HIS B CD2 1 
ATOM   2392 C  CE1 . HIS B 1 127 ? -21.380 5.261   -27.598 1.00 37.93  ? 127 HIS B CE1 1 
ATOM   2393 N  NE2 . HIS B 1 127 ? -20.408 5.469   -26.728 1.00 37.57  ? 127 HIS B NE2 1 
ATOM   2394 N  N   . LYS B 1 128 ? -16.379 7.810   -31.418 1.00 38.46  ? 128 LYS B N   1 
ATOM   2395 C  CA  . LYS B 1 128 ? -15.602 8.084   -32.626 1.00 39.43  ? 128 LYS B CA  1 
ATOM   2396 C  C   . LYS B 1 128 ? -14.115 8.003   -32.306 1.00 38.49  ? 128 LYS B C   1 
ATOM   2397 O  O   . LYS B 1 128 ? -13.309 7.589   -33.142 1.00 38.66  ? 128 LYS B O   1 
ATOM   2398 C  CB  . LYS B 1 128 ? -15.904 9.485   -33.162 1.00 42.61  ? 128 LYS B CB  1 
ATOM   2399 C  CG  . LYS B 1 128 ? -17.286 9.672   -33.761 1.00 47.08  ? 128 LYS B CG  1 
ATOM   2400 C  CD  . LYS B 1 128 ? -17.398 9.011   -35.127 1.00 51.69  ? 128 LYS B CD  1 
ATOM   2401 C  CE  . LYS B 1 128 ? -18.640 9.496   -35.866 1.00 53.27  ? 128 LYS B CE  1 
ATOM   2402 N  NZ  . LYS B 1 128 ? -18.612 10.976  -36.038 1.00 54.49  ? 128 LYS B NZ  1 
ATOM   2403 N  N   . GLN B 1 129 ? -13.751 8.421   -31.099 1.00 35.90  ? 129 GLN B N   1 
ATOM   2404 C  CA  . GLN B 1 129 ? -12.356 8.382   -30.686 1.00 35.75  ? 129 GLN B CA  1 
ATOM   2405 C  C   . GLN B 1 129 ? -11.790 6.968   -30.603 1.00 33.32  ? 129 GLN B C   1 
ATOM   2406 O  O   . GLN B 1 129 ? -10.620 6.748   -30.910 1.00 34.42  ? 129 GLN B O   1 
ATOM   2407 C  CB  . GLN B 1 129 ? -12.177 9.063   -29.333 1.00 37.73  ? 129 GLN B CB  1 
ATOM   2408 C  CG  . GLN B 1 129 ? -12.181 10.580  -29.390 1.00 41.94  ? 129 GLN B CG  1 
ATOM   2409 C  CD  . GLN B 1 129 ? -11.772 11.206  -28.063 1.00 45.43  ? 129 GLN B CD  1 
ATOM   2410 O  OE1 . GLN B 1 129 ? -12.345 10.895  -27.013 1.00 47.14  ? 129 GLN B OE1 1 
ATOM   2411 N  NE2 . GLN B 1 129 ? -10.773 12.091  -28.103 1.00 45.18  ? 129 GLN B NE2 1 
ATOM   2412 N  N   . TYR B 1 130 ? -12.616 6.011   -30.196 1.00 30.16  ? 130 TYR B N   1 
ATOM   2413 C  CA  . TYR B 1 130 ? -12.172 4.629   -30.071 1.00 28.78  ? 130 TYR B CA  1 
ATOM   2414 C  C   . TYR B 1 130 ? -11.535 4.090   -31.338 1.00 29.76  ? 130 TYR B C   1 
ATOM   2415 O  O   . TYR B 1 130 ? -10.799 3.114   -31.288 1.00 31.49  ? 130 TYR B O   1 
ATOM   2416 C  CB  . TYR B 1 130 ? -13.331 3.698   -29.709 1.00 27.11  ? 130 TYR B CB  1 
ATOM   2417 C  CG  . TYR B 1 130 ? -14.121 4.045   -28.461 1.00 22.53  ? 130 TYR B CG  1 
ATOM   2418 C  CD1 . TYR B 1 130 ? -13.635 4.954   -27.503 1.00 20.80  ? 130 TYR B CD1 1 
ATOM   2419 C  CD2 . TYR B 1 130 ? -15.345 3.435   -28.226 1.00 18.41  ? 130 TYR B CD2 1 
ATOM   2420 C  CE1 . TYR B 1 130 ? -14.367 5.237   -26.340 1.00 16.23  ? 130 TYR B CE1 1 
ATOM   2421 C  CE2 . TYR B 1 130 ? -16.072 3.700   -27.082 1.00 19.53  ? 130 TYR B CE2 1 
ATOM   2422 C  CZ  . TYR B 1 130 ? -15.581 4.601   -26.140 1.00 19.83  ? 130 TYR B CZ  1 
ATOM   2423 O  OH  . TYR B 1 130 ? -16.314 4.832   -24.998 1.00 23.45  ? 130 TYR B OH  1 
ATOM   2424 N  N   . GLN B 1 131 ? -11.808 4.704   -32.481 1.00 30.57  ? 131 GLN B N   1 
ATOM   2425 C  CA  . GLN B 1 131 ? -11.228 4.193   -33.714 1.00 31.64  ? 131 GLN B CA  1 
ATOM   2426 C  C   . GLN B 1 131 ? -9.993  4.984   -34.074 1.00 33.75  ? 131 GLN B C   1 
ATOM   2427 O  O   . GLN B 1 131 ? -9.451  4.831   -35.166 1.00 34.55  ? 131 GLN B O   1 
ATOM   2428 C  CB  . GLN B 1 131 ? -12.234 4.275   -34.861 1.00 31.58  ? 131 GLN B CB  1 
ATOM   2429 C  CG  . GLN B 1 131 ? -13.655 3.896   -34.475 1.00 30.59  ? 131 GLN B CG  1 
ATOM   2430 C  CD  . GLN B 1 131 ? -14.595 3.893   -35.665 1.00 29.60  ? 131 GLN B CD  1 
ATOM   2431 O  OE1 . GLN B 1 131 ? -14.847 2.851   -36.266 1.00 30.05  ? 131 GLN B OE1 1 
ATOM   2432 N  NE2 . GLN B 1 131 ? -15.104 5.067   -36.022 1.00 28.92  ? 131 GLN B NE2 1 
ATOM   2433 N  N   . ILE B 1 132 ? -9.556  5.842   -33.163 1.00 35.45  ? 132 ILE B N   1 
ATOM   2434 C  CA  . ILE B 1 132 ? -8.369  6.652   -33.402 1.00 38.05  ? 132 ILE B CA  1 
ATOM   2435 C  C   . ILE B 1 132 ? -7.195  6.121   -32.578 1.00 37.68  ? 132 ILE B C   1 
ATOM   2436 O  O   . ILE B 1 132 ? -7.323  5.876   -31.378 1.00 37.07  ? 132 ILE B O   1 
ATOM   2437 C  CB  . ILE B 1 132 ? -8.626  8.135   -33.027 1.00 40.39  ? 132 ILE B CB  1 
ATOM   2438 C  CG1 . ILE B 1 132 ? -9.856  8.643   -33.779 1.00 43.25  ? 132 ILE B CG1 1 
ATOM   2439 C  CG2 . ILE B 1 132 ? -7.412  8.991   -33.375 1.00 38.68  ? 132 ILE B CG2 1 
ATOM   2440 C  CD1 . ILE B 1 132 ? -10.322 10.022  -33.336 1.00 48.11  ? 132 ILE B CD1 1 
ATOM   2441 N  N   . VAL B 1 133 ? -6.054  5.928   -33.227 1.00 38.37  ? 133 VAL B N   1 
ATOM   2442 C  CA  . VAL B 1 133 ? -4.887  5.448   -32.519 1.00 39.39  ? 133 VAL B CA  1 
ATOM   2443 C  C   . VAL B 1 133 ? -4.322  6.593   -31.703 1.00 41.96  ? 133 VAL B C   1 
ATOM   2444 O  O   . VAL B 1 133 ? -3.872  7.599   -32.253 1.00 43.70  ? 133 VAL B O   1 
ATOM   2445 C  CB  . VAL B 1 133 ? -3.800  4.955   -33.472 1.00 38.25  ? 133 VAL B CB  1 
ATOM   2446 C  CG1 . VAL B 1 133 ? -2.531  4.661   -32.683 1.00 38.04  ? 133 VAL B CG1 1 
ATOM   2447 C  CG2 . VAL B 1 133 ? -4.267  3.700   -34.184 1.00 38.42  ? 133 VAL B CG2 1 
ATOM   2448 N  N   . GLY B 1 134 ? -4.355  6.438   -30.387 1.00 43.46  ? 134 GLY B N   1 
ATOM   2449 C  CA  . GLY B 1 134 ? -3.838  7.468   -29.514 1.00 44.73  ? 134 GLY B CA  1 
ATOM   2450 C  C   . GLY B 1 134 ? -2.360  7.274   -29.255 1.00 46.42  ? 134 GLY B C   1 
ATOM   2451 O  O   . GLY B 1 134 ? -1.696  8.183   -28.747 1.00 49.62  ? 134 GLY B O   1 
ATOM   2452 N  N   . ARG B 1 135 ? -1.835  6.099   -29.598 1.00 45.04  ? 135 ARG B N   1 
ATOM   2453 C  CA  . ARG B 1 135 ? -0.421  5.822   -29.390 1.00 43.62  ? 135 ARG B CA  1 
ATOM   2454 C  C   . ARG B 1 135 ? -0.038  4.395   -29.712 1.00 44.52  ? 135 ARG B C   1 
ATOM   2455 O  O   . ARG B 1 135 ? -0.745  3.457   -29.337 1.00 43.48  ? 135 ARG B O   1 
ATOM   2456 C  CB  . ARG B 1 135 ? -0.034  6.102   -27.941 1.00 44.02  ? 135 ARG B CB  1 
ATOM   2457 C  CG  . ARG B 1 135 ? 1.452   6.090   -27.696 1.00 43.17  ? 135 ARG B CG  1 
ATOM   2458 C  CD  . ARG B 1 135 ? 1.744   5.861   -26.229 1.00 44.68  ? 135 ARG B CD  1 
ATOM   2459 N  NE  . ARG B 1 135 ? 3.080   6.329   -25.868 1.00 46.77  ? 135 ARG B NE  1 
ATOM   2460 C  CZ  . ARG B 1 135 ? 3.414   7.612   -25.769 1.00 44.98  ? 135 ARG B CZ  1 
ATOM   2461 N  NH1 . ARG B 1 135 ? 2.512   8.555   -26.004 1.00 44.53  ? 135 ARG B NH1 1 
ATOM   2462 N  NH2 . ARG B 1 135 ? 4.647   7.951   -25.428 1.00 43.77  ? 135 ARG B NH2 1 
ATOM   2463 N  N   . ILE B 1 136 ? 1.081   4.229   -30.409 1.00 45.79  ? 136 ILE B N   1 
ATOM   2464 C  CA  . ILE B 1 136 ? 1.563   2.895   -30.718 1.00 47.22  ? 136 ILE B CA  1 
ATOM   2465 C  C   . ILE B 1 136 ? 2.531   2.533   -29.602 1.00 49.62  ? 136 ILE B C   1 
ATOM   2466 O  O   . ILE B 1 136 ? 3.466   3.277   -29.295 1.00 49.75  ? 136 ILE B O   1 
ATOM   2467 C  CB  . ILE B 1 136 ? 2.236   2.833   -32.096 1.00 45.40  ? 136 ILE B CB  1 
ATOM   2468 C  CG1 . ILE B 1 136 ? 1.159   3.038   -33.168 1.00 45.29  ? 136 ILE B CG1 1 
ATOM   2469 C  CG2 . ILE B 1 136 ? 2.965   1.501   -32.269 1.00 44.03  ? 136 ILE B CG2 1 
ATOM   2470 C  CD1 . ILE B 1 136 ? 1.375   2.269   -34.462 1.00 44.23  ? 136 ILE B CD1 1 
ATOM   2471 N  N   . ILE B 1 137 ? 2.297   1.378   -28.997 1.00 52.60  ? 137 ILE B N   1 
ATOM   2472 C  CA  . ILE B 1 137 ? 3.087   0.949   -27.863 1.00 54.84  ? 137 ILE B CA  1 
ATOM   2473 C  C   . ILE B 1 137 ? 4.007   -0.243  -28.046 1.00 57.67  ? 137 ILE B C   1 
ATOM   2474 O  O   . ILE B 1 137 ? 4.837   -0.527  -27.181 1.00 59.16  ? 137 ILE B O   1 
ATOM   2475 C  CB  . ILE B 1 137 ? 2.129   0.743   -26.693 1.00 54.59  ? 137 ILE B CB  1 
ATOM   2476 C  CG1 . ILE B 1 137 ? 1.659   2.131   -26.258 1.00 54.44  ? 137 ILE B CG1 1 
ATOM   2477 C  CG2 . ILE B 1 137 ? 2.750   -0.099  -25.594 1.00 54.17  ? 137 ILE B CG2 1 
ATOM   2478 C  CD1 . ILE B 1 137 ? 1.170   2.206   -24.870 1.00 57.66  ? 137 ILE B CD1 1 
ATOM   2479 N  N   . ALA B 1 138 ? 3.886   -0.924  -29.177 1.00 59.33  ? 138 ALA B N   1 
ATOM   2480 C  CA  . ALA B 1 138 ? 4.734   -2.074  -29.454 1.00 61.50  ? 138 ALA B CA  1 
ATOM   2481 C  C   . ALA B 1 138 ? 4.568   -2.469  -30.909 1.00 63.30  ? 138 ALA B C   1 
ATOM   2482 O  O   . ALA B 1 138 ? 3.716   -1.926  -31.613 1.00 64.69  ? 138 ALA B O   1 
ATOM   2483 C  CB  . ALA B 1 138 ? 4.356   -3.241  -28.545 1.00 61.75  ? 138 ALA B CB  1 
ATOM   2484 N  N   . HIS B 1 139 ? 5.388   -3.406  -31.365 1.00 64.66  ? 139 HIS B N   1 
ATOM   2485 C  CA  . HIS B 1 139 ? 5.300   -3.867  -32.739 1.00 66.67  ? 139 HIS B CA  1 
ATOM   2486 C  C   . HIS B 1 139 ? 5.919   -5.251  -32.845 1.00 67.50  ? 139 HIS B C   1 
ATOM   2487 O  O   . HIS B 1 139 ? 7.045   -5.475  -32.406 1.00 67.51  ? 139 HIS B O   1 
ATOM   2488 C  CB  . HIS B 1 139 ? 6.003   -2.880  -33.677 1.00 67.38  ? 139 HIS B CB  1 
ATOM   2489 C  CG  . HIS B 1 139 ? 7.492   -3.027  -33.717 1.00 69.21  ? 139 HIS B CG  1 
ATOM   2490 N  ND1 . HIS B 1 139 ? 8.260   -3.157  -32.581 1.00 70.23  ? 139 HIS B ND1 1 
ATOM   2491 C  CD2 . HIS B 1 139 ? 8.355   -3.063  -34.760 1.00 69.61  ? 139 HIS B CD2 1 
ATOM   2492 C  CE1 . HIS B 1 139 ? 9.531   -3.269  -32.922 1.00 69.93  ? 139 HIS B CE1 1 
ATOM   2493 N  NE2 . HIS B 1 139 ? 9.616   -3.215  -34.239 1.00 69.23  ? 139 HIS B NE2 1 
ATOM   2494 N  N   . SER B 1 140 ? 5.169   -6.191  -33.402 1.00 68.69  ? 140 SER B N   1 
ATOM   2495 C  CA  . SER B 1 140 ? 5.668   -7.551  -33.552 1.00 70.53  ? 140 SER B CA  1 
ATOM   2496 C  C   . SER B 1 140 ? 6.791   -7.491  -34.560 1.00 72.14  ? 140 SER B C   1 
ATOM   2497 O  O   . SER B 1 140 ? 6.929   -6.495  -35.270 1.00 71.67  ? 140 SER B O   1 
ATOM   2498 C  CB  . SER B 1 140 ? 4.581   -8.464  -34.123 1.00 70.42  ? 140 SER B CB  1 
ATOM   2499 O  OG  . SER B 1 140 ? 4.507   -8.328  -35.541 1.00 68.18  ? 140 SER B OG  1 
ATOM   2500 N  N   . ASN B 1 141 ? 7.609   -8.534  -34.625 1.00 74.25  ? 141 ASN B N   1 
ATOM   2501 C  CA  . ASN B 1 141 ? 8.626   -8.512  -35.649 1.00 76.96  ? 141 ASN B CA  1 
ATOM   2502 C  C   . ASN B 1 141 ? 8.440   -9.618  -36.669 1.00 78.17  ? 141 ASN B C   1 
ATOM   2503 O  O   . ASN B 1 141 ? 9.317   -9.864  -37.502 1.00 78.68  ? 141 ASN B O   1 
ATOM   2504 C  CB  . ASN B 1 141 ? 10.042  -8.540  -35.106 1.00 77.76  ? 141 ASN B CB  1 
ATOM   2505 C  CG  . ASN B 1 141 ? 11.031  -8.036  -36.142 1.00 79.72  ? 141 ASN B CG  1 
ATOM   2506 O  OD1 . ASN B 1 141 ? 10.880  -6.926  -36.659 1.00 80.49  ? 141 ASN B OD1 1 
ATOM   2507 N  ND2 . ASN B 1 141 ? 12.027  -8.851  -36.473 1.00 80.89  ? 141 ASN B ND2 1 
ATOM   2508 N  N   . GLN B 1 142 ? 7.301   -10.302 -36.597 1.00 79.17  ? 142 GLN B N   1 
ATOM   2509 C  CA  . GLN B 1 142 ? 6.990   -11.296 -37.610 1.00 79.67  ? 142 GLN B CA  1 
ATOM   2510 C  C   . GLN B 1 142 ? 6.687   -10.273 -38.705 1.00 80.76  ? 142 GLN B C   1 
ATOM   2511 O  O   . GLN B 1 142 ? 6.771   -9.069  -38.452 1.00 81.12  ? 142 GLN B O   1 
ATOM   2512 C  CB  . GLN B 1 142 ? 5.739   -12.080 -37.242 1.00 78.42  ? 142 GLN B CB  1 
ATOM   2513 N  N   . LYS B 1 143 ? 6.325   -10.702 -39.904 1.00 81.39  ? 143 LYS B N   1 
ATOM   2514 C  CA  . LYS B 1 143 ? 6.067   -9.720  -40.953 1.00 81.26  ? 143 LYS B CA  1 
ATOM   2515 C  C   . LYS B 1 143 ? 5.757   -10.495 -42.218 1.00 81.74  ? 143 LYS B C   1 
ATOM   2516 O  O   . LYS B 1 143 ? 6.254   -11.605 -42.396 1.00 82.15  ? 143 LYS B O   1 
ATOM   2517 C  CB  . LYS B 1 143 ? 7.318   -8.857  -41.147 1.00 80.27  ? 143 LYS B CB  1 
ATOM   2518 C  CG  . LYS B 1 143 ? 7.101   -7.478  -41.745 1.00 80.59  ? 143 LYS B CG  1 
ATOM   2519 C  CD  . LYS B 1 143 ? 8.354   -6.623  -41.537 1.00 80.03  ? 143 LYS B CD  1 
ATOM   2520 C  CE  . LYS B 1 143 ? 8.689   -6.502  -40.044 1.00 80.55  ? 143 LYS B CE  1 
ATOM   2521 N  NZ  . LYS B 1 143 ? 10.015  -5.875  -39.765 1.00 80.00  ? 143 LYS B NZ  1 
ATOM   2522 N  N   . SER B 1 144 ? 4.940   -9.913  -43.090 1.00 81.93  ? 144 SER B N   1 
ATOM   2523 C  CA  . SER B 1 144 ? 4.553   -10.569 -44.333 1.00 81.76  ? 144 SER B CA  1 
ATOM   2524 C  C   . SER B 1 144 ? 4.870   -9.693  -45.541 1.00 81.77  ? 144 SER B C   1 
ATOM   2525 O  O   . SER B 1 144 ? 4.313   -8.606  -45.694 1.00 81.72  ? 144 SER B O   1 
ATOM   2526 C  CB  . SER B 1 144 ? 3.074   -10.925 -44.306 1.00 81.27  ? 144 SER B CB  1 
ATOM   2527 N  N   . GLY B 1 147 ? 6.468   -5.814  -46.225 1.00 76.53  ? 147 GLY B N   1 
ATOM   2528 C  CA  . GLY B 1 147 ? 7.153   -5.342  -45.036 1.00 74.08  ? 147 GLY B CA  1 
ATOM   2529 C  C   . GLY B 1 147 ? 6.270   -4.471  -44.165 1.00 72.08  ? 147 GLY B C   1 
ATOM   2530 O  O   . GLY B 1 147 ? 6.204   -3.255  -44.350 1.00 72.32  ? 147 GLY B O   1 
ATOM   2531 N  N   . TYR B 1 148 ? 5.588   -5.095  -43.210 1.00 68.53  ? 148 TYR B N   1 
ATOM   2532 C  CA  . TYR B 1 148 ? 4.709   -4.375  -42.302 1.00 65.07  ? 148 TYR B CA  1 
ATOM   2533 C  C   . TYR B 1 148 ? 4.581   -5.186  -41.035 1.00 61.23  ? 148 TYR B C   1 
ATOM   2534 O  O   . TYR B 1 148 ? 4.041   -6.291  -41.044 1.00 60.40  ? 148 TYR B O   1 
ATOM   2535 C  CB  . TYR B 1 148 ? 3.300   -4.052  -42.821 1.00 67.36  ? 148 TYR B CB  1 
ATOM   2536 C  CG  . TYR B 1 148 ? 3.243   -2.875  -43.766 1.00 69.24  ? 148 TYR B CG  1 
ATOM   2537 C  CD1 . TYR B 1 148 ? 3.467   -1.577  -43.307 1.00 70.48  ? 148 TYR B CD1 1 
ATOM   2538 C  CD2 . TYR B 1 148 ? 2.999   -3.058  -45.125 1.00 69.89  ? 148 TYR B CD2 1 
ATOM   2539 C  CE1 . TYR B 1 148 ? 3.454   -0.488  -44.179 1.00 70.45  ? 148 TYR B CE1 1 
ATOM   2540 C  CE2 . TYR B 1 148 ? 2.984   -1.980  -46.004 1.00 70.97  ? 148 TYR B CE2 1 
ATOM   2541 C  CZ  . TYR B 1 148 ? 3.215   -0.696  -45.525 1.00 70.96  ? 148 TYR B CZ  1 
ATOM   2542 O  OH  . TYR B 1 148 ? 3.220   0.377   -46.391 1.00 70.01  ? 148 TYR B OH  1 
ATOM   2543 N  N   . PRO B 1 149 ? 5.107   -4.662  -39.925 1.00 58.30  ? 149 PRO B N   1 
ATOM   2544 C  CA  . PRO B 1 149 ? 4.983   -5.420  -38.686 1.00 55.45  ? 149 PRO B CA  1 
ATOM   2545 C  C   . PRO B 1 149 ? 3.631   -5.018  -38.105 1.00 53.28  ? 149 PRO B C   1 
ATOM   2546 O  O   . PRO B 1 149 ? 3.067   -3.995  -38.508 1.00 52.87  ? 149 PRO B O   1 
ATOM   2547 C  CB  . PRO B 1 149 ? 6.156   -4.907  -37.859 1.00 56.17  ? 149 PRO B CB  1 
ATOM   2548 C  CG  . PRO B 1 149 ? 6.221   -3.456  -38.259 1.00 57.22  ? 149 PRO B CG  1 
ATOM   2549 C  CD  . PRO B 1 149 ? 6.034   -3.524  -39.766 1.00 58.19  ? 149 PRO B CD  1 
ATOM   2550 N  N   . ASP B 1 150 ? 3.097   -5.821  -37.193 1.00 50.07  ? 150 ASP B N   1 
ATOM   2551 C  CA  . ASP B 1 150 ? 1.823   -5.490  -36.570 1.00 47.54  ? 150 ASP B CA  1 
ATOM   2552 C  C   . ASP B 1 150 ? 2.121   -4.513  -35.443 1.00 46.27  ? 150 ASP B C   1 
ATOM   2553 O  O   . ASP B 1 150 ? 3.217   -4.518  -34.891 1.00 46.79  ? 150 ASP B O   1 
ATOM   2554 C  CB  . ASP B 1 150 ? 1.166   -6.748  -36.005 1.00 46.97  ? 150 ASP B CB  1 
ATOM   2555 C  CG  . ASP B 1 150 ? 0.516   -7.604  -37.082 1.00 48.89  ? 150 ASP B CG  1 
ATOM   2556 O  OD1 . ASP B 1 150 ? 0.057   -8.720  -36.754 1.00 50.00  ? 150 ASP B OD1 1 
ATOM   2557 O  OD2 . ASP B 1 150 ? 0.451   -7.163  -38.253 1.00 48.58  ? 150 ASP B OD2 1 
ATOM   2558 N  N   . TYR B 1 151 ? 1.161   -3.664  -35.101 1.00 44.74  ? 151 TYR B N   1 
ATOM   2559 C  CA  . TYR B 1 151 ? 1.386   -2.712  -34.022 1.00 42.46  ? 151 TYR B CA  1 
ATOM   2560 C  C   . TYR B 1 151 ? 0.399   -2.894  -32.886 1.00 41.41  ? 151 TYR B C   1 
ATOM   2561 O  O   . TYR B 1 151 ? -0.758  -3.259  -33.105 1.00 40.94  ? 151 TYR B O   1 
ATOM   2562 C  CB  . TYR B 1 151 ? 1.304   -1.280  -34.540 1.00 42.97  ? 151 TYR B CB  1 
ATOM   2563 C  CG  . TYR B 1 151 ? 2.403   -0.931  -35.507 1.00 44.48  ? 151 TYR B CG  1 
ATOM   2564 C  CD1 . TYR B 1 151 ? 2.127   -0.668  -36.848 1.00 44.71  ? 151 TYR B CD1 1 
ATOM   2565 C  CD2 . TYR B 1 151 ? 3.725   -0.885  -35.086 1.00 43.76  ? 151 TYR B CD2 1 
ATOM   2566 C  CE1 . TYR B 1 151 ? 3.146   -0.366  -37.746 1.00 46.02  ? 151 TYR B CE1 1 
ATOM   2567 C  CE2 . TYR B 1 151 ? 4.749   -0.587  -35.973 1.00 45.23  ? 151 TYR B CE2 1 
ATOM   2568 C  CZ  . TYR B 1 151 ? 4.456   -0.327  -37.304 1.00 45.27  ? 151 TYR B CZ  1 
ATOM   2569 O  OH  . TYR B 1 151 ? 5.471   -0.025  -38.190 1.00 45.50  ? 151 TYR B OH  1 
ATOM   2570 N  N   . TYR B 1 152 ? 0.879   -2.667  -31.666 1.00 39.71  ? 152 TYR B N   1 
ATOM   2571 C  CA  . TYR B 1 152 ? 0.045   -2.762  -30.477 1.00 38.47  ? 152 TYR B CA  1 
ATOM   2572 C  C   . TYR B 1 152 ? -0.405  -1.314  -30.269 1.00 38.14  ? 152 TYR B C   1 
ATOM   2573 O  O   . TYR B 1 152 ? 0.408   -0.431  -29.984 1.00 37.68  ? 152 TYR B O   1 
ATOM   2574 C  CB  . TYR B 1 152 ? 0.872   -3.271  -29.290 1.00 35.40  ? 152 TYR B CB  1 
ATOM   2575 C  CG  . TYR B 1 152 ? 0.039   -3.810  -28.148 1.00 33.49  ? 152 TYR B CG  1 
ATOM   2576 C  CD1 . TYR B 1 152 ? -0.796  -4.911  -28.326 1.00 31.33  ? 152 TYR B CD1 1 
ATOM   2577 C  CD2 . TYR B 1 152 ? 0.066   -3.204  -26.896 1.00 32.54  ? 152 TYR B CD2 1 
ATOM   2578 C  CE1 . TYR B 1 152 ? -1.589  -5.393  -27.283 1.00 31.92  ? 152 TYR B CE1 1 
ATOM   2579 C  CE2 . TYR B 1 152 ? -0.725  -3.678  -25.842 1.00 31.36  ? 152 TYR B CE2 1 
ATOM   2580 C  CZ  . TYR B 1 152 ? -1.550  -4.769  -26.041 1.00 32.29  ? 152 TYR B CZ  1 
ATOM   2581 O  OH  . TYR B 1 152 ? -2.339  -5.223  -25.004 1.00 33.54  ? 152 TYR B OH  1 
ATOM   2582 N  N   . CYS B 1 153 ? -1.698  -1.069  -30.427 1.00 38.48  ? 153 CYS B N   1 
ATOM   2583 C  CA  . CYS B 1 153 ? -2.206  0.284   -30.325 1.00 39.17  ? 153 CYS B CA  1 
ATOM   2584 C  C   . CYS B 1 153 ? -3.012  0.609   -29.093 1.00 40.38  ? 153 CYS B C   1 
ATOM   2585 O  O   . CYS B 1 153 ? -3.735  -0.229  -28.553 1.00 41.24  ? 153 CYS B O   1 
ATOM   2586 C  CB  . CYS B 1 153 ? -3.031  0.589   -31.564 1.00 39.36  ? 153 CYS B CB  1 
ATOM   2587 S  SG  . CYS B 1 153 ? -2.260  -0.119  -33.026 1.00 43.69  ? 153 CYS B SG  1 
ATOM   2588 N  N   . LYS B 1 154 ? -2.872  1.857   -28.661 1.00 40.57  ? 154 LYS B N   1 
ATOM   2589 C  CA  . LYS B 1 154 ? -3.582  2.367   -27.505 1.00 40.14  ? 154 LYS B CA  1 
ATOM   2590 C  C   . LYS B 1 154 ? -4.634  3.272   -28.132 1.00 39.38  ? 154 LYS B C   1 
ATOM   2591 O  O   . LYS B 1 154 ? -4.308  4.170   -28.912 1.00 38.52  ? 154 LYS B O   1 
ATOM   2592 C  CB  . LYS B 1 154 ? -2.630  3.169   -26.612 1.00 39.85  ? 154 LYS B CB  1 
ATOM   2593 C  CG  . LYS B 1 154 ? -3.121  3.374   -25.190 1.00 38.72  ? 154 LYS B CG  1 
ATOM   2594 C  CD  . LYS B 1 154 ? -4.328  4.275   -25.167 1.00 40.51  ? 154 LYS B CD  1 
ATOM   2595 C  CE  . LYS B 1 154 ? -4.761  4.567   -23.745 1.00 39.99  ? 154 LYS B CE  1 
ATOM   2596 N  NZ  . LYS B 1 154 ? -5.767  5.664   -23.729 1.00 41.48  ? 154 LYS B NZ  1 
ATOM   2597 N  N   . TRP B 1 155 ? -5.893  3.024   -27.793 1.00 37.10  ? 155 TRP B N   1 
ATOM   2598 C  CA  . TRP B 1 155 ? -7.001  3.777   -28.356 1.00 35.08  ? 155 TRP B CA  1 
ATOM   2599 C  C   . TRP B 1 155 ? -7.444  4.978   -27.540 1.00 34.65  ? 155 TRP B C   1 
ATOM   2600 O  O   . TRP B 1 155 ? -7.514  4.922   -26.315 1.00 35.75  ? 155 TRP B O   1 
ATOM   2601 C  CB  . TRP B 1 155 ? -8.188  2.835   -28.583 1.00 33.75  ? 155 TRP B CB  1 
ATOM   2602 C  CG  . TRP B 1 155 ? -7.833  1.687   -29.471 1.00 32.88  ? 155 TRP B CG  1 
ATOM   2603 C  CD1 . TRP B 1 155 ? -7.613  0.392   -29.095 1.00 32.90  ? 155 TRP B CD1 1 
ATOM   2604 C  CD2 . TRP B 1 155 ? -7.597  1.744   -30.883 1.00 31.54  ? 155 TRP B CD2 1 
ATOM   2605 N  NE1 . TRP B 1 155 ? -7.249  -0.360  -30.192 1.00 34.47  ? 155 TRP B NE1 1 
ATOM   2606 C  CE2 . TRP B 1 155 ? -7.233  0.445   -31.300 1.00 30.51  ? 155 TRP B CE2 1 
ATOM   2607 C  CE3 . TRP B 1 155 ? -7.659  2.768   -31.838 1.00 30.74  ? 155 TRP B CE3 1 
ATOM   2608 C  CZ2 . TRP B 1 155 ? -6.934  0.143   -32.630 1.00 30.62  ? 155 TRP B CZ2 1 
ATOM   2609 C  CZ3 . TRP B 1 155 ? -7.363  2.471   -33.159 1.00 30.18  ? 155 TRP B CZ3 1 
ATOM   2610 C  CH2 . TRP B 1 155 ? -7.004  1.165   -33.544 1.00 31.55  ? 155 TRP B CH2 1 
ATOM   2611 N  N   . GLN B 1 156 ? -7.755  6.065   -28.235 1.00 35.14  ? 156 GLN B N   1 
ATOM   2612 C  CA  . GLN B 1 156 ? -8.209  7.285   -27.590 1.00 35.10  ? 156 GLN B CA  1 
ATOM   2613 C  C   . GLN B 1 156 ? -9.469  6.995   -26.799 1.00 34.59  ? 156 GLN B C   1 
ATOM   2614 O  O   . GLN B 1 156 ? -10.321 6.208   -27.225 1.00 33.70  ? 156 GLN B O   1 
ATOM   2615 C  CB  . GLN B 1 156 ? -8.519  8.352   -28.631 1.00 38.86  ? 156 GLN B CB  1 
ATOM   2616 C  CG  . GLN B 1 156 ? -7.417  8.590   -29.637 1.00 45.13  ? 156 GLN B CG  1 
ATOM   2617 C  CD  . GLN B 1 156 ? -7.125  10.071  -29.816 1.00 50.75  ? 156 GLN B CD  1 
ATOM   2618 O  OE1 . GLN B 1 156 ? -6.118  10.582  -29.316 1.00 51.70  ? 156 GLN B OE1 1 
ATOM   2619 N  NE2 . GLN B 1 156 ? -8.017  10.775  -30.518 1.00 53.28  ? 156 GLN B NE2 1 
ATOM   2620 N  N   . GLY B 1 157 ? -9.584  7.635   -25.642 1.00 32.91  ? 157 GLY B N   1 
ATOM   2621 C  CA  . GLY B 1 157 ? -10.753 7.446   -24.813 1.00 30.47  ? 157 GLY B CA  1 
ATOM   2622 C  C   . GLY B 1 157 ? -10.882 6.076   -24.187 1.00 29.84  ? 157 GLY B C   1 
ATOM   2623 O  O   . GLY B 1 157 ? -11.849 5.838   -23.479 1.00 28.68  ? 157 GLY B O   1 
ATOM   2624 N  N   . LEU B 1 158 ? -9.930  5.176   -24.422 1.00 30.76  ? 158 LEU B N   1 
ATOM   2625 C  CA  . LEU B 1 158 ? -10.020 3.837   -23.825 1.00 30.93  ? 158 LEU B CA  1 
ATOM   2626 C  C   . LEU B 1 158 ? -8.819  3.418   -22.970 1.00 29.91  ? 158 LEU B C   1 
ATOM   2627 O  O   . LEU B 1 158 ? -7.687  3.805   -23.238 1.00 26.99  ? 158 LEU B O   1 
ATOM   2628 C  CB  . LEU B 1 158 ? -10.225 2.794   -24.920 1.00 29.63  ? 158 LEU B CB  1 
ATOM   2629 C  CG  . LEU B 1 158 ? -11.494 2.926   -25.750 1.00 28.85  ? 158 LEU B CG  1 
ATOM   2630 C  CD1 . LEU B 1 158 ? -11.469 1.885   -26.877 1.00 29.76  ? 158 LEU B CD1 1 
ATOM   2631 C  CD2 . LEU B 1 158 ? -12.709 2.757   -24.858 1.00 25.67  ? 158 LEU B CD2 1 
ATOM   2632 N  N   . PRO B 1 159 ? -9.063  2.600   -21.935 1.00 30.97  ? 159 PRO B N   1 
ATOM   2633 C  CA  . PRO B 1 159 ? -8.043  2.086   -21.004 1.00 31.87  ? 159 PRO B CA  1 
ATOM   2634 C  C   . PRO B 1 159 ? -6.983  1.263   -21.742 1.00 31.45  ? 159 PRO B C   1 
ATOM   2635 O  O   . PRO B 1 159 ? -7.193  0.860   -22.881 1.00 28.89  ? 159 PRO B O   1 
ATOM   2636 C  CB  . PRO B 1 159 ? -8.851  1.203   -20.054 1.00 31.28  ? 159 PRO B CB  1 
ATOM   2637 C  CG  . PRO B 1 159 ? -10.217 1.779   -20.106 1.00 32.33  ? 159 PRO B CG  1 
ATOM   2638 C  CD  . PRO B 1 159 ? -10.395 2.094   -21.572 1.00 30.67  ? 159 PRO B CD  1 
ATOM   2639 N  N   . TYR B 1 160 ? -5.854  0.998   -21.093 1.00 33.49  ? 160 TYR B N   1 
ATOM   2640 C  CA  . TYR B 1 160 ? -4.807  0.193   -21.720 1.00 34.49  ? 160 TYR B CA  1 
ATOM   2641 C  C   . TYR B 1 160 ? -5.230  -1.258  -21.876 1.00 34.33  ? 160 TYR B C   1 
ATOM   2642 O  O   . TYR B 1 160 ? -4.641  -2.006  -22.658 1.00 34.81  ? 160 TYR B O   1 
ATOM   2643 C  CB  . TYR B 1 160 ? -3.511  0.272   -20.919 1.00 34.42  ? 160 TYR B CB  1 
ATOM   2644 C  CG  . TYR B 1 160 ? -2.628  1.397   -21.397 1.00 34.88  ? 160 TYR B CG  1 
ATOM   2645 C  CD1 . TYR B 1 160 ? -2.953  2.732   -21.137 1.00 33.73  ? 160 TYR B CD1 1 
ATOM   2646 C  CD2 . TYR B 1 160 ? -1.513  1.135   -22.175 1.00 33.58  ? 160 TYR B CD2 1 
ATOM   2647 C  CE1 . TYR B 1 160 ? -2.183  3.774   -21.654 1.00 32.64  ? 160 TYR B CE1 1 
ATOM   2648 C  CE2 . TYR B 1 160 ? -0.744  2.167   -22.691 1.00 35.65  ? 160 TYR B CE2 1 
ATOM   2649 C  CZ  . TYR B 1 160 ? -1.081  3.481   -22.434 1.00 32.97  ? 160 TYR B CZ  1 
ATOM   2650 O  OH  . TYR B 1 160 ? -0.314  4.480   -22.979 1.00 32.61  ? 160 TYR B OH  1 
ATOM   2651 N  N   . SER B 1 161 ? -6.262  -1.645  -21.134 1.00 33.65  ? 161 SER B N   1 
ATOM   2652 C  CA  . SER B 1 161 ? -6.788  -3.000  -21.193 1.00 34.48  ? 161 SER B CA  1 
ATOM   2653 C  C   . SER B 1 161 ? -7.500  -3.239  -22.516 1.00 35.51  ? 161 SER B C   1 
ATOM   2654 O  O   . SER B 1 161 ? -7.957  -4.350  -22.785 1.00 36.89  ? 161 SER B O   1 
ATOM   2655 C  CB  . SER B 1 161 ? -7.771  -3.225  -20.055 1.00 31.67  ? 161 SER B CB  1 
ATOM   2656 O  OG  . SER B 1 161 ? -8.738  -2.194  -20.054 1.00 36.10  ? 161 SER B OG  1 
ATOM   2657 N  N   . GLU B 1 162 ? -7.597  -2.192  -23.330 1.00 36.20  ? 162 GLU B N   1 
ATOM   2658 C  CA  . GLU B 1 162 ? -8.264  -2.269  -24.628 1.00 36.53  ? 162 GLU B CA  1 
ATOM   2659 C  C   . GLU B 1 162 ? -7.279  -2.158  -25.773 1.00 37.06  ? 162 GLU B C   1 
ATOM   2660 O  O   . GLU B 1 162 ? -7.678  -2.065  -26.930 1.00 38.53  ? 162 GLU B O   1 
ATOM   2661 C  CB  . GLU B 1 162 ? -9.304  -1.158  -24.769 1.00 36.66  ? 162 GLU B CB  1 
ATOM   2662 C  CG  . GLU B 1 162 ? -10.349 -1.182  -23.684 1.00 42.01  ? 162 GLU B CG  1 
ATOM   2663 C  CD  . GLU B 1 162 ? -11.149 -2.469  -23.674 1.00 43.72  ? 162 GLU B CD  1 
ATOM   2664 O  OE1 . GLU B 1 162 ? -11.730 -2.796  -22.619 1.00 47.85  ? 162 GLU B OE1 1 
ATOM   2665 O  OE2 . GLU B 1 162 ? -11.207 -3.149  -24.720 1.00 44.95  ? 162 GLU B OE2 1 
ATOM   2666 N  N   . CYS B 1 163 ? -5.993  -2.133  -25.460 1.00 36.49  ? 163 CYS B N   1 
ATOM   2667 C  CA  . CYS B 1 163 ? -5.005  -2.052  -26.510 1.00 36.78  ? 163 CYS B CA  1 
ATOM   2668 C  C   . CYS B 1 163 ? -5.226  -3.288  -27.348 1.00 36.21  ? 163 CYS B C   1 
ATOM   2669 O  O   . CYS B 1 163 ? -5.754  -4.287  -26.858 1.00 36.42  ? 163 CYS B O   1 
ATOM   2670 C  CB  . CYS B 1 163 ? -3.596  -2.064  -25.928 1.00 37.71  ? 163 CYS B CB  1 
ATOM   2671 S  SG  . CYS B 1 163 ? -3.261  -0.680  -24.844 1.00 42.26  ? 163 CYS B SG  1 
ATOM   2672 N  N   . SER B 1 164 ? -4.815  -3.233  -28.607 1.00 36.40  ? 164 SER B N   1 
ATOM   2673 C  CA  . SER B 1 164 ? -5.003  -4.368  -29.488 1.00 34.80  ? 164 SER B CA  1 
ATOM   2674 C  C   . SER B 1 164 ? -3.959  -4.431  -30.584 1.00 34.28  ? 164 SER B C   1 
ATOM   2675 O  O   . SER B 1 164 ? -3.381  -3.415  -30.967 1.00 34.60  ? 164 SER B O   1 
ATOM   2676 C  CB  . SER B 1 164 ? -6.392  -4.290  -30.111 1.00 33.46  ? 164 SER B CB  1 
ATOM   2677 O  OG  . SER B 1 164 ? -6.560  -3.037  -30.749 1.00 31.39  ? 164 SER B OG  1 
ATOM   2678 N  N   . TRP B 1 165 ? -3.695  -5.638  -31.071 1.00 33.55  ? 165 TRP B N   1 
ATOM   2679 C  CA  . TRP B 1 165 ? -2.755  -5.795  -32.161 1.00 34.51  ? 165 TRP B CA  1 
ATOM   2680 C  C   . TRP B 1 165 ? -3.532  -5.537  -33.456 1.00 35.29  ? 165 TRP B C   1 
ATOM   2681 O  O   . TRP B 1 165 ? -4.675  -5.975  -33.618 1.00 33.27  ? 165 TRP B O   1 
ATOM   2682 C  CB  . TRP B 1 165 ? -2.145  -7.199  -32.164 1.00 32.24  ? 165 TRP B CB  1 
ATOM   2683 C  CG  . TRP B 1 165 ? -1.100  -7.382  -31.125 1.00 29.46  ? 165 TRP B CG  1 
ATOM   2684 C  CD1 . TRP B 1 165 ? -1.237  -8.016  -29.915 1.00 30.09  ? 165 TRP B CD1 1 
ATOM   2685 C  CD2 . TRP B 1 165 ? 0.260   -6.931  -31.190 1.00 27.81  ? 165 TRP B CD2 1 
ATOM   2686 N  NE1 . TRP B 1 165 ? -0.039  -7.989  -29.223 1.00 27.66  ? 165 TRP B NE1 1 
ATOM   2687 C  CE2 . TRP B 1 165 ? 0.895   -7.333  -29.982 1.00 27.62  ? 165 TRP B CE2 1 
ATOM   2688 C  CE3 . TRP B 1 165 ? 1.008   -6.233  -32.149 1.00 25.03  ? 165 TRP B CE3 1 
ATOM   2689 C  CZ2 . TRP B 1 165 ? 2.240   -7.060  -29.714 1.00 25.70  ? 165 TRP B CZ2 1 
ATOM   2690 C  CZ3 . TRP B 1 165 ? 2.350   -5.962  -31.881 1.00 24.83  ? 165 TRP B CZ3 1 
ATOM   2691 C  CH2 . TRP B 1 165 ? 2.949   -6.379  -30.670 1.00 25.17  ? 165 TRP B CH2 1 
ATOM   2692 N  N   . GLU B 1 166 ? -2.904  -4.819  -34.376 1.00 37.84  ? 166 GLU B N   1 
ATOM   2693 C  CA  . GLU B 1 166 ? -3.550  -4.471  -35.631 1.00 40.17  ? 166 GLU B CA  1 
ATOM   2694 C  C   . GLU B 1 166 ? -2.576  -4.559  -36.797 1.00 41.62  ? 166 GLU B C   1 
ATOM   2695 O  O   . GLU B 1 166 ? -1.388  -4.278  -36.646 1.00 41.87  ? 166 GLU B O   1 
ATOM   2696 C  CB  . GLU B 1 166 ? -4.107  -3.045  -35.535 1.00 39.32  ? 166 GLU B CB  1 
ATOM   2697 C  CG  . GLU B 1 166 ? -5.027  -2.821  -34.339 1.00 39.29  ? 166 GLU B CG  1 
ATOM   2698 C  CD  . GLU B 1 166 ? -6.424  -3.424  -34.520 1.00 40.32  ? 166 GLU B CD  1 
ATOM   2699 O  OE1 . GLU B 1 166 ? -7.184  -3.443  -33.524 1.00 37.66  ? 166 GLU B OE1 1 
ATOM   2700 O  OE2 . GLU B 1 166 ? -6.771  -3.861  -35.645 1.00 37.79  ? 166 GLU B OE2 1 
ATOM   2701 N  N   . ASP B 1 167 ? -3.100  -4.938  -37.960 1.00 44.35  ? 167 ASP B N   1 
ATOM   2702 C  CA  . ASP B 1 167 ? -2.306  -5.068  -39.174 1.00 44.71  ? 167 ASP B CA  1 
ATOM   2703 C  C   . ASP B 1 167 ? -1.570  -3.764  -39.442 1.00 45.35  ? 167 ASP B C   1 
ATOM   2704 O  O   . ASP B 1 167 ? -2.172  -2.699  -39.449 1.00 45.93  ? 167 ASP B O   1 
ATOM   2705 C  CB  . ASP B 1 167 ? -3.222  -5.407  -40.344 1.00 45.21  ? 167 ASP B CB  1 
ATOM   2706 C  CG  . ASP B 1 167 ? -2.457  -5.661  -41.614 1.00 46.71  ? 167 ASP B CG  1 
ATOM   2707 O  OD1 . ASP B 1 167 ? -1.591  -6.563  -41.622 1.00 47.48  ? 167 ASP B OD1 1 
ATOM   2708 O  OD2 . ASP B 1 167 ? -2.716  -4.954  -42.609 1.00 49.18  ? 167 ASP B OD2 1 
ATOM   2709 N  N   . GLY B 1 168 ? -0.266  -3.852  -39.665 1.00 46.98  ? 168 GLY B N   1 
ATOM   2710 C  CA  . GLY B 1 168 ? 0.523   -2.656  -39.898 1.00 50.38  ? 168 GLY B CA  1 
ATOM   2711 C  C   . GLY B 1 168 ? 0.172   -1.865  -41.145 1.00 52.07  ? 168 GLY B C   1 
ATOM   2712 O  O   . GLY B 1 168 ? 0.179   -0.634  -41.134 1.00 52.78  ? 168 GLY B O   1 
ATOM   2713 N  N   . ALA B 1 169 ? -0.125  -2.560  -42.233 1.00 53.09  ? 169 ALA B N   1 
ATOM   2714 C  CA  . ALA B 1 169 ? -0.463  -1.879  -43.467 1.00 53.23  ? 169 ALA B CA  1 
ATOM   2715 C  C   . ALA B 1 169 ? -1.684  -0.989  -43.265 1.00 54.73  ? 169 ALA B C   1 
ATOM   2716 O  O   . ALA B 1 169 ? -1.728  0.144   -43.750 1.00 55.10  ? 169 ALA B O   1 
ATOM   2717 C  CB  . ALA B 1 169 ? -0.734  -2.900  -44.554 1.00 54.39  ? 169 ALA B CB  1 
ATOM   2718 N  N   . LEU B 1 170 ? -2.670  -1.506  -42.536 1.00 54.99  ? 170 LEU B N   1 
ATOM   2719 C  CA  . LEU B 1 170 ? -3.907  -0.779  -42.279 1.00 55.27  ? 170 LEU B CA  1 
ATOM   2720 C  C   . LEU B 1 170 ? -3.784  0.406   -41.337 1.00 56.31  ? 170 LEU B C   1 
ATOM   2721 O  O   . LEU B 1 170 ? -4.401  1.450   -41.552 1.00 57.12  ? 170 LEU B O   1 
ATOM   2722 C  CB  . LEU B 1 170 ? -4.974  -1.721  -41.727 1.00 55.91  ? 170 LEU B CB  1 
ATOM   2723 C  CG  . LEU B 1 170 ? -6.251  -1.012  -41.252 1.00 55.92  ? 170 LEU B CG  1 
ATOM   2724 C  CD1 . LEU B 1 170 ? -6.794  -0.115  -42.367 1.00 55.06  ? 170 LEU B CD1 1 
ATOM   2725 C  CD2 . LEU B 1 170 ? -7.289  -2.044  -40.839 1.00 55.31  ? 170 LEU B CD2 1 
ATOM   2726 N  N   . ILE B 1 171 ? -3.009  0.242   -40.275 1.00 56.90  ? 171 ILE B N   1 
ATOM   2727 C  CA  . ILE B 1 171 ? -2.850  1.321   -39.321 1.00 57.04  ? 171 ILE B CA  1 
ATOM   2728 C  C   . ILE B 1 171 ? -1.998  2.451   -39.876 1.00 58.88  ? 171 ILE B C   1 
ATOM   2729 O  O   . ILE B 1 171 ? -2.228  3.623   -39.569 1.00 60.36  ? 171 ILE B O   1 
ATOM   2730 C  CB  . ILE B 1 171 ? -2.253  0.802   -37.995 1.00 55.43  ? 171 ILE B CB  1 
ATOM   2731 C  CG1 . ILE B 1 171 ? -3.387  0.632   -36.984 1.00 55.54  ? 171 ILE B CG1 1 
ATOM   2732 C  CG2 . ILE B 1 171 ? -1.159  1.724   -37.495 1.00 51.87  ? 171 ILE B CG2 1 
ATOM   2733 C  CD1 . ILE B 1 171 ? -3.036  1.076   -35.595 1.00 57.58  ? 171 ILE B CD1 1 
ATOM   2734 N  N   . SER B 1 172 ? -1.028  2.098   -40.710 1.00 58.71  ? 172 SER B N   1 
ATOM   2735 C  CA  . SER B 1 172 ? -0.136  3.085   -41.295 1.00 59.71  ? 172 SER B CA  1 
ATOM   2736 C  C   . SER B 1 172 ? -0.847  3.998   -42.293 1.00 59.71  ? 172 SER B C   1 
ATOM   2737 O  O   . SER B 1 172 ? -0.524  5.178   -42.402 1.00 59.62  ? 172 SER B O   1 
ATOM   2738 C  CB  . SER B 1 172 ? 1.028   2.382   -41.988 1.00 59.80  ? 172 SER B CB  1 
ATOM   2739 O  OG  . SER B 1 172 ? 0.559   1.646   -43.102 1.00 62.71  ? 172 SER B OG  1 
ATOM   2740 N  N   . LYS B 1 173 ? -1.812  3.455   -43.025 1.00 59.95  ? 173 LYS B N   1 
ATOM   2741 C  CA  . LYS B 1 173 ? -2.535  4.249   -44.011 1.00 59.78  ? 173 LYS B CA  1 
ATOM   2742 C  C   . LYS B 1 173 ? -3.201  5.478   -43.412 1.00 57.90  ? 173 LYS B C   1 
ATOM   2743 O  O   . LYS B 1 173 ? -3.527  6.415   -44.134 1.00 57.35  ? 173 LYS B O   1 
ATOM   2744 C  CB  . LYS B 1 173 ? -3.587  3.394   -44.726 1.00 62.49  ? 173 LYS B CB  1 
ATOM   2745 C  CG  . LYS B 1 173 ? -2.994  2.333   -45.649 1.00 66.94  ? 173 LYS B CG  1 
ATOM   2746 C  CD  . LYS B 1 173 ? -4.077  1.513   -46.337 1.00 69.90  ? 173 LYS B CD  1 
ATOM   2747 C  CE  . LYS B 1 173 ? -3.468  0.417   -47.208 1.00 72.34  ? 173 LYS B CE  1 
ATOM   2748 N  NZ  . LYS B 1 173 ? -4.495  -0.477  -47.820 1.00 72.77  ? 173 LYS B NZ  1 
ATOM   2749 N  N   . LYS B 1 174 ? -3.401  5.485   -42.098 1.00 55.44  ? 174 LYS B N   1 
ATOM   2750 C  CA  . LYS B 1 174 ? -4.043  6.627   -41.453 1.00 52.96  ? 174 LYS B CA  1 
ATOM   2751 C  C   . LYS B 1 174 ? -3.317  7.190   -40.231 1.00 52.02  ? 174 LYS B C   1 
ATOM   2752 O  O   . LYS B 1 174 ? -3.429  8.377   -39.932 1.00 52.49  ? 174 LYS B O   1 
ATOM   2753 C  CB  . LYS B 1 174 ? -5.474  6.262   -41.054 1.00 52.27  ? 174 LYS B CB  1 
ATOM   2754 C  CG  . LYS B 1 174 ? -6.256  7.415   -40.444 1.00 49.12  ? 174 LYS B CG  1 
ATOM   2755 C  CD  . LYS B 1 174 ? -7.666  6.987   -40.108 1.00 47.97  ? 174 LYS B CD  1 
ATOM   2756 C  CE  . LYS B 1 174 ? -8.482  8.156   -39.596 1.00 47.86  ? 174 LYS B CE  1 
ATOM   2757 N  NZ  . LYS B 1 174 ? -9.893  7.760   -39.289 1.00 48.13  ? 174 LYS B NZ  1 
ATOM   2758 N  N   . PHE B 1 175 ? -2.572  6.346   -39.530 1.00 50.06  ? 175 PHE B N   1 
ATOM   2759 C  CA  . PHE B 1 175 ? -1.867  6.781   -38.335 1.00 49.07  ? 175 PHE B CA  1 
ATOM   2760 C  C   . PHE B 1 175 ? -0.363  6.675   -38.470 1.00 50.49  ? 175 PHE B C   1 
ATOM   2761 O  O   . PHE B 1 175 ? 0.324   6.261   -37.533 1.00 50.71  ? 175 PHE B O   1 
ATOM   2762 C  CB  . PHE B 1 175 ? -2.338  5.955   -37.146 1.00 45.72  ? 175 PHE B CB  1 
ATOM   2763 C  CG  . PHE B 1 175 ? -3.825  5.921   -37.002 1.00 44.23  ? 175 PHE B CG  1 
ATOM   2764 C  CD1 . PHE B 1 175 ? -4.520  7.056   -36.600 1.00 42.02  ? 175 PHE B CD1 1 
ATOM   2765 C  CD2 . PHE B 1 175 ? -4.543  4.776   -37.345 1.00 44.27  ? 175 PHE B CD2 1 
ATOM   2766 C  CE1 . PHE B 1 175 ? -5.913  7.059   -36.545 1.00 42.80  ? 175 PHE B CE1 1 
ATOM   2767 C  CE2 . PHE B 1 175 ? -5.939  4.766   -37.293 1.00 44.39  ? 175 PHE B CE2 1 
ATOM   2768 C  CZ  . PHE B 1 175 ? -6.626  5.912   -36.893 1.00 43.59  ? 175 PHE B CZ  1 
ATOM   2769 N  N   . GLN B 1 176 ? 0.148   7.061   -39.633 1.00 51.63  ? 176 GLN B N   1 
ATOM   2770 C  CA  . GLN B 1 176 ? 1.579   7.008   -39.885 1.00 53.65  ? 176 GLN B CA  1 
ATOM   2771 C  C   . GLN B 1 176 ? 2.327   7.784   -38.811 1.00 54.51  ? 176 GLN B C   1 
ATOM   2772 O  O   . GLN B 1 176 ? 3.301   7.297   -38.243 1.00 54.91  ? 176 GLN B O   1 
ATOM   2773 C  CB  . GLN B 1 176 ? 1.902   7.604   -41.254 1.00 55.35  ? 176 GLN B CB  1 
ATOM   2774 C  CG  . GLN B 1 176 ? 3.331   7.352   -41.689 1.00 56.34  ? 176 GLN B CG  1 
ATOM   2775 C  CD  . GLN B 1 176 ? 3.631   5.873   -41.803 1.00 57.09  ? 176 GLN B CD  1 
ATOM   2776 O  OE1 . GLN B 1 176 ? 2.942   5.142   -42.518 1.00 58.07  ? 176 GLN B OE1 1 
ATOM   2777 N  NE2 . GLN B 1 176 ? 4.660   5.421   -41.099 1.00 57.16  ? 176 GLN B NE2 1 
ATOM   2778 N  N   . ALA B 1 177 ? 1.859   8.997   -38.540 1.00 55.23  ? 177 ALA B N   1 
ATOM   2779 C  CA  . ALA B 1 177 ? 2.470   9.857   -37.538 1.00 57.52  ? 177 ALA B CA  1 
ATOM   2780 C  C   . ALA B 1 177 ? 2.650   9.132   -36.215 1.00 59.51  ? 177 ALA B C   1 
ATOM   2781 O  O   . ALA B 1 177 ? 3.703   9.224   -35.581 1.00 58.34  ? 177 ALA B O   1 
ATOM   2782 C  CB  . ALA B 1 177 ? 1.610   11.092  -37.331 1.00 58.10  ? 177 ALA B CB  1 
HETATM 2783 N  N   . MSE B 1 178 ? 1.612   8.409   -35.810 1.00 61.45  ? 178 MSE B N   1 
HETATM 2784 C  CA  . MSE B 1 178 ? 1.633   7.675   -34.558 1.00 63.15  ? 178 MSE B CA  1 
HETATM 2785 C  C   . MSE B 1 178 ? 2.669   6.565   -34.497 1.00 62.83  ? 178 MSE B C   1 
HETATM 2786 O  O   . MSE B 1 178 ? 3.056   6.139   -33.403 1.00 63.59  ? 178 MSE B O   1 
HETATM 2787 C  CB  . MSE B 1 178 ? 0.249   7.092   -34.274 1.00 66.59  ? 178 MSE B CB  1 
HETATM 2788 C  CG  . MSE B 1 178 ? -0.808  8.136   -33.976 1.00 71.07  ? 178 MSE B CG  1 
HETATM 2789 SE SE  . MSE B 1 178 ? -0.247  9.345   -32.591 1.00 77.82  ? 178 MSE B SE  1 
HETATM 2790 C  CE  . MSE B 1 178 ? -0.242  8.157   -31.138 1.00 74.68  ? 178 MSE B CE  1 
ATOM   2791 N  N   . ILE B 1 179 ? 3.124   6.090   -35.652 1.00 61.80  ? 179 ILE B N   1 
ATOM   2792 C  CA  . ILE B 1 179 ? 4.108   5.022   -35.653 1.00 62.20  ? 179 ILE B CA  1 
ATOM   2793 C  C   . ILE B 1 179 ? 5.519   5.585   -35.829 1.00 62.19  ? 179 ILE B C   1 
ATOM   2794 O  O   . ILE B 1 179 ? 6.500   4.965   -35.412 1.00 62.06  ? 179 ILE B O   1 
ATOM   2795 C  CB  . ILE B 1 179 ? 3.782   3.959   -36.744 1.00 63.25  ? 179 ILE B CB  1 
ATOM   2796 C  CG1 . ILE B 1 179 ? 4.521   4.267   -38.041 1.00 64.59  ? 179 ILE B CG1 1 
ATOM   2797 C  CG2 . ILE B 1 179 ? 2.288   3.916   -36.997 1.00 62.55  ? 179 ILE B CG2 1 
ATOM   2798 C  CD1 . ILE B 1 179 ? 5.924   3.698   -38.072 1.00 67.04  ? 179 ILE B CD1 1 
ATOM   2799 N  N   . ASP B 1 180 ? 5.623   6.759   -36.446 1.00 61.82  ? 180 ASP B N   1 
ATOM   2800 C  CA  . ASP B 1 180 ? 6.925   7.385   -36.621 1.00 61.24  ? 180 ASP B CA  1 
ATOM   2801 C  C   . ASP B 1 180 ? 7.362   7.921   -35.258 1.00 61.25  ? 180 ASP B C   1 
ATOM   2802 O  O   . ASP B 1 180 ? 8.547   7.919   -34.918 1.00 62.46  ? 180 ASP B O   1 
ATOM   2803 C  CB  . ASP B 1 180 ? 6.852   8.513   -37.656 1.00 60.48  ? 180 ASP B CB  1 
ATOM   2804 C  CG  . ASP B 1 180 ? 6.700   7.988   -39.079 1.00 61.15  ? 180 ASP B CG  1 
ATOM   2805 O  OD1 . ASP B 1 180 ? 7.270   6.917   -39.381 1.00 62.46  ? 180 ASP B OD1 1 
ATOM   2806 O  OD2 . ASP B 1 180 ? 6.026   8.644   -39.903 1.00 61.38  ? 180 ASP B OD2 1 
ATOM   2807 N  N   . GLU B 1 181 ? 6.394   8.370   -34.471 1.00 60.87  ? 181 GLU B N   1 
ATOM   2808 C  CA  . GLU B 1 181 ? 6.680   8.873   -33.134 1.00 61.64  ? 181 GLU B CA  1 
ATOM   2809 C  C   . GLU B 1 181 ? 7.142   7.710   -32.257 1.00 61.63  ? 181 GLU B C   1 
ATOM   2810 O  O   . GLU B 1 181 ? 8.027   7.857   -31.408 1.00 62.11  ? 181 GLU B O   1 
ATOM   2811 C  CB  . GLU B 1 181 ? 5.429   9.504   -32.523 1.00 61.20  ? 181 GLU B CB  1 
ATOM   2812 C  CG  . GLU B 1 181 ? 5.145   10.907  -33.005 1.00 62.99  ? 181 GLU B CG  1 
ATOM   2813 C  CD  . GLU B 1 181 ? 3.861   11.462  -32.426 1.00 63.58  ? 181 GLU B CD  1 
ATOM   2814 O  OE1 . GLU B 1 181 ? 3.651   11.335  -31.204 1.00 64.63  ? 181 GLU B OE1 1 
ATOM   2815 O  OE2 . GLU B 1 181 ? 3.062   12.033  -33.192 1.00 65.15  ? 181 GLU B OE2 1 
ATOM   2816 N  N   . TYR B 1 182 ? 6.524   6.555   -32.469 1.00 60.46  ? 182 TYR B N   1 
ATOM   2817 C  CA  . TYR B 1 182 ? 6.855   5.355   -31.717 1.00 59.91  ? 182 TYR B CA  1 
ATOM   2818 C  C   . TYR B 1 182 ? 8.328   4.989   -31.887 1.00 61.14  ? 182 TYR B C   1 
ATOM   2819 O  O   . TYR B 1 182 ? 8.995   4.593   -30.930 1.00 60.34  ? 182 TYR B O   1 
ATOM   2820 C  CB  . TYR B 1 182 ? 5.988   4.192   -32.195 1.00 57.10  ? 182 TYR B CB  1 
ATOM   2821 C  CG  . TYR B 1 182 ? 6.451   2.840   -31.711 1.00 55.20  ? 182 TYR B CG  1 
ATOM   2822 C  CD1 . TYR B 1 182 ? 6.273   2.456   -30.384 1.00 54.26  ? 182 TYR B CD1 1 
ATOM   2823 C  CD2 . TYR B 1 182 ? 7.063   1.937   -32.585 1.00 54.14  ? 182 TYR B CD2 1 
ATOM   2824 C  CE1 . TYR B 1 182 ? 6.689   1.197   -29.939 1.00 54.24  ? 182 TYR B CE1 1 
ATOM   2825 C  CE2 . TYR B 1 182 ? 7.481   0.683   -32.154 1.00 53.11  ? 182 TYR B CE2 1 
ATOM   2826 C  CZ  . TYR B 1 182 ? 7.293   0.316   -30.831 1.00 53.20  ? 182 TYR B CZ  1 
ATOM   2827 O  OH  . TYR B 1 182 ? 7.698   -0.931  -30.403 1.00 52.09  ? 182 TYR B OH  1 
ATOM   2828 N  N   . PHE B 1 183 ? 8.828   5.108   -33.112 1.00 62.82  ? 183 PHE B N   1 
ATOM   2829 C  CA  . PHE B 1 183 ? 10.213  4.767   -33.384 1.00 64.42  ? 183 PHE B CA  1 
ATOM   2830 C  C   . PHE B 1 183 ? 11.178  5.856   -32.954 1.00 65.89  ? 183 PHE B C   1 
ATOM   2831 O  O   . PHE B 1 183 ? 12.338  5.571   -32.655 1.00 65.67  ? 183 PHE B O   1 
ATOM   2832 C  CB  . PHE B 1 183 ? 10.393  4.422   -34.863 1.00 63.94  ? 183 PHE B CB  1 
ATOM   2833 C  CG  . PHE B 1 183 ? 9.916   3.039   -35.214 1.00 62.97  ? 183 PHE B CG  1 
ATOM   2834 C  CD1 . PHE B 1 183 ? 8.937   2.846   -36.184 1.00 63.13  ? 183 PHE B CD1 1 
ATOM   2835 C  CD2 . PHE B 1 183 ? 10.426  1.929   -34.551 1.00 61.81  ? 183 PHE B CD2 1 
ATOM   2836 C  CE1 . PHE B 1 183 ? 8.471   1.567   -36.484 1.00 61.73  ? 183 PHE B CE1 1 
ATOM   2837 C  CE2 . PHE B 1 183 ? 9.968   0.648   -34.842 1.00 61.07  ? 183 PHE B CE2 1 
ATOM   2838 C  CZ  . PHE B 1 183 ? 8.989   0.466   -35.809 1.00 61.04  ? 183 PHE B CZ  1 
ATOM   2839 N  N   . SER B 1 184 ? 10.708  7.099   -32.911 1.00 68.03  ? 184 SER B N   1 
ATOM   2840 C  CA  . SER B 1 184 ? 11.571  8.182   -32.468 1.00 70.30  ? 184 SER B CA  1 
ATOM   2841 C  C   . SER B 1 184 ? 11.801  7.956   -30.968 1.00 72.31  ? 184 SER B C   1 
ATOM   2842 O  O   . SER B 1 184 ? 12.728  8.511   -30.374 1.00 73.36  ? 184 SER B O   1 
ATOM   2843 C  CB  . SER B 1 184 ? 10.909  9.544   -32.706 1.00 69.37  ? 184 SER B CB  1 
ATOM   2844 O  OG  . SER B 1 184 ? 10.231  10.004  -31.548 1.00 69.69  ? 184 SER B OG  1 
ATOM   2845 N  N   . ARG B 1 185 ? 10.947  7.136   -30.365 1.00 73.86  ? 185 ARG B N   1 
ATOM   2846 C  CA  . ARG B 1 185 ? 11.103  6.760   -28.965 1.00 76.23  ? 185 ARG B CA  1 
ATOM   2847 C  C   . ARG B 1 185 ? 12.180  5.693   -28.798 1.00 78.24  ? 185 ARG B C   1 
ATOM   2848 O  O   . ARG B 1 185 ? 11.982  4.703   -28.094 1.00 79.06  ? 185 ARG B O   1 
ATOM   2849 C  CB  . ARG B 1 185 ? 9.779   6.275   -28.395 1.00 76.80  ? 185 ARG B CB  1 
ATOM   2850 N  N   . LYS B 1 186 ? 13.319  5.903   -29.449 1.00 80.34  ? 186 LYS B N   1 
ATOM   2851 C  CA  . LYS B 1 186 ? 14.531  5.156   -29.132 1.00 82.97  ? 186 LYS B CA  1 
ATOM   2852 C  C   . LYS B 1 186 ? 15.739  5.729   -29.866 1.00 84.63  ? 186 LYS B C   1 
ATOM   2853 O  O   . LYS B 1 186 ? 16.577  6.406   -29.269 1.00 85.54  ? 186 LYS B O   1 
ATOM   2854 C  CB  . LYS B 1 186 ? 14.356  3.677   -29.483 1.00 82.89  ? 186 LYS B CB  1 
ATOM   2855 C  CG  . LYS B 1 186 ? 15.338  2.753   -28.781 1.00 83.43  ? 186 LYS B CG  1 
ATOM   2856 C  CD  . LYS B 1 186 ? 16.228  2.031   -29.780 1.00 83.99  ? 186 LYS B CD  1 
ATOM   2857 C  CE  . LYS B 1 186 ? 17.545  2.763   -29.976 1.00 83.79  ? 186 LYS B CE  1 
ATOM   2858 N  NZ  . LYS B 1 186 ? 18.581  1.888   -30.591 1.00 83.17  ? 186 LYS B NZ  1 
ATOM   2859 N  N   . GLU C 2 12  ? -72.972 6.893   -25.581 1.00 75.51  ? 12  GLU C N   1 
ATOM   2860 C  CA  . GLU C 2 12  ? -71.584 7.437   -25.498 1.00 76.32  ? 12  GLU C CA  1 
ATOM   2861 C  C   . GLU C 2 12  ? -70.587 6.288   -25.690 1.00 75.97  ? 12  GLU C C   1 
ATOM   2862 O  O   . GLU C 2 12  ? -70.064 5.734   -24.724 1.00 77.02  ? 12  GLU C O   1 
ATOM   2863 C  CB  . GLU C 2 12  ? -71.362 8.105   -24.136 1.00 77.53  ? 12  GLU C CB  1 
ATOM   2864 C  CG  . GLU C 2 12  ? -72.622 8.242   -23.284 1.00 80.93  ? 12  GLU C CG  1 
ATOM   2865 C  CD  . GLU C 2 12  ? -73.267 9.623   -23.361 1.00 83.70  ? 12  GLU C CD  1 
ATOM   2866 O  OE1 . GLU C 2 12  ? -72.769 10.557  -22.691 1.00 85.22  ? 12  GLU C OE1 1 
ATOM   2867 O  OE2 . GLU C 2 12  ? -74.273 9.774   -24.093 1.00 85.21  ? 12  GLU C OE2 1 
ATOM   2868 N  N   . PHE C 2 13  ? -70.342 5.949   -26.953 1.00 75.00  ? 13  PHE C N   1 
ATOM   2869 C  CA  . PHE C 2 13  ? -69.446 4.864   -27.390 1.00 72.97  ? 13  PHE C CA  1 
ATOM   2870 C  C   . PHE C 2 13  ? -68.093 5.441   -27.868 1.00 70.69  ? 13  PHE C C   1 
ATOM   2871 O  O   . PHE C 2 13  ? -68.036 5.974   -28.975 1.00 72.10  ? 13  PHE C O   1 
ATOM   2872 C  CB  . PHE C 2 13  ? -70.076 4.179   -28.608 1.00 75.02  ? 13  PHE C CB  1 
ATOM   2873 C  CG  . PHE C 2 13  ? -70.792 2.870   -28.345 1.00 77.33  ? 13  PHE C CG  1 
ATOM   2874 C  CD1 . PHE C 2 13  ? -71.778 2.750   -27.368 1.00 77.74  ? 13  PHE C CD1 1 
ATOM   2875 C  CD2 . PHE C 2 13  ? -70.546 1.775   -29.182 1.00 78.34  ? 13  PHE C CD2 1 
ATOM   2876 C  CE1 . PHE C 2 13  ? -72.510 1.557   -27.238 1.00 78.40  ? 13  PHE C CE1 1 
ATOM   2877 C  CE2 . PHE C 2 13  ? -71.265 0.588   -29.064 1.00 78.79  ? 13  PHE C CE2 1 
ATOM   2878 C  CZ  . PHE C 2 13  ? -72.251 0.477   -28.091 1.00 79.28  ? 13  PHE C CZ  1 
ATOM   2879 N  N   . GLU C 2 14  ? -67.012 5.338   -27.095 1.00 66.91  ? 14  GLU C N   1 
ATOM   2880 C  CA  . GLU C 2 14  ? -65.719 5.868   -27.573 1.00 62.39  ? 14  GLU C CA  1 
ATOM   2881 C  C   . GLU C 2 14  ? -65.352 5.194   -28.900 1.00 59.23  ? 14  GLU C C   1 
ATOM   2882 O  O   . GLU C 2 14  ? -65.854 4.115   -29.192 1.00 58.42  ? 14  GLU C O   1 
ATOM   2883 C  CB  . GLU C 2 14  ? -64.609 5.626   -26.546 1.00 62.58  ? 14  GLU C CB  1 
ATOM   2884 C  CG  . GLU C 2 14  ? -64.694 6.498   -25.296 1.00 63.44  ? 14  GLU C CG  1 
ATOM   2885 C  CD  . GLU C 2 14  ? -64.320 7.953   -25.550 1.00 65.47  ? 14  GLU C CD  1 
ATOM   2886 O  OE1 . GLU C 2 14  ? -63.976 8.304   -26.703 1.00 66.56  ? 14  GLU C OE1 1 
ATOM   2887 O  OE2 . GLU C 2 14  ? -64.367 8.750   -24.587 1.00 66.33  ? 14  GLU C OE2 1 
ATOM   2888 N  N   . THR C 2 15  ? -64.477 5.817   -29.695 1.00 56.55  ? 15  THR C N   1 
ATOM   2889 C  CA  . THR C 2 15  ? -64.093 5.266   -31.007 1.00 54.59  ? 15  THR C CA  1 
ATOM   2890 C  C   . THR C 2 15  ? -62.585 5.251   -31.317 1.00 53.59  ? 15  THR C C   1 
ATOM   2891 O  O   . THR C 2 15  ? -61.868 6.201   -31.016 1.00 53.96  ? 15  THR C O   1 
ATOM   2892 C  CB  . THR C 2 15  ? -64.792 6.043   -32.156 1.00 53.49  ? 15  THR C CB  1 
ATOM   2893 O  OG1 . THR C 2 15  ? -66.157 6.294   -31.807 1.00 52.84  ? 15  THR C OG1 1 
ATOM   2894 C  CG2 . THR C 2 15  ? -64.765 5.237   -33.443 1.00 53.20  ? 15  THR C CG2 1 
ATOM   2895 N  N   . ILE C 2 16  ? -62.123 4.175   -31.952 1.00 52.30  ? 16  ILE C N   1 
ATOM   2896 C  CA  . ILE C 2 16  ? -60.712 4.012   -32.323 1.00 52.37  ? 16  ILE C CA  1 
ATOM   2897 C  C   . ILE C 2 16  ? -60.412 4.648   -33.676 1.00 53.37  ? 16  ILE C C   1 
ATOM   2898 O  O   . ILE C 2 16  ? -61.018 4.263   -34.680 1.00 54.12  ? 16  ILE C O   1 
ATOM   2899 C  CB  . ILE C 2 16  ? -60.315 2.525   -32.509 1.00 51.85  ? 16  ILE C CB  1 
ATOM   2900 C  CG1 . ILE C 2 16  ? -60.739 1.680   -31.310 1.00 52.15  ? 16  ILE C CG1 1 
ATOM   2901 C  CG2 . ILE C 2 16  ? -58.816 2.436   -32.759 1.00 50.27  ? 16  ILE C CG2 1 
ATOM   2902 C  CD1 . ILE C 2 16  ? -59.840 1.807   -30.111 1.00 55.83  ? 16  ILE C CD1 1 
ATOM   2903 N  N   . GLU C 2 17  ? -59.471 5.587   -33.731 1.00 53.17  ? 17  GLU C N   1 
ATOM   2904 C  CA  . GLU C 2 17  ? -59.150 6.181   -35.018 1.00 52.68  ? 17  GLU C CA  1 
ATOM   2905 C  C   . GLU C 2 17  ? -57.818 5.645   -35.529 1.00 53.00  ? 17  GLU C C   1 
ATOM   2906 O  O   . GLU C 2 17  ? -57.521 5.755   -36.719 1.00 54.33  ? 17  GLU C O   1 
ATOM   2907 C  CB  . GLU C 2 17  ? -59.165 7.721   -34.951 1.00 52.38  ? 17  GLU C CB  1 
ATOM   2908 C  CG  . GLU C 2 17  ? -57.816 8.425   -34.992 1.00 53.69  ? 17  GLU C CG  1 
ATOM   2909 C  CD  . GLU C 2 17  ? -57.918 9.866   -35.514 1.00 53.79  ? 17  GLU C CD  1 
ATOM   2910 O  OE1 . GLU C 2 17  ? -58.992 10.489  -35.350 1.00 51.80  ? 17  GLU C OE1 1 
ATOM   2911 O  OE2 . GLU C 2 17  ? -56.919 10.379  -36.077 1.00 54.06  ? 17  GLU C OE2 1 
ATOM   2912 N  N   . ARG C 2 18  ? -57.020 5.049   -34.644 1.00 51.84  ? 18  ARG C N   1 
ATOM   2913 C  CA  . ARG C 2 18  ? -55.745 4.474   -35.068 1.00 50.70  ? 18  ARG C CA  1 
ATOM   2914 C  C   . ARG C 2 18  ? -54.973 3.634   -34.060 1.00 49.41  ? 18  ARG C C   1 
ATOM   2915 O  O   . ARG C 2 18  ? -55.043 3.848   -32.847 1.00 48.93  ? 18  ARG C O   1 
ATOM   2916 C  CB  . ARG C 2 18  ? -54.803 5.556   -35.601 1.00 52.66  ? 18  ARG C CB  1 
ATOM   2917 C  CG  . ARG C 2 18  ? -54.463 5.361   -37.068 1.00 54.79  ? 18  ARG C CG  1 
ATOM   2918 C  CD  . ARG C 2 18  ? -53.006 5.663   -37.375 1.00 57.79  ? 18  ARG C CD  1 
ATOM   2919 N  NE  . ARG C 2 18  ? -52.712 5.496   -38.800 1.00 62.18  ? 18  ARG C NE  1 
ATOM   2920 C  CZ  . ARG C 2 18  ? -52.497 4.329   -39.408 1.00 63.30  ? 18  ARG C CZ  1 
ATOM   2921 N  NH1 . ARG C 2 18  ? -52.530 3.192   -38.722 1.00 65.03  ? 18  ARG C NH1 1 
ATOM   2922 N  NH2 . ARG C 2 18  ? -52.253 4.299   -40.712 1.00 62.84  ? 18  ARG C NH2 1 
ATOM   2923 N  N   . PHE C 2 19  ? -54.246 2.658   -34.590 1.00 46.96  ? 19  PHE C N   1 
ATOM   2924 C  CA  . PHE C 2 19  ? -53.398 1.790   -33.793 1.00 44.65  ? 19  PHE C CA  1 
ATOM   2925 C  C   . PHE C 2 19  ? -52.015 2.367   -34.053 1.00 45.64  ? 19  PHE C C   1 
ATOM   2926 O  O   . PHE C 2 19  ? -51.487 2.287   -35.165 1.00 47.63  ? 19  PHE C O   1 
ATOM   2927 C  CB  . PHE C 2 19  ? -53.506 0.342   -34.282 1.00 42.45  ? 19  PHE C CB  1 
ATOM   2928 C  CG  . PHE C 2 19  ? -54.693 -0.396  -33.716 1.00 40.08  ? 19  PHE C CG  1 
ATOM   2929 C  CD1 . PHE C 2 19  ? -54.514 -1.415  -32.780 1.00 39.18  ? 19  PHE C CD1 1 
ATOM   2930 C  CD2 . PHE C 2 19  ? -55.987 -0.018  -34.050 1.00 37.66  ? 19  PHE C CD2 1 
ATOM   2931 C  CE1 . PHE C 2 19  ? -55.608 -2.038  -32.179 1.00 37.46  ? 19  PHE C CE1 1 
ATOM   2932 C  CE2 . PHE C 2 19  ? -57.087 -0.630  -33.458 1.00 37.26  ? 19  PHE C CE2 1 
ATOM   2933 C  CZ  . PHE C 2 19  ? -56.899 -1.641  -32.518 1.00 37.93  ? 19  PHE C CZ  1 
HETATM 2934 N  N   . MSE C 2 20  ? -51.441 2.978   -33.027 1.00 46.31  ? 20  MSE C N   1 
HETATM 2935 C  CA  . MSE C 2 20  ? -50.147 3.620   -33.151 1.00 46.98  ? 20  MSE C CA  1 
HETATM 2936 C  C   . MSE C 2 20  ? -48.959 2.731   -32.871 1.00 48.19  ? 20  MSE C C   1 
HETATM 2937 O  O   . MSE C 2 20  ? -47.927 2.839   -33.538 1.00 48.96  ? 20  MSE C O   1 
HETATM 2938 C  CB  . MSE C 2 20  ? -50.077 4.808   -32.203 1.00 48.44  ? 20  MSE C CB  1 
HETATM 2939 C  CG  . MSE C 2 20  ? -51.222 5.795   -32.348 1.00 53.81  ? 20  MSE C CG  1 
HETATM 2940 SE SE  . MSE C 2 20  ? -51.263 6.688   -34.070 1.00 59.17  ? 20  MSE C SE  1 
HETATM 2941 C  CE  . MSE C 2 20  ? -49.616 7.692   -33.947 1.00 52.94  ? 20  MSE C CE  1 
ATOM   2942 N  N   . ASP C 2 21  ? -49.100 1.850   -31.886 1.00 47.96  ? 21  ASP C N   1 
ATOM   2943 C  CA  . ASP C 2 21  ? -47.989 1.005   -31.483 1.00 48.06  ? 21  ASP C CA  1 
ATOM   2944 C  C   . ASP C 2 21  ? -48.498 -0.312  -30.918 1.00 47.97  ? 21  ASP C C   1 
ATOM   2945 O  O   . ASP C 2 21  ? -49.704 -0.546  -30.827 1.00 47.56  ? 21  ASP C O   1 
ATOM   2946 C  CB  . ASP C 2 21  ? -47.196 1.735   -30.390 1.00 49.87  ? 21  ASP C CB  1 
ATOM   2947 C  CG  . ASP C 2 21  ? -45.703 1.584   -30.542 1.00 51.82  ? 21  ASP C CG  1 
ATOM   2948 O  OD1 . ASP C 2 21  ? -45.239 0.467   -30.857 1.00 53.20  ? 21  ASP C OD1 1 
ATOM   2949 O  OD2 . ASP C 2 21  ? -44.992 2.592   -30.329 1.00 53.47  ? 21  ASP C OD2 1 
ATOM   2950 N  N   . CYS C 2 22  ? -47.561 -1.165  -30.523 1.00 46.43  ? 22  CYS C N   1 
ATOM   2951 C  CA  . CYS C 2 22  ? -47.908 -2.444  -29.927 1.00 46.04  ? 22  CYS C CA  1 
ATOM   2952 C  C   . CYS C 2 22  ? -46.790 -2.869  -28.969 1.00 44.98  ? 22  CYS C C   1 
ATOM   2953 O  O   . CYS C 2 22  ? -45.639 -2.442  -29.114 1.00 43.67  ? 22  CYS C O   1 
ATOM   2954 C  CB  . CYS C 2 22  ? -48.105 -3.499  -31.009 1.00 46.49  ? 22  CYS C CB  1 
ATOM   2955 S  SG  . CYS C 2 22  ? -48.955 -4.970  -30.404 1.00 52.15  ? 22  CYS C SG  1 
ATOM   2956 N  N   . ARG C 2 23  ? -47.126 -3.695  -27.984 1.00 42.67  ? 23  ARG C N   1 
ATOM   2957 C  CA  . ARG C 2 23  ? -46.121 -4.142  -27.031 1.00 42.51  ? 23  ARG C CA  1 
ATOM   2958 C  C   . ARG C 2 23  ? -46.644 -5.214  -26.081 1.00 42.88  ? 23  ARG C C   1 
ATOM   2959 O  O   . ARG C 2 23  ? -47.852 -5.448  -25.972 1.00 41.52  ? 23  ARG C O   1 
ATOM   2960 C  CB  . ARG C 2 23  ? -45.631 -2.956  -26.182 1.00 41.27  ? 23  ARG C CB  1 
ATOM   2961 C  CG  . ARG C 2 23  ? -46.545 -2.646  -24.992 1.00 36.97  ? 23  ARG C CG  1 
ATOM   2962 C  CD  . ARG C 2 23  ? -46.141 -1.394  -24.227 1.00 36.17  ? 23  ARG C CD  1 
ATOM   2963 N  NE  . ARG C 2 23  ? -47.089 -1.117  -23.147 1.00 33.37  ? 23  ARG C NE  1 
ATOM   2964 C  CZ  . ARG C 2 23  ? -47.051 -0.039  -22.366 1.00 32.57  ? 23  ARG C CZ  1 
ATOM   2965 N  NH1 . ARG C 2 23  ? -46.113 0.885   -22.536 1.00 29.82  ? 23  ARG C NH1 1 
ATOM   2966 N  NH2 . ARG C 2 23  ? -47.954 0.110   -21.405 1.00 31.42  ? 23  ARG C NH2 1 
ATOM   2967 N  N   . ILE C 2 24  ? -45.710 -5.862  -25.397 1.00 43.82  ? 24  ILE C N   1 
ATOM   2968 C  CA  . ILE C 2 24  ? -46.060 -6.857  -24.404 1.00 45.68  ? 24  ILE C CA  1 
ATOM   2969 C  C   . ILE C 2 24  ? -45.731 -6.152  -23.104 1.00 45.58  ? 24  ILE C C   1 
ATOM   2970 O  O   . ILE C 2 24  ? -44.594 -5.755  -22.869 1.00 45.84  ? 24  ILE C O   1 
ATOM   2971 C  CB  . ILE C 2 24  ? -45.235 -8.167  -24.562 1.00 47.45  ? 24  ILE C CB  1 
ATOM   2972 C  CG1 . ILE C 2 24  ? -43.799 -7.859  -25.017 1.00 49.35  ? 24  ILE C CG1 1 
ATOM   2973 C  CG2 . ILE C 2 24  ? -45.921 -9.085  -25.581 1.00 45.37  ? 24  ILE C CG2 1 
ATOM   2974 C  CD1 . ILE C 2 24  ? -42.867 -7.294  -23.941 1.00 50.66  ? 24  ILE C CD1 1 
ATOM   2975 N  N   . GLY C 2 25  ? -46.741 -5.942  -22.275 1.00 45.21  ? 25  GLY C N   1 
ATOM   2976 C  CA  . GLY C 2 25  ? -46.483 -5.257  -21.030 1.00 44.51  ? 25  GLY C CA  1 
ATOM   2977 C  C   . GLY C 2 25  ? -47.246 -5.832  -19.867 1.00 44.15  ? 25  GLY C C   1 
ATOM   2978 O  O   . GLY C 2 25  ? -48.170 -6.628  -20.053 1.00 44.56  ? 25  GLY C O   1 
ATOM   2979 N  N   . ARG C 2 26  ? -46.844 -5.416  -18.669 1.00 43.36  ? 26  ARG C N   1 
ATOM   2980 C  CA  . ARG C 2 26  ? -47.464 -5.853  -17.426 1.00 43.62  ? 26  ARG C CA  1 
ATOM   2981 C  C   . ARG C 2 26  ? -48.979 -5.873  -17.567 1.00 45.12  ? 26  ARG C C   1 
ATOM   2982 O  O   . ARG C 2 26  ? -49.560 -4.994  -18.208 1.00 46.63  ? 26  ARG C O   1 
ATOM   2983 C  CB  . ARG C 2 26  ? -47.051 -4.905  -16.295 1.00 39.85  ? 26  ARG C CB  1 
ATOM   2984 C  CG  . ARG C 2 26  ? -47.578 -5.255  -14.910 1.00 35.60  ? 26  ARG C CG  1 
ATOM   2985 C  CD  . ARG C 2 26  ? -46.898 -4.370  -13.861 1.00 32.91  ? 26  ARG C CD  1 
ATOM   2986 N  NE  . ARG C 2 26  ? -45.466 -4.644  -13.782 1.00 31.84  ? 26  ARG C NE  1 
ATOM   2987 C  CZ  . ARG C 2 26  ? -44.506 -3.726  -13.819 1.00 32.18  ? 26  ARG C CZ  1 
ATOM   2988 N  NH1 . ARG C 2 26  ? -44.799 -2.431  -13.937 1.00 32.29  ? 26  ARG C NH1 1 
ATOM   2989 N  NH2 . ARG C 2 26  ? -43.243 -4.118  -13.746 1.00 29.74  ? 26  ARG C NH2 1 
ATOM   2990 N  N   . LYS C 2 27  ? -49.609 -6.896  -16.997 1.00 45.86  ? 27  LYS C N   1 
ATOM   2991 C  CA  . LYS C 2 27  ? -51.060 -7.005  -17.036 1.00 46.33  ? 27  LYS C CA  1 
ATOM   2992 C  C   . LYS C 2 27  ? -51.592 -5.870  -16.191 1.00 44.95  ? 27  LYS C C   1 
ATOM   2993 O  O   . LYS C 2 27  ? -51.187 -5.719  -15.040 1.00 46.50  ? 27  LYS C O   1 
ATOM   2994 C  CB  . LYS C 2 27  ? -51.533 -8.326  -16.424 1.00 48.78  ? 27  LYS C CB  1 
ATOM   2995 C  CG  . LYS C 2 27  ? -51.694 -9.473  -17.409 1.00 53.24  ? 27  LYS C CG  1 
ATOM   2996 C  CD  . LYS C 2 27  ? -52.395 -10.670 -16.767 1.00 56.12  ? 27  LYS C CD  1 
ATOM   2997 C  CE  . LYS C 2 27  ? -52.882 -11.660 -17.822 1.00 58.05  ? 27  LYS C CE  1 
ATOM   2998 N  NZ  . LYS C 2 27  ? -54.011 -11.098 -18.629 1.00 56.87  ? 27  LYS C NZ  1 
ATOM   2999 N  N   . GLY C 2 28  ? -52.489 -5.070  -16.754 1.00 43.63  ? 28  GLY C N   1 
ATOM   3000 C  CA  . GLY C 2 28  ? -53.056 -3.968  -15.994 1.00 40.68  ? 28  GLY C CA  1 
ATOM   3001 C  C   . GLY C 2 28  ? -52.508 -2.607  -16.374 1.00 38.20  ? 28  GLY C C   1 
ATOM   3002 O  O   . GLY C 2 28  ? -53.049 -1.579  -15.969 1.00 38.34  ? 28  GLY C O   1 
ATOM   3003 N  N   . ALA C 2 29  ? -51.426 -2.594  -17.146 1.00 36.56  ? 29  ALA C N   1 
ATOM   3004 C  CA  . ALA C 2 29  ? -50.826 -1.337  -17.575 1.00 34.76  ? 29  ALA C CA  1 
ATOM   3005 C  C   . ALA C 2 29  ? -51.608 -0.866  -18.799 1.00 33.74  ? 29  ALA C C   1 
ATOM   3006 O  O   . ALA C 2 29  ? -51.064 -0.737  -19.904 1.00 33.46  ? 29  ALA C O   1 
ATOM   3007 C  CB  . ALA C 2 29  ? -49.357 -1.548  -17.918 1.00 32.88  ? 29  ALA C CB  1 
ATOM   3008 N  N   . THR C 2 30  ? -52.898 -0.623  -18.582 1.00 32.25  ? 30  THR C N   1 
ATOM   3009 C  CA  . THR C 2 30  ? -53.793 -0.186  -19.640 1.00 31.21  ? 30  THR C CA  1 
ATOM   3010 C  C   . THR C 2 30  ? -54.826 0.778   -19.081 1.00 31.45  ? 30  THR C C   1 
ATOM   3011 O  O   . THR C 2 30  ? -55.058 0.813   -17.877 1.00 30.27  ? 30  THR C O   1 
ATOM   3012 C  CB  . THR C 2 30  ? -54.559 -1.381  -20.241 1.00 31.69  ? 30  THR C CB  1 
ATOM   3013 O  OG1 . THR C 2 30  ? -55.289 -2.047  -19.203 1.00 28.23  ? 30  THR C OG1 1 
ATOM   3014 C  CG2 . THR C 2 30  ? -53.605 -2.367  -20.901 1.00 31.68  ? 30  THR C CG2 1 
ATOM   3015 N  N   . GLY C 2 31  ? -55.459 1.553   -19.957 1.00 31.90  ? 31  GLY C N   1 
ATOM   3016 C  CA  . GLY C 2 31  ? -56.480 2.475   -19.491 1.00 32.82  ? 31  GLY C CA  1 
ATOM   3017 C  C   . GLY C 2 31  ? -55.979 3.871   -19.179 1.00 32.63  ? 31  GLY C C   1 
ATOM   3018 O  O   . GLY C 2 31  ? -54.882 4.270   -19.587 1.00 31.53  ? 31  GLY C O   1 
ATOM   3019 N  N   . ALA C 2 32  ? -56.792 4.614   -18.441 1.00 32.22  ? 32  ALA C N   1 
ATOM   3020 C  CA  . ALA C 2 32  ? -56.467 5.989   -18.086 1.00 34.68  ? 32  ALA C CA  1 
ATOM   3021 C  C   . ALA C 2 32  ? -55.040 6.201   -17.540 1.00 35.87  ? 32  ALA C C   1 
ATOM   3022 O  O   . ALA C 2 32  ? -54.363 7.174   -17.916 1.00 37.39  ? 32  ALA C O   1 
ATOM   3023 C  CB  . ALA C 2 32  ? -57.507 6.517   -17.087 1.00 31.61  ? 32  ALA C CB  1 
ATOM   3024 N  N   . THR C 2 33  ? -54.577 5.291   -16.681 1.00 33.22  ? 33  THR C N   1 
ATOM   3025 C  CA  . THR C 2 33  ? -53.253 5.409   -16.072 1.00 31.80  ? 33  THR C CA  1 
ATOM   3026 C  C   . THR C 2 33  ? -52.093 5.388   -17.041 1.00 30.40  ? 33  THR C C   1 
ATOM   3027 O  O   . THR C 2 33  ? -50.953 5.588   -16.633 1.00 30.76  ? 33  THR C O   1 
ATOM   3028 C  CB  . THR C 2 33  ? -52.992 4.291   -15.026 1.00 32.21  ? 33  THR C CB  1 
ATOM   3029 O  OG1 . THR C 2 33  ? -52.995 3.012   -15.673 1.00 32.33  ? 33  THR C OG1 1 
ATOM   3030 C  CG2 . THR C 2 33  ? -54.062 4.306   -13.951 1.00 31.35  ? 33  THR C CG2 1 
ATOM   3031 N  N   . THR C 2 34  ? -52.374 5.146   -18.315 1.00 30.04  ? 34  THR C N   1 
ATOM   3032 C  CA  . THR C 2 34  ? -51.321 5.085   -19.317 1.00 29.99  ? 34  THR C CA  1 
ATOM   3033 C  C   . THR C 2 34  ? -51.272 6.308   -20.228 1.00 31.95  ? 34  THR C C   1 
ATOM   3034 O  O   . THR C 2 34  ? -50.531 6.308   -21.215 1.00 33.82  ? 34  THR C O   1 
ATOM   3035 C  CB  . THR C 2 34  ? -51.467 3.832   -20.213 1.00 31.50  ? 34  THR C CB  1 
ATOM   3036 O  OG1 . THR C 2 34  ? -52.744 3.872   -20.859 1.00 30.90  ? 34  THR C OG1 1 
ATOM   3037 C  CG2 . THR C 2 34  ? -51.357 2.528   -19.381 1.00 28.28  ? 34  THR C CG2 1 
ATOM   3038 N  N   . THR C 2 35  ? -52.068 7.337   -19.937 1.00 31.48  ? 35  THR C N   1 
ATOM   3039 C  CA  . THR C 2 35  ? -52.016 8.541   -20.766 1.00 30.84  ? 35  THR C CA  1 
ATOM   3040 C  C   . THR C 2 35  ? -50.695 9.182   -20.392 1.00 31.84  ? 35  THR C C   1 
ATOM   3041 O  O   . THR C 2 35  ? -50.262 9.077   -19.253 1.00 33.20  ? 35  THR C O   1 
ATOM   3042 C  CB  . THR C 2 35  ? -53.117 9.568   -20.430 1.00 30.93  ? 35  THR C CB  1 
ATOM   3043 O  OG1 . THR C 2 35  ? -53.000 9.944   -19.056 1.00 26.75  ? 35  THR C OG1 1 
ATOM   3044 C  CG2 . THR C 2 35  ? -54.501 9.002   -20.702 1.00 27.12  ? 35  THR C CG2 1 
ATOM   3045 N  N   . ILE C 2 36  ? -50.050 9.840   -21.342 1.00 31.04  ? 36  ILE C N   1 
ATOM   3046 C  CA  . ILE C 2 36  ? -48.781 10.469  -21.054 1.00 32.51  ? 36  ILE C CA  1 
ATOM   3047 C  C   . ILE C 2 36  ? -48.827 11.430  -19.845 1.00 32.68  ? 36  ILE C C   1 
ATOM   3048 O  O   . ILE C 2 36  ? -47.860 11.514  -19.099 1.00 32.52  ? 36  ILE C O   1 
ATOM   3049 C  CB  . ILE C 2 36  ? -48.242 11.195  -22.314 1.00 34.15  ? 36  ILE C CB  1 
ATOM   3050 C  CG1 . ILE C 2 36  ? -46.737 11.455  -22.159 1.00 36.18  ? 36  ILE C CG1 1 
ATOM   3051 C  CG2 . ILE C 2 36  ? -49.032 12.480  -22.570 1.00 32.52  ? 36  ILE C CG2 1 
ATOM   3052 C  CD1 . ILE C 2 36  ? -46.381 12.609  -21.255 1.00 38.19  ? 36  ILE C CD1 1 
ATOM   3053 N  N   . TYR C 2 37  ? -49.932 12.143  -19.630 1.00 31.83  ? 37  TYR C N   1 
ATOM   3054 C  CA  . TYR C 2 37  ? -49.989 13.052  -18.493 1.00 30.56  ? 37  TYR C CA  1 
ATOM   3055 C  C   . TYR C 2 37  ? -50.216 12.329  -17.184 1.00 32.98  ? 37  TYR C C   1 
ATOM   3056 O  O   . TYR C 2 37  ? -49.820 12.812  -16.121 1.00 33.51  ? 37  TYR C O   1 
ATOM   3057 C  CB  . TYR C 2 37  ? -51.063 14.125  -18.687 1.00 29.93  ? 37  TYR C CB  1 
ATOM   3058 C  CG  . TYR C 2 37  ? -52.409 13.624  -19.143 1.00 28.77  ? 37  TYR C CG  1 
ATOM   3059 C  CD1 . TYR C 2 37  ? -53.376 13.219  -18.229 1.00 27.42  ? 37  TYR C CD1 1 
ATOM   3060 C  CD2 . TYR C 2 37  ? -52.727 13.578  -20.500 1.00 30.35  ? 37  TYR C CD2 1 
ATOM   3061 C  CE1 . TYR C 2 37  ? -54.635 12.787  -18.660 1.00 26.60  ? 37  TYR C CE1 1 
ATOM   3062 C  CE2 . TYR C 2 37  ? -53.975 13.141  -20.940 1.00 26.17  ? 37  TYR C CE2 1 
ATOM   3063 C  CZ  . TYR C 2 37  ? -54.920 12.755  -20.020 1.00 26.73  ? 37  TYR C CZ  1 
ATOM   3064 O  OH  . TYR C 2 37  ? -56.159 12.360  -20.467 1.00 28.37  ? 37  TYR C OH  1 
ATOM   3065 N  N   . ALA C 2 38  ? -50.853 11.168  -17.245 1.00 33.44  ? 38  ALA C N   1 
ATOM   3066 C  CA  . ALA C 2 38  ? -51.080 10.412  -16.033 1.00 33.95  ? 38  ALA C CA  1 
ATOM   3067 C  C   . ALA C 2 38  ? -49.747 9.781   -15.646 1.00 36.26  ? 38  ALA C C   1 
ATOM   3068 O  O   . ALA C 2 38  ? -49.386 9.733   -14.461 1.00 38.27  ? 38  ALA C O   1 
ATOM   3069 C  CB  . ALA C 2 38  ? -52.126 9.334   -16.263 1.00 34.32  ? 38  ALA C CB  1 
ATOM   3070 N  N   . VAL C 2 39  ? -49.006 9.315   -16.647 1.00 35.66  ? 39  VAL C N   1 
ATOM   3071 C  CA  . VAL C 2 39  ? -47.723 8.670   -16.389 1.00 37.40  ? 39  VAL C CA  1 
ATOM   3072 C  C   . VAL C 2 39  ? -46.708 9.635   -15.796 1.00 38.26  ? 39  VAL C C   1 
ATOM   3073 O  O   . VAL C 2 39  ? -45.937 9.255   -14.910 1.00 37.93  ? 39  VAL C O   1 
ATOM   3074 C  CB  . VAL C 2 39  ? -47.128 8.039   -17.670 1.00 36.33  ? 39  VAL C CB  1 
ATOM   3075 C  CG1 . VAL C 2 39  ? -45.754 7.478   -17.376 1.00 37.98  ? 39  VAL C CG1 1 
ATOM   3076 C  CG2 . VAL C 2 39  ? -48.036 6.933   -18.173 1.00 37.27  ? 39  VAL C CG2 1 
ATOM   3077 N  N   . GLU C 2 40  ? -46.711 10.879  -16.272 1.00 38.26  ? 40  GLU C N   1 
ATOM   3078 C  CA  . GLU C 2 40  ? -45.777 11.877  -15.767 1.00 38.41  ? 40  GLU C CA  1 
ATOM   3079 C  C   . GLU C 2 40  ? -46.137 12.338  -14.374 1.00 38.72  ? 40  GLU C C   1 
ATOM   3080 O  O   . GLU C 2 40  ? -45.267 12.780  -13.633 1.00 40.42  ? 40  GLU C O   1 
ATOM   3081 C  CB  . GLU C 2 40  ? -45.715 13.084  -16.690 1.00 39.17  ? 40  GLU C CB  1 
ATOM   3082 C  CG  . GLU C 2 40  ? -45.271 12.737  -18.086 1.00 41.07  ? 40  GLU C CG  1 
ATOM   3083 C  CD  . GLU C 2 40  ? -45.042 13.965  -18.927 1.00 44.52  ? 40  GLU C CD  1 
ATOM   3084 O  OE1 . GLU C 2 40  ? -45.867 14.896  -18.823 1.00 43.39  ? 40  GLU C OE1 1 
ATOM   3085 O  OE2 . GLU C 2 40  ? -44.050 14.002  -19.698 1.00 47.54  ? 40  GLU C OE2 1 
ATOM   3086 N  N   . ALA C 2 41  ? -47.408 12.226  -14.000 1.00 37.59  ? 41  ALA C N   1 
ATOM   3087 C  CA  . ALA C 2 41  ? -47.810 12.654  -12.669 1.00 38.14  ? 41  ALA C CA  1 
ATOM   3088 C  C   . ALA C 2 41  ? -47.814 11.510  -11.647 1.00 39.44  ? 41  ALA C C   1 
ATOM   3089 O  O   . ALA C 2 41  ? -47.379 11.692  -10.501 1.00 40.42  ? 41  ALA C O   1 
ATOM   3090 C  CB  . ALA C 2 41  ? -49.200 13.326  -12.719 1.00 35.12  ? 41  ALA C CB  1 
ATOM   3091 N  N   . ASP C 2 42  ? -48.287 10.336  -12.060 1.00 38.72  ? 42  ASP C N   1 
ATOM   3092 C  CA  . ASP C 2 42  ? -48.374 9.204   -11.146 1.00 39.28  ? 42  ASP C CA  1 
ATOM   3093 C  C   . ASP C 2 42  ? -47.341 8.109   -11.372 1.00 39.18  ? 42  ASP C C   1 
ATOM   3094 O  O   . ASP C 2 42  ? -47.253 7.160   -10.590 1.00 39.27  ? 42  ASP C O   1 
ATOM   3095 C  CB  . ASP C 2 42  ? -49.767 8.576   -11.220 1.00 42.88  ? 42  ASP C CB  1 
ATOM   3096 C  CG  . ASP C 2 42  ? -50.877 9.613   -11.248 1.00 47.35  ? 42  ASP C CG  1 
ATOM   3097 O  OD1 . ASP C 2 42  ? -50.815 10.567  -10.444 1.00 48.32  ? 42  ASP C OD1 1 
ATOM   3098 O  OD2 . ASP C 2 42  ? -51.813 9.467   -12.070 1.00 49.03  ? 42  ASP C OD2 1 
ATOM   3099 N  N   . GLY C 2 43  ? -46.559 8.227   -12.436 1.00 37.17  ? 43  GLY C N   1 
ATOM   3100 C  CA  . GLY C 2 43  ? -45.577 7.197   -12.707 1.00 35.45  ? 43  GLY C CA  1 
ATOM   3101 C  C   . GLY C 2 43  ? -46.142 6.214   -13.711 1.00 36.14  ? 43  GLY C C   1 
ATOM   3102 O  O   . GLY C 2 43  ? -47.356 6.163   -13.923 1.00 35.29  ? 43  GLY C O   1 
ATOM   3103 N  N   . ASP C 2 44  ? -45.267 5.421   -14.316 1.00 36.05  ? 44  ASP C N   1 
ATOM   3104 C  CA  . ASP C 2 44  ? -45.680 4.451   -15.313 1.00 37.30  ? 44  ASP C CA  1 
ATOM   3105 C  C   . ASP C 2 44  ? -46.026 3.070   -14.750 1.00 36.85  ? 44  ASP C C   1 
ATOM   3106 O  O   . ASP C 2 44  ? -45.192 2.401   -14.157 1.00 36.59  ? 44  ASP C O   1 
ATOM   3107 C  CB  . ASP C 2 44  ? -44.581 4.294   -16.349 1.00 39.46  ? 44  ASP C CB  1 
ATOM   3108 C  CG  . ASP C 2 44  ? -45.045 3.521   -17.563 1.00 43.43  ? 44  ASP C CG  1 
ATOM   3109 O  OD1 . ASP C 2 44  ? -45.822 2.547   -17.401 1.00 42.98  ? 44  ASP C OD1 1 
ATOM   3110 O  OD2 . ASP C 2 44  ? -44.632 3.886   -18.684 1.00 47.82  ? 44  ASP C OD2 1 
ATOM   3111 N  N   . PRO C 2 45  ? -47.261 2.608   -14.966 1.00 37.24  ? 45  PRO C N   1 
ATOM   3112 C  CA  . PRO C 2 45  ? -47.657 1.292   -14.451 1.00 37.84  ? 45  PRO C CA  1 
ATOM   3113 C  C   . PRO C 2 45  ? -46.959 0.115   -15.143 1.00 38.74  ? 45  PRO C C   1 
ATOM   3114 O  O   . PRO C 2 45  ? -47.093 -1.032  -14.716 1.00 39.65  ? 45  PRO C O   1 
ATOM   3115 C  CB  . PRO C 2 45  ? -49.177 1.293   -14.637 1.00 36.12  ? 45  PRO C CB  1 
ATOM   3116 C  CG  . PRO C 2 45  ? -49.362 2.126   -15.858 1.00 38.20  ? 45  PRO C CG  1 
ATOM   3117 C  CD  . PRO C 2 45  ? -48.384 3.271   -15.647 1.00 37.67  ? 45  PRO C CD  1 
ATOM   3118 N  N   . ASN C 2 46  ? -46.206 0.399   -16.197 1.00 38.94  ? 46  ASN C N   1 
ATOM   3119 C  CA  . ASN C 2 46  ? -45.484 -0.644  -16.915 1.00 40.81  ? 46  ASN C CA  1 
ATOM   3120 C  C   . ASN C 2 46  ? -44.021 -0.696  -16.438 1.00 42.33  ? 46  ASN C C   1 
ATOM   3121 O  O   . ASN C 2 46  ? -43.289 -1.615  -16.786 1.00 41.97  ? 46  ASN C O   1 
ATOM   3122 C  CB  . ASN C 2 46  ? -45.515 -0.360  -18.417 1.00 40.76  ? 46  ASN C CB  1 
ATOM   3123 C  CG  . ASN C 2 46  ? -45.105 -1.561  -19.250 1.00 39.99  ? 46  ASN C CG  1 
ATOM   3124 O  OD1 . ASN C 2 46  ? -45.258 -2.708  -18.821 1.00 40.27  ? 46  ASN C OD1 1 
ATOM   3125 N  ND2 . ASN C 2 46  ? -44.563 -1.303  -20.437 1.00 38.42  ? 46  ASN C ND2 1 
ATOM   3126 N  N   . ALA C 2 47  ? -43.615 0.314   -15.664 1.00 44.05  ? 47  ALA C N   1 
ATOM   3127 C  CA  . ALA C 2 47  ? -42.268 0.447   -15.094 1.00 45.80  ? 47  ALA C CA  1 
ATOM   3128 C  C   . ALA C 2 47  ? -41.163 -0.358  -15.776 1.00 49.03  ? 47  ALA C C   1 
ATOM   3129 O  O   . ALA C 2 47  ? -40.938 -0.224  -16.984 1.00 52.07  ? 47  ALA C O   1 
ATOM   3130 C  CB  . ALA C 2 47  ? -42.313 0.100   -13.619 1.00 47.76  ? 47  ALA C CB  1 
ATOM   3131 N  N   . GLY C 2 48  ? -40.454 -1.171  -14.995 1.00 49.53  ? 48  GLY C N   1 
ATOM   3132 C  CA  . GLY C 2 48  ? -39.391 -1.998  -15.546 1.00 51.83  ? 48  GLY C CA  1 
ATOM   3133 C  C   . GLY C 2 48  ? -39.906 -3.401  -15.816 1.00 53.24  ? 48  GLY C C   1 
ATOM   3134 O  O   . GLY C 2 48  ? -39.606 -4.346  -15.080 1.00 53.96  ? 48  GLY C O   1 
ATOM   3135 N  N   . PHE C 2 49  ? -40.683 -3.538  -16.883 1.00 53.51  ? 49  PHE C N   1 
ATOM   3136 C  CA  . PHE C 2 49  ? -41.270 -4.816  -17.227 1.00 54.75  ? 49  PHE C CA  1 
ATOM   3137 C  C   . PHE C 2 49  ? -40.465 -5.653  -18.209 1.00 57.85  ? 49  PHE C C   1 
ATOM   3138 O  O   . PHE C 2 49  ? -39.902 -5.141  -19.178 1.00 58.85  ? 49  PHE C O   1 
ATOM   3139 C  CB  . PHE C 2 49  ? -42.680 -4.583  -17.767 1.00 50.93  ? 49  PHE C CB  1 
ATOM   3140 C  CG  . PHE C 2 49  ? -43.322 -5.807  -18.339 1.00 48.16  ? 49  PHE C CG  1 
ATOM   3141 C  CD1 . PHE C 2 49  ? -43.130 -6.153  -19.676 1.00 46.67  ? 49  PHE C CD1 1 
ATOM   3142 C  CD2 . PHE C 2 49  ? -44.135 -6.608  -17.548 1.00 45.14  ? 49  PHE C CD2 1 
ATOM   3143 C  CE1 . PHE C 2 49  ? -43.746 -7.278  -20.217 1.00 46.14  ? 49  PHE C CE1 1 
ATOM   3144 C  CE2 . PHE C 2 49  ? -44.751 -7.732  -18.073 1.00 45.19  ? 49  PHE C CE2 1 
ATOM   3145 C  CZ  . PHE C 2 49  ? -44.562 -8.071  -19.412 1.00 45.63  ? 49  PHE C CZ  1 
ATOM   3146 N  N   . GLU C 2 50  ? -40.417 -6.950  -17.927 1.00 61.41  ? 50  GLU C N   1 
ATOM   3147 C  CA  . GLU C 2 50  ? -39.741 -7.940  -18.756 1.00 65.01  ? 50  GLU C CA  1 
ATOM   3148 C  C   . GLU C 2 50  ? -40.602 -9.177  -18.608 1.00 66.10  ? 50  GLU C C   1 
ATOM   3149 O  O   . GLU C 2 50  ? -41.723 -9.086  -18.121 1.00 66.63  ? 50  GLU C O   1 
ATOM   3150 C  CB  . GLU C 2 50  ? -38.335 -8.238  -18.241 1.00 67.39  ? 50  GLU C CB  1 
ATOM   3151 C  CG  . GLU C 2 50  ? -37.302 -7.176  -18.562 1.00 71.17  ? 50  GLU C CG  1 
ATOM   3152 C  CD  . GLU C 2 50  ? -35.873 -7.689  -18.414 1.00 73.56  ? 50  GLU C CD  1 
ATOM   3153 O  OE1 . GLU C 2 50  ? -34.931 -6.901  -18.657 1.00 75.02  ? 50  GLU C OE1 1 
ATOM   3154 O  OE2 . GLU C 2 50  ? -35.694 -8.879  -18.062 1.00 74.08  ? 50  GLU C OE2 1 
ATOM   3155 N  N   . LYS C 2 51  ? -40.095 -10.335 -19.003 1.00 68.40  ? 51  LYS C N   1 
ATOM   3156 C  CA  . LYS C 2 51  ? -40.896 -11.539 -18.860 1.00 70.70  ? 51  LYS C CA  1 
ATOM   3157 C  C   . LYS C 2 51  ? -40.568 -12.396 -17.633 1.00 72.34  ? 51  LYS C C   1 
ATOM   3158 O  O   . LYS C 2 51  ? -40.582 -13.630 -17.700 1.00 72.55  ? 51  LYS C O   1 
ATOM   3159 C  CB  . LYS C 2 51  ? -40.833 -12.367 -20.140 1.00 69.73  ? 51  LYS C CB  1 
ATOM   3160 C  CG  . LYS C 2 51  ? -41.744 -11.836 -21.248 1.00 69.27  ? 51  LYS C CG  1 
ATOM   3161 C  CD  . LYS C 2 51  ? -41.615 -10.322 -21.423 1.00 67.56  ? 51  LYS C CD  1 
ATOM   3162 C  CE  . LYS C 2 51  ? -41.680 -9.925  -22.887 1.00 65.76  ? 51  LYS C CE  1 
ATOM   3163 N  NZ  . LYS C 2 51  ? -40.448 -10.280 -23.643 1.00 65.06  ? 51  LYS C NZ  1 
ATOM   3164 N  N   . ASN C 2 52  ? -40.263 -11.731 -16.514 1.00 73.35  ? 52  ASN C N   1 
ATOM   3165 C  CA  . ASN C 2 52  ? -40.014 -12.428 -15.255 1.00 74.10  ? 52  ASN C CA  1 
ATOM   3166 C  C   . ASN C 2 52  ? -41.436 -12.499 -14.741 1.00 74.17  ? 52  ASN C C   1 
ATOM   3167 O  O   . ASN C 2 52  ? -41.700 -12.986 -13.641 1.00 74.20  ? 52  ASN C O   1 
ATOM   3168 C  CB  . ASN C 2 52  ? -39.231 -11.584 -14.244 1.00 75.84  ? 52  ASN C CB  1 
ATOM   3169 C  CG  . ASN C 2 52  ? -38.253 -10.630 -14.889 1.00 77.92  ? 52  ASN C CG  1 
ATOM   3170 O  OD1 . ASN C 2 52  ? -37.276 -11.043 -15.515 1.00 79.03  ? 52  ASN C OD1 1 
ATOM   3171 N  ND2 . ASN C 2 52  ? -38.508 -9.335  -14.730 1.00 79.38  ? 52  ASN C ND2 1 
ATOM   3172 N  N   . LYS C 2 53  ? -42.368 -12.005 -15.550 1.00 74.26  ? 53  LYS C N   1 
ATOM   3173 C  CA  . LYS C 2 53  ? -43.756 -11.870 -15.127 1.00 74.14  ? 53  LYS C CA  1 
ATOM   3174 C  C   . LYS C 2 53  ? -44.707 -11.982 -16.314 1.00 74.96  ? 53  LYS C C   1 
ATOM   3175 O  O   . LYS C 2 53  ? -44.391 -11.541 -17.419 1.00 74.12  ? 53  LYS C O   1 
ATOM   3176 C  CB  . LYS C 2 53  ? -43.970 -10.538 -14.406 1.00 72.95  ? 53  LYS C CB  1 
ATOM   3177 C  CG  . LYS C 2 53  ? -43.296 -9.353  -15.079 1.00 70.59  ? 53  LYS C CG  1 
ATOM   3178 C  CD  . LYS C 2 53  ? -43.853 -8.036  -14.564 1.00 69.02  ? 53  LYS C CD  1 
ATOM   3179 C  CE  . LYS C 2 53  ? -42.866 -7.344  -13.638 1.00 67.21  ? 53  LYS C CE  1 
ATOM   3180 N  NZ  . LYS C 2 53  ? -41.533 -7.168  -14.278 1.00 67.07  ? 53  LYS C NZ  1 
ATOM   3181 N  N   . GLU C 2 54  ? -45.873 -12.574 -16.078 1.00 76.38  ? 54  GLU C N   1 
ATOM   3182 C  CA  . GLU C 2 54  ? -47.088 -12.183 -16.784 1.00 78.16  ? 54  GLU C CA  1 
ATOM   3183 C  C   . GLU C 2 54  ? -48.218 -11.874 -15.807 1.00 78.89  ? 54  GLU C C   1 
ATOM   3184 O  O   . GLU C 2 54  ? -48.908 -12.778 -15.336 1.00 78.53  ? 54  GLU C O   1 
ATOM   3185 C  CB  . GLU C 2 54  ? -47.520 -13.281 -17.757 1.00 79.62  ? 54  GLU C CB  1 
ATOM   3186 C  CG  . GLU C 2 54  ? -47.488 -12.863 -19.218 1.00 80.68  ? 54  GLU C CG  1 
ATOM   3187 C  CD  . GLU C 2 54  ? -46.507 -13.681 -20.036 1.00 82.38  ? 54  GLU C CD  1 
ATOM   3188 O  OE1 . GLU C 2 54  ? -45.973 -14.677 -19.505 1.00 83.55  ? 54  GLU C OE1 1 
ATOM   3189 O  OE2 . GLU C 2 54  ? -46.271 -13.327 -21.211 1.00 82.32  ? 54  GLU C OE2 1 
ATOM   3190 N  N   . PRO C 2 55  ? -48.400 -10.593 -15.507 1.00 80.06  ? 55  PRO C N   1 
ATOM   3191 C  CA  . PRO C 2 55  ? -48.426 -9.555  -16.542 1.00 79.33  ? 55  PRO C CA  1 
ATOM   3192 C  C   . PRO C 2 55  ? -47.565 -9.931  -17.743 1.00 78.09  ? 55  PRO C C   1 
ATOM   3193 O  O   . PRO C 2 55  ? -46.413 -9.506  -17.833 1.00 78.92  ? 55  PRO C O   1 
ATOM   3194 C  CB  . PRO C 2 55  ? -47.830 -8.340  -15.828 1.00 80.08  ? 55  PRO C CB  1 
ATOM   3195 C  CG  . PRO C 2 55  ? -46.935 -8.922  -14.793 1.00 81.09  ? 55  PRO C CG  1 
ATOM   3196 C  CD  . PRO C 2 55  ? -47.603 -10.188 -14.335 1.00 81.69  ? 55  PRO C CD  1 
ATOM   3197 N  N   . GLY C 2 56  ? -48.124 -10.722 -18.653 1.00 76.57  ? 56  GLY C N   1 
ATOM   3198 C  CA  . GLY C 2 56  ? -47.731 -10.674 -20.049 1.00 73.27  ? 56  GLY C CA  1 
ATOM   3199 C  C   . GLY C 2 56  ? -48.914 -10.482 -20.979 1.00 70.72  ? 56  GLY C C   1 
ATOM   3200 O  O   . GLY C 2 56  ? -49.575 -11.446 -21.365 1.00 71.78  ? 56  GLY C O   1 
ATOM   3201 N  N   . GLU C 2 57  ? -49.180 -9.231  -21.339 1.00 67.07  ? 57  GLU C N   1 
ATOM   3202 C  CA  . GLU C 2 57  ? -50.268 -8.914  -22.242 1.00 63.34  ? 57  GLU C CA  1 
ATOM   3203 C  C   . GLU C 2 57  ? -49.751 -8.161  -23.439 1.00 60.69  ? 57  GLU C C   1 
ATOM   3204 O  O   . GLU C 2 57  ? -48.810 -7.375  -23.337 1.00 59.66  ? 57  GLU C O   1 
ATOM   3205 C  CB  . GLU C 2 57  ? -51.322 -8.036  -21.567 1.00 63.34  ? 57  GLU C CB  1 
ATOM   3206 C  CG  . GLU C 2 57  ? -51.969 -8.614  -20.337 1.00 62.53  ? 57  GLU C CG  1 
ATOM   3207 C  CD  . GLU C 2 57  ? -53.106 -7.743  -19.827 1.00 62.50  ? 57  GLU C CD  1 
ATOM   3208 O  OE1 . GLU C 2 57  ? -52.956 -6.498  -19.819 1.00 62.05  ? 57  GLU C OE1 1 
ATOM   3209 O  OE2 . GLU C 2 57  ? -54.148 -8.303  -19.425 1.00 62.60  ? 57  GLU C OE2 1 
ATOM   3210 N  N   . ILE C 2 58  ? -50.358 -8.426  -24.584 1.00 58.21  ? 58  ILE C N   1 
ATOM   3211 C  CA  . ILE C 2 58  ? -50.003 -7.707  -25.785 1.00 55.76  ? 58  ILE C CA  1 
ATOM   3212 C  C   . ILE C 2 58  ? -51.029 -6.578  -25.738 1.00 52.90  ? 58  ILE C C   1 
ATOM   3213 O  O   . ILE C 2 58  ? -52.242 -6.811  -25.719 1.00 51.89  ? 58  ILE C O   1 
ATOM   3214 C  CB  . ILE C 2 58  ? -50.129 -8.603  -27.058 1.00 56.99  ? 58  ILE C CB  1 
ATOM   3215 C  CG1 . ILE C 2 58  ? -50.382 -7.729  -28.291 1.00 57.63  ? 58  ILE C CG1 1 
ATOM   3216 C  CG2 . ILE C 2 58  ? -51.184 -9.677  -26.849 1.00 56.34  ? 58  ILE C CG2 1 
ATOM   3217 C  CD1 . ILE C 2 58  ? -50.193 -8.461  -29.617 1.00 60.55  ? 58  ILE C CD1 1 
ATOM   3218 N  N   . GLN C 2 59  ? -50.524 -5.353  -25.650 1.00 49.75  ? 59  GLN C N   1 
ATOM   3219 C  CA  . GLN C 2 59  ? -51.369 -4.171  -25.550 1.00 45.79  ? 59  GLN C CA  1 
ATOM   3220 C  C   . GLN C 2 59  ? -51.146 -3.282  -26.772 1.00 42.44  ? 59  GLN C C   1 
ATOM   3221 O  O   . GLN C 2 59  ? -50.087 -3.335  -27.402 1.00 40.93  ? 59  GLN C O   1 
ATOM   3222 C  CB  . GLN C 2 59  ? -51.020 -3.421  -24.260 1.00 45.30  ? 59  GLN C CB  1 
ATOM   3223 C  CG  . GLN C 2 59  ? -50.837 -4.355  -23.060 1.00 44.47  ? 59  GLN C CG  1 
ATOM   3224 C  CD  . GLN C 2 59  ? -50.199 -3.677  -21.849 1.00 44.49  ? 59  GLN C CD  1 
ATOM   3225 O  OE1 . GLN C 2 59  ? -49.174 -2.998  -21.968 1.00 42.13  ? 59  GLN C OE1 1 
ATOM   3226 N  NE2 . GLN C 2 59  ? -50.798 -3.873  -20.674 1.00 42.46  ? 59  GLN C NE2 1 
ATOM   3227 N  N   . TYR C 2 60  ? -52.140 -2.464  -27.099 1.00 39.05  ? 60  TYR C N   1 
ATOM   3228 C  CA  . TYR C 2 60  ? -52.046 -1.591  -28.267 1.00 37.98  ? 60  TYR C CA  1 
ATOM   3229 C  C   . TYR C 2 60  ? -52.200 -0.124  -27.899 1.00 35.87  ? 60  TYR C C   1 
ATOM   3230 O  O   . TYR C 2 60  ? -53.128 0.251   -27.190 1.00 33.57  ? 60  TYR C O   1 
ATOM   3231 C  CB  . TYR C 2 60  ? -53.137 -1.957  -29.278 1.00 38.79  ? 60  TYR C CB  1 
ATOM   3232 C  CG  . TYR C 2 60  ? -53.211 -3.432  -29.614 1.00 39.33  ? 60  TYR C CG  1 
ATOM   3233 C  CD1 . TYR C 2 60  ? -52.241 -4.036  -30.412 1.00 40.81  ? 60  TYR C CD1 1 
ATOM   3234 C  CD2 . TYR C 2 60  ? -54.256 -4.220  -29.137 1.00 40.32  ? 60  TYR C CD2 1 
ATOM   3235 C  CE1 . TYR C 2 60  ? -52.313 -5.388  -30.730 1.00 42.23  ? 60  TYR C CE1 1 
ATOM   3236 C  CE2 . TYR C 2 60  ? -54.335 -5.572  -29.448 1.00 41.12  ? 60  TYR C CE2 1 
ATOM   3237 C  CZ  . TYR C 2 60  ? -53.360 -6.149  -30.248 1.00 41.98  ? 60  TYR C CZ  1 
ATOM   3238 O  OH  . TYR C 2 60  ? -53.433 -7.484  -30.594 1.00 43.36  ? 60  TYR C OH  1 
ATOM   3239 N  N   . LEU C 2 61  ? -51.286 0.703   -28.388 1.00 34.44  ? 61  LEU C N   1 
ATOM   3240 C  CA  . LEU C 2 61  ? -51.334 2.137   -28.130 1.00 33.44  ? 61  LEU C CA  1 
ATOM   3241 C  C   . LEU C 2 61  ? -52.402 2.732   -29.038 1.00 33.81  ? 61  LEU C C   1 
ATOM   3242 O  O   . LEU C 2 61  ? -52.188 2.874   -30.237 1.00 34.55  ? 61  LEU C O   1 
ATOM   3243 C  CB  . LEU C 2 61  ? -49.988 2.787   -28.454 1.00 30.76  ? 61  LEU C CB  1 
ATOM   3244 C  CG  . LEU C 2 61  ? -50.005 4.306   -28.244 1.00 27.94  ? 61  LEU C CG  1 
ATOM   3245 C  CD1 . LEU C 2 61  ? -50.313 4.568   -26.783 1.00 25.91  ? 61  LEU C CD1 1 
ATOM   3246 C  CD2 . LEU C 2 61  ? -48.669 4.942   -28.642 1.00 21.52  ? 61  LEU C CD2 1 
ATOM   3247 N  N   . ILE C 2 62  ? -53.542 3.096   -28.469 1.00 34.78  ? 62  ILE C N   1 
ATOM   3248 C  CA  . ILE C 2 62  ? -54.628 3.641   -29.262 1.00 35.96  ? 62  ILE C CA  1 
ATOM   3249 C  C   . ILE C 2 62  ? -54.802 5.161   -29.306 1.00 37.38  ? 62  ILE C C   1 
ATOM   3250 O  O   . ILE C 2 62  ? -54.721 5.853   -28.290 1.00 35.53  ? 62  ILE C O   1 
ATOM   3251 C  CB  . ILE C 2 62  ? -55.958 3.000   -28.834 1.00 35.11  ? 62  ILE C CB  1 
ATOM   3252 C  CG1 . ILE C 2 62  ? -55.942 1.529   -29.251 1.00 34.79  ? 62  ILE C CG1 1 
ATOM   3253 C  CG2 . ILE C 2 62  ? -57.138 3.759   -29.447 1.00 33.23  ? 62  ILE C CG2 1 
ATOM   3254 C  CD1 . ILE C 2 62  ? -57.101 0.716   -28.739 1.00 37.50  ? 62  ILE C CD1 1 
ATOM   3255 N  N   . LYS C 2 63  ? -55.035 5.668   -30.511 1.00 37.96  ? 63  LYS C N   1 
ATOM   3256 C  CA  . LYS C 2 63  ? -55.271 7.087   -30.719 1.00 39.65  ? 63  LYS C CA  1 
ATOM   3257 C  C   . LYS C 2 63  ? -56.782 7.220   -30.891 1.00 40.40  ? 63  LYS C C   1 
ATOM   3258 O  O   . LYS C 2 63  ? -57.340 6.810   -31.905 1.00 41.84  ? 63  LYS C O   1 
ATOM   3259 C  CB  . LYS C 2 63  ? -54.540 7.565   -31.968 1.00 39.94  ? 63  LYS C CB  1 
ATOM   3260 C  CG  . LYS C 2 63  ? -55.101 8.842   -32.568 1.00 42.64  ? 63  LYS C CG  1 
ATOM   3261 C  CD  . LYS C 2 63  ? -54.869 10.062  -31.704 1.00 43.37  ? 63  LYS C CD  1 
ATOM   3262 C  CE  . LYS C 2 63  ? -55.748 11.199  -32.186 1.00 44.63  ? 63  LYS C CE  1 
ATOM   3263 N  NZ  . LYS C 2 63  ? -55.574 11.410  -33.643 1.00 46.97  ? 63  LYS C NZ  1 
ATOM   3264 N  N   . TRP C 2 64  ? -57.447 7.778   -29.892 1.00 40.62  ? 64  TRP C N   1 
ATOM   3265 C  CA  . TRP C 2 64  ? -58.885 7.905   -29.949 1.00 42.48  ? 64  TRP C CA  1 
ATOM   3266 C  C   . TRP C 2 64  ? -59.432 8.999   -30.861 1.00 43.52  ? 64  TRP C C   1 
ATOM   3267 O  O   . TRP C 2 64  ? -58.763 9.991   -31.164 1.00 43.02  ? 64  TRP C O   1 
ATOM   3268 C  CB  . TRP C 2 64  ? -59.437 8.082   -28.535 1.00 43.68  ? 64  TRP C CB  1 
ATOM   3269 C  CG  . TRP C 2 64  ? -59.016 6.985   -27.642 1.00 45.19  ? 64  TRP C CG  1 
ATOM   3270 C  CD1 . TRP C 2 64  ? -57.926 6.970   -26.824 1.00 44.68  ? 64  TRP C CD1 1 
ATOM   3271 C  CD2 . TRP C 2 64  ? -59.625 5.692   -27.526 1.00 46.20  ? 64  TRP C CD2 1 
ATOM   3272 N  NE1 . TRP C 2 64  ? -57.814 5.746   -26.205 1.00 45.79  ? 64  TRP C NE1 1 
ATOM   3273 C  CE2 . TRP C 2 64  ? -58.844 4.941   -26.619 1.00 46.69  ? 64  TRP C CE2 1 
ATOM   3274 C  CE3 . TRP C 2 64  ? -60.755 5.094   -28.105 1.00 45.63  ? 64  TRP C CE3 1 
ATOM   3275 C  CZ2 . TRP C 2 64  ? -59.158 3.613   -26.270 1.00 46.66  ? 64  TRP C CZ2 1 
ATOM   3276 C  CZ3 . TRP C 2 64  ? -61.065 3.775   -27.760 1.00 46.37  ? 64  TRP C CZ3 1 
ATOM   3277 C  CH2 . TRP C 2 64  ? -60.267 3.052   -26.851 1.00 45.46  ? 64  TRP C CH2 1 
ATOM   3278 N  N   . LYS C 2 65  ? -60.673 8.783   -31.292 1.00 44.17  ? 65  LYS C N   1 
ATOM   3279 C  CA  . LYS C 2 65  ? -61.400 9.706   -32.157 1.00 42.25  ? 65  LYS C CA  1 
ATOM   3280 C  C   . LYS C 2 65  ? -61.900 10.879  -31.324 1.00 39.35  ? 65  LYS C C   1 
ATOM   3281 O  O   . LYS C 2 65  ? -62.610 10.686  -30.336 1.00 37.65  ? 65  LYS C O   1 
ATOM   3282 C  CB  . LYS C 2 65  ? -62.594 8.980   -32.793 1.00 43.26  ? 65  LYS C CB  1 
ATOM   3283 C  CG  . LYS C 2 65  ? -63.642 9.905   -33.389 1.00 48.04  ? 65  LYS C CG  1 
ATOM   3284 C  CD  . LYS C 2 65  ? -64.846 9.139   -33.934 1.00 49.93  ? 65  LYS C CD  1 
ATOM   3285 C  CE  . LYS C 2 65  ? -65.923 10.094  -34.461 1.00 50.73  ? 65  LYS C CE  1 
ATOM   3286 N  NZ  . LYS C 2 65  ? -65.423 10.988  -35.551 1.00 48.82  ? 65  LYS C NZ  1 
ATOM   3287 N  N   . GLY C 2 66  ? -61.526 12.091  -31.717 1.00 37.78  ? 66  GLY C N   1 
ATOM   3288 C  CA  . GLY C 2 66  ? -61.975 13.257  -30.981 1.00 38.73  ? 66  GLY C CA  1 
ATOM   3289 C  C   . GLY C 2 66  ? -61.066 13.674  -29.833 1.00 39.54  ? 66  GLY C C   1 
ATOM   3290 O  O   . GLY C 2 66  ? -61.427 14.535  -29.027 1.00 40.31  ? 66  GLY C O   1 
ATOM   3291 N  N   . TRP C 2 67  ? -59.886 13.067  -29.744 1.00 38.42  ? 67  TRP C N   1 
ATOM   3292 C  CA  . TRP C 2 67  ? -58.944 13.414  -28.690 1.00 36.90  ? 67  TRP C CA  1 
ATOM   3293 C  C   . TRP C 2 67  ? -57.539 13.451  -29.270 1.00 37.66  ? 67  TRP C C   1 
ATOM   3294 O  O   . TRP C 2 67  ? -57.178 12.604  -30.090 1.00 38.75  ? 67  TRP C O   1 
ATOM   3295 C  CB  . TRP C 2 67  ? -59.013 12.402  -27.541 1.00 34.66  ? 67  TRP C CB  1 
ATOM   3296 C  CG  . TRP C 2 67  ? -60.323 12.392  -26.831 1.00 31.38  ? 67  TRP C CG  1 
ATOM   3297 C  CD1 . TRP C 2 67  ? -61.350 11.511  -27.014 1.00 31.47  ? 67  TRP C CD1 1 
ATOM   3298 C  CD2 . TRP C 2 67  ? -60.763 13.318  -25.829 1.00 30.91  ? 67  TRP C CD2 1 
ATOM   3299 N  NE1 . TRP C 2 67  ? -62.404 11.830  -26.187 1.00 30.06  ? 67  TRP C NE1 1 
ATOM   3300 C  CE2 . TRP C 2 67  ? -62.071 12.937  -25.451 1.00 30.86  ? 67  TRP C CE2 1 
ATOM   3301 C  CE3 . TRP C 2 67  ? -60.181 14.434  -25.216 1.00 30.98  ? 67  TRP C CE3 1 
ATOM   3302 C  CZ2 . TRP C 2 67  ? -62.808 13.636  -24.485 1.00 30.23  ? 67  TRP C CZ2 1 
ATOM   3303 C  CZ3 . TRP C 2 67  ? -60.917 15.133  -24.250 1.00 28.77  ? 67  TRP C CZ3 1 
ATOM   3304 C  CH2 . TRP C 2 67  ? -62.217 14.728  -23.899 1.00 30.25  ? 67  TRP C CH2 1 
ATOM   3305 N  N   . SER C 2 68  ? -56.755 14.440  -28.848 1.00 37.78  ? 68  SER C N   1 
ATOM   3306 C  CA  . SER C 2 68  ? -55.393 14.597  -29.332 1.00 38.32  ? 68  SER C CA  1 
ATOM   3307 C  C   . SER C 2 68  ? -54.509 13.473  -28.794 1.00 39.99  ? 68  SER C C   1 
ATOM   3308 O  O   . SER C 2 68  ? -54.885 12.755  -27.857 1.00 39.48  ? 68  SER C O   1 
ATOM   3309 C  CB  . SER C 2 68  ? -54.854 15.955  -28.897 1.00 38.92  ? 68  SER C CB  1 
ATOM   3310 O  OG  . SER C 2 68  ? -54.913 16.090  -27.486 1.00 39.65  ? 68  SER C OG  1 
ATOM   3311 N  N   . HIS C 2 69  ? -53.326 13.326  -29.374 1.00 40.84  ? 69  HIS C N   1 
ATOM   3312 C  CA  . HIS C 2 69  ? -52.430 12.261  -28.963 1.00 41.12  ? 69  HIS C CA  1 
ATOM   3313 C  C   . HIS C 2 69  ? -52.047 12.161  -27.499 1.00 40.58  ? 69  HIS C C   1 
ATOM   3314 O  O   . HIS C 2 69  ? -51.668 11.077  -27.043 1.00 40.82  ? 69  HIS C O   1 
ATOM   3315 C  CB  . HIS C 2 69  ? -51.172 12.275  -29.819 1.00 43.54  ? 69  HIS C CB  1 
ATOM   3316 C  CG  . HIS C 2 69  ? -51.379 11.683  -31.178 1.00 48.25  ? 69  HIS C CG  1 
ATOM   3317 N  ND1 . HIS C 2 69  ? -50.958 10.413  -31.511 1.00 49.28  ? 69  HIS C ND1 1 
ATOM   3318 C  CD2 . HIS C 2 69  ? -51.908 12.212  -32.308 1.00 47.33  ? 69  HIS C CD2 1 
ATOM   3319 C  CE1 . HIS C 2 69  ? -51.217 10.187  -32.787 1.00 50.25  ? 69  HIS C CE1 1 
ATOM   3320 N  NE2 . HIS C 2 69  ? -51.791 11.266  -33.293 1.00 48.72  ? 69  HIS C NE2 1 
ATOM   3321 N  N   . ILE C 2 70  ? -52.139 13.254  -26.745 1.00 39.10  ? 70  ILE C N   1 
ATOM   3322 C  CA  . ILE C 2 70  ? -51.778 13.159  -25.334 1.00 38.61  ? 70  ILE C CA  1 
ATOM   3323 C  C   . ILE C 2 70  ? -52.765 12.254  -24.595 1.00 37.40  ? 70  ILE C C   1 
ATOM   3324 O  O   . ILE C 2 70  ? -52.453 11.730  -23.528 1.00 37.37  ? 70  ILE C O   1 
ATOM   3325 C  CB  . ILE C 2 70  ? -51.732 14.550  -24.633 1.00 39.55  ? 70  ILE C CB  1 
ATOM   3326 C  CG1 . ILE C 2 70  ? -53.137 15.122  -24.467 1.00 41.01  ? 70  ILE C CG1 1 
ATOM   3327 C  CG2 . ILE C 2 70  ? -50.893 15.510  -25.448 1.00 39.95  ? 70  ILE C CG2 1 
ATOM   3328 C  CD1 . ILE C 2 70  ? -53.169 16.401  -23.659 1.00 39.40  ? 70  ILE C CD1 1 
ATOM   3329 N  N   . HIS C 2 71  ? -53.946 12.055  -25.180 1.00 36.20  ? 71  HIS C N   1 
ATOM   3330 C  CA  . HIS C 2 71  ? -54.985 11.219  -24.581 1.00 34.20  ? 71  HIS C CA  1 
ATOM   3331 C  C   . HIS C 2 71  ? -54.895 9.751   -25.019 1.00 34.93  ? 71  HIS C C   1 
ATOM   3332 O  O   . HIS C 2 71  ? -55.702 8.924   -24.588 1.00 32.97  ? 71  HIS C O   1 
ATOM   3333 C  CB  . HIS C 2 71  ? -56.369 11.775  -24.936 1.00 33.29  ? 71  HIS C CB  1 
ATOM   3334 C  CG  . HIS C 2 71  ? -56.602 13.175  -24.455 1.00 34.70  ? 71  HIS C CG  1 
ATOM   3335 N  ND1 . HIS C 2 71  ? -57.047 13.461  -23.183 1.00 35.05  ? 71  HIS C ND1 1 
ATOM   3336 C  CD2 . HIS C 2 71  ? -56.421 14.372  -25.068 1.00 34.20  ? 71  HIS C CD2 1 
ATOM   3337 C  CE1 . HIS C 2 71  ? -57.132 14.772  -23.032 1.00 35.24  ? 71  HIS C CE1 1 
ATOM   3338 N  NE2 . HIS C 2 71  ? -56.757 15.348  -24.161 1.00 33.49  ? 71  HIS C NE2 1 
ATOM   3339 N  N   . ASN C 2 72  ? -53.921 9.428   -25.872 1.00 34.85  ? 72  ASN C N   1 
ATOM   3340 C  CA  . ASN C 2 72  ? -53.759 8.055   -26.343 1.00 36.66  ? 72  ASN C CA  1 
ATOM   3341 C  C   . ASN C 2 72  ? -53.444 7.125   -25.188 1.00 36.66  ? 72  ASN C C   1 
ATOM   3342 O  O   . ASN C 2 72  ? -52.613 7.447   -24.345 1.00 38.01  ? 72  ASN C O   1 
ATOM   3343 C  CB  . ASN C 2 72  ? -52.641 7.961   -27.384 1.00 37.07  ? 72  ASN C CB  1 
ATOM   3344 C  CG  . ASN C 2 72  ? -52.934 8.784   -28.637 1.00 38.80  ? 72  ASN C CG  1 
ATOM   3345 O  OD1 . ASN C 2 72  ? -54.080 9.170   -28.896 1.00 38.51  ? 72  ASN C OD1 1 
ATOM   3346 N  ND2 . ASN C 2 72  ? -51.898 9.041   -29.426 1.00 36.51  ? 72  ASN C ND2 1 
ATOM   3347 N  N   . THR C 2 73  ? -54.109 5.974   -25.143 1.00 36.93  ? 73  THR C N   1 
ATOM   3348 C  CA  . THR C 2 73  ? -53.872 5.012   -24.069 1.00 37.53  ? 73  THR C CA  1 
ATOM   3349 C  C   . THR C 2 73  ? -53.554 3.605   -24.579 1.00 38.92  ? 73  THR C C   1 
ATOM   3350 O  O   . THR C 2 73  ? -53.887 3.250   -25.715 1.00 39.29  ? 73  THR C O   1 
ATOM   3351 C  CB  . THR C 2 73  ? -55.088 4.896   -23.154 1.00 35.13  ? 73  THR C CB  1 
ATOM   3352 O  OG1 . THR C 2 73  ? -56.194 4.400   -23.914 1.00 33.72  ? 73  THR C OG1 1 
ATOM   3353 C  CG2 . THR C 2 73  ? -55.425 6.252   -22.534 1.00 33.26  ? 73  THR C CG2 1 
ATOM   3354 N  N   . TRP C 2 74  ? -52.893 2.814   -23.737 1.00 38.79  ? 74  TRP C N   1 
ATOM   3355 C  CA  . TRP C 2 74  ? -52.567 1.434   -24.091 1.00 39.17  ? 74  TRP C CA  1 
ATOM   3356 C  C   . TRP C 2 74  ? -53.757 0.569   -23.670 1.00 40.63  ? 74  TRP C C   1 
ATOM   3357 O  O   . TRP C 2 74  ? -54.208 0.627   -22.524 1.00 41.67  ? 74  TRP C O   1 
ATOM   3358 C  CB  . TRP C 2 74  ? -51.298 0.958   -23.370 1.00 36.36  ? 74  TRP C CB  1 
ATOM   3359 C  CG  . TRP C 2 74  ? -50.014 1.555   -23.887 1.00 32.72  ? 74  TRP C CG  1 
ATOM   3360 C  CD1 . TRP C 2 74  ? -49.381 2.666   -23.425 1.00 30.93  ? 74  TRP C CD1 1 
ATOM   3361 C  CD2 . TRP C 2 74  ? -49.207 1.053   -24.963 1.00 32.66  ? 74  TRP C CD2 1 
ATOM   3362 N  NE1 . TRP C 2 74  ? -48.222 2.892   -24.142 1.00 31.91  ? 74  TRP C NE1 1 
ATOM   3363 C  CE2 . TRP C 2 74  ? -48.095 1.916   -25.092 1.00 32.66  ? 74  TRP C CE2 1 
ATOM   3364 C  CE3 . TRP C 2 74  ? -49.315 -0.045  -25.827 1.00 30.92  ? 74  TRP C CE3 1 
ATOM   3365 C  CZ2 . TRP C 2 74  ? -47.097 1.714   -26.048 1.00 33.82  ? 74  TRP C CZ2 1 
ATOM   3366 C  CZ3 . TRP C 2 74  ? -48.324 -0.247  -26.775 1.00 30.80  ? 74  TRP C CZ3 1 
ATOM   3367 C  CH2 . TRP C 2 74  ? -47.229 0.627   -26.879 1.00 33.77  ? 74  TRP C CH2 1 
ATOM   3368 N  N   . GLU C 2 75  ? -54.270 -0.226  -24.600 1.00 42.94  ? 75  GLU C N   1 
ATOM   3369 C  CA  . GLU C 2 75  ? -55.413 -1.077  -24.314 1.00 45.48  ? 75  GLU C CA  1 
ATOM   3370 C  C   . GLU C 2 75  ? -55.166 -2.524  -24.724 1.00 47.17  ? 75  GLU C C   1 
ATOM   3371 O  O   . GLU C 2 75  ? -54.173 -2.855  -25.376 1.00 46.84  ? 75  GLU C O   1 
ATOM   3372 C  CB  . GLU C 2 75  ? -56.646 -0.553  -25.052 1.00 46.51  ? 75  GLU C CB  1 
ATOM   3373 C  CG  . GLU C 2 75  ? -57.049 0.872   -24.690 1.00 47.99  ? 75  GLU C CG  1 
ATOM   3374 C  CD  . GLU C 2 75  ? -57.658 0.963   -23.311 1.00 48.71  ? 75  GLU C CD  1 
ATOM   3375 O  OE1 . GLU C 2 75  ? -57.986 -0.102  -22.741 1.00 51.68  ? 75  GLU C OE1 1 
ATOM   3376 O  OE2 . GLU C 2 75  ? -57.823 2.093   -22.804 1.00 49.26  ? 75  GLU C OE2 1 
ATOM   3377 N  N   . THR C 2 76  ? -56.107 -3.374  -24.343 1.00 49.55  ? 76  THR C N   1 
ATOM   3378 C  CA  . THR C 2 76  ? -56.068 -4.798  -24.642 1.00 52.42  ? 76  THR C CA  1 
ATOM   3379 C  C   . THR C 2 76  ? -57.457 -5.137  -25.201 1.00 54.72  ? 76  THR C C   1 
ATOM   3380 O  O   . THR C 2 76  ? -58.378 -4.315  -25.116 1.00 54.91  ? 76  THR C O   1 
ATOM   3381 C  CB  . THR C 2 76  ? -55.750 -5.601  -23.331 1.00 52.25  ? 76  THR C CB  1 
ATOM   3382 O  OG1 . THR C 2 76  ? -54.355 -5.934  -23.299 1.00 52.71  ? 76  THR C OG1 1 
ATOM   3383 C  CG2 . THR C 2 76  ? -56.593 -6.858  -23.219 1.00 53.16  ? 76  THR C CG2 1 
ATOM   3384 N  N   . GLU C 2 77  ? -57.618 -6.325  -25.779 1.00 56.70  ? 77  GLU C N   1 
ATOM   3385 C  CA  . GLU C 2 77  ? -58.916 -6.701  -26.334 1.00 58.65  ? 77  GLU C CA  1 
ATOM   3386 C  C   . GLU C 2 77  ? -60.075 -6.756  -25.358 1.00 58.41  ? 77  GLU C C   1 
ATOM   3387 O  O   . GLU C 2 77  ? -61.095 -6.122  -25.606 1.00 59.03  ? 77  GLU C O   1 
ATOM   3388 C  CB  . GLU C 2 77  ? -58.834 -8.032  -27.079 1.00 60.76  ? 77  GLU C CB  1 
ATOM   3389 C  CG  . GLU C 2 77  ? -58.271 -7.887  -28.475 1.00 63.51  ? 77  GLU C CG  1 
ATOM   3390 C  CD  . GLU C 2 77  ? -58.395 -9.153  -29.292 1.00 65.44  ? 77  GLU C CD  1 
ATOM   3391 O  OE1 . GLU C 2 77  ? -57.344 -9.717  -29.670 1.00 66.11  ? 77  GLU C OE1 1 
ATOM   3392 O  OE2 . GLU C 2 77  ? -59.541 -9.579  -29.555 1.00 64.62  ? 77  GLU C OE2 1 
ATOM   3393 N  N   . GLU C 2 78  ? -59.953 -7.511  -24.268 1.00 58.46  ? 78  GLU C N   1 
ATOM   3394 C  CA  . GLU C 2 78  ? -61.065 -7.563  -23.325 1.00 58.85  ? 78  GLU C CA  1 
ATOM   3395 C  C   . GLU C 2 78  ? -61.354 -6.120  -22.965 1.00 56.60  ? 78  GLU C C   1 
ATOM   3396 O  O   . GLU C 2 78  ? -62.503 -5.702  -22.926 1.00 55.11  ? 78  GLU C O   1 
ATOM   3397 C  CB  . GLU C 2 78  ? -60.709 -8.348  -22.056 1.00 61.89  ? 78  GLU C CB  1 
ATOM   3398 C  CG  . GLU C 2 78  ? -61.933 -8.763  -21.183 1.00 68.19  ? 78  GLU C CG  1 
ATOM   3399 C  CD  . GLU C 2 78  ? -62.821 -7.587  -20.733 1.00 72.16  ? 78  GLU C CD  1 
ATOM   3400 O  OE1 . GLU C 2 78  ? -62.265 -6.574  -20.240 1.00 73.90  ? 78  GLU C OE1 1 
ATOM   3401 O  OE2 . GLU C 2 78  ? -64.071 -7.682  -20.860 1.00 72.37  ? 78  GLU C OE2 1 
ATOM   3402 N  N   . THR C 2 79  ? -60.289 -5.359  -22.726 1.00 55.52  ? 79  THR C N   1 
ATOM   3403 C  CA  . THR C 2 79  ? -60.407 -3.951  -22.364 1.00 55.50  ? 79  THR C CA  1 
ATOM   3404 C  C   . THR C 2 79  ? -61.132 -3.165  -23.444 1.00 54.14  ? 79  THR C C   1 
ATOM   3405 O  O   . THR C 2 79  ? -62.092 -2.449  -23.166 1.00 53.01  ? 79  THR C O   1 
ATOM   3406 C  CB  . THR C 2 79  ? -59.030 -3.330  -22.145 1.00 57.39  ? 79  THR C CB  1 
ATOM   3407 O  OG1 . THR C 2 79  ? -58.025 -4.308  -22.428 1.00 60.66  ? 79  THR C OG1 1 
ATOM   3408 C  CG2 . THR C 2 79  ? -58.879 -2.868  -20.704 1.00 56.84  ? 79  THR C CG2 1 
ATOM   3409 N  N   . LEU C 2 80  ? -60.667 -3.293  -24.679 1.00 53.94  ? 80  LEU C N   1 
ATOM   3410 C  CA  . LEU C 2 80  ? -61.312 -2.608  -25.790 1.00 55.01  ? 80  LEU C CA  1 
ATOM   3411 C  C   . LEU C 2 80  ? -62.765 -3.085  -25.869 1.00 56.75  ? 80  LEU C C   1 
ATOM   3412 O  O   . LEU C 2 80  ? -63.688 -2.280  -25.949 1.00 56.55  ? 80  LEU C O   1 
ATOM   3413 C  CB  . LEU C 2 80  ? -60.572 -2.917  -27.094 1.00 53.79  ? 80  LEU C CB  1 
ATOM   3414 C  CG  . LEU C 2 80  ? -59.979 -1.734  -27.863 1.00 51.94  ? 80  LEU C CG  1 
ATOM   3415 C  CD1 . LEU C 2 80  ? -59.516 -0.656  -26.900 1.00 52.77  ? 80  LEU C CD1 1 
ATOM   3416 C  CD2 . LEU C 2 80  ? -58.823 -2.222  -28.720 1.00 51.34  ? 80  LEU C CD2 1 
ATOM   3417 N  N   . LYS C 2 81  ? -62.963 -4.400  -25.821 1.00 59.19  ? 81  LYS C N   1 
ATOM   3418 C  CA  . LYS C 2 81  ? -64.304 -4.975  -25.868 1.00 61.18  ? 81  LYS C CA  1 
ATOM   3419 C  C   . LYS C 2 81  ? -65.130 -4.527  -24.674 1.00 61.93  ? 81  LYS C C   1 
ATOM   3420 O  O   . LYS C 2 81  ? -66.208 -3.971  -24.841 1.00 64.04  ? 81  LYS C O   1 
ATOM   3421 C  CB  . LYS C 2 81  ? -64.230 -6.501  -25.899 1.00 62.36  ? 81  LYS C CB  1 
ATOM   3422 C  CG  . LYS C 2 81  ? -63.727 -7.057  -27.217 1.00 63.69  ? 81  LYS C CG  1 
ATOM   3423 C  CD  . LYS C 2 81  ? -63.461 -8.548  -27.125 1.00 65.92  ? 81  LYS C CD  1 
ATOM   3424 C  CE  . LYS C 2 81  ? -62.936 -9.100  -28.443 1.00 67.62  ? 81  LYS C CE  1 
ATOM   3425 N  NZ  . LYS C 2 81  ? -63.936 -8.957  -29.542 1.00 69.10  ? 81  LYS C NZ  1 
ATOM   3426 N  N   . GLN C 2 82  ? -64.617 -4.769  -23.473 1.00 62.84  ? 82  GLN C N   1 
ATOM   3427 C  CA  . GLN C 2 82  ? -65.286 -4.392  -22.228 1.00 63.79  ? 82  GLN C CA  1 
ATOM   3428 C  C   . GLN C 2 82  ? -65.957 -3.022  -22.295 1.00 63.25  ? 82  GLN C C   1 
ATOM   3429 O  O   . GLN C 2 82  ? -67.027 -2.825  -21.725 1.00 62.24  ? 82  GLN C O   1 
ATOM   3430 C  CB  . GLN C 2 82  ? -64.274 -4.402  -21.074 1.00 66.28  ? 82  GLN C CB  1 
ATOM   3431 C  CG  . GLN C 2 82  ? -64.821 -3.929  -19.730 1.00 67.91  ? 82  GLN C CG  1 
ATOM   3432 C  CD  . GLN C 2 82  ? -63.821 -4.103  -18.591 1.00 70.86  ? 82  GLN C CD  1 
ATOM   3433 O  OE1 . GLN C 2 82  ? -62.657 -4.449  -18.818 1.00 71.87  ? 82  GLN C OE1 1 
ATOM   3434 N  NE2 . GLN C 2 82  ? -64.272 -3.863  -17.361 1.00 70.90  ? 82  GLN C NE2 1 
ATOM   3435 N  N   . GLN C 2 83  ? -65.326 -2.078  -22.988 1.00 63.82  ? 83  GLN C N   1 
ATOM   3436 C  CA  . GLN C 2 83  ? -65.868 -0.724  -23.116 1.00 63.80  ? 83  GLN C CA  1 
ATOM   3437 C  C   . GLN C 2 83  ? -66.854 -0.566  -24.275 1.00 63.42  ? 83  GLN C C   1 
ATOM   3438 O  O   . GLN C 2 83  ? -67.618 0.396   -24.310 1.00 63.05  ? 83  GLN C O   1 
ATOM   3439 C  CB  . GLN C 2 83  ? -64.739 0.292   -23.299 1.00 63.62  ? 83  GLN C CB  1 
ATOM   3440 C  CG  . GLN C 2 83  ? -63.794 0.443   -22.127 1.00 63.76  ? 83  GLN C CG  1 
ATOM   3441 C  CD  . GLN C 2 83  ? -62.826 1.593   -22.341 1.00 64.75  ? 83  GLN C CD  1 
ATOM   3442 O  OE1 . GLN C 2 83  ? -63.233 2.758   -22.425 1.00 64.53  ? 83  GLN C OE1 1 
ATOM   3443 N  NE2 . GLN C 2 83  ? -61.539 1.274   -22.447 1.00 64.57  ? 83  GLN C NE2 1 
ATOM   3444 N  N   . ASN C 2 84  ? -66.824 -1.502  -25.219 1.00 63.69  ? 84  ASN C N   1 
ATOM   3445 C  CA  . ASN C 2 84  ? -67.709 -1.475  -26.387 1.00 64.29  ? 84  ASN C CA  1 
ATOM   3446 C  C   . ASN C 2 84  ? -67.348 -0.362  -27.365 1.00 63.58  ? 84  ASN C C   1 
ATOM   3447 O  O   . ASN C 2 84  ? -68.223 0.255   -27.963 1.00 63.87  ? 84  ASN C O   1 
ATOM   3448 C  CB  . ASN C 2 84  ? -69.179 -1.313  -25.964 1.00 66.24  ? 84  ASN C CB  1 
ATOM   3449 C  CG  . ASN C 2 84  ? -69.745 -2.560  -25.302 1.00 68.54  ? 84  ASN C CG  1 
ATOM   3450 O  OD1 . ASN C 2 84  ? -69.603 -3.672  -25.819 1.00 70.54  ? 84  ASN C OD1 1 
ATOM   3451 N  ND2 . ASN C 2 84  ? -70.404 -2.377  -24.160 1.00 68.81  ? 84  ASN C ND2 1 
ATOM   3452 N  N   . VAL C 2 85  ? -66.057 -0.109  -27.532 1.00 62.56  ? 85  VAL C N   1 
ATOM   3453 C  CA  . VAL C 2 85  ? -65.594 0.932   -28.438 1.00 62.24  ? 85  VAL C CA  1 
ATOM   3454 C  C   . VAL C 2 85  ? -65.959 0.612   -29.888 1.00 62.85  ? 85  VAL C C   1 
ATOM   3455 O  O   . VAL C 2 85  ? -66.167 -0.550  -30.233 1.00 62.97  ? 85  VAL C O   1 
ATOM   3456 C  CB  . VAL C 2 85  ? -64.067 1.078   -28.351 1.00 61.84  ? 85  VAL C CB  1 
ATOM   3457 C  CG1 . VAL C 2 85  ? -63.658 1.413   -26.926 1.00 61.15  ? 85  VAL C CG1 1 
ATOM   3458 C  CG2 . VAL C 2 85  ? -63.398 -0.216  -28.805 1.00 60.62  ? 85  VAL C CG2 1 
ATOM   3459 N  N   . ARG C 2 86  ? -66.035 1.642   -30.732 1.00 63.01  ? 86  ARG C N   1 
ATOM   3460 C  CA  . ARG C 2 86  ? -66.342 1.452   -32.150 1.00 63.71  ? 86  ARG C CA  1 
ATOM   3461 C  C   . ARG C 2 86  ? -65.016 1.299   -32.869 1.00 63.96  ? 86  ARG C C   1 
ATOM   3462 O  O   . ARG C 2 86  ? -63.963 1.632   -32.321 1.00 63.90  ? 86  ARG C O   1 
ATOM   3463 C  CB  . ARG C 2 86  ? -67.028 2.676   -32.756 1.00 64.65  ? 86  ARG C CB  1 
ATOM   3464 C  CG  . ARG C 2 86  ? -67.926 3.444   -31.838 1.00 66.62  ? 86  ARG C CG  1 
ATOM   3465 C  CD  . ARG C 2 86  ? -69.359 3.027   -31.982 1.00 68.69  ? 86  ARG C CD  1 
ATOM   3466 N  NE  . ARG C 2 86  ? -70.210 3.917   -31.202 1.00 71.20  ? 86  ARG C NE  1 
ATOM   3467 C  CZ  . ARG C 2 86  ? -70.359 5.219   -31.436 1.00 72.23  ? 86  ARG C CZ  1 
ATOM   3468 N  NH1 . ARG C 2 86  ? -71.154 5.946   -30.653 1.00 72.77  ? 86  ARG C NH1 1 
ATOM   3469 N  NH2 . ARG C 2 86  ? -69.733 5.793   -32.457 1.00 71.64  ? 86  ARG C NH2 1 
ATOM   3470 N  N   . GLY C 2 87  ? -65.072 0.822   -34.106 1.00 64.40  ? 87  GLY C N   1 
ATOM   3471 C  CA  . GLY C 2 87  ? -63.858 0.666   -34.885 1.00 65.15  ? 87  GLY C CA  1 
ATOM   3472 C  C   . GLY C 2 87  ? -63.100 -0.617  -34.613 1.00 65.92  ? 87  GLY C C   1 
ATOM   3473 O  O   . GLY C 2 87  ? -61.891 -0.687  -34.824 1.00 64.13  ? 87  GLY C O   1 
HETATM 3474 N  N   . MSE C 2 88  ? -63.805 -1.641  -34.149 1.00 67.80  ? 88  MSE C N   1 
HETATM 3475 C  CA  . MSE C 2 88  ? -63.159 -2.913  -33.869 1.00 70.63  ? 88  MSE C CA  1 
HETATM 3476 C  C   . MSE C 2 88  ? -62.622 -3.564  -35.140 1.00 69.73  ? 88  MSE C C   1 
HETATM 3477 O  O   . MSE C 2 88  ? -61.730 -4.409  -35.083 1.00 68.79  ? 88  MSE C O   1 
HETATM 3478 C  CB  . MSE C 2 88  ? -64.133 -3.851  -33.155 1.00 75.58  ? 88  MSE C CB  1 
HETATM 3479 C  CG  . MSE C 2 88  ? -64.392 -3.451  -31.710 1.00 81.52  ? 88  MSE C CG  1 
HETATM 3480 SE SE  . MSE C 2 88  ? -62.742 -3.410  -30.683 1.00 88.97  ? 88  MSE C SE  1 
HETATM 3481 C  CE  . MSE C 2 88  ? -62.651 -5.288  -30.236 1.00 87.39  ? 88  MSE C CE  1 
ATOM   3482 N  N   . LYS C 2 89  ? -63.163 -3.166  -36.287 1.00 68.97  ? 89  LYS C N   1 
ATOM   3483 C  CA  . LYS C 2 89  ? -62.705 -3.709  -37.560 1.00 67.98  ? 89  LYS C CA  1 
ATOM   3484 C  C   . LYS C 2 89  ? -61.208 -3.463  -37.701 1.00 66.78  ? 89  LYS C C   1 
ATOM   3485 O  O   . LYS C 2 89  ? -60.454 -4.358  -38.092 1.00 66.92  ? 89  LYS C O   1 
ATOM   3486 C  CB  . LYS C 2 89  ? -63.434 -3.038  -38.731 1.00 69.19  ? 89  LYS C CB  1 
ATOM   3487 C  CG  . LYS C 2 89  ? -62.837 -3.327  -40.118 1.00 69.48  ? 89  LYS C CG  1 
ATOM   3488 C  CD  . LYS C 2 89  ? -63.097 -4.763  -40.572 1.00 71.55  ? 89  LYS C CD  1 
ATOM   3489 C  CE  . LYS C 2 89  ? -62.751 -4.958  -42.054 1.00 72.19  ? 89  LYS C CE  1 
ATOM   3490 N  NZ  . LYS C 2 89  ? -63.256 -6.265  -42.577 1.00 72.80  ? 89  LYS C NZ  1 
ATOM   3491 N  N   . LYS C 2 90  ? -60.769 -2.250  -37.379 1.00 64.68  ? 90  LYS C N   1 
ATOM   3492 C  CA  . LYS C 2 90  ? -59.354 -1.948  -37.510 1.00 63.12  ? 90  LYS C CA  1 
ATOM   3493 C  C   . LYS C 2 90  ? -58.486 -2.685  -36.493 1.00 62.03  ? 90  LYS C C   1 
ATOM   3494 O  O   . LYS C 2 90  ? -57.256 -2.612  -36.552 1.00 60.91  ? 90  LYS C O   1 
ATOM   3495 C  CB  . LYS C 2 90  ? -59.113 -0.437  -37.452 1.00 62.85  ? 90  LYS C CB  1 
ATOM   3496 C  CG  . LYS C 2 90  ? -59.557 0.247   -36.195 1.00 62.79  ? 90  LYS C CG  1 
ATOM   3497 C  CD  . LYS C 2 90  ? -59.428 1.759   -36.342 1.00 63.28  ? 90  LYS C CD  1 
ATOM   3498 C  CE  . LYS C 2 90  ? -60.322 2.283   -37.456 1.00 62.83  ? 90  LYS C CE  1 
ATOM   3499 N  NZ  . LYS C 2 90  ? -60.379 3.763   -37.468 1.00 60.96  ? 90  LYS C NZ  1 
ATOM   3500 N  N   . LEU C 2 91  ? -59.119 -3.414  -35.576 1.00 61.83  ? 91  LEU C N   1 
ATOM   3501 C  CA  . LEU C 2 91  ? -58.364 -4.183  -34.596 1.00 61.47  ? 91  LEU C CA  1 
ATOM   3502 C  C   . LEU C 2 91  ? -57.771 -5.396  -35.320 1.00 62.22  ? 91  LEU C C   1 
ATOM   3503 O  O   . LEU C 2 91  ? -56.557 -5.462  -35.547 1.00 62.36  ? 91  LEU C O   1 
ATOM   3504 C  CB  . LEU C 2 91  ? -59.264 -4.658  -33.455 1.00 60.82  ? 91  LEU C CB  1 
ATOM   3505 C  CG  . LEU C 2 91  ? -58.573 -4.965  -32.119 1.00 60.14  ? 91  LEU C CG  1 
ATOM   3506 C  CD1 . LEU C 2 91  ? -59.534 -5.749  -31.243 1.00 61.43  ? 91  LEU C CD1 1 
ATOM   3507 C  CD2 . LEU C 2 91  ? -57.296 -5.767  -32.322 1.00 58.98  ? 91  LEU C CD2 1 
ATOM   3508 N  N   . ASP C 2 92  ? -58.622 -6.349  -35.694 1.00 62.07  ? 92  ASP C N   1 
ATOM   3509 C  CA  . ASP C 2 92  ? -58.134 -7.535  -36.395 1.00 62.96  ? 92  ASP C CA  1 
ATOM   3510 C  C   . ASP C 2 92  ? -57.377 -7.163  -37.663 1.00 62.63  ? 92  ASP C C   1 
ATOM   3511 O  O   . ASP C 2 92  ? -56.530 -7.930  -38.127 1.00 62.10  ? 92  ASP C O   1 
ATOM   3512 C  CB  . ASP C 2 92  ? -59.280 -8.492  -36.734 1.00 63.86  ? 92  ASP C CB  1 
ATOM   3513 C  CG  . ASP C 2 92  ? -60.541 -7.771  -37.126 1.00 64.94  ? 92  ASP C CG  1 
ATOM   3514 O  OD1 . ASP C 2 92  ? -60.435 -6.758  -37.849 1.00 66.41  ? 92  ASP C OD1 1 
ATOM   3515 O  OD2 . ASP C 2 92  ? -61.634 -8.223  -36.718 1.00 64.09  ? 92  ASP C OD2 1 
ATOM   3516 N  N   . ASN C 2 93  ? -57.683 -5.994  -38.223 1.00 62.38  ? 93  ASN C N   1 
ATOM   3517 C  CA  . ASN C 2 93  ? -56.981 -5.527  -39.413 1.00 62.70  ? 93  ASN C CA  1 
ATOM   3518 C  C   . ASN C 2 93  ? -55.530 -5.258  -39.023 1.00 62.86  ? 93  ASN C C   1 
ATOM   3519 O  O   . ASN C 2 93  ? -54.594 -5.520  -39.786 1.00 62.28  ? 93  ASN C O   1 
ATOM   3520 C  CB  . ASN C 2 93  ? -57.629 -4.251  -39.947 1.00 63.85  ? 93  ASN C CB  1 
ATOM   3521 C  CG  . ASN C 2 93  ? -58.532 -4.512  -41.141 1.00 64.67  ? 93  ASN C CG  1 
ATOM   3522 O  OD1 . ASN C 2 93  ? -58.831 -5.660  -41.469 1.00 65.56  ? 93  ASN C OD1 1 
ATOM   3523 N  ND2 . ASN C 2 93  ? -58.975 -3.443  -41.792 1.00 64.85  ? 93  ASN C ND2 1 
ATOM   3524 N  N   . TYR C 2 94  ? -55.342 -4.747  -37.814 1.00 63.01  ? 94  TYR C N   1 
ATOM   3525 C  CA  . TYR C 2 94  ? -54.000 -4.468  -37.334 1.00 63.98  ? 94  TYR C CA  1 
ATOM   3526 C  C   . TYR C 2 94  ? -53.329 -5.745  -36.841 1.00 65.28  ? 94  TYR C C   1 
ATOM   3527 O  O   . TYR C 2 94  ? -52.100 -5.869  -36.866 1.00 64.59  ? 94  TYR C O   1 
ATOM   3528 C  CB  . TYR C 2 94  ? -54.034 -3.461  -36.184 1.00 63.18  ? 94  TYR C CB  1 
ATOM   3529 C  CG  . TYR C 2 94  ? -52.659 -3.160  -35.644 1.00 61.33  ? 94  TYR C CG  1 
ATOM   3530 C  CD1 . TYR C 2 94  ? -51.720 -2.497  -36.430 1.00 62.35  ? 94  TYR C CD1 1 
ATOM   3531 C  CD2 . TYR C 2 94  ? -52.278 -3.578  -34.375 1.00 60.01  ? 94  TYR C CD2 1 
ATOM   3532 C  CE1 . TYR C 2 94  ? -50.437 -2.261  -35.971 1.00 62.49  ? 94  TYR C CE1 1 
ATOM   3533 C  CE2 . TYR C 2 94  ? -50.991 -3.345  -33.903 1.00 60.64  ? 94  TYR C CE2 1 
ATOM   3534 C  CZ  . TYR C 2 94  ? -50.075 -2.684  -34.706 1.00 61.78  ? 94  TYR C CZ  1 
ATOM   3535 O  OH  . TYR C 2 94  ? -48.796 -2.425  -34.252 1.00 63.37  ? 94  TYR C OH  1 
ATOM   3536 N  N   . LYS C 2 95  ? -54.149 -6.694  -36.401 1.00 66.97  ? 95  LYS C N   1 
ATOM   3537 C  CA  . LYS C 2 95  ? -53.654 -7.949  -35.849 1.00 70.12  ? 95  LYS C CA  1 
ATOM   3538 C  C   . LYS C 2 95  ? -52.995 -8.956  -36.788 1.00 72.17  ? 95  LYS C C   1 
ATOM   3539 O  O   . LYS C 2 95  ? -52.970 -10.155 -36.505 1.00 73.18  ? 95  LYS C O   1 
ATOM   3540 C  CB  . LYS C 2 95  ? -54.772 -8.631  -35.060 1.00 70.06  ? 95  LYS C CB  1 
ATOM   3541 C  CG  . LYS C 2 95  ? -54.565 -8.552  -33.553 1.00 69.77  ? 95  LYS C CG  1 
ATOM   3542 C  CD  . LYS C 2 95  ? -55.854 -8.753  -32.780 1.00 70.11  ? 95  LYS C CD  1 
ATOM   3543 C  CE  . LYS C 2 95  ? -56.540 -10.057 -33.138 1.00 69.76  ? 95  LYS C CE  1 
ATOM   3544 N  NZ  . LYS C 2 95  ? -57.691 -10.328 -32.231 1.00 70.29  ? 95  LYS C NZ  1 
ATOM   3545 N  N   . LYS C 2 96  ? -52.458 -8.475  -37.900 1.00 73.95  ? 96  LYS C N   1 
ATOM   3546 C  CA  . LYS C 2 96  ? -51.768 -9.343  -38.848 1.00 74.78  ? 96  LYS C CA  1 
ATOM   3547 C  C   . LYS C 2 96  ? -50.697 -8.455  -39.450 1.00 75.57  ? 96  LYS C C   1 
ATOM   3548 O  O   . LYS C 2 96  ? -49.592 -8.901  -39.759 1.00 75.35  ? 96  LYS C O   1 
ATOM   3549 C  CB  . LYS C 2 96  ? -52.727 -9.846  -39.926 1.00 73.92  ? 96  LYS C CB  1 
ATOM   3550 C  CG  . LYS C 2 96  ? -54.171 -9.860  -39.488 1.00 73.20  ? 96  LYS C CG  1 
ATOM   3551 C  CD  . LYS C 2 96  ? -54.910 -8.754  -40.187 1.00 72.21  ? 96  LYS C CD  1 
ATOM   3552 C  CE  . LYS C 2 96  ? -55.329 -9.185  -41.576 1.00 73.17  ? 96  LYS C CE  1 
ATOM   3553 N  NZ  . LYS C 2 96  ? -56.568 -10.014 -41.529 1.00 72.76  ? 96  LYS C NZ  1 
ATOM   3554 N  N   . LYS C 2 97  ? -51.045 -7.184  -39.609 1.00 76.79  ? 97  LYS C N   1 
ATOM   3555 C  CA  . LYS C 2 97  ? -50.106 -6.207  -40.123 1.00 78.12  ? 97  LYS C CA  1 
ATOM   3556 C  C   . LYS C 2 97  ? -49.059 -6.002  -39.035 1.00 79.45  ? 97  LYS C C   1 
ATOM   3557 O  O   . LYS C 2 97  ? -47.852 -6.132  -39.337 1.00 80.32  ? 97  LYS C O   1 
ATOM   3558 C  CB  . LYS C 2 97  ? -50.784 -4.867  -40.392 1.00 77.27  ? 97  LYS C CB  1 
ATOM   3559 C  CG  . LYS C 2 97  ? -49.786 -3.836  -40.877 1.00 77.72  ? 97  LYS C CG  1 
ATOM   3560 C  CD  . LYS C 2 97  ? -50.055 -2.434  -40.371 1.00 77.56  ? 97  LYS C CD  1 
ATOM   3561 C  CE  . LYS C 2 97  ? -49.125 -1.473  -41.088 1.00 76.83  ? 97  LYS C CE  1 
ATOM   3562 N  NZ  . LYS C 2 97  ? -47.946 -2.215  -41.618 1.00 75.90  ? 97  LYS C NZ  1 
ATOM   3563 N  N   . ALA D 3 1   ? -36.984 -3.266  -9.194  1.00 117.53 ? 1   ALA D N   1 
ATOM   3564 C  CA  . ALA D 3 1   ? -35.753 -2.628  -8.745  1.00 117.36 ? 1   ALA D CA  1 
ATOM   3565 C  C   . ALA D 3 1   ? -35.072 -3.449  -7.655  1.00 117.05 ? 1   ALA D C   1 
ATOM   3566 O  O   . ALA D 3 1   ? -35.586 -3.571  -6.543  1.00 116.97 ? 1   ALA D O   1 
ATOM   3567 C  CB  . ALA D 3 1   ? -36.036 -1.218  -8.251  1.00 117.38 ? 1   ALA D CB  1 
ATOM   3568 N  N   . ARG D 3 2   ? -33.912 -4.011  -7.982  1.00 116.71 ? 2   ARG D N   1 
ATOM   3569 C  CA  . ARG D 3 2   ? -33.143 -4.794  -7.023  1.00 116.53 ? 2   ARG D CA  1 
ATOM   3570 C  C   . ARG D 3 2   ? -31.849 -4.083  -6.641  1.00 115.52 ? 2   ARG D C   1 
ATOM   3571 O  O   . ARG D 3 2   ? -31.387 -3.190  -7.352  1.00 115.23 ? 2   ARG D O   1 
ATOM   3572 C  CB  . ARG D 3 2   ? -32.833 -6.181  -7.590  1.00 118.13 ? 2   ARG D CB  1 
ATOM   3573 C  CG  . ARG D 3 2   ? -33.652 -6.548  -8.816  1.00 120.09 ? 2   ARG D CG  1 
ATOM   3574 C  CD  . ARG D 3 2   ? -32.991 -7.576  -9.720  1.00 121.82 ? 2   ARG D CD  1 
ATOM   3575 N  NE  . ARG D 3 2   ? -32.483 -6.977  -10.950 1.00 122.97 ? 2   ARG D NE  1 
ATOM   3576 C  CZ  . ARG D 3 2   ? -31.780 -7.633  -11.863 1.00 123.41 ? 2   ARG D CZ  1 
ATOM   3577 N  NH1 . ARG D 3 2   ? -31.498 -8.917  -11.690 1.00 123.90 ? 2   ARG D NH1 1 
ATOM   3578 N  NH2 . ARG D 3 2   ? -31.357 -7.007  -12.953 1.00 123.14 ? 2   ARG D NH2 1 
HETATM 3579 N  N   . TPO D 3 3   ? -31.269 -4.484  -5.515  1.00 114.26 ? 3   TPO D N   1 
HETATM 3580 C  CA  . TPO D 3 3   ? -29.950 -3.963  -5.091  1.00 112.84 ? 3   TPO D CA  1 
HETATM 3581 C  CB  . TPO D 3 3   ? -29.973 -2.789  -4.043  1.00 114.30 ? 3   TPO D CB  1 
HETATM 3582 C  CG2 . TPO D 3 3   ? -30.638 -1.591  -4.662  1.00 113.70 ? 3   TPO D CG2 1 
HETATM 3583 O  OG1 . TPO D 3 3   ? -30.560 -3.183  -2.813  1.00 116.58 ? 3   TPO D OG1 1 
HETATM 3584 P  P   . TPO D 3 3   ? -30.357 -2.094  -1.544  1.00 118.16 ? 3   TPO D P   1 
HETATM 3585 O  O1P . TPO D 3 3   ? -28.964 -2.188  -1.022  1.00 117.71 ? 3   TPO D O1P 1 
HETATM 3586 O  O2P . TPO D 3 3   ? -30.695 -0.673  -2.137  1.00 118.15 ? 3   TPO D O2P 1 
HETATM 3587 O  O3P . TPO D 3 3   ? -31.500 -2.442  -0.445  1.00 117.37 ? 3   TPO D O3P 1 
HETATM 3588 C  C   . TPO D 3 3   ? -29.036 -5.084  -4.622  1.00 110.81 ? 3   TPO D C   1 
HETATM 3589 O  O   . TPO D 3 3   ? -29.459 -6.217  -4.620  1.00 110.36 ? 3   TPO D O   1 
HETATM 3590 N  N   . M3L D 3 4   ? -27.794 -4.838  -4.258  1.00 108.61 ? 4   M3L D N   1 
HETATM 3591 C  CA  . M3L D 3 4   ? -27.012 -5.969  -3.898  1.00 106.80 ? 4   M3L D CA  1 
HETATM 3592 C  CB  . M3L D 3 4   ? -25.583 -5.563  -3.802  1.00 104.20 ? 4   M3L D CB  1 
HETATM 3593 C  CG  . M3L D 3 4   ? -25.001 -5.114  -5.281  1.00 101.45 ? 4   M3L D CG  1 
HETATM 3594 C  CD  . M3L D 3 4   ? -24.557 -6.273  -6.311  1.00 98.22  ? 4   M3L D CD  1 
HETATM 3595 C  CE  . M3L D 3 4   ? -25.648 -7.168  -6.946  1.00 95.84  ? 4   M3L D CE  1 
HETATM 3596 N  NZ  . M3L D 3 4   ? -25.063 -8.254  -7.758  1.00 94.12  ? 4   M3L D NZ  1 
HETATM 3597 C  C   . M3L D 3 4   ? -27.628 -6.878  -2.852  1.00 107.19 ? 4   M3L D C   1 
HETATM 3598 O  O   . M3L D 3 4   ? -27.159 -7.970  -2.518  1.00 107.22 ? 4   M3L D O   1 
HETATM 3599 C  CM1 . M3L D 3 4   ? -26.045 -9.373  -7.890  1.00 93.63  ? 4   M3L D CM1 1 
HETATM 3600 C  CM2 . M3L D 3 4   ? -24.661 -7.877  -9.145  1.00 94.29  ? 4   M3L D CM2 1 
HETATM 3601 C  CM3 . M3L D 3 4   ? -23.824 -8.844  -7.139  1.00 93.18  ? 4   M3L D CM3 1 
ATOM   3602 N  N   . GLN D 3 5   ? -28.741 -6.400  -2.305  1.00 107.47 ? 5   GLN D N   1 
ATOM   3603 C  CA  . GLN D 3 5   ? -29.673 -7.262  -1.588  1.00 107.49 ? 5   GLN D CA  1 
ATOM   3604 C  C   . GLN D 3 5   ? -29.897 -6.767  -0.163  1.00 107.72 ? 5   GLN D C   1 
ATOM   3605 O  O   . GLN D 3 5   ? -30.108 -7.561  0.754   1.00 107.75 ? 5   GLN D O   1 
ATOM   3606 C  CB  . GLN D 3 5   ? -29.163 -8.705  -1.570  1.00 106.98 ? 5   GLN D CB  1 
ATOM   3607 C  CG  . GLN D 3 5   ? -30.110 -9.689  -0.903  1.00 106.56 ? 5   GLN D CG  1 
ATOM   3608 C  CD  . GLN D 3 5   ? -30.477 -10.849 -1.809  1.00 105.93 ? 5   GLN D CD  1 
ATOM   3609 O  OE1 . GLN D 3 5   ? -30.311 -12.010 -1.436  1.00 105.37 ? 5   GLN D OE1 1 
ATOM   3610 N  NE2 . GLN D 3 5   ? -30.976 -10.538 -2.999  1.00 105.04 ? 5   GLN D NE2 1 
HETATM 3611 O  O   . HOH E 4 .   ? -14.645 2.870   -21.260 1.00 31.53  ? 188 HOH A O   1 
HETATM 3612 O  O   . HOH E 4 .   ? -24.649 3.328   -12.667 1.00 32.95  ? 189 HOH A O   1 
HETATM 3613 O  O   . HOH E 4 .   ? -21.030 0.301   -19.790 1.00 29.95  ? 190 HOH A O   1 
HETATM 3614 O  O   . HOH E 4 .   ? -20.035 -8.206  1.325   1.00 33.01  ? 191 HOH A O   1 
HETATM 3615 O  O   . HOH E 4 .   ? -29.462 -1.716  -12.306 1.00 18.69  ? 192 HOH A O   1 
HETATM 3616 O  O   . HOH E 4 .   ? -1.782  -10.576 -27.542 1.00 19.63  ? 193 HOH A O   1 
HETATM 3617 O  O   . HOH E 4 .   ? -9.910  -0.261  -3.944  1.00 36.45  ? 194 HOH A O   1 
HETATM 3618 O  O   . HOH E 4 .   ? -24.529 -3.270  -1.945  1.00 22.96  ? 195 HOH A O   1 
HETATM 3619 O  O   . HOH E 4 .   ? -31.544 -0.453  -7.726  1.00 30.56  ? 196 HOH A O   1 
HETATM 3620 O  O   . HOH E 4 .   ? -13.531 -1.794  -1.203  1.00 23.12  ? 197 HOH A O   1 
HETATM 3621 O  O   . HOH E 4 .   ? -24.255 2.601   -15.407 1.00 37.59  ? 198 HOH A O   1 
HETATM 3622 O  O   . HOH E 4 .   ? -25.681 -5.040  -18.695 1.00 31.98  ? 199 HOH A O   1 
HETATM 3623 O  O   . HOH E 4 .   ? -17.699 1.970   -13.334 1.00 19.54  ? 200 HOH A O   1 
HETATM 3624 O  O   . HOH E 4 .   ? -1.136  -13.479 -14.540 1.00 34.69  ? 201 HOH A O   1 
HETATM 3625 O  O   . HOH E 4 .   ? -25.402 2.248   -27.606 1.00 36.73  ? 202 HOH A O   1 
HETATM 3626 O  O   . HOH E 4 .   ? -13.225 -7.471  -19.024 1.00 30.41  ? 203 HOH A O   1 
HETATM 3627 O  O   . HOH E 4 .   ? -21.187 -10.741 -5.539  1.00 43.82  ? 204 HOH A O   1 
HETATM 3628 O  O   . HOH E 4 .   ? -8.497  -15.465 -2.149  1.00 62.40  ? 205 HOH A O   1 
HETATM 3629 O  O   . HOH E 4 .   ? -28.364 5.513   -26.510 1.00 28.28  ? 206 HOH A O   1 
HETATM 3630 O  O   . HOH E 4 .   ? -52.361 2.668   -11.373 1.00 52.21  ? 207 HOH A O   1 
HETATM 3631 O  O   . HOH E 4 .   ? -15.441 -0.349  -2.970  1.00 28.19  ? 208 HOH A O   1 
HETATM 3632 O  O   . HOH E 4 .   ? -10.739 -0.879  -17.020 1.00 42.02  ? 209 HOH A O   1 
HETATM 3633 O  O   . HOH E 4 .   ? -25.940 -2.731  -17.917 1.00 28.56  ? 210 HOH A O   1 
HETATM 3634 O  O   . HOH E 4 .   ? -30.136 16.725  -15.242 1.00 27.64  ? 211 HOH A O   1 
HETATM 3635 O  O   . HOH E 4 .   ? -5.888  -9.143  4.768   1.00 53.25  ? 212 HOH A O   1 
HETATM 3636 O  O   . HOH E 4 .   ? -20.171 0.115   -6.831  1.00 24.97  ? 213 HOH A O   1 
HETATM 3637 O  O   . HOH E 4 .   ? -39.418 19.169  -6.758  1.00 46.48  ? 214 HOH A O   1 
HETATM 3638 O  O   . HOH E 4 .   ? -4.713  7.308   -25.973 1.00 48.00  ? 215 HOH A O   1 
HETATM 3639 O  O   . HOH E 4 .   ? -26.001 4.555   0.722   1.00 27.79  ? 216 HOH A O   1 
HETATM 3640 O  O   . HOH E 4 .   ? -27.231 6.323   -19.031 1.00 25.95  ? 217 HOH A O   1 
HETATM 3641 O  O   . HOH E 4 .   ? -17.885 13.105  -18.750 1.00 41.20  ? 218 HOH A O   1 
HETATM 3642 O  O   . HOH E 4 .   ? -45.319 6.566   -7.488  1.00 41.56  ? 219 HOH A O   1 
HETATM 3643 O  O   . HOH E 4 .   ? -11.348 2.119   -13.362 1.00 27.04  ? 220 HOH A O   1 
HETATM 3644 O  O   . HOH E 4 .   ? -21.821 -10.470 -1.240  1.00 35.34  ? 221 HOH A O   1 
HETATM 3645 O  O   . HOH E 4 .   ? -21.566 -21.283 -15.896 1.00 62.62  ? 222 HOH A O   1 
HETATM 3646 O  O   . HOH E 4 .   ? -20.172 -2.169  3.341   1.00 33.32  ? 223 HOH A O   1 
HETATM 3647 O  O   . HOH E 4 .   ? -24.308 -2.995  -21.841 1.00 62.30  ? 224 HOH A O   1 
HETATM 3648 O  O   . HOH E 4 .   ? -26.618 -13.401 -15.671 1.00 38.80  ? 225 HOH A O   1 
HETATM 3649 O  O   . HOH E 4 .   ? -18.562 7.048   -8.474  1.00 27.14  ? 226 HOH A O   1 
HETATM 3650 O  O   . HOH E 4 .   ? -16.977 -18.546 -19.569 1.00 40.28  ? 227 HOH A O   1 
HETATM 3651 O  O   . HOH E 4 .   ? -10.908 1.226   -8.857  1.00 47.53  ? 228 HOH A O   1 
HETATM 3652 O  O   . HOH E 4 .   ? -36.256 21.837  -12.610 1.00 61.50  ? 229 HOH A O   1 
HETATM 3653 O  O   . HOH E 4 .   ? -33.712 14.357  -20.647 1.00 46.78  ? 230 HOH A O   1 
HETATM 3654 O  O   . HOH E 4 .   ? -6.542  -14.007 -9.037  1.00 34.94  ? 231 HOH A O   1 
HETATM 3655 O  O   . HOH E 4 .   ? -18.291 -0.477  -18.921 1.00 37.94  ? 232 HOH A O   1 
HETATM 3656 O  O   . HOH E 4 .   ? -10.839 0.630   -0.482  1.00 36.99  ? 233 HOH A O   1 
HETATM 3657 O  O   . HOH E 4 .   ? -49.274 0.060   -10.863 1.00 43.92  ? 234 HOH A O   1 
HETATM 3658 O  O   . HOH E 4 .   ? -52.503 5.004   -10.358 1.00 37.33  ? 235 HOH A O   1 
HETATM 3659 O  O   . HOH E 4 .   ? -17.257 0.699   -6.554  1.00 30.92  ? 236 HOH A O   1 
HETATM 3660 O  O   . HOH E 4 .   ? -41.837 10.340  -17.765 1.00 34.27  ? 237 HOH A O   1 
HETATM 3661 O  O   . HOH E 4 .   ? -27.816 -1.748  -16.489 1.00 26.67  ? 238 HOH A O   1 
HETATM 3662 O  O   . HOH E 4 .   ? -14.591 -8.401  -21.217 1.00 46.85  ? 239 HOH A O   1 
HETATM 3663 O  O   . HOH E 4 .   ? -6.756  -0.031  -7.652  1.00 46.32  ? 240 HOH A O   1 
HETATM 3664 O  O   . HOH E 4 .   ? -12.895 -7.281  5.543   1.00 58.02  ? 241 HOH A O   1 
HETATM 3665 O  O   . HOH E 4 .   ? -29.617 -2.290  -14.835 1.00 29.96  ? 242 HOH A O   1 
HETATM 3666 O  O   . HOH E 4 .   ? -11.461 -15.049 -1.074  1.00 34.28  ? 243 HOH A O   1 
HETATM 3667 O  O   . HOH E 4 .   ? -25.846 12.591  -17.841 1.00 35.23  ? 244 HOH A O   1 
HETATM 3668 O  O   . HOH E 4 .   ? -11.777 -9.372  -19.976 1.00 35.04  ? 245 HOH A O   1 
HETATM 3669 O  O   . HOH E 4 .   ? 5.269   0.060   -23.944 1.00 34.83  ? 246 HOH A O   1 
HETATM 3670 O  O   . HOH E 4 .   ? -11.156 -5.449  -19.632 1.00 43.25  ? 247 HOH A O   1 
HETATM 3671 O  O   . HOH E 4 .   ? -17.010 -7.899  3.879   1.00 63.53  ? 248 HOH A O   1 
HETATM 3672 O  O   . HOH E 4 .   ? -23.983 -18.950 -23.539 1.00 57.04  ? 249 HOH A O   1 
HETATM 3673 O  O   . HOH E 4 .   ? -9.942  -20.181 -6.381  1.00 46.40  ? 250 HOH A O   1 
HETATM 3674 O  O   . HOH E 4 .   ? -19.185 0.243   -21.424 1.00 52.55  ? 251 HOH A O   1 
HETATM 3675 O  O   . HOH E 4 .   ? 1.785   -7.118  10.794  1.00 51.17  ? 252 HOH A O   1 
HETATM 3676 O  O   . HOH E 4 .   ? -0.792  -2.055  10.590  1.00 49.14  ? 253 HOH A O   1 
HETATM 3677 O  O   . HOH E 4 .   ? -51.455 6.328   -8.111  1.00 49.93  ? 254 HOH A O   1 
HETATM 3678 O  O   . HOH E 4 .   ? -39.365 -1.548  -11.360 1.00 41.74  ? 255 HOH A O   1 
HETATM 3679 O  O   . HOH E 4 .   ? -32.260 17.358  -13.428 1.00 58.56  ? 256 HOH A O   1 
HETATM 3680 O  O   . HOH E 4 .   ? -18.525 -18.840 -16.965 1.00 48.71  ? 257 HOH A O   1 
HETATM 3681 O  O   . HOH E 4 .   ? -31.117 -16.388 -14.971 1.00 56.14  ? 258 HOH A O   1 
HETATM 3682 O  O   . HOH E 4 .   ? -9.415  3.395   -14.275 1.00 75.79  ? 259 HOH A O   1 
HETATM 3683 O  O   . HOH E 4 .   ? -33.399 4.765   -21.881 1.00 46.63  ? 260 HOH A O   1 
HETATM 3684 O  O   . HOH E 4 .   ? -45.967 9.483   -8.506  1.00 43.16  ? 261 HOH A O   1 
HETATM 3685 O  O   . HOH E 4 .   ? 6.369   -10.399 -18.371 1.00 55.33  ? 262 HOH A O   1 
HETATM 3686 O  O   . HOH E 4 .   ? 7.313   8.299   -27.481 1.00 68.76  ? 263 HOH A O   1 
HETATM 3687 O  O   . HOH E 4 .   ? -16.434 3.548   -7.398  1.00 50.71  ? 264 HOH A O   1 
HETATM 3688 O  O   . HOH E 4 .   ? -3.427  -0.331  7.079   1.00 71.26  ? 265 HOH A O   1 
HETATM 3689 O  O   . HOH E 4 .   ? -8.016  -13.417 -6.708  1.00 51.39  ? 266 HOH A O   1 
HETATM 3690 O  O   . HOH E 4 .   ? -21.453 4.211   8.984   1.00 51.22  ? 267 HOH A O   1 
HETATM 3691 O  O   . HOH E 4 .   ? -24.415 0.405   -19.067 1.00 48.33  ? 268 HOH A O   1 
HETATM 3692 O  O   . HOH E 4 .   ? -18.260 9.131   -17.585 1.00 60.30  ? 269 HOH A O   1 
HETATM 3693 O  O   . HOH E 4 .   ? -15.364 6.374   -20.621 1.00 60.44  ? 270 HOH A O   1 
HETATM 3694 O  O   . HOH E 4 .   ? -23.294 13.632  -17.716 1.00 63.28  ? 271 HOH A O   1 
HETATM 3695 O  O   . HOH E 4 .   ? -47.974 1.247   -4.886  1.00 45.39  ? 272 HOH A O   1 
HETATM 3696 O  O   . HOH E 4 .   ? -27.656 -15.749 -8.526  1.00 59.40  ? 273 HOH A O   1 
HETATM 3697 O  O   . HOH E 4 .   ? -3.053  11.664  -26.640 1.00 56.20  ? 274 HOH A O   1 
HETATM 3698 O  O   . HOH E 4 .   ? -7.086  2.680   -10.584 1.00 60.66  ? 275 HOH A O   1 
HETATM 3699 O  O   . HOH E 4 .   ? 9.153   3.244   -26.839 1.00 64.75  ? 276 HOH A O   1 
HETATM 3700 O  O   . HOH E 4 .   ? 1.289   -6.869  7.658   1.00 61.52  ? 277 HOH A O   1 
HETATM 3701 O  O   . HOH E 4 .   ? -39.035 1.720   -4.458  1.00 53.10  ? 278 HOH A O   1 
HETATM 3702 O  O   . HOH E 4 .   ? -25.305 6.069   -1.256  1.00 51.54  ? 279 HOH A O   1 
HETATM 3703 O  O   . HOH E 4 .   ? -35.820 21.568  -7.795  1.00 57.33  ? 280 HOH A O   1 
HETATM 3704 O  O   . HOH E 4 .   ? -25.470 -2.320  7.385   1.00 60.99  ? 281 HOH A O   1 
HETATM 3705 O  O   . HOH E 4 .   ? 10.379  0.487   -16.866 1.00 77.09  ? 282 HOH A O   1 
HETATM 3706 O  O   . HOH E 4 .   ? -40.346 21.790  -16.573 1.00 58.08  ? 283 HOH A O   1 
HETATM 3707 O  O   . HOH E 4 .   ? -25.404 -10.812 -14.247 1.00 67.30  ? 284 HOH A O   1 
HETATM 3708 O  O   . HOH E 4 .   ? -22.632 -2.607  4.308   1.00 55.88  ? 285 HOH A O   1 
HETATM 3709 O  O   . HOH E 4 .   ? -13.637 0.911   -4.461  1.00 53.10  ? 286 HOH A O   1 
HETATM 3710 O  O   . HOH E 4 .   ? -9.399  7.411   -9.248  1.00 68.69  ? 287 HOH A O   1 
HETATM 3711 O  O   . HOH E 4 .   ? -19.783 -18.596 -19.935 1.00 58.31  ? 288 HOH A O   1 
HETATM 3712 O  O   . HOH E 4 .   ? -14.767 3.559   5.323   1.00 68.31  ? 289 HOH A O   1 
HETATM 3713 O  O   . HOH E 4 .   ? -33.645 21.641  -14.235 1.00 60.52  ? 290 HOH A O   1 
HETATM 3714 O  O   . HOH E 4 .   ? -23.752 5.418   -4.022  1.00 52.82  ? 291 HOH A O   1 
HETATM 3715 O  O   . HOH E 4 .   ? -44.524 -2.746  -1.712  1.00 54.36  ? 292 HOH A O   1 
HETATM 3716 O  O   . HOH E 4 .   ? 2.754   0.170   -21.265 1.00 64.48  ? 293 HOH A O   1 
HETATM 3717 O  O   . HOH E 4 .   ? -12.489 -11.912 0.049   1.00 61.38  ? 294 HOH A O   1 
HETATM 3718 O  O   . HOH E 4 .   ? -40.239 -0.435  1.357   1.00 62.40  ? 295 HOH A O   1 
HETATM 3719 O  O   . HOH E 4 .   ? -23.454 -13.164 -21.600 1.00 62.62  ? 296 HOH A O   1 
HETATM 3720 O  O   . HOH E 4 .   ? -32.736 11.873  0.672   1.00 54.07  ? 297 HOH A O   1 
HETATM 3721 O  O   . HOH E 4 .   ? -32.986 14.939  -12.674 1.00 39.83  ? 298 HOH A O   1 
HETATM 3722 O  O   . HOH E 4 .   ? -9.021  -15.633 -5.287  1.00 35.65  ? 299 HOH A O   1 
HETATM 3723 O  O   . HOH E 4 .   ? -46.859 3.693   0.038   1.00 50.22  ? 300 HOH A O   1 
HETATM 3724 O  O   . HOH E 4 .   ? -15.398 12.136  -6.230  1.00 67.47  ? 301 HOH A O   1 
HETATM 3725 O  O   . HOH E 4 .   ? -22.416 -3.943  -12.104 1.00 26.67  ? 302 HOH A O   1 
HETATM 3726 O  O   . HOH E 4 .   ? -9.487  -21.432 -16.583 1.00 64.74  ? 303 HOH A O   1 
HETATM 3727 O  O   . HOH E 4 .   ? -18.189 -12.032 -2.746  1.00 59.51  ? 304 HOH A O   1 
HETATM 3728 O  O   . HOH E 4 .   ? -8.949  1.942   -16.168 1.00 49.91  ? 305 HOH A O   1 
HETATM 3729 O  O   . HOH E 4 .   ? -32.434 18.589  -3.652  1.00 59.74  ? 306 HOH A O   1 
HETATM 3730 O  O   . HOH E 4 .   ? -28.847 19.161  -15.123 1.00 47.01  ? 307 HOH A O   1 
HETATM 3731 O  O   . HOH E 4 .   ? -18.113 7.916   -3.252  1.00 52.45  ? 308 HOH A O   1 
HETATM 3732 O  O   . HOH E 4 .   ? -31.983 -2.228  -13.710 1.00 46.08  ? 309 HOH A O   1 
HETATM 3733 O  O   . HOH E 4 .   ? -43.841 21.966  -10.046 1.00 67.24  ? 310 HOH A O   1 
HETATM 3734 O  O   . HOH E 4 .   ? 0.000   -9.163  0.000   0.25 42.53  ? 311 HOH A O   1 
HETATM 3735 O  O   . HOH E 4 .   ? -5.824  -5.547  7.236   1.00 48.33  ? 312 HOH A O   1 
HETATM 3736 O  O   . HOH E 4 .   ? -24.398 -0.412  -24.845 1.00 51.36  ? 313 HOH A O   1 
HETATM 3737 O  O   . HOH E 4 .   ? -9.404  -7.667  -20.229 1.00 51.59  ? 314 HOH A O   1 
HETATM 3738 O  O   . HOH E 4 .   ? 10.701  9.442   -25.031 1.00 50.10  ? 315 HOH A O   1 
HETATM 3739 O  O   . HOH E 4 .   ? -8.224  0.897   -13.551 1.00 55.98  ? 316 HOH A O   1 
HETATM 3740 O  O   . HOH E 4 .   ? 2.712   -1.291  2.789   1.00 46.89  ? 317 HOH A O   1 
HETATM 3741 O  O   . HOH F 4 .   ? -22.450 2.547   -43.999 1.00 47.87  ? 188 HOH B O   1 
HETATM 3742 O  O   . HOH F 4 .   ? -15.773 -4.395  -33.474 1.00 32.52  ? 189 HOH B O   1 
HETATM 3743 O  O   . HOH F 4 .   ? -15.652 0.647   -38.241 1.00 31.83  ? 190 HOH B O   1 
HETATM 3744 O  O   . HOH F 4 .   ? -9.867  5.312   -37.487 1.00 32.14  ? 191 HOH B O   1 
HETATM 3745 O  O   . HOH F 4 .   ? -19.965 2.635   -42.604 1.00 39.30  ? 192 HOH B O   1 
HETATM 3746 O  O   . HOH F 4 .   ? -16.494 -11.634 -32.625 1.00 34.06  ? 193 HOH B O   1 
HETATM 3747 O  O   . HOH F 4 .   ? -20.541 4.454   -24.385 1.00 34.55  ? 194 HOH B O   1 
HETATM 3748 O  O   . HOH F 4 .   ? -16.397 0.138   -48.839 1.00 54.04  ? 195 HOH B O   1 
HETATM 3749 O  O   . HOH F 4 .   ? -30.667 -7.620  -45.175 1.00 53.56  ? 196 HOH B O   1 
HETATM 3750 O  O   . HOH F 4 .   ? -6.797  1.371   -25.994 1.00 24.00  ? 197 HOH B O   1 
HETATM 3751 O  O   . HOH F 4 .   ? -13.300 -4.140  -44.301 1.00 35.78  ? 198 HOH B O   1 
HETATM 3752 O  O   . HOH F 4 .   ? -35.200 -3.843  -41.939 1.00 50.42  ? 199 HOH B O   1 
HETATM 3753 O  O   . HOH F 4 .   ? -40.691 18.912  -26.876 1.00 39.13  ? 200 HOH B O   1 
HETATM 3754 O  O   . HOH F 4 .   ? -13.502 12.348  -35.231 1.00 42.02  ? 201 HOH B O   1 
HETATM 3755 O  O   . HOH F 4 .   ? -13.904 -8.051  -27.221 1.00 51.73  ? 202 HOH B O   1 
HETATM 3756 O  O   . HOH F 4 .   ? -19.604 -9.457  -40.529 1.00 54.11  ? 203 HOH B O   1 
HETATM 3757 O  O   . HOH F 4 .   ? -41.478 -3.692  -27.822 1.00 38.34  ? 204 HOH B O   1 
HETATM 3758 O  O   . HOH F 4 .   ? -48.136 6.507   -24.004 1.00 56.13  ? 205 HOH B O   1 
HETATM 3759 O  O   . HOH F 4 .   ? -18.195 3.786   -23.996 1.00 27.67  ? 206 HOH B O   1 
HETATM 3760 O  O   . HOH F 4 .   ? -29.197 -10.311 -46.365 1.00 42.94  ? 207 HOH B O   1 
HETATM 3761 O  O   . HOH F 4 .   ? -25.986 5.663   -28.173 1.00 56.55  ? 208 HOH B O   1 
HETATM 3762 O  O   . HOH F 4 .   ? -24.792 6.203   -40.849 1.00 47.12  ? 209 HOH B O   1 
HETATM 3763 O  O   . HOH F 4 .   ? -18.433 17.822  -28.633 1.00 70.59  ? 210 HOH B O   1 
HETATM 3764 O  O   . HOH F 4 .   ? -43.033 -2.270  -29.410 1.00 73.73  ? 211 HOH B O   1 
HETATM 3765 O  O   . HOH F 4 .   ? -41.013 15.128  -19.820 1.00 42.63  ? 212 HOH B O   1 
HETATM 3766 O  O   . HOH F 4 .   ? -14.065 7.603   -35.695 1.00 40.60  ? 213 HOH B O   1 
HETATM 3767 O  O   . HOH F 4 .   ? 7.323   -9.586  -32.005 1.00 50.87  ? 214 HOH B O   1 
HETATM 3768 O  O   . HOH F 4 .   ? 9.763   -4.549  -37.420 1.00 69.23  ? 215 HOH B O   1 
HETATM 3769 O  O   . HOH F 4 .   ? -25.695 -2.375  -26.993 1.00 52.06  ? 216 HOH B O   1 
HETATM 3770 O  O   . HOH F 4 .   ? -22.664 -8.659  -43.262 1.00 55.51  ? 217 HOH B O   1 
HETATM 3771 O  O   . HOH F 4 .   ? -24.250 11.294  -22.719 1.00 52.59  ? 218 HOH B O   1 
HETATM 3772 O  O   . HOH F 4 .   ? -49.141 12.871  -27.604 1.00 74.29  ? 219 HOH B O   1 
HETATM 3773 O  O   . HOH F 4 .   ? -11.102 -0.137  -29.975 1.00 46.42  ? 220 HOH B O   1 
HETATM 3774 O  O   . HOH F 4 .   ? 2.467   4.335   -23.027 1.00 53.77  ? 221 HOH B O   1 
HETATM 3775 O  O   . HOH F 4 .   ? -8.844  -10.991 -32.082 1.00 55.95  ? 222 HOH B O   1 
HETATM 3776 O  O   . HOH F 4 .   ? -10.112 0.945   -32.798 1.00 67.49  ? 223 HOH B O   1 
HETATM 3777 O  O   . HOH F 4 .   ? -25.774 10.953  -48.179 1.00 58.21  ? 224 HOH B O   1 
HETATM 3778 O  O   . HOH F 4 .   ? -40.254 -1.498  -27.082 1.00 74.68  ? 225 HOH B O   1 
HETATM 3779 O  O   . HOH F 4 .   ? -23.749 -21.723 -42.272 1.00 55.42  ? 226 HOH B O   1 
HETATM 3780 O  O   . HOH F 4 .   ? -24.673 -16.842 -28.370 1.00 57.25  ? 227 HOH B O   1 
HETATM 3781 O  O   . HOH F 4 .   ? -25.405 -19.840 -35.411 1.00 60.82  ? 228 HOH B O   1 
HETATM 3782 O  O   . HOH F 4 .   ? -21.015 -21.730 -30.248 1.00 67.69  ? 229 HOH B O   1 
HETATM 3783 O  O   . HOH F 4 .   ? -5.789  -5.479  -37.552 1.00 47.61  ? 230 HOH B O   1 
HETATM 3784 O  O   . HOH F 4 .   ? -33.957 -10.845 -31.975 1.00 69.35  ? 231 HOH B O   1 
HETATM 3785 O  O   . HOH F 4 .   ? -21.559 -3.990  -49.823 1.00 51.38  ? 232 HOH B O   1 
HETATM 3786 O  O   . HOH F 4 .   ? -27.692 -5.180  -26.009 1.00 50.78  ? 233 HOH B O   1 
HETATM 3787 O  O   . HOH F 4 .   ? -26.412 10.717  -45.311 1.00 54.29  ? 234 HOH B O   1 
HETATM 3788 O  O   . HOH F 4 .   ? -0.528  9.847   -39.731 1.00 61.20  ? 235 HOH B O   1 
HETATM 3789 O  O   . HOH F 4 .   ? -13.770 8.893   -25.961 1.00 62.85  ? 236 HOH B O   1 
HETATM 3790 O  O   . HOH F 4 .   ? -23.708 -5.436  -24.328 1.00 59.17  ? 237 HOH B O   1 
HETATM 3791 O  O   . HOH F 4 .   ? -30.986 5.033   -33.940 1.00 74.25  ? 238 HOH B O   1 
HETATM 3792 O  O   . HOH F 4 .   ? -34.734 20.608  -27.958 1.00 58.10  ? 239 HOH B O   1 
HETATM 3793 O  O   . HOH F 4 .   ? -1.075  7.740   -42.021 1.00 60.79  ? 240 HOH B O   1 
HETATM 3794 O  O   . HOH F 4 .   ? 13.696  8.301   -39.853 1.00 56.63  ? 241 HOH B O   1 
HETATM 3795 O  O   . HOH F 4 .   ? 14.051  -7.636  -38.019 1.00 56.04  ? 242 HOH B O   1 
HETATM 3796 O  O   . HOH F 4 .   ? 5.739   6.962   -29.059 1.00 39.59  ? 243 HOH B O   1 
HETATM 3797 O  O   . HOH F 4 .   ? -26.452 8.615   -47.241 1.00 65.49  ? 244 HOH B O   1 
HETATM 3798 O  O   . HOH F 4 .   ? -48.287 15.120  -28.405 1.00 57.96  ? 245 HOH B O   1 
HETATM 3799 O  O   . HOH F 4 .   ? -21.872 -20.494 -33.041 1.00 45.82  ? 246 HOH B O   1 
HETATM 3800 O  O   . HOH F 4 .   ? -19.023 -8.544  -44.553 1.00 53.72  ? 247 HOH B O   1 
HETATM 3801 O  O   . HOH F 4 .   ? -8.802  -5.624  -33.015 1.00 65.13  ? 248 HOH B O   1 
HETATM 3802 O  O   . HOH F 4 .   ? -5.461  -8.324  -29.899 1.00 55.91  ? 249 HOH B O   1 
HETATM 3803 O  O   . HOH F 4 .   ? -17.305 6.158   -37.905 1.00 61.00  ? 250 HOH B O   1 
HETATM 3804 O  O   . HOH F 4 .   ? -23.837 6.931   -43.973 1.00 55.96  ? 251 HOH B O   1 
HETATM 3805 O  O   . HOH F 4 .   ? -19.779 -25.450 -34.640 1.00 47.47  ? 252 HOH B O   1 
HETATM 3806 O  O   . HOH F 4 .   ? -13.575 -3.899  -47.042 1.00 64.14  ? 253 HOH B O   1 
HETATM 3807 O  O   . HOH F 4 .   ? -31.563 4.000   -29.169 1.00 86.77  ? 254 HOH B O   1 
HETATM 3808 O  O   . HOH F 4 .   ? -6.395  -0.885  -18.651 1.00 37.63  ? 255 HOH B O   1 
HETATM 3809 O  O   . HOH F 4 .   ? -27.838 3.265   -29.116 1.00 77.22  ? 256 HOH B O   1 
HETATM 3810 O  O   . HOH F 4 .   ? -33.615 10.071  -46.308 1.00 57.93  ? 257 HOH B O   1 
HETATM 3811 O  O   . HOH F 4 .   ? -21.373 5.158   -41.008 1.00 55.61  ? 258 HOH B O   1 
HETATM 3812 O  O   . HOH F 4 .   ? 8.092   -1.156  -27.014 1.00 68.71  ? 259 HOH B O   1 
HETATM 3813 O  O   . HOH F 4 .   ? -35.117 -1.654  -34.351 1.00 50.20  ? 260 HOH B O   1 
HETATM 3814 O  O   . HOH F 4 .   ? -34.469 14.551  -31.513 1.00 49.15  ? 261 HOH B O   1 
HETATM 3815 O  O   . HOH F 4 .   ? -42.175 11.605  -23.284 1.00 39.92  ? 262 HOH B O   1 
HETATM 3816 O  O   . HOH F 4 .   ? -10.097 -2.190  -28.481 1.00 48.32  ? 263 HOH B O   1 
HETATM 3817 O  O   . HOH F 4 .   ? -13.261 -20.281 -39.656 1.00 62.29  ? 264 HOH B O   1 
HETATM 3818 O  O   . HOH F 4 .   ? -17.880 -3.190  -26.486 1.00 69.00  ? 265 HOH B O   1 
HETATM 3819 O  O   . HOH F 4 .   ? -33.378 -7.719  -42.369 1.00 62.41  ? 266 HOH B O   1 
HETATM 3820 O  O   . HOH F 4 .   ? -6.922  6.475   -44.308 1.00 53.15  ? 267 HOH B O   1 
HETATM 3821 O  O   . HOH G 4 .   ? -55.153 9.705   -17.738 1.00 27.99  ? 116 HOH C O   1 
HETATM 3822 O  O   . HOH G 4 .   ? -50.179 6.326   -14.007 1.00 30.53  ? 117 HOH C O   1 
HETATM 3823 O  O   . HOH G 4 .   ? -57.850 8.712   -23.135 1.00 35.74  ? 118 HOH C O   1 
HETATM 3824 O  O   . HOH G 4 .   ? -47.613 2.307   -19.518 1.00 33.71  ? 119 HOH C O   1 
HETATM 3825 O  O   . HOH G 4 .   ? -59.792 4.823   -22.127 1.00 37.45  ? 120 HOH C O   1 
HETATM 3826 O  O   . HOH G 4 .   ? -42.954 8.950   -15.363 1.00 33.63  ? 121 HOH C O   1 
HETATM 3827 O  O   . HOH G 4 .   ? -55.517 2.520   -15.863 1.00 39.86  ? 122 HOH C O   1 
HETATM 3828 O  O   . HOH G 4 .   ? -60.330 13.017  -34.369 1.00 53.75  ? 123 HOH C O   1 
HETATM 3829 O  O   . HOH G 4 .   ? -49.079 10.263  -26.826 1.00 32.47  ? 124 HOH C O   1 
HETATM 3830 O  O   . HOH G 4 .   ? -47.388 -1.058  -12.085 1.00 33.92  ? 125 HOH C O   1 
HETATM 3831 O  O   . HOH G 4 .   ? -56.571 10.040  -28.206 1.00 32.70  ? 126 HOH C O   1 
HETATM 3832 O  O   . HOH G 4 .   ? -43.022 -5.405  -26.670 1.00 60.76  ? 127 HOH C O   1 
HETATM 3833 O  O   . HOH G 4 .   ? -48.144 4.446   -21.089 1.00 31.37  ? 128 HOH C O   1 
HETATM 3834 O  O   . HOH G 4 .   ? -41.819 12.898  -21.065 1.00 43.02  ? 129 HOH C O   1 
HETATM 3835 O  O   . HOH G 4 .   ? -48.143 8.076   -27.797 1.00 41.07  ? 130 HOH C O   1 
HETATM 3836 O  O   . HOH G 4 .   ? -58.267 8.461   -20.479 1.00 46.34  ? 131 HOH C O   1 
HETATM 3837 O  O   . HOH G 4 .   ? -59.018 3.135   -17.425 1.00 29.86  ? 132 HOH C O   1 
HETATM 3838 O  O   . HOH G 4 .   ? -50.795 9.530   -24.021 1.00 36.64  ? 133 HOH C O   1 
HETATM 3839 O  O   . HOH G 4 .   ? -46.145 4.925   -23.300 1.00 54.62  ? 134 HOH C O   1 
HETATM 3840 O  O   . HOH G 4 .   ? -57.327 -0.761  -17.988 1.00 55.66  ? 135 HOH C O   1 
HETATM 3841 O  O   . HOH G 4 .   ? -57.285 10.419  -19.138 1.00 62.09  ? 136 HOH C O   1 
HETATM 3842 O  O   . HOH G 4 .   ? -76.493 8.607   -25.673 1.00 46.63  ? 137 HOH C O   1 
HETATM 3843 O  O   . HOH G 4 .   ? -71.258 7.977   -33.478 1.00 51.06  ? 138 HOH C O   1 
HETATM 3844 O  O   . HOH G 4 .   ? -75.248 5.865   -24.767 1.00 65.94  ? 139 HOH C O   1 
HETATM 3845 O  O   . HOH G 4 .   ? -50.770 1.017   -38.419 1.00 64.60  ? 140 HOH C O   1 
HETATM 3846 O  O   . HOH G 4 .   ? -49.157 10.091  -8.228  1.00 48.27  ? 141 HOH C O   1 
HETATM 3847 O  O   . HOH G 4 .   ? -59.528 -12.388 -29.702 1.00 51.19  ? 142 HOH C O   1 
HETATM 3848 O  O   . HOH G 4 .   ? -48.144 -8.021  -37.191 1.00 74.40  ? 143 HOH C O   1 
HETATM 3849 O  O   . HOH G 4 .   ? -56.146 -12.220 -17.598 1.00 52.17  ? 144 HOH C O   1 
HETATM 3850 O  O   . HOH G 4 .   ? -39.882 1.450   -18.807 1.00 60.65  ? 145 HOH C O   1 
HETATM 3851 O  O   . HOH G 4 .   ? -47.510 -12.886 -23.490 1.00 50.16  ? 146 HOH C O   1 
HETATM 3852 O  O   . HOH G 4 .   ? -53.145 0.442   -14.334 1.00 53.92  ? 147 HOH C O   1 
HETATM 3853 O  O   . HOH G 4 .   ? -60.751 5.393   -17.801 1.00 59.27  ? 148 HOH C O   1 
HETATM 3854 O  O   . HOH G 4 .   ? -71.555 -5.837  -25.004 1.00 60.59  ? 149 HOH C O   1 
HETATM 3855 O  O   . HOH G 4 .   ? -40.868 -5.478  -10.620 1.00 65.12  ? 150 HOH C O   1 
HETATM 3856 O  O   . HOH G 4 .   ? -43.672 17.032  -19.971 1.00 57.12  ? 151 HOH C O   1 
HETATM 3857 O  O   . HOH G 4 .   ? -58.145 0.256   -20.286 1.00 50.59  ? 152 HOH C O   1 
HETATM 3858 O  O   . HOH G 4 .   ? -56.508 -7.831  -20.458 1.00 54.54  ? 153 HOH C O   1 
HETATM 3859 O  O   . HOH G 4 .   ? -49.376 15.350  -15.607 1.00 40.68  ? 154 HOH C O   1 
HETATM 3860 O  O   . HOH G 4 .   ? -67.091 -4.519  -16.650 1.00 51.85  ? 155 HOH C O   1 
HETATM 3861 O  O   . HOH G 4 .   ? -66.347 3.703   -24.768 1.00 64.42  ? 156 HOH C O   1 
HETATM 3862 O  O   . HOH G 4 .   ? -53.314 11.825  -13.372 1.00 49.41  ? 157 HOH C O   1 
HETATM 3863 O  O   . HOH G 4 .   ? -46.295 -11.322 -41.608 1.00 52.30  ? 158 HOH C O   1 
HETATM 3864 O  O   . HOH G 4 .   ? -46.085 -14.916 -41.508 1.00 64.21  ? 159 HOH C O   1 
HETATM 3865 O  O   . HOH G 4 .   ? -42.351 -12.709 -43.032 1.00 49.05  ? 160 HOH C O   1 
HETATM 3866 O  O   . HOH H 4 .   ? -37.170 -2.979  -12.366 1.00 62.25  ? 316 HOH D O   1 
HETATM 3867 O  O   . HOH H 4 .   ? -25.916 -8.787  -4.221  1.00 72.87  ? 402 HOH D O   1 
HETATM 3868 O  O   . HOH H 4 .   ? -36.005 -3.916  -14.756 1.00 57.39  ? 482 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   HIS 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   HIS 6   6   ?   ?   ?   A . n 
A 1 7   HIS 7   7   ?   ?   ?   A . n 
A 1 8   HIS 8   8   ?   ?   ?   A . n 
A 1 9   HIS 9   9   ?   ?   ?   A . n 
A 1 10  GLU 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  MSE 20  20  20  MSE MSE A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  TRP 64  64  64  TRP TRP A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  TRP 74  74  74  TRP TRP A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  MSE 88  88  88  MSE MSE A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 TRP 104 104 104 TRP TRP A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 HIS 127 127 127 HIS HIS A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 CYS 153 153 153 CYS CYS A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 TRP 155 155 155 TRP TRP A . n 
A 1 156 GLN 156 156 156 GLN GLN A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 CYS 163 163 163 CYS CYS A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 TRP 165 165 165 TRP TRP A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 MSE 178 178 178 MSE MSE A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 LYS 187 187 ?   ?   ?   A . n 
B 1 1   MSE 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   LYS 3   3   ?   ?   ?   B . n 
B 1 4   HIS 4   4   ?   ?   ?   B . n 
B 1 5   HIS 5   5   ?   ?   ?   B . n 
B 1 6   HIS 6   6   ?   ?   ?   B . n 
B 1 7   HIS 7   7   ?   ?   ?   B . n 
B 1 8   HIS 8   8   ?   ?   ?   B . n 
B 1 9   HIS 9   9   ?   ?   ?   B . n 
B 1 10  GLU 10  10  10  GLU GLU B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  GLU 12  12  12  GLU GLU B . n 
B 1 13  PHE 13  13  13  PHE PHE B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  PHE 19  19  19  PHE PHE B . n 
B 1 20  MSE 20  20  20  MSE MSE B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  CYS 22  22  22  CYS CYS B . n 
B 1 23  ARG 23  23  23  ARG ARG B . n 
B 1 24  ILE 24  24  24  ILE ILE B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  THR 30  30  30  THR THR B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  THR 35  35  35  THR THR B . n 
B 1 36  ILE 36  36  36  ILE ILE B . n 
B 1 37  TYR 37  37  37  TYR TYR B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  VAL 39  39  39  VAL VAL B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  ASP 44  44  44  ASP ASP B . n 
B 1 45  PRO 45  45  45  PRO PRO B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  PHE 49  49  49  PHE PHE B . n 
B 1 50  GLU 50  50  50  GLU GLU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASN 52  52  ?   ?   ?   B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  GLN 59  59  59  GLN GLN B . n 
B 1 60  TYR 60  60  60  TYR TYR B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  TRP 64  64  64  TRP TRP B . n 
B 1 65  LYS 65  65  65  LYS LYS B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  TRP 67  67  67  TRP TRP B . n 
B 1 68  SER 68  68  68  SER SER B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  HIS 71  71  71  HIS HIS B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  TRP 74  74  74  TRP TRP B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  THR 76  76  76  THR THR B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  THR 79  79  79  THR THR B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  GLN 82  82  82  GLN GLN B . n 
B 1 83  GLN 83  83  83  GLN GLN B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  MSE 88  88  88  MSE MSE B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  TYR 94  94  94  TYR TYR B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 THR 101 101 101 THR THR B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 TRP 104 104 104 TRP TRP B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 ASN 107 107 107 ASN ASN B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 GLU 114 114 114 GLU GLU B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 TYR 116 116 116 TYR TYR B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 CYS 118 118 118 CYS CYS B . n 
B 1 119 GLN 119 119 119 GLN GLN B . n 
B 1 120 GLN 120 120 120 GLN GLN B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 ASP 124 124 124 ASP ASP B . n 
B 1 125 ASP 125 125 125 ASP ASP B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 HIS 127 127 127 HIS HIS B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 GLN 129 129 129 GLN GLN B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 ARG 135 135 135 ARG ARG B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 HIS 139 139 139 HIS HIS B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 ASN 141 141 141 ASN ASN B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 LYS 143 143 143 LYS LYS B . n 
B 1 144 SER 144 144 144 SER SER B . n 
B 1 145 ALA 145 145 ?   ?   ?   B . n 
B 1 146 ALA 146 146 ?   ?   ?   B . n 
B 1 147 GLY 147 147 147 GLY GLY B . n 
B 1 148 TYR 148 148 148 TYR TYR B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 CYS 153 153 153 CYS CYS B . n 
B 1 154 LYS 154 154 154 LYS LYS B . n 
B 1 155 TRP 155 155 155 TRP TRP B . n 
B 1 156 GLN 156 156 156 GLN GLN B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 PRO 159 159 159 PRO PRO B . n 
B 1 160 TYR 160 160 160 TYR TYR B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 GLU 162 162 162 GLU GLU B . n 
B 1 163 CYS 163 163 163 CYS CYS B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 TRP 165 165 165 TRP TRP B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ILE 171 171 171 ILE ILE B . n 
B 1 172 SER 172 172 172 SER SER B . n 
B 1 173 LYS 173 173 173 LYS LYS B . n 
B 1 174 LYS 174 174 174 LYS LYS B . n 
B 1 175 PHE 175 175 175 PHE PHE B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 MSE 178 178 178 MSE MSE B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 ASP 180 180 180 ASP ASP B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 PHE 183 183 183 PHE PHE B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 ARG 185 185 185 ARG ARG B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 LYS 187 187 ?   ?   ?   B . n 
C 2 1   MSE 1   1   ?   ?   ?   C . n 
C 2 2   LYS 2   2   ?   ?   ?   C . n 
C 2 3   LYS 3   3   ?   ?   ?   C . n 
C 2 4   HIS 4   4   ?   ?   ?   C . n 
C 2 5   HIS 5   5   ?   ?   ?   C . n 
C 2 6   HIS 6   6   ?   ?   ?   C . n 
C 2 7   HIS 7   7   ?   ?   ?   C . n 
C 2 8   HIS 8   8   ?   ?   ?   C . n 
C 2 9   HIS 9   9   ?   ?   ?   C . n 
C 2 10  GLU 10  10  ?   ?   ?   C . n 
C 2 11  GLU 11  11  ?   ?   ?   C . n 
C 2 12  GLU 12  12  12  GLU GLU C . n 
C 2 13  PHE 13  13  13  PHE PHE C . n 
C 2 14  GLU 14  14  14  GLU GLU C . n 
C 2 15  THR 15  15  15  THR THR C . n 
C 2 16  ILE 16  16  16  ILE ILE C . n 
C 2 17  GLU 17  17  17  GLU GLU C . n 
C 2 18  ARG 18  18  18  ARG ARG C . n 
C 2 19  PHE 19  19  19  PHE PHE C . n 
C 2 20  MSE 20  20  20  MSE MSE C . n 
C 2 21  ASP 21  21  21  ASP ASP C . n 
C 2 22  CYS 22  22  22  CYS CYS C . n 
C 2 23  ARG 23  23  23  ARG ARG C . n 
C 2 24  ILE 24  24  24  ILE ILE C . n 
C 2 25  GLY 25  25  25  GLY GLY C . n 
C 2 26  ARG 26  26  26  ARG ARG C . n 
C 2 27  LYS 27  27  27  LYS LYS C . n 
C 2 28  GLY 28  28  28  GLY GLY C . n 
C 2 29  ALA 29  29  29  ALA ALA C . n 
C 2 30  THR 30  30  30  THR THR C . n 
C 2 31  GLY 31  31  31  GLY GLY C . n 
C 2 32  ALA 32  32  32  ALA ALA C . n 
C 2 33  THR 33  33  33  THR THR C . n 
C 2 34  THR 34  34  34  THR THR C . n 
C 2 35  THR 35  35  35  THR THR C . n 
C 2 36  ILE 36  36  36  ILE ILE C . n 
C 2 37  TYR 37  37  37  TYR TYR C . n 
C 2 38  ALA 38  38  38  ALA ALA C . n 
C 2 39  VAL 39  39  39  VAL VAL C . n 
C 2 40  GLU 40  40  40  GLU GLU C . n 
C 2 41  ALA 41  41  41  ALA ALA C . n 
C 2 42  ASP 42  42  42  ASP ASP C . n 
C 2 43  GLY 43  43  43  GLY GLY C . n 
C 2 44  ASP 44  44  44  ASP ASP C . n 
C 2 45  PRO 45  45  45  PRO PRO C . n 
C 2 46  ASN 46  46  46  ASN ASN C . n 
C 2 47  ALA 47  47  47  ALA ALA C . n 
C 2 48  GLY 48  48  48  GLY GLY C . n 
C 2 49  PHE 49  49  49  PHE PHE C . n 
C 2 50  GLU 50  50  50  GLU GLU C . n 
C 2 51  LYS 51  51  51  LYS LYS C . n 
C 2 52  ASN 52  52  52  ASN ASN C . n 
C 2 53  LYS 53  53  53  LYS LYS C . n 
C 2 54  GLU 54  54  54  GLU GLU C . n 
C 2 55  PRO 55  55  55  PRO PRO C . n 
C 2 56  GLY 56  56  56  GLY GLY C . n 
C 2 57  GLU 57  57  57  GLU GLU C . n 
C 2 58  ILE 58  58  58  ILE ILE C . n 
C 2 59  GLN 59  59  59  GLN GLN C . n 
C 2 60  TYR 60  60  60  TYR TYR C . n 
C 2 61  LEU 61  61  61  LEU LEU C . n 
C 2 62  ILE 62  62  62  ILE ILE C . n 
C 2 63  LYS 63  63  63  LYS LYS C . n 
C 2 64  TRP 64  64  64  TRP TRP C . n 
C 2 65  LYS 65  65  65  LYS LYS C . n 
C 2 66  GLY 66  66  66  GLY GLY C . n 
C 2 67  TRP 67  67  67  TRP TRP C . n 
C 2 68  SER 68  68  68  SER SER C . n 
C 2 69  HIS 69  69  69  HIS HIS C . n 
C 2 70  ILE 70  70  70  ILE ILE C . n 
C 2 71  HIS 71  71  71  HIS HIS C . n 
C 2 72  ASN 72  72  72  ASN ASN C . n 
C 2 73  THR 73  73  73  THR THR C . n 
C 2 74  TRP 74  74  74  TRP TRP C . n 
C 2 75  GLU 75  75  75  GLU GLU C . n 
C 2 76  THR 76  76  76  THR THR C . n 
C 2 77  GLU 77  77  77  GLU GLU C . n 
C 2 78  GLU 78  78  78  GLU GLU C . n 
C 2 79  THR 79  79  79  THR THR C . n 
C 2 80  LEU 80  80  80  LEU LEU C . n 
C 2 81  LYS 81  81  81  LYS LYS C . n 
C 2 82  GLN 82  82  82  GLN GLN C . n 
C 2 83  GLN 83  83  83  GLN GLN C . n 
C 2 84  ASN 84  84  84  ASN ASN C . n 
C 2 85  VAL 85  85  85  VAL VAL C . n 
C 2 86  ARG 86  86  86  ARG ARG C . n 
C 2 87  GLY 87  87  87  GLY GLY C . n 
C 2 88  MSE 88  88  88  MSE MSE C . n 
C 2 89  LYS 89  89  89  LYS LYS C . n 
C 2 90  LYS 90  90  90  LYS LYS C . n 
C 2 91  LEU 91  91  91  LEU LEU C . n 
C 2 92  ASP 92  92  92  ASP ASP C . n 
C 2 93  ASN 93  93  93  ASN ASN C . n 
C 2 94  TYR 94  94  94  TYR TYR C . n 
C 2 95  LYS 95  95  95  LYS LYS C . n 
C 2 96  LYS 96  96  96  LYS LYS C . n 
C 2 97  LYS 97  97  97  LYS LYS C . n 
C 2 98  ASP 98  98  ?   ?   ?   C . n 
C 2 99  GLN 99  99  ?   ?   ?   C . n 
C 2 100 GLU 100 100 ?   ?   ?   C . n 
C 2 101 THR 101 101 ?   ?   ?   C . n 
C 2 102 LYS 102 102 ?   ?   ?   C . n 
C 2 103 ARG 103 103 ?   ?   ?   C . n 
C 2 104 TRP 104 104 ?   ?   ?   C . n 
C 2 105 LEU 105 105 ?   ?   ?   C . n 
C 2 106 LYS 106 106 ?   ?   ?   C . n 
C 2 107 ASN 107 107 ?   ?   ?   C . n 
C 2 108 ALA 108 108 ?   ?   ?   C . n 
C 2 109 SER 109 109 ?   ?   ?   C . n 
C 2 110 PRO 110 110 ?   ?   ?   C . n 
C 2 111 GLU 111 111 ?   ?   ?   C . n 
C 2 112 ASP 112 112 ?   ?   ?   C . n 
C 2 113 VAL 113 113 ?   ?   ?   C . n 
C 2 114 GLU 114 114 ?   ?   ?   C . n 
C 2 115 TYR 115 115 ?   ?   ?   C . n 
D 3 1   ALA 1   1   1   ALA ALA D . n 
D 3 2   ARG 2   2   2   ARG ARG D . n 
D 3 3   TPO 3   3   3   TPO TPO D . n 
D 3 4   M3L 4   4   4   M3L M3L D . n 
D 3 5   GLN 5   5   5   GLN GLN D . n 
D 3 6   THR 6   6   ?   ?   ?   D . n 
D 3 7   ALA 7   7   ?   ?   ?   D . n 
D 3 8   ARG 8   8   ?   ?   ?   D . n 
D 3 9   LYS 9   9   ?   ?   ?   D . n 
D 3 10  SER 10  10  ?   ?   ?   D . n 
D 3 11  THR 11  11  ?   ?   ?   D . n 
D 3 12  GLY 12  12  ?   ?   ?   D . n 
D 3 13  GLY 13  13  ?   ?   ?   D . n 
D 3 14  LYS 14  14  ?   ?   ?   D . n 
D 3 15  ALA 15  15  ?   ?   ?   D . n 
D 3 16  PRO 16  16  ?   ?   ?   D . n 
D 3 17  ARG 17  17  ?   ?   ?   D . n 
D 3 18  LYS 18  18  ?   ?   ?   D . n 
D 3 19  GLN 19  19  ?   ?   ?   D . n 
D 3 20  TYR 20  20  ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1   188 1   HOH HOH A . 
E 4 HOH 2   189 2   HOH HOH A . 
E 4 HOH 3   190 3   HOH HOH A . 
E 4 HOH 4   191 4   HOH HOH A . 
E 4 HOH 5   192 5   HOH HOH A . 
E 4 HOH 6   193 6   HOH HOH A . 
E 4 HOH 7   194 7   HOH HOH A . 
E 4 HOH 8   195 9   HOH HOH A . 
E 4 HOH 9   196 12  HOH HOH A . 
E 4 HOH 10  197 15  HOH HOH A . 
E 4 HOH 11  198 17  HOH HOH A . 
E 4 HOH 12  199 19  HOH HOH A . 
E 4 HOH 13  200 25  HOH HOH A . 
E 4 HOH 14  201 26  HOH HOH A . 
E 4 HOH 15  202 27  HOH HOH A . 
E 4 HOH 16  203 28  HOH HOH A . 
E 4 HOH 17  204 29  HOH HOH A . 
E 4 HOH 18  205 32  HOH HOH A . 
E 4 HOH 19  206 35  HOH HOH A . 
E 4 HOH 20  207 38  HOH HOH A . 
E 4 HOH 21  208 39  HOH HOH A . 
E 4 HOH 22  209 40  HOH HOH A . 
E 4 HOH 23  210 41  HOH HOH A . 
E 4 HOH 24  211 42  HOH HOH A . 
E 4 HOH 25  212 43  HOH HOH A . 
E 4 HOH 26  213 47  HOH HOH A . 
E 4 HOH 27  214 48  HOH HOH A . 
E 4 HOH 28  215 51  HOH HOH A . 
E 4 HOH 29  216 53  HOH HOH A . 
E 4 HOH 30  217 54  HOH HOH A . 
E 4 HOH 31  218 55  HOH HOH A . 
E 4 HOH 32  219 61  HOH HOH A . 
E 4 HOH 33  220 63  HOH HOH A . 
E 4 HOH 34  221 65  HOH HOH A . 
E 4 HOH 35  222 69  HOH HOH A . 
E 4 HOH 36  223 72  HOH HOH A . 
E 4 HOH 37  224 76  HOH HOH A . 
E 4 HOH 38  225 80  HOH HOH A . 
E 4 HOH 39  226 83  HOH HOH A . 
E 4 HOH 40  227 90  HOH HOH A . 
E 4 HOH 41  228 95  HOH HOH A . 
E 4 HOH 42  229 101 HOH HOH A . 
E 4 HOH 43  230 102 HOH HOH A . 
E 4 HOH 44  231 107 HOH HOH A . 
E 4 HOH 45  232 117 HOH HOH A . 
E 4 HOH 46  233 126 HOH HOH A . 
E 4 HOH 47  234 130 HOH HOH A . 
E 4 HOH 48  235 136 HOH HOH A . 
E 4 HOH 49  236 137 HOH HOH A . 
E 4 HOH 50  237 138 HOH HOH A . 
E 4 HOH 51  238 141 HOH HOH A . 
E 4 HOH 52  239 144 HOH HOH A . 
E 4 HOH 53  240 157 HOH HOH A . 
E 4 HOH 54  241 162 HOH HOH A . 
E 4 HOH 55  242 200 HOH HOH A . 
E 4 HOH 56  243 201 HOH HOH A . 
E 4 HOH 57  244 202 HOH HOH A . 
E 4 HOH 58  245 207 HOH HOH A . 
E 4 HOH 59  246 209 HOH HOH A . 
E 4 HOH 60  247 213 HOH HOH A . 
E 4 HOH 61  248 215 HOH HOH A . 
E 4 HOH 62  249 222 HOH HOH A . 
E 4 HOH 63  250 226 HOH HOH A . 
E 4 HOH 64  251 233 HOH HOH A . 
E 4 HOH 65  252 234 HOH HOH A . 
E 4 HOH 66  253 241 HOH HOH A . 
E 4 HOH 67  254 244 HOH HOH A . 
E 4 HOH 68  255 245 HOH HOH A . 
E 4 HOH 69  256 246 HOH HOH A . 
E 4 HOH 70  257 248 HOH HOH A . 
E 4 HOH 71  258 249 HOH HOH A . 
E 4 HOH 72  259 251 HOH HOH A . 
E 4 HOH 73  260 252 HOH HOH A . 
E 4 HOH 74  261 253 HOH HOH A . 
E 4 HOH 75  262 257 HOH HOH A . 
E 4 HOH 76  263 258 HOH HOH A . 
E 4 HOH 77  264 260 HOH HOH A . 
E 4 HOH 78  265 261 HOH HOH A . 
E 4 HOH 79  266 263 HOH HOH A . 
E 4 HOH 80  267 265 HOH HOH A . 
E 4 HOH 81  268 269 HOH HOH A . 
E 4 HOH 82  269 270 HOH HOH A . 
E 4 HOH 83  270 271 HOH HOH A . 
E 4 HOH 84  271 273 HOH HOH A . 
E 4 HOH 85  272 275 HOH HOH A . 
E 4 HOH 86  273 277 HOH HOH A . 
E 4 HOH 87  274 282 HOH HOH A . 
E 4 HOH 88  275 283 HOH HOH A . 
E 4 HOH 89  276 285 HOH HOH A . 
E 4 HOH 90  277 286 HOH HOH A . 
E 4 HOH 91  278 289 HOH HOH A . 
E 4 HOH 92  279 290 HOH HOH A . 
E 4 HOH 93  280 291 HOH HOH A . 
E 4 HOH 94  281 296 HOH HOH A . 
E 4 HOH 95  282 297 HOH HOH A . 
E 4 HOH 96  283 298 HOH HOH A . 
E 4 HOH 97  284 299 HOH HOH A . 
E 4 HOH 98  285 300 HOH HOH A . 
E 4 HOH 99  286 303 HOH HOH A . 
E 4 HOH 100 287 307 HOH HOH A . 
E 4 HOH 101 288 313 HOH HOH A . 
E 4 HOH 102 289 317 HOH HOH A . 
E 4 HOH 103 290 318 HOH HOH A . 
E 4 HOH 104 291 319 HOH HOH A . 
E 4 HOH 105 292 321 HOH HOH A . 
E 4 HOH 106 293 323 HOH HOH A . 
E 4 HOH 107 294 325 HOH HOH A . 
E 4 HOH 108 295 326 HOH HOH A . 
E 4 HOH 109 296 327 HOH HOH A . 
E 4 HOH 110 297 329 HOH HOH A . 
E 4 HOH 111 298 401 HOH HOH A . 
E 4 HOH 112 299 412 HOH HOH A . 
E 4 HOH 113 300 415 HOH HOH A . 
E 4 HOH 114 301 416 HOH HOH A . 
E 4 HOH 115 302 417 HOH HOH A . 
E 4 HOH 116 303 419 HOH HOH A . 
E 4 HOH 117 304 424 HOH HOH A . 
E 4 HOH 118 305 434 HOH HOH A . 
E 4 HOH 119 306 437 HOH HOH A . 
E 4 HOH 120 307 443 HOH HOH A . 
E 4 HOH 121 308 445 HOH HOH A . 
E 4 HOH 122 309 446 HOH HOH A . 
E 4 HOH 123 310 449 HOH HOH A . 
E 4 HOH 124 311 452 HOH HOH A . 
E 4 HOH 125 312 453 HOH HOH A . 
E 4 HOH 126 313 458 HOH HOH A . 
E 4 HOH 127 314 464 HOH HOH A . 
E 4 HOH 128 315 473 HOH HOH A . 
E 4 HOH 129 316 480 HOH HOH A . 
E 4 HOH 130 317 491 HOH HOH A . 
F 4 HOH 1   188 8   HOH HOH B . 
F 4 HOH 2   189 13  HOH HOH B . 
F 4 HOH 3   190 16  HOH HOH B . 
F 4 HOH 4   191 18  HOH HOH B . 
F 4 HOH 5   192 24  HOH HOH B . 
F 4 HOH 6   193 34  HOH HOH B . 
F 4 HOH 7   194 36  HOH HOH B . 
F 4 HOH 8   195 49  HOH HOH B . 
F 4 HOH 9   196 56  HOH HOH B . 
F 4 HOH 10  197 57  HOH HOH B . 
F 4 HOH 11  198 67  HOH HOH B . 
F 4 HOH 12  199 70  HOH HOH B . 
F 4 HOH 13  200 74  HOH HOH B . 
F 4 HOH 14  201 96  HOH HOH B . 
F 4 HOH 15  202 115 HOH HOH B . 
F 4 HOH 16  203 129 HOH HOH B . 
F 4 HOH 17  204 154 HOH HOH B . 
F 4 HOH 18  205 163 HOH HOH B . 
F 4 HOH 19  206 199 HOH HOH B . 
F 4 HOH 20  207 208 HOH HOH B . 
F 4 HOH 21  208 225 HOH HOH B . 
F 4 HOH 22  209 232 HOH HOH B . 
F 4 HOH 23  210 239 HOH HOH B . 
F 4 HOH 24  211 247 HOH HOH B . 
F 4 HOH 25  212 250 HOH HOH B . 
F 4 HOH 26  213 255 HOH HOH B . 
F 4 HOH 27  214 256 HOH HOH B . 
F 4 HOH 28  215 266 HOH HOH B . 
F 4 HOH 29  216 267 HOH HOH B . 
F 4 HOH 30  217 268 HOH HOH B . 
F 4 HOH 31  218 272 HOH HOH B . 
F 4 HOH 32  219 274 HOH HOH B . 
F 4 HOH 33  220 276 HOH HOH B . 
F 4 HOH 34  221 278 HOH HOH B . 
F 4 HOH 35  222 279 HOH HOH B . 
F 4 HOH 36  223 280 HOH HOH B . 
F 4 HOH 37  224 284 HOH HOH B . 
F 4 HOH 38  225 292 HOH HOH B . 
F 4 HOH 39  226 294 HOH HOH B . 
F 4 HOH 40  227 295 HOH HOH B . 
F 4 HOH 41  228 301 HOH HOH B . 
F 4 HOH 42  229 302 HOH HOH B . 
F 4 HOH 43  230 304 HOH HOH B . 
F 4 HOH 44  231 305 HOH HOH B . 
F 4 HOH 45  232 306 HOH HOH B . 
F 4 HOH 46  233 309 HOH HOH B . 
F 4 HOH 47  234 312 HOH HOH B . 
F 4 HOH 48  235 314 HOH HOH B . 
F 4 HOH 49  236 315 HOH HOH B . 
F 4 HOH 50  237 320 HOH HOH B . 
F 4 HOH 51  238 322 HOH HOH B . 
F 4 HOH 52  239 324 HOH HOH B . 
F 4 HOH 53  240 328 HOH HOH B . 
F 4 HOH 54  241 330 HOH HOH B . 
F 4 HOH 55  242 331 HOH HOH B . 
F 4 HOH 56  243 403 HOH HOH B . 
F 4 HOH 57  244 406 HOH HOH B . 
F 4 HOH 58  245 411 HOH HOH B . 
F 4 HOH 59  246 414 HOH HOH B . 
F 4 HOH 60  247 421 HOH HOH B . 
F 4 HOH 61  248 422 HOH HOH B . 
F 4 HOH 62  249 425 HOH HOH B . 
F 4 HOH 63  250 426 HOH HOH B . 
F 4 HOH 64  251 427 HOH HOH B . 
F 4 HOH 65  252 428 HOH HOH B . 
F 4 HOH 66  253 429 HOH HOH B . 
F 4 HOH 67  254 432 HOH HOH B . 
F 4 HOH 68  255 433 HOH HOH B . 
F 4 HOH 69  256 439 HOH HOH B . 
F 4 HOH 70  257 442 HOH HOH B . 
F 4 HOH 71  258 455 HOH HOH B . 
F 4 HOH 72  259 456 HOH HOH B . 
F 4 HOH 73  260 465 HOH HOH B . 
F 4 HOH 74  261 467 HOH HOH B . 
F 4 HOH 75  262 470 HOH HOH B . 
F 4 HOH 76  263 477 HOH HOH B . 
F 4 HOH 77  264 481 HOH HOH B . 
F 4 HOH 78  265 484 HOH HOH B . 
F 4 HOH 79  266 485 HOH HOH B . 
F 4 HOH 80  267 490 HOH HOH B . 
G 4 HOH 1   116 11  HOH HOH C . 
G 4 HOH 2   117 14  HOH HOH C . 
G 4 HOH 3   118 23  HOH HOH C . 
G 4 HOH 4   119 37  HOH HOH C . 
G 4 HOH 5   120 44  HOH HOH C . 
G 4 HOH 6   121 52  HOH HOH C . 
G 4 HOH 7   122 75  HOH HOH C . 
G 4 HOH 8   123 79  HOH HOH C . 
G 4 HOH 9   124 93  HOH HOH C . 
G 4 HOH 10  125 112 HOH HOH C . 
G 4 HOH 11  126 113 HOH HOH C . 
G 4 HOH 12  127 134 HOH HOH C . 
G 4 HOH 13  128 148 HOH HOH C . 
G 4 HOH 14  129 149 HOH HOH C . 
G 4 HOH 15  130 203 HOH HOH C . 
G 4 HOH 16  131 211 HOH HOH C . 
G 4 HOH 17  132 216 HOH HOH C . 
G 4 HOH 18  133 219 HOH HOH C . 
G 4 HOH 19  134 237 HOH HOH C . 
G 4 HOH 20  135 254 HOH HOH C . 
G 4 HOH 21  136 259 HOH HOH C . 
G 4 HOH 22  137 262 HOH HOH C . 
G 4 HOH 23  138 264 HOH HOH C . 
G 4 HOH 24  139 281 HOH HOH C . 
G 4 HOH 25  140 287 HOH HOH C . 
G 4 HOH 26  141 288 HOH HOH C . 
G 4 HOH 27  142 293 HOH HOH C . 
G 4 HOH 28  143 308 HOH HOH C . 
G 4 HOH 29  144 310 HOH HOH C . 
G 4 HOH 30  145 311 HOH HOH C . 
G 4 HOH 31  146 405 HOH HOH C . 
G 4 HOH 32  147 407 HOH HOH C . 
G 4 HOH 33  148 409 HOH HOH C . 
G 4 HOH 34  149 413 HOH HOH C . 
G 4 HOH 35  150 420 HOH HOH C . 
G 4 HOH 36  151 431 HOH HOH C . 
G 4 HOH 37  152 435 HOH HOH C . 
G 4 HOH 38  153 450 HOH HOH C . 
G 4 HOH 39  154 457 HOH HOH C . 
G 4 HOH 40  155 466 HOH HOH C . 
G 4 HOH 41  156 469 HOH HOH C . 
G 4 HOH 42  157 471 HOH HOH C . 
G 4 HOH 43  158 492 HOH HOH C . 
G 4 HOH 44  159 493 HOH HOH C . 
G 4 HOH 45  160 494 HOH HOH C . 
H 4 HOH 1   316 316 HOH HOH D . 
H 4 HOH 2   402 402 HOH HOH D . 
H 4 HOH 3   482 482 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 20  A MSE 20  ? MET SELENOMETHIONINE  
2  A MSE 88  A MSE 88  ? MET SELENOMETHIONINE  
3  A MSE 178 A MSE 178 ? MET SELENOMETHIONINE  
4  B MSE 20  B MSE 20  ? MET SELENOMETHIONINE  
5  B MSE 88  B MSE 88  ? MET SELENOMETHIONINE  
6  B MSE 178 B MSE 178 ? MET SELENOMETHIONINE  
7  C MSE 20  C MSE 20  ? MET SELENOMETHIONINE  
8  C MSE 88  C MSE 88  ? MET SELENOMETHIONINE  
9  D TPO 3   D TPO 3   ? THR PHOSPHOTHREONINE  
10 D M3L 4   D M3L 4   ? LYS N-TRIMETHYLLYSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     311 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-12-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_diffrn_reflns.diffrn_id 
_diffrn_reflns.pdbx_d_res_low 
_diffrn_reflns.pdbx_d_res_high 
_diffrn_reflns.number 
_diffrn_reflns.pdbx_percent_possible_obs 
_diffrn_reflns.pdbx_Rmerge_I_obs 
_diffrn_reflns.pdbx_chi_squared 
_diffrn_reflns.pdbx_redundancy 
_diffrn_reflns.pdbx_rejects 
_diffrn_reflns.pdbx_number_obs 
_diffrn_reflns.av_sigmaI_over_netI 
_diffrn_reflns.pdbx_Rsym_value 
_diffrn_reflns.pdbx_observed_criterion 
1 50.00 2.80 14057 98.500 0.080 1.077 3.800 ? ? ? ? ? 
2 50.00 2.40 21731 97.300 0.071 1.048 3.700 ? ? ? ? ? 
3 50.00 2.60 17511 98.400 0.068 1.058 3.800 ? ? ? ? ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
1 50.00 6.03 98.700 0.042 2.011 3.700 ? ? ? 
1 6.03  4.79 99.200 0.048 1.223 3.800 ? ? ? 
1 4.79  4.18 99.200 0.056 1.381 3.800 ? ? ? 
1 4.18  3.80 98.800 0.072 1.227 3.800 ? ? ? 
1 3.80  3.53 98.900 0.096 1.110 3.800 ? ? ? 
1 3.53  3.32 98.600 0.132 0.944 3.800 ? ? ? 
1 3.32  3.15 98.700 0.186 0.815 3.900 ? ? ? 
1 3.15  3.02 98.600 0.267 0.705 3.900 ? ? ? 
1 3.02  2.90 98.500 0.389 0.652 3.800 ? ? ? 
1 2.90  2.80 96.200 0.525 0.612 3.400 ? ? ? 
2 50.00 5.17 98.900 0.048 2.505 3.700 ? ? ? 
2 5.17  4.10 99.100 0.047 1.548 3.800 ? ? ? 
2 4.10  3.58 98.800 0.054 1.190 3.800 ? ? ? 
2 3.58  3.26 99.000 0.073 1.034 3.800 ? ? ? 
2 3.26  3.02 98.600 0.099 0.858 3.900 ? ? ? 
2 3.02  2.85 98.600 0.153 0.679 3.900 ? ? ? 
2 2.85  2.70 98.400 0.226 0.622 3.800 ? ? ? 
2 2.70  2.59 98.200 0.308 0.597 3.700 ? ? ? 
2 2.59  2.49 95.700 0.348 0.568 3.300 ? ? ? 
2 2.49  2.40 87.700 0.426 0.565 2.900 ? ? ? 
3 50.00 5.60 98.700 0.042 2.346 3.700 ? ? ? 
3 5.60  4.45 99.300 0.043 1.449 3.800 ? ? ? 
3 4.45  3.88 98.800 0.048 1.260 3.800 ? ? ? 
3 3.88  3.53 98.800 0.063 1.151 3.800 ? ? ? 
3 3.53  3.28 98.800 0.084 0.993 3.800 ? ? ? 
3 3.28  3.08 98.700 0.113 0.791 3.900 ? ? ? 
3 3.08  2.93 98.600 0.173 0.698 3.900 ? ? ? 
3 2.93  2.80 98.500 0.261 0.611 3.800 ? ? ? 
3 2.80  2.69 97.900 0.358 0.586 3.700 ? ? ? 
3 2.69  2.60 95.700 0.447 0.575 3.300 ? ? ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         .     ?               package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 1.700 'May. 30, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
MAR345      .     ?               ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .     ?               ?       ?                    ?                        'data scaling'    ? ?          ? 6 
SOLVE       .     ?               ?       ?                    ?                        phasing           ? ?          ? 7 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
999 
;SEQUENCE
Selenomethionine at position 1 in chains A, B, C is a 
modified methionine residue and a cloning artifact.
Selenomethionine at position 178 is a modified residue 
and a result of C436M mutation in chains A and B. Tyrosine 
at position 20 is a synthetic modification and does not 
exist in histone H3   
;
300 
;BIOMOLECULE
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT 
WHICH CONSISTS OF 4 CHAIN(S). ACCORDING TO AUTHORS, THE 
BIOLOGICAL UNIT OF THE PROTEIN IS UNKNOWN.
;
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     50 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     50 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.04 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A LYS 51  ? ? CA A LYS 51  ? ? C  A LYS 51  ? ? 83.72  111.00 -27.28 2.70 N 
2 1 C  A GLU 54  ? ? N  A PRO 55  ? ? CD A PRO 55  ? ? 110.36 128.40 -18.04 2.10 Y 
3 1 N  A GLY 56  ? ? CA A GLY 56  ? ? C  A GLY 56  ? ? 95.39  113.10 -17.71 2.50 N 
4 1 N  A GLU 57  ? ? CA A GLU 57  ? ? C  A GLU 57  ? ? 94.43  111.00 -16.57 2.70 N 
5 1 CB A ALA 108 ? ? CA A ALA 108 ? ? C  A ALA 108 ? ? 131.77 110.10 21.67  1.50 N 
6 1 CB A LYS 186 ? ? CA A LYS 186 ? ? C  A LYS 186 ? ? 126.84 110.40 16.44  2.00 N 
7 1 CB B GLU 11  ? ? CA B GLU 11  ? ? C  B GLU 11  ? ? 122.91 110.40 12.51  2.00 N 
8 1 CB B ALA 32  ? ? CA B ALA 32  ? ? C  B ALA 32  ? ? 89.29  110.10 -20.81 1.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 12  ? ? -117.71 -74.14  
2  1 PHE A 13  ? ? 85.89   174.31  
3  1 MSE A 20  ? ? -94.65  -114.28 
4  1 ALA A 47  ? ? -32.87  -75.84  
5  1 GLU A 50  ? ? 27.47   73.69   
6  1 ASN A 52  ? ? 91.87   -16.86  
7  1 GLU A 54  ? ? -25.80  131.10  
8  1 PRO A 55  ? ? -5.36   -117.86 
9  1 TRP A 104 ? ? -104.57 65.70   
10 1 LYS A 106 ? ? -25.22  -61.91  
11 1 ASN A 107 ? ? -141.90 -62.58  
12 1 ALA A 108 ? ? 70.72   175.91  
13 1 ARG A 135 ? ? -178.38 132.78  
14 1 GLU B 11  ? ? 64.12   173.50  
15 1 ALA B 32  ? ? 56.33   2.99    
16 1 PRO B 55  ? ? -49.55  167.59  
17 1 ARG B 103 ? ? -65.37  -74.98  
18 1 ARG B 135 ? ? 174.29  135.93  
19 1 LYS B 143 ? ? 176.74  150.47  
20 1 ARG B 185 ? ? -78.18  46.24   
21 1 ARG C 18  ? ? -171.33 148.86  
22 1 ALA C 47  ? ? 20.18   -125.27 
23 1 LYS C 51  ? ? -99.21  37.76   
24 1 PRO C 55  ? ? -29.34  83.28   
25 1 ASN C 84  ? ? 70.58   37.37   
26 1 LEU C 91  ? ? -73.90  -70.90  
27 1 LYS C 95  ? ? -69.96  24.73   
28 1 LYS C 96  ? ? -148.41 -35.08  
29 1 M3L D 4   ? ? -52.61  -7.65   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 48 ? ? PHE A 49 ? ? -125.95 
2 1 GLY B 48 ? ? PHE B 49 ? ? -139.86 
3 1 LYS C 53 ? ? GLU C 54 ? ? 147.58  
4 1 GLU C 54 ? ? PRO C 55 ? ? 46.25   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 11  ? CG  ? A GLU 11  CG  
2  1 Y 1 A GLU 11  ? CD  ? A GLU 11  CD  
3  1 Y 1 A GLU 11  ? OE1 ? A GLU 11  OE1 
4  1 Y 1 A GLU 11  ? OE2 ? A GLU 11  OE2 
5  1 Y 1 A GLU 12  ? CG  ? A GLU 12  CG  
6  1 Y 1 A GLU 12  ? CD  ? A GLU 12  CD  
7  1 Y 1 A GLU 12  ? OE1 ? A GLU 12  OE1 
8  1 Y 1 A GLU 12  ? OE2 ? A GLU 12  OE2 
9  1 Y 1 B GLU 10  ? CG  ? B GLU 10  CG  
10 1 Y 1 B GLU 10  ? CD  ? B GLU 10  CD  
11 1 Y 1 B GLU 10  ? OE1 ? B GLU 10  OE1 
12 1 Y 1 B GLU 10  ? OE2 ? B GLU 10  OE2 
13 1 Y 1 B GLU 11  ? CG  ? B GLU 11  CG  
14 1 Y 1 B GLU 11  ? CD  ? B GLU 11  CD  
15 1 Y 1 B GLU 11  ? OE1 ? B GLU 11  OE1 
16 1 Y 1 B GLU 11  ? OE2 ? B GLU 11  OE2 
17 1 Y 1 B GLU 12  ? CG  ? B GLU 12  CG  
18 1 Y 1 B GLU 12  ? CD  ? B GLU 12  CD  
19 1 Y 1 B GLU 12  ? OE1 ? B GLU 12  OE1 
20 1 Y 1 B GLU 12  ? OE2 ? B GLU 12  OE2 
21 1 Y 1 B PHE 13  ? CG  ? B PHE 13  CG  
22 1 Y 1 B PHE 13  ? CD1 ? B PHE 13  CD1 
23 1 Y 1 B PHE 13  ? CD2 ? B PHE 13  CD2 
24 1 Y 1 B PHE 13  ? CE1 ? B PHE 13  CE1 
25 1 Y 1 B PHE 13  ? CE2 ? B PHE 13  CE2 
26 1 Y 1 B PHE 13  ? CZ  ? B PHE 13  CZ  
27 1 Y 1 B LYS 51  ? CG  ? B LYS 51  CG  
28 1 Y 1 B LYS 51  ? CD  ? B LYS 51  CD  
29 1 Y 1 B LYS 51  ? CE  ? B LYS 51  CE  
30 1 Y 1 B LYS 51  ? NZ  ? B LYS 51  NZ  
31 1 Y 1 B LYS 53  ? CG  ? B LYS 53  CG  
32 1 Y 1 B LYS 53  ? CD  ? B LYS 53  CD  
33 1 Y 1 B LYS 53  ? CE  ? B LYS 53  CE  
34 1 Y 1 B LYS 53  ? NZ  ? B LYS 53  NZ  
35 1 Y 1 B GLN 142 ? CG  ? B GLN 142 CG  
36 1 Y 1 B GLN 142 ? CD  ? B GLN 142 CD  
37 1 Y 1 B GLN 142 ? OE1 ? B GLN 142 OE1 
38 1 Y 1 B GLN 142 ? NE2 ? B GLN 142 NE2 
39 1 Y 1 B SER 144 ? OG  ? B SER 144 OG  
40 1 Y 1 B ARG 185 ? CG  ? B ARG 185 CG  
41 1 Y 1 B ARG 185 ? CD  ? B ARG 185 CD  
42 1 Y 1 B ARG 185 ? NE  ? B ARG 185 NE  
43 1 Y 1 B ARG 185 ? CZ  ? B ARG 185 CZ  
44 1 Y 1 B ARG 185 ? NH1 ? B ARG 185 NH1 
45 1 Y 1 B ARG 185 ? NH2 ? B ARG 185 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 1   ? A MSE 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A LYS 3   ? A LYS 3   
4  1 Y 1 A HIS 4   ? A HIS 4   
5  1 Y 1 A HIS 5   ? A HIS 5   
6  1 Y 1 A HIS 6   ? A HIS 6   
7  1 Y 1 A HIS 7   ? A HIS 7   
8  1 Y 1 A HIS 8   ? A HIS 8   
9  1 Y 1 A HIS 9   ? A HIS 9   
10 1 Y 1 A GLU 10  ? A GLU 10  
11 1 Y 1 A LYS 187 ? A LYS 187 
12 1 Y 1 B MSE 1   ? B MSE 1   
13 1 Y 1 B LYS 2   ? B LYS 2   
14 1 Y 1 B LYS 3   ? B LYS 3   
15 1 Y 1 B HIS 4   ? B HIS 4   
16 1 Y 1 B HIS 5   ? B HIS 5   
17 1 Y 1 B HIS 6   ? B HIS 6   
18 1 Y 1 B HIS 7   ? B HIS 7   
19 1 Y 1 B HIS 8   ? B HIS 8   
20 1 Y 1 B HIS 9   ? B HIS 9   
21 1 Y 1 B ASN 52  ? B ASN 52  
22 1 Y 1 B ALA 145 ? B ALA 145 
23 1 Y 1 B ALA 146 ? B ALA 146 
24 1 Y 1 B LYS 187 ? B LYS 187 
25 1 Y 1 C MSE 1   ? C MSE 1   
26 1 Y 1 C LYS 2   ? C LYS 2   
27 1 Y 1 C LYS 3   ? C LYS 3   
28 1 Y 1 C HIS 4   ? C HIS 4   
29 1 Y 1 C HIS 5   ? C HIS 5   
30 1 Y 1 C HIS 6   ? C HIS 6   
31 1 Y 1 C HIS 7   ? C HIS 7   
32 1 Y 1 C HIS 8   ? C HIS 8   
33 1 Y 1 C HIS 9   ? C HIS 9   
34 1 Y 1 C GLU 10  ? C GLU 10  
35 1 Y 1 C GLU 11  ? C GLU 11  
36 1 Y 1 C ASP 98  ? C ASP 98  
37 1 Y 1 C GLN 99  ? C GLN 99  
38 1 Y 1 C GLU 100 ? C GLU 100 
39 1 Y 1 C THR 101 ? C THR 101 
40 1 Y 1 C LYS 102 ? C LYS 102 
41 1 Y 1 C ARG 103 ? C ARG 103 
42 1 Y 1 C TRP 104 ? C TRP 104 
43 1 Y 1 C LEU 105 ? C LEU 105 
44 1 Y 1 C LYS 106 ? C LYS 106 
45 1 Y 1 C ASN 107 ? C ASN 107 
46 1 Y 1 C ALA 108 ? C ALA 108 
47 1 Y 1 C SER 109 ? C SER 109 
48 1 Y 1 C PRO 110 ? C PRO 110 
49 1 Y 1 C GLU 111 ? C GLU 111 
50 1 Y 1 C ASP 112 ? C ASP 112 
51 1 Y 1 C VAL 113 ? C VAL 113 
52 1 Y 1 C GLU 114 ? C GLU 114 
53 1 Y 1 C TYR 115 ? C TYR 115 
54 1 Y 1 D THR 6   ? D THR 6   
55 1 Y 1 D ALA 7   ? D ALA 7   
56 1 Y 1 D ARG 8   ? D ARG 8   
57 1 Y 1 D LYS 9   ? D LYS 9   
58 1 Y 1 D SER 10  ? D SER 10  
59 1 Y 1 D THR 11  ? D THR 11  
60 1 Y 1 D GLY 12  ? D GLY 12  
61 1 Y 1 D GLY 13  ? D GLY 13  
62 1 Y 1 D LYS 14  ? D LYS 14  
63 1 Y 1 D ALA 15  ? D ALA 15  
64 1 Y 1 D PRO 16  ? D PRO 16  
65 1 Y 1 D ARG 17  ? D ARG 17  
66 1 Y 1 D LYS 18  ? D LYS 18  
67 1 Y 1 D GLN 19  ? D GLN 19  
68 1 Y 1 D TYR 20  ? D TYR 20  
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#