data_2B4M
# 
_entry.id   2B4M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2B4M         
RCSB  RCSB034668   
WWPDB D_1000034668 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2B4L 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2B4M 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horn, C.'         1 
'Sohn-Boesser, L.' 2 
'Breed, J.'        3 
'Welte, W.'        4 
'Schmitt, L.'      5 
'Bremer, E.'       6 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Determinants for Substrate Specificity of the Ligand-binding Protein OpuAC from Bacillus subtilis for the Compatible Solutes Glycine Betaine and Proline Betaine.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            357 
_citation.page_first                592 
_citation.page_last                 606 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16445940 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.085 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horn, C.'         1 
primary 'Sohn-Boesser, L.' 2 
primary 'Breed, J.'        3 
primary 'Welte, W.'        4 
primary 'Schmitt, L.'      5 
primary 'Bremer, E.'       6 
# 
_cell.entry_id           2B4M 
_cell.length_a           88.562 
_cell.length_b           28.318 
_cell.length_c           102.826 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.87 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2B4M 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycine betaine-binding protein' 29780.914 2 ? ? ? ? 
2 non-polymer syn 1,1-DIMETHYL-PROLINIUM            144.192   2 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLK
YLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQ
KVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDI
GTSMTGVKMGLVVPQYMKNVNSIEDLKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLK
YLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQ
KVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDI
GTSMTGVKMGLVVPQYMKNVNSIEDLKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   GLU n 
1 3   ASN n 
1 4   ALA n 
1 5   SER n 
1 6   ALA n 
1 7   ALA n 
1 8   GLU n 
1 9   GLN n 
1 10  VAL n 
1 11  ASN n 
1 12  LYS n 
1 13  THR n 
1 14  ILE n 
1 15  ILE n 
1 16  GLY n 
1 17  ILE n 
1 18  ASP n 
1 19  PRO n 
1 20  GLY n 
1 21  SER n 
1 22  GLY n 
1 23  ILE n 
1 24  MET n 
1 25  SER n 
1 26  LEU n 
1 27  THR n 
1 28  ASP n 
1 29  LYS n 
1 30  ALA n 
1 31  MET n 
1 32  LYS n 
1 33  ASP n 
1 34  TYR n 
1 35  ASP n 
1 36  LEU n 
1 37  ASN n 
1 38  ASP n 
1 39  TRP n 
1 40  THR n 
1 41  LEU n 
1 42  ILE n 
1 43  SER n 
1 44  ALA n 
1 45  SER n 
1 46  SER n 
1 47  ALA n 
1 48  ALA n 
1 49  MET n 
1 50  THR n 
1 51  ALA n 
1 52  THR n 
1 53  LEU n 
1 54  LYS n 
1 55  LYS n 
1 56  SER n 
1 57  TYR n 
1 58  ASP n 
1 59  ARG n 
1 60  LYS n 
1 61  LYS n 
1 62  PRO n 
1 63  ILE n 
1 64  ILE n 
1 65  ILE n 
1 66  THR n 
1 67  GLY n 
1 68  TRP n 
1 69  THR n 
1 70  PRO n 
1 71  HIS n 
1 72  TRP n 
1 73  MET n 
1 74  PHE n 
1 75  SER n 
1 76  ARG n 
1 77  TYR n 
1 78  LYS n 
1 79  LEU n 
1 80  LYS n 
1 81  TYR n 
1 82  LEU n 
1 83  ASP n 
1 84  ASP n 
1 85  PRO n 
1 86  LYS n 
1 87  GLN n 
1 88  SER n 
1 89  TYR n 
1 90  GLY n 
1 91  SER n 
1 92  ALA n 
1 93  GLU n 
1 94  GLU n 
1 95  ILE n 
1 96  HIS n 
1 97  THR n 
1 98  ILE n 
1 99  THR n 
1 100 ARG n 
1 101 LYS n 
1 102 GLY n 
1 103 PHE n 
1 104 SER n 
1 105 LYS n 
1 106 GLU n 
1 107 GLN n 
1 108 PRO n 
1 109 ASN n 
1 110 ALA n 
1 111 ALA n 
1 112 LYS n 
1 113 LEU n 
1 114 LEU n 
1 115 SER n 
1 116 GLN n 
1 117 PHE n 
1 118 LYS n 
1 119 TRP n 
1 120 THR n 
1 121 GLN n 
1 122 ASP n 
1 123 GLU n 
1 124 MET n 
1 125 GLY n 
1 126 GLU n 
1 127 ILE n 
1 128 MET n 
1 129 ILE n 
1 130 LYS n 
1 131 VAL n 
1 132 GLU n 
1 133 GLU n 
1 134 GLY n 
1 135 GLU n 
1 136 LYS n 
1 137 PRO n 
1 138 ALA n 
1 139 LYS n 
1 140 VAL n 
1 141 ALA n 
1 142 ALA n 
1 143 GLU n 
1 144 TYR n 
1 145 VAL n 
1 146 ASN n 
1 147 LYS n 
1 148 HIS n 
1 149 LYS n 
1 150 ASP n 
1 151 GLN n 
1 152 ILE n 
1 153 ALA n 
1 154 GLU n 
1 155 TRP n 
1 156 THR n 
1 157 LYS n 
1 158 GLY n 
1 159 VAL n 
1 160 GLN n 
1 161 LYS n 
1 162 VAL n 
1 163 LYS n 
1 164 GLY n 
1 165 ASP n 
1 166 LYS n 
1 167 ILE n 
1 168 ASN n 
1 169 LEU n 
1 170 ALA n 
1 171 TYR n 
1 172 VAL n 
1 173 ALA n 
1 174 TRP n 
1 175 ASP n 
1 176 SER n 
1 177 GLU n 
1 178 ILE n 
1 179 ALA n 
1 180 SER n 
1 181 THR n 
1 182 ASN n 
1 183 VAL n 
1 184 ILE n 
1 185 GLY n 
1 186 LYS n 
1 187 VAL n 
1 188 LEU n 
1 189 GLU n 
1 190 ASP n 
1 191 LEU n 
1 192 GLY n 
1 193 TYR n 
1 194 GLU n 
1 195 VAL n 
1 196 THR n 
1 197 LEU n 
1 198 THR n 
1 199 GLN n 
1 200 VAL n 
1 201 GLU n 
1 202 ALA n 
1 203 GLY n 
1 204 PRO n 
1 205 MET n 
1 206 TRP n 
1 207 THR n 
1 208 ALA n 
1 209 ILE n 
1 210 ALA n 
1 211 THR n 
1 212 GLY n 
1 213 SER n 
1 214 ALA n 
1 215 ASP n 
1 216 ALA n 
1 217 SER n 
1 218 LEU n 
1 219 SER n 
1 220 ALA n 
1 221 TRP n 
1 222 LEU n 
1 223 PRO n 
1 224 ASN n 
1 225 THR n 
1 226 HIS n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 ALA n 
1 231 ALA n 
1 232 LYS n 
1 233 TYR n 
1 234 LYS n 
1 235 GLY n 
1 236 LYS n 
1 237 TYR n 
1 238 ASP n 
1 239 ASP n 
1 240 ILE n 
1 241 GLY n 
1 242 THR n 
1 243 SER n 
1 244 MET n 
1 245 THR n 
1 246 GLY n 
1 247 VAL n 
1 248 LYS n 
1 249 MET n 
1 250 GLY n 
1 251 LEU n 
1 252 VAL n 
1 253 VAL n 
1 254 PRO n 
1 255 GLN n 
1 256 TYR n 
1 257 MET n 
1 258 LYS n 
1 259 ASN n 
1 260 VAL n 
1 261 ASN n 
1 262 SER n 
1 263 ILE n 
1 264 GLU n 
1 265 ASP n 
1 266 LEU n 
1 267 LYS n 
1 268 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 opuAC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               pBKB76 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    OPUAC_BACSU 
_struct_ref.pdbx_db_accession          P46922 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLK
YLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQ
KVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDI
GTSMTGVKMGLVVPQYMKNVNSIEDLKK
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2B4M A 1 ? 268 ? P46922 26 ? 293 ? 5 272 
2 1 2B4M B 1 ? 268 ? P46922 26 ? 293 ? 5 272 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE              ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?                 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE             ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                 'C5 H11 N O2 S'  149.211 
PBE non-polymer         . 1,1-DIMETHYL-PROLINIUM 'PROLINE BETAINE' 'C7 H14 N O2 1'  144.192 
PHE 'L-peptide linking' y PHENYLALANINE          ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2B4M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            274 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.25 
_exptl_crystal_grow.pdbx_details    'Tris, ammonium acetate, PEG 4000, pH 8.25, VAPOR DIFFUSION, HANGING DROP, temperature 274K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     2B4M 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             15 
_reflns.number_all                   13067 
_reflns.number_obs                   10846 
_reflns.percent_possible_obs         83 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.84 
_reflns_shell.percent_possible_all   70.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.312 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      369 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2B4M 
_refine.ls_number_reflns_obs                     10300 
_refine.ls_number_reflns_all                     13067 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    82.40 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.23322 
_refine.ls_R_factor_R_work                       0.23056 
_refine.ls_R_factor_R_free                       0.28302 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  546 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.909 
_refine.correlation_coeff_Fo_to_Fc_free          0.865 
_refine.B_iso_mean                               15.618 
_refine.aniso_B[1][1]                            -0.27 
_refine.aniso_B[2][2]                            -1.16 
_refine.aniso_B[3][3]                            2.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            5.49 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2B4L 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.544 
_refine.overall_SU_ML                            0.405 
_refine.overall_SU_B                             47.945 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4122 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4142 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009  0.022  ? 4212 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.133  1.947  ? 5702 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.759  5.000  ? 526  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   39.522 25.926 ? 162  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   19.143 15.000 ? 770  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   9.138  15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.080  0.200  ? 634  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 3072 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.197  0.200  ? 1807 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.140  0.200  ? 136  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.240  0.200  ? 45   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.185  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.226  1.500  ? 2704 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.378  2.000  ? 4242 'X-RAY DIFFRACTION' ? 
r_scbond_it              0.549  3.000  ? 1771 'X-RAY DIFFRACTION' ? 
r_scangle_it             0.919  4.500  ? 1460 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2053 0.02 0.05 'tight positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 2053 0.04 0.50 'tight thermal'    1 'X-RAY DIFFRACTION' 2 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             671 
_refine_ls_shell.R_factor_R_work                  0.369 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.41 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             25 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 9 A 272 1 1 A SER 5 ? A LYS 268 ? 1 ? 
2 B 9 B 272 1 1 B SER 5 ? B LYS 268 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2B4M 
_struct.title                     'Crystal structure of the binding protein OpuAC in complex with proline betaine' 
_struct.pdbx_descriptor           'Glycine betaine-binding protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2B4M 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
'substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, Transport Protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 5   ? ASN A 11  ? SER A 9   ASN A 15  1 ? 7  
HELX_P HELX_P2  2  SER A 21  ? TYR A 34  ? SER A 25  TYR A 38  1 ? 14 
HELX_P HELX_P3  3  SER A 45  ? LYS A 60  ? SER A 49  LYS A 64  1 ? 16 
HELX_P HELX_P4  4  TRP A 72  ? TYR A 77  ? TRP A 76  TYR A 81  1 ? 6  
HELX_P HELX_P5  5  GLY A 102 ? GLN A 107 ? GLY A 106 GLN A 111 1 ? 6  
HELX_P HELX_P6  6  GLN A 107 ? PHE A 117 ? GLN A 111 PHE A 121 1 ? 11 
HELX_P HELX_P7  7  THR A 120 ? GLU A 133 ? THR A 124 GLU A 137 1 ? 14 
HELX_P HELX_P8  8  LYS A 136 ? ASN A 146 ? LYS A 140 ASN A 150 1 ? 11 
HELX_P HELX_P9  9  HIS A 148 ? THR A 156 ? HIS A 152 THR A 160 1 ? 9  
HELX_P HELX_P10 10 TRP A 174 ? LEU A 191 ? TRP A 178 LEU A 195 1 ? 18 
HELX_P HELX_P11 11 GLY A 203 ? THR A 211 ? GLY A 207 THR A 215 1 ? 9  
HELX_P HELX_P12 12 HIS A 226 ? TYR A 233 ? HIS A 230 TYR A 237 1 ? 8  
HELX_P HELX_P13 13 SER A 262 ? LYS A 267 ? SER A 266 LYS A 271 5 ? 6  
HELX_P HELX_P14 14 SER B 5   ? ASN B 11  ? SER B 9   ASN B 15  1 ? 7  
HELX_P HELX_P15 15 SER B 21  ? TYR B 34  ? SER B 25  TYR B 38  1 ? 14 
HELX_P HELX_P16 16 SER B 45  ? ARG B 59  ? SER B 49  ARG B 63  1 ? 15 
HELX_P HELX_P17 17 TRP B 72  ? TYR B 77  ? TRP B 76  TYR B 81  1 ? 6  
HELX_P HELX_P18 18 GLY B 102 ? GLN B 107 ? GLY B 106 GLN B 111 1 ? 6  
HELX_P HELX_P19 19 GLN B 107 ? PHE B 117 ? GLN B 111 PHE B 121 1 ? 11 
HELX_P HELX_P20 20 THR B 120 ? GLU B 133 ? THR B 124 GLU B 137 1 ? 14 
HELX_P HELX_P21 21 LYS B 136 ? ASN B 146 ? LYS B 140 ASN B 150 1 ? 11 
HELX_P HELX_P22 22 HIS B 148 ? THR B 156 ? HIS B 152 THR B 160 1 ? 9  
HELX_P HELX_P23 23 TRP B 174 ? LEU B 191 ? TRP B 178 LEU B 195 1 ? 18 
HELX_P HELX_P24 24 GLY B 203 ? THR B 211 ? GLY B 207 THR B 215 1 ? 9  
HELX_P HELX_P25 25 HIS B 226 ? TYR B 233 ? HIS B 230 TYR B 237 1 ? 8  
HELX_P HELX_P26 26 SER B 262 ? LYS B 267 ? SER B 266 LYS B 271 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 222 A . ? LEU 226 A PRO 223 A ? PRO 227 A 1 1.80 
2 LEU 222 B . ? LEU 226 B PRO 223 B ? PRO 227 B 1 0.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 5 ? 
D ? 2 ? 
E ? 3 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 13  ? ILE A 15  ? THR A 17  ILE A 19  
A 2 THR A 40  ? ILE A 42  ? THR A 44  ILE A 46  
B 1 ILE A 65  ? TRP A 68  ? ILE A 69  TRP A 72  
B 2 MET A 249 ? PRO A 254 ? MET A 253 PRO A 258 
B 3 LEU A 79  ? TYR A 81  ? LEU A 83  TYR A 85  
C 1 GLU A 194 ? VAL A 200 ? GLU A 198 VAL A 204 
C 2 LYS A 166 ? VAL A 172 ? LYS A 170 VAL A 176 
C 3 ALA A 216 ? LEU A 222 ? ALA A 220 LEU A 226 
C 4 GLU A 93  ? ARG A 100 ? GLU A 97  ARG A 104 
C 5 TYR A 237 ? VAL A 247 ? TYR A 241 VAL A 251 
D 1 THR B 13  ? ILE B 15  ? THR B 17  ILE B 19  
D 2 THR B 40  ? ILE B 42  ? THR B 44  ILE B 46  
E 1 ILE B 65  ? TRP B 68  ? ILE B 69  TRP B 72  
E 2 MET B 249 ? PRO B 254 ? MET B 253 PRO B 258 
E 3 LEU B 79  ? TYR B 81  ? LEU B 83  TYR B 85  
F 1 GLU B 194 ? GLN B 199 ? GLU B 198 GLN B 203 
F 2 LYS B 166 ? TYR B 171 ? LYS B 170 TYR B 175 
F 3 ALA B 216 ? LEU B 222 ? ALA B 220 LEU B 226 
F 4 GLU B 93  ? ARG B 100 ? GLU B 97  ARG B 104 
F 5 TYR B 237 ? VAL B 247 ? TYR B 241 VAL B 251 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 14  ? N ILE A 18  O ILE A 42  ? O ILE A 46  
B 1 2 N GLY A 67  ? N GLY A 71  O GLY A 250 ? O GLY A 254 
B 2 3 O VAL A 253 ? O VAL A 257 N LYS A 80  ? N LYS A 84  
C 1 2 O THR A 196 ? O THR A 200 N LEU A 169 ? N LEU A 173 
C 2 3 N ALA A 170 ? N ALA A 174 O ALA A 216 ? O ALA A 220 
C 3 4 O ALA A 220 ? O ALA A 224 N HIS A 96  ? N HIS A 100 
C 4 5 N THR A 97  ? N THR A 101 O GLY A 241 ? O GLY A 245 
D 1 2 N ILE B 14  ? N ILE B 18  O THR B 40  ? O THR B 44  
E 1 2 N ILE B 65  ? N ILE B 69  O VAL B 252 ? O VAL B 256 
E 2 3 O VAL B 253 ? O VAL B 257 N LYS B 80  ? N LYS B 84  
F 1 2 O THR B 196 ? O THR B 200 N LEU B 169 ? N LEU B 173 
F 2 3 N ALA B 170 ? N ALA B 174 O ALA B 216 ? O ALA B 220 
F 3 4 O ALA B 220 ? O ALA B 224 N HIS B 96  ? N HIS B 100 
F 4 5 N THR B 97  ? N THR B 101 O GLY B 241 ? O GLY B 245 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PBE B 310' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PBE A 311' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ILE B 17  ? ILE B 21  . ? 1_555 ? 
2  AC1 8 SER B 21  ? SER B 25  . ? 1_555 ? 
3  AC1 8 GLY B 22  ? GLY B 26  . ? 1_555 ? 
4  AC1 8 ILE B 23  ? ILE B 27  . ? 1_555 ? 
5  AC1 8 TRP B 68  ? TRP B 72  . ? 1_555 ? 
6  AC1 8 TRP B 174 ? TRP B 178 . ? 1_555 ? 
7  AC1 8 TRP B 221 ? TRP B 225 . ? 1_555 ? 
8  AC1 8 THR B 225 ? THR B 229 . ? 1_555 ? 
9  AC2 7 SER A 21  ? SER A 25  . ? 1_555 ? 
10 AC2 7 GLY A 22  ? GLY A 26  . ? 1_555 ? 
11 AC2 7 ILE A 23  ? ILE A 27  . ? 1_555 ? 
12 AC2 7 TRP A 68  ? TRP A 72  . ? 1_555 ? 
13 AC2 7 TRP A 174 ? TRP A 178 . ? 1_555 ? 
14 AC2 7 TRP A 221 ? TRP A 225 . ? 1_555 ? 
15 AC2 7 THR A 225 ? THR A 229 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2B4M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2B4M 
_atom_sites.fract_transf_matrix[1][1]   0.011292 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000764 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.035313 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009747 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? 53.781  4.305   24.652  1.00 15.15 ? 9   SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? 52.521  3.530   24.858  1.00 15.40 ? 9   SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? 51.386  4.117   24.024  1.00 15.77 ? 9   SER A C   1 
ATOM   4    O O   . SER A 1 5   ? 51.491  5.247   23.543  1.00 15.92 ? 9   SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? 52.131  3.507   26.339  1.00 15.31 ? 9   SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? 51.594  4.751   26.758  1.00 15.12 ? 9   SER A OG  1 
ATOM   7    N N   . ALA A 1 6   ? 50.302  3.356   23.861  1.00 16.00 ? 10  ALA A N   1 
ATOM   8    C CA  . ALA A 1 6   ? 49.166  3.789   23.047  1.00 16.07 ? 10  ALA A CA  1 
ATOM   9    C C   . ALA A 1 6   ? 48.490  5.003   23.648  1.00 16.19 ? 10  ALA A C   1 
ATOM   10   O O   . ALA A 1 6   ? 48.007  5.867   22.913  1.00 16.67 ? 10  ALA A O   1 
ATOM   11   C CB  . ALA A 1 6   ? 48.170  2.669   22.873  1.00 16.29 ? 10  ALA A CB  1 
ATOM   12   N N   . ALA A 1 7   ? 48.447  5.066   24.979  1.00 15.93 ? 11  ALA A N   1 
ATOM   13   C CA  . ALA A 1 7   ? 47.920  6.240   25.656  1.00 15.80 ? 11  ALA A CA  1 
ATOM   14   C C   . ALA A 1 7   ? 48.821  7.436   25.357  1.00 15.88 ? 11  ALA A C   1 
ATOM   15   O O   . ALA A 1 7   ? 48.333  8.487   24.948  1.00 15.87 ? 11  ALA A O   1 
ATOM   16   C CB  . ALA A 1 7   ? 47.793  5.994   27.145  1.00 15.69 ? 11  ALA A CB  1 
ATOM   17   N N   . GLU A 1 8   ? 50.133  7.253   25.534  1.00 16.15 ? 12  GLU A N   1 
ATOM   18   C CA  . GLU A 1 8   ? 51.147  8.260   25.176  1.00 16.27 ? 12  GLU A CA  1 
ATOM   19   C C   . GLU A 1 8   ? 50.935  8.779   23.760  1.00 16.18 ? 12  GLU A C   1 
ATOM   20   O O   . GLU A 1 8   ? 50.936  9.985   23.530  1.00 16.16 ? 12  GLU A O   1 
ATOM   21   C CB  . GLU A 1 8   ? 52.555  7.679   25.325  1.00 16.39 ? 12  GLU A CB  1 
ATOM   22   C CG  . GLU A 1 8   ? 52.887  7.212   26.733  1.00 17.44 ? 12  GLU A CG  1 
ATOM   23   C CD  . GLU A 1 8   ? 54.288  6.644   26.842  1.00 20.00 ? 12  GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 8   ? 55.000  6.615   25.816  1.00 20.00 ? 12  GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 8   ? 54.675  6.227   27.954  1.00 20.00 ? 12  GLU A OE2 1 
ATOM   26   N N   . GLN A 1 9   ? 50.753  7.853   22.822  1.00 16.15 ? 13  GLN A N   1 
ATOM   27   C CA  . GLN A 1 9   ? 50.745  8.164   21.396  1.00 16.17 ? 13  GLN A CA  1 
ATOM   28   C C   . GLN A 1 9   ? 49.564  9.012   20.928  1.00 16.17 ? 13  GLN A C   1 
ATOM   29   O O   . GLN A 1 9   ? 49.740  9.860   20.056  1.00 16.47 ? 13  GLN A O   1 
ATOM   30   C CB  . GLN A 1 9   ? 50.820  6.887   20.557  1.00 16.25 ? 13  GLN A CB  1 
ATOM   31   C CG  . GLN A 1 9   ? 52.177  6.200   20.562  1.00 16.28 ? 13  GLN A CG  1 
ATOM   32   C CD  . GLN A 1 9   ? 52.099  4.790   20.004  1.00 16.52 ? 13  GLN A CD  1 
ATOM   33   O OE1 . GLN A 1 9   ? 51.644  4.585   18.875  1.00 17.27 ? 13  GLN A OE1 1 
ATOM   34   N NE2 . GLN A 1 9   ? 52.532  3.815   20.793  1.00 16.27 ? 13  GLN A NE2 1 
ATOM   35   N N   . VAL A 1 10  ? 48.369  8.779   21.473  1.00 15.91 ? 14  VAL A N   1 
ATOM   36   C CA  . VAL A 1 10  ? 47.180  9.512   21.004  1.00 15.78 ? 14  VAL A CA  1 
ATOM   37   C C   . VAL A 1 10  ? 46.615  10.522  22.012  1.00 15.66 ? 14  VAL A C   1 
ATOM   38   O O   . VAL A 1 10  ? 45.598  11.174  21.727  1.00 15.64 ? 14  VAL A O   1 
ATOM   39   C CB  . VAL A 1 10  ? 46.038  8.574   20.516  1.00 15.75 ? 14  VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 10  ? 46.454  7.790   19.269  1.00 15.86 ? 14  VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 10  ? 45.600  7.641   21.623  1.00 16.12 ? 14  VAL A CG2 1 
ATOM   42   N N   . ASN A 1 11  ? 47.270  10.648  23.172  1.00 15.34 ? 15  ASN A N   1 
ATOM   43   C CA  . ASN A 1 11  ? 46.834  11.552  24.243  1.00 14.96 ? 15  ASN A CA  1 
ATOM   44   C C   . ASN A 1 11  ? 45.484  11.109  24.857  1.00 14.61 ? 15  ASN A C   1 
ATOM   45   O O   . ASN A 1 11  ? 44.635  11.940  25.184  1.00 14.54 ? 15  ASN A O   1 
ATOM   46   C CB  . ASN A 1 11  ? 46.772  12.996  23.704  1.00 15.12 ? 15  ASN A CB  1 
ATOM   47   C CG  . ASN A 1 11  ? 46.819  14.055  24.799  1.00 15.69 ? 15  ASN A CG  1 
ATOM   48   O OD1 . ASN A 1 11  ? 47.461  15.095  24.635  1.00 16.49 ? 15  ASN A OD1 1 
ATOM   49   N ND2 . ASN A 1 11  ? 46.128  13.810  25.905  1.00 16.35 ? 15  ASN A ND2 1 
ATOM   50   N N   . LYS A 1 12  ? 45.297  9.800   25.011  1.00 14.16 ? 16  LYS A N   1 
ATOM   51   C CA  . LYS A 1 12  ? 44.044  9.233   25.520  1.00 14.03 ? 16  LYS A CA  1 
ATOM   52   C C   . LYS A 1 12  ? 42.801  9.721   24.742  1.00 14.14 ? 16  LYS A C   1 
ATOM   53   O O   . LYS A 1 12  ? 41.805  10.158  25.340  1.00 14.29 ? 16  LYS A O   1 
ATOM   54   C CB  . LYS A 1 12  ? 43.888  9.507   27.022  1.00 13.94 ? 16  LYS A CB  1 
ATOM   55   C CG  . LYS A 1 12  ? 44.922  8.827   27.910  1.00 14.16 ? 16  LYS A CG  1 
ATOM   56   C CD  . LYS A 1 12  ? 44.741  9.233   29.366  1.00 14.17 ? 16  LYS A CD  1 
ATOM   57   C CE  . LYS A 1 12  ? 45.838  8.665   30.231  1.00 14.72 ? 16  LYS A CE  1 
ATOM   58   N NZ  . LYS A 1 12  ? 45.785  9.249   31.595  1.00 15.48 ? 16  LYS A NZ  1 
ATOM   59   N N   . THR A 1 13  ? 42.860  9.626   23.412  1.00 13.91 ? 17  THR A N   1 
ATOM   60   C CA  . THR A 1 13  ? 41.817  10.169  22.543  1.00 13.41 ? 17  THR A CA  1 
ATOM   61   C C   . THR A 1 13  ? 41.404  9.194   21.450  1.00 13.29 ? 17  THR A C   1 
ATOM   62   O O   . THR A 1 13  ? 42.242  8.703   20.688  1.00 13.44 ? 17  THR A O   1 
ATOM   63   C CB  . THR A 1 13  ? 42.294  11.480  21.890  1.00 13.43 ? 17  THR A CB  1 
ATOM   64   O OG1 . THR A 1 13  ? 42.812  12.355  22.898  1.00 13.22 ? 17  THR A OG1 1 
ATOM   65   C CG2 . THR A 1 13  ? 41.121  12.261  21.294  1.00 12.90 ? 17  THR A CG2 1 
ATOM   66   N N   . ILE A 1 14  ? 40.103  8.931   21.379  1.00 12.81 ? 18  ILE A N   1 
ATOM   67   C CA  . ILE A 1 14  ? 39.521  8.156   20.301  1.00 12.22 ? 18  ILE A CA  1 
ATOM   68   C C   . ILE A 1 14  ? 38.716  9.114   19.450  1.00 11.98 ? 18  ILE A C   1 
ATOM   69   O O   . ILE A 1 14  ? 37.917  9.882   19.977  1.00 11.84 ? 18  ILE A O   1 
ATOM   70   C CB  . ILE A 1 14  ? 38.620  7.043   20.865  1.00 12.20 ? 18  ILE A CB  1 
ATOM   71   C CG1 . ILE A 1 14  ? 39.441  6.099   21.747  1.00 11.71 ? 18  ILE A CG1 1 
ATOM   72   C CG2 . ILE A 1 14  ? 37.938  6.254   19.734  1.00 12.50 ? 18  ILE A CG2 1 
ATOM   73   C CD1 . ILE A 1 14  ? 38.614  5.256   22.705  1.00 10.95 ? 18  ILE A CD1 1 
ATOM   74   N N   . ILE A 1 15  ? 38.941  9.082   18.141  1.00 11.90 ? 19  ILE A N   1 
ATOM   75   C CA  . ILE A 1 15  ? 38.153  9.881   17.204  1.00 11.98 ? 19  ILE A CA  1 
ATOM   76   C C   . ILE A 1 15  ? 36.979  9.051   16.699  1.00 12.12 ? 19  ILE A C   1 
ATOM   77   O O   . ILE A 1 15  ? 37.168  8.048   16.021  1.00 12.25 ? 19  ILE A O   1 
ATOM   78   C CB  . ILE A 1 15  ? 39.032  10.395  16.011  1.00 12.06 ? 19  ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 15  ? 40.327  11.073  16.509  1.00 10.81 ? 19  ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 15  ? 38.200  11.268  15.031  1.00 11.52 ? 19  ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 15  ? 40.136  12.376  17.226  1.00 9.62  ? 19  ILE A CD1 1 
ATOM   82   N N   . GLY A 1 16  ? 35.769  9.466   17.042  1.00 12.40 ? 20  GLY A N   1 
ATOM   83   C CA  . GLY A 1 16  ? 34.570  8.753   16.612  1.00 12.95 ? 20  GLY A CA  1 
ATOM   84   C C   . GLY A 1 16  ? 33.742  9.483   15.571  1.00 13.27 ? 20  GLY A C   1 
ATOM   85   O O   . GLY A 1 16  ? 34.189  10.468  14.974  1.00 12.99 ? 20  GLY A O   1 
ATOM   86   N N   . ILE A 1 17  ? 32.529  8.977   15.350  1.00 13.88 ? 21  ILE A N   1 
ATOM   87   C CA  . ILE A 1 17  ? 31.582  9.583   14.414  1.00 14.32 ? 21  ILE A CA  1 
ATOM   88   C C   . ILE A 1 17  ? 30.422  10.247  15.163  1.00 14.74 ? 21  ILE A C   1 
ATOM   89   O O   . ILE A 1 17  ? 30.623  10.762  16.263  1.00 15.05 ? 21  ILE A O   1 
ATOM   90   C CB  . ILE A 1 17  ? 31.107  8.569   13.345  1.00 14.19 ? 21  ILE A CB  1 
ATOM   91   C CG1 . ILE A 1 17  ? 30.578  7.279   13.972  1.00 14.48 ? 21  ILE A CG1 1 
ATOM   92   C CG2 . ILE A 1 17  ? 32.233  8.246   12.393  1.00 14.34 ? 21  ILE A CG2 1 
ATOM   93   C CD1 . ILE A 1 17  ? 29.605  6.523   13.062  1.00 14.63 ? 21  ILE A CD1 1 
ATOM   94   N N   . ASP A 1 18  ? 29.222  10.249  14.587  1.00 15.20 ? 22  ASP A N   1 
ATOM   95   C CA  . ASP A 1 18  ? 28.115  11.013  15.175  1.00 15.77 ? 22  ASP A CA  1 
ATOM   96   C C   . ASP A 1 18  ? 27.535  10.394  16.449  1.00 16.00 ? 22  ASP A C   1 
ATOM   97   O O   . ASP A 1 18  ? 27.390  9.171   16.530  1.00 16.11 ? 22  ASP A O   1 
ATOM   98   C CB  . ASP A 1 18  ? 27.019  11.372  14.149  1.00 15.85 ? 22  ASP A CB  1 
ATOM   99   C CG  . ASP A 1 18  ? 26.996  10.453  12.946  1.00 16.15 ? 22  ASP A CG  1 
ATOM   100  O OD1 . ASP A 1 18  ? 27.991  10.397  12.189  1.00 15.73 ? 22  ASP A OD1 1 
ATOM   101  O OD2 . ASP A 1 18  ? 25.986  9.781   12.658  1.00 17.78 ? 22  ASP A OD2 1 
ATOM   102  N N   . PRO A 1 19  ? 27.223  11.241  17.442  1.00 16.18 ? 23  PRO A N   1 
ATOM   103  C CA  . PRO A 1 19  ? 26.830  10.776  18.785  1.00 16.30 ? 23  PRO A CA  1 
ATOM   104  C C   . PRO A 1 19  ? 25.616  9.834   18.857  1.00 16.52 ? 23  PRO A C   1 
ATOM   105  O O   . PRO A 1 19  ? 25.591  8.945   19.720  1.00 16.72 ? 23  PRO A O   1 
ATOM   106  C CB  . PRO A 1 19  ? 26.560  12.080  19.552  1.00 16.15 ? 23  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 19  ? 26.403  13.121  18.517  1.00 16.09 ? 23  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 19  ? 27.251  12.714  17.362  1.00 15.98 ? 23  PRO A CD  1 
ATOM   109  N N   . GLY A 1 20  ? 24.637  10.004  17.966  1.00 16.53 ? 24  GLY A N   1 
ATOM   110  C CA  . GLY A 1 20  ? 23.428  9.179   18.007  1.00 16.68 ? 24  GLY A CA  1 
ATOM   111  C C   . GLY A 1 20  ? 23.567  7.812   17.348  1.00 17.01 ? 24  GLY A C   1 
ATOM   112  O O   . GLY A 1 20  ? 22.564  7.145   17.072  1.00 17.26 ? 24  GLY A O   1 
ATOM   113  N N   . SER A 1 21  ? 24.799  7.375   17.093  1.00 16.88 ? 25  SER A N   1 
ATOM   114  C CA  . SER A 1 21  ? 25.008  6.168   16.288  1.00 16.73 ? 25  SER A CA  1 
ATOM   115  C C   . SER A 1 21  ? 25.285  4.921   17.127  1.00 16.50 ? 25  SER A C   1 
ATOM   116  O O   . SER A 1 21  ? 25.691  5.018   18.293  1.00 16.43 ? 25  SER A O   1 
ATOM   117  C CB  . SER A 1 21  ? 26.106  6.393   15.236  1.00 16.74 ? 25  SER A CB  1 
ATOM   118  O OG  . SER A 1 21  ? 27.339  6.727   15.848  1.00 16.92 ? 25  SER A OG  1 
ATOM   119  N N   . GLY A 1 22  ? 25.056  3.758   16.513  1.00 16.20 ? 26  GLY A N   1 
ATOM   120  C CA  . GLY A 1 22  ? 25.189  2.461   17.175  1.00 15.98 ? 26  GLY A CA  1 
ATOM   121  C C   . GLY A 1 22  ? 26.608  2.163   17.619  1.00 15.85 ? 26  GLY A C   1 
ATOM   122  O O   . GLY A 1 22  ? 26.837  1.680   18.733  1.00 15.82 ? 26  GLY A O   1 
ATOM   123  N N   . ILE A 1 23  ? 27.565  2.467   16.750  1.00 15.54 ? 27  ILE A N   1 
ATOM   124  C CA  . ILE A 1 23  ? 28.973  2.264   17.058  1.00 15.25 ? 27  ILE A CA  1 
ATOM   125  C C   . ILE A 1 23  ? 29.441  3.137   18.226  1.00 15.04 ? 27  ILE A C   1 
ATOM   126  O O   . ILE A 1 23  ? 30.392  2.794   18.923  1.00 15.10 ? 27  ILE A O   1 
ATOM   127  C CB  . ILE A 1 23  ? 29.837  2.491   15.794  1.00 15.27 ? 27  ILE A CB  1 
ATOM   128  C CG1 . ILE A 1 23  ? 31.276  2.015   16.021  1.00 15.32 ? 27  ILE A CG1 1 
ATOM   129  C CG2 . ILE A 1 23  ? 29.789  3.943   15.350  1.00 15.36 ? 27  ILE A CG2 1 
ATOM   130  C CD1 . ILE A 1 23  ? 32.008  1.622   14.745  1.00 16.11 ? 27  ILE A CD1 1 
ATOM   131  N N   . MET A 1 24  ? 28.761  4.255   18.447  1.00 14.83 ? 28  MET A N   1 
ATOM   132  C CA  . MET A 1 24  ? 29.161  5.172   19.503  1.00 14.64 ? 28  MET A CA  1 
ATOM   133  C C   . MET A 1 24  ? 28.674  4.724   20.878  1.00 14.64 ? 28  MET A C   1 
ATOM   134  O O   . MET A 1 24  ? 29.373  4.909   21.876  1.00 14.46 ? 28  MET A O   1 
ATOM   135  C CB  . MET A 1 24  ? 28.711  6.594   19.174  1.00 14.76 ? 28  MET A CB  1 
ATOM   136  C CG  . MET A 1 24  ? 29.521  7.233   18.054  1.00 14.15 ? 28  MET A CG  1 
ATOM   137  S SD  . MET A 1 24  ? 31.214  7.543   18.572  1.00 13.71 ? 28  MET A SD  1 
ATOM   138  C CE  . MET A 1 24  ? 31.012  9.111   19.409  1.00 13.42 ? 28  MET A CE  1 
ATOM   139  N N   . SER A 1 25  ? 27.483  4.126   20.918  1.00 14.73 ? 29  SER A N   1 
ATOM   140  C CA  . SER A 1 25  ? 26.968  3.480   22.127  1.00 14.66 ? 29  SER A CA  1 
ATOM   141  C C   . SER A 1 25  ? 27.861  2.311   22.464  1.00 14.74 ? 29  SER A C   1 
ATOM   142  O O   . SER A 1 25  ? 28.337  2.179   23.594  1.00 14.69 ? 29  SER A O   1 
ATOM   143  C CB  . SER A 1 25  ? 25.544  2.976   21.913  1.00 14.48 ? 29  SER A CB  1 
ATOM   144  O OG  . SER A 1 25  ? 24.632  4.055   21.905  1.00 15.16 ? 29  SER A OG  1 
ATOM   145  N N   . LEU A 1 26  ? 28.089  1.466   21.464  1.00 14.81 ? 30  LEU A N   1 
ATOM   146  C CA  . LEU A 1 26  ? 28.966  0.316   21.605  1.00 14.93 ? 30  LEU A CA  1 
ATOM   147  C C   . LEU A 1 26  ? 30.357  0.695   22.123  1.00 14.89 ? 30  LEU A C   1 
ATOM   148  O O   . LEU A 1 26  ? 30.917  -0.020  22.954  1.00 14.70 ? 30  LEU A O   1 
ATOM   149  C CB  . LEU A 1 26  ? 29.060  -0.451  20.282  1.00 15.08 ? 30  LEU A CB  1 
ATOM   150  C CG  . LEU A 1 26  ? 27.861  -1.324  19.870  1.00 15.61 ? 30  LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 26  ? 28.030  -1.825  18.443  1.00 16.90 ? 30  LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 26  ? 27.640  -2.503  20.810  1.00 15.49 ? 30  LEU A CD2 1 
ATOM   153  N N   . THR A 1 27  ? 30.895  1.818   21.640  1.00 15.01 ? 31  THR A N   1 
ATOM   154  C CA  . THR A 1 27  ? 32.187  2.335   22.104  1.00 15.29 ? 31  THR A CA  1 
ATOM   155  C C   . THR A 1 27  ? 32.134  2.780   23.571  1.00 15.64 ? 31  THR A C   1 
ATOM   156  O O   . THR A 1 27  ? 33.054  2.509   24.350  1.00 15.37 ? 31  THR A O   1 
ATOM   157  C CB  . THR A 1 27  ? 32.669  3.477   21.208  1.00 15.15 ? 31  THR A CB  1 
ATOM   158  O OG1 . THR A 1 27  ? 32.857  2.984   19.876  1.00 15.05 ? 31  THR A OG1 1 
ATOM   159  C CG2 . THR A 1 27  ? 34.061  3.913   21.617  1.00 14.74 ? 31  THR A CG2 1 
ATOM   160  N N   . ASP A 1 28  ? 31.047  3.457   23.931  1.00 16.23 ? 32  ASP A N   1 
ATOM   161  C CA  . ASP A 1 28  ? 30.758  3.821   25.317  1.00 16.68 ? 32  ASP A CA  1 
ATOM   162  C C   . ASP A 1 28  ? 30.871  2.584   26.205  1.00 16.77 ? 32  ASP A C   1 
ATOM   163  O O   . ASP A 1 28  ? 31.522  2.632   27.254  1.00 16.94 ? 32  ASP A O   1 
ATOM   164  C CB  . ASP A 1 28  ? 29.341  4.384   25.426  1.00 16.87 ? 32  ASP A CB  1 
ATOM   165  C CG  . ASP A 1 28  ? 29.282  5.659   26.214  1.00 17.75 ? 32  ASP A CG  1 
ATOM   166  O OD1 . ASP A 1 28  ? 29.839  5.708   27.333  1.00 18.12 ? 32  ASP A OD1 1 
ATOM   167  O OD2 . ASP A 1 28  ? 28.692  6.674   25.779  1.00 19.52 ? 32  ASP A OD2 1 
ATOM   168  N N   . LYS A 1 29  ? 30.238  1.485   25.778  1.00 16.64 ? 33  LYS A N   1 
ATOM   169  C CA  . LYS A 1 29  ? 30.302  0.227   26.515  1.00 16.52 ? 33  LYS A CA  1 
ATOM   170  C C   . LYS A 1 29  ? 31.739  -0.279  26.564  1.00 16.25 ? 33  LYS A C   1 
ATOM   171  O O   . LYS A 1 29  ? 32.187  -0.765  27.605  1.00 16.18 ? 33  LYS A O   1 
ATOM   172  C CB  . LYS A 1 29  ? 29.380  -0.838  25.908  1.00 16.44 ? 33  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 29  ? 29.343  -2.155  26.709  1.00 16.92 ? 33  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 29  ? 28.670  -3.295  25.957  1.00 17.20 ? 33  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 29  ? 27.160  -3.337  26.204  1.00 19.34 ? 33  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 29  ? 26.404  -3.773  24.981  1.00 20.75 ? 33  LYS A NZ  1 
ATOM   177  N N   . ALA A 1 30  ? 32.458  -0.146  25.446  1.00 15.99 ? 34  ALA A N   1 
ATOM   178  C CA  . ALA A 1 30  ? 33.849  -0.602  25.356  1.00 15.81 ? 34  ALA A CA  1 
ATOM   179  C C   . ALA A 1 30  ? 34.731  0.126   26.368  1.00 15.89 ? 34  ALA A C   1 
ATOM   180  O O   . ALA A 1 30  ? 35.366  -0.507  27.216  1.00 15.71 ? 34  ALA A O   1 
ATOM   181  C CB  . ALA A 1 30  ? 34.386  -0.431  23.953  1.00 15.51 ? 34  ALA A CB  1 
ATOM   182  N N   . MET A 1 31  ? 34.741  1.456   26.290  1.00 16.03 ? 35  MET A N   1 
ATOM   183  C CA  . MET A 1 31  ? 35.484  2.283   27.235  1.00 16.18 ? 35  MET A CA  1 
ATOM   184  C C   . MET A 1 31  ? 35.164  1.898   28.683  1.00 16.27 ? 35  MET A C   1 
ATOM   185  O O   . MET A 1 31  ? 36.055  1.859   29.536  1.00 16.49 ? 35  MET A O   1 
ATOM   186  C CB  . MET A 1 31  ? 35.197  3.761   26.982  1.00 16.03 ? 35  MET A CB  1 
ATOM   187  C CG  . MET A 1 31  ? 35.392  4.173   25.529  1.00 16.00 ? 35  MET A CG  1 
ATOM   188  S SD  . MET A 1 31  ? 35.714  5.938   25.301  1.00 16.77 ? 35  MET A SD  1 
ATOM   189  C CE  . MET A 1 31  ? 34.208  6.686   25.962  1.00 16.86 ? 35  MET A CE  1 
ATOM   190  N N   . LYS A 1 32  ? 33.895  1.594   28.944  1.00 16.22 ? 36  LYS A N   1 
ATOM   191  C CA  . LYS A 1 32  ? 33.463  1.139   30.262  1.00 16.39 ? 36  LYS A CA  1 
ATOM   192  C C   . LYS A 1 32  ? 33.958  -0.279  30.598  1.00 16.08 ? 36  LYS A C   1 
ATOM   193  O O   . LYS A 1 32  ? 34.275  -0.565  31.757  1.00 16.19 ? 36  LYS A O   1 
ATOM   194  C CB  . LYS A 1 32  ? 31.937  1.202   30.384  1.00 16.38 ? 36  LYS A CB  1 
ATOM   195  C CG  . LYS A 1 32  ? 31.336  2.610   30.455  1.00 17.16 ? 36  LYS A CG  1 
ATOM   196  C CD  . LYS A 1 32  ? 29.814  2.537   30.705  1.00 17.69 ? 36  LYS A CD  1 
ATOM   197  C CE  . LYS A 1 32  ? 29.114  3.868   30.436  1.00 18.99 ? 36  LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 32  ? 28.740  3.996   29.003  1.00 20.05 ? 36  LYS A NZ  1 
ATOM   199  N N   . ASP A 1 33  ? 34.022  -1.161  29.597  1.00 15.78 ? 37  ASP A N   1 
ATOM   200  C CA  . ASP A 1 33  ? 34.395  -2.574  29.821  1.00 15.45 ? 37  ASP A CA  1 
ATOM   201  C C   . ASP A 1 33  ? 35.894  -2.783  30.067  1.00 15.28 ? 37  ASP A C   1 
ATOM   202  O O   . ASP A 1 33  ? 36.304  -3.742  30.724  1.00 14.97 ? 37  ASP A O   1 
ATOM   203  C CB  . ASP A 1 33  ? 33.962  -3.450  28.636  1.00 15.38 ? 37  ASP A CB  1 
ATOM   204  C CG  . ASP A 1 33  ? 32.469  -3.748  28.626  1.00 15.41 ? 37  ASP A CG  1 
ATOM   205  O OD1 . ASP A 1 33  ? 31.841  -3.800  29.713  1.00 15.35 ? 37  ASP A OD1 1 
ATOM   206  O OD2 . ASP A 1 33  ? 31.841  -3.960  27.561  1.00 15.47 ? 37  ASP A OD2 1 
ATOM   207  N N   . TYR A 1 34  ? 36.703  -1.887  29.517  1.00 15.23 ? 38  TYR A N   1 
ATOM   208  C CA  . TYR A 1 34  ? 38.150  -2.020  29.553  1.00 15.24 ? 38  TYR A CA  1 
ATOM   209  C C   . TYR A 1 34  ? 38.771  -1.011  30.514  1.00 15.60 ? 38  TYR A C   1 
ATOM   210  O O   . TYR A 1 34  ? 39.991  -0.829  30.517  1.00 15.57 ? 38  TYR A O   1 
ATOM   211  C CB  . TYR A 1 34  ? 38.723  -1.846  28.143  1.00 14.91 ? 38  TYR A CB  1 
ATOM   212  C CG  . TYR A 1 34  ? 38.451  -3.009  27.201  1.00 14.98 ? 38  TYR A CG  1 
ATOM   213  C CD1 . TYR A 1 34  ? 37.249  -3.100  26.490  1.00 14.88 ? 38  TYR A CD1 1 
ATOM   214  C CD2 . TYR A 1 34  ? 39.400  -4.023  27.017  1.00 14.82 ? 38  TYR A CD2 1 
ATOM   215  C CE1 . TYR A 1 34  ? 37.000  -4.172  25.626  1.00 14.27 ? 38  TYR A CE1 1 
ATOM   216  C CE2 . TYR A 1 34  ? 39.155  -5.098  26.152  1.00 14.31 ? 38  TYR A CE2 1 
ATOM   217  C CZ  . TYR A 1 34  ? 37.956  -5.157  25.463  1.00 14.32 ? 38  TYR A CZ  1 
ATOM   218  O OH  . TYR A 1 34  ? 37.713  -6.201  24.610  1.00 14.35 ? 38  TYR A OH  1 
ATOM   219  N N   . ASP A 1 35  ? 37.923  -0.373  31.327  1.00 16.02 ? 39  ASP A N   1 
ATOM   220  C CA  . ASP A 1 35  ? 38.334  0.662   32.293  1.00 16.45 ? 39  ASP A CA  1 
ATOM   221  C C   . ASP A 1 35  ? 39.150  1.767   31.635  1.00 16.46 ? 39  ASP A C   1 
ATOM   222  O O   . ASP A 1 35  ? 40.318  1.993   31.982  1.00 16.55 ? 39  ASP A O   1 
ATOM   223  C CB  . ASP A 1 35  ? 39.100  0.064   33.492  1.00 16.50 ? 39  ASP A CB  1 
ATOM   224  C CG  . ASP A 1 35  ? 38.227  -0.828  34.365  1.00 17.44 ? 39  ASP A CG  1 
ATOM   225  O OD1 . ASP A 1 35  ? 38.668  -1.146  35.486  1.00 19.27 ? 39  ASP A OD1 1 
ATOM   226  O OD2 . ASP A 1 35  ? 37.097  -1.265  34.032  1.00 17.63 ? 39  ASP A OD2 1 
ATOM   227  N N   . LEU A 1 36  ? 38.521  2.447   30.681  1.00 16.50 ? 40  LEU A N   1 
ATOM   228  C CA  . LEU A 1 36  ? 39.159  3.543   29.940  1.00 16.53 ? 40  LEU A CA  1 
ATOM   229  C C   . LEU A 1 36  ? 38.516  4.899   30.272  1.00 16.69 ? 40  LEU A C   1 
ATOM   230  O O   . LEU A 1 36  ? 38.459  5.798   29.429  1.00 16.67 ? 40  LEU A O   1 
ATOM   231  C CB  . LEU A 1 36  ? 39.093  3.269   28.426  1.00 16.24 ? 40  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 36  ? 39.862  2.055   27.893  1.00 15.87 ? 40  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 36  ? 39.493  1.783   26.454  1.00 15.20 ? 40  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 36  ? 41.375  2.220   28.039  1.00 15.17 ? 40  LEU A CD2 1 
ATOM   235  N N   . ASN A 1 37  ? 38.045  5.046   31.508  1.00 16.85 ? 41  ASN A N   1 
ATOM   236  C CA  . ASN A 1 37  ? 37.230  6.202   31.884  1.00 17.04 ? 41  ASN A CA  1 
ATOM   237  C C   . ASN A 1 37  ? 37.979  7.529   32.039  1.00 16.90 ? 41  ASN A C   1 
ATOM   238  O O   . ASN A 1 37  ? 37.372  8.547   32.393  1.00 17.07 ? 41  ASN A O   1 
ATOM   239  C CB  . ASN A 1 37  ? 36.370  5.887   33.116  1.00 17.23 ? 41  ASN A CB  1 
ATOM   240  C CG  . ASN A 1 37  ? 35.236  4.920   32.800  1.00 18.19 ? 41  ASN A CG  1 
ATOM   241  O OD1 . ASN A 1 37  ? 35.166  3.831   33.370  1.00 19.63 ? 41  ASN A OD1 1 
ATOM   242  N ND2 . ASN A 1 37  ? 34.355  5.306   31.869  1.00 18.45 ? 41  ASN A ND2 1 
ATOM   243  N N   . ASP A 1 38  ? 39.286  7.512   31.770  1.00 16.62 ? 42  ASP A N   1 
ATOM   244  C CA  . ASP A 1 38  ? 40.082  8.737   31.664  1.00 16.22 ? 42  ASP A CA  1 
ATOM   245  C C   . ASP A 1 38  ? 40.369  9.095   30.190  1.00 16.04 ? 42  ASP A C   1 
ATOM   246  O O   . ASP A 1 38  ? 41.004  10.113  29.893  1.00 16.05 ? 42  ASP A O   1 
ATOM   247  C CB  . ASP A 1 38  ? 41.369  8.621   32.488  1.00 16.07 ? 42  ASP A CB  1 
ATOM   248  C CG  . ASP A 1 38  ? 42.248  7.457   32.057  1.00 16.28 ? 42  ASP A CG  1 
ATOM   249  O OD1 . ASP A 1 38  ? 41.723  6.474   31.487  1.00 16.22 ? 42  ASP A OD1 1 
ATOM   250  O OD2 . ASP A 1 38  ? 43.484  7.436   32.256  1.00 16.67 ? 42  ASP A OD2 1 
ATOM   251  N N   . TRP A 1 39  ? 39.883  8.257   29.273  1.00 15.71 ? 43  TRP A N   1 
ATOM   252  C CA  . TRP A 1 39  ? 39.998  8.518   27.837  1.00 15.31 ? 43  TRP A CA  1 
ATOM   253  C C   . TRP A 1 39  ? 38.912  9.466   27.366  1.00 14.86 ? 43  TRP A C   1 
ATOM   254  O O   . TRP A 1 39  ? 37.878  9.607   28.016  1.00 14.70 ? 43  TRP A O   1 
ATOM   255  C CB  . TRP A 1 39  ? 39.962  7.211   27.026  1.00 15.40 ? 43  TRP A CB  1 
ATOM   256  C CG  . TRP A 1 39  ? 41.304  6.498   26.979  1.00 15.56 ? 43  TRP A CG  1 
ATOM   257  C CD1 . TRP A 1 39  ? 42.010  5.993   28.041  1.00 15.11 ? 43  TRP A CD1 1 
ATOM   258  C CD2 . TRP A 1 39  ? 42.092  6.225   25.814  1.00 15.61 ? 43  TRP A CD2 1 
ATOM   259  N NE1 . TRP A 1 39  ? 43.180  5.421   27.606  1.00 14.57 ? 43  TRP A NE1 1 
ATOM   260  C CE2 . TRP A 1 39  ? 43.260  5.549   26.245  1.00 15.00 ? 43  TRP A CE2 1 
ATOM   261  C CE3 . TRP A 1 39  ? 41.931  6.480   24.442  1.00 15.67 ? 43  TRP A CE3 1 
ATOM   262  C CZ2 . TRP A 1 39  ? 44.257  5.130   25.361  1.00 15.30 ? 43  TRP A CZ2 1 
ATOM   263  C CZ3 . TRP A 1 39  ? 42.921  6.066   23.562  1.00 15.36 ? 43  TRP A CZ3 1 
ATOM   264  C CH2 . TRP A 1 39  ? 44.073  5.397   24.027  1.00 15.79 ? 43  TRP A CH2 1 
ATOM   265  N N   . THR A 1 40  ? 39.169  10.123  26.239  1.00 14.57 ? 44  THR A N   1 
ATOM   266  C CA  . THR A 1 40  ? 38.192  10.999  25.591  1.00 14.11 ? 44  THR A CA  1 
ATOM   267  C C   . THR A 1 40  ? 37.744  10.399  24.273  1.00 13.96 ? 44  THR A C   1 
ATOM   268  O O   . THR A 1 40  ? 38.577  10.081  23.426  1.00 13.70 ? 44  THR A O   1 
ATOM   269  C CB  . THR A 1 40  ? 38.804  12.401  25.335  1.00 14.01 ? 44  THR A CB  1 
ATOM   270  O OG1 . THR A 1 40  ? 38.970  13.089  26.577  1.00 13.37 ? 44  THR A OG1 1 
ATOM   271  C CG2 . THR A 1 40  ? 37.831  13.297  24.572  1.00 13.60 ? 44  THR A CG2 1 
ATOM   272  N N   . LEU A 1 41  ? 36.432  10.243  24.115  1.00 14.09 ? 45  LEU A N   1 
ATOM   273  C CA  . LEU A 1 41  ? 35.838  9.880   22.822  1.00 14.20 ? 45  LEU A CA  1 
ATOM   274  C C   . LEU A 1 41  ? 35.291  11.125  22.132  1.00 14.34 ? 45  LEU A C   1 
ATOM   275  O O   . LEU A 1 41  ? 34.300  11.711  22.577  1.00 14.37 ? 45  LEU A O   1 
ATOM   276  C CB  . LEU A 1 41  ? 34.739  8.821   22.989  1.00 13.97 ? 45  LEU A CB  1 
ATOM   277  C CG  . LEU A 1 41  ? 33.875  8.424   21.782  1.00 14.14 ? 45  LEU A CG  1 
ATOM   278  C CD1 . LEU A 1 41  ? 34.663  7.683   20.715  1.00 13.93 ? 45  LEU A CD1 1 
ATOM   279  C CD2 . LEU A 1 41  ? 32.697  7.576   22.233  1.00 14.15 ? 45  LEU A CD2 1 
ATOM   280  N N   . ILE A 1 42  ? 35.959  11.539  21.061  1.00 14.62 ? 46  ILE A N   1 
ATOM   281  C CA  . ILE A 1 42  ? 35.490  12.659  20.251  1.00 14.85 ? 46  ILE A CA  1 
ATOM   282  C C   . ILE A 1 42  ? 34.331  12.193  19.371  1.00 15.10 ? 46  ILE A C   1 
ATOM   283  O O   . ILE A 1 42  ? 34.447  11.199  18.652  1.00 15.18 ? 46  ILE A O   1 
ATOM   284  C CB  . ILE A 1 42  ? 36.646  13.240  19.377  1.00 14.89 ? 46  ILE A CB  1 
ATOM   285  C CG1 . ILE A 1 42  ? 37.781  13.823  20.249  1.00 14.68 ? 46  ILE A CG1 1 
ATOM   286  C CG2 . ILE A 1 42  ? 36.112  14.243  18.348  1.00 14.32 ? 46  ILE A CG2 1 
ATOM   287  C CD1 . ILE A 1 42  ? 37.406  15.021  21.110  1.00 14.18 ? 46  ILE A CD1 1 
ATOM   288  N N   . SER A 1 43  ? 33.206  12.893  19.470  1.00 15.34 ? 47  SER A N   1 
ATOM   289  C CA  . SER A 1 43  ? 32.106  12.738  18.529  1.00 15.59 ? 47  SER A CA  1 
ATOM   290  C C   . SER A 1 43  ? 32.365  13.657  17.344  1.00 15.90 ? 47  SER A C   1 
ATOM   291  O O   . SER A 1 43  ? 32.843  14.781  17.508  1.00 15.99 ? 47  SER A O   1 
ATOM   292  C CB  . SER A 1 43  ? 30.782  13.132  19.181  1.00 15.47 ? 47  SER A CB  1 
ATOM   293  O OG  . SER A 1 43  ? 30.267  12.098  19.995  1.00 15.73 ? 47  SER A OG  1 
ATOM   294  N N   . ALA A 1 44  ? 32.055  13.177  16.148  1.00 16.26 ? 48  ALA A N   1 
ATOM   295  C CA  . ALA A 1 44  ? 32.200  13.985  14.945  1.00 16.57 ? 48  ALA A CA  1 
ATOM   296  C C   . ALA A 1 44  ? 31.125  13.587  13.929  1.00 16.77 ? 48  ALA A C   1 
ATOM   297  O O   . ALA A 1 44  ? 29.938  13.772  14.191  1.00 17.01 ? 48  ALA A O   1 
ATOM   298  C CB  . ALA A 1 44  ? 33.612  13.845  14.371  1.00 16.50 ? 48  ALA A CB  1 
ATOM   299  N N   . SER A 1 45  ? 31.540  13.056  12.781  1.00 16.92 ? 49  SER A N   1 
ATOM   300  C CA  . SER A 1 45  ? 30.635  12.490  11.781  1.00 17.13 ? 49  SER A CA  1 
ATOM   301  C C   . SER A 1 45  ? 31.486  11.650  10.842  1.00 17.36 ? 49  SER A C   1 
ATOM   302  O O   . SER A 1 45  ? 32.712  11.633  10.982  1.00 17.63 ? 49  SER A O   1 
ATOM   303  C CB  . SER A 1 45  ? 29.883  13.588  11.020  1.00 17.08 ? 49  SER A CB  1 
ATOM   304  O OG  . SER A 1 45  ? 30.769  14.544  10.461  1.00 17.36 ? 49  SER A OG  1 
ATOM   305  N N   . SER A 1 46  ? 30.860  10.934  9.910   1.00 17.49 ? 50  SER A N   1 
ATOM   306  C CA  . SER A 1 46  ? 31.622  10.156  8.936   1.00 17.60 ? 50  SER A CA  1 
ATOM   307  C C   . SER A 1 46  ? 32.573  11.055  8.164   1.00 17.50 ? 50  SER A C   1 
ATOM   308  O O   . SER A 1 46  ? 33.786  10.892  8.266   1.00 17.70 ? 50  SER A O   1 
ATOM   309  C CB  . SER A 1 46  ? 30.711  9.393   7.981   1.00 17.77 ? 50  SER A CB  1 
ATOM   310  O OG  . SER A 1 46  ? 30.886  8.000   8.160   1.00 18.71 ? 50  SER A OG  1 
ATOM   311  N N   . ALA A 1 47  ? 32.021  12.023  7.429   1.00 17.20 ? 51  ALA A N   1 
ATOM   312  C CA  . ALA A 1 47  ? 32.823  12.975  6.658   1.00 16.79 ? 51  ALA A CA  1 
ATOM   313  C C   . ALA A 1 47  ? 34.003  13.558  7.457   1.00 16.56 ? 51  ALA A C   1 
ATOM   314  O O   . ALA A 1 47  ? 35.133  13.572  6.971   1.00 16.73 ? 51  ALA A O   1 
ATOM   315  C CB  . ALA A 1 47  ? 31.938  14.082  6.087   1.00 16.59 ? 51  ALA A CB  1 
ATOM   316  N N   . ALA A 1 48  ? 33.736  13.999  8.687   1.00 16.36 ? 52  ALA A N   1 
ATOM   317  C CA  . ALA A 1 48  ? 34.734  14.661  9.547   1.00 16.10 ? 52  ALA A CA  1 
ATOM   318  C C   . ALA A 1 48  ? 35.841  13.740  10.058  1.00 15.94 ? 52  ALA A C   1 
ATOM   319  O O   . ALA A 1 48  ? 37.007  14.131  10.133  1.00 15.98 ? 52  ALA A O   1 
ATOM   320  C CB  . ALA A 1 48  ? 34.046  15.345  10.717  1.00 16.05 ? 52  ALA A CB  1 
ATOM   321  N N   . MET A 1 49  ? 35.464  12.520  10.417  1.00 15.73 ? 53  MET A N   1 
ATOM   322  C CA  . MET A 1 49  ? 36.396  11.542  10.949  1.00 15.48 ? 53  MET A CA  1 
ATOM   323  C C   . MET A 1 49  ? 37.329  11.008  9.850   1.00 15.55 ? 53  MET A C   1 
ATOM   324  O O   . MET A 1 49  ? 38.549  10.887  10.060  1.00 15.55 ? 53  MET A O   1 
ATOM   325  C CB  . MET A 1 49  ? 35.608  10.420  11.635  1.00 15.43 ? 53  MET A CB  1 
ATOM   326  C CG  . MET A 1 49  ? 36.439  9.306   12.255  1.00 14.98 ? 53  MET A CG  1 
ATOM   327  S SD  . MET A 1 49  ? 36.820  7.996   11.083  1.00 13.54 ? 53  MET A SD  1 
ATOM   328  C CE  . MET A 1 49  ? 35.333  7.000   11.110  1.00 13.90 ? 53  MET A CE  1 
ATOM   329  N N   . THR A 1 50  ? 36.759  10.706  8.680   1.00 15.32 ? 54  THR A N   1 
ATOM   330  C CA  . THR A 1 50  ? 37.537  10.193  7.547   1.00 15.05 ? 54  THR A CA  1 
ATOM   331  C C   . THR A 1 50  ? 38.531  11.230  7.031   1.00 14.96 ? 54  THR A C   1 
ATOM   332  O O   . THR A 1 50  ? 39.602  10.869  6.541   1.00 14.95 ? 54  THR A O   1 
ATOM   333  C CB  . THR A 1 50  ? 36.629  9.647   6.399   1.00 15.11 ? 54  THR A CB  1 
ATOM   334  O OG1 . THR A 1 50  ? 35.790  10.686  5.877   1.00 14.50 ? 54  THR A OG1 1 
ATOM   335  C CG2 . THR A 1 50  ? 35.644  8.601   6.933   1.00 14.99 ? 54  THR A CG2 1 
ATOM   336  N N   . ALA A 1 51  ? 38.169  12.508  7.161   1.00 14.79 ? 55  ALA A N   1 
ATOM   337  C CA  . ALA A 1 51  ? 39.068  13.627  6.881   1.00 14.75 ? 55  ALA A CA  1 
ATOM   338  C C   . ALA A 1 51  ? 40.207  13.712  7.906   1.00 15.05 ? 55  ALA A C   1 
ATOM   339  O O   . ALA A 1 51  ? 41.371  13.892  7.527   1.00 15.11 ? 55  ALA A O   1 
ATOM   340  C CB  . ALA A 1 51  ? 38.292  14.927  6.842   1.00 14.63 ? 55  ALA A CB  1 
ATOM   341  N N   . THR A 1 52  ? 39.873  13.578  9.196   1.00 15.18 ? 56  THR A N   1 
ATOM   342  C CA  . THR A 1 52  ? 40.879  13.557  10.271  1.00 15.22 ? 56  THR A CA  1 
ATOM   343  C C   . THR A 1 52  ? 41.801  12.348  10.133  1.00 15.35 ? 56  THR A C   1 
ATOM   344  O O   . THR A 1 52  ? 42.998  12.438  10.423  1.00 15.37 ? 56  THR A O   1 
ATOM   345  C CB  . THR A 1 52  ? 40.213  13.557  11.671  1.00 15.32 ? 56  THR A CB  1 
ATOM   346  O OG1 . THR A 1 52  ? 39.495  14.780  11.863  1.00 15.46 ? 56  THR A OG1 1 
ATOM   347  C CG2 . THR A 1 52  ? 41.262  13.595  12.790  1.00 14.66 ? 56  THR A CG2 1 
ATOM   348  N N   . LEU A 1 53  ? 41.232  11.222  9.699   1.00 15.36 ? 57  LEU A N   1 
ATOM   349  C CA  . LEU A 1 53  ? 42.017  10.028  9.382   1.00 15.27 ? 57  LEU A CA  1 
ATOM   350  C C   . LEU A 1 53  ? 43.021  10.299  8.254   1.00 15.38 ? 57  LEU A C   1 
ATOM   351  O O   . LEU A 1 53  ? 44.190  9.927   8.356   1.00 15.37 ? 57  LEU A O   1 
ATOM   352  C CB  . LEU A 1 53  ? 41.097  8.863   9.010   1.00 15.28 ? 57  LEU A CB  1 
ATOM   353  C CG  . LEU A 1 53  ? 41.739  7.538   8.571   1.00 15.08 ? 57  LEU A CG  1 
ATOM   354  C CD1 . LEU A 1 53  ? 42.684  6.940   9.628   1.00 14.80 ? 57  LEU A CD1 1 
ATOM   355  C CD2 . LEU A 1 53  ? 40.644  6.552   8.209   1.00 14.92 ? 57  LEU A CD2 1 
ATOM   356  N N   . LYS A 1 54  ? 42.560  10.960  7.194   1.00 15.51 ? 58  LYS A N   1 
ATOM   357  C CA  . LYS A 1 54  ? 43.423  11.313  6.071   1.00 15.68 ? 58  LYS A CA  1 
ATOM   358  C C   . LYS A 1 54  ? 44.644  12.158  6.492   1.00 15.98 ? 58  LYS A C   1 
ATOM   359  O O   . LYS A 1 54  ? 45.780  11.806  6.160   1.00 16.05 ? 58  LYS A O   1 
ATOM   360  C CB  . LYS A 1 54  ? 42.622  11.978  4.945   1.00 15.50 ? 58  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 54  ? 43.482  12.422  3.781   1.00 15.24 ? 58  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 54  ? 42.815  12.194  2.444   1.00 14.49 ? 58  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 54  ? 43.460  13.068  1.377   1.00 14.31 ? 58  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 54  ? 44.947  13.048  1.442   1.00 13.17 ? 58  LYS A NZ  1 
ATOM   365  N N   . LYS A 1 55  ? 44.405  13.250  7.225   1.00 16.18 ? 59  LYS A N   1 
ATOM   366  C CA  . LYS A 1 55  ? 45.486  14.090  7.770   1.00 16.40 ? 59  LYS A CA  1 
ATOM   367  C C   . LYS A 1 55  ? 46.553  13.287  8.524   1.00 16.21 ? 59  LYS A C   1 
ATOM   368  O O   . LYS A 1 55  ? 47.742  13.381  8.214   1.00 16.30 ? 59  LYS A O   1 
ATOM   369  C CB  . LYS A 1 55  ? 44.927  15.167  8.699   1.00 16.29 ? 59  LYS A CB  1 
ATOM   370  C CG  . LYS A 1 55  ? 44.679  16.513  8.036   1.00 17.21 ? 59  LYS A CG  1 
ATOM   371  C CD  . LYS A 1 55  ? 44.393  17.629  9.077   1.00 17.28 ? 59  LYS A CD  1 
ATOM   372  C CE  . LYS A 1 55  ? 42.965  17.549  9.674   1.00 18.00 ? 59  LYS A CE  1 
ATOM   373  N NZ  . LYS A 1 55  ? 41.885  17.782  8.655   1.00 17.42 ? 59  LYS A NZ  1 
ATOM   374  N N   . SER A 1 56  ? 46.112  12.494  9.501   1.00 15.98 ? 60  SER A N   1 
ATOM   375  C CA  . SER A 1 56  ? 47.003  11.725  10.364  1.00 15.59 ? 60  SER A CA  1 
ATOM   376  C C   . SER A 1 56  ? 47.755  10.605  9.642   1.00 15.42 ? 60  SER A C   1 
ATOM   377  O O   . SER A 1 56  ? 48.930  10.345  9.945   1.00 15.09 ? 60  SER A O   1 
ATOM   378  C CB  . SER A 1 56  ? 46.218  11.168  11.544  1.00 15.52 ? 60  SER A CB  1 
ATOM   379  O OG  . SER A 1 56  ? 45.648  12.232  12.281  1.00 16.02 ? 60  SER A OG  1 
ATOM   380  N N   . TYR A 1 57  ? 47.081  9.953   8.691   1.00 15.17 ? 61  TYR A N   1 
ATOM   381  C CA  . TYR A 1 57  ? 47.698  8.890   7.896   1.00 14.99 ? 61  TYR A CA  1 
ATOM   382  C C   . TYR A 1 57  ? 48.896  9.427   7.114   1.00 15.09 ? 61  TYR A C   1 
ATOM   383  O O   . TYR A 1 57  ? 49.999  8.884   7.211   1.00 15.14 ? 61  TYR A O   1 
ATOM   384  C CB  . TYR A 1 57  ? 46.680  8.274   6.942   1.00 14.74 ? 61  TYR A CB  1 
ATOM   385  C CG  . TYR A 1 57  ? 46.998  6.856   6.512   1.00 14.64 ? 61  TYR A CG  1 
ATOM   386  C CD1 . TYR A 1 57  ? 46.554  5.761   7.264   1.00 14.23 ? 61  TYR A CD1 1 
ATOM   387  C CD2 . TYR A 1 57  ? 47.721  6.603   5.342   1.00 14.47 ? 61  TYR A CD2 1 
ATOM   388  C CE1 . TYR A 1 57  ? 46.832  4.458   6.870   1.00 13.60 ? 61  TYR A CE1 1 
ATOM   389  C CE2 . TYR A 1 57  ? 48.005  5.301   4.939   1.00 13.91 ? 61  TYR A CE2 1 
ATOM   390  C CZ  . TYR A 1 57  ? 47.557  4.237   5.707   1.00 14.15 ? 61  TYR A CZ  1 
ATOM   391  O OH  . TYR A 1 57  ? 47.833  2.947   5.308   1.00 14.57 ? 61  TYR A OH  1 
ATOM   392  N N   . ASP A 1 58  ? 48.669  10.506  6.365   1.00 15.12 ? 62  ASP A N   1 
ATOM   393  C CA  . ASP A 1 58  ? 49.693  11.135  5.533   1.00 15.19 ? 62  ASP A CA  1 
ATOM   394  C C   . ASP A 1 58  ? 50.912  11.562  6.341   1.00 15.18 ? 62  ASP A C   1 
ATOM   395  O O   . ASP A 1 58  ? 52.050  11.427  5.889   1.00 15.07 ? 62  ASP A O   1 
ATOM   396  C CB  . ASP A 1 58  ? 49.120  12.356  4.810   1.00 15.38 ? 62  ASP A CB  1 
ATOM   397  C CG  . ASP A 1 58  ? 47.957  12.004  3.905   1.00 15.60 ? 62  ASP A CG  1 
ATOM   398  O OD1 . ASP A 1 58  ? 47.828  10.817  3.537   1.00 20.00 ? 62  ASP A OD1 1 
ATOM   399  O OD2 . ASP A 1 58  ? 47.173  12.915  3.563   1.00 20.00 ? 62  ASP A OD2 1 
ATOM   400  N N   . ARG A 1 59  ? 50.652  12.079  7.537   1.00 15.34 ? 63  ARG A N   1 
ATOM   401  C CA  . ARG A 1 59  ? 51.685  12.583  8.432   1.00 15.53 ? 63  ARG A CA  1 
ATOM   402  C C   . ARG A 1 59  ? 52.348  11.463  9.248   1.00 15.77 ? 63  ARG A C   1 
ATOM   403  O O   . ARG A 1 59  ? 53.338  11.705  9.949   1.00 15.65 ? 63  ARG A O   1 
ATOM   404  C CB  . ARG A 1 59  ? 51.079  13.637  9.370   1.00 15.51 ? 63  ARG A CB  1 
ATOM   405  C CG  . ARG A 1 59  ? 51.272  15.075  8.916   1.00 15.63 ? 63  ARG A CG  1 
ATOM   406  C CD  . ARG A 1 59  ? 50.114  16.000  9.244   1.00 15.98 ? 63  ARG A CD  1 
ATOM   407  N NE  . ARG A 1 59  ? 49.028  15.827  8.276   1.00 17.31 ? 63  ARG A NE  1 
ATOM   408  C CZ  . ARG A 1 59  ? 48.721  16.683  7.302   1.00 17.19 ? 63  ARG A CZ  1 
ATOM   409  N NH1 . ARG A 1 59  ? 49.392  17.821  7.149   1.00 17.61 ? 63  ARG A NH1 1 
ATOM   410  N NH2 . ARG A 1 59  ? 47.720  16.403  6.483   1.00 17.20 ? 63  ARG A NH2 1 
ATOM   411  N N   . LYS A 1 60  ? 51.802  10.245  9.139   1.00 15.95 ? 64  LYS A N   1 
ATOM   412  C CA  . LYS A 1 60  ? 52.170  9.104   9.997   1.00 16.05 ? 64  LYS A CA  1 
ATOM   413  C C   . LYS A 1 60  ? 52.004  9.473   11.472  1.00 16.01 ? 64  LYS A C   1 
ATOM   414  O O   . LYS A 1 60  ? 52.831  9.125   12.322  1.00 16.16 ? 64  LYS A O   1 
ATOM   415  C CB  . LYS A 1 60  ? 53.586  8.591   9.710   1.00 16.20 ? 64  LYS A CB  1 
ATOM   416  C CG  . LYS A 1 60  ? 53.858  8.220   8.258   1.00 17.04 ? 64  LYS A CG  1 
ATOM   417  C CD  . LYS A 1 60  ? 53.705  6.739   7.994   1.00 17.31 ? 64  LYS A CD  1 
ATOM   418  C CE  . LYS A 1 60  ? 54.301  6.402   6.639   1.00 17.42 ? 64  LYS A CE  1 
ATOM   419  N NZ  . LYS A 1 60  ? 54.353  4.941   6.406   1.00 17.43 ? 64  LYS A NZ  1 
ATOM   420  N N   . LYS A 1 61  ? 50.925  10.198  11.753  1.00 15.86 ? 65  LYS A N   1 
ATOM   421  C CA  . LYS A 1 61  ? 50.535  10.570  13.104  1.00 15.60 ? 65  LYS A CA  1 
ATOM   422  C C   . LYS A 1 61  ? 49.681  9.421   13.658  1.00 15.62 ? 65  LYS A C   1 
ATOM   423  O O   . LYS A 1 61  ? 48.769  8.947   12.965  1.00 15.69 ? 65  LYS A O   1 
ATOM   424  C CB  . LYS A 1 61  ? 49.740  11.874  13.057  1.00 15.44 ? 65  LYS A CB  1 
ATOM   425  C CG  . LYS A 1 61  ? 49.461  12.497  14.396  1.00 15.58 ? 65  LYS A CG  1 
ATOM   426  C CD  . LYS A 1 61  ? 48.925  13.901  14.251  1.00 15.44 ? 65  LYS A CD  1 
ATOM   427  C CE  . LYS A 1 61  ? 48.692  14.523  15.610  1.00 15.60 ? 65  LYS A CE  1 
ATOM   428  N NZ  . LYS A 1 61  ? 48.270  15.942  15.488  1.00 16.32 ? 65  LYS A NZ  1 
ATOM   429  N N   . PRO A 1 62  ? 49.984  8.938   14.870  1.00 15.46 ? 66  PRO A N   1 
ATOM   430  C CA  . PRO A 1 62  ? 49.174  7.873   15.481  1.00 15.33 ? 66  PRO A CA  1 
ATOM   431  C C   . PRO A 1 62  ? 47.733  8.327   15.736  1.00 15.12 ? 66  PRO A C   1 
ATOM   432  O O   . PRO A 1 62  ? 47.527  9.447   16.209  1.00 15.49 ? 66  PRO A O   1 
ATOM   433  C CB  . PRO A 1 62  ? 49.911  7.563   16.793  1.00 15.27 ? 66  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 62  ? 50.790  8.695   17.034  1.00 15.28 ? 66  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 62  ? 51.122  9.323   15.719  1.00 15.33 ? 66  PRO A CD  1 
ATOM   436  N N   . ILE A 1 63  ? 46.759  7.474   15.404  1.00 14.61 ? 67  ILE A N   1 
ATOM   437  C CA  . ILE A 1 63  ? 45.322  7.786   15.541  1.00 13.90 ? 67  ILE A CA  1 
ATOM   438  C C   . ILE A 1 63  ? 44.507  6.520   15.860  1.00 13.79 ? 67  ILE A C   1 
ATOM   439  O O   . ILE A 1 63  ? 44.821  5.437   15.361  1.00 13.80 ? 67  ILE A O   1 
ATOM   440  C CB  . ILE A 1 63  ? 44.774  8.491   14.243  1.00 13.99 ? 67  ILE A CB  1 
ATOM   441  C CG1 . ILE A 1 63  ? 43.281  8.841   14.378  1.00 13.35 ? 67  ILE A CG1 1 
ATOM   442  C CG2 . ILE A 1 63  ? 45.038  7.629   12.990  1.00 13.65 ? 67  ILE A CG2 1 
ATOM   443  C CD1 . ILE A 1 63  ? 42.712  9.675   13.249  1.00 13.29 ? 67  ILE A CD1 1 
ATOM   444  N N   . ILE A 1 64  ? 43.469  6.662   16.686  1.00 13.38 ? 68  ILE A N   1 
ATOM   445  C CA  . ILE A 1 64  ? 42.529  5.571   16.967  1.00 12.97 ? 68  ILE A CA  1 
ATOM   446  C C   . ILE A 1 64  ? 41.112  6.009   16.620  1.00 13.18 ? 68  ILE A C   1 
ATOM   447  O O   . ILE A 1 64  ? 40.521  6.816   17.328  1.00 13.23 ? 68  ILE A O   1 
ATOM   448  C CB  . ILE A 1 64  ? 42.586  5.141   18.468  1.00 13.01 ? 68  ILE A CB  1 
ATOM   449  C CG1 . ILE A 1 64  ? 44.021  4.775   18.897  1.00 12.78 ? 68  ILE A CG1 1 
ATOM   450  C CG2 . ILE A 1 64  ? 41.597  4.002   18.737  1.00 12.42 ? 68  ILE A CG2 1 
ATOM   451  C CD1 . ILE A 1 64  ? 44.218  4.546   20.381  1.00 12.42 ? 68  ILE A CD1 1 
ATOM   452  N N   . ILE A 1 65  ? 40.562  5.477   15.537  1.00 13.46 ? 69  ILE A N   1 
ATOM   453  C CA  . ILE A 1 65  ? 39.184  5.810   15.152  1.00 13.79 ? 69  ILE A CA  1 
ATOM   454  C C   . ILE A 1 65  ? 38.203  4.742   15.616  1.00 14.08 ? 69  ILE A C   1 
ATOM   455  O O   . ILE A 1 65  ? 38.607  3.710   16.148  1.00 14.16 ? 69  ILE A O   1 
ATOM   456  C CB  . ILE A 1 65  ? 39.043  6.026   13.611  1.00 13.72 ? 69  ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 65  ? 39.433  4.759   12.840  1.00 13.42 ? 69  ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 65  ? 39.850  7.240   13.159  1.00 13.54 ? 69  ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 65  ? 38.834  4.655   11.462  1.00 13.52 ? 69  ILE A CD1 1 
ATOM   460  N N   . THR A 1 66  ? 36.915  5.016   15.426  1.00 14.46 ? 70  THR A N   1 
ATOM   461  C CA  . THR A 1 66  ? 35.879  3.980   15.432  1.00 14.56 ? 70  THR A CA  1 
ATOM   462  C C   . THR A 1 66  ? 35.591  3.587   13.987  1.00 14.68 ? 70  THR A C   1 
ATOM   463  O O   . THR A 1 66  ? 34.990  4.365   13.236  1.00 14.77 ? 70  THR A O   1 
ATOM   464  C CB  . THR A 1 66  ? 34.576  4.474   16.091  1.00 14.51 ? 70  THR A CB  1 
ATOM   465  O OG1 . THR A 1 66  ? 34.132  5.675   15.440  1.00 14.34 ? 70  THR A OG1 1 
ATOM   466  C CG2 . THR A 1 66  ? 34.817  4.875   17.543  1.00 14.34 ? 70  THR A CG2 1 
ATOM   467  N N   . GLY A 1 67  ? 36.029  2.391   13.601  1.00 14.66 ? 71  GLY A N   1 
ATOM   468  C CA  . GLY A 1 67  ? 35.827  1.899   12.246  1.00 14.59 ? 71  GLY A CA  1 
ATOM   469  C C   . GLY A 1 67  ? 34.817  0.779   12.183  1.00 14.70 ? 71  GLY A C   1 
ATOM   470  O O   . GLY A 1 67  ? 34.618  0.051   13.154  1.00 14.48 ? 71  GLY A O   1 
ATOM   471  N N   . TRP A 1 68  ? 34.167  0.662   11.031  1.00 15.14 ? 72  TRP A N   1 
ATOM   472  C CA  . TRP A 1 68  ? 33.269  -0.451  10.730  1.00 15.66 ? 72  TRP A CA  1 
ATOM   473  C C   . TRP A 1 68  ? 33.697  -1.053  9.406   1.00 16.20 ? 72  TRP A C   1 
ATOM   474  O O   . TRP A 1 68  ? 34.163  -0.325  8.524   1.00 16.21 ? 72  TRP A O   1 
ATOM   475  C CB  . TRP A 1 68  ? 31.808  0.002   10.688  1.00 15.41 ? 72  TRP A CB  1 
ATOM   476  C CG  . TRP A 1 68  ? 31.550  1.205   9.849   1.00 15.17 ? 72  TRP A CG  1 
ATOM   477  C CD1 . TRP A 1 68  ? 31.030  1.222   8.592   1.00 15.45 ? 72  TRP A CD1 1 
ATOM   478  C CD2 . TRP A 1 68  ? 31.788  2.574   10.205  1.00 15.35 ? 72  TRP A CD2 1 
ATOM   479  N NE1 . TRP A 1 68  ? 30.932  2.515   8.136   1.00 15.59 ? 72  TRP A NE1 1 
ATOM   480  C CE2 . TRP A 1 68  ? 31.392  3.367   9.106   1.00 15.40 ? 72  TRP A CE2 1 
ATOM   481  C CE3 . TRP A 1 68  ? 32.308  3.218   11.345  1.00 15.52 ? 72  TRP A CE3 1 
ATOM   482  C CZ2 . TRP A 1 68  ? 31.490  4.767   9.111   1.00 15.17 ? 72  TRP A CZ2 1 
ATOM   483  C CZ3 . TRP A 1 68  ? 32.410  4.612   11.347  1.00 15.21 ? 72  TRP A CZ3 1 
ATOM   484  C CH2 . TRP A 1 68  ? 32.003  5.367   10.237  1.00 15.10 ? 72  TRP A CH2 1 
ATOM   485  N N   . THR A 1 69  ? 33.561  -2.371  9.264   1.00 16.93 ? 73  THR A N   1 
ATOM   486  C CA  . THR A 1 69  ? 34.160  -3.049  8.114   1.00 17.78 ? 73  THR A CA  1 
ATOM   487  C C   . THR A 1 69  ? 33.545  -2.652  6.777   1.00 18.27 ? 73  THR A C   1 
ATOM   488  O O   . THR A 1 69  ? 34.272  -2.030  5.981   1.00 19.52 ? 73  THR A O   1 
ATOM   489  C CB  . THR A 1 69  ? 34.260  -4.554  8.280   1.00 17.89 ? 73  THR A CB  1 
ATOM   490  O OG1 . THR A 1 69  ? 35.025  -4.838  9.457   1.00 19.32 ? 73  THR A OG1 1 
ATOM   491  C CG2 . THR A 1 69  ? 35.129  -5.128  7.174   1.00 18.09 ? 73  THR A CG2 1 
ATOM   492  N N   . PRO A 1 70  ? 32.262  -2.970  6.501   1.00 17.77 ? 74  PRO A N   1 
ATOM   493  C CA  . PRO A 1 70  ? 31.649  -2.557  5.216   1.00 17.16 ? 74  PRO A CA  1 
ATOM   494  C C   . PRO A 1 70  ? 31.823  -1.054  4.987   1.00 16.72 ? 74  PRO A C   1 
ATOM   495  O O   . PRO A 1 70  ? 30.911  -0.263  5.249   1.00 16.96 ? 74  PRO A O   1 
ATOM   496  C CB  . PRO A 1 70  ? 30.175  -2.946  5.373   1.00 17.04 ? 74  PRO A CB  1 
ATOM   497  C CG  . PRO A 1 70  ? 30.200  -4.033  6.364   1.00 17.45 ? 74  PRO A CG  1 
ATOM   498  C CD  . PRO A 1 70  ? 31.310  -3.720  7.344   1.00 17.33 ? 74  PRO A CD  1 
ATOM   499  N N   . HIS A 1 71  ? 33.015  -0.677  4.528   1.00 16.23 ? 75  HIS A N   1 
ATOM   500  C CA  . HIS A 1 71  ? 33.372  0.717   4.289   1.00 16.01 ? 75  HIS A CA  1 
ATOM   501  C C   . HIS A 1 71  ? 34.636  0.822   3.462   1.00 15.86 ? 75  HIS A C   1 
ATOM   502  O O   . HIS A 1 71  ? 35.538  -0.005  3.602   1.00 15.93 ? 75  HIS A O   1 
ATOM   503  C CB  . HIS A 1 71  ? 33.574  1.470   5.606   1.00 16.11 ? 75  HIS A CB  1 
ATOM   504  C CG  . HIS A 1 71  ? 33.427  2.954   5.473   1.00 15.26 ? 75  HIS A CG  1 
ATOM   505  N ND1 . HIS A 1 71  ? 34.411  3.754   4.936   1.00 14.91 ? 75  HIS A ND1 1 
ATOM   506  C CD2 . HIS A 1 71  ? 32.403  3.778   5.789   1.00 14.71 ? 75  HIS A CD2 1 
ATOM   507  C CE1 . HIS A 1 71  ? 34.008  5.010   4.942   1.00 14.82 ? 75  HIS A CE1 1 
ATOM   508  N NE2 . HIS A 1 71  ? 32.791  5.051   5.453   1.00 15.33 ? 75  HIS A NE2 1 
ATOM   509  N N   . TRP A 1 72  ? 34.705  1.857   2.627   1.00 15.61 ? 76  TRP A N   1 
ATOM   510  C CA  . TRP A 1 72  ? 35.847  2.068   1.740   1.00 15.52 ? 76  TRP A CA  1 
ATOM   511  C C   . TRP A 1 72  ? 37.152  2.406   2.470   1.00 15.54 ? 76  TRP A C   1 
ATOM   512  O O   . TRP A 1 72  ? 38.220  2.339   1.862   1.00 15.65 ? 76  TRP A O   1 
ATOM   513  C CB  . TRP A 1 72  ? 35.528  3.113   0.647   1.00 15.33 ? 76  TRP A CB  1 
ATOM   514  C CG  . TRP A 1 72  ? 34.978  4.432   1.155   1.00 15.30 ? 76  TRP A CG  1 
ATOM   515  C CD1 . TRP A 1 72  ? 33.673  4.848   1.118   1.00 14.89 ? 76  TRP A CD1 1 
ATOM   516  C CD2 . TRP A 1 72  ? 35.715  5.502   1.777   1.00 15.30 ? 76  TRP A CD2 1 
ATOM   517  N NE1 . TRP A 1 72  ? 33.555  6.101   1.674   1.00 14.84 ? 76  TRP A NE1 1 
ATOM   518  C CE2 . TRP A 1 72  ? 34.793  6.528   2.083   1.00 15.08 ? 76  TRP A CE2 1 
ATOM   519  C CE3 . TRP A 1 72  ? 37.064  5.701   2.105   1.00 14.63 ? 76  TRP A CE3 1 
ATOM   520  C CZ2 . TRP A 1 72  ? 35.174  7.719   2.705   1.00 14.87 ? 76  TRP A CZ2 1 
ATOM   521  C CZ3 . TRP A 1 72  ? 37.437  6.888   2.718   1.00 14.65 ? 76  TRP A CZ3 1 
ATOM   522  C CH2 . TRP A 1 72  ? 36.495  7.881   3.008   1.00 14.68 ? 76  TRP A CH2 1 
ATOM   523  N N   . MET A 1 73  ? 37.068  2.750   3.761   1.00 15.52 ? 77  MET A N   1 
ATOM   524  C CA  . MET A 1 73  ? 38.251  3.155   4.551   1.00 15.75 ? 77  MET A CA  1 
ATOM   525  C C   . MET A 1 73  ? 39.335  2.090   4.640   1.00 15.51 ? 77  MET A C   1 
ATOM   526  O O   . MET A 1 73  ? 40.521  2.406   4.694   1.00 15.62 ? 77  MET A O   1 
ATOM   527  C CB  . MET A 1 73  ? 37.883  3.666   5.956   1.00 15.71 ? 77  MET A CB  1 
ATOM   528  C CG  . MET A 1 73  ? 37.002  2.740   6.797   1.00 16.43 ? 77  MET A CG  1 
ATOM   529  S SD  . MET A 1 73  ? 36.760  3.319   8.499   1.00 16.72 ? 77  MET A SD  1 
ATOM   530  C CE  . MET A 1 73  ? 34.978  3.368   8.572   1.00 15.98 ? 77  MET A CE  1 
ATOM   531  N N   . PHE A 1 74  ? 38.925  0.829   4.641   1.00 15.48 ? 78  PHE A N   1 
ATOM   532  C CA  . PHE A 1 74  ? 39.878  -0.271  4.616   1.00 15.62 ? 78  PHE A CA  1 
ATOM   533  C C   . PHE A 1 74  ? 40.491  -0.515  3.226   1.00 15.80 ? 78  PHE A C   1 
ATOM   534  O O   . PHE A 1 74  ? 41.486  -1.236  3.103   1.00 16.17 ? 78  PHE A O   1 
ATOM   535  C CB  . PHE A 1 74  ? 39.249  -1.543  5.202   1.00 15.45 ? 78  PHE A CB  1 
ATOM   536  C CG  . PHE A 1 74  ? 39.249  -1.577  6.714   1.00 14.93 ? 78  PHE A CG  1 
ATOM   537  C CD1 . PHE A 1 74  ? 40.271  -2.223  7.409   1.00 14.46 ? 78  PHE A CD1 1 
ATOM   538  C CD2 . PHE A 1 74  ? 38.237  -0.949  7.436   1.00 14.38 ? 78  PHE A CD2 1 
ATOM   539  C CE1 . PHE A 1 74  ? 40.275  -2.256  8.799   1.00 14.35 ? 78  PHE A CE1 1 
ATOM   540  C CE2 . PHE A 1 74  ? 38.231  -0.969  8.823   1.00 13.82 ? 78  PHE A CE2 1 
ATOM   541  C CZ  . PHE A 1 74  ? 39.250  -1.627  9.509   1.00 14.61 ? 78  PHE A CZ  1 
ATOM   542  N N   . SER A 1 75  ? 39.916  0.103   2.193   1.00 15.88 ? 79  SER A N   1 
ATOM   543  C CA  . SER A 1 75  ? 40.464  0.037   0.830   1.00 15.82 ? 79  SER A CA  1 
ATOM   544  C C   . SER A 1 75  ? 41.495  1.144   0.564   1.00 15.83 ? 79  SER A C   1 
ATOM   545  O O   . SER A 1 75  ? 42.614  0.855   0.124   1.00 15.87 ? 79  SER A O   1 
ATOM   546  C CB  . SER A 1 75  ? 39.344  0.110   -0.208  1.00 15.77 ? 79  SER A CB  1 
ATOM   547  O OG  . SER A 1 75  ? 38.230  -0.645  0.213   1.00 16.02 ? 79  SER A OG  1 
ATOM   548  N N   . ARG A 1 76  ? 41.109  2.398   0.827   1.00 15.64 ? 80  ARG A N   1 
ATOM   549  C CA  . ARG A 1 76  ? 41.989  3.553   0.653   1.00 15.65 ? 80  ARG A CA  1 
ATOM   550  C C   . ARG A 1 76  ? 43.161  3.557   1.655   1.00 15.61 ? 80  ARG A C   1 
ATOM   551  O O   . ARG A 1 76  ? 44.189  4.191   1.398   1.00 15.60 ? 80  ARG A O   1 
ATOM   552  C CB  . ARG A 1 76  ? 41.182  4.857   0.752   1.00 15.73 ? 80  ARG A CB  1 
ATOM   553  C CG  . ARG A 1 76  ? 42.013  6.165   0.656   1.00 17.03 ? 80  ARG A CG  1 
ATOM   554  C CD  . ARG A 1 76  ? 41.906  6.947   -0.664  1.00 18.75 ? 80  ARG A CD  1 
ATOM   555  N NE  . ARG A 1 76  ? 40.588  7.580   -0.829  1.00 20.67 ? 80  ARG A NE  1 
ATOM   556  C CZ  . ARG A 1 76  ? 40.244  8.795   -0.371  1.00 21.23 ? 80  ARG A CZ  1 
ATOM   557  N NH1 . ARG A 1 76  ? 41.118  9.546   0.301   1.00 21.57 ? 80  ARG A NH1 1 
ATOM   558  N NH2 . ARG A 1 76  ? 39.011  9.262   -0.587  1.00 20.46 ? 80  ARG A NH2 1 
ATOM   559  N N   . TYR A 1 77  ? 43.010  2.844   2.779   1.00 15.44 ? 81  TYR A N   1 
ATOM   560  C CA  . TYR A 1 77  ? 44.043  2.792   3.824   1.00 15.10 ? 81  TYR A CA  1 
ATOM   561  C C   . TYR A 1 77  ? 44.373  1.386   4.332   1.00 15.05 ? 81  TYR A C   1 
ATOM   562  O O   . TYR A 1 77  ? 43.508  0.498   4.383   1.00 14.74 ? 81  TYR A O   1 
ATOM   563  C CB  . TYR A 1 77  ? 43.645  3.657   5.023   1.00 15.08 ? 81  TYR A CB  1 
ATOM   564  C CG  . TYR A 1 77  ? 43.275  5.068   4.677   1.00 14.95 ? 81  TYR A CG  1 
ATOM   565  C CD1 . TYR A 1 77  ? 44.256  6.032   4.484   1.00 14.71 ? 81  TYR A CD1 1 
ATOM   566  C CD2 . TYR A 1 77  ? 41.938  5.444   4.542   1.00 14.64 ? 81  TYR A CD2 1 
ATOM   567  C CE1 . TYR A 1 77  ? 43.921  7.347   4.162   1.00 14.83 ? 81  TYR A CE1 1 
ATOM   568  C CE2 . TYR A 1 77  ? 41.585  6.752   4.220   1.00 14.60 ? 81  TYR A CE2 1 
ATOM   569  C CZ  . TYR A 1 77  ? 42.584  7.702   4.030   1.00 14.83 ? 81  TYR A CZ  1 
ATOM   570  O OH  . TYR A 1 77  ? 42.260  9.005   3.706   1.00 15.16 ? 81  TYR A OH  1 
ATOM   571  N N   . LYS A 1 78  ? 45.639  1.217   4.721   1.00 14.93 ? 82  LYS A N   1 
ATOM   572  C CA  . LYS A 1 78  ? 46.106  0.049   5.445   1.00 14.93 ? 82  LYS A CA  1 
ATOM   573  C C   . LYS A 1 78  ? 45.762  0.210   6.927   1.00 14.93 ? 82  LYS A C   1 
ATOM   574  O O   . LYS A 1 78  ? 46.541  0.770   7.694   1.00 15.16 ? 82  LYS A O   1 
ATOM   575  C CB  . LYS A 1 78  ? 47.616  -0.118  5.268   1.00 14.90 ? 82  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 78  ? 48.066  -0.571  3.886   1.00 15.11 ? 82  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 78  ? 49.480  -1.174  3.911   1.00 15.15 ? 82  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 78  ? 49.865  -1.726  2.539   1.00 15.64 ? 82  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 78  ? 51.166  -2.441  2.552   1.00 15.68 ? 82  LYS A NZ  1 
ATOM   580  N N   . LEU A 1 79  ? 44.590  -0.285  7.318   1.00 14.95 ? 83  LEU A N   1 
ATOM   581  C CA  . LEU A 1 79  ? 44.087  -0.179  8.696   1.00 14.69 ? 83  LEU A CA  1 
ATOM   582  C C   . LEU A 1 79  ? 43.938  -1.560  9.348   1.00 14.62 ? 83  LEU A C   1 
ATOM   583  O O   . LEU A 1 79  ? 44.073  -2.576  8.673   1.00 14.77 ? 83  LEU A O   1 
ATOM   584  C CB  . LEU A 1 79  ? 42.732  0.545   8.702   1.00 14.76 ? 83  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 79  ? 42.622  1.990   8.207   1.00 13.85 ? 83  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 79  ? 41.178  2.331   7.937   1.00 12.60 ? 83  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 79  ? 43.217  2.944   9.219   1.00 13.49 ? 83  LEU A CD2 1 
ATOM   588  N N   . LYS A 1 80  ? 43.664  -1.590  10.654  1.00 14.57 ? 84  LYS A N   1 
ATOM   589  C CA  . LYS A 1 80  ? 43.500  -2.851  11.409  1.00 14.62 ? 84  LYS A CA  1 
ATOM   590  C C   . LYS A 1 80  ? 42.619  -2.699  12.649  1.00 14.74 ? 84  LYS A C   1 
ATOM   591  O O   . LYS A 1 80  ? 42.573  -1.617  13.254  1.00 14.85 ? 84  LYS A O   1 
ATOM   592  C CB  . LYS A 1 80  ? 44.862  -3.428  11.840  1.00 14.56 ? 84  LYS A CB  1 
ATOM   593  C CG  . LYS A 1 80  ? 45.660  -2.540  12.797  1.00 14.41 ? 84  LYS A CG  1 
ATOM   594  C CD  . LYS A 1 80  ? 46.818  -3.281  13.432  1.00 14.43 ? 84  LYS A CD  1 
ATOM   595  C CE  . LYS A 1 80  ? 47.789  -2.300  14.063  1.00 14.24 ? 84  LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 80  ? 48.954  -2.971  14.697  1.00 14.05 ? 84  LYS A NZ  1 
ATOM   597  N N   . TYR A 1 81  ? 41.950  -3.787  13.041  1.00 14.57 ? 85  TYR A N   1 
ATOM   598  C CA  . TYR A 1 81  ? 41.168  -3.801  14.278  1.00 14.45 ? 85  TYR A CA  1 
ATOM   599  C C   . TYR A 1 81  ? 42.037  -4.057  15.487  1.00 14.54 ? 85  TYR A C   1 
ATOM   600  O O   . TYR A 1 81  ? 42.923  -4.919  15.462  1.00 14.51 ? 85  TYR A O   1 
ATOM   601  C CB  . TYR A 1 81  ? 40.043  -4.834  14.225  1.00 14.37 ? 85  TYR A CB  1 
ATOM   602  C CG  . TYR A 1 81  ? 38.881  -4.372  13.395  1.00 14.43 ? 85  TYR A CG  1 
ATOM   603  C CD1 . TYR A 1 81  ? 37.996  -3.419  13.887  1.00 14.65 ? 85  TYR A CD1 1 
ATOM   604  C CD2 . TYR A 1 81  ? 38.682  -4.859  12.110  1.00 14.45 ? 85  TYR A CD2 1 
ATOM   605  C CE1 . TYR A 1 81  ? 36.933  -2.969  13.131  1.00 15.14 ? 85  TYR A CE1 1 
ATOM   606  C CE2 . TYR A 1 81  ? 37.620  -4.414  11.335  1.00 15.26 ? 85  TYR A CE2 1 
ATOM   607  C CZ  . TYR A 1 81  ? 36.743  -3.465  11.852  1.00 15.11 ? 85  TYR A CZ  1 
ATOM   608  O OH  . TYR A 1 81  ? 35.675  -3.005  11.112  1.00 14.13 ? 85  TYR A OH  1 
ATOM   609  N N   . LEU A 1 82  ? 41.796  -3.284  16.538  1.00 14.57 ? 86  LEU A N   1 
ATOM   610  C CA  . LEU A 1 82  ? 42.306  -3.621  17.849  1.00 14.72 ? 86  LEU A CA  1 
ATOM   611  C C   . LEU A 1 82  ? 41.424  -4.760  18.344  1.00 14.87 ? 86  LEU A C   1 
ATOM   612  O O   . LEU A 1 82  ? 40.196  -4.685  18.228  1.00 15.02 ? 86  LEU A O   1 
ATOM   613  C CB  . LEU A 1 82  ? 42.233  -2.418  18.792  1.00 14.88 ? 86  LEU A CB  1 
ATOM   614  C CG  . LEU A 1 82  ? 43.289  -1.297  18.701  1.00 14.92 ? 86  LEU A CG  1 
ATOM   615  C CD1 . LEU A 1 82  ? 43.093  -0.469  17.466  1.00 14.90 ? 86  LEU A CD1 1 
ATOM   616  C CD2 . LEU A 1 82  ? 43.251  -0.388  19.931  1.00 14.75 ? 86  LEU A CD2 1 
ATOM   617  N N   . ASP A 1 83  ? 42.042  -5.823  18.858  1.00 14.97 ? 87  ASP A N   1 
ATOM   618  C CA  . ASP A 1 83  ? 41.304  -7.010  19.295  1.00 14.84 ? 87  ASP A CA  1 
ATOM   619  C C   . ASP A 1 83  ? 40.332  -6.673  20.402  1.00 14.72 ? 87  ASP A C   1 
ATOM   620  O O   . ASP A 1 83  ? 40.649  -5.875  21.284  1.00 14.94 ? 87  ASP A O   1 
ATOM   621  C CB  . ASP A 1 83  ? 42.258  -8.107  19.763  1.00 14.87 ? 87  ASP A CB  1 
ATOM   622  C CG  . ASP A 1 83  ? 42.899  -8.845  18.616  1.00 15.30 ? 87  ASP A CG  1 
ATOM   623  O OD1 . ASP A 1 83  ? 42.367  -8.762  17.490  1.00 16.31 ? 87  ASP A OD1 1 
ATOM   624  O OD2 . ASP A 1 83  ? 43.929  -9.538  18.740  1.00 16.04 ? 87  ASP A OD2 1 
ATOM   625  N N   . ASP A 1 84  ? 39.154  -7.285  20.342  1.00 14.55 ? 88  ASP A N   1 
ATOM   626  C CA  . ASP A 1 84  ? 38.102  -7.109  21.346  1.00 14.32 ? 88  ASP A CA  1 
ATOM   627  C C   . ASP A 1 84  ? 37.827  -8.431  22.102  1.00 14.00 ? 88  ASP A C   1 
ATOM   628  O O   . ASP A 1 84  ? 36.814  -9.095  21.844  1.00 13.84 ? 88  ASP A O   1 
ATOM   629  C CB  . ASP A 1 84  ? 36.832  -6.588  20.652  1.00 14.35 ? 88  ASP A CB  1 
ATOM   630  C CG  . ASP A 1 84  ? 35.741  -6.165  21.628  1.00 14.81 ? 88  ASP A CG  1 
ATOM   631  O OD1 . ASP A 1 84  ? 36.012  -6.017  22.841  1.00 15.63 ? 88  ASP A OD1 1 
ATOM   632  O OD2 . ASP A 1 84  ? 34.565  -5.950  21.253  1.00 15.18 ? 88  ASP A OD2 1 
ATOM   633  N N   . PRO A 1 85  ? 38.718  -8.822  23.024  1.00 13.73 ? 89  PRO A N   1 
ATOM   634  C CA  . PRO A 1 85  ? 38.528  -10.070 23.775  1.00 13.62 ? 89  PRO A CA  1 
ATOM   635  C C   . PRO A 1 85  ? 37.266  -10.095 24.657  1.00 13.45 ? 89  PRO A C   1 
ATOM   636  O O   . PRO A 1 85  ? 36.693  -11.162 24.870  1.00 13.42 ? 89  PRO A O   1 
ATOM   637  C CB  . PRO A 1 85  ? 39.805  -10.180 24.625  1.00 13.37 ? 89  PRO A CB  1 
ATOM   638  C CG  . PRO A 1 85  ? 40.353  -8.818  24.692  1.00 13.44 ? 89  PRO A CG  1 
ATOM   639  C CD  . PRO A 1 85  ? 39.963  -8.139  23.419  1.00 13.55 ? 89  PRO A CD  1 
ATOM   640  N N   . LYS A 1 86  ? 36.844  -8.932  25.149  1.00 13.34 ? 90  LYS A N   1 
ATOM   641  C CA  . LYS A 1 86  ? 35.641  -8.825  25.977  1.00 13.38 ? 90  LYS A CA  1 
ATOM   642  C C   . LYS A 1 86  ? 34.380  -8.700  25.116  1.00 13.55 ? 90  LYS A C   1 
ATOM   643  O O   . LYS A 1 86  ? 33.265  -8.645  25.634  1.00 13.33 ? 90  LYS A O   1 
ATOM   644  C CB  . LYS A 1 86  ? 35.758  -7.646  26.945  1.00 13.27 ? 90  LYS A CB  1 
ATOM   645  C CG  . LYS A 1 86  ? 36.974  -7.693  27.834  1.00 13.13 ? 90  LYS A CG  1 
ATOM   646  C CD  . LYS A 1 86  ? 36.690  -7.003  29.142  1.00 14.07 ? 90  LYS A CD  1 
ATOM   647  C CE  . LYS A 1 86  ? 37.683  -7.408  30.214  1.00 14.34 ? 90  LYS A CE  1 
ATOM   648  N NZ  . LYS A 1 86  ? 39.001  -6.768  29.975  1.00 14.96 ? 90  LYS A NZ  1 
ATOM   649  N N   . GLN A 1 87  ? 34.590  -8.663  23.800  1.00 13.95 ? 91  GLN A N   1 
ATOM   650  C CA  . GLN A 1 87  ? 33.530  -8.574  22.775  1.00 14.15 ? 91  GLN A CA  1 
ATOM   651  C C   . GLN A 1 87  ? 32.455  -7.530  23.033  1.00 14.33 ? 91  GLN A C   1 
ATOM   652  O O   . GLN A 1 87  ? 31.258  -7.774  22.820  1.00 14.12 ? 91  GLN A O   1 
ATOM   653  C CB  . GLN A 1 87  ? 32.947  -9.945  22.448  1.00 14.03 ? 91  GLN A CB  1 
ATOM   654  C CG  . GLN A 1 87  ? 33.868  -10.705 21.528  1.00 13.99 ? 91  GLN A CG  1 
ATOM   655  C CD  . GLN A 1 87  ? 33.395  -12.090 21.228  1.00 13.78 ? 91  GLN A CD  1 
ATOM   656  O OE1 . GLN A 1 87  ? 33.326  -12.937 22.121  1.00 13.73 ? 91  GLN A OE1 1 
ATOM   657  N NE2 . GLN A 1 87  ? 33.085  -12.343 19.963  1.00 13.51 ? 91  GLN A NE2 1 
ATOM   658  N N   . SER A 1 88  ? 32.930  -6.360  23.464  1.00 14.58 ? 92  SER A N   1 
ATOM   659  C CA  . SER A 1 88  ? 32.093  -5.215  23.797  1.00 14.85 ? 92  SER A CA  1 
ATOM   660  C C   . SER A 1 88  ? 31.232  -4.796  22.622  1.00 14.98 ? 92  SER A C   1 
ATOM   661  O O   . SER A 1 88  ? 30.134  -4.282  22.814  1.00 15.23 ? 92  SER A O   1 
ATOM   662  C CB  . SER A 1 88  ? 32.965  -4.041  24.228  1.00 14.81 ? 92  SER A CB  1 
ATOM   663  O OG  . SER A 1 88  ? 33.860  -4.421  25.253  1.00 15.07 ? 92  SER A OG  1 
ATOM   664  N N   . TYR A 1 89  ? 31.737  -5.026  21.411  1.00 15.05 ? 93  TYR A N   1 
ATOM   665  C CA  . TYR A 1 89  ? 31.028  -4.664  20.192  1.00 15.19 ? 93  TYR A CA  1 
ATOM   666  C C   . TYR A 1 89  ? 30.086  -5.766  19.710  1.00 15.18 ? 93  TYR A C   1 
ATOM   667  O O   . TYR A 1 89  ? 29.543  -5.688  18.612  1.00 15.16 ? 93  TYR A O   1 
ATOM   668  C CB  . TYR A 1 89  ? 32.029  -4.274  19.091  1.00 15.34 ? 93  TYR A CB  1 
ATOM   669  C CG  . TYR A 1 89  ? 32.780  -2.975  19.365  1.00 15.53 ? 93  TYR A CG  1 
ATOM   670  C CD1 . TYR A 1 89  ? 32.256  -1.735  18.959  1.00 15.30 ? 93  TYR A CD1 1 
ATOM   671  C CD2 . TYR A 1 89  ? 34.009  -2.986  20.043  1.00 14.89 ? 93  TYR A CD2 1 
ATOM   672  C CE1 . TYR A 1 89  ? 32.939  -0.548  19.231  1.00 15.50 ? 93  TYR A CE1 1 
ATOM   673  C CE2 . TYR A 1 89  ? 34.696  -1.812  20.311  1.00 13.96 ? 93  TYR A CE2 1 
ATOM   674  C CZ  . TYR A 1 89  ? 34.163  -0.600  19.910  1.00 15.16 ? 93  TYR A CZ  1 
ATOM   675  O OH  . TYR A 1 89  ? 34.860  0.559   20.176  1.00 15.53 ? 93  TYR A OH  1 
ATOM   676  N N   . GLY A 1 90  ? 29.878  -6.782  20.541  1.00 15.32 ? 94  GLY A N   1 
ATOM   677  C CA  . GLY A 1 90  ? 29.097  -7.948  20.142  1.00 15.53 ? 94  GLY A CA  1 
ATOM   678  C C   . GLY A 1 90  ? 29.761  -8.693  18.992  1.00 15.67 ? 94  GLY A C   1 
ATOM   679  O O   . GLY A 1 90  ? 30.963  -8.531  18.737  1.00 15.80 ? 94  GLY A O   1 
ATOM   680  N N   . SER A 1 91  ? 28.983  -9.511  18.293  1.00 15.60 ? 95  SER A N   1 
ATOM   681  C CA  . SER A 1 91  ? 29.508  -10.264 17.155  1.00 15.65 ? 95  SER A CA  1 
ATOM   682  C C   . SER A 1 91  ? 28.425  -10.598 16.119  1.00 15.64 ? 95  SER A C   1 
ATOM   683  O O   . SER A 1 91  ? 27.304  -10.073 16.178  1.00 15.71 ? 95  SER A O   1 
ATOM   684  C CB  . SER A 1 91  ? 30.216  -11.535 17.635  1.00 15.56 ? 95  SER A CB  1 
ATOM   685  O OG  . SER A 1 91  ? 29.373  -12.294 18.482  1.00 16.08 ? 95  SER A OG  1 
ATOM   686  N N   . ALA A 1 92  ? 28.782  -11.459 15.164  1.00 15.35 ? 96  ALA A N   1 
ATOM   687  C CA  . ALA A 1 92  ? 27.883  -11.910 14.102  1.00 15.06 ? 96  ALA A CA  1 
ATOM   688  C C   . ALA A 1 92  ? 26.916  -10.827 13.595  1.00 14.92 ? 96  ALA A C   1 
ATOM   689  O O   . ALA A 1 92  ? 25.728  -11.087 13.374  1.00 15.01 ? 96  ALA A O   1 
ATOM   690  C CB  . ALA A 1 92  ? 27.129  -13.148 14.551  1.00 15.08 ? 96  ALA A CB  1 
ATOM   691  N N   . GLU A 1 93  ? 27.432  -9.613  13.417  1.00 14.66 ? 97  GLU A N   1 
ATOM   692  C CA  . GLU A 1 93  ? 26.626  -8.524  12.890  1.00 14.32 ? 97  GLU A CA  1 
ATOM   693  C C   . GLU A 1 93  ? 26.292  -8.768  11.422  1.00 14.06 ? 97  GLU A C   1 
ATOM   694  O O   . GLU A 1 93  ? 27.072  -9.366  10.690  1.00 14.06 ? 97  GLU A O   1 
ATOM   695  C CB  . GLU A 1 93  ? 27.305  -7.171  13.097  1.00 14.32 ? 97  GLU A CB  1 
ATOM   696  C CG  . GLU A 1 93  ? 26.390  -5.964  12.898  1.00 14.18 ? 97  GLU A CG  1 
ATOM   697  C CD  . GLU A 1 93  ? 25.448  -5.695  14.061  1.00 14.05 ? 97  GLU A CD  1 
ATOM   698  O OE1 . GLU A 1 93  ? 25.181  -6.611  14.859  1.00 14.61 ? 97  GLU A OE1 1 
ATOM   699  O OE2 . GLU A 1 93  ? 24.962  -4.556  14.178  1.00 13.44 ? 97  GLU A OE2 1 
ATOM   700  N N   . GLU A 1 94  ? 25.107  -8.317  11.025  1.00 13.79 ? 98  GLU A N   1 
ATOM   701  C CA  . GLU A 1 94  ? 24.542  -8.580  9.713   1.00 13.50 ? 98  GLU A CA  1 
ATOM   702  C C   . GLU A 1 94  ? 23.773  -7.374  9.239   1.00 13.17 ? 98  GLU A C   1 
ATOM   703  O O   . GLU A 1 94  ? 23.262  -6.600  10.056  1.00 13.25 ? 98  GLU A O   1 
ATOM   704  C CB  . GLU A 1 94  ? 23.586  -9.764  9.783   1.00 13.39 ? 98  GLU A CB  1 
ATOM   705  C CG  . GLU A 1 94  ? 24.278  -11.113 9.869   1.00 14.02 ? 98  GLU A CG  1 
ATOM   706  C CD  . GLU A 1 94  ? 23.313  -12.272 10.017  1.00 13.99 ? 98  GLU A CD  1 
ATOM   707  O OE1 . GLU A 1 94  ? 23.785  -13.436 10.082  1.00 13.97 ? 98  GLU A OE1 1 
ATOM   708  O OE2 . GLU A 1 94  ? 22.086  -12.018 10.077  1.00 15.19 ? 98  GLU A OE2 1 
ATOM   709  N N   . ILE A 1 95  ? 23.700  -7.208  7.924   1.00 12.83 ? 99  ILE A N   1 
ATOM   710  C CA  . ILE A 1 95  ? 22.805  -6.221  7.330   1.00 12.73 ? 99  ILE A CA  1 
ATOM   711  C C   . ILE A 1 95  ? 21.523  -6.930  6.911   1.00 12.73 ? 99  ILE A C   1 
ATOM   712  O O   . ILE A 1 95  ? 21.570  -7.939  6.209   1.00 12.76 ? 99  ILE A O   1 
ATOM   713  C CB  . ILE A 1 95  ? 23.468  -5.483  6.134   1.00 12.70 ? 99  ILE A CB  1 
ATOM   714  C CG1 . ILE A 1 95  ? 24.846  -4.934  6.536   1.00 12.58 ? 99  ILE A CG1 1 
ATOM   715  C CG2 . ILE A 1 95  ? 22.544  -4.374  5.604   1.00 12.36 ? 99  ILE A CG2 1 
ATOM   716  C CD1 . ILE A 1 95  ? 25.626  -4.267  5.402   1.00 12.48 ? 99  ILE A CD1 1 
ATOM   717  N N   . HIS A 1 96  ? 20.389  -6.401  7.354   1.00 12.73 ? 100 HIS A N   1 
ATOM   718  C CA  . HIS A 1 96  ? 19.089  -7.024  7.121   1.00 13.29 ? 100 HIS A CA  1 
ATOM   719  C C   . HIS A 1 96  ? 18.178  -6.225  6.172   1.00 13.30 ? 100 HIS A C   1 
ATOM   720  O O   . HIS A 1 96  ? 18.311  -5.003  6.054   1.00 13.65 ? 100 HIS A O   1 
ATOM   721  C CB  . HIS A 1 96  ? 18.389  -7.263  8.468   1.00 13.42 ? 100 HIS A CB  1 
ATOM   722  C CG  . HIS A 1 96  ? 18.908  -8.451  9.224   1.00 14.02 ? 100 HIS A CG  1 
ATOM   723  N ND1 . HIS A 1 96  ? 18.126  -9.180  10.092  1.00 14.32 ? 100 HIS A ND1 1 
ATOM   724  C CD2 . HIS A 1 96  ? 20.126  -9.044  9.232   1.00 14.51 ? 100 HIS A CD2 1 
ATOM   725  C CE1 . HIS A 1 96  ? 18.838  -10.167 10.604  1.00 14.43 ? 100 HIS A CE1 1 
ATOM   726  N NE2 . HIS A 1 96  ? 20.057  -10.106 10.101  1.00 14.43 ? 100 HIS A NE2 1 
ATOM   727  N N   . THR A 1 97  ? 17.262  -6.923  5.502   1.00 13.10 ? 101 THR A N   1 
ATOM   728  C CA  . THR A 1 97  ? 16.258  -6.294  4.637   1.00 13.13 ? 101 THR A CA  1 
ATOM   729  C C   . THR A 1 97  ? 14.928  -6.289  5.377   1.00 13.04 ? 101 THR A C   1 
ATOM   730  O O   . THR A 1 97  ? 14.351  -7.358  5.601   1.00 13.26 ? 101 THR A O   1 
ATOM   731  C CB  . THR A 1 97  ? 16.092  -7.098  3.321   1.00 13.36 ? 101 THR A CB  1 
ATOM   732  O OG1 . THR A 1 97  ? 17.302  -7.064  2.549   1.00 13.50 ? 101 THR A OG1 1 
ATOM   733  C CG2 . THR A 1 97  ? 15.041  -6.451  2.406   1.00 13.32 ? 101 THR A CG2 1 
ATOM   734  N N   . ILE A 1 98  ? 14.443  -5.109  5.766   1.00 12.85 ? 102 ILE A N   1 
ATOM   735  C CA  . ILE A 1 98  ? 13.170  -5.014  6.498   1.00 12.60 ? 102 ILE A CA  1 
ATOM   736  C C   . ILE A 1 98  ? 12.061  -4.292  5.731   1.00 12.91 ? 102 ILE A C   1 
ATOM   737  O O   . ILE A 1 98  ? 12.322  -3.376  4.949   1.00 12.80 ? 102 ILE A O   1 
ATOM   738  C CB  . ILE A 1 98  ? 13.349  -4.433  7.931   1.00 12.37 ? 102 ILE A CB  1 
ATOM   739  C CG1 . ILE A 1 98  ? 13.849  -2.991  7.906   1.00 12.24 ? 102 ILE A CG1 1 
ATOM   740  C CG2 . ILE A 1 98  ? 14.266  -5.318  8.763   1.00 12.26 ? 102 ILE A CG2 1 
ATOM   741  C CD1 . ILE A 1 98  ? 13.536  -2.207  9.190   1.00 12.19 ? 102 ILE A CD1 1 
ATOM   742  N N   . THR A 1 99  ? 10.823  -4.734  5.938   1.00 13.39 ? 103 THR A N   1 
ATOM   743  C CA  . THR A 1 99  ? 9.655   -4.046  5.376   1.00 14.03 ? 103 THR A CA  1 
ATOM   744  C C   . THR A 1 99  ? 8.633   -3.661  6.454   1.00 14.55 ? 103 THR A C   1 
ATOM   745  O O   . THR A 1 99  ? 8.759   -4.031  7.641   1.00 14.57 ? 103 THR A O   1 
ATOM   746  C CB  . THR A 1 99  ? 8.952   -4.893  4.284   1.00 13.90 ? 103 THR A CB  1 
ATOM   747  O OG1 . THR A 1 99  ? 8.571   -6.169  4.820   1.00 14.01 ? 103 THR A OG1 1 
ATOM   748  C CG2 . THR A 1 99  ? 9.900   -5.246  3.162   1.00 13.97 ? 103 THR A CG2 1 
ATOM   749  N N   . ARG A 1 100 ? 7.624   -2.908  6.028   1.00 14.91 ? 104 ARG A N   1 
ATOM   750  C CA  . ARG A 1 100 ? 6.503   -2.581  6.884   1.00 15.37 ? 104 ARG A CA  1 
ATOM   751  C C   . ARG A 1 100 ? 5.620   -3.806  7.021   1.00 15.61 ? 104 ARG A C   1 
ATOM   752  O O   . ARG A 1 100 ? 5.517   -4.605  6.085   1.00 15.72 ? 104 ARG A O   1 
ATOM   753  C CB  . ARG A 1 100 ? 5.707   -1.407  6.311   1.00 15.47 ? 104 ARG A CB  1 
ATOM   754  C CG  . ARG A 1 100 ? 5.157   -1.606  4.901   1.00 15.48 ? 104 ARG A CG  1 
ATOM   755  C CD  . ARG A 1 100 ? 4.296   -0.438  4.419   1.00 15.59 ? 104 ARG A CD  1 
ATOM   756  N NE  . ARG A 1 100 ? 3.674   -0.689  3.115   1.00 15.42 ? 104 ARG A NE  1 
ATOM   757  C CZ  . ARG A 1 100 ? 2.526   -1.325  2.941   1.00 14.37 ? 104 ARG A CZ  1 
ATOM   758  N NH1 . ARG A 1 100 ? 1.858   -1.796  3.981   1.00 14.29 ? 104 ARG A NH1 1 
ATOM   759  N NH2 . ARG A 1 100 ? 2.045   -1.503  1.724   1.00 14.70 ? 104 ARG A NH2 1 
ATOM   760  N N   . LYS A 1 101 ? 5.003   -3.948  8.194   1.00 15.90 ? 105 LYS A N   1 
ATOM   761  C CA  . LYS A 1 101 ? 4.069   -5.041  8.487   1.00 16.10 ? 105 LYS A CA  1 
ATOM   762  C C   . LYS A 1 101 ? 3.032   -5.209  7.362   1.00 16.20 ? 105 LYS A C   1 
ATOM   763  O O   . LYS A 1 101 ? 2.289   -4.279  7.032   1.00 16.04 ? 105 LYS A O   1 
ATOM   764  C CB  . LYS A 1 101 ? 3.390   -4.805  9.853   1.00 16.07 ? 105 LYS A CB  1 
ATOM   765  C CG  . LYS A 1 101 ? 2.780   -6.049  10.519  1.00 15.95 ? 105 LYS A CG  1 
ATOM   766  C CD  . LYS A 1 101 ? 3.847   -7.048  10.924  1.00 15.93 ? 105 LYS A CD  1 
ATOM   767  C CE  . LYS A 1 101 ? 3.521   -7.732  12.244  1.00 16.31 ? 105 LYS A CE  1 
ATOM   768  N NZ  . LYS A 1 101 ? 2.501   -8.813  12.151  1.00 16.47 ? 105 LYS A NZ  1 
ATOM   769  N N   . GLY A 1 102 ? 3.015   -6.391  6.754   1.00 16.40 ? 106 GLY A N   1 
ATOM   770  C CA  . GLY A 1 102 ? 2.041   -6.693  5.703   1.00 16.70 ? 106 GLY A CA  1 
ATOM   771  C C   . GLY A 1 102 ? 2.393   -6.226  4.300   1.00 16.76 ? 106 GLY A C   1 
ATOM   772  O O   . GLY A 1 102 ? 1.515   -6.098  3.453   1.00 16.79 ? 106 GLY A O   1 
ATOM   773  N N   . PHE A 1 103 ? 3.674   -5.982  4.045   1.00 16.85 ? 107 PHE A N   1 
ATOM   774  C CA  . PHE A 1 103 ? 4.138   -5.613  2.707   1.00 16.90 ? 107 PHE A CA  1 
ATOM   775  C C   . PHE A 1 103 ? 4.198   -6.829  1.779   1.00 16.87 ? 107 PHE A C   1 
ATOM   776  O O   . PHE A 1 103 ? 3.895   -6.726  0.587   1.00 16.72 ? 107 PHE A O   1 
ATOM   777  C CB  . PHE A 1 103 ? 5.506   -4.918  2.785   1.00 16.94 ? 107 PHE A CB  1 
ATOM   778  C CG  . PHE A 1 103 ? 6.052   -4.491  1.450   1.00 17.04 ? 107 PHE A CG  1 
ATOM   779  C CD1 . PHE A 1 103 ? 5.593   -3.329  0.836   1.00 17.03 ? 107 PHE A CD1 1 
ATOM   780  C CD2 . PHE A 1 103 ? 7.028   -5.251  0.805   1.00 16.86 ? 107 PHE A CD2 1 
ATOM   781  C CE1 . PHE A 1 103 ? 6.095   -2.932  -0.406  1.00 16.89 ? 107 PHE A CE1 1 
ATOM   782  C CE2 . PHE A 1 103 ? 7.537   -4.860  -0.430  1.00 16.51 ? 107 PHE A CE2 1 
ATOM   783  C CZ  . PHE A 1 103 ? 7.066   -3.697  -1.035  1.00 16.84 ? 107 PHE A CZ  1 
ATOM   784  N N   . SER A 1 104 ? 4.585   -7.974  2.342   1.00 16.81 ? 108 SER A N   1 
ATOM   785  C CA  . SER A 1 104 ? 4.751   -9.217  1.588   1.00 16.67 ? 108 SER A CA  1 
ATOM   786  C C   . SER A 1 104 ? 3.473   -9.689  0.893   1.00 16.81 ? 108 SER A C   1 
ATOM   787  O O   . SER A 1 104 ? 3.541   -10.360 -0.139  1.00 17.05 ? 108 SER A O   1 
ATOM   788  C CB  . SER A 1 104 ? 5.288   -10.331 2.485   1.00 16.45 ? 108 SER A CB  1 
ATOM   789  O OG  . SER A 1 104 ? 6.665   -10.158 2.753   1.00 16.31 ? 108 SER A OG  1 
ATOM   790  N N   . LYS A 1 105 ? 2.317   -9.356  1.457   1.00 16.77 ? 109 LYS A N   1 
ATOM   791  C CA  . LYS A 1 105 ? 1.034   -9.795  0.887   1.00 16.82 ? 109 LYS A CA  1 
ATOM   792  C C   . LYS A 1 105 ? 0.381   -8.690  0.077   1.00 16.79 ? 109 LYS A C   1 
ATOM   793  O O   . LYS A 1 105 ? -0.344  -8.967  -0.878  1.00 16.76 ? 109 LYS A O   1 
ATOM   794  C CB  . LYS A 1 105 ? 0.079   -10.361 1.959   1.00 16.84 ? 109 LYS A CB  1 
ATOM   795  C CG  . LYS A 1 105 ? 0.374   -9.907  3.399   1.00 17.67 ? 109 LYS A CG  1 
ATOM   796  C CD  . LYS A 1 105 ? 0.597   -11.105 4.360   1.00 17.71 ? 109 LYS A CD  1 
ATOM   797  C CE  . LYS A 1 105 ? 1.381   -10.691 5.616   1.00 17.47 ? 109 LYS A CE  1 
ATOM   798  N NZ  . LYS A 1 105 ? 2.730   -10.093 5.325   1.00 16.74 ? 109 LYS A NZ  1 
ATOM   799  N N   . GLU A 1 106 ? 0.663   -7.444  0.464   1.00 16.68 ? 110 GLU A N   1 
ATOM   800  C CA  . GLU A 1 106 ? 0.278   -6.247  -0.283  1.00 16.38 ? 110 GLU A CA  1 
ATOM   801  C C   . GLU A 1 106 ? 0.992   -6.256  -1.643  1.00 16.25 ? 110 GLU A C   1 
ATOM   802  O O   . GLU A 1 106 ? 0.387   -5.945  -2.674  1.00 16.09 ? 110 GLU A O   1 
ATOM   803  C CB  . GLU A 1 106 ? 0.585   -4.987  0.529   1.00 16.59 ? 110 GLU A CB  1 
ATOM   804  C CG  . GLU A 1 106 ? -0.467  -3.897  0.405   1.00 16.93 ? 110 GLU A CG  1 
ATOM   805  C CD  . GLU A 1 106 ? -0.975  -3.422  1.752   1.00 20.00 ? 110 GLU A CD  1 
ATOM   806  O OE1 . GLU A 1 106 ? -1.160  -4.270  2.650   1.00 20.00 ? 110 GLU A OE1 1 
ATOM   807  O OE2 . GLU A 1 106 ? -1.189  -2.201  1.909   1.00 20.00 ? 110 GLU A OE2 1 
ATOM   808  N N   . GLN A 1 107 ? 2.278   -6.626  -1.627  1.00 16.15 ? 111 GLN A N   1 
ATOM   809  C CA  . GLN A 1 107 ? 3.108   -6.723  -2.835  1.00 15.99 ? 111 GLN A CA  1 
ATOM   810  C C   . GLN A 1 107 ? 4.050   -7.931  -2.796  1.00 15.73 ? 111 GLN A C   1 
ATOM   811  O O   . GLN A 1 107 ? 5.213   -7.797  -2.414  1.00 15.63 ? 111 GLN A O   1 
ATOM   812  C CB  . GLN A 1 107 ? 3.931   -5.453  -3.030  1.00 15.97 ? 111 GLN A CB  1 
ATOM   813  C CG  . GLN A 1 107 ? 3.118   -4.213  -3.349  1.00 16.72 ? 111 GLN A CG  1 
ATOM   814  C CD  . GLN A 1 107 ? 3.994   -3.014  -3.649  1.00 17.37 ? 111 GLN A CD  1 
ATOM   815  O OE1 . GLN A 1 107 ? 3.885   -1.976  -2.991  1.00 17.34 ? 111 GLN A OE1 1 
ATOM   816  N NE2 . GLN A 1 107 ? 4.878   -3.157  -4.633  1.00 17.91 ? 111 GLN A NE2 1 
ATOM   817  N N   . PRO A 1 108 ? 3.562   -9.099  -3.221  1.00 15.63 ? 112 PRO A N   1 
ATOM   818  C CA  . PRO A 1 108 ? 4.349   -10.341 -3.143  1.00 15.35 ? 112 PRO A CA  1 
ATOM   819  C C   . PRO A 1 108 ? 5.574   -10.314 -4.064  1.00 15.06 ? 112 PRO A C   1 
ATOM   820  O O   . PRO A 1 108 ? 6.654   -10.771 -3.688  1.00 14.95 ? 112 PRO A O   1 
ATOM   821  C CB  . PRO A 1 108 ? 3.351   -11.417 -3.598  1.00 15.47 ? 112 PRO A CB  1 
ATOM   822  C CG  . PRO A 1 108 ? 1.988   -10.758 -3.525  1.00 15.37 ? 112 PRO A CG  1 
ATOM   823  C CD  . PRO A 1 108 ? 2.239   -9.322  -3.840  1.00 15.54 ? 112 PRO A CD  1 
ATOM   824  N N   . ASN A 1 109 ? 5.386   -9.766  -5.260  1.00 14.74 ? 113 ASN A N   1 
ATOM   825  C CA  . ASN A 1 109 ? 6.441   -9.639  -6.250  1.00 14.22 ? 113 ASN A CA  1 
ATOM   826  C C   . ASN A 1 109 ? 7.667   -8.820  -5.799  1.00 14.06 ? 113 ASN A C   1 
ATOM   827  O O   . ASN A 1 109 ? 8.805   -9.243  -6.008  1.00 13.84 ? 113 ASN A O   1 
ATOM   828  C CB  . ASN A 1 109 ? 5.854   -9.058  -7.527  1.00 13.87 ? 113 ASN A CB  1 
ATOM   829  C CG  . ASN A 1 109 ? 6.837   -9.054  -8.655  1.00 13.45 ? 113 ASN A CG  1 
ATOM   830  O OD1 . ASN A 1 109 ? 7.375   -8.010  -9.012  1.00 13.25 ? 113 ASN A OD1 1 
ATOM   831  N ND2 . ASN A 1 109 ? 7.098   -10.227 -9.217  1.00 12.43 ? 113 ASN A ND2 1 
ATOM   832  N N   . ALA A 1 110 ? 7.427   -7.655  -5.196  1.00 13.94 ? 114 ALA A N   1 
ATOM   833  C CA  . ALA A 1 110 ? 8.498   -6.766  -4.737  1.00 13.94 ? 114 ALA A CA  1 
ATOM   834  C C   . ALA A 1 110 ? 9.253   -7.353  -3.526  1.00 14.28 ? 114 ALA A C   1 
ATOM   835  O O   . ALA A 1 110 ? 10.482  -7.245  -3.431  1.00 14.20 ? 114 ALA A O   1 
ATOM   836  C CB  . ALA A 1 110 ? 7.939   -5.395  -4.417  1.00 13.62 ? 114 ALA A CB  1 
ATOM   837  N N   . ALA A 1 111 ? 8.502   -7.987  -2.621  1.00 14.38 ? 115 ALA A N   1 
ATOM   838  C CA  . ALA A 1 111 ? 9.051   -8.699  -1.470  1.00 14.21 ? 115 ALA A CA  1 
ATOM   839  C C   . ALA A 1 111 ? 9.913   -9.898  -1.880  1.00 14.28 ? 115 ALA A C   1 
ATOM   840  O O   . ALA A 1 111 ? 10.935  -10.182 -1.241  1.00 14.57 ? 115 ALA A O   1 
ATOM   841  C CB  . ALA A 1 111 ? 7.929   -9.141  -0.552  1.00 14.18 ? 115 ALA A CB  1 
ATOM   842  N N   . LYS A 1 112 ? 9.496   -10.600 -2.934  1.00 14.07 ? 116 LYS A N   1 
ATOM   843  C CA  . LYS A 1 112 ? 10.273  -11.701 -3.504  1.00 13.93 ? 116 LYS A CA  1 
ATOM   844  C C   . LYS A 1 112 ? 11.690  -11.223 -3.806  1.00 13.90 ? 116 LYS A C   1 
ATOM   845  O O   . LYS A 1 112 ? 12.662  -11.840 -3.359  1.00 13.78 ? 116 LYS A O   1 
ATOM   846  C CB  . LYS A 1 112 ? 9.600   -12.217 -4.782  1.00 14.07 ? 116 LYS A CB  1 
ATOM   847  C CG  . LYS A 1 112 ? 10.354  -13.309 -5.551  1.00 14.01 ? 116 LYS A CG  1 
ATOM   848  C CD  . LYS A 1 112 ? 9.765   -14.690 -5.305  1.00 14.20 ? 116 LYS A CD  1 
ATOM   849  C CE  . LYS A 1 112 ? 10.221  -15.683 -6.359  1.00 14.68 ? 116 LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 112 ? 10.132  -17.109 -5.889  1.00 15.22 ? 116 LYS A NZ  1 
ATOM   851  N N   . LEU A 1 113 ? 11.790  -10.110 -4.543  1.00 13.84 ? 117 LEU A N   1 
ATOM   852  C CA  . LEU A 1 113 ? 13.079  -9.532  -4.945  1.00 13.83 ? 117 LEU A CA  1 
ATOM   853  C C   . LEU A 1 113 ? 13.917  -9.088  -3.744  1.00 13.76 ? 117 LEU A C   1 
ATOM   854  O O   . LEU A 1 113 ? 15.087  -9.448  -3.632  1.00 13.50 ? 117 LEU A O   1 
ATOM   855  C CB  . LEU A 1 113 ? 12.878  -8.361  -5.913  1.00 13.60 ? 117 LEU A CB  1 
ATOM   856  C CG  . LEU A 1 113 ? 14.144  -7.550  -6.209  1.00 14.03 ? 117 LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 113 ? 14.997  -8.214  -7.271  1.00 14.51 ? 117 LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 113 ? 13.800  -6.137  -6.613  1.00 14.20 ? 117 LEU A CD2 1 
ATOM   859  N N   . LEU A 1 114 ? 13.291  -8.314  -2.859  1.00 13.86 ? 118 LEU A N   1 
ATOM   860  C CA  . LEU A 1 114 ? 13.917  -7.798  -1.651  1.00 14.00 ? 118 LEU A CA  1 
ATOM   861  C C   . LEU A 1 114 ? 14.466  -8.899  -0.748  1.00 14.17 ? 118 LEU A C   1 
ATOM   862  O O   . LEU A 1 114 ? 15.527  -8.733  -0.146  1.00 14.44 ? 118 LEU A O   1 
ATOM   863  C CB  . LEU A 1 114 ? 12.920  -6.949  -0.861  1.00 14.03 ? 118 LEU A CB  1 
ATOM   864  C CG  . LEU A 1 114 ? 12.478  -5.591  -1.409  1.00 13.83 ? 118 LEU A CG  1 
ATOM   865  C CD1 . LEU A 1 114 ? 11.423  -5.016  -0.495  1.00 13.56 ? 118 LEU A CD1 1 
ATOM   866  C CD2 . LEU A 1 114 ? 13.653  -4.616  -1.569  1.00 13.67 ? 118 LEU A CD2 1 
ATOM   867  N N   . SER A 1 115 ? 13.746  -10.015 -0.657  1.00 14.13 ? 119 SER A N   1 
ATOM   868  C CA  . SER A 1 115 ? 14.169  -11.133 0.184   1.00 14.19 ? 119 SER A CA  1 
ATOM   869  C C   . SER A 1 115 ? 15.303  -11.945 -0.441  1.00 14.31 ? 119 SER A C   1 
ATOM   870  O O   . SER A 1 115 ? 15.969  -12.710 0.252   1.00 14.39 ? 119 SER A O   1 
ATOM   871  C CB  . SER A 1 115 ? 12.988  -12.054 0.484   1.00 14.14 ? 119 SER A CB  1 
ATOM   872  O OG  . SER A 1 115 ? 12.608  -12.768 -0.673  1.00 13.85 ? 119 SER A OG  1 
ATOM   873  N N   . GLN A 1 116 ? 15.503  -11.787 -1.747  1.00 14.51 ? 120 GLN A N   1 
ATOM   874  C CA  . GLN A 1 116 ? 16.527  -12.537 -2.472  1.00 14.57 ? 120 GLN A CA  1 
ATOM   875  C C   . GLN A 1 116 ? 17.820  -11.732 -2.643  1.00 15.14 ? 120 GLN A C   1 
ATOM   876  O O   . GLN A 1 116 ? 18.823  -12.254 -3.137  1.00 15.51 ? 120 GLN A O   1 
ATOM   877  C CB  . GLN A 1 116 ? 15.989  -13.018 -3.825  1.00 14.48 ? 120 GLN A CB  1 
ATOM   878  C CG  . GLN A 1 116 ? 15.221  -14.332 -3.747  1.00 13.94 ? 120 GLN A CG  1 
ATOM   879  C CD  . GLN A 1 116 ? 14.354  -14.615 -4.967  1.00 13.74 ? 120 GLN A CD  1 
ATOM   880  O OE1 . GLN A 1 116 ? 14.613  -14.125 -6.066  1.00 12.99 ? 120 GLN A OE1 1 
ATOM   881  N NE2 . GLN A 1 116 ? 13.323  -15.414 -4.771  1.00 12.59 ? 120 GLN A NE2 1 
ATOM   882  N N   . PHE A 1 117 ? 17.790  -10.470 -2.222  1.00 15.37 ? 121 PHE A N   1 
ATOM   883  C CA  . PHE A 1 117 ? 18.954  -9.585  -2.280  1.00 15.74 ? 121 PHE A CA  1 
ATOM   884  C C   . PHE A 1 117 ? 20.089  -10.009 -1.311  1.00 16.03 ? 121 PHE A C   1 
ATOM   885  O O   . PHE A 1 117 ? 19.921  -10.007 -0.086  1.00 16.12 ? 121 PHE A O   1 
ATOM   886  C CB  . PHE A 1 117 ? 18.506  -8.131  -2.049  1.00 15.63 ? 121 PHE A CB  1 
ATOM   887  C CG  . PHE A 1 117 ? 19.638  -7.143  -1.904  1.00 16.08 ? 121 PHE A CG  1 
ATOM   888  C CD1 . PHE A 1 117 ? 20.539  -6.918  -2.946  1.00 16.68 ? 121 PHE A CD1 1 
ATOM   889  C CD2 . PHE A 1 117 ? 19.788  -6.414  -0.732  1.00 16.49 ? 121 PHE A CD2 1 
ATOM   890  C CE1 . PHE A 1 117 ? 21.579  -5.995  -2.819  1.00 16.37 ? 121 PHE A CE1 1 
ATOM   891  C CE2 . PHE A 1 117 ? 20.822  -5.485  -0.595  1.00 16.52 ? 121 PHE A CE2 1 
ATOM   892  C CZ  . PHE A 1 117 ? 21.721  -5.278  -1.642  1.00 16.35 ? 121 PHE A CZ  1 
ATOM   893  N N   . LYS A 1 118 ? 21.230  -10.384 -1.893  1.00 16.18 ? 122 LYS A N   1 
ATOM   894  C CA  . LYS A 1 118 ? 22.452  -10.739 -1.166  1.00 16.27 ? 122 LYS A CA  1 
ATOM   895  C C   . LYS A 1 118 ? 23.649  -10.224 -1.956  1.00 15.74 ? 122 LYS A C   1 
ATOM   896  O O   . LYS A 1 118 ? 23.584  -10.136 -3.181  1.00 15.64 ? 122 LYS A O   1 
ATOM   897  C CB  . LYS A 1 118 ? 22.588  -12.264 -1.053  1.00 16.44 ? 122 LYS A CB  1 
ATOM   898  C CG  . LYS A 1 118 ? 21.631  -12.966 -0.094  1.00 17.37 ? 122 LYS A CG  1 
ATOM   899  C CD  . LYS A 1 118 ? 22.150  -14.354 0.285   1.00 17.08 ? 122 LYS A CD  1 
ATOM   900  C CE  . LYS A 1 118 ? 21.752  -15.406 -0.748  1.00 19.08 ? 122 LYS A CE  1 
ATOM   901  N NZ  . LYS A 1 118 ? 22.389  -16.762 -0.501  1.00 19.12 ? 122 LYS A NZ  1 
ATOM   902  N N   . TRP A 1 119 ? 24.737  -9.902  -1.260  1.00 15.27 ? 123 TRP A N   1 
ATOM   903  C CA  . TRP A 1 119 ? 26.043  -9.637  -1.888  1.00 15.00 ? 123 TRP A CA  1 
ATOM   904  C C   . TRP A 1 119 ? 27.150  -9.574  -0.836  1.00 15.34 ? 123 TRP A C   1 
ATOM   905  O O   . TRP A 1 119 ? 26.859  -9.633  0.362   1.00 15.56 ? 123 TRP A O   1 
ATOM   906  C CB  . TRP A 1 119 ? 26.028  -8.381  -2.775  1.00 14.53 ? 123 TRP A CB  1 
ATOM   907  C CG  . TRP A 1 119 ? 25.772  -7.053  -2.087  1.00 14.18 ? 123 TRP A CG  1 
ATOM   908  C CD1 . TRP A 1 119 ? 25.359  -6.844  -0.796  1.00 13.80 ? 123 TRP A CD1 1 
ATOM   909  C CD2 . TRP A 1 119 ? 25.867  -5.751  -2.684  1.00 13.70 ? 123 TRP A CD2 1 
ATOM   910  N NE1 . TRP A 1 119 ? 25.215  -5.499  -0.553  1.00 13.40 ? 123 TRP A NE1 1 
ATOM   911  C CE2 . TRP A 1 119 ? 25.520  -4.804  -1.694  1.00 13.43 ? 123 TRP A CE2 1 
ATOM   912  C CE3 . TRP A 1 119 ? 26.218  -5.284  -3.960  1.00 13.31 ? 123 TRP A CE3 1 
ATOM   913  C CZ2 . TRP A 1 119 ? 25.521  -3.423  -1.937  1.00 13.49 ? 123 TRP A CZ2 1 
ATOM   914  C CZ3 . TRP A 1 119 ? 26.212  -3.911  -4.199  1.00 13.56 ? 123 TRP A CZ3 1 
ATOM   915  C CH2 . TRP A 1 119 ? 25.868  -3.000  -3.191  1.00 13.57 ? 123 TRP A CH2 1 
ATOM   916  N N   . THR A 1 120 ? 28.406  -9.477  -1.286  1.00 15.57 ? 124 THR A N   1 
ATOM   917  C CA  . THR A 1 120 ? 29.583  -9.486  -0.401  1.00 15.41 ? 124 THR A CA  1 
ATOM   918  C C   . THR A 1 120 ? 30.105  -8.079  -0.167  1.00 15.85 ? 124 THR A C   1 
ATOM   919  O O   . THR A 1 120 ? 29.624  -7.122  -0.784  1.00 15.73 ? 124 THR A O   1 
ATOM   920  C CB  . THR A 1 120 ? 30.725  -10.394 -0.949  1.00 15.37 ? 124 THR A CB  1 
ATOM   921  O OG1 . THR A 1 120 ? 31.124  -9.962  -2.256  1.00 15.13 ? 124 THR A OG1 1 
ATOM   922  C CG2 . THR A 1 120 ? 30.243  -11.822 -1.175  1.00 14.80 ? 124 THR A CG2 1 
ATOM   923  N N   . GLN A 1 121 ? 31.093  -7.974  0.727   1.00 16.29 ? 125 GLN A N   1 
ATOM   924  C CA  . GLN A 1 121 ? 31.676  -6.692  1.168   1.00 16.46 ? 125 GLN A CA  1 
ATOM   925  C C   . GLN A 1 121 ? 32.410  -5.921  0.082   1.00 16.48 ? 125 GLN A C   1 
ATOM   926  O O   . GLN A 1 121 ? 32.350  -4.688  0.032   1.00 16.62 ? 125 GLN A O   1 
ATOM   927  C CB  . GLN A 1 121 ? 32.663  -6.933  2.291   1.00 16.41 ? 125 GLN A CB  1 
ATOM   928  C CG  . GLN A 1 121 ? 32.036  -7.054  3.630   1.00 17.67 ? 125 GLN A CG  1 
ATOM   929  C CD  . GLN A 1 121 ? 33.051  -6.913  4.734   1.00 19.49 ? 125 GLN A CD  1 
ATOM   930  O OE1 . GLN A 1 121 ? 34.261  -6.994  4.499   1.00 20.17 ? 125 GLN A OE1 1 
ATOM   931  N NE2 . GLN A 1 121 ? 32.568  -6.691  5.946   1.00 20.94 ? 125 GLN A NE2 1 
ATOM   932  N N   . ASP A 1 122 ? 33.133  -6.649  -0.760  1.00 16.41 ? 126 ASP A N   1 
ATOM   933  C CA  . ASP A 1 122 ? 33.932  -6.031  -1.803  1.00 16.44 ? 126 ASP A CA  1 
ATOM   934  C C   . ASP A 1 122 ? 33.051  -5.698  -2.990  1.00 16.10 ? 126 ASP A C   1 
ATOM   935  O O   . ASP A 1 122 ? 33.390  -4.813  -3.776  1.00 16.34 ? 126 ASP A O   1 
ATOM   936  C CB  . ASP A 1 122 ? 35.097  -6.937  -2.221  1.00 16.78 ? 126 ASP A CB  1 
ATOM   937  C CG  . ASP A 1 122 ? 34.676  -8.381  -2.392  1.00 17.64 ? 126 ASP A CG  1 
ATOM   938  O OD1 . ASP A 1 122 ? 34.610  -9.106  -1.366  1.00 18.11 ? 126 ASP A OD1 1 
ATOM   939  O OD2 . ASP A 1 122 ? 34.388  -8.869  -3.512  1.00 18.32 ? 126 ASP A OD2 1 
ATOM   940  N N   . GLU A 1 123 ? 31.930  -6.415  -3.120  1.00 15.62 ? 127 GLU A N   1 
ATOM   941  C CA  . GLU A 1 123 ? 30.921  -6.109  -4.133  1.00 14.94 ? 127 GLU A CA  1 
ATOM   942  C C   . GLU A 1 123 ? 30.241  -4.795  -3.815  1.00 14.90 ? 127 GLU A C   1 
ATOM   943  O O   . GLU A 1 123 ? 29.975  -4.016  -4.721  1.00 14.77 ? 127 GLU A O   1 
ATOM   944  C CB  . GLU A 1 123 ? 29.895  -7.229  -4.248  1.00 14.82 ? 127 GLU A CB  1 
ATOM   945  C CG  . GLU A 1 123 ? 30.329  -8.324  -5.203  1.00 14.40 ? 127 GLU A CG  1 
ATOM   946  C CD  . GLU A 1 123 ? 29.510  -9.601  -5.107  1.00 13.87 ? 127 GLU A CD  1 
ATOM   947  O OE1 . GLU A 1 123 ? 28.553  -9.677  -4.306  1.00 12.52 ? 127 GLU A OE1 1 
ATOM   948  O OE2 . GLU A 1 123 ? 29.841  -10.545 -5.852  1.00 13.54 ? 127 GLU A OE2 1 
ATOM   949  N N   . MET A 1 124 ? 29.973  -4.553  -2.528  1.00 15.02 ? 128 MET A N   1 
ATOM   950  C CA  . MET A 1 124 ? 29.485  -3.250  -2.044  1.00 15.28 ? 128 MET A CA  1 
ATOM   951  C C   . MET A 1 124 ? 30.542  -2.134  -2.215  1.00 15.63 ? 128 MET A C   1 
ATOM   952  O O   . MET A 1 124 ? 30.199  -1.010  -2.594  1.00 16.11 ? 128 MET A O   1 
ATOM   953  C CB  . MET A 1 124 ? 29.012  -3.342  -0.582  1.00 15.10 ? 128 MET A CB  1 
ATOM   954  C CG  . MET A 1 124 ? 28.495  -2.019  -0.004  1.00 15.27 ? 128 MET A CG  1 
ATOM   955  S SD  . MET A 1 124 ? 28.142  -1.998  1.772   1.00 15.32 ? 128 MET A SD  1 
ATOM   956  C CE  . MET A 1 124 ? 26.483  -2.677  1.757   1.00 15.60 ? 128 MET A CE  1 
ATOM   957  N N   . GLY A 1 125 ? 31.811  -2.448  -1.938  1.00 15.57 ? 129 GLY A N   1 
ATOM   958  C CA  . GLY A 1 125 ? 32.932  -1.514  -2.155  1.00 15.43 ? 129 GLY A CA  1 
ATOM   959  C C   . GLY A 1 125 ? 33.155  -1.122  -3.610  1.00 15.43 ? 129 GLY A C   1 
ATOM   960  O O   . GLY A 1 125 ? 33.591  -0.010  -3.900  1.00 15.24 ? 129 GLY A O   1 
ATOM   961  N N   . GLU A 1 126 ? 32.871  -2.057  -4.519  1.00 15.71 ? 130 GLU A N   1 
ATOM   962  C CA  . GLU A 1 126 ? 32.802  -1.804  -5.961  1.00 15.82 ? 130 GLU A CA  1 
ATOM   963  C C   . GLU A 1 126 ? 32.012  -0.503  -6.172  1.00 15.59 ? 130 GLU A C   1 
ATOM   964  O O   . GLU A 1 126 ? 32.417  0.337   -6.972  1.00 15.59 ? 130 GLU A O   1 
ATOM   965  C CB  . GLU A 1 126 ? 32.210  -3.012  -6.689  1.00 16.18 ? 130 GLU A CB  1 
ATOM   966  C CG  . GLU A 1 126 ? 32.320  -2.940  -8.204  1.00 17.51 ? 130 GLU A CG  1 
ATOM   967  C CD  . GLU A 1 126 ? 31.724  -4.153  -8.890  1.00 20.00 ? 130 GLU A CD  1 
ATOM   968  O OE1 . GLU A 1 126 ? 31.225  -5.051  -8.180  1.00 20.00 ? 130 GLU A OE1 1 
ATOM   969  O OE2 . GLU A 1 126 ? 31.757  -4.205  -10.137 1.00 20.00 ? 130 GLU A OE2 1 
ATOM   970  N N   . ILE A 1 127 ? 30.925  -0.322  -5.413  1.00 15.30 ? 131 ILE A N   1 
ATOM   971  C CA  . ILE A 1 127 ? 30.086  0.883   -5.499  1.00 15.04 ? 131 ILE A CA  1 
ATOM   972  C C   . ILE A 1 127 ? 30.580  2.032   -4.621  1.00 14.94 ? 131 ILE A C   1 
ATOM   973  O O   . ILE A 1 127 ? 30.759  3.146   -5.114  1.00 14.93 ? 131 ILE A O   1 
ATOM   974  C CB  . ILE A 1 127 ? 28.593  0.560   -5.191  1.00 15.17 ? 131 ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 127 ? 28.019  -0.385  -6.254  1.00 14.92 ? 131 ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 127 ? 27.762  1.862   -5.091  1.00 15.10 ? 131 ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 127 ? 26.596  -0.806  -6.009  1.00 14.99 ? 131 ILE A CD1 1 
ATOM   978  N N   . MET A 1 128 ? 30.788  1.753   -3.331  1.00 14.87 ? 132 MET A N   1 
ATOM   979  C CA  . MET A 1 128 ? 31.246  2.750   -2.349  1.00 14.74 ? 132 MET A CA  1 
ATOM   980  C C   . MET A 1 128 ? 32.471  3.543   -2.795  1.00 14.75 ? 132 MET A C   1 
ATOM   981  O O   . MET A 1 128 ? 32.544  4.751   -2.550  1.00 14.86 ? 132 MET A O   1 
ATOM   982  C CB  . MET A 1 128 ? 31.557  2.093   -1.003  1.00 14.71 ? 132 MET A CB  1 
ATOM   983  C CG  . MET A 1 128 ? 30.368  1.513   -0.265  1.00 14.59 ? 132 MET A CG  1 
ATOM   984  S SD  . MET A 1 128 ? 30.801  1.057   1.426   1.00 14.77 ? 132 MET A SD  1 
ATOM   985  C CE  . MET A 1 128 ? 31.754  -0.441  1.172   1.00 14.41 ? 132 MET A CE  1 
ATOM   986  N N   . ILE A 1 129 ? 33.424  2.865   -3.440  1.00 14.67 ? 133 ILE A N   1 
ATOM   987  C CA  . ILE A 1 129 ? 34.674  3.500   -3.868  1.00 14.82 ? 133 ILE A CA  1 
ATOM   988  C C   . ILE A 1 129 ? 34.448  4.480   -5.009  1.00 14.87 ? 133 ILE A C   1 
ATOM   989  O O   . ILE A 1 129 ? 34.937  5.610   -4.958  1.00 15.06 ? 133 ILE A O   1 
ATOM   990  C CB  . ILE A 1 129 ? 35.765  2.457   -4.244  1.00 14.86 ? 133 ILE A CB  1 
ATOM   991  C CG1 . ILE A 1 129 ? 36.194  1.649   -3.013  1.00 14.89 ? 133 ILE A CG1 1 
ATOM   992  C CG2 . ILE A 1 129 ? 36.984  3.157   -4.846  1.00 14.62 ? 133 ILE A CG2 1 
ATOM   993  C CD1 . ILE A 1 129 ? 36.880  0.332   -3.342  1.00 14.40 ? 133 ILE A CD1 1 
ATOM   994  N N   . LYS A 1 130 ? 33.717  4.037   -6.031  1.00 14.85 ? 134 LYS A N   1 
ATOM   995  C CA  . LYS A 1 130 ? 33.338  4.893   -7.149  1.00 14.81 ? 134 LYS A CA  1 
ATOM   996  C C   . LYS A 1 130 ? 32.509  6.110   -6.722  1.00 14.66 ? 134 LYS A C   1 
ATOM   997  O O   . LYS A 1 130 ? 32.651  7.193   -7.307  1.00 14.59 ? 134 LYS A O   1 
ATOM   998  C CB  . LYS A 1 130 ? 32.592  4.100   -8.220  1.00 14.97 ? 134 LYS A CB  1 
ATOM   999  C CG  . LYS A 1 130 ? 33.340  3.979   -9.535  1.00 15.73 ? 134 LYS A CG  1 
ATOM   1000 C CD  . LYS A 1 130 ? 33.834  2.572   -9.790  1.00 17.08 ? 134 LYS A CD  1 
ATOM   1001 C CE  . LYS A 1 130 ? 34.109  2.394   -11.279 1.00 18.44 ? 134 LYS A CE  1 
ATOM   1002 N NZ  . LYS A 1 130 ? 34.550  1.015   -11.619 1.00 19.20 ? 134 LYS A NZ  1 
ATOM   1003 N N   . VAL A 1 131 ? 31.659  5.938   -5.709  1.00 14.36 ? 135 VAL A N   1 
ATOM   1004 C CA  . VAL A 1 131 ? 30.851  7.052   -5.205  1.00 14.46 ? 135 VAL A CA  1 
ATOM   1005 C C   . VAL A 1 131 ? 31.701  8.090   -4.455  1.00 14.70 ? 135 VAL A C   1 
ATOM   1006 O O   . VAL A 1 131 ? 31.526  9.296   -4.682  1.00 14.71 ? 135 VAL A O   1 
ATOM   1007 C CB  . VAL A 1 131 ? 29.611  6.588   -4.377  1.00 14.42 ? 135 VAL A CB  1 
ATOM   1008 C CG1 . VAL A 1 131 ? 28.929  7.766   -3.694  1.00 13.96 ? 135 VAL A CG1 1 
ATOM   1009 C CG2 . VAL A 1 131 ? 28.607  5.845   -5.269  1.00 14.08 ? 135 VAL A CG2 1 
ATOM   1010 N N   . GLU A 1 132 ? 32.625  7.633   -3.600  1.00 14.89 ? 136 GLU A N   1 
ATOM   1011 C CA  . GLU A 1 132 ? 33.555  8.547   -2.909  1.00 15.20 ? 136 GLU A CA  1 
ATOM   1012 C C   . GLU A 1 132 ? 34.507  9.259   -3.874  1.00 15.24 ? 136 GLU A C   1 
ATOM   1013 O O   . GLU A 1 132 ? 34.964  10.372  -3.595  1.00 15.23 ? 136 GLU A O   1 
ATOM   1014 C CB  . GLU A 1 132 ? 34.381  7.786   -1.870  1.00 15.34 ? 136 GLU A CB  1 
ATOM   1015 C CG  . GLU A 1 132 ? 35.192  8.680   -0.946  1.00 16.06 ? 136 GLU A CG  1 
ATOM   1016 C CD  . GLU A 1 132 ? 34.322  9.458   0.022   1.00 20.00 ? 136 GLU A CD  1 
ATOM   1017 O OE1 . GLU A 1 132 ? 33.085  9.297   -0.030  1.00 20.00 ? 136 GLU A OE1 1 
ATOM   1018 O OE2 . GLU A 1 132 ? 34.879  10.228  0.833   1.00 20.00 ? 136 GLU A OE2 1 
ATOM   1019 N N   . GLU A 1 133 ? 34.801  8.604   -5.001  1.00 15.39 ? 137 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 133 ? 35.516  9.213   -6.127  1.00 15.40 ? 137 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 133 ? 34.689  10.318  -6.796  1.00 15.39 ? 137 GLU A C   1 
ATOM   1022 O O   . GLU A 1 133 ? 35.185  11.011  -7.685  1.00 15.45 ? 137 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 133 ? 35.901  8.148   -7.156  1.00 15.40 ? 137 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 133 ? 36.805  7.055   -6.610  1.00 15.99 ? 137 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 133 ? 37.968  6.745   -7.532  1.00 20.00 ? 137 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 133 ? 38.066  7.387   -8.599  1.00 20.00 ? 137 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 133 ? 38.790  5.875   -7.179  1.00 20.00 ? 137 GLU A OE2 1 
ATOM   1028 N N   . GLY A 1 134 ? 33.432  10.470  -6.376  1.00 15.34 ? 138 GLY A N   1 
ATOM   1029 C CA  . GLY A 1 134 ? 32.568  11.538  -6.877  1.00 15.47 ? 138 GLY A CA  1 
ATOM   1030 C C   . GLY A 1 134 ? 31.602  11.135  -7.980  1.00 15.51 ? 138 GLY A C   1 
ATOM   1031 O O   . GLY A 1 134 ? 30.840  11.967  -8.480  1.00 15.31 ? 138 GLY A O   1 
ATOM   1032 N N   . GLU A 1 135 ? 31.646  9.864   -8.371  1.00 15.66 ? 139 GLU A N   1 
ATOM   1033 C CA  . GLU A 1 135 ? 30.670  9.318   -9.300  1.00 15.85 ? 139 GLU A CA  1 
ATOM   1034 C C   . GLU A 1 135 ? 29.299  9.352   -8.642  1.00 15.80 ? 139 GLU A C   1 
ATOM   1035 O O   . GLU A 1 135 ? 29.176  9.124   -7.435  1.00 15.70 ? 139 GLU A O   1 
ATOM   1036 C CB  . GLU A 1 135 ? 31.077  7.910   -9.738  1.00 16.01 ? 139 GLU A CB  1 
ATOM   1037 C CG  . GLU A 1 135 ? 31.114  7.714   -11.245 1.00 16.95 ? 139 GLU A CG  1 
ATOM   1038 C CD  . GLU A 1 135 ? 32.492  7.337   -11.750 1.00 20.00 ? 139 GLU A CD  1 
ATOM   1039 O OE1 . GLU A 1 135 ? 33.420  7.229   -10.921 1.00 20.00 ? 139 GLU A OE1 1 
ATOM   1040 O OE2 . GLU A 1 135 ? 32.644  7.149   -12.975 1.00 20.00 ? 139 GLU A OE2 1 
ATOM   1041 N N   . LYS A 1 136 ? 28.280  9.654   -9.441  1.00 15.86 ? 140 LYS A N   1 
ATOM   1042 C CA  . LYS A 1 136 ? 26.900  9.708   -8.957  1.00 15.89 ? 140 LYS A CA  1 
ATOM   1043 C C   . LYS A 1 136 ? 26.316  8.307   -8.689  1.00 15.73 ? 140 LYS A C   1 
ATOM   1044 O O   . LYS A 1 136 ? 26.336  7.438   -9.566  1.00 15.79 ? 140 LYS A O   1 
ATOM   1045 C CB  . LYS A 1 136 ? 26.021  10.505  -9.928  1.00 16.01 ? 140 LYS A CB  1 
ATOM   1046 C CG  . LYS A 1 136 ? 26.428  11.979  -10.083 1.00 16.65 ? 140 LYS A CG  1 
ATOM   1047 C CD  . LYS A 1 136 ? 26.035  12.844  -8.873  1.00 17.08 ? 140 LYS A CD  1 
ATOM   1048 C CE  . LYS A 1 136 ? 27.202  13.061  -7.911  1.00 16.86 ? 140 LYS A CE  1 
ATOM   1049 N NZ  . LYS A 1 136 ? 26.871  14.071  -6.872  1.00 16.83 ? 140 LYS A NZ  1 
ATOM   1050 N N   . PRO A 1 137 ? 25.804  8.094   -7.477  1.00 15.41 ? 141 PRO A N   1 
ATOM   1051 C CA  . PRO A 1 137 ? 25.305  6.794   -7.056  1.00 15.34 ? 141 PRO A CA  1 
ATOM   1052 C C   . PRO A 1 137 ? 24.397  6.082   -8.063  1.00 15.50 ? 141 PRO A C   1 
ATOM   1053 O O   . PRO A 1 137 ? 24.560  4.880   -8.262  1.00 15.50 ? 141 PRO A O   1 
ATOM   1054 C CB  . PRO A 1 137 ? 24.543  7.123   -5.772  1.00 15.27 ? 141 PRO A CB  1 
ATOM   1055 C CG  . PRO A 1 137 ? 25.257  8.300   -5.218  1.00 15.10 ? 141 PRO A CG  1 
ATOM   1056 C CD  . PRO A 1 137 ? 25.676  9.099   -6.406  1.00 15.37 ? 141 PRO A CD  1 
ATOM   1057 N N   . ALA A 1 138 ? 23.465  6.805   -8.692  1.00 15.70 ? 142 ALA A N   1 
ATOM   1058 C CA  . ALA A 1 138 ? 22.526  6.210   -9.661  1.00 15.75 ? 142 ALA A CA  1 
ATOM   1059 C C   . ALA A 1 138 ? 23.237  5.686   -10.910 1.00 15.89 ? 142 ALA A C   1 
ATOM   1060 O O   . ALA A 1 138 ? 22.833  4.669   -11.484 1.00 15.85 ? 142 ALA A O   1 
ATOM   1061 C CB  . ALA A 1 138 ? 21.442  7.199   -10.046 1.00 15.80 ? 142 ALA A CB  1 
ATOM   1062 N N   . LYS A 1 139 ? 24.292  6.387   -11.324 1.00 15.95 ? 143 LYS A N   1 
ATOM   1063 C CA  . LYS A 1 139 ? 25.136  5.941   -12.430 1.00 15.93 ? 143 LYS A CA  1 
ATOM   1064 C C   . LYS A 1 139 ? 25.937  4.696   -12.060 1.00 16.05 ? 143 LYS A C   1 
ATOM   1065 O O   . LYS A 1 139 ? 26.006  3.756   -12.855 1.00 16.15 ? 143 LYS A O   1 
ATOM   1066 C CB  . LYS A 1 139 ? 26.089  7.049   -12.877 1.00 15.96 ? 143 LYS A CB  1 
ATOM   1067 C CG  . LYS A 1 139 ? 25.547  7.950   -13.967 1.00 15.82 ? 143 LYS A CG  1 
ATOM   1068 C CD  . LYS A 1 139 ? 26.668  8.788   -14.558 1.00 15.71 ? 143 LYS A CD  1 
ATOM   1069 C CE  . LYS A 1 139 ? 26.204  9.534   -15.799 1.00 16.13 ? 143 LYS A CE  1 
ATOM   1070 N NZ  . LYS A 1 139 ? 27.209  10.553  -16.240 1.00 15.78 ? 143 LYS A NZ  1 
ATOM   1071 N N   . VAL A 1 140 ? 26.537  4.694   -10.864 1.00 16.02 ? 144 VAL A N   1 
ATOM   1072 C CA  . VAL A 1 140 ? 27.332  3.551   -10.390 1.00 16.04 ? 144 VAL A CA  1 
ATOM   1073 C C   . VAL A 1 140 ? 26.442  2.319   -10.215 1.00 16.17 ? 144 VAL A C   1 
ATOM   1074 O O   . VAL A 1 140 ? 26.854  1.202   -10.540 1.00 16.28 ? 144 VAL A O   1 
ATOM   1075 C CB  . VAL A 1 140 ? 28.119  3.852   -9.072  1.00 16.13 ? 144 VAL A CB  1 
ATOM   1076 C CG1 . VAL A 1 140 ? 29.056  2.693   -8.706  1.00 15.67 ? 144 VAL A CG1 1 
ATOM   1077 C CG2 . VAL A 1 140 ? 28.928  5.134   -9.199  1.00 16.04 ? 144 VAL A CG2 1 
ATOM   1078 N N   . ALA A 1 141 ? 25.223  2.529   -9.716  1.00 16.21 ? 145 ALA A N   1 
ATOM   1079 C CA  . ALA A 1 141 ? 24.223  1.461   -9.622  1.00 16.27 ? 145 ALA A CA  1 
ATOM   1080 C C   . ALA A 1 141 ? 23.916  0.847   -10.991 1.00 16.47 ? 145 ALA A C   1 
ATOM   1081 O O   . ALA A 1 141 ? 23.920  -0.380  -11.133 1.00 16.69 ? 145 ALA A O   1 
ATOM   1082 C CB  . ALA A 1 141 ? 22.950  1.967   -8.967  1.00 16.25 ? 145 ALA A CB  1 
ATOM   1083 N N   . ALA A 1 142 ? 23.661  1.693   -11.994 1.00 16.54 ? 146 ALA A N   1 
ATOM   1084 C CA  . ALA A 1 142 ? 23.427  1.220   -13.366 1.00 16.46 ? 146 ALA A CA  1 
ATOM   1085 C C   . ALA A 1 142 ? 24.632  0.436   -13.877 1.00 16.49 ? 146 ALA A C   1 
ATOM   1086 O O   . ALA A 1 142 ? 24.480  -0.688  -14.349 1.00 16.54 ? 146 ALA A O   1 
ATOM   1087 C CB  . ALA A 1 142 ? 23.095  2.380   -14.299 1.00 16.35 ? 146 ALA A CB  1 
ATOM   1088 N N   . GLU A 1 143 ? 25.825  1.023   -13.757 1.00 16.56 ? 147 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 143 ? 27.075  0.378   -14.181 1.00 16.78 ? 147 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 143 ? 27.227  -1.010  -13.555 1.00 16.72 ? 147 GLU A C   1 
ATOM   1091 O O   . GLU A 1 143 ? 27.649  -1.960  -14.215 1.00 16.61 ? 147 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 143 ? 28.277  1.255   -13.827 1.00 17.03 ? 147 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 143 ? 28.257  2.629   -14.478 1.00 17.57 ? 147 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 143 ? 29.463  3.468   -14.104 1.00 20.00 ? 147 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 143 ? 30.315  2.976   -13.335 1.00 20.00 ? 147 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 143 ? 29.555  4.619   -14.580 1.00 20.00 ? 147 GLU A OE2 1 
ATOM   1097 N N   . TYR A 1 144 ? 26.868  -1.101  -12.276 1.00 16.80 ? 148 TYR A N   1 
ATOM   1098 C CA  . TYR A 1 144 ? 26.963  -2.335  -11.501 1.00 16.72 ? 148 TYR A CA  1 
ATOM   1099 C C   . TYR A 1 144 ? 26.035  -3.435  -12.034 1.00 16.77 ? 148 TYR A C   1 
ATOM   1100 O O   . TYR A 1 144 ? 26.464  -4.577  -12.208 1.00 16.85 ? 148 TYR A O   1 
ATOM   1101 C CB  . TYR A 1 144 ? 26.657  -2.058  -10.027 1.00 16.41 ? 148 TYR A CB  1 
ATOM   1102 C CG  . TYR A 1 144 ? 26.907  -3.237  -9.134  1.00 16.38 ? 148 TYR A CG  1 
ATOM   1103 C CD1 . TYR A 1 144 ? 28.097  -3.348  -8.414  1.00 16.88 ? 148 TYR A CD1 1 
ATOM   1104 C CD2 . TYR A 1 144 ? 25.958  -4.246  -9.000  1.00 16.22 ? 148 TYR A CD2 1 
ATOM   1105 C CE1 . TYR A 1 144 ? 28.333  -4.433  -7.578  1.00 16.84 ? 148 TYR A CE1 1 
ATOM   1106 C CE2 . TYR A 1 144 ? 26.185  -5.340  -8.174  1.00 16.63 ? 148 TYR A CE2 1 
ATOM   1107 C CZ  . TYR A 1 144 ? 27.372  -5.429  -7.467  1.00 16.83 ? 148 TYR A CZ  1 
ATOM   1108 O OH  . TYR A 1 144 ? 27.589  -6.518  -6.655  1.00 16.93 ? 148 TYR A OH  1 
ATOM   1109 N N   . VAL A 1 145 ? 24.772  -3.090  -12.284 1.00 16.67 ? 149 VAL A N   1 
ATOM   1110 C CA  . VAL A 1 145 ? 23.785  -4.081  -12.714 1.00 16.76 ? 149 VAL A CA  1 
ATOM   1111 C C   . VAL A 1 145 ? 24.038  -4.567  -14.143 1.00 16.81 ? 149 VAL A C   1 
ATOM   1112 O O   . VAL A 1 145 ? 23.762  -5.720  -14.469 1.00 16.85 ? 149 VAL A O   1 
ATOM   1113 C CB  . VAL A 1 145 ? 22.308  -3.599  -12.524 1.00 16.75 ? 149 VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 145 ? 22.075  -3.122  -11.090 1.00 16.80 ? 149 VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 145 ? 21.925  -2.503  -13.514 1.00 17.21 ? 149 VAL A CG2 1 
ATOM   1116 N N   . ASN A 1 146 ? 24.585  -3.690  -14.982 1.00 16.98 ? 150 ASN A N   1 
ATOM   1117 C CA  . ASN A 1 146 ? 24.911  -4.041  -16.368 1.00 17.13 ? 150 ASN A CA  1 
ATOM   1118 C C   . ASN A 1 146 ? 26.283  -4.707  -16.469 1.00 17.07 ? 150 ASN A C   1 
ATOM   1119 O O   . ASN A 1 146 ? 26.786  -4.964  -17.568 1.00 17.11 ? 150 ASN A O   1 
ATOM   1120 C CB  . ASN A 1 146 ? 24.803  -2.805  -17.273 1.00 17.11 ? 150 ASN A CB  1 
ATOM   1121 C CG  . ASN A 1 146 ? 23.432  -2.143  -17.186 1.00 17.39 ? 150 ASN A CG  1 
ATOM   1122 O OD1 . ASN A 1 146 ? 22.401  -2.796  -17.376 1.00 17.61 ? 150 ASN A OD1 1 
ATOM   1123 N ND2 . ASN A 1 146 ? 23.414  -0.847  -16.879 1.00 17.16 ? 150 ASN A ND2 1 
ATOM   1124 N N   . LYS A 1 147 ? 26.861  -4.988  -15.299 1.00 16.99 ? 151 LYS A N   1 
ATOM   1125 C CA  . LYS A 1 147 ? 28.161  -5.637  -15.166 1.00 16.87 ? 151 LYS A CA  1 
ATOM   1126 C C   . LYS A 1 147 ? 28.013  -7.003  -14.496 1.00 16.91 ? 151 LYS A C   1 
ATOM   1127 O O   . LYS A 1 147 ? 28.329  -8.029  -15.107 1.00 17.08 ? 151 LYS A O   1 
ATOM   1128 C CB  . LYS A 1 147 ? 29.113  -4.752  -14.366 1.00 16.74 ? 151 LYS A CB  1 
ATOM   1129 C CG  . LYS A 1 147 ? 30.489  -5.341  -14.167 1.00 16.55 ? 151 LYS A CG  1 
ATOM   1130 C CD  . LYS A 1 147 ? 31.361  -4.372  -13.422 1.00 15.94 ? 151 LYS A CD  1 
ATOM   1131 C CE  . LYS A 1 147 ? 32.795  -4.815  -13.427 1.00 15.64 ? 151 LYS A CE  1 
ATOM   1132 N NZ  . LYS A 1 147 ? 33.581  -3.803  -12.687 1.00 16.41 ? 151 LYS A NZ  1 
ATOM   1133 N N   . HIS A 1 148 ? 27.531  -7.003  -13.251 1.00 16.77 ? 152 HIS A N   1 
ATOM   1134 C CA  . HIS A 1 148 ? 27.213  -8.229  -12.507 1.00 16.77 ? 152 HIS A CA  1 
ATOM   1135 C C   . HIS A 1 148 ? 25.885  -8.897  -12.967 1.00 16.66 ? 152 HIS A C   1 
ATOM   1136 O O   . HIS A 1 148 ? 24.979  -9.120  -12.156 1.00 16.47 ? 152 HIS A O   1 
ATOM   1137 C CB  . HIS A 1 148 ? 27.152  -7.923  -11.006 1.00 16.86 ? 152 HIS A CB  1 
ATOM   1138 C CG  . HIS A 1 148 ? 28.435  -7.403  -10.431 1.00 17.67 ? 152 HIS A CG  1 
ATOM   1139 N ND1 . HIS A 1 148 ? 29.295  -8.190  -9.692  1.00 18.30 ? 152 HIS A ND1 1 
ATOM   1140 C CD2 . HIS A 1 148 ? 28.996  -6.170  -10.466 1.00 18.39 ? 152 HIS A CD2 1 
ATOM   1141 C CE1 . HIS A 1 148 ? 30.335  -7.468  -9.308  1.00 18.58 ? 152 HIS A CE1 1 
ATOM   1142 N NE2 . HIS A 1 148 ? 30.178  -6.238  -9.763  1.00 18.72 ? 152 HIS A NE2 1 
ATOM   1143 N N   . LYS A 1 149 ? 25.797  -9.229  -14.259 1.00 16.59 ? 153 LYS A N   1 
ATOM   1144 C CA  . LYS A 1 149 ? 24.585  -9.783  -14.897 1.00 16.50 ? 153 LYS A CA  1 
ATOM   1145 C C   . LYS A 1 149 ? 23.970  -10.996 -14.184 1.00 16.39 ? 153 LYS A C   1 
ATOM   1146 O O   . LYS A 1 149 ? 22.744  -11.114 -14.076 1.00 16.36 ? 153 LYS A O   1 
ATOM   1147 C CB  . LYS A 1 149 ? 24.889  -10.174 -16.349 1.00 16.56 ? 153 LYS A CB  1 
ATOM   1148 C CG  . LYS A 1 149 ? 25.327  -9.035  -17.256 1.00 16.79 ? 153 LYS A CG  1 
ATOM   1149 C CD  . LYS A 1 149 ? 24.286  -8.725  -18.319 1.00 16.78 ? 153 LYS A CD  1 
ATOM   1150 C CE  . LYS A 1 149 ? 24.947  -8.033  -19.502 1.00 16.64 ? 153 LYS A CE  1 
ATOM   1151 N NZ  . LYS A 1 149 ? 24.108  -8.081  -20.724 1.00 16.83 ? 153 LYS A NZ  1 
ATOM   1152 N N   . ASP A 1 150 ? 24.827  -11.901 -13.723 1.00 16.15 ? 154 ASP A N   1 
ATOM   1153 C CA  . ASP A 1 150 ? 24.388  -13.137 -13.087 1.00 16.03 ? 154 ASP A CA  1 
ATOM   1154 C C   . ASP A 1 150 ? 23.856  -12.947 -11.672 1.00 15.89 ? 154 ASP A C   1 
ATOM   1155 O O   . ASP A 1 150 ? 22.988  -13.705 -11.228 1.00 15.83 ? 154 ASP A O   1 
ATOM   1156 C CB  . ASP A 1 150 ? 25.534  -14.144 -13.060 1.00 16.21 ? 154 ASP A CB  1 
ATOM   1157 C CG  . ASP A 1 150 ? 25.748  -14.814 -14.390 1.00 16.72 ? 154 ASP A CG  1 
ATOM   1158 O OD1 . ASP A 1 150 ? 26.375  -15.892 -14.399 1.00 17.13 ? 154 ASP A OD1 1 
ATOM   1159 O OD2 . ASP A 1 150 ? 25.324  -14.346 -15.474 1.00 18.07 ? 154 ASP A OD2 1 
ATOM   1160 N N   . GLN A 1 151 ? 24.395  -11.956 -10.960 1.00 15.69 ? 155 GLN A N   1 
ATOM   1161 C CA  . GLN A 1 151 ? 23.968  -11.678 -9.595  1.00 15.25 ? 155 GLN A CA  1 
ATOM   1162 C C   . GLN A 1 151 ? 22.531  -11.161 -9.587  1.00 15.21 ? 155 GLN A C   1 
ATOM   1163 O O   . GLN A 1 151 ? 21.744  -11.534 -8.721  1.00 15.29 ? 155 GLN A O   1 
ATOM   1164 C CB  . GLN A 1 151 ? 24.912  -10.694 -8.918  1.00 14.93 ? 155 GLN A CB  1 
ATOM   1165 C CG  . GLN A 1 151 ? 24.682  -10.580 -7.431  1.00 14.92 ? 155 GLN A CG  1 
ATOM   1166 C CD  . GLN A 1 151 ? 25.826  -9.900  -6.709  1.00 15.08 ? 155 GLN A CD  1 
ATOM   1167 O OE1 . GLN A 1 151 ? 26.062  -8.702  -6.875  1.00 14.91 ? 155 GLN A OE1 1 
ATOM   1168 N NE2 . GLN A 1 151 ? 26.535  -10.662 -5.899  1.00 15.23 ? 155 GLN A NE2 1 
ATOM   1169 N N   . ILE A 1 152 ? 22.197  -10.319 -10.565 1.00 15.13 ? 156 ILE A N   1 
ATOM   1170 C CA  . ILE A 1 152 ? 20.846  -9.770  -10.697 1.00 15.18 ? 156 ILE A CA  1 
ATOM   1171 C C   . ILE A 1 152 ? 19.833  -10.883 -11.009 1.00 15.28 ? 156 ILE A C   1 
ATOM   1172 O O   . ILE A 1 152 ? 18.733  -10.891 -10.446 1.00 15.35 ? 156 ILE A O   1 
ATOM   1173 C CB  . ILE A 1 152 ? 20.800  -8.614  -11.760 1.00 15.13 ? 156 ILE A CB  1 
ATOM   1174 C CG1 . ILE A 1 152 ? 21.207  -7.272  -11.147 1.00 15.12 ? 156 ILE A CG1 1 
ATOM   1175 C CG2 . ILE A 1 152 ? 19.402  -8.434  -12.323 1.00 14.80 ? 156 ILE A CG2 1 
ATOM   1176 C CD1 . ILE A 1 152 ? 22.678  -7.122  -10.755 1.00 14.96 ? 156 ILE A CD1 1 
ATOM   1177 N N   . ALA A 1 153 ? 20.216  -11.814 -11.889 1.00 15.14 ? 157 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 153 ? 19.416  -13.006 -12.183 1.00 15.11 ? 157 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 153 ? 19.041  -13.783 -10.907 1.00 15.37 ? 157 ALA A C   1 
ATOM   1180 O O   . ALA A 1 153 ? 17.881  -14.177 -10.748 1.00 15.30 ? 157 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 153 ? 20.142  -13.903 -13.169 1.00 15.01 ? 157 ALA A CB  1 
ATOM   1182 N N   . GLU A 1 154 ? 20.016  -13.996 -10.011 1.00 15.71 ? 158 GLU A N   1 
ATOM   1183 C CA  . GLU A 1 154 ? 19.763  -14.548 -8.671  1.00 15.95 ? 158 GLU A CA  1 
ATOM   1184 C C   . GLU A 1 154 ? 18.627  -13.781 -8.011  1.00 15.93 ? 158 GLU A C   1 
ATOM   1185 O O   . GLU A 1 154 ? 17.600  -14.365 -7.660  1.00 16.06 ? 158 GLU A O   1 
ATOM   1186 C CB  . GLU A 1 154 ? 21.041  -14.521 -7.830  1.00 16.28 ? 158 GLU A CB  1 
ATOM   1187 C CG  . GLU A 1 154 ? 22.189  -15.325 -8.420  1.00 17.68 ? 158 GLU A CG  1 
ATOM   1188 C CD  . GLU A 1 154 ? 23.437  -15.275 -7.560  1.00 20.00 ? 158 GLU A CD  1 
ATOM   1189 O OE1 . GLU A 1 154 ? 23.404  -14.610 -6.503  1.00 20.00 ? 158 GLU A OE1 1 
ATOM   1190 O OE2 . GLU A 1 154 ? 24.448  -15.899 -7.944  1.00 20.00 ? 158 GLU A OE2 1 
ATOM   1191 N N   . TRP A 1 155 ? 18.819  -12.466 -7.874  1.00 15.73 ? 159 TRP A N   1 
ATOM   1192 C CA  . TRP A 1 155 ? 17.886  -11.577 -7.186  1.00 15.44 ? 159 TRP A CA  1 
ATOM   1193 C C   . TRP A 1 155 ? 16.496  -11.539 -7.825  1.00 15.39 ? 159 TRP A C   1 
ATOM   1194 O O   . TRP A 1 155 ? 15.488  -11.538 -7.113  1.00 15.48 ? 159 TRP A O   1 
ATOM   1195 C CB  . TRP A 1 155 ? 18.452  -10.155 -7.106  1.00 15.39 ? 159 TRP A CB  1 
ATOM   1196 C CG  . TRP A 1 155 ? 19.786  -10.021 -6.394  1.00 15.45 ? 159 TRP A CG  1 
ATOM   1197 C CD1 . TRP A 1 155 ? 20.412  -10.953 -5.606  1.00 15.49 ? 159 TRP A CD1 1 
ATOM   1198 C CD2 . TRP A 1 155 ? 20.635  -8.866  -6.385  1.00 15.41 ? 159 TRP A CD2 1 
ATOM   1199 N NE1 . TRP A 1 155 ? 21.602  -10.455 -5.130  1.00 15.18 ? 159 TRP A NE1 1 
ATOM   1200 C CE2 . TRP A 1 155 ? 21.764  -9.174  -5.589  1.00 15.13 ? 159 TRP A CE2 1 
ATOM   1201 C CE3 . TRP A 1 155 ? 20.558  -7.593  -6.977  1.00 15.25 ? 159 TRP A CE3 1 
ATOM   1202 C CZ2 . TRP A 1 155 ? 22.806  -8.263  -5.373  1.00 15.17 ? 159 TRP A CZ2 1 
ATOM   1203 C CZ3 . TRP A 1 155 ? 21.591  -6.688  -6.757  1.00 15.39 ? 159 TRP A CZ3 1 
ATOM   1204 C CH2 . TRP A 1 155 ? 22.702  -7.031  -5.962  1.00 15.37 ? 159 TRP A CH2 1 
ATOM   1205 N N   . THR A 1 156 ? 16.449  -11.516 -9.160  1.00 15.20 ? 160 THR A N   1 
ATOM   1206 C CA  . THR A 1 156 ? 15.179  -11.414 -9.902  1.00 14.77 ? 160 THR A CA  1 
ATOM   1207 C C   . THR A 1 156 ? 14.598  -12.770 -10.296 1.00 14.76 ? 160 THR A C   1 
ATOM   1208 O O   . THR A 1 156 ? 13.674  -12.827 -11.104 1.00 14.69 ? 160 THR A O   1 
ATOM   1209 C CB  . THR A 1 156 ? 15.336  -10.546 -11.165 1.00 14.54 ? 160 THR A CB  1 
ATOM   1210 O OG1 . THR A 1 156 ? 16.266  -11.168 -12.058 1.00 14.20 ? 160 THR A OG1 1 
ATOM   1211 C CG2 . THR A 1 156 ? 15.989  -9.223  -10.832 1.00 14.42 ? 160 THR A CG2 1 
ATOM   1212 N N   . LYS A 1 157 ? 15.139  -13.847 -9.727  1.00 14.79 ? 161 LYS A N   1 
ATOM   1213 C CA  . LYS A 1 157 ? 14.680  -15.209 -10.014 1.00 14.84 ? 161 LYS A CA  1 
ATOM   1214 C C   . LYS A 1 157 ? 13.197  -15.357 -9.679  1.00 14.85 ? 161 LYS A C   1 
ATOM   1215 O O   . LYS A 1 157 ? 12.782  -15.068 -8.547  1.00 14.90 ? 161 LYS A O   1 
ATOM   1216 C CB  . LYS A 1 157 ? 15.509  -16.225 -9.219  1.00 14.91 ? 161 LYS A CB  1 
ATOM   1217 C CG  . LYS A 1 157 ? 14.944  -17.637 -9.153  1.00 14.69 ? 161 LYS A CG  1 
ATOM   1218 C CD  . LYS A 1 157 ? 15.429  -18.464 -10.318 1.00 15.08 ? 161 LYS A CD  1 
ATOM   1219 C CE  . LYS A 1 157 ? 15.245  -19.940 -10.048 1.00 15.29 ? 161 LYS A CE  1 
ATOM   1220 N NZ  . LYS A 1 157 ? 16.202  -20.727 -10.867 1.00 15.75 ? 161 LYS A NZ  1 
ATOM   1221 N N   . GLY A 1 158 ? 12.415  -15.801 -10.668 1.00 14.63 ? 162 GLY A N   1 
ATOM   1222 C CA  . GLY A 1 158 ? 10.962  -15.916 -10.548 1.00 14.54 ? 162 GLY A CA  1 
ATOM   1223 C C   . GLY A 1 158 ? 10.250  -14.622 -10.167 1.00 14.62 ? 162 GLY A C   1 
ATOM   1224 O O   . GLY A 1 158 ? 9.221   -14.661 -9.492  1.00 14.57 ? 162 GLY A O   1 
ATOM   1225 N N   . VAL A 1 159 ? 10.800  -13.480 -10.591 1.00 14.70 ? 163 VAL A N   1 
ATOM   1226 C CA  . VAL A 1 159 ? 10.220  -12.163 -10.302 1.00 14.79 ? 163 VAL A CA  1 
ATOM   1227 C C   . VAL A 1 159 ? 9.660   -11.528 -11.586 1.00 15.17 ? 163 VAL A C   1 
ATOM   1228 O O   . VAL A 1 159 ? 10.398  -11.252 -12.537 1.00 15.09 ? 163 VAL A O   1 
ATOM   1229 C CB  . VAL A 1 159 ? 11.234  -11.204 -9.577  1.00 14.69 ? 163 VAL A CB  1 
ATOM   1230 C CG1 . VAL A 1 159 ? 10.591  -9.864  -9.213  1.00 13.92 ? 163 VAL A CG1 1 
ATOM   1231 C CG2 . VAL A 1 159 ? 11.803  -11.852 -8.318  1.00 14.86 ? 163 VAL A CG2 1 
ATOM   1232 N N   . GLN A 1 160 ? 8.344   -11.315 -11.594 1.00 15.58 ? 164 GLN A N   1 
ATOM   1233 C CA  . GLN A 1 160 ? 7.624   -10.720 -12.724 1.00 15.99 ? 164 GLN A CA  1 
ATOM   1234 C C   . GLN A 1 160 ? 7.894   -9.219  -12.883 1.00 15.97 ? 164 GLN A C   1 
ATOM   1235 O O   . GLN A 1 160 ? 8.441   -8.568  -11.984 1.00 15.70 ? 164 GLN A O   1 
ATOM   1236 C CB  . GLN A 1 160 ? 6.104   -10.934 -12.580 1.00 16.16 ? 164 GLN A CB  1 
ATOM   1237 C CG  . GLN A 1 160 ? 5.658   -12.374 -12.412 1.00 17.19 ? 164 GLN A CG  1 
ATOM   1238 C CD  . GLN A 1 160 ? 6.119   -13.267 -13.550 1.00 19.07 ? 164 GLN A CD  1 
ATOM   1239 O OE1 . GLN A 1 160 ? 5.979   -12.912 -14.724 1.00 20.01 ? 164 GLN A OE1 1 
ATOM   1240 N NE2 . GLN A 1 160 ? 6.666   -14.432 -13.207 1.00 19.73 ? 164 GLN A NE2 1 
ATOM   1241 N N   . LYS A 1 161 ? 7.491   -8.684  -14.038 1.00 15.92 ? 165 LYS A N   1 
ATOM   1242 C CA  . LYS A 1 161 ? 7.531   -7.247  -14.289 1.00 15.73 ? 165 LYS A CA  1 
ATOM   1243 C C   . LYS A 1 161 ? 6.183   -6.608  -13.969 1.00 15.54 ? 165 LYS A C   1 
ATOM   1244 O O   . LYS A 1 161 ? 5.137   -7.254  -14.078 1.00 15.46 ? 165 LYS A O   1 
ATOM   1245 C CB  . LYS A 1 161 ? 7.924   -6.954  -15.734 1.00 15.71 ? 165 LYS A CB  1 
ATOM   1246 C CG  . LYS A 1 161 ? 9.383   -7.172  -16.023 1.00 15.89 ? 165 LYS A CG  1 
ATOM   1247 C CD  . LYS A 1 161 ? 9.787   -6.510  -17.318 1.00 16.37 ? 165 LYS A CD  1 
ATOM   1248 C CE  . LYS A 1 161 ? 11.206  -6.891  -17.688 1.00 16.99 ? 165 LYS A CE  1 
ATOM   1249 N NZ  . LYS A 1 161 ? 11.752  -6.025  -18.760 1.00 17.67 ? 165 LYS A NZ  1 
ATOM   1250 N N   . VAL A 1 162 ? 6.231   -5.335  -13.581 1.00 15.38 ? 166 VAL A N   1 
ATOM   1251 C CA  . VAL A 1 162 ? 5.059   -4.578  -13.142 1.00 15.15 ? 166 VAL A CA  1 
ATOM   1252 C C   . VAL A 1 162 ? 4.841   -3.320  -14.018 1.00 15.40 ? 166 VAL A C   1 
ATOM   1253 O O   . VAL A 1 162 ? 5.772   -2.855  -14.691 1.00 15.19 ? 166 VAL A O   1 
ATOM   1254 C CB  . VAL A 1 162 ? 5.160   -4.195  -11.611 1.00 15.04 ? 166 VAL A CB  1 
ATOM   1255 C CG1 . VAL A 1 162 ? 5.309   -5.432  -10.737 1.00 13.86 ? 166 VAL A CG1 1 
ATOM   1256 C CG2 . VAL A 1 162 ? 6.292   -3.213  -11.355 1.00 14.28 ? 166 VAL A CG2 1 
ATOM   1257 N N   . LYS A 1 163 ? 3.619   -2.778  -14.000 1.00 15.67 ? 167 LYS A N   1 
ATOM   1258 C CA  . LYS A 1 163 ? 3.285   -1.562  -14.771 1.00 15.98 ? 167 LYS A CA  1 
ATOM   1259 C C   . LYS A 1 163 ? 3.313   -0.282  -13.926 1.00 15.99 ? 167 LYS A C   1 
ATOM   1260 O O   . LYS A 1 163 ? 2.264   0.304   -13.626 1.00 16.10 ? 167 LYS A O   1 
ATOM   1261 C CB  . LYS A 1 163 ? 1.927   -1.699  -15.493 1.00 15.98 ? 167 LYS A CB  1 
ATOM   1262 C CG  . LYS A 1 163 ? 1.836   -2.832  -16.515 1.00 16.60 ? 167 LYS A CG  1 
ATOM   1263 C CD  . LYS A 1 163 ? 3.019   -2.827  -17.478 1.00 17.41 ? 167 LYS A CD  1 
ATOM   1264 C CE  . LYS A 1 163 ? 3.736   -4.183  -17.445 1.00 17.94 ? 167 LYS A CE  1 
ATOM   1265 N NZ  . LYS A 1 163 ? 5.209   -4.057  -17.677 1.00 17.32 ? 167 LYS A NZ  1 
ATOM   1266 N N   . GLY A 1 164 ? 4.517   0.133   -13.538 1.00 15.97 ? 168 GLY A N   1 
ATOM   1267 C CA  . GLY A 1 164 ? 4.727   1.409   -12.851 1.00 15.81 ? 168 GLY A CA  1 
ATOM   1268 C C   . GLY A 1 164 ? 4.280   1.471   -11.404 1.00 15.69 ? 168 GLY A C   1 
ATOM   1269 O O   . GLY A 1 164 ? 4.040   2.554   -10.883 1.00 15.82 ? 168 GLY A O   1 
ATOM   1270 N N   . ASP A 1 165 ? 4.167   0.318   -10.753 1.00 15.52 ? 169 ASP A N   1 
ATOM   1271 C CA  . ASP A 1 165 ? 3.841   0.255   -9.328  1.00 15.61 ? 169 ASP A CA  1 
ATOM   1272 C C   . ASP A 1 165 ? 4.756   1.118   -8.455  1.00 15.58 ? 169 ASP A C   1 
ATOM   1273 O O   . ASP A 1 165 ? 5.971   1.194   -8.680  1.00 15.58 ? 169 ASP A O   1 
ATOM   1274 C CB  . ASP A 1 165 ? 3.933   -1.184  -8.835  1.00 15.83 ? 169 ASP A CB  1 
ATOM   1275 C CG  . ASP A 1 165 ? 2.798   -2.037  -9.324  1.00 16.35 ? 169 ASP A CG  1 
ATOM   1276 O OD1 . ASP A 1 165 ? 2.566   -2.088  -10.549 1.00 16.91 ? 169 ASP A OD1 1 
ATOM   1277 O OD2 . ASP A 1 165 ? 2.085   -2.703  -8.547  1.00 17.28 ? 169 ASP A OD2 1 
ATOM   1278 N N   . LYS A 1 166 ? 4.171   1.736   -7.435  1.00 15.33 ? 170 LYS A N   1 
ATOM   1279 C CA  . LYS A 1 166 ? 4.918   2.635   -6.565  1.00 15.18 ? 170 LYS A CA  1 
ATOM   1280 C C   . LYS A 1 166 ? 5.624   1.904   -5.413  1.00 14.77 ? 170 LYS A C   1 
ATOM   1281 O O   . LYS A 1 166 ? 5.061   0.996   -4.809  1.00 14.48 ? 170 LYS A O   1 
ATOM   1282 C CB  . LYS A 1 166 ? 4.006   3.760   -6.060  1.00 15.13 ? 170 LYS A CB  1 
ATOM   1283 C CG  . LYS A 1 166 ? 3.544   4.680   -7.173  1.00 15.44 ? 170 LYS A CG  1 
ATOM   1284 C CD  . LYS A 1 166 ? 2.537   5.740   -6.724  1.00 15.68 ? 170 LYS A CD  1 
ATOM   1285 C CE  . LYS A 1 166 ? 2.218   6.674   -7.899  1.00 16.54 ? 170 LYS A CE  1 
ATOM   1286 N NZ  . LYS A 1 166 ? 1.016   7.523   -7.682  1.00 17.56 ? 170 LYS A NZ  1 
ATOM   1287 N N   . ILE A 1 167 ? 6.869   2.288   -5.138  1.00 14.51 ? 171 ILE A N   1 
ATOM   1288 C CA  . ILE A 1 167 ? 7.604   1.753   -3.992  1.00 14.44 ? 171 ILE A CA  1 
ATOM   1289 C C   . ILE A 1 167 ? 8.506   2.780   -3.315  1.00 14.37 ? 171 ILE A C   1 
ATOM   1290 O O   . ILE A 1 167 ? 9.255   3.507   -3.963  1.00 14.16 ? 171 ILE A O   1 
ATOM   1291 C CB  . ILE A 1 167 ? 8.382   0.451   -4.351  1.00 14.47 ? 171 ILE A CB  1 
ATOM   1292 C CG1 . ILE A 1 167 ? 9.109   -0.094  -3.119  1.00 14.00 ? 171 ILE A CG1 1 
ATOM   1293 C CG2 . ILE A 1 167 ? 9.358   0.680   -5.505  1.00 14.67 ? 171 ILE A CG2 1 
ATOM   1294 C CD1 . ILE A 1 167 ? 9.152   -1.583  -3.050  1.00 13.26 ? 171 ILE A CD1 1 
ATOM   1295 N N   . ASN A 1 168 ? 8.413   2.825   -1.995  1.00 14.50 ? 172 ASN A N   1 
ATOM   1296 C CA  . ASN A 1 168 ? 9.148   3.784   -1.203  1.00 14.78 ? 172 ASN A CA  1 
ATOM   1297 C C   . ASN A 1 168 ? 10.226  3.086   -0.405  1.00 14.82 ? 172 ASN A C   1 
ATOM   1298 O O   . ASN A 1 168 ? 9.921   2.371   0.541   1.00 15.01 ? 172 ASN A O   1 
ATOM   1299 C CB  . ASN A 1 168 ? 8.187   4.495   -0.256  1.00 14.75 ? 172 ASN A CB  1 
ATOM   1300 C CG  . ASN A 1 168 ? 8.793   5.716   0.388   1.00 14.97 ? 172 ASN A CG  1 
ATOM   1301 O OD1 . ASN A 1 168 ? 8.075   6.529   0.946   1.00 15.62 ? 172 ASN A OD1 1 
ATOM   1302 N ND2 . ASN A 1 168 ? 10.117  5.852   0.324   1.00 14.90 ? 172 ASN A ND2 1 
ATOM   1303 N N   . LEU A 1 169 ? 11.483  3.289   -0.786  1.00 14.95 ? 173 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 169 ? 12.602  2.723   -0.028  1.00 15.26 ? 173 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 169 ? 13.203  3.764   0.911   1.00 15.43 ? 173 LEU A C   1 
ATOM   1306 O O   . LEU A 1 169 ? 13.670  4.818   0.469   1.00 15.55 ? 173 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 169 ? 13.685  2.139   -0.955  1.00 15.15 ? 173 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 169 ? 13.304  1.047   -1.961  1.00 14.84 ? 173 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 169 ? 14.474  0.744   -2.870  1.00 14.95 ? 173 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 169 ? 12.832  -0.223  -1.272  1.00 14.16 ? 173 LEU A CD2 1 
ATOM   1311 N N   . ALA A 1 170 ? 13.178  3.471   2.205   1.00 15.52 ? 174 ALA A N   1 
ATOM   1312 C CA  . ALA A 1 170 ? 13.829  4.328   3.187   1.00 15.74 ? 174 ALA A CA  1 
ATOM   1313 C C   . ALA A 1 170 ? 15.281  3.900   3.382   1.00 15.82 ? 174 ALA A C   1 
ATOM   1314 O O   . ALA A 1 170 ? 15.576  2.709   3.543   1.00 15.85 ? 174 ALA A O   1 
ATOM   1315 C CB  . ALA A 1 170 ? 13.068  4.305   4.520   1.00 15.69 ? 174 ALA A CB  1 
ATOM   1316 N N   . TYR A 1 171 ? 16.183  4.875   3.359   1.00 15.92 ? 175 TYR A N   1 
ATOM   1317 C CA  . TYR A 1 171 ? 17.597  4.612   3.625   1.00 16.03 ? 175 TYR A CA  1 
ATOM   1318 C C   . TYR A 1 171 ? 18.216  5.603   4.589   1.00 15.89 ? 175 TYR A C   1 
ATOM   1319 O O   . TYR A 1 171 ? 17.831  6.771   4.623   1.00 15.69 ? 175 TYR A O   1 
ATOM   1320 C CB  . TYR A 1 171 ? 18.411  4.579   2.324   1.00 16.20 ? 175 TYR A CB  1 
ATOM   1321 C CG  . TYR A 1 171 ? 18.595  5.919   1.632   1.00 16.27 ? 175 TYR A CG  1 
ATOM   1322 C CD1 . TYR A 1 171 ? 19.785  6.635   1.764   1.00 16.03 ? 175 TYR A CD1 1 
ATOM   1323 C CD2 . TYR A 1 171 ? 17.580  6.462   0.827   1.00 16.24 ? 175 TYR A CD2 1 
ATOM   1324 C CE1 . TYR A 1 171 ? 19.964  7.858   1.121   1.00 16.27 ? 175 TYR A CE1 1 
ATOM   1325 C CE2 . TYR A 1 171 ? 17.744  7.681   0.183   1.00 15.97 ? 175 TYR A CE2 1 
ATOM   1326 C CZ  . TYR A 1 171 ? 18.940  8.373   0.330   1.00 16.56 ? 175 TYR A CZ  1 
ATOM   1327 O OH  . TYR A 1 171 ? 19.114  9.586   -0.305  1.00 16.82 ? 175 TYR A OH  1 
ATOM   1328 N N   . VAL A 1 172 ? 19.173  5.109   5.372   1.00 16.03 ? 176 VAL A N   1 
ATOM   1329 C CA  . VAL A 1 172 ? 20.017  5.952   6.216   1.00 16.21 ? 176 VAL A CA  1 
ATOM   1330 C C   . VAL A 1 172 ? 21.292  6.263   5.422   1.00 16.38 ? 176 VAL A C   1 
ATOM   1331 O O   . VAL A 1 172 ? 21.852  5.381   4.767   1.00 16.36 ? 176 VAL A O   1 
ATOM   1332 C CB  . VAL A 1 172 ? 20.338  5.275   7.573   1.00 16.34 ? 176 VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 172 ? 21.265  6.147   8.425   1.00 16.00 ? 176 VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 172 ? 19.048  4.975   8.336   1.00 16.13 ? 176 VAL A CG2 1 
ATOM   1335 N N   . ALA A 1 173 ? 21.738  7.517   5.480   1.00 16.45 ? 177 ALA A N   1 
ATOM   1336 C CA  . ALA A 1 173 ? 22.782  8.011   4.585   1.00 16.47 ? 177 ALA A CA  1 
ATOM   1337 C C   . ALA A 1 173 ? 24.239  7.644   4.955   1.00 16.65 ? 177 ALA A C   1 
ATOM   1338 O O   . ALA A 1 173 ? 25.142  8.482   4.846   1.00 16.62 ? 177 ALA A O   1 
ATOM   1339 C CB  . ALA A 1 173 ? 22.627  9.505   4.409   1.00 16.43 ? 177 ALA A CB  1 
ATOM   1340 N N   . TRP A 1 174 ? 24.467  6.402   5.387   1.00 16.78 ? 178 TRP A N   1 
ATOM   1341 C CA  . TRP A 1 174 ? 25.827  5.859   5.477   1.00 16.90 ? 178 TRP A CA  1 
ATOM   1342 C C   . TRP A 1 174 ? 26.195  5.344   4.095   1.00 16.88 ? 178 TRP A C   1 
ATOM   1343 O O   . TRP A 1 174 ? 25.327  4.866   3.364   1.00 17.07 ? 178 TRP A O   1 
ATOM   1344 C CB  . TRP A 1 174 ? 25.926  4.717   6.491   1.00 17.00 ? 178 TRP A CB  1 
ATOM   1345 C CG  . TRP A 1 174 ? 25.403  5.045   7.852   1.00 17.54 ? 178 TRP A CG  1 
ATOM   1346 C CD1 . TRP A 1 174 ? 24.233  4.608   8.401   1.00 18.04 ? 178 TRP A CD1 1 
ATOM   1347 C CD2 . TRP A 1 174 ? 26.017  5.885   8.842   1.00 17.66 ? 178 TRP A CD2 1 
ATOM   1348 N NE1 . TRP A 1 174 ? 24.082  5.114   9.671   1.00 17.93 ? 178 TRP A NE1 1 
ATOM   1349 C CE2 . TRP A 1 174 ? 25.161  5.901   9.969   1.00 17.34 ? 178 TRP A CE2 1 
ATOM   1350 C CE3 . TRP A 1 174 ? 27.209  6.624   8.894   1.00 17.94 ? 178 TRP A CE3 1 
ATOM   1351 C CZ2 . TRP A 1 174 ? 25.455  6.616   11.130  1.00 16.83 ? 178 TRP A CZ2 1 
ATOM   1352 C CZ3 . TRP A 1 174 ? 27.505  7.337   10.055  1.00 17.75 ? 178 TRP A CZ3 1 
ATOM   1353 C CH2 . TRP A 1 174 ? 26.627  7.324   11.156  1.00 17.57 ? 178 TRP A CH2 1 
ATOM   1354 N N   . ASP A 1 175 ? 27.477  5.433   3.746   1.00 16.89 ? 179 ASP A N   1 
ATOM   1355 C CA  . ASP A 1 175 ? 27.956  5.105   2.399   1.00 16.77 ? 179 ASP A CA  1 
ATOM   1356 C C   . ASP A 1 175 ? 27.613  3.683   1.947   1.00 16.60 ? 179 ASP A C   1 
ATOM   1357 O O   . ASP A 1 175 ? 27.403  3.429   0.751   1.00 16.60 ? 179 ASP A O   1 
ATOM   1358 C CB  . ASP A 1 175 ? 29.468  5.344   2.304   1.00 16.96 ? 179 ASP A CB  1 
ATOM   1359 C CG  . ASP A 1 175 ? 29.827  6.825   2.230   1.00 16.77 ? 179 ASP A CG  1 
ATOM   1360 O OD1 . ASP A 1 175 ? 30.914  7.199   2.745   1.00 16.97 ? 179 ASP A OD1 1 
ATOM   1361 O OD2 . ASP A 1 175 ? 29.084  7.675   1.680   1.00 15.24 ? 179 ASP A OD2 1 
ATOM   1362 N N   . SER A 1 176 ? 27.556  2.770   2.913   1.00 16.29 ? 180 SER A N   1 
ATOM   1363 C CA  . SER A 1 176 ? 27.205  1.381   2.664   1.00 16.20 ? 180 SER A CA  1 
ATOM   1364 C C   . SER A 1 176 ? 25.778  1.284   2.152   1.00 16.29 ? 180 SER A C   1 
ATOM   1365 O O   . SER A 1 176 ? 25.493  0.598   1.161   1.00 16.51 ? 180 SER A O   1 
ATOM   1366 C CB  . SER A 1 176 ? 27.369  0.555   3.942   1.00 16.21 ? 180 SER A CB  1 
ATOM   1367 O OG  . SER A 1 176 ? 27.011  1.297   5.096   1.00 16.03 ? 180 SER A OG  1 
ATOM   1368 N N   . GLU A 1 177 ? 24.888  2.004   2.821   1.00 16.03 ? 181 GLU A N   1 
ATOM   1369 C CA  . GLU A 1 177 ? 23.474  1.955   2.501   1.00 15.80 ? 181 GLU A CA  1 
ATOM   1370 C C   . GLU A 1 177 ? 23.075  2.820   1.308   1.00 15.42 ? 181 GLU A C   1 
ATOM   1371 O O   . GLU A 1 177 ? 22.017  2.607   0.735   1.00 15.27 ? 181 GLU A O   1 
ATOM   1372 C CB  . GLU A 1 177 ? 22.649  2.274   3.742   1.00 15.81 ? 181 GLU A CB  1 
ATOM   1373 C CG  . GLU A 1 177 ? 22.507  1.081   4.675   1.00 16.94 ? 181 GLU A CG  1 
ATOM   1374 C CD  . GLU A 1 177 ? 23.838  0.542   5.197   1.00 18.57 ? 181 GLU A CD  1 
ATOM   1375 O OE1 . GLU A 1 177 ? 24.561  1.297   5.891   1.00 19.39 ? 181 GLU A OE1 1 
ATOM   1376 O OE2 . GLU A 1 177 ? 24.152  -0.643  4.932   1.00 18.25 ? 181 GLU A OE2 1 
ATOM   1377 N N   . ILE A 1 178 ? 23.920  3.783   0.941   1.00 15.18 ? 182 ILE A N   1 
ATOM   1378 C CA  . ILE A 1 178 ? 23.775  4.484   -0.333  1.00 15.25 ? 182 ILE A CA  1 
ATOM   1379 C C   . ILE A 1 178 ? 24.091  3.503   -1.462  1.00 15.39 ? 182 ILE A C   1 
ATOM   1380 O O   . ILE A 1 178 ? 23.484  3.551   -2.540  1.00 15.35 ? 182 ILE A O   1 
ATOM   1381 C CB  . ILE A 1 178 ? 24.693  5.739   -0.419  1.00 15.21 ? 182 ILE A CB  1 
ATOM   1382 C CG1 . ILE A 1 178 ? 24.331  6.756   0.670   1.00 15.37 ? 182 ILE A CG1 1 
ATOM   1383 C CG2 . ILE A 1 178 ? 24.592  6.399   -1.808  1.00 14.78 ? 182 ILE A CG2 1 
ATOM   1384 C CD1 . ILE A 1 178 ? 25.126  8.059   0.609   1.00 15.33 ? 182 ILE A CD1 1 
ATOM   1385 N N   . ALA A 1 179 ? 25.044  2.607   -1.195  1.00 15.28 ? 183 ALA A N   1 
ATOM   1386 C CA  . ALA A 1 179 ? 25.427  1.579   -2.153  1.00 14.98 ? 183 ALA A CA  1 
ATOM   1387 C C   . ALA A 1 179 ? 24.236  0.664   -2.424  1.00 14.90 ? 183 ALA A C   1 
ATOM   1388 O O   . ALA A 1 179 ? 23.711  0.637   -3.539  1.00 14.75 ? 183 ALA A O   1 
ATOM   1389 C CB  . ALA A 1 179 ? 26.623  0.792   -1.632  1.00 14.78 ? 183 ALA A CB  1 
ATOM   1390 N N   . SER A 1 180 ? 23.792  -0.035  -1.379  1.00 14.79 ? 184 SER A N   1 
ATOM   1391 C CA  . SER A 1 180 ? 22.738  -1.039  -1.473  1.00 14.86 ? 184 SER A CA  1 
ATOM   1392 C C   . SER A 1 180 ? 21.393  -0.484  -1.928  1.00 15.00 ? 184 SER A C   1 
ATOM   1393 O O   . SER A 1 180 ? 20.737  -1.048  -2.805  1.00 14.78 ? 184 SER A O   1 
ATOM   1394 C CB  . SER A 1 180 ? 22.570  -1.718  -0.124  1.00 14.86 ? 184 SER A CB  1 
ATOM   1395 O OG  . SER A 1 180 ? 22.472  -0.750  0.902   1.00 15.22 ? 184 SER A OG  1 
ATOM   1396 N N   . THR A 1 181 ? 20.983  0.627   -1.327  1.00 15.30 ? 185 THR A N   1 
ATOM   1397 C CA  . THR A 1 181 ? 19.683  1.198   -1.639  1.00 15.51 ? 185 THR A CA  1 
ATOM   1398 C C   . THR A 1 181 ? 19.571  1.586   -3.122  1.00 15.83 ? 185 THR A C   1 
ATOM   1399 O O   . THR A 1 181 ? 18.521  1.375   -3.744  1.00 15.96 ? 185 THR A O   1 
ATOM   1400 C CB  . THR A 1 181 ? 19.347  2.376   -0.703  1.00 15.45 ? 185 THR A CB  1 
ATOM   1401 O OG1 . THR A 1 181 ? 19.656  2.018   0.653   1.00 14.89 ? 185 THR A OG1 1 
ATOM   1402 C CG2 . THR A 1 181 ? 17.838  2.618   -0.677  1.00 15.48 ? 185 THR A CG2 1 
ATOM   1403 N N   . ASN A 1 182 ? 20.653  2.119   -3.688  1.00 15.86 ? 186 ASN A N   1 
ATOM   1404 C CA  . ASN A 1 182 ? 20.645  2.505   -5.097  1.00 15.99 ? 186 ASN A CA  1 
ATOM   1405 C C   . ASN A 1 182 ? 20.670  1.335   -6.064  1.00 15.90 ? 186 ASN A C   1 
ATOM   1406 O O   . ASN A 1 182 ? 19.973  1.363   -7.095  1.00 15.85 ? 186 ASN A O   1 
ATOM   1407 C CB  . ASN A 1 182 ? 21.782  3.461   -5.415  1.00 16.12 ? 186 ASN A CB  1 
ATOM   1408 C CG  . ASN A 1 182 ? 21.520  4.837   -4.893  1.00 16.94 ? 186 ASN A CG  1 
ATOM   1409 O OD1 . ASN A 1 182 ? 21.310  5.022   -3.696  1.00 18.57 ? 186 ASN A OD1 1 
ATOM   1410 N ND2 . ASN A 1 182 ? 21.517  5.819   -5.780  1.00 17.46 ? 186 ASN A ND2 1 
ATOM   1411 N N   . VAL A 1 183 ? 21.471  0.317   -5.739  1.00 15.55 ? 187 VAL A N   1 
ATOM   1412 C CA  . VAL A 1 183 ? 21.570  -0.854  -6.602  1.00 15.19 ? 187 VAL A CA  1 
ATOM   1413 C C   . VAL A 1 183 ? 20.208  -1.534  -6.672  1.00 14.98 ? 187 VAL A C   1 
ATOM   1414 O O   . VAL A 1 183 ? 19.720  -1.807  -7.764  1.00 15.26 ? 187 VAL A O   1 
ATOM   1415 C CB  . VAL A 1 183 ? 22.760  -1.815  -6.245  1.00 15.06 ? 187 VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 183 ? 22.612  -2.437  -4.886  1.00 15.14 ? 187 VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 183 ? 22.900  -2.903  -7.275  1.00 15.06 ? 187 VAL A CG2 1 
ATOM   1418 N N   . ILE A 1 184 ? 19.575  -1.745  -5.525  1.00 14.66 ? 188 ILE A N   1 
ATOM   1419 C CA  . ILE A 1 184 ? 18.258  -2.363  -5.496  1.00 14.63 ? 188 ILE A CA  1 
ATOM   1420 C C   . ILE A 1 184 ? 17.219  -1.444  -6.130  1.00 14.77 ? 188 ILE A C   1 
ATOM   1421 O O   . ILE A 1 184 ? 16.359  -1.904  -6.896  1.00 14.79 ? 188 ILE A O   1 
ATOM   1422 C CB  . ILE A 1 184 ? 17.882  -2.783  -4.058  1.00 14.60 ? 188 ILE A CB  1 
ATOM   1423 C CG1 . ILE A 1 184 ? 18.456  -4.163  -3.753  1.00 14.42 ? 188 ILE A CG1 1 
ATOM   1424 C CG2 . ILE A 1 184 ? 16.376  -2.805  -3.846  1.00 14.69 ? 188 ILE A CG2 1 
ATOM   1425 C CD1 . ILE A 1 184 ? 18.069  -5.232  -4.750  1.00 14.36 ? 188 ILE A CD1 1 
ATOM   1426 N N   . GLY A 1 185 ? 17.323  -0.148  -5.828  1.00 14.73 ? 189 GLY A N   1 
ATOM   1427 C CA  . GLY A 1 185 ? 16.467  0.868   -6.428  1.00 14.56 ? 189 GLY A CA  1 
ATOM   1428 C C   . GLY A 1 185 ? 16.468  0.750   -7.939  1.00 14.64 ? 189 GLY A C   1 
ATOM   1429 O O   . GLY A 1 185 ? 15.405  0.787   -8.571  1.00 14.58 ? 189 GLY A O   1 
ATOM   1430 N N   . LYS A 1 186 ? 17.663  0.583   -8.508  1.00 14.54 ? 190 LYS A N   1 
ATOM   1431 C CA  . LYS A 1 186 ? 17.827  0.488   -9.953  1.00 14.60 ? 190 LYS A CA  1 
ATOM   1432 C C   . LYS A 1 186 ? 17.206  -0.798  -10.482 1.00 14.61 ? 190 LYS A C   1 
ATOM   1433 O O   . LYS A 1 186 ? 16.578  -0.801  -11.549 1.00 14.68 ? 190 LYS A O   1 
ATOM   1434 C CB  . LYS A 1 186 ? 19.309  0.551   -10.345 1.00 14.73 ? 190 LYS A CB  1 
ATOM   1435 C CG  . LYS A 1 186 ? 19.627  1.462   -11.547 1.00 14.69 ? 190 LYS A CG  1 
ATOM   1436 C CD  . LYS A 1 186 ? 19.148  0.911   -12.890 1.00 14.82 ? 190 LYS A CD  1 
ATOM   1437 C CE  . LYS A 1 186 ? 19.385  1.939   -14.008 1.00 15.03 ? 190 LYS A CE  1 
ATOM   1438 N NZ  . LYS A 1 186 ? 18.718  1.602   -15.298 1.00 14.58 ? 190 LYS A NZ  1 
ATOM   1439 N N   . VAL A 1 187 ? 17.381  -1.885  -9.736  1.00 14.44 ? 191 VAL A N   1 
ATOM   1440 C CA  . VAL A 1 187 ? 16.861  -3.182  -10.155 1.00 14.45 ? 191 VAL A CA  1 
ATOM   1441 C C   . VAL A 1 187 ? 15.343  -3.092  -10.290 1.00 14.69 ? 191 VAL A C   1 
ATOM   1442 O O   . VAL A 1 187 ? 14.768  -3.586  -11.272 1.00 14.63 ? 191 VAL A O   1 
ATOM   1443 C CB  . VAL A 1 187 ? 17.277  -4.325  -9.181  1.00 14.33 ? 191 VAL A CB  1 
ATOM   1444 C CG1 . VAL A 1 187 ? 16.648  -5.657  -9.585  1.00 13.79 ? 191 VAL A CG1 1 
ATOM   1445 C CG2 . VAL A 1 187 ? 18.790  -4.462  -9.127  1.00 14.16 ? 191 VAL A CG2 1 
ATOM   1446 N N   . LEU A 1 188 ? 14.716  -2.437  -9.308  1.00 14.73 ? 192 LEU A N   1 
ATOM   1447 C CA  . LEU A 1 188 ? 13.274  -2.204  -9.302  1.00 14.87 ? 192 LEU A CA  1 
ATOM   1448 C C   . LEU A 1 188 ? 12.832  -1.316  -10.470 1.00 15.05 ? 192 LEU A C   1 
ATOM   1449 O O   . LEU A 1 188 ? 11.796  -1.566  -11.101 1.00 14.94 ? 192 LEU A O   1 
ATOM   1450 C CB  . LEU A 1 188 ? 12.834  -1.608  -7.962  1.00 14.72 ? 192 LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 188 ? 12.821  -2.585  -6.779  1.00 15.19 ? 192 LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 188 ? 13.065  -1.863  -5.455  1.00 15.49 ? 192 LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 188 ? 11.524  -3.394  -6.722  1.00 15.33 ? 192 LEU A CD2 1 
ATOM   1454 N N   . GLU A 1 189 ? 13.629  -0.292  -10.763 1.00 15.13 ? 193 GLU A N   1 
ATOM   1455 C CA  . GLU A 1 189 ? 13.350  0.591   -11.885 1.00 15.31 ? 193 GLU A CA  1 
ATOM   1456 C C   . GLU A 1 189 ? 13.459  -0.129  -13.220 1.00 15.57 ? 193 GLU A C   1 
ATOM   1457 O O   . GLU A 1 189 ? 12.688  0.145   -14.135 1.00 15.64 ? 193 GLU A O   1 
ATOM   1458 C CB  . GLU A 1 189 ? 14.284  1.787   -11.873 1.00 15.26 ? 193 GLU A CB  1 
ATOM   1459 C CG  . GLU A 1 189 ? 13.889  2.854   -10.876 1.00 15.14 ? 193 GLU A CG  1 
ATOM   1460 C CD  . GLU A 1 189 ? 14.824  4.041   -10.901 1.00 15.18 ? 193 GLU A CD  1 
ATOM   1461 O OE1 . GLU A 1 189 ? 16.056  3.841   -10.811 1.00 15.80 ? 193 GLU A OE1 1 
ATOM   1462 O OE2 . GLU A 1 189 ? 14.321  5.175   -10.997 1.00 15.19 ? 193 GLU A OE2 1 
ATOM   1463 N N   . ASP A 1 190 ? 14.422  -1.042  -13.327 1.00 15.84 ? 194 ASP A N   1 
ATOM   1464 C CA  . ASP A 1 190 ? 14.572  -1.879  -14.522 1.00 16.00 ? 194 ASP A CA  1 
ATOM   1465 C C   . ASP A 1 190 ? 13.400  -2.860  -14.644 1.00 16.07 ? 194 ASP A C   1 
ATOM   1466 O O   . ASP A 1 190 ? 13.092  -3.354  -15.730 1.00 16.15 ? 194 ASP A O   1 
ATOM   1467 C CB  . ASP A 1 190 ? 15.908  -2.638  -14.487 1.00 15.91 ? 194 ASP A CB  1 
ATOM   1468 C CG  . ASP A 1 190 ? 17.104  -1.753  -14.829 1.00 16.06 ? 194 ASP A CG  1 
ATOM   1469 O OD1 . ASP A 1 190 ? 16.909  -0.606  -15.278 1.00 16.24 ? 194 ASP A OD1 1 
ATOM   1470 O OD2 . ASP A 1 190 ? 18.288  -2.123  -14.688 1.00 16.03 ? 194 ASP A OD2 1 
ATOM   1471 N N   . LEU A 1 191 ? 12.743  -3.110  -13.516 1.00 16.14 ? 195 LEU A N   1 
ATOM   1472 C CA  . LEU A 1 191 ? 11.631  -4.042  -13.434 1.00 16.25 ? 195 LEU A CA  1 
ATOM   1473 C C   . LEU A 1 191 ? 10.291  -3.352  -13.738 1.00 16.34 ? 195 LEU A C   1 
ATOM   1474 O O   . LEU A 1 191 ? 9.254   -4.021  -13.857 1.00 16.38 ? 195 LEU A O   1 
ATOM   1475 C CB  . LEU A 1 191 ? 11.612  -4.667  -12.035 1.00 16.29 ? 195 LEU A CB  1 
ATOM   1476 C CG  . LEU A 1 191 ? 11.637  -6.191  -11.830 1.00 16.64 ? 195 LEU A CG  1 
ATOM   1477 C CD1 . LEU A 1 191 ? 12.381  -6.955  -12.941 1.00 16.06 ? 195 LEU A CD1 1 
ATOM   1478 C CD2 . LEU A 1 191 ? 12.223  -6.524  -10.442 1.00 16.32 ? 195 LEU A CD2 1 
ATOM   1479 N N   . GLY A 1 192 ? 10.322  -2.020  -13.864 1.00 16.24 ? 196 GLY A N   1 
ATOM   1480 C CA  . GLY A 1 192 ? 9.132   -1.217  -14.171 1.00 15.89 ? 196 GLY A CA  1 
ATOM   1481 C C   . GLY A 1 192 ? 8.420   -0.638  -12.958 1.00 15.67 ? 196 GLY A C   1 
ATOM   1482 O O   . GLY A 1 192 ? 7.213   -0.372  -13.012 1.00 15.52 ? 196 GLY A O   1 
ATOM   1483 N N   . TYR A 1 193 ? 9.162   -0.449  -11.864 1.00 15.42 ? 197 TYR A N   1 
ATOM   1484 C CA  . TYR A 1 193 ? 8.607   0.113   -10.626 1.00 15.16 ? 197 TYR A CA  1 
ATOM   1485 C C   . TYR A 1 193 ? 8.834   1.616   -10.578 1.00 15.04 ? 197 TYR A C   1 
ATOM   1486 O O   . TYR A 1 193 ? 9.850   2.095   -11.077 1.00 15.14 ? 197 TYR A O   1 
ATOM   1487 C CB  . TYR A 1 193 ? 9.243   -0.534  -9.386  1.00 15.03 ? 197 TYR A CB  1 
ATOM   1488 C CG  . TYR A 1 193 ? 8.635   -1.856  -8.950  1.00 14.83 ? 197 TYR A CG  1 
ATOM   1489 C CD1 . TYR A 1 193 ? 9.186   -3.074  -9.371  1.00 14.58 ? 197 TYR A CD1 1 
ATOM   1490 C CD2 . TYR A 1 193 ? 7.520   -1.892  -8.104  1.00 14.47 ? 197 TYR A CD2 1 
ATOM   1491 C CE1 . TYR A 1 193 ? 8.638   -4.301  -8.970  1.00 14.19 ? 197 TYR A CE1 1 
ATOM   1492 C CE2 . TYR A 1 193 ? 6.959   -3.113  -7.697  1.00 14.38 ? 197 TYR A CE2 1 
ATOM   1493 C CZ  . TYR A 1 193 ? 7.525   -4.316  -8.136  1.00 14.45 ? 197 TYR A CZ  1 
ATOM   1494 O OH  . TYR A 1 193 ? 6.978   -5.527  -7.747  1.00 14.30 ? 197 TYR A OH  1 
ATOM   1495 N N   . GLU A 1 194 ? 7.888   2.354   -9.994  1.00 14.82 ? 198 GLU A N   1 
ATOM   1496 C CA  . GLU A 1 194 ? 8.095   3.767   -9.678  1.00 14.73 ? 198 GLU A CA  1 
ATOM   1497 C C   . GLU A 1 194 ? 8.732   3.847   -8.289  1.00 14.56 ? 198 GLU A C   1 
ATOM   1498 O O   . GLU A 1 194 ? 8.060   3.669   -7.267  1.00 14.40 ? 198 GLU A O   1 
ATOM   1499 C CB  . GLU A 1 194 ? 6.782   4.552   -9.730  1.00 14.78 ? 198 GLU A CB  1 
ATOM   1500 C CG  . GLU A 1 194 ? 6.957   6.062   -9.618  1.00 15.37 ? 198 GLU A CG  1 
ATOM   1501 C CD  . GLU A 1 194 ? 5.681   6.771   -9.198  1.00 16.23 ? 198 GLU A CD  1 
ATOM   1502 O OE1 . GLU A 1 194 ? 4.793   6.983   -10.047 1.00 16.75 ? 198 GLU A OE1 1 
ATOM   1503 O OE2 . GLU A 1 194 ? 5.565   7.131   -8.011  1.00 17.13 ? 198 GLU A OE2 1 
ATOM   1504 N N   . VAL A 1 195 ? 10.037  4.105   -8.265  1.00 14.33 ? 199 VAL A N   1 
ATOM   1505 C CA  . VAL A 1 195 ? 10.820  4.028   -7.031  1.00 14.05 ? 199 VAL A CA  1 
ATOM   1506 C C   . VAL A 1 195 ? 11.107  5.401   -6.405  1.00 14.00 ? 199 VAL A C   1 
ATOM   1507 O O   . VAL A 1 195 ? 11.602  6.318   -7.063  1.00 13.87 ? 199 VAL A O   1 
ATOM   1508 C CB  . VAL A 1 195 ? 12.139  3.261   -7.257  1.00 13.88 ? 199 VAL A CB  1 
ATOM   1509 C CG1 . VAL A 1 195 ? 12.816  2.937   -5.931  1.00 13.81 ? 199 VAL A CG1 1 
ATOM   1510 C CG2 . VAL A 1 195 ? 11.884  1.994   -8.056  1.00 13.75 ? 199 VAL A CG2 1 
ATOM   1511 N N   . THR A 1 196 ? 10.762  5.528   -5.130  1.00 13.98 ? 200 THR A N   1 
ATOM   1512 C CA  . THR A 1 196 ? 11.154  6.668   -4.324  1.00 14.03 ? 200 THR A CA  1 
ATOM   1513 C C   . THR A 1 196 ? 12.164  6.191   -3.289  1.00 14.04 ? 200 THR A C   1 
ATOM   1514 O O   . THR A 1 196 ? 11.977  5.143   -2.667  1.00 14.12 ? 200 THR A O   1 
ATOM   1515 C CB  . THR A 1 196 ? 9.927   7.252   -3.616  1.00 14.07 ? 200 THR A CB  1 
ATOM   1516 O OG1 . THR A 1 196 ? 9.015   7.767   -4.595  1.00 13.66 ? 200 THR A OG1 1 
ATOM   1517 C CG2 . THR A 1 196 ? 10.315  8.476   -2.775  1.00 14.26 ? 200 THR A CG2 1 
ATOM   1518 N N   . LEU A 1 197 ? 13.239  6.948   -3.116  1.00 14.09 ? 201 LEU A N   1 
ATOM   1519 C CA  . LEU A 1 197 ? 14.150  6.713   -2.004  1.00 14.21 ? 201 LEU A CA  1 
ATOM   1520 C C   . LEU A 1 197 ? 13.975  7.846   -1.009  1.00 14.29 ? 201 LEU A C   1 
ATOM   1521 O O   . LEU A 1 197 ? 14.177  9.005   -1.343  1.00 14.44 ? 201 LEU A O   1 
ATOM   1522 C CB  . LEU A 1 197 ? 15.600  6.637   -2.478  1.00 14.12 ? 201 LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 197 ? 15.907  5.717   -3.666  1.00 14.79 ? 201 LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 197 ? 17.216  6.117   -4.327  1.00 15.24 ? 201 LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 197 ? 15.933  4.251   -3.269  1.00 15.39 ? 201 LEU A CD2 1 
ATOM   1526 N N   . THR A 1 198 ? 13.566  7.515   0.206   1.00 14.58 ? 202 THR A N   1 
ATOM   1527 C CA  . THR A 1 198 ? 13.416  8.519   1.254   1.00 14.94 ? 202 THR A CA  1 
ATOM   1528 C C   . THR A 1 198 ? 14.576  8.441   2.250   1.00 14.99 ? 202 THR A C   1 
ATOM   1529 O O   . THR A 1 198 ? 14.785  7.418   2.897   1.00 14.72 ? 202 THR A O   1 
ATOM   1530 C CB  . THR A 1 198 ? 12.037  8.385   1.952   1.00 14.97 ? 202 THR A CB  1 
ATOM   1531 O OG1 . THR A 1 198 ? 10.996  8.543   0.978   1.00 14.95 ? 202 THR A OG1 1 
ATOM   1532 C CG2 . THR A 1 198 ? 11.796  9.547   2.926   1.00 14.93 ? 202 THR A CG2 1 
ATOM   1533 N N   . GLN A 1 199 ? 15.336  9.527   2.336   1.00 15.43 ? 203 GLN A N   1 
ATOM   1534 C CA  . GLN A 1 199 ? 16.475  9.621   3.254   1.00 15.92 ? 203 GLN A CA  1 
ATOM   1535 C C   . GLN A 1 199 ? 15.990  10.042  4.628   1.00 15.82 ? 203 GLN A C   1 
ATOM   1536 O O   . GLN A 1 199 ? 15.149  10.937  4.752   1.00 15.86 ? 203 GLN A O   1 
ATOM   1537 C CB  . GLN A 1 199 ? 17.508  10.627  2.748   1.00 15.64 ? 203 GLN A CB  1 
ATOM   1538 C CG  . GLN A 1 199 ? 18.844  10.540  3.445   1.00 16.02 ? 203 GLN A CG  1 
ATOM   1539 C CD  . GLN A 1 199 ? 19.800  11.660  3.051   1.00 16.82 ? 203 GLN A CD  1 
ATOM   1540 O OE1 . GLN A 1 199 ? 20.767  11.938  3.773   1.00 18.22 ? 203 GLN A OE1 1 
ATOM   1541 N NE2 . GLN A 1 199 ? 19.538  12.306  1.910   1.00 17.57 ? 203 GLN A NE2 1 
ATOM   1542 N N   . VAL A 1 200 ? 16.523  9.383   5.652   1.00 15.80 ? 204 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 200 ? 16.180  9.669   7.046   1.00 15.87 ? 204 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 200 ? 17.318  9.223   7.968   1.00 15.90 ? 204 VAL A C   1 
ATOM   1545 O O   . VAL A 1 200 ? 18.201  8.463   7.556   1.00 15.92 ? 204 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 200 ? 14.826  8.990   7.470   1.00 15.99 ? 204 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 200 ? 13.635  9.898   7.192   1.00 15.66 ? 204 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 200 ? 14.636  7.638   6.781   1.00 15.66 ? 204 VAL A CG2 1 
ATOM   1549 N N   . GLU A 1 201 ? 17.307  9.711   9.204   1.00 16.10 ? 205 GLU A N   1 
ATOM   1550 C CA  . GLU A 1 201 ? 18.197  9.185   10.241  1.00 16.46 ? 205 GLU A CA  1 
ATOM   1551 C C   . GLU A 1 201 ? 17.693  7.799   10.658  1.00 16.74 ? 205 GLU A C   1 
ATOM   1552 O O   . GLU A 1 201 ? 16.538  7.457   10.402  1.00 16.83 ? 205 GLU A O   1 
ATOM   1553 C CB  . GLU A 1 201 ? 18.303  10.171  11.406  1.00 16.50 ? 205 GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 201 ? 18.850  11.535  11.018  1.00 16.59 ? 205 GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 201 ? 18.941  12.483  12.197  1.00 20.00 ? 205 GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 201 ? 18.575  12.073  13.319  1.00 20.00 ? 205 GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 201 ? 19.377  13.637  11.999  1.00 20.00 ? 205 GLU A OE2 1 
ATOM   1558 N N   . ALA A 1 202 ? 18.554  7.006   11.301  1.00 17.09 ? 206 ALA A N   1 
ATOM   1559 C CA  . ALA A 1 202 ? 18.105  5.811   12.028  1.00 17.16 ? 206 ALA A CA  1 
ATOM   1560 C C   . ALA A 1 202 ? 17.222  6.265   13.187  1.00 17.23 ? 206 ALA A C   1 
ATOM   1561 O O   . ALA A 1 202 ? 17.597  7.159   13.969  1.00 17.52 ? 206 ALA A O   1 
ATOM   1562 C CB  . ALA A 1 202 ? 19.287  5.034   12.547  1.00 17.16 ? 206 ALA A CB  1 
ATOM   1563 N N   . GLY A 1 203 ? 16.046  5.665   13.296  1.00 16.93 ? 207 GLY A N   1 
ATOM   1564 C CA  . GLY A 1 203 ? 15.067  6.147   14.260  1.00 16.68 ? 207 GLY A CA  1 
ATOM   1565 C C   . GLY A 1 203 ? 13.875  6.585   13.449  1.00 16.55 ? 207 GLY A C   1 
ATOM   1566 O O   . GLY A 1 203 ? 12.885  5.861   13.382  1.00 16.77 ? 207 GLY A O   1 
ATOM   1567 N N   . PRO A 1 204 ? 13.953  7.766   12.834  1.00 16.38 ? 208 PRO A N   1 
ATOM   1568 C CA  . PRO A 1 204 ? 13.000  8.146   11.776  1.00 16.30 ? 208 PRO A CA  1 
ATOM   1569 C C   . PRO A 1 204 ? 12.822  7.059   10.688  1.00 16.04 ? 208 PRO A C   1 
ATOM   1570 O O   . PRO A 1 204 ? 11.708  6.848   10.198  1.00 16.10 ? 208 PRO A O   1 
ATOM   1571 C CB  . PRO A 1 204 ? 13.606  9.437   11.206  1.00 16.21 ? 208 PRO A CB  1 
ATOM   1572 C CG  . PRO A 1 204 ? 14.334  10.041  12.383  1.00 16.06 ? 208 PRO A CG  1 
ATOM   1573 C CD  . PRO A 1 204 ? 14.894  8.862   13.144  1.00 16.33 ? 208 PRO A CD  1 
ATOM   1574 N N   . MET A 1 205 ? 13.905  6.366   10.343  1.00 15.73 ? 209 MET A N   1 
ATOM   1575 C CA  . MET A 1 205 ? 13.847  5.203   9.446   1.00 15.55 ? 209 MET A CA  1 
ATOM   1576 C C   . MET A 1 205 ? 13.035  4.049   10.035  1.00 15.46 ? 209 MET A C   1 
ATOM   1577 O O   . MET A 1 205 ? 12.161  3.496   9.366   1.00 15.64 ? 209 MET A O   1 
ATOM   1578 C CB  . MET A 1 205 ? 15.262  4.729   9.085   1.00 15.47 ? 209 MET A CB  1 
ATOM   1579 C CG  . MET A 1 205 ? 15.340  3.633   8.030   1.00 15.30 ? 209 MET A CG  1 
ATOM   1580 S SD  . MET A 1 205 ? 15.351  1.950   8.697   1.00 16.40 ? 209 MET A SD  1 
ATOM   1581 C CE  . MET A 1 205 ? 16.999  1.867   9.405   1.00 17.21 ? 209 MET A CE  1 
ATOM   1582 N N   . TRP A 1 206 ? 13.339  3.685   11.280  1.00 15.33 ? 210 TRP A N   1 
ATOM   1583 C CA  . TRP A 1 206 ? 12.620  2.625   11.992  1.00 15.06 ? 210 TRP A CA  1 
ATOM   1584 C C   . TRP A 1 206 ? 11.150  2.960   12.209  1.00 14.90 ? 210 TRP A C   1 
ATOM   1585 O O   . TRP A 1 206 ? 10.286  2.108   12.014  1.00 14.80 ? 210 TRP A O   1 
ATOM   1586 C CB  . TRP A 1 206 ? 13.326  2.299   13.312  1.00 15.11 ? 210 TRP A CB  1 
ATOM   1587 C CG  . TRP A 1 206 ? 14.525  1.416   13.090  1.00 15.40 ? 210 TRP A CG  1 
ATOM   1588 C CD1 . TRP A 1 206 ? 15.823  1.814   12.915  1.00 15.42 ? 210 TRP A CD1 1 
ATOM   1589 C CD2 . TRP A 1 206 ? 14.527  -0.015  12.963  1.00 15.21 ? 210 TRP A CD2 1 
ATOM   1590 N NE1 . TRP A 1 206 ? 16.629  0.720   12.705  1.00 15.39 ? 210 TRP A NE1 1 
ATOM   1591 C CE2 . TRP A 1 206 ? 15.861  -0.415  12.730  1.00 15.23 ? 210 TRP A CE2 1 
ATOM   1592 C CE3 . TRP A 1 206 ? 13.535  -1.003  13.033  1.00 14.65 ? 210 TRP A CE3 1 
ATOM   1593 C CZ2 . TRP A 1 206 ? 16.226  -1.750  12.573  1.00 15.11 ? 210 TRP A CZ2 1 
ATOM   1594 C CZ3 . TRP A 1 206 ? 13.899  -2.324  12.876  1.00 15.15 ? 210 TRP A CZ3 1 
ATOM   1595 C CH2 . TRP A 1 206 ? 15.233  -2.687  12.649  1.00 15.31 ? 210 TRP A CH2 1 
ATOM   1596 N N   . THR A 1 207 ? 10.884  4.212   12.585  1.00 14.78 ? 211 THR A N   1 
ATOM   1597 C CA  . THR A 1 207 ? 9.527   4.730   12.743  1.00 14.73 ? 211 THR A CA  1 
ATOM   1598 C C   . THR A 1 207 ? 8.755   4.646   11.441  1.00 14.89 ? 211 THR A C   1 
ATOM   1599 O O   . THR A 1 207 ? 7.645   4.130   11.426  1.00 15.10 ? 211 THR A O   1 
ATOM   1600 C CB  . THR A 1 207 ? 9.545   6.192   13.224  1.00 14.64 ? 211 THR A CB  1 
ATOM   1601 O OG1 . THR A 1 207 ? 10.442  6.326   14.326  1.00 14.35 ? 211 THR A OG1 1 
ATOM   1602 C CG2 . THR A 1 207 ? 8.190   6.590   13.809  1.00 14.21 ? 211 THR A CG2 1 
ATOM   1603 N N   . ALA A 1 208 ? 9.346   5.159   10.359  1.00 15.04 ? 212 ALA A N   1 
ATOM   1604 C CA  . ALA A 1 208 ? 8.720   5.132   9.033   1.00 15.15 ? 212 ALA A CA  1 
ATOM   1605 C C   . ALA A 1 208 ? 8.272   3.720   8.647   1.00 15.30 ? 212 ALA A C   1 
ATOM   1606 O O   . ALA A 1 208 ? 7.158   3.532   8.147   1.00 15.48 ? 212 ALA A O   1 
ATOM   1607 C CB  . ALA A 1 208 ? 9.651   5.704   7.982   1.00 14.81 ? 212 ALA A CB  1 
ATOM   1608 N N   . ILE A 1 209 ? 9.130   2.735   8.906   1.00 15.22 ? 213 ILE A N   1 
ATOM   1609 C CA  . ILE A 1 209 ? 8.831   1.349   8.580   1.00 15.30 ? 213 ILE A CA  1 
ATOM   1610 C C   . ILE A 1 209 ? 7.715   0.832   9.485   1.00 15.44 ? 213 ILE A C   1 
ATOM   1611 O O   . ILE A 1 209 ? 6.726   0.252   9.004   1.00 15.62 ? 213 ILE A O   1 
ATOM   1612 C CB  . ILE A 1 209 ? 10.116  0.452   8.682   1.00 15.25 ? 213 ILE A CB  1 
ATOM   1613 C CG1 . ILE A 1 209 ? 11.180  0.860   7.646   1.00 15.08 ? 213 ILE A CG1 1 
ATOM   1614 C CG2 . ILE A 1 209 ? 9.767   -1.043  8.559   1.00 14.95 ? 213 ILE A CG2 1 
ATOM   1615 C CD1 . ILE A 1 209 ? 10.857  0.501   6.179   1.00 15.18 ? 213 ILE A CD1 1 
ATOM   1616 N N   . ALA A 1 210 ? 7.874   1.060   10.790  1.00 15.41 ? 214 ALA A N   1 
ATOM   1617 C CA  . ALA A 1 210 ? 6.940   0.549   11.805  1.00 15.27 ? 214 ALA A CA  1 
ATOM   1618 C C   . ALA A 1 210 ? 5.543   1.171   11.707  1.00 15.17 ? 214 ALA A C   1 
ATOM   1619 O O   . ALA A 1 210 ? 4.558   0.553   12.102  1.00 15.00 ? 214 ALA A O   1 
ATOM   1620 C CB  . ALA A 1 210 ? 7.510   0.748   13.188  1.00 14.99 ? 214 ALA A CB  1 
ATOM   1621 N N   . THR A 1 211 ? 5.475   2.389   11.176  1.00 15.22 ? 215 THR A N   1 
ATOM   1622 C CA  . THR A 1 211 ? 4.206   3.093   10.984  1.00 15.31 ? 215 THR A CA  1 
ATOM   1623 C C   . THR A 1 211 ? 3.731   3.151   9.518   1.00 15.32 ? 215 THR A C   1 
ATOM   1624 O O   . THR A 1 211 ? 2.943   4.021   9.155   1.00 15.31 ? 215 THR A O   1 
ATOM   1625 C CB  . THR A 1 211 ? 4.282   4.519   11.572  1.00 15.30 ? 215 THR A CB  1 
ATOM   1626 O OG1 . THR A 1 211 ? 5.358   5.239   10.953  1.00 15.11 ? 215 THR A OG1 1 
ATOM   1627 C CG2 . THR A 1 211 ? 4.641   4.471   13.060  1.00 14.96 ? 215 THR A CG2 1 
ATOM   1628 N N   . GLY A 1 212 ? 4.222   2.229   8.691   1.00 15.23 ? 216 GLY A N   1 
ATOM   1629 C CA  . GLY A 1 212 ? 3.796   2.093   7.303   1.00 14.88 ? 216 GLY A CA  1 
ATOM   1630 C C   . GLY A 1 212 ? 4.142   3.205   6.331   1.00 14.86 ? 216 GLY A C   1 
ATOM   1631 O O   . GLY A 1 212 ? 3.854   3.080   5.144   1.00 14.97 ? 216 GLY A O   1 
ATOM   1632 N N   . SER A 1 213 ? 4.761   4.284   6.810   1.00 14.94 ? 217 SER A N   1 
ATOM   1633 C CA  . SER A 1 213 ? 5.015   5.471   5.969   1.00 14.95 ? 217 SER A CA  1 
ATOM   1634 C C   . SER A 1 213 ? 6.188   5.286   5.009   1.00 15.02 ? 217 SER A C   1 
ATOM   1635 O O   . SER A 1 213 ? 6.503   6.183   4.223   1.00 15.10 ? 217 SER A O   1 
ATOM   1636 C CB  . SER A 1 213 ? 5.201   6.733   6.822   1.00 14.90 ? 217 SER A CB  1 
ATOM   1637 O OG  . SER A 1 213 ? 6.445   6.734   7.499   1.00 14.96 ? 217 SER A OG  1 
ATOM   1638 N N   . ALA A 1 214 ? 6.835   4.127   5.099   1.00 15.03 ? 218 ALA A N   1 
ATOM   1639 C CA  . ALA A 1 214 ? 7.804   3.669   4.112   1.00 15.19 ? 218 ALA A CA  1 
ATOM   1640 C C   . ALA A 1 214 ? 7.622   2.163   3.887   1.00 15.51 ? 218 ALA A C   1 
ATOM   1641 O O   . ALA A 1 214 ? 7.289   1.422   4.823   1.00 15.72 ? 218 ALA A O   1 
ATOM   1642 C CB  . ALA A 1 214 ? 9.210   3.969   4.564   1.00 15.01 ? 218 ALA A CB  1 
ATOM   1643 N N   . ASP A 1 215 ? 7.849   1.716   2.651   1.00 15.52 ? 219 ASP A N   1 
ATOM   1644 C CA  . ASP A 1 215 ? 7.667   0.320   2.284   1.00 15.49 ? 219 ASP A CA  1 
ATOM   1645 C C   . ASP A 1 215 ? 8.800   -0.596  2.721   1.00 15.58 ? 219 ASP A C   1 
ATOM   1646 O O   . ASP A 1 215 ? 8.546   -1.632  3.333   1.00 16.05 ? 219 ASP A O   1 
ATOM   1647 C CB  . ASP A 1 215 ? 7.469   0.185   0.778   1.00 15.66 ? 219 ASP A CB  1 
ATOM   1648 C CG  . ASP A 1 215 ? 6.299   0.982   0.273   1.00 15.71 ? 219 ASP A CG  1 
ATOM   1649 O OD1 . ASP A 1 215 ? 5.305   1.141   1.007   1.00 16.06 ? 219 ASP A OD1 1 
ATOM   1650 O OD2 . ASP A 1 215 ? 6.283   1.485   -0.862  1.00 16.67 ? 219 ASP A OD2 1 
ATOM   1651 N N   . ALA A 1 216 ? 10.042  -0.245  2.397   1.00 15.42 ? 220 ALA A N   1 
ATOM   1652 C CA  . ALA A 1 216 ? 11.170  -1.128  2.706   1.00 15.44 ? 220 ALA A CA  1 
ATOM   1653 C C   . ALA A 1 216 ? 12.449  -0.383  3.010   1.00 15.41 ? 220 ALA A C   1 
ATOM   1654 O O   . ALA A 1 216 ? 12.609  0.774   2.616   1.00 15.44 ? 220 ALA A O   1 
ATOM   1655 C CB  . ALA A 1 216 ? 11.401  -2.116  1.572   1.00 15.44 ? 220 ALA A CB  1 
ATOM   1656 N N   . SER A 1 217 ? 13.362  -1.063  3.701   1.00 15.33 ? 221 SER A N   1 
ATOM   1657 C CA  . SER A 1 217 ? 14.669  -0.498  4.021   1.00 15.34 ? 221 SER A CA  1 
ATOM   1658 C C   . SER A 1 217 ? 15.742  -1.563  4.029   1.00 15.32 ? 221 SER A C   1 
ATOM   1659 O O   . SER A 1 217 ? 15.505  -2.685  4.460   1.00 15.48 ? 221 SER A O   1 
ATOM   1660 C CB  . SER A 1 217 ? 14.645  0.200   5.376   1.00 15.36 ? 221 SER A CB  1 
ATOM   1661 O OG  . SER A 1 217 ? 15.929  0.713   5.680   1.00 15.56 ? 221 SER A OG  1 
ATOM   1662 N N   . LEU A 1 218 ? 16.930  -1.195  3.562   1.00 15.44 ? 222 LEU A N   1 
ATOM   1663 C CA  . LEU A 1 218 ? 18.076  -2.107  3.505   1.00 15.30 ? 222 LEU A CA  1 
ATOM   1664 C C   . LEU A 1 218 ? 19.168  -1.620  4.473   1.00 15.35 ? 222 LEU A C   1 
ATOM   1665 O O   . LEU A 1 218 ? 20.366  -1.819  4.246   1.00 15.67 ? 222 LEU A O   1 
ATOM   1666 C CB  . LEU A 1 218 ? 18.599  -2.181  2.062   1.00 15.17 ? 222 LEU A CB  1 
ATOM   1667 C CG  . LEU A 1 218 ? 17.573  -2.401  0.938   1.00 15.09 ? 222 LEU A CG  1 
ATOM   1668 C CD1 . LEU A 1 218 ? 18.082  -1.858  -0.370  1.00 15.43 ? 222 LEU A CD1 1 
ATOM   1669 C CD2 . LEU A 1 218 ? 17.207  -3.869  0.789   1.00 14.82 ? 222 LEU A CD2 1 
ATOM   1670 N N   . SER A 1 219 ? 18.737  -0.986  5.559   1.00 15.13 ? 223 SER A N   1 
ATOM   1671 C CA  . SER A 1 219 ? 19.639  -0.276  6.445   1.00 15.00 ? 223 SER A CA  1 
ATOM   1672 C C   . SER A 1 219 ? 19.647  -0.841  7.867   1.00 15.03 ? 223 SER A C   1 
ATOM   1673 O O   . SER A 1 219 ? 20.291  -0.293  8.764   1.00 14.90 ? 223 SER A O   1 
ATOM   1674 C CB  . SER A 1 219 ? 19.262  1.202   6.458   1.00 15.10 ? 223 SER A CB  1 
ATOM   1675 O OG  . SER A 1 219 ? 19.319  1.746   5.150   1.00 15.47 ? 223 SER A OG  1 
ATOM   1676 N N   . ALA A 1 220 ? 18.927  -1.940  8.067   1.00 15.04 ? 224 ALA A N   1 
ATOM   1677 C CA  . ALA A 1 220 ? 18.876  -2.593  9.360   1.00 14.66 ? 224 ALA A CA  1 
ATOM   1678 C C   . ALA A 1 220 ? 20.197  -3.313  9.608   1.00 14.52 ? 224 ALA A C   1 
ATOM   1679 O O   . ALA A 1 220 ? 20.526  -4.266  8.912   1.00 14.65 ? 224 ALA A O   1 
ATOM   1680 C CB  . ALA A 1 220 ? 17.708  -3.560  9.421   1.00 14.49 ? 224 ALA A CB  1 
ATOM   1681 N N   . TRP A 1 221 ? 20.962  -2.825  10.578  1.00 14.40 ? 225 TRP A N   1 
ATOM   1682 C CA  . TRP A 1 221 ? 22.162  -3.501  11.040  1.00 14.38 ? 225 TRP A CA  1 
ATOM   1683 C C   . TRP A 1 221 ? 21.843  -4.171  12.377  1.00 14.52 ? 225 TRP A C   1 
ATOM   1684 O O   . TRP A 1 221 ? 21.675  -3.494  13.402  1.00 14.38 ? 225 TRP A O   1 
ATOM   1685 C CB  . TRP A 1 221 ? 23.303  -2.499  11.200  1.00 14.42 ? 225 TRP A CB  1 
ATOM   1686 C CG  . TRP A 1 221 ? 24.066  -2.155  9.934   1.00 14.39 ? 225 TRP A CG  1 
ATOM   1687 C CD1 . TRP A 1 221 ? 23.545  -1.820  8.708   1.00 14.30 ? 225 TRP A CD1 1 
ATOM   1688 C CD2 . TRP A 1 221 ? 25.491  -2.067  9.797   1.00 14.66 ? 225 TRP A CD2 1 
ATOM   1689 N NE1 . TRP A 1 221 ? 24.558  -1.551  7.818   1.00 13.86 ? 225 TRP A NE1 1 
ATOM   1690 C CE2 . TRP A 1 221 ? 25.764  -1.694  8.457   1.00 14.54 ? 225 TRP A CE2 1 
ATOM   1691 C CE3 . TRP A 1 221 ? 26.576  -2.265  10.676  1.00 14.44 ? 225 TRP A CE3 1 
ATOM   1692 C CZ2 . TRP A 1 221 ? 27.074  -1.521  7.974   1.00 14.62 ? 225 TRP A CZ2 1 
ATOM   1693 C CZ3 . TRP A 1 221 ? 27.874  -2.093  10.198  1.00 14.01 ? 225 TRP A CZ3 1 
ATOM   1694 C CH2 . TRP A 1 221 ? 28.111  -1.727  8.856   1.00 14.43 ? 225 TRP A CH2 1 
ATOM   1695 N N   . LEU A 1 222 ? 21.756  -5.500  12.347  1.00 14.55 ? 226 LEU A N   1 
ATOM   1696 C CA  . LEU A 1 222 ? 21.291  -6.302  13.476  1.00 14.71 ? 226 LEU A CA  1 
ATOM   1697 C C   . LEU A 1 222 ? 22.295  -7.416  13.716  1.00 14.87 ? 226 LEU A C   1 
ATOM   1698 O O   . LEU A 1 222 ? 22.948  -7.819  12.767  1.00 15.05 ? 226 LEU A O   1 
ATOM   1699 C CB  . LEU A 1 222 ? 19.930  -6.905  13.132  1.00 14.75 ? 226 LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 222 ? 18.587  -6.255  13.518  1.00 14.71 ? 226 LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 222 ? 18.693  -4.848  14.049  1.00 15.10 ? 226 LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 222 ? 17.647  -6.297  12.335  1.00 14.74 ? 226 LEU A CD2 1 
ATOM   1703 N N   . PRO A 1 223 ? 22.426  -7.929  14.947  1.00 15.01 ? 227 PRO A N   1 
ATOM   1704 C CA  . PRO A 1 223 ? 21.627  -7.511  16.102  1.00 15.19 ? 227 PRO A CA  1 
ATOM   1705 C C   . PRO A 1 223 ? 22.194  -6.370  16.956  1.00 15.28 ? 227 PRO A C   1 
ATOM   1706 O O   . PRO A 1 223 ? 21.454  -5.812  17.765  1.00 15.19 ? 227 PRO A O   1 
ATOM   1707 C CB  . PRO A 1 223 ? 21.601  -8.781  16.959  1.00 15.33 ? 227 PRO A CB  1 
ATOM   1708 C CG  . PRO A 1 223 ? 22.934  -9.432  16.704  1.00 15.07 ? 227 PRO A CG  1 
ATOM   1709 C CD  . PRO A 1 223 ? 23.358  -9.015  15.307  1.00 15.01 ? 227 PRO A CD  1 
ATOM   1710 N N   . ASN A 1 224 ? 23.478  -6.040  16.785  1.00 15.47 ? 228 ASN A N   1 
ATOM   1711 C CA  . ASN A 1 224 ? 24.183  -5.123  17.701  1.00 15.65 ? 228 ASN A CA  1 
ATOM   1712 C C   . ASN A 1 224 ? 23.916  -3.634  17.482  1.00 15.92 ? 228 ASN A C   1 
ATOM   1713 O O   . ASN A 1 224 ? 23.742  -2.884  18.454  1.00 16.14 ? 228 ASN A O   1 
ATOM   1714 C CB  . ASN A 1 224 ? 25.697  -5.388  17.705  1.00 15.37 ? 228 ASN A CB  1 
ATOM   1715 C CG  . ASN A 1 224 ? 26.041  -6.812  18.085  1.00 15.19 ? 228 ASN A CG  1 
ATOM   1716 O OD1 . ASN A 1 224 ? 25.825  -7.233  19.218  1.00 14.94 ? 228 ASN A OD1 1 
ATOM   1717 N ND2 . ASN A 1 224 ? 26.586  -7.560  17.136  1.00 14.92 ? 228 ASN A ND2 1 
ATOM   1718 N N   . THR A 1 225 ? 23.885  -3.202  16.222  1.00 15.96 ? 229 THR A N   1 
ATOM   1719 C CA  . THR A 1 225 ? 23.852  -1.770  15.927  1.00 16.14 ? 229 THR A CA  1 
ATOM   1720 C C   . THR A 1 225 ? 22.513  -1.128  16.292  1.00 16.28 ? 229 THR A C   1 
ATOM   1721 O O   . THR A 1 225 ? 22.489  -0.030  16.850  1.00 16.42 ? 229 THR A O   1 
ATOM   1722 C CB  . THR A 1 225 ? 24.183  -1.497  14.442  1.00 16.31 ? 229 THR A CB  1 
ATOM   1723 O OG1 . THR A 1 225 ? 25.377  -2.194  14.056  1.00 16.25 ? 229 THR A OG1 1 
ATOM   1724 C CG2 . THR A 1 225 ? 24.556  -0.051  14.249  1.00 16.22 ? 229 THR A CG2 1 
ATOM   1725 N N   . HIS A 1 226 ? 21.417  -1.818  15.956  1.00 16.18 ? 230 HIS A N   1 
ATOM   1726 C CA  . HIS A 1 226 ? 20.055  -1.330  16.174  1.00 15.70 ? 230 HIS A CA  1 
ATOM   1727 C C   . HIS A 1 226 ? 19.295  -2.176  17.189  1.00 15.73 ? 230 HIS A C   1 
ATOM   1728 O O   . HIS A 1 226 ? 18.092  -2.407  17.039  1.00 15.65 ? 230 HIS A O   1 
ATOM   1729 C CB  . HIS A 1 226 ? 19.300  -1.277  14.849  1.00 15.47 ? 230 HIS A CB  1 
ATOM   1730 C CG  . HIS A 1 226 ? 19.872  -0.299  13.873  1.00 15.27 ? 230 HIS A CG  1 
ATOM   1731 N ND1 . HIS A 1 226 ? 19.782  -0.471  12.511  1.00 14.81 ? 230 HIS A ND1 1 
ATOM   1732 C CD2 . HIS A 1 226 ? 20.554  0.856   14.062  1.00 14.69 ? 230 HIS A CD2 1 
ATOM   1733 C CE1 . HIS A 1 226 ? 20.373  0.540   11.902  1.00 14.58 ? 230 HIS A CE1 1 
ATOM   1734 N NE2 . HIS A 1 226 ? 20.853  1.358   12.821  1.00 14.13 ? 230 HIS A NE2 1 
ATOM   1735 N N   . LYS A 1 227 ? 20.010  -2.620  18.224  1.00 15.62 ? 231 LYS A N   1 
ATOM   1736 C CA  . LYS A 1 227 ? 19.447  -3.423  19.308  1.00 15.51 ? 231 LYS A CA  1 
ATOM   1737 C C   . LYS A 1 227 ? 18.165  -2.786  19.823  1.00 15.50 ? 231 LYS A C   1 
ATOM   1738 O O   . LYS A 1 227 ? 17.109  -3.433  19.841  1.00 15.38 ? 231 LYS A O   1 
ATOM   1739 C CB  . LYS A 1 227 ? 20.449  -3.527  20.457  1.00 15.54 ? 231 LYS A CB  1 
ATOM   1740 C CG  . LYS A 1 227 ? 20.359  -4.813  21.250  1.00 16.16 ? 231 LYS A CG  1 
ATOM   1741 C CD  . LYS A 1 227 ? 20.586  -4.561  22.740  1.00 18.21 ? 231 LYS A CD  1 
ATOM   1742 C CE  . LYS A 1 227 ? 21.505  -5.600  23.395  1.00 18.74 ? 231 LYS A CE  1 
ATOM   1743 N NZ  . LYS A 1 227 ? 21.092  -7.002  23.107  1.00 19.19 ? 231 LYS A NZ  1 
ATOM   1744 N N   . ALA A 1 228 ? 18.275  -1.510  20.215  1.00 15.42 ? 232 ALA A N   1 
ATOM   1745 C CA  . ALA A 1 228 ? 17.178  -0.731  20.791  1.00 15.13 ? 232 ALA A CA  1 
ATOM   1746 C C   . ALA A 1 228 ? 16.040  -0.475  19.807  1.00 15.11 ? 232 ALA A C   1 
ATOM   1747 O O   . ALA A 1 228 ? 14.876  -0.697  20.143  1.00 15.04 ? 232 ALA A O   1 
ATOM   1748 C CB  . ALA A 1 228 ? 17.698  0.578   21.345  1.00 15.06 ? 232 ALA A CB  1 
ATOM   1749 N N   . TYR A 1 229 ? 16.378  -0.012  18.601  1.00 15.12 ? 233 TYR A N   1 
ATOM   1750 C CA  . TYR A 1 229 ? 15.382  0.253   17.549  1.00 15.12 ? 233 TYR A CA  1 
ATOM   1751 C C   . TYR A 1 229 ? 14.557  -0.985  17.145  1.00 15.15 ? 233 TYR A C   1 
ATOM   1752 O O   . TYR A 1 229 ? 13.332  -0.893  16.994  1.00 15.21 ? 233 TYR A O   1 
ATOM   1753 C CB  . TYR A 1 229 ? 16.033  0.874   16.309  1.00 15.02 ? 233 TYR A CB  1 
ATOM   1754 C CG  . TYR A 1 229 ? 16.600  2.265   16.499  1.00 15.28 ? 233 TYR A CG  1 
ATOM   1755 C CD1 . TYR A 1 229 ? 15.850  3.289   17.100  1.00 15.45 ? 233 TYR A CD1 1 
ATOM   1756 C CD2 . TYR A 1 229 ? 17.884  2.575   16.051  1.00 15.63 ? 233 TYR A CD2 1 
ATOM   1757 C CE1 . TYR A 1 229 ? 16.384  4.589   17.268  1.00 15.20 ? 233 TYR A CE1 1 
ATOM   1758 C CE2 . TYR A 1 229 ? 18.424  3.874   16.208  1.00 15.76 ? 233 TYR A CE2 1 
ATOM   1759 C CZ  . TYR A 1 229 ? 17.670  4.866   16.815  1.00 15.41 ? 233 TYR A CZ  1 
ATOM   1760 O OH  . TYR A 1 229 ? 18.207  6.120   16.958  1.00 15.18 ? 233 TYR A OH  1 
ATOM   1761 N N   . ALA A 1 230 ? 15.233  -2.128  16.972  1.00 15.00 ? 234 ALA A N   1 
ATOM   1762 C CA  . ALA A 1 230 ? 14.571  -3.414  16.717  1.00 14.81 ? 234 ALA A CA  1 
ATOM   1763 C C   . ALA A 1 230 ? 13.671  -3.849  17.878  1.00 14.83 ? 234 ALA A C   1 
ATOM   1764 O O   . ALA A 1 230 ? 12.538  -4.277  17.655  1.00 14.96 ? 234 ALA A O   1 
ATOM   1765 C CB  . ALA A 1 230 ? 15.595  -4.490  16.404  1.00 14.63 ? 234 ALA A CB  1 
ATOM   1766 N N   . ALA A 1 231 ? 14.179  -3.738  19.106  1.00 14.80 ? 235 ALA A N   1 
ATOM   1767 C CA  . ALA A 1 231 ? 13.394  -4.014  20.311  1.00 14.79 ? 235 ALA A CA  1 
ATOM   1768 C C   . ALA A 1 231 ? 12.122  -3.151  20.355  1.00 14.88 ? 235 ALA A C   1 
ATOM   1769 O O   . ALA A 1 231 ? 11.002  -3.671  20.464  1.00 14.76 ? 235 ALA A O   1 
ATOM   1770 C CB  . ALA A 1 231 ? 14.245  -3.791  21.565  1.00 14.47 ? 235 ALA A CB  1 
ATOM   1771 N N   . LYS A 1 232 ? 12.314  -1.838  20.248  1.00 14.93 ? 236 LYS A N   1 
ATOM   1772 C CA  . LYS A 1 232 ? 11.239  -0.844  20.267  1.00 15.04 ? 236 LYS A CA  1 
ATOM   1773 C C   . LYS A 1 232 ? 10.062  -1.144  19.327  1.00 15.10 ? 236 LYS A C   1 
ATOM   1774 O O   . LYS A 1 232 ? 8.918   -0.870  19.675  1.00 15.18 ? 236 LYS A O   1 
ATOM   1775 C CB  . LYS A 1 232 ? 11.829  0.531   19.939  1.00 15.17 ? 236 LYS A CB  1 
ATOM   1776 C CG  . LYS A 1 232 ? 10.867  1.713   20.022  1.00 15.37 ? 236 LYS A CG  1 
ATOM   1777 C CD  . LYS A 1 232 ? 11.557  2.970   19.532  1.00 15.56 ? 236 LYS A CD  1 
ATOM   1778 C CE  . LYS A 1 232 ? 10.598  4.123   19.461  1.00 16.21 ? 236 LYS A CE  1 
ATOM   1779 N NZ  . LYS A 1 232 ? 11.274  5.368   19.009  1.00 16.80 ? 236 LYS A NZ  1 
ATOM   1780 N N   . TYR A 1 233 ? 10.350  -1.688  18.143  1.00 15.18 ? 237 TYR A N   1 
ATOM   1781 C CA  . TYR A 1 233 ? 9.319   -2.025  17.158  1.00 15.12 ? 237 TYR A CA  1 
ATOM   1782 C C   . TYR A 1 233 ? 9.270   -3.526  16.914  1.00 15.25 ? 237 TYR A C   1 
ATOM   1783 O O   . TYR A 1 233 ? 9.211   -3.977  15.770  1.00 15.12 ? 237 TYR A O   1 
ATOM   1784 C CB  . TYR A 1 233 ? 9.574   -1.289  15.844  1.00 15.22 ? 237 TYR A CB  1 
ATOM   1785 C CG  . TYR A 1 233 ? 9.580   0.221   15.958  1.00 15.16 ? 237 TYR A CG  1 
ATOM   1786 C CD1 . TYR A 1 233 ? 8.416   0.920   16.272  1.00 15.02 ? 237 TYR A CD1 1 
ATOM   1787 C CD2 . TYR A 1 233 ? 10.747  0.954   15.740  1.00 14.78 ? 237 TYR A CD2 1 
ATOM   1788 C CE1 . TYR A 1 233 ? 8.409   2.310   16.372  1.00 14.99 ? 237 TYR A CE1 1 
ATOM   1789 C CE2 . TYR A 1 233 ? 10.752  2.345   15.835  1.00 14.99 ? 237 TYR A CE2 1 
ATOM   1790 C CZ  . TYR A 1 233 ? 9.575   3.015   16.150  1.00 15.41 ? 237 TYR A CZ  1 
ATOM   1791 O OH  . TYR A 1 233 ? 9.554   4.390   16.257  1.00 15.62 ? 237 TYR A OH  1 
ATOM   1792 N N   . LYS A 1 234 ? 9.278   -4.280  18.015  1.00 15.45 ? 238 LYS A N   1 
ATOM   1793 C CA  . LYS A 1 234 ? 9.399   -5.747  18.030  1.00 15.31 ? 238 LYS A CA  1 
ATOM   1794 C C   . LYS A 1 234 ? 8.391   -6.458  17.120  1.00 15.00 ? 238 LYS A C   1 
ATOM   1795 O O   . LYS A 1 234 ? 8.779   -7.284  16.289  1.00 15.13 ? 238 LYS A O   1 
ATOM   1796 C CB  . LYS A 1 234 ? 9.313   -6.262  19.481  1.00 15.36 ? 238 LYS A CB  1 
ATOM   1797 C CG  . LYS A 1 234 ? 9.837   -7.672  19.739  1.00 15.73 ? 238 LYS A CG  1 
ATOM   1798 C CD  . LYS A 1 234 ? 8.693   -8.654  20.009  1.00 17.21 ? 238 LYS A CD  1 
ATOM   1799 C CE  . LYS A 1 234 ? 8.940   -9.504  21.259  1.00 17.55 ? 238 LYS A CE  1 
ATOM   1800 N NZ  . LYS A 1 234 ? 10.209  -10.303 21.188  1.00 17.97 ? 238 LYS A NZ  1 
ATOM   1801 N N   . GLY A 1 235 ? 7.113   -6.132  17.260  1.00 14.51 ? 239 GLY A N   1 
ATOM   1802 C CA  . GLY A 1 235 ? 6.086   -6.844  16.510  1.00 14.60 ? 239 GLY A CA  1 
ATOM   1803 C C   . GLY A 1 235 ? 5.460   -6.057  15.374  1.00 14.63 ? 239 GLY A C   1 
ATOM   1804 O O   . GLY A 1 235 ? 4.369   -6.395  14.901  1.00 14.36 ? 239 GLY A O   1 
ATOM   1805 N N   . LYS A 1 236 ? 6.164   -5.015  14.931  1.00 14.76 ? 240 LYS A N   1 
ATOM   1806 C CA  . LYS A 1 236 ? 5.594   -4.003  14.046  1.00 14.79 ? 240 LYS A CA  1 
ATOM   1807 C C   . LYS A 1 236 ? 6.320   -3.836  12.711  1.00 14.96 ? 240 LYS A C   1 
ATOM   1808 O O   . LYS A 1 236 ? 6.030   -2.894  11.970  1.00 15.30 ? 240 LYS A O   1 
ATOM   1809 C CB  . LYS A 1 236 ? 5.506   -2.655  14.775  1.00 14.77 ? 240 LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 236 ? 4.621   -2.684  16.010  1.00 14.90 ? 240 LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 236 ? 4.467   -1.323  16.619  1.00 15.08 ? 240 LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 236 ? 3.504   -1.380  17.786  1.00 15.69 ? 240 LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 236 ? 3.143   -0.009  18.274  1.00 16.44 ? 240 LYS A NZ  1 
ATOM   1814 N N   . TYR A 1 237 ? 7.256   -4.736  12.407  1.00 14.92 ? 241 TYR A N   1 
ATOM   1815 C CA  . TYR A 1 237 ? 7.937   -4.754  11.104  1.00 14.91 ? 241 TYR A CA  1 
ATOM   1816 C C   . TYR A 1 237 ? 8.164   -6.188  10.625  1.00 14.93 ? 241 TYR A C   1 
ATOM   1817 O O   . TYR A 1 237 ? 7.954   -7.134  11.386  1.00 14.88 ? 241 TYR A O   1 
ATOM   1818 C CB  . TYR A 1 237 ? 9.264   -3.970  11.156  1.00 14.92 ? 241 TYR A CB  1 
ATOM   1819 C CG  . TYR A 1 237 ? 10.411  -4.665  11.881  1.00 14.94 ? 241 TYR A CG  1 
ATOM   1820 C CD1 . TYR A 1 237 ? 11.222  -5.594  11.224  1.00 14.62 ? 241 TYR A CD1 1 
ATOM   1821 C CD2 . TYR A 1 237 ? 10.696  -4.377  13.221  1.00 15.25 ? 241 TYR A CD2 1 
ATOM   1822 C CE1 . TYR A 1 237 ? 12.273  -6.226  11.882  1.00 14.79 ? 241 TYR A CE1 1 
ATOM   1823 C CE2 . TYR A 1 237 ? 11.752  -5.009  13.895  1.00 14.83 ? 241 TYR A CE2 1 
ATOM   1824 C CZ  . TYR A 1 237 ? 12.531  -5.927  13.213  1.00 14.88 ? 241 TYR A CZ  1 
ATOM   1825 O OH  . TYR A 1 237 ? 13.566  -6.557  13.851  1.00 14.81 ? 241 TYR A OH  1 
ATOM   1826 N N   . ASP A 1 238 ? 8.584   -6.343  9.367   1.00 14.99 ? 242 ASP A N   1 
ATOM   1827 C CA  . ASP A 1 238 ? 8.983   -7.650  8.829   1.00 14.90 ? 242 ASP A CA  1 
ATOM   1828 C C   . ASP A 1 238 ? 10.474  -7.674  8.517   1.00 14.83 ? 242 ASP A C   1 
ATOM   1829 O O   . ASP A 1 238 ? 10.992  -6.742  7.905   1.00 14.87 ? 242 ASP A O   1 
ATOM   1830 C CB  . ASP A 1 238 ? 8.207   -7.978  7.555   1.00 14.89 ? 242 ASP A CB  1 
ATOM   1831 C CG  . ASP A 1 238 ? 6.784   -8.411  7.825   1.00 15.34 ? 242 ASP A CG  1 
ATOM   1832 O OD1 . ASP A 1 238 ? 5.894   -8.062  7.014   1.00 16.96 ? 242 ASP A OD1 1 
ATOM   1833 O OD2 . ASP A 1 238 ? 6.453   -9.102  8.808   1.00 15.26 ? 242 ASP A OD2 1 
ATOM   1834 N N   . ASP A 1 239 ? 11.154  -8.734  8.943   1.00 14.74 ? 243 ASP A N   1 
ATOM   1835 C CA  . ASP A 1 239 ? 12.552  -8.963  8.590   1.00 14.72 ? 243 ASP A CA  1 
ATOM   1836 C C   . ASP A 1 239 ? 12.559  -10.081 7.569   1.00 14.66 ? 243 ASP A C   1 
ATOM   1837 O O   . ASP A 1 239 ? 12.431  -11.257 7.929   1.00 14.76 ? 243 ASP A O   1 
ATOM   1838 C CB  . ASP A 1 239 ? 13.364  -9.368  9.831   1.00 14.80 ? 243 ASP A CB  1 
ATOM   1839 C CG  . ASP A 1 239 ? 14.863  -9.479  9.561   1.00 14.71 ? 243 ASP A CG  1 
ATOM   1840 O OD1 . ASP A 1 239 ? 15.628  -9.370  10.540  1.00 15.66 ? 243 ASP A OD1 1 
ATOM   1841 O OD2 . ASP A 1 239 ? 15.375  -9.679  8.437   1.00 13.89 ? 243 ASP A OD2 1 
ATOM   1842 N N   . ILE A 1 240 ? 12.711  -9.716  6.299   1.00 14.49 ? 244 ILE A N   1 
ATOM   1843 C CA  . ILE A 1 240 ? 12.490  -10.668 5.202   1.00 14.40 ? 244 ILE A CA  1 
ATOM   1844 C C   . ILE A 1 240 ? 13.745  -11.128 4.459   1.00 14.29 ? 244 ILE A C   1 
ATOM   1845 O O   . ILE A 1 240 ? 13.643  -11.872 3.491   1.00 14.53 ? 244 ILE A O   1 
ATOM   1846 C CB  . ILE A 1 240 ? 11.395  -10.155 4.193   1.00 14.42 ? 244 ILE A CB  1 
ATOM   1847 C CG1 . ILE A 1 240 ? 11.786  -8.800  3.581   1.00 14.41 ? 244 ILE A CG1 1 
ATOM   1848 C CG2 . ILE A 1 240 ? 10.024  -10.097 4.866   1.00 14.01 ? 244 ILE A CG2 1 
ATOM   1849 C CD1 . ILE A 1 240 ? 11.168  -8.519  2.227   1.00 14.49 ? 244 ILE A CD1 1 
ATOM   1850 N N   . GLY A 1 241 ? 14.917  -10.687 4.903   1.00 14.10 ? 245 GLY A N   1 
ATOM   1851 C CA  . GLY A 1 241 ? 16.173  -11.178 4.340   1.00 14.03 ? 245 GLY A CA  1 
ATOM   1852 C C   . GLY A 1 241 ? 17.412  -10.664 5.048   1.00 14.04 ? 245 GLY A C   1 
ATOM   1853 O O   . GLY A 1 241 ? 17.359  -9.652  5.756   1.00 14.26 ? 245 GLY A O   1 
ATOM   1854 N N   . THR A 1 242 ? 18.525  -11.377 4.870   1.00 13.73 ? 246 THR A N   1 
ATOM   1855 C CA  . THR A 1 242 ? 19.840  -10.868 5.254   1.00 13.52 ? 246 THR A CA  1 
ATOM   1856 C C   . THR A 1 242 ? 20.618  -10.563 3.978   1.00 13.39 ? 246 THR A C   1 
ATOM   1857 O O   . THR A 1 242 ? 20.811  -11.440 3.149   1.00 13.18 ? 246 THR A O   1 
ATOM   1858 C CB  . THR A 1 242 ? 20.597  -11.872 6.177   1.00 13.38 ? 246 THR A CB  1 
ATOM   1859 O OG1 . THR A 1 242 ? 20.075  -11.781 7.504   1.00 13.26 ? 246 THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 242 ? 22.037  -11.456 6.380   1.00 13.02 ? 246 THR A CG2 1 
ATOM   1861 N N   . SER A 1 243 ? 21.041  -9.313  3.823   1.00 13.57 ? 247 SER A N   1 
ATOM   1862 C CA  . SER A 1 243 ? 21.799  -8.900  2.646   1.00 13.92 ? 247 SER A CA  1 
ATOM   1863 C C   . SER A 1 243 ? 23.321  -8.969  2.833   1.00 14.19 ? 247 SER A C   1 
ATOM   1864 O O   . SER A 1 243 ? 24.068  -8.949  1.846   1.00 14.44 ? 247 SER A O   1 
ATOM   1865 C CB  . SER A 1 243 ? 21.359  -7.520  2.156   1.00 13.86 ? 247 SER A CB  1 
ATOM   1866 O OG  . SER A 1 243 ? 21.371  -6.554  3.193   1.00 14.36 ? 247 SER A OG  1 
ATOM   1867 N N   . MET A 1 244 ? 23.786  -9.058  4.078   1.00 14.22 ? 248 MET A N   1 
ATOM   1868 C CA  . MET A 1 244 ? 25.213  -9.283  4.315   1.00 14.73 ? 248 MET A CA  1 
ATOM   1869 C C   . MET A 1 244 ? 25.555  -9.744  5.725   1.00 14.60 ? 248 MET A C   1 
ATOM   1870 O O   . MET A 1 244 ? 24.941  -9.320  6.693   1.00 14.56 ? 248 MET A O   1 
ATOM   1871 C CB  . MET A 1 244 ? 26.032  -8.036  3.977   1.00 14.68 ? 248 MET A CB  1 
ATOM   1872 C CG  . MET A 1 244 ? 27.516  -8.314  3.804   1.00 15.09 ? 248 MET A CG  1 
ATOM   1873 S SD  . MET A 1 244 ? 28.484  -6.842  3.473   1.00 15.65 ? 248 MET A SD  1 
ATOM   1874 C CE  . MET A 1 244 ? 27.734  -6.231  1.949   1.00 15.27 ? 248 MET A CE  1 
ATOM   1875 N N   . THR A 1 245 ? 26.560  -10.608 5.814   1.00 14.87 ? 249 THR A N   1 
ATOM   1876 C CA  . THR A 1 245 ? 27.081  -11.106 7.087   1.00 15.09 ? 249 THR A CA  1 
ATOM   1877 C C   . THR A 1 245 ? 28.547  -10.670 7.299   1.00 15.16 ? 249 THR A C   1 
ATOM   1878 O O   . THR A 1 245 ? 29.142  -9.997  6.453   1.00 15.06 ? 249 THR A O   1 
ATOM   1879 C CB  . THR A 1 245 ? 26.948  -12.656 7.162   1.00 15.11 ? 249 THR A CB  1 
ATOM   1880 O OG1 . THR A 1 245 ? 28.129  -13.281 6.639   1.00 15.37 ? 249 THR A OG1 1 
ATOM   1881 C CG2 . THR A 1 245 ? 25.822  -13.170 6.242   1.00 14.82 ? 249 THR A CG2 1 
ATOM   1882 N N   . GLY A 1 246 ? 29.121  -11.045 8.438   1.00 15.33 ? 250 GLY A N   1 
ATOM   1883 C CA  . GLY A 1 246 ? 30.538  -10.791 8.705   1.00 15.57 ? 250 GLY A CA  1 
ATOM   1884 C C   . GLY A 1 246 ? 30.947  -9.328  8.785   1.00 15.72 ? 250 GLY A C   1 
ATOM   1885 O O   . GLY A 1 246 ? 32.133  -9.004  8.670   1.00 15.79 ? 250 GLY A O   1 
ATOM   1886 N N   . VAL A 1 247 ? 29.976  -8.440  8.980   1.00 15.93 ? 251 VAL A N   1 
ATOM   1887 C CA  . VAL A 1 247 ? 30.283  -7.031  9.215   1.00 16.27 ? 251 VAL A CA  1 
ATOM   1888 C C   . VAL A 1 247 ? 30.868  -6.893  10.629  1.00 16.73 ? 251 VAL A C   1 
ATOM   1889 O O   . VAL A 1 247 ? 30.301  -7.409  11.598  1.00 17.06 ? 251 VAL A O   1 
ATOM   1890 C CB  . VAL A 1 247 ? 29.057  -6.084  8.971   1.00 16.10 ? 251 VAL A CB  1 
ATOM   1891 C CG1 . VAL A 1 247 ? 27.908  -6.811  8.277   1.00 15.58 ? 251 VAL A CG1 1 
ATOM   1892 C CG2 . VAL A 1 247 ? 28.577  -5.456  10.239  1.00 16.11 ? 251 VAL A CG2 1 
ATOM   1893 N N   . LYS A 1 248 ? 32.023  -6.239  10.735  1.00 17.06 ? 252 LYS A N   1 
ATOM   1894 C CA  . LYS A 1 248 ? 32.715  -6.078  12.017  1.00 17.42 ? 252 LYS A CA  1 
ATOM   1895 C C   . LYS A 1 248 ? 32.755  -4.602  12.376  1.00 17.79 ? 252 LYS A C   1 
ATOM   1896 O O   . LYS A 1 248 ? 32.598  -3.743  11.504  1.00 17.77 ? 252 LYS A O   1 
ATOM   1897 C CB  . LYS A 1 248 ? 34.140  -6.657  11.949  1.00 17.39 ? 252 LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 248 ? 34.200  -8.188  11.687  1.00 17.62 ? 252 LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 248 ? 35.346  -8.597  10.744  1.00 17.46 ? 252 LYS A CD  1 
ATOM   1900 C CE  . LYS A 1 248 ? 36.386  -9.496  11.400  1.00 17.08 ? 252 LYS A CE  1 
ATOM   1901 N NZ  . LYS A 1 248 ? 37.214  -8.815  12.422  1.00 17.03 ? 252 LYS A NZ  1 
ATOM   1902 N N   . MET A 1 249 ? 32.939  -4.306  13.662  1.00 18.26 ? 253 MET A N   1 
ATOM   1903 C CA  . MET A 1 249 ? 33.114  -2.912  14.112  1.00 18.65 ? 253 MET A CA  1 
ATOM   1904 C C   . MET A 1 249 ? 33.903  -2.775  15.410  1.00 17.86 ? 253 MET A C   1 
ATOM   1905 O O   . MET A 1 249 ? 33.862  -3.650  16.278  1.00 17.83 ? 253 MET A O   1 
ATOM   1906 C CB  . MET A 1 249 ? 31.775  -2.180  14.222  1.00 18.53 ? 253 MET A CB  1 
ATOM   1907 C CG  . MET A 1 249 ? 30.780  -2.868  15.102  1.00 19.29 ? 253 MET A CG  1 
ATOM   1908 S SD  . MET A 1 249 ? 29.115  -2.575  14.501  1.00 21.05 ? 253 MET A SD  1 
ATOM   1909 C CE  . MET A 1 249 ? 28.265  -3.948  15.299  1.00 20.17 ? 253 MET A CE  1 
ATOM   1910 N N   . GLY A 1 250 ? 34.625  -1.669  15.527  1.00 17.18 ? 254 GLY A N   1 
ATOM   1911 C CA  . GLY A 1 250 ? 35.356  -1.393  16.740  1.00 16.45 ? 254 GLY A CA  1 
ATOM   1912 C C   . GLY A 1 250 ? 36.374  -0.293  16.609  1.00 15.82 ? 254 GLY A C   1 
ATOM   1913 O O   . GLY A 1 250 ? 36.186  0.653   15.850  1.00 15.57 ? 254 GLY A O   1 
ATOM   1914 N N   . LEU A 1 251 ? 37.451  -0.433  17.376  1.00 15.43 ? 255 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 251 ? 38.558  0.508   17.365  1.00 14.90 ? 255 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 251 ? 39.528  0.119   16.264  1.00 14.60 ? 255 LEU A C   1 
ATOM   1917 O O   . LEU A 1 251 ? 39.960  -1.032  16.159  1.00 14.50 ? 255 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 251 ? 39.254  0.565   18.738  1.00 14.96 ? 255 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 251 ? 38.387  0.891   19.970  1.00 14.83 ? 255 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 251 ? 39.212  0.876   21.250  1.00 14.68 ? 255 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 251 ? 37.637  2.216   19.834  1.00 13.72 ? 255 LEU A CD2 1 
ATOM   1922 N N   . VAL A 1 252 ? 39.841  1.094   15.427  1.00 14.32 ? 256 VAL A N   1 
ATOM   1923 C CA  . VAL A 1 252 ? 40.661  0.872   14.252  1.00 14.05 ? 256 VAL A CA  1 
ATOM   1924 C C   . VAL A 1 252 ? 41.855  1.812   14.327  1.00 14.15 ? 256 VAL A C   1 
ATOM   1925 O O   . VAL A 1 252 ? 41.704  3.001   14.608  1.00 14.29 ? 256 VAL A O   1 
ATOM   1926 C CB  . VAL A 1 252 ? 39.831  1.086   12.943  1.00 13.84 ? 256 VAL A CB  1 
ATOM   1927 C CG1 . VAL A 1 252 ? 40.712  1.196   11.712  1.00 13.35 ? 256 VAL A CG1 1 
ATOM   1928 C CG2 . VAL A 1 252 ? 38.844  -0.034  12.761  1.00 13.52 ? 256 VAL A CG2 1 
ATOM   1929 N N   . VAL A 1 253 ? 43.044  1.259   14.120  1.00 14.18 ? 257 VAL A N   1 
ATOM   1930 C CA  . VAL A 1 253 ? 44.259  2.059   13.994  1.00 14.33 ? 257 VAL A CA  1 
ATOM   1931 C C   . VAL A 1 253 ? 44.880  1.752   12.631  1.00 14.51 ? 257 VAL A C   1 
ATOM   1932 O O   . VAL A 1 253 ? 44.586  0.703   12.040  1.00 14.47 ? 257 VAL A O   1 
ATOM   1933 C CB  . VAL A 1 253 ? 45.304  1.780   15.143  1.00 14.41 ? 257 VAL A CB  1 
ATOM   1934 C CG1 . VAL A 1 253 ? 44.819  2.306   16.473  1.00 13.80 ? 257 VAL A CG1 1 
ATOM   1935 C CG2 . VAL A 1 253 ? 45.670  0.292   15.241  1.00 14.33 ? 257 VAL A CG2 1 
ATOM   1936 N N   . PRO A 1 254 ? 45.743  2.638   12.133  1.00 14.57 ? 258 PRO A N   1 
ATOM   1937 C CA  . PRO A 1 254 ? 46.480  2.350   10.920  1.00 14.63 ? 258 PRO A CA  1 
ATOM   1938 C C   . PRO A 1 254 ? 47.524  1.292   11.219  1.00 14.85 ? 258 PRO A C   1 
ATOM   1939 O O   . PRO A 1 254 ? 47.951  1.143   12.376  1.00 14.92 ? 258 PRO A O   1 
ATOM   1940 C CB  . PRO A 1 254 ? 47.170  3.675   10.593  1.00 14.56 ? 258 PRO A CB  1 
ATOM   1941 C CG  . PRO A 1 254 ? 46.576  4.671   11.484  1.00 14.61 ? 258 PRO A CG  1 
ATOM   1942 C CD  . PRO A 1 254 ? 46.108  3.949   12.693  1.00 14.58 ? 258 PRO A CD  1 
ATOM   1943 N N   . GLN A 1 255 ? 47.938  0.570   10.184  1.00 14.89 ? 259 GLN A N   1 
ATOM   1944 C CA  . GLN A 1 255 ? 48.883  -0.519  10.352  1.00 15.04 ? 259 GLN A CA  1 
ATOM   1945 C C   . GLN A 1 255 ? 50.273  -0.098  10.829  1.00 15.04 ? 259 GLN A C   1 
ATOM   1946 O O   . GLN A 1 255 ? 51.014  -0.929  11.369  1.00 14.93 ? 259 GLN A O   1 
ATOM   1947 C CB  . GLN A 1 255 ? 48.976  -1.336  9.073   1.00 14.94 ? 259 GLN A CB  1 
ATOM   1948 C CG  . GLN A 1 255 ? 47.907  -2.400  8.993   1.00 15.78 ? 259 GLN A CG  1 
ATOM   1949 C CD  . GLN A 1 255 ? 47.794  -3.009  7.612   1.00 17.20 ? 259 GLN A CD  1 
ATOM   1950 O OE1 . GLN A 1 255 ? 48.804  -3.412  7.023   1.00 18.04 ? 259 GLN A OE1 1 
ATOM   1951 N NE2 . GLN A 1 255 ? 46.564  -3.077  7.085   1.00 16.62 ? 259 GLN A NE2 1 
ATOM   1952 N N   . TYR A 1 256 ? 50.627  1.176   10.647  1.00 15.06 ? 260 TYR A N   1 
ATOM   1953 C CA  . TYR A 1 256 ? 51.956  1.621   11.062  1.00 15.41 ? 260 TYR A CA  1 
ATOM   1954 C C   . TYR A 1 256 ? 52.151  1.598   12.590  1.00 15.78 ? 260 TYR A C   1 
ATOM   1955 O O   . TYR A 1 256 ? 53.283  1.463   13.080  1.00 15.86 ? 260 TYR A O   1 
ATOM   1956 C CB  . TYR A 1 256 ? 52.381  2.951   10.415  1.00 15.11 ? 260 TYR A CB  1 
ATOM   1957 C CG  . TYR A 1 256 ? 51.431  4.119   10.556  1.00 14.95 ? 260 TYR A CG  1 
ATOM   1958 C CD1 . TYR A 1 256 ? 51.405  4.892   11.724  1.00 14.72 ? 260 TYR A CD1 1 
ATOM   1959 C CD2 . TYR A 1 256 ? 50.595  4.492   9.499   1.00 14.73 ? 260 TYR A CD2 1 
ATOM   1960 C CE1 . TYR A 1 256 ? 50.542  5.981   11.851  1.00 14.19 ? 260 TYR A CE1 1 
ATOM   1961 C CE2 . TYR A 1 256 ? 49.736  5.581   9.614   1.00 14.32 ? 260 TYR A CE2 1 
ATOM   1962 C CZ  . TYR A 1 256 ? 49.713  6.314   10.794  1.00 14.58 ? 260 TYR A CZ  1 
ATOM   1963 O OH  . TYR A 1 256 ? 48.864  7.381   10.914  1.00 14.62 ? 260 TYR A OH  1 
ATOM   1964 N N   . MET A 1 257 ? 51.039  1.678   13.321  1.00 16.01 ? 261 MET A N   1 
ATOM   1965 C CA  . MET A 1 257 ? 51.034  1.509   14.770  1.00 16.37 ? 261 MET A CA  1 
ATOM   1966 C C   . MET A 1 257 ? 51.212  0.028   15.138  1.00 16.60 ? 261 MET A C   1 
ATOM   1967 O O   . MET A 1 257 ? 50.286  -0.610  15.665  1.00 16.53 ? 261 MET A O   1 
ATOM   1968 C CB  . MET A 1 257 ? 49.740  2.082   15.371  1.00 16.31 ? 261 MET A CB  1 
ATOM   1969 C CG  . MET A 1 257 ? 49.623  3.610   15.279  1.00 16.57 ? 261 MET A CG  1 
ATOM   1970 S SD  . MET A 1 257 ? 48.059  4.291   15.876  1.00 16.86 ? 261 MET A SD  1 
ATOM   1971 C CE  . MET A 1 257 ? 48.244  4.195   17.656  1.00 15.84 ? 261 MET A CE  1 
ATOM   1972 N N   . LYS A 1 258 ? 52.408  -0.507  14.860  1.00 16.92 ? 262 LYS A N   1 
ATOM   1973 C CA  . LYS A 1 258 ? 52.709  -1.939  15.054  1.00 17.26 ? 262 LYS A CA  1 
ATOM   1974 C C   . LYS A 1 258 ? 52.472  -2.431  16.477  1.00 17.21 ? 262 LYS A C   1 
ATOM   1975 O O   . LYS A 1 258 ? 51.970  -3.533  16.678  1.00 17.31 ? 262 LYS A O   1 
ATOM   1976 C CB  . LYS A 1 258 ? 54.153  -2.277  14.656  1.00 17.42 ? 262 LYS A CB  1 
ATOM   1977 C CG  . LYS A 1 258 ? 54.366  -2.559  13.175  1.00 18.52 ? 262 LYS A CG  1 
ATOM   1978 C CD  . LYS A 1 258 ? 55.109  -1.407  12.491  1.00 20.40 ? 262 LYS A CD  1 
ATOM   1979 C CE  . LYS A 1 258 ? 54.589  -1.146  11.065  1.00 21.20 ? 262 LYS A CE  1 
ATOM   1980 N NZ  . LYS A 1 258 ? 54.722  -2.314  10.132  1.00 20.75 ? 262 LYS A NZ  1 
ATOM   1981 N N   . ASN A 1 259 ? 52.826  -1.604  17.454  1.00 17.06 ? 263 ASN A N   1 
ATOM   1982 C CA  . ASN A 1 259 ? 52.808  -2.002  18.852  1.00 16.88 ? 263 ASN A CA  1 
ATOM   1983 C C   . ASN A 1 259 ? 51.458  -1.884  19.527  1.00 16.63 ? 263 ASN A C   1 
ATOM   1984 O O   . ASN A 1 259 ? 51.326  -2.204  20.707  1.00 16.70 ? 263 ASN A O   1 
ATOM   1985 C CB  . ASN A 1 259 ? 53.858  -1.209  19.616  1.00 17.08 ? 263 ASN A CB  1 
ATOM   1986 C CG  . ASN A 1 259 ? 55.238  -1.367  19.016  1.00 18.05 ? 263 ASN A CG  1 
ATOM   1987 O OD1 . ASN A 1 259 ? 55.997  -0.405  18.928  1.00 19.28 ? 263 ASN A OD1 1 
ATOM   1988 N ND2 . ASN A 1 259 ? 55.563  -2.586  18.576  1.00 18.27 ? 263 ASN A ND2 1 
ATOM   1989 N N   . VAL A 1 260 ? 50.460  -1.424  18.780  1.00 16.37 ? 264 VAL A N   1 
ATOM   1990 C CA  . VAL A 1 260 ? 49.100  -1.338  19.296  1.00 16.21 ? 264 VAL A CA  1 
ATOM   1991 C C   . VAL A 1 260 ? 48.233  -2.329  18.533  1.00 16.26 ? 264 VAL A C   1 
ATOM   1992 O O   . VAL A 1 260 ? 47.998  -2.160  17.329  1.00 16.39 ? 264 VAL A O   1 
ATOM   1993 C CB  . VAL A 1 260 ? 48.532  0.095   19.196  1.00 16.12 ? 264 VAL A CB  1 
ATOM   1994 C CG1 . VAL A 1 260 ? 47.129  0.166   19.775  1.00 15.95 ? 264 VAL A CG1 1 
ATOM   1995 C CG2 . VAL A 1 260 ? 49.441  1.078   19.918  1.00 16.33 ? 264 VAL A CG2 1 
ATOM   1996 N N   . ASN A 1 261 ? 47.776  -3.364  19.241  1.00 16.14 ? 265 ASN A N   1 
ATOM   1997 C CA  . ASN A 1 261 ? 47.015  -4.459  18.627  1.00 15.92 ? 265 ASN A CA  1 
ATOM   1998 C C   . ASN A 1 261 ? 45.700  -4.822  19.308  1.00 15.78 ? 265 ASN A C   1 
ATOM   1999 O O   . ASN A 1 261 ? 44.757  -5.261  18.640  1.00 15.75 ? 265 ASN A O   1 
ATOM   2000 C CB  . ASN A 1 261 ? 47.894  -5.699  18.474  1.00 15.84 ? 265 ASN A CB  1 
ATOM   2001 C CG  . ASN A 1 261 ? 48.911  -5.544  17.370  1.00 15.72 ? 265 ASN A CG  1 
ATOM   2002 O OD1 . ASN A 1 261 ? 48.555  -5.404  16.198  1.00 15.95 ? 265 ASN A OD1 1 
ATOM   2003 N ND2 . ASN A 1 261 ? 50.186  -5.555  17.735  1.00 15.44 ? 265 ASN A ND2 1 
ATOM   2004 N N   . SER A 1 262 ? 45.646  -4.656  20.628  1.00 15.48 ? 266 SER A N   1 
ATOM   2005 C CA  . SER A 1 262 ? 44.431  -4.938  21.387  1.00 15.19 ? 266 SER A CA  1 
ATOM   2006 C C   . SER A 1 262 ? 43.852  -3.645  21.961  1.00 15.07 ? 266 SER A C   1 
ATOM   2007 O O   . SER A 1 262 ? 44.555  -2.637  22.074  1.00 15.04 ? 266 SER A O   1 
ATOM   2008 C CB  . SER A 1 262 ? 44.723  -5.949  22.501  1.00 14.99 ? 266 SER A CB  1 
ATOM   2009 O OG  . SER A 1 262 ? 43.525  -6.493  23.021  1.00 14.41 ? 266 SER A OG  1 
ATOM   2010 N N   . ILE A 1 263 ? 42.567  -3.665  22.302  1.00 14.82 ? 267 ILE A N   1 
ATOM   2011 C CA  . ILE A 1 263 ? 42.001  -2.592  23.111  1.00 14.51 ? 267 ILE A CA  1 
ATOM   2012 C C   . ILE A 1 263 ? 42.698  -2.609  24.482  1.00 14.73 ? 267 ILE A C   1 
ATOM   2013 O O   . ILE A 1 263 ? 42.848  -1.566  25.121  1.00 14.45 ? 267 ILE A O   1 
ATOM   2014 C CB  . ILE A 1 263 ? 40.461  -2.738  23.252  1.00 14.50 ? 267 ILE A CB  1 
ATOM   2015 C CG1 . ILE A 1 263 ? 39.781  -2.761  21.878  1.00 13.90 ? 267 ILE A CG1 1 
ATOM   2016 C CG2 . ILE A 1 263 ? 39.892  -1.609  24.113  1.00 14.57 ? 267 ILE A CG2 1 
ATOM   2017 C CD1 . ILE A 1 263 ? 38.276  -2.943  21.928  1.00 13.76 ? 267 ILE A CD1 1 
ATOM   2018 N N   . GLU A 1 264 ? 43.143  -3.801  24.899  1.00 15.12 ? 268 GLU A N   1 
ATOM   2019 C CA  . GLU A 1 264 ? 43.889  -4.012  26.156  1.00 15.65 ? 268 GLU A CA  1 
ATOM   2020 C C   . GLU A 1 264 ? 45.162  -3.180  26.208  1.00 15.76 ? 268 GLU A C   1 
ATOM   2021 O O   . GLU A 1 264 ? 45.624  -2.808  27.291  1.00 16.02 ? 268 GLU A O   1 
ATOM   2022 C CB  . GLU A 1 264 ? 44.267  -5.492  26.346  1.00 15.67 ? 268 GLU A CB  1 
ATOM   2023 C CG  . GLU A 1 264 ? 43.100  -6.467  26.451  1.00 16.59 ? 268 GLU A CG  1 
ATOM   2024 C CD  . GLU A 1 264 ? 42.559  -6.626  27.864  1.00 17.75 ? 268 GLU A CD  1 
ATOM   2025 O OE1 . GLU A 1 264 ? 42.746  -5.713  28.706  1.00 18.03 ? 268 GLU A OE1 1 
ATOM   2026 O OE2 . GLU A 1 264 ? 41.934  -7.677  28.133  1.00 18.41 ? 268 GLU A OE2 1 
ATOM   2027 N N   . ASP A 1 265 ? 45.727  -2.905  25.035  1.00 15.87 ? 269 ASP A N   1 
ATOM   2028 C CA  . ASP A 1 265 ? 46.963  -2.145  24.921  1.00 16.11 ? 269 ASP A CA  1 
ATOM   2029 C C   . ASP A 1 265 ? 46.755  -0.682  25.322  1.00 16.20 ? 269 ASP A C   1 
ATOM   2030 O O   . ASP A 1 265 ? 47.719  0.050   25.576  1.00 16.29 ? 269 ASP A O   1 
ATOM   2031 C CB  . ASP A 1 265 ? 47.532  -2.248  23.496  1.00 16.23 ? 269 ASP A CB  1 
ATOM   2032 C CG  . ASP A 1 265 ? 48.102  -3.635  23.176  1.00 16.76 ? 269 ASP A CG  1 
ATOM   2033 O OD1 . ASP A 1 265 ? 48.531  -3.849  22.022  1.00 17.45 ? 269 ASP A OD1 1 
ATOM   2034 O OD2 . ASP A 1 265 ? 48.171  -4.572  24.000  1.00 17.76 ? 269 ASP A OD2 1 
ATOM   2035 N N   . LEU A 1 266 ? 45.495  -0.266  25.389  1.00 16.29 ? 270 LEU A N   1 
ATOM   2036 C CA  . LEU A 1 266 ? 45.168  1.101   25.784  1.00 16.51 ? 270 LEU A CA  1 
ATOM   2037 C C   . LEU A 1 266 ? 45.262  1.307   27.301  1.00 16.65 ? 270 LEU A C   1 
ATOM   2038 O O   . LEU A 1 266 ? 45.478  2.429   27.762  1.00 16.73 ? 270 LEU A O   1 
ATOM   2039 C CB  . LEU A 1 266 ? 43.785  1.507   25.256  1.00 16.43 ? 270 LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 266 ? 43.429  1.230   23.785  1.00 16.39 ? 270 LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 266 ? 42.156  1.973   23.392  1.00 16.00 ? 270 LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 266 ? 44.566  1.590   22.841  1.00 16.54 ? 270 LEU A CD2 1 
ATOM   2043 N N   . LYS A 1 267 ? 45.114  0.221   28.063  1.00 16.91 ? 271 LYS A N   1 
ATOM   2044 C CA  . LYS A 1 267 ? 45.216  0.260   29.530  1.00 17.23 ? 271 LYS A CA  1 
ATOM   2045 C C   . LYS A 1 267 ? 46.637  0.594   29.995  1.00 17.38 ? 271 LYS A C   1 
ATOM   2046 O O   . LYS A 1 267 ? 46.831  1.118   31.095  1.00 17.42 ? 271 LYS A O   1 
ATOM   2047 C CB  . LYS A 1 267 ? 44.767  -1.070  30.157  1.00 17.22 ? 271 LYS A CB  1 
ATOM   2048 C CG  . LYS A 1 267 ? 43.268  -1.371  30.063  1.00 17.27 ? 271 LYS A CG  1 
ATOM   2049 C CD  . LYS A 1 267 ? 42.889  -2.623  30.872  1.00 17.30 ? 271 LYS A CD  1 
ATOM   2050 C CE  . LYS A 1 267 ? 42.814  -2.328  32.372  1.00 17.68 ? 271 LYS A CE  1 
ATOM   2051 N NZ  . LYS A 1 267 ? 42.913  -3.561  33.208  1.00 17.83 ? 271 LYS A NZ  1 
ATOM   2052 N N   . LYS A 1 268 ? 47.623  0.287   29.153  1.00 17.52 ? 272 LYS A N   1 
ATOM   2053 C CA  . LYS A 1 268 ? 49.033  0.514   29.484  1.00 17.63 ? 272 LYS A CA  1 
ATOM   2054 C C   . LYS A 1 268 ? 49.335  2.004   29.594  1.00 17.66 ? 272 LYS A C   1 
ATOM   2055 O O   . LYS A 1 268 ? 49.658  2.489   30.673  1.00 17.61 ? 272 LYS A O   1 
ATOM   2056 C CB  . LYS A 1 268 ? 49.956  -0.150  28.451  1.00 17.57 ? 272 LYS A CB  1 
ATOM   2057 C CG  . LYS A 1 268 ? 49.705  -1.644  28.258  1.00 17.76 ? 272 LYS A CG  1 
ATOM   2058 C CD  . LYS A 1 268 ? 50.627  -2.248  27.210  1.00 17.81 ? 272 LYS A CD  1 
ATOM   2059 C CE  . LYS A 1 268 ? 50.088  -3.590  26.733  1.00 18.31 ? 272 LYS A CE  1 
ATOM   2060 N NZ  . LYS A 1 268 ? 50.755  -4.031  25.481  1.00 18.33 ? 272 LYS A NZ  1 
ATOM   2061 O OXT . LYS A 1 268 ? 49.252  2.761   28.623  1.00 17.91 ? 272 LYS A OXT 1 
ATOM   2062 N N   . SER B 1 5   ? -9.328  11.795  25.573  1.00 15.09 ? 9   SER B N   1 
ATOM   2063 C CA  . SER B 1 5   ? -8.030  11.052  25.536  1.00 15.41 ? 9   SER B CA  1 
ATOM   2064 C C   . SER B 1 5   ? -7.009  11.628  26.531  1.00 15.80 ? 9   SER B C   1 
ATOM   2065 O O   . SER B 1 5   ? -7.174  12.745  27.029  1.00 15.86 ? 9   SER B O   1 
ATOM   2066 C CB  . SER B 1 5   ? -7.438  11.042  24.120  1.00 15.30 ? 9   SER B CB  1 
ATOM   2067 O OG  . SER B 1 5   ? -6.803  12.274  23.804  1.00 15.03 ? 9   SER B OG  1 
ATOM   2068 N N   . ALA B 1 6   ? -5.954  10.861  26.810  1.00 16.03 ? 10  ALA B N   1 
ATOM   2069 C CA  . ALA B 1 6   ? -4.935  11.271  27.773  1.00 16.12 ? 10  ALA B CA  1 
ATOM   2070 C C   . ALA B 1 6   ? -4.186  12.489  27.282  1.00 16.25 ? 10  ALA B C   1 
ATOM   2071 O O   . ALA B 1 6   ? -3.850  13.374  28.081  1.00 16.72 ? 10  ALA B O   1 
ATOM   2072 C CB  . ALA B 1 6   ? -3.968  10.142  28.054  1.00 16.28 ? 10  ALA B CB  1 
ATOM   2073 N N   . ALA B 1 7   ? -3.917  12.532  25.976  1.00 16.01 ? 11  ALA B N   1 
ATOM   2074 C CA  . ALA B 1 7   ? -3.322  13.714  25.357  1.00 15.84 ? 11  ALA B CA  1 
ATOM   2075 C C   . ALA B 1 7   ? -4.250  14.920  25.548  1.00 15.91 ? 11  ALA B C   1 
ATOM   2076 O O   . ALA B 1 7   ? -3.815  15.955  26.058  1.00 15.77 ? 11  ALA B O   1 
ATOM   2077 C CB  . ALA B 1 7   ? -3.018  13.464  23.884  1.00 15.67 ? 11  ALA B CB  1 
ATOM   2078 N N   . GLU B 1 8   ? -5.525  14.757  25.166  1.00 16.15 ? 12  GLU B N   1 
ATOM   2079 C CA  . GLU B 1 8   ? -6.577  15.760  25.376  1.00 16.21 ? 12  GLU B CA  1 
ATOM   2080 C C   . GLU B 1 8   ? -6.562  16.303  26.800  1.00 16.10 ? 12  GLU B C   1 
ATOM   2081 O O   . GLU B 1 8   ? -6.518  17.511  27.010  1.00 15.93 ? 12  GLU B O   1 
ATOM   2082 C CB  . GLU B 1 8   ? -7.951  15.171  25.051  1.00 16.38 ? 12  GLU B CB  1 
ATOM   2083 C CG  . GLU B 1 8   ? -8.096  14.686  23.618  1.00 17.44 ? 12  GLU B CG  1 
ATOM   2084 C CD  . GLU B 1 8   ? -9.469  14.110  23.333  1.00 20.00 ? 12  GLU B CD  1 
ATOM   2085 O OE1 . GLU B 1 8   ? -10.308 14.090  24.258  1.00 20.00 ? 12  GLU B OE1 1 
ATOM   2086 O OE2 . GLU B 1 8   ? -9.705  13.679  22.185  1.00 20.00 ? 12  GLU B OE2 1 
ATOM   2087 N N   . GLN B 1 9   ? -6.582  15.384  27.764  1.00 16.17 ? 13  GLN B N   1 
ATOM   2088 C CA  . GLN B 1 9   ? -6.750  15.701  29.183  1.00 16.18 ? 13  GLN B CA  1 
ATOM   2089 C C   . GLN B 1 9   ? -5.642  16.529  29.822  1.00 16.12 ? 13  GLN B C   1 
ATOM   2090 O O   . GLN B 1 9   ? -5.943  17.373  30.666  1.00 16.39 ? 13  GLN B O   1 
ATOM   2091 C CB  . GLN B 1 9   ? -6.951  14.425  30.006  1.00 16.28 ? 13  GLN B CB  1 
ATOM   2092 C CG  . GLN B 1 9   ? -8.307  13.755  29.829  1.00 16.25 ? 13  GLN B CG  1 
ATOM   2093 C CD  . GLN B 1 9   ? -8.318  12.348  30.379  1.00 16.51 ? 13  GLN B CD  1 
ATOM   2094 O OE1 . GLN B 1 9   ? -8.036  12.131  31.561  1.00 17.30 ? 13  GLN B OE1 1 
ATOM   2095 N NE2 . GLN B 1 9   ? -8.631  11.385  29.526  1.00 16.33 ? 13  GLN B NE2 1 
ATOM   2096 N N   . VAL B 1 10  ? -4.382  16.296  29.449  1.00 15.87 ? 14  VAL B N   1 
ATOM   2097 C CA  . VAL B 1 10  ? -3.261  17.021  30.084  1.00 15.72 ? 14  VAL B CA  1 
ATOM   2098 C C   . VAL B 1 10  ? -2.535  17.996  29.159  1.00 15.53 ? 14  VAL B C   1 
ATOM   2099 O O   . VAL B 1 10  ? -1.548  18.612  29.573  1.00 15.51 ? 14  VAL B O   1 
ATOM   2100 C CB  . VAL B 1 10  ? -2.211  16.067  30.755  1.00 15.75 ? 14  VAL B CB  1 
ATOM   2101 C CG1 . VAL B 1 10  ? -2.816  15.296  31.933  1.00 15.64 ? 14  VAL B CG1 1 
ATOM   2102 C CG2 . VAL B 1 10  ? -1.595  15.118  29.730  1.00 16.16 ? 14  VAL B CG2 1 
ATOM   2103 N N   . ASN B 1 11  ? -3.023  18.129  27.920  1.00 15.30 ? 15  ASN B N   1 
ATOM   2104 C CA  . ASN B 1 11  ? -2.429  19.018  26.905  1.00 14.93 ? 15  ASN B CA  1 
ATOM   2105 C C   . ASN B 1 11  ? -1.018  18.577  26.477  1.00 14.58 ? 15  ASN B C   1 
ATOM   2106 O O   . ASN B 1 11  ? -0.141  19.411  26.251  1.00 14.42 ? 15  ASN B O   1 
ATOM   2107 C CB  . ASN B 1 11  ? -2.424  20.467  27.418  1.00 15.12 ? 15  ASN B CB  1 
ATOM   2108 C CG  . ASN B 1 11  ? -2.324  21.496  26.307  1.00 15.78 ? 15  ASN B CG  1 
ATOM   2109 O OD1 . ASN B 1 11  ? -2.990  22.532  26.355  1.00 16.64 ? 15  ASN B OD1 1 
ATOM   2110 N ND2 . ASN B 1 11  ? -1.486  21.230  25.312  1.00 16.36 ? 15  ASN B ND2 1 
ATOM   2111 N N   . LYS B 1 12  ? -0.815  17.262  26.368  1.00 14.22 ? 16  LYS B N   1 
ATOM   2112 C CA  . LYS B 1 12  ? 0.486   16.663  26.031  1.00 14.00 ? 16  LYS B CA  1 
ATOM   2113 C C   . LYS B 1 12  ? 1.628   17.093  26.972  1.00 14.03 ? 16  LYS B C   1 
ATOM   2114 O O   . LYS B 1 12  ? 2.730   17.404  26.524  1.00 14.10 ? 16  LYS B O   1 
ATOM   2115 C CB  . LYS B 1 12  ? 0.849   16.940  24.569  1.00 13.93 ? 16  LYS B CB  1 
ATOM   2116 C CG  . LYS B 1 12  ? -0.068  16.269  23.554  1.00 14.06 ? 16  LYS B CG  1 
ATOM   2117 C CD  . LYS B 1 12  ? 0.301   16.670  22.147  1.00 14.12 ? 16  LYS B CD  1 
ATOM   2118 C CE  . LYS B 1 12  ? -0.677  16.097  21.146  1.00 14.80 ? 16  LYS B CE  1 
ATOM   2119 N NZ  . LYS B 1 12  ? -0.433  16.637  19.777  1.00 15.50 ? 16  LYS B NZ  1 
ATOM   2120 N N   . THR B 1 13  ? 1.354   17.076  28.279  1.00 13.93 ? 17  THR B N   1 
ATOM   2121 C CA  . THR B 1 13  ? 2.269   17.606  29.296  1.00 13.45 ? 17  THR B CA  1 
ATOM   2122 C C   . THR B 1 13  ? 2.515   16.612  30.419  1.00 13.21 ? 17  THR B C   1 
ATOM   2123 O O   . THR B 1 13  ? 1.577   16.075  31.011  1.00 13.21 ? 17  THR B O   1 
ATOM   2124 C CB  . THR B 1 13  ? 1.714   18.922  29.889  1.00 13.39 ? 17  THR B CB  1 
ATOM   2125 O OG1 . THR B 1 13  ? 1.358   19.806  28.825  1.00 13.14 ? 17  THR B OG1 1 
ATOM   2126 C CG2 . THR B 1 13  ? 2.797   19.689  30.635  1.00 12.89 ? 17  THR B CG2 1 
ATOM   2127 N N   . ILE B 1 14  ? 3.791   16.376  30.697  1.00 12.79 ? 18  ILE B N   1 
ATOM   2128 C CA  . ILE B 1 14  ? 4.204   15.602  31.858  1.00 12.29 ? 18  ILE B CA  1 
ATOM   2129 C C   . ILE B 1 14  ? 4.885   16.565  32.829  1.00 11.94 ? 18  ILE B C   1 
ATOM   2130 O O   . ILE B 1 14  ? 5.739   17.355  32.430  1.00 11.74 ? 18  ILE B O   1 
ATOM   2131 C CB  . ILE B 1 14  ? 5.152   14.452  31.428  1.00 12.26 ? 18  ILE B CB  1 
ATOM   2132 C CG1 . ILE B 1 14  ? 4.443   13.518  30.446  1.00 11.53 ? 18  ILE B CG1 1 
ATOM   2133 C CG2 . ILE B 1 14  ? 5.672   13.666  32.643  1.00 12.49 ? 18  ILE B CG2 1 
ATOM   2134 C CD1 . ILE B 1 14  ? 5.380   12.683  29.610  1.00 10.84 ? 18  ILE B CD1 1 
ATOM   2135 N N   . ILE B 1 15  ? 4.476   16.520  34.091  1.00 11.78 ? 19  ILE B N   1 
ATOM   2136 C CA  . ILE B 1 15  ? 5.135   17.314  35.133  1.00 11.98 ? 19  ILE B CA  1 
ATOM   2137 C C   . ILE B 1 15  ? 6.230   16.490  35.810  1.00 12.13 ? 19  ILE B C   1 
ATOM   2138 O O   . ILE B 1 15  ? 5.943   15.522  36.511  1.00 12.20 ? 19  ILE B O   1 
ATOM   2139 C CB  . ILE B 1 15  ? 4.107   17.856  36.190  1.00 12.01 ? 19  ILE B CB  1 
ATOM   2140 C CG1 . ILE B 1 15  ? 2.904   18.554  35.521  1.00 10.87 ? 19  ILE B CG1 1 
ATOM   2141 C CG2 . ILE B 1 15  ? 4.804   18.740  37.241  1.00 11.50 ? 19  ILE B CG2 1 
ATOM   2142 C CD1 . ILE B 1 15  ? 3.211   19.867  34.815  1.00 9.68  ? 19  ILE B CD1 1 
ATOM   2143 N N   . GLY B 1 16  ? 7.483   16.870  35.587  1.00 12.38 ? 20  GLY B N   1 
ATOM   2144 C CA  . GLY B 1 16  ? 8.614   16.152  36.174  1.00 12.97 ? 20  GLY B CA  1 
ATOM   2145 C C   . GLY B 1 16  ? 9.287   16.865  37.331  1.00 13.21 ? 20  GLY B C   1 
ATOM   2146 O O   . GLY B 1 16  ? 8.763   17.838  37.861  1.00 13.09 ? 20  GLY B O   1 
ATOM   2147 N N   . ILE B 1 17  ? 10.452  16.362  37.726  1.00 13.87 ? 21  ILE B N   1 
ATOM   2148 C CA  . ILE B 1 17  ? 11.263  16.988  38.781  1.00 14.37 ? 21  ILE B CA  1 
ATOM   2149 C C   . ILE B 1 17  ? 12.521  17.637  38.198  1.00 14.72 ? 21  ILE B C   1 
ATOM   2150 O O   . ILE B 1 17  ? 12.479  18.141  37.076  1.00 15.05 ? 21  ILE B O   1 
ATOM   2151 C CB  . ILE B 1 17  ? 11.586  15.994  39.922  1.00 14.29 ? 21  ILE B CB  1 
ATOM   2152 C CG1 . ILE B 1 17  ? 12.194  14.692  39.388  1.00 14.61 ? 21  ILE B CG1 1 
ATOM   2153 C CG2 . ILE B 1 17  ? 10.338  15.692  40.723  1.00 14.47 ? 21  ILE B CG2 1 
ATOM   2154 C CD1 . ILE B 1 17  ? 13.058  13.955  40.421  1.00 14.72 ? 21  ILE B CD1 1 
ATOM   2155 N N   . ASP B 1 18  ? 13.627  17.637  38.939  1.00 15.18 ? 22  ASP B N   1 
ATOM   2156 C CA  . ASP B 1 18  ? 14.811  18.407  38.520  1.00 15.74 ? 22  ASP B CA  1 
ATOM   2157 C C   . ASP B 1 18  ? 15.563  17.775  37.354  1.00 15.91 ? 22  ASP B C   1 
ATOM   2158 O O   . ASP B 1 18  ? 15.701  16.554  37.303  1.00 16.11 ? 22  ASP B O   1 
ATOM   2159 C CB  . ASP B 1 18  ? 15.752  18.777  39.692  1.00 15.75 ? 22  ASP B CB  1 
ATOM   2160 C CG  . ASP B 1 18  ? 15.615  17.858  40.880  1.00 16.15 ? 22  ASP B CG  1 
ATOM   2161 O OD1 . ASP B 1 18  ? 14.519  17.780  41.476  1.00 15.95 ? 22  ASP B OD1 1 
ATOM   2162 O OD2 . ASP B 1 18  ? 16.572  17.190  41.307  1.00 17.80 ? 22  ASP B OD2 1 
ATOM   2163 N N   . PRO B 1 19  ? 16.024  18.613  36.418  1.00 16.07 ? 23  PRO B N   1 
ATOM   2164 C CA  . PRO B 1 19  ? 16.596  18.139  35.142  1.00 16.27 ? 23  PRO B CA  1 
ATOM   2165 C C   . PRO B 1 19  ? 17.793  17.177  35.228  1.00 16.47 ? 23  PRO B C   1 
ATOM   2166 O O   . PRO B 1 19  ? 17.917  16.300  34.371  1.00 16.69 ? 23  PRO B O   1 
ATOM   2167 C CB  . PRO B 1 19  ? 16.984  19.437  34.412  1.00 16.16 ? 23  PRO B CB  1 
ATOM   2168 C CG  . PRO B 1 19  ? 16.977  20.507  35.456  1.00 16.00 ? 23  PRO B CG  1 
ATOM   2169 C CD  . PRO B 1 19  ? 15.998  20.086  36.493  1.00 15.91 ? 23  PRO B CD  1 
ATOM   2170 N N   . GLY B 1 20  ? 18.650  17.328  36.235  1.00 16.38 ? 24  GLY B N   1 
ATOM   2171 C CA  . GLY B 1 20  ? 19.828  16.478  36.341  1.00 16.63 ? 24  GLY B CA  1 
ATOM   2172 C C   . GLY B 1 20  ? 19.595  15.127  37.006  1.00 16.92 ? 24  GLY B C   1 
ATOM   2173 O O   . GLY B 1 20  ? 20.555  14.448  37.385  1.00 17.14 ? 24  GLY B O   1 
ATOM   2174 N N   . SER B 1 21  ? 18.333  14.723  37.144  1.00 16.82 ? 25  SER B N   1 
ATOM   2175 C CA  . SER B 1 21  ? 17.988  13.526  37.925  1.00 16.66 ? 25  SER B CA  1 
ATOM   2176 C C   . SER B 1 21  ? 17.799  12.267  37.078  1.00 16.47 ? 25  SER B C   1 
ATOM   2177 O O   . SER B 1 21  ? 17.527  12.349  35.877  1.00 16.55 ? 25  SER B O   1 
ATOM   2178 C CB  . SER B 1 21  ? 16.762  13.790  38.809  1.00 16.66 ? 25  SER B CB  1 
ATOM   2179 O OG  . SER B 1 21  ? 15.623  14.125  38.038  1.00 16.87 ? 25  SER B OG  1 
ATOM   2180 N N   . GLY B 1 22  ? 17.943  11.106  37.716  1.00 16.18 ? 26  GLY B N   1 
ATOM   2181 C CA  . GLY B 1 22  ? 17.921  9.820   37.017  1.00 15.98 ? 26  GLY B CA  1 
ATOM   2182 C C   . GLY B 1 22  ? 16.587  9.556   36.355  1.00 15.81 ? 26  GLY B C   1 
ATOM   2183 O O   . GLY B 1 22  ? 16.516  9.125   35.193  1.00 15.73 ? 26  GLY B O   1 
ATOM   2184 N N   . ILE B 1 23  ? 15.524  9.843   37.100  1.00 15.60 ? 27  ILE B N   1 
ATOM   2185 C CA  . ILE B 1 23  ? 14.161  9.662   36.610  1.00 15.38 ? 27  ILE B CA  1 
ATOM   2186 C C   . ILE B 1 23  ? 13.861  10.538  35.390  1.00 15.09 ? 27  ILE B C   1 
ATOM   2187 O O   . ILE B 1 23  ? 13.020  10.189  34.565  1.00 15.14 ? 27  ILE B O   1 
ATOM   2188 C CB  . ILE B 1 23  ? 13.138  9.880   37.750  1.00 15.29 ? 27  ILE B CB  1 
ATOM   2189 C CG1 . ILE B 1 23  ? 11.750  9.381   37.332  1.00 15.27 ? 27  ILE B CG1 1 
ATOM   2190 C CG2 . ILE B 1 23  ? 13.124  11.336  38.193  1.00 15.39 ? 27  ILE B CG2 1 
ATOM   2191 C CD1 . ILE B 1 23  ? 10.857  8.991   38.501  1.00 15.97 ? 27  ILE B CD1 1 
ATOM   2192 N N   . MET B 1 24  ? 14.575  11.652  35.267  1.00 14.84 ? 28  MET B N   1 
ATOM   2193 C CA  . MET B 1 24  ? 14.360  12.566  34.151  1.00 14.65 ? 28  MET B CA  1 
ATOM   2194 C C   . MET B 1 24  ? 15.036  12.101  32.860  1.00 14.62 ? 28  MET B C   1 
ATOM   2195 O O   . MET B 1 24  ? 14.487  12.304  31.778  1.00 14.48 ? 28  MET B O   1 
ATOM   2196 C CB  . MET B 1 24  ? 14.764  13.989  34.534  1.00 14.66 ? 28  MET B CB  1 
ATOM   2197 C CG  . MET B 1 24  ? 13.814  14.631  35.538  1.00 14.08 ? 28  MET B CG  1 
ATOM   2198 S SD  . MET B 1 24  ? 12.156  14.928  34.886  1.00 13.33 ? 28  MET B SD  1 
ATOM   2199 C CE  . MET B 1 24  ? 12.442  16.491  34.050  1.00 13.51 ? 28  MET B CE  1 
ATOM   2200 N N   . SER B 1 25  ? 16.215  11.480  32.984  1.00 14.64 ? 29  SER B N   1 
ATOM   2201 C CA  . SER B 1 25  ? 16.889  10.815  31.857  1.00 14.63 ? 29  SER B CA  1 
ATOM   2202 C C   . SER B 1 25  ? 16.068  9.631   31.383  1.00 14.71 ? 29  SER B C   1 
ATOM   2203 O O   . SER B 1 25  ? 15.812  9.478   30.190  1.00 14.48 ? 29  SER B O   1 
ATOM   2204 C CB  . SER B 1 25  ? 18.263  10.304  32.273  1.00 14.43 ? 29  SER B CB  1 
ATOM   2205 O OG  . SER B 1 25  ? 19.150  11.376  32.479  1.00 15.15 ? 29  SER B OG  1 
ATOM   2206 N N   . LEU B 1 26  ? 15.669  8.801   32.347  1.00 14.89 ? 30  LEU B N   1 
ATOM   2207 C CA  . LEU B 1 26  ? 14.782  7.671   32.114  1.00 14.97 ? 30  LEU B CA  1 
ATOM   2208 C C   . LEU B 1 26  ? 13.475  8.068   31.406  1.00 14.88 ? 30  LEU B C   1 
ATOM   2209 O O   . LEU B 1 26  ? 13.024  7.364   30.511  1.00 14.78 ? 30  LEU B O   1 
ATOM   2210 C CB  . LEU B 1 26  ? 14.497  6.953   33.437  1.00 15.04 ? 30  LEU B CB  1 
ATOM   2211 C CG  . LEU B 1 26  ? 15.618  6.074   34.000  1.00 15.59 ? 30  LEU B CG  1 
ATOM   2212 C CD1 . LEU B 1 26  ? 15.237  5.576   35.386  1.00 16.90 ? 30  LEU B CD1 1 
ATOM   2213 C CD2 . LEU B 1 26  ? 15.945  4.890   33.088  1.00 15.58 ? 30  LEU B CD2 1 
ATOM   2214 N N   . THR B 1 27  ? 12.888  9.196   31.800  1.00 14.96 ? 31  THR B N   1 
ATOM   2215 C CA  . THR B 1 27  ? 11.688  9.722   31.148  1.00 15.29 ? 31  THR B CA  1 
ATOM   2216 C C   . THR B 1 27  ? 11.968  10.166  29.704  1.00 15.63 ? 31  THR B C   1 
ATOM   2217 O O   . THR B 1 27  ? 11.162  9.935   28.797  1.00 15.39 ? 31  THR B O   1 
ATOM   2218 C CB  . THR B 1 27  ? 11.082  10.878  31.977  1.00 15.25 ? 31  THR B CB  1 
ATOM   2219 O OG1 . THR B 1 27  ? 10.687  10.384  33.267  1.00 15.20 ? 31  THR B OG1 1 
ATOM   2220 C CG2 . THR B 1 27  ? 9.763   11.361  31.369  1.00 14.72 ? 31  THR B CG2 1 
ATOM   2221 N N   . ASP B 1 28  ? 13.119  10.797  29.506  1.00 16.07 ? 32  ASP B N   1 
ATOM   2222 C CA  . ASP B 1 28  ? 13.575  11.163  28.180  1.00 16.57 ? 32  ASP B CA  1 
ATOM   2223 C C   . ASP B 1 28  ? 13.586  9.930   27.286  1.00 16.67 ? 32  ASP B C   1 
ATOM   2224 O O   . ASP B 1 28  ? 13.076  9.977   26.165  1.00 16.95 ? 32  ASP B O   1 
ATOM   2225 C CB  . ASP B 1 28  ? 14.980  11.738  28.264  1.00 16.87 ? 32  ASP B CB  1 
ATOM   2226 C CG  . ASP B 1 28  ? 15.135  13.010  27.477  1.00 17.71 ? 32  ASP B CG  1 
ATOM   2227 O OD1 . ASP B 1 28  ? 14.758  13.040  26.285  1.00 18.01 ? 32  ASP B OD1 1 
ATOM   2228 O OD2 . ASP B 1 28  ? 15.639  14.035  27.983  1.00 19.33 ? 32  ASP B OD2 1 
ATOM   2229 N N   . LYS B 1 29  ? 14.158  8.833   27.793  1.00 16.58 ? 33  LYS B N   1 
ATOM   2230 C CA  . LYS B 1 29  ? 14.187  7.566   27.075  1.00 16.48 ? 33  LYS B CA  1 
ATOM   2231 C C   . LYS B 1 29  ? 12.758  7.074   26.816  1.00 16.22 ? 33  LYS B C   1 
ATOM   2232 O O   . LYS B 1 29  ? 12.448  6.612   25.713  1.00 16.20 ? 33  LYS B O   1 
ATOM   2233 C CB  . LYS B 1 29  ? 15.011  6.511   27.827  1.00 16.31 ? 33  LYS B CB  1 
ATOM   2234 C CG  . LYS B 1 29  ? 15.179  5.195   27.032  1.00 17.07 ? 33  LYS B CG  1 
ATOM   2235 C CD  . LYS B 1 29  ? 15.698  4.037   27.873  1.00 17.12 ? 33  LYS B CD  1 
ATOM   2236 C CE  . LYS B 1 29  ? 17.214  3.998   27.847  1.00 19.32 ? 33  LYS B CE  1 
ATOM   2237 N NZ  . LYS B 1 29  ? 17.786  3.518   29.140  1.00 20.71 ? 33  LYS B NZ  1 
ATOM   2238 N N   . ALA B 1 30  ? 11.896  7.205   27.824  1.00 15.91 ? 34  ALA B N   1 
ATOM   2239 C CA  . ALA B 1 30  ? 10.500  6.790   27.718  1.00 15.82 ? 34  ALA B CA  1 
ATOM   2240 C C   . ALA B 1 30  ? 9.786   7.504   26.569  1.00 15.82 ? 34  ALA B C   1 
ATOM   2241 O O   . ALA B 1 30  ? 9.294   6.861   25.644  1.00 15.74 ? 34  ALA B O   1 
ATOM   2242 C CB  . ALA B 1 30  ? 9.765   7.004   29.045  1.00 15.50 ? 34  ALA B CB  1 
ATOM   2243 N N   . MET B 1 31  ? 9.758   8.831   26.626  1.00 15.99 ? 35  MET B N   1 
ATOM   2244 C CA  . MET B 1 31  ? 9.148   9.649   25.588  1.00 16.11 ? 35  MET B CA  1 
ATOM   2245 C C   . MET B 1 31  ? 9.682   9.253   24.212  1.00 16.28 ? 35  MET B C   1 
ATOM   2246 O O   . MET B 1 31  ? 8.935   9.231   23.220  1.00 16.63 ? 35  MET B O   1 
ATOM   2247 C CB  . MET B 1 31  ? 9.414   11.129  25.861  1.00 16.02 ? 35  MET B CB  1 
ATOM   2248 C CG  . MET B 1 31  ? 9.065   11.571  27.290  1.00 16.10 ? 35  MET B CG  1 
ATOM   2249 S SD  . MET B 1 31  ? 8.788   13.349  27.513  1.00 16.55 ? 35  MET B SD  1 
ATOM   2250 C CE  . MET B 1 31  ? 10.353  14.065  27.000  1.00 16.70 ? 35  MET B CE  1 
ATOM   2251 N N   . LYS B 1 32  ? 10.968  8.918   24.159  1.00 16.12 ? 36  LYS B N   1 
ATOM   2252 C CA  . LYS B 1 32  ? 11.592  8.478   22.921  1.00 16.18 ? 36  LYS B CA  1 
ATOM   2253 C C   . LYS B 1 32  ? 11.143  7.072   22.512  1.00 16.01 ? 36  LYS B C   1 
ATOM   2254 O O   . LYS B 1 32  ? 11.027  6.777   21.323  1.00 16.08 ? 36  LYS B O   1 
ATOM   2255 C CB  . LYS B 1 32  ? 13.118  8.519   23.041  1.00 16.27 ? 36  LYS B CB  1 
ATOM   2256 C CG  . LYS B 1 32  ? 13.739  9.901   23.001  1.00 16.93 ? 36  LYS B CG  1 
ATOM   2257 C CD  . LYS B 1 32  ? 15.252  9.798   22.941  1.00 17.72 ? 36  LYS B CD  1 
ATOM   2258 C CE  . LYS B 1 32  ? 15.931  11.114  23.308  1.00 19.03 ? 36  LYS B CE  1 
ATOM   2259 N NZ  . LYS B 1 32  ? 16.094  11.260  24.791  1.00 20.06 ? 36  LYS B NZ  1 
ATOM   2260 N N   . ASP B 1 33  ? 10.902  6.208   23.497  1.00 15.77 ? 37  ASP B N   1 
ATOM   2261 C CA  . ASP B 1 33  ? 10.564  4.801   23.234  1.00 15.49 ? 37  ASP B CA  1 
ATOM   2262 C C   . ASP B 1 33  ? 9.122   4.606   22.762  1.00 15.26 ? 37  ASP B C   1 
ATOM   2263 O O   . ASP B 1 33  ? 8.814   3.643   22.050  1.00 14.96 ? 37  ASP B O   1 
ATOM   2264 C CB  . ASP B 1 33  ? 10.819  3.936   24.483  1.00 15.41 ? 37  ASP B CB  1 
ATOM   2265 C CG  . ASP B 1 33  ? 12.288  3.631   24.703  1.00 15.26 ? 37  ASP B CG  1 
ATOM   2266 O OD1 . ASP B 1 33  ? 13.058  3.612   23.725  1.00 15.42 ? 37  ASP B OD1 1 
ATOM   2267 O OD2 . ASP B 1 33  ? 12.765  3.385   25.825  1.00 15.28 ? 37  ASP B OD2 1 
ATOM   2268 N N   . TYR B 1 34  ? 8.252   5.517   23.183  1.00 15.10 ? 38  TYR B N   1 
ATOM   2269 C CA  . TYR B 1 34  ? 6.828   5.382   22.958  1.00 15.25 ? 38  TYR B CA  1 
ATOM   2270 C C   . TYR B 1 34  ? 6.362   6.360   21.885  1.00 15.62 ? 38  TYR B C   1 
ATOM   2271 O O   . TYR B 1 34  ? 5.161   6.497   21.636  1.00 15.69 ? 38  TYR B O   1 
ATOM   2272 C CB  . TYR B 1 34  ? 6.061   5.567   24.276  1.00 14.92 ? 38  TYR B CB  1 
ATOM   2273 C CG  . TYR B 1 34  ? 6.180   4.394   25.253  1.00 14.97 ? 38  TYR B CG  1 
ATOM   2274 C CD1 . TYR B 1 34  ? 7.231   4.325   26.172  1.00 14.88 ? 38  TYR B CD1 1 
ATOM   2275 C CD2 . TYR B 1 34  ? 5.235   3.359   25.264  1.00 14.68 ? 38  TYR B CD2 1 
ATOM   2276 C CE1 . TYR B 1 34  ? 7.339   3.258   27.067  1.00 14.29 ? 38  TYR B CE1 1 
ATOM   2277 C CE2 . TYR B 1 34  ? 5.334   2.295   26.158  1.00 14.19 ? 38  TYR B CE2 1 
ATOM   2278 C CZ  . TYR B 1 34  ? 6.387   2.255   27.056  1.00 14.32 ? 38  TYR B CZ  1 
ATOM   2279 O OH  . TYR B 1 34  ? 6.504   1.213   27.936  1.00 14.18 ? 38  TYR B OH  1 
ATOM   2280 N N   . ASP B 1 35  ? 7.333   7.010   21.238  1.00 16.05 ? 39  ASP B N   1 
ATOM   2281 C CA  . ASP B 1 35  ? 7.098   8.018   20.197  1.00 16.41 ? 39  ASP B CA  1 
ATOM   2282 C C   . ASP B 1 35  ? 6.218   9.148   20.714  1.00 16.46 ? 39  ASP B C   1 
ATOM   2283 O O   . ASP B 1 35  ? 5.138   9.415   20.171  1.00 16.66 ? 39  ASP B O   1 
ATOM   2284 C CB  . ASP B 1 35  ? 6.499   7.392   18.929  1.00 16.51 ? 39  ASP B CB  1 
ATOM   2285 C CG  . ASP B 1 35  ? 7.486   6.498   18.186  1.00 17.43 ? 39  ASP B CG  1 
ATOM   2286 O OD1 . ASP B 1 35  ? 7.163   6.080   17.052  1.00 19.33 ? 39  ASP B OD1 1 
ATOM   2287 O OD2 . ASP B 1 35  ? 8.600   6.155   18.635  1.00 17.37 ? 39  ASP B OD2 1 
ATOM   2288 N N   . LEU B 1 36  ? 6.687   9.802   21.772  1.00 16.37 ? 40  LEU B N   1 
ATOM   2289 C CA  . LEU B 1 36  ? 5.939   10.888  22.389  1.00 16.40 ? 40  LEU B CA  1 
ATOM   2290 C C   . LEU B 1 36  ? 6.605   12.240  22.154  1.00 16.63 ? 40  LEU B C   1 
ATOM   2291 O O   . LEU B 1 36  ? 6.509   13.137  22.988  1.00 16.59 ? 40  LEU B O   1 
ATOM   2292 C CB  . LEU B 1 36  ? 5.773   10.628  23.883  1.00 16.26 ? 40  LEU B CB  1 
ATOM   2293 C CG  . LEU B 1 36  ? 4.934   9.418   24.301  1.00 15.91 ? 40  LEU B CG  1 
ATOM   2294 C CD1 . LEU B 1 36  ? 5.044   9.204   25.805  1.00 15.28 ? 40  LEU B CD1 1 
ATOM   2295 C CD2 . LEU B 1 36  ? 3.470   9.560   23.877  1.00 15.27 ? 40  LEU B CD2 1 
ATOM   2296 N N   . ASN B 1 37  ? 7.240   12.389  20.991  1.00 16.94 ? 41  ASN B N   1 
ATOM   2297 C CA  . ASN B 1 37  ? 8.104   13.541  20.702  1.00 17.03 ? 41  ASN B CA  1 
ATOM   2298 C C   . ASN B 1 37  ? 7.393   14.860  20.434  1.00 16.77 ? 41  ASN B C   1 
ATOM   2299 O O   . ASN B 1 37  ? 8.041   15.867  20.162  1.00 16.93 ? 41  ASN B O   1 
ATOM   2300 C CB  . ASN B 1 37  ? 9.109   13.203  19.591  1.00 17.26 ? 41  ASN B CB  1 
ATOM   2301 C CG  . ASN B 1 37  ? 10.225  12.269  20.079  1.00 18.19 ? 41  ASN B CG  1 
ATOM   2302 O OD1 . ASN B 1 37  ? 10.439  11.188  19.522  1.00 19.49 ? 41  ASN B OD1 1 
ATOM   2303 N ND2 . ASN B 1 37  ? 10.925  12.680  21.140  1.00 18.46 ? 41  ASN B ND2 1 
ATOM   2304 N N   . ASP B 1 38  ? 6.066   14.846  20.533  1.00 16.48 ? 42  ASP B N   1 
ATOM   2305 C CA  . ASP B 1 38  ? 5.266   16.070  20.532  1.00 16.19 ? 42  ASP B CA  1 
ATOM   2306 C C   . ASP B 1 38  ? 4.759   16.443  21.946  1.00 16.04 ? 42  ASP B C   1 
ATOM   2307 O O   . ASP B 1 38  ? 4.109   17.474  22.139  1.00 16.06 ? 42  ASP B O   1 
ATOM   2308 C CB  . ASP B 1 38  ? 4.115   15.956  19.531  1.00 16.09 ? 42  ASP B CB  1 
ATOM   2309 C CG  . ASP B 1 38  ? 3.174   14.808  19.840  1.00 16.25 ? 42  ASP B CG  1 
ATOM   2310 O OD1 . ASP B 1 38  ? 3.576   13.845  20.526  1.00 16.06 ? 42  ASP B OD1 1 
ATOM   2311 O OD2 . ASP B 1 38  ? 1.996   14.786  19.423  1.00 16.85 ? 42  ASP B OD2 1 
ATOM   2312 N N   . TRP B 1 39  ? 5.077   15.599  22.928  1.00 15.78 ? 43  TRP B N   1 
ATOM   2313 C CA  . TRP B 1 39  ? 4.790   15.877  24.343  1.00 15.35 ? 43  TRP B CA  1 
ATOM   2314 C C   . TRP B 1 39  ? 5.819   16.818  24.957  1.00 14.88 ? 43  TRP B C   1 
ATOM   2315 O O   . TRP B 1 39  ? 6.936   16.938  24.449  1.00 14.72 ? 43  TRP B O   1 
ATOM   2316 C CB  . TRP B 1 39  ? 4.722   14.566  25.146  1.00 15.45 ? 43  TRP B CB  1 
ATOM   2317 C CG  . TRP B 1 39  ? 3.400   13.869  25.005  1.00 15.49 ? 43  TRP B CG  1 
ATOM   2318 C CD1 . TRP B 1 39  ? 2.861   13.356  23.862  1.00 15.08 ? 43  TRP B CD1 1 
ATOM   2319 C CD2 . TRP B 1 39  ? 2.441   13.630  26.040  1.00 15.66 ? 43  TRP B CD2 1 
ATOM   2320 N NE1 . TRP B 1 39  ? 1.626   12.812  24.120  1.00 14.56 ? 43  TRP B NE1 1 
ATOM   2321 C CE2 . TRP B 1 39  ? 1.341   12.964  25.449  1.00 14.98 ? 43  TRP B CE2 1 
ATOM   2322 C CE3 . TRP B 1 39  ? 2.396   13.908  27.417  1.00 15.78 ? 43  TRP B CE3 1 
ATOM   2323 C CZ2 . TRP B 1 39  ? 0.212   12.575  26.179  1.00 15.33 ? 43  TRP B CZ2 1 
ATOM   2324 C CZ3 . TRP B 1 39  ? 1.272   13.523  28.146  1.00 15.44 ? 43  TRP B CZ3 1 
ATOM   2325 C CH2 . TRP B 1 39  ? 0.193   12.864  27.522  1.00 15.78 ? 43  TRP B CH2 1 
ATOM   2326 N N   . THR B 1 40  ? 5.423   17.483  26.042  1.00 14.52 ? 44  THR B N   1 
ATOM   2327 C CA  . THR B 1 40  ? 6.305   18.362  26.813  1.00 14.00 ? 44  THR B CA  1 
ATOM   2328 C C   . THR B 1 40  ? 6.559   17.758  28.179  1.00 14.01 ? 44  THR B C   1 
ATOM   2329 O O   . THR B 1 40  ? 5.613   17.398  28.896  1.00 13.69 ? 44  THR B O   1 
ATOM   2330 C CB  . THR B 1 40  ? 5.678   19.752  26.975  1.00 13.79 ? 44  THR B CB  1 
ATOM   2331 O OG1 . THR B 1 40  ? 5.694   20.418  25.716  1.00 13.23 ? 44  THR B OG1 1 
ATOM   2332 C CG2 . THR B 1 40  ? 6.536   20.646  27.862  1.00 13.45 ? 44  THR B CG2 1 
ATOM   2333 N N   . LEU B 1 41  ? 7.839   17.640  28.528  1.00 14.12 ? 45  LEU B N   1 
ATOM   2334 C CA  . LEU B 1 41  ? 8.225   17.269  29.884  1.00 14.19 ? 45  LEU B CA  1 
ATOM   2335 C C   . LEU B 1 41  ? 8.686   18.515  30.624  1.00 14.27 ? 45  LEU B C   1 
ATOM   2336 O O   . LEU B 1 41  ? 9.732   19.063  30.327  1.00 14.22 ? 45  LEU B O   1 
ATOM   2337 C CB  . LEU B 1 41  ? 9.313   16.194  29.879  1.00 14.01 ? 45  LEU B CB  1 
ATOM   2338 C CG  . LEU B 1 41  ? 10.016  15.807  31.192  1.00 14.25 ? 45  LEU B CG  1 
ATOM   2339 C CD1 . LEU B 1 41  ? 9.077   15.090  32.169  1.00 14.01 ? 45  LEU B CD1 1 
ATOM   2340 C CD2 . LEU B 1 41  ? 11.266  14.952  30.911  1.00 14.06 ? 45  LEU B CD2 1 
ATOM   2341 N N   . ILE B 1 42  ? 7.875   18.972  31.572  1.00 14.67 ? 46  ILE B N   1 
ATOM   2342 C CA  . ILE B 1 42  ? 8.245   20.087  32.440  1.00 14.85 ? 46  ILE B CA  1 
ATOM   2343 C C   . ILE B 1 42  ? 9.242   19.604  33.485  1.00 15.03 ? 46  ILE B C   1 
ATOM   2344 O O   . ILE B 1 42  ? 8.987   18.622  34.179  1.00 15.08 ? 46  ILE B O   1 
ATOM   2345 C CB  . ILE B 1 42  ? 6.984   20.681  33.141  1.00 14.91 ? 46  ILE B CB  1 
ATOM   2346 C CG1 . ILE B 1 42  ? 5.977   21.256  32.117  1.00 14.73 ? 46  ILE B CG1 1 
ATOM   2347 C CG2 . ILE B 1 42  ? 7.375   21.684  34.243  1.00 14.30 ? 46  ILE B CG2 1 
ATOM   2348 C CD1 . ILE B 1 42  ? 6.453   22.465  31.317  1.00 14.13 ? 46  ILE B CD1 1 
ATOM   2349 N N   . SER B 1 43  ? 10.382  20.285  33.567  1.00 15.27 ? 47  SER B N   1 
ATOM   2350 C CA  . SER B 1 43  ? 11.331  20.112  34.659  1.00 15.51 ? 47  SER B CA  1 
ATOM   2351 C C   . SER B 1 43  ? 10.922  21.038  35.780  1.00 15.85 ? 47  SER B C   1 
ATOM   2352 O O   . SER B 1 43  ? 10.447  22.144  35.534  1.00 16.04 ? 47  SER B O   1 
ATOM   2353 C CB  . SER B 1 43  ? 12.735  20.484  34.216  1.00 15.33 ? 47  SER B CB  1 
ATOM   2354 O OG  . SER B 1 43  ? 13.330  19.422  33.514  1.00 15.64 ? 47  SER B OG  1 
ATOM   2355 N N   . ALA B 1 44  ? 11.101  20.591  37.013  1.00 16.18 ? 48  ALA B N   1 
ATOM   2356 C CA  . ALA B 1 44  ? 10.786  21.421  38.166  1.00 16.52 ? 48  ALA B CA  1 
ATOM   2357 C C   . ALA B 1 44  ? 11.696  21.027  39.323  1.00 16.70 ? 48  ALA B C   1 
ATOM   2358 O O   . ALA B 1 44  ? 12.893  21.222  39.230  1.00 16.92 ? 48  ALA B O   1 
ATOM   2359 C CB  . ALA B 1 44  ? 9.298   21.303  38.536  1.00 16.48 ? 48  ALA B CB  1 
ATOM   2360 N N   . SER B 1 45  ? 11.125  20.489  40.399  1.00 16.96 ? 49  SER B N   1 
ATOM   2361 C CA  . SER B 1 45  ? 11.860  19.903  41.530  1.00 17.17 ? 49  SER B CA  1 
ATOM   2362 C C   . SER B 1 45  ? 10.876  19.047  42.326  1.00 17.41 ? 49  SER B C   1 
ATOM   2363 O O   . SER B 1 45  ? 9.681   19.032  42.007  1.00 17.71 ? 49  SER B O   1 
ATOM   2364 C CB  . SER B 1 45  ? 12.486  20.984  42.419  1.00 17.10 ? 49  SER B CB  1 
ATOM   2365 O OG  . SER B 1 45  ? 11.524  21.926  42.857  1.00 17.20 ? 49  SER B OG  1 
ATOM   2366 N N   . SER B 1 46  ? 11.352  18.320  43.337  1.00 17.52 ? 50  SER B N   1 
ATOM   2367 C CA  . SER B 1 46  ? 10.438  17.585  44.228  1.00 17.66 ? 50  SER B CA  1 
ATOM   2368 C C   . SER B 1 46  ? 9.376   18.507  44.840  1.00 17.48 ? 50  SER B C   1 
ATOM   2369 O O   . SER B 1 46  ? 8.184   18.383  44.529  1.00 17.49 ? 50  SER B O   1 
ATOM   2370 C CB  . SER B 1 46  ? 11.197  16.838  45.328  1.00 17.72 ? 50  SER B CB  1 
ATOM   2371 O OG  . SER B 1 46  ? 11.075  15.440  45.150  1.00 18.66 ? 50  SER B OG  1 
ATOM   2372 N N   . ALA B 1 47  ? 9.825   19.444  45.677  1.00 17.17 ? 51  ALA B N   1 
ATOM   2373 C CA  . ALA B 1 47  ? 8.942   20.416  46.315  1.00 16.81 ? 51  ALA B CA  1 
ATOM   2374 C C   . ALA B 1 47  ? 7.916   21.040  45.350  1.00 16.62 ? 51  ALA B C   1 
ATOM   2375 O O   . ALA B 1 47  ? 6.736   21.129  45.688  1.00 16.84 ? 51  ALA B O   1 
ATOM   2376 C CB  . ALA B 1 47  ? 9.760   21.496  47.021  1.00 16.60 ? 51  ALA B CB  1 
ATOM   2377 N N   . ALA B 1 48  ? 8.361   21.442  44.157  1.00 16.36 ? 52  ALA B N   1 
ATOM   2378 C CA  . ALA B 1 48  ? 7.501   22.122  43.168  1.00 16.13 ? 52  ALA B CA  1 
ATOM   2379 C C   . ALA B 1 48  ? 6.460   21.213  42.514  1.00 15.96 ? 52  ALA B C   1 
ATOM   2380 O O   . ALA B 1 48  ? 5.323   21.627  42.271  1.00 15.97 ? 52  ALA B O   1 
ATOM   2381 C CB  . ALA B 1 48  ? 8.351   22.799  42.092  1.00 16.09 ? 52  ALA B CB  1 
ATOM   2382 N N   . MET B 1 49  ? 6.864   19.980  42.224  1.00 15.79 ? 53  MET B N   1 
ATOM   2383 C CA  . MET B 1 49  ? 6.010   19.007  41.550  1.00 15.51 ? 53  MET B CA  1 
ATOM   2384 C C   . MET B 1 49  ? 4.947   18.458  42.509  1.00 15.47 ? 53  MET B C   1 
ATOM   2385 O O   . MET B 1 49  ? 3.793   18.276  42.119  1.00 15.47 ? 53  MET B O   1 
ATOM   2386 C CB  . MET B 1 49  ? 6.880   17.891  40.948  1.00 15.45 ? 53  MET B CB  1 
ATOM   2387 C CG  . MET B 1 49  ? 6.143   16.783  40.231  1.00 14.76 ? 53  MET B CG  1 
ATOM   2388 S SD  . MET B 1 49  ? 5.587   15.495  41.339  1.00 13.06 ? 53  MET B SD  1 
ATOM   2389 C CE  . MET B 1 49  ? 7.069   14.509  41.519  1.00 13.81 ? 53  MET B CE  1 
ATOM   2390 N N   . THR B 1 50  ? 5.337   18.211  43.761  1.00 15.25 ? 54  THR B N   1 
ATOM   2391 C CA  . THR B 1 50  ? 4.398   17.708  44.768  1.00 14.99 ? 54  THR B CA  1 
ATOM   2392 C C   . THR B 1 50  ? 3.347   18.757  45.124  1.00 14.95 ? 54  THR B C   1 
ATOM   2393 O O   . THR B 1 50  ? 2.215   18.413  45.459  1.00 14.95 ? 54  THR B O   1 
ATOM   2394 C CB  . THR B 1 50  ? 5.126   17.175  46.040  1.00 15.07 ? 54  THR B CB  1 
ATOM   2395 O OG1 . THR B 1 50  ? 5.874   18.221  46.679  1.00 14.45 ? 54  THR B OG1 1 
ATOM   2396 C CG2 . THR B 1 50  ? 6.180   16.125  45.666  1.00 15.02 ? 54  THR B CG2 1 
ATOM   2397 N N   . ALA B 1 51  ? 3.738   20.029  45.036  1.00 14.80 ? 55  ALA B N   1 
ATOM   2398 C CA  . ALA B 1 51  ? 2.829   21.159  45.185  1.00 14.78 ? 55  ALA B CA  1 
ATOM   2399 C C   . ALA B 1 51  ? 1.832   21.253  44.012  1.00 15.10 ? 55  ALA B C   1 
ATOM   2400 O O   . ALA B 1 51  ? 0.629   21.453  44.229  1.00 15.13 ? 55  ALA B O   1 
ATOM   2401 C CB  . ALA B 1 51  ? 3.619   22.440  45.318  1.00 14.57 ? 55  ALA B CB  1 
ATOM   2402 N N   . THR B 1 52  ? 2.334   21.105  42.780  1.00 15.20 ? 56  THR B N   1 
ATOM   2403 C CA  . THR B 1 52  ? 1.489   21.086  41.579  1.00 15.16 ? 56  THR B CA  1 
ATOM   2404 C C   . THR B 1 52  ? 0.550   19.886  41.609  1.00 15.26 ? 56  THR B C   1 
ATOM   2405 O O   . THR B 1 52  ? -0.601  19.984  41.171  1.00 15.38 ? 56  THR B O   1 
ATOM   2406 C CB  . THR B 1 52  ? 2.343   21.049  40.287  1.00 15.26 ? 56  THR B CB  1 
ATOM   2407 O OG1 . THR B 1 52  ? 3.152   22.227  40.199  1.00 15.29 ? 56  THR B OG1 1 
ATOM   2408 C CG2 . THR B 1 52  ? 1.452   21.137  39.031  1.00 14.82 ? 56  THR B CG2 1 
ATOM   2409 N N   . LEU B 1 53  ? 1.049   18.756  42.117  1.00 15.23 ? 57  LEU B N   1 
ATOM   2410 C CA  . LEU B 1 53  ? 0.228   17.564  42.290  1.00 15.18 ? 57  LEU B CA  1 
ATOM   2411 C C   . LEU B 1 53  ? -0.926  17.840  43.255  1.00 15.38 ? 57  LEU B C   1 
ATOM   2412 O O   . LEU B 1 53  ? -2.075  17.473  42.981  1.00 15.33 ? 57  LEU B O   1 
ATOM   2413 C CB  . LEU B 1 53  ? 1.071   16.388  42.776  1.00 15.20 ? 57  LEU B CB  1 
ATOM   2414 C CG  . LEU B 1 53  ? 0.359   15.068  43.109  1.00 15.04 ? 57  LEU B CG  1 
ATOM   2415 C CD1 . LEU B 1 53  ? -0.391  14.482  41.908  1.00 14.81 ? 57  LEU B CD1 1 
ATOM   2416 C CD2 . LEU B 1 53  ? 1.350   14.061  43.660  1.00 14.82 ? 57  LEU B CD2 1 
ATOM   2417 N N   . LYS B 1 54  ? -0.617  18.505  44.367  1.00 15.52 ? 58  LYS B N   1 
ATOM   2418 C CA  . LYS B 1 54  ? -1.629  18.844  45.353  1.00 15.68 ? 58  LYS B CA  1 
ATOM   2419 C C   . LYS B 1 54  ? -2.758  19.679  44.739  1.00 16.04 ? 58  LYS B C   1 
ATOM   2420 O O   . LYS B 1 54  ? -3.921  19.299  44.863  1.00 16.23 ? 58  LYS B O   1 
ATOM   2421 C CB  . LYS B 1 54  ? -1.017  19.526  46.580  1.00 15.57 ? 58  LYS B CB  1 
ATOM   2422 C CG  . LYS B 1 54  ? -2.055  19.948  47.614  1.00 15.24 ? 58  LYS B CG  1 
ATOM   2423 C CD  . LYS B 1 54  ? -1.596  19.714  49.035  1.00 14.38 ? 58  LYS B CD  1 
ATOM   2424 C CE  . LYS B 1 54  ? -2.346  20.629  49.977  1.00 14.28 ? 58  LYS B CE  1 
ATOM   2425 N NZ  . LYS B 1 54  ? -3.804  20.640  49.700  1.00 13.06 ? 58  LYS B NZ  1 
ATOM   2426 N N   . LYS B 1 55  ? -2.416  20.781  44.062  1.00 16.15 ? 59  LYS B N   1 
ATOM   2427 C CA  . LYS B 1 55  ? -3.410  21.630  43.391  1.00 16.33 ? 59  LYS B CA  1 
ATOM   2428 C C   . LYS B 1 55  ? -4.358  20.831  42.503  1.00 16.10 ? 59  LYS B C   1 
ATOM   2429 O O   . LYS B 1 55  ? -5.576  20.939  42.643  1.00 16.19 ? 59  LYS B O   1 
ATOM   2430 C CB  . LYS B 1 55  ? -2.738  22.716  42.551  1.00 16.37 ? 59  LYS B CB  1 
ATOM   2431 C CG  . LYS B 1 55  ? -2.576  24.070  43.248  1.00 17.22 ? 59  LYS B CG  1 
ATOM   2432 C CD  . LYS B 1 55  ? -2.102  25.153  42.263  1.00 17.22 ? 59  LYS B CD  1 
ATOM   2433 C CE  . LYS B 1 55  ? -0.605  25.001  41.907  1.00 18.03 ? 59  LYS B CE  1 
ATOM   2434 N NZ  . LYS B 1 55  ? 0.305   25.206  43.087  1.00 17.48 ? 59  LYS B NZ  1 
ATOM   2435 N N   . SER B 1 56  ? -3.788  20.025  41.605  1.00 15.99 ? 60  SER B N   1 
ATOM   2436 C CA  . SER B 1 56  ? -4.558  19.263  40.609  1.00 15.62 ? 60  SER B CA  1 
ATOM   2437 C C   . SER B 1 56  ? -5.398  18.142  41.209  1.00 15.41 ? 60  SER B C   1 
ATOM   2438 O O   . SER B 1 56  ? -6.490  17.849  40.712  1.00 15.10 ? 60  SER B O   1 
ATOM   2439 C CB  . SER B 1 56  ? -3.629  18.699  39.546  1.00 15.53 ? 60  SER B CB  1 
ATOM   2440 O OG  . SER B 1 56  ? -2.976  19.753  38.877  1.00 16.14 ? 60  SER B OG  1 
ATOM   2441 N N   . TYR B 1 57  ? -4.884  17.521  42.271  1.00 15.18 ? 61  TYR B N   1 
ATOM   2442 C CA  . TYR B 1 57  ? -5.612  16.473  42.981  1.00 15.04 ? 61  TYR B CA  1 
ATOM   2443 C C   . TYR B 1 57  ? -6.908  17.028  43.563  1.00 15.21 ? 61  TYR B C   1 
ATOM   2444 O O   . TYR B 1 57  ? -7.999  16.509  43.268  1.00 15.30 ? 61  TYR B O   1 
ATOM   2445 C CB  . TYR B 1 57  ? -4.755  15.873  44.094  1.00 14.74 ? 61  TYR B CB  1 
ATOM   2446 C CG  . TYR B 1 57  ? -5.135  14.459  44.476  1.00 14.53 ? 61  TYR B CG  1 
ATOM   2447 C CD1 . TYR B 1 57  ? -4.601  13.361  43.796  1.00 14.20 ? 61  TYR B CD1 1 
ATOM   2448 C CD2 . TYR B 1 57  ? -6.020  14.215  45.523  1.00 14.55 ? 61  TYR B CD2 1 
ATOM   2449 C CE1 . TYR B 1 57  ? -4.944  12.060  44.146  1.00 13.69 ? 61  TYR B CE1 1 
ATOM   2450 C CE2 . TYR B 1 57  ? -6.368  12.906  45.884  1.00 14.08 ? 61  TYR B CE2 1 
ATOM   2451 C CZ  . TYR B 1 57  ? -5.825  11.842  45.190  1.00 14.13 ? 61  TYR B CZ  1 
ATOM   2452 O OH  . TYR B 1 57  ? -6.162  10.564  45.543  1.00 14.45 ? 61  TYR B OH  1 
ATOM   2453 N N   . ASP B 1 58  ? -6.778  18.094  44.361  1.00 15.18 ? 62  ASP B N   1 
ATOM   2454 C CA  . ASP B 1 58  ? -7.911  18.742  45.032  1.00 15.21 ? 62  ASP B CA  1 
ATOM   2455 C C   . ASP B 1 58  ? -8.998  19.164  44.055  1.00 15.24 ? 62  ASP B C   1 
ATOM   2456 O O   . ASP B 1 58  ? -10.179 19.019  44.342  1.00 15.17 ? 62  ASP B O   1 
ATOM   2457 C CB  . ASP B 1 58  ? -7.440  19.970  45.814  1.00 15.38 ? 62  ASP B CB  1 
ATOM   2458 C CG  . ASP B 1 58  ? -6.420  19.624  46.881  1.00 15.58 ? 62  ASP B CG  1 
ATOM   2459 O OD1 . ASP B 1 58  ? -6.353  18.442  47.279  1.00 20.00 ? 62  ASP B OD1 1 
ATOM   2460 O OD2 . ASP B 1 58  ? -5.688  20.536  47.320  1.00 20.00 ? 62  ASP B OD2 1 
ATOM   2461 N N   . ARG B 1 59  ? -8.575  19.692  42.909  1.00 15.46 ? 63  ARG B N   1 
ATOM   2462 C CA  . ARG B 1 59  ? -9.467  20.197  41.872  1.00 15.60 ? 63  ARG B CA  1 
ATOM   2463 C C   . ARG B 1 59  ? -10.036 19.086  40.986  1.00 15.75 ? 63  ARG B C   1 
ATOM   2464 O O   . ARG B 1 59  ? -10.898 19.347  40.149  1.00 15.73 ? 63  ARG B O   1 
ATOM   2465 C CB  . ARG B 1 59  ? -8.714  21.224  41.008  1.00 15.61 ? 63  ARG B CB  1 
ATOM   2466 C CG  . ARG B 1 59  ? -8.950  22.681  41.401  1.00 15.73 ? 63  ARG B CG  1 
ATOM   2467 C CD  . ARG B 1 59  ? -7.726  23.574  41.266  1.00 16.01 ? 63  ARG B CD  1 
ATOM   2468 N NE  . ARG B 1 59  ? -6.829  23.400  42.410  1.00 17.16 ? 63  ARG B NE  1 
ATOM   2469 C CZ  . ARG B 1 59  ? -6.693  24.263  43.419  1.00 17.22 ? 63  ARG B CZ  1 
ATOM   2470 N NH1 . ARG B 1 59  ? -7.379  25.403  43.441  1.00 17.59 ? 63  ARG B NH1 1 
ATOM   2471 N NH2 . ARG B 1 59  ? -5.855  23.991  44.413  1.00 17.22 ? 63  ARG B NH2 1 
ATOM   2472 N N   . LYS B 1 60  ? -9.557  17.855  41.182  1.00 15.94 ? 64  LYS B N   1 
ATOM   2473 C CA  . LYS B 1 60  ? -9.804  16.730  40.258  1.00 16.13 ? 64  LYS B CA  1 
ATOM   2474 C C   . LYS B 1 60  ? -9.421  17.108  38.826  1.00 16.05 ? 64  LYS B C   1 
ATOM   2475 O O   . LYS B 1 60  ? -10.153 16.832  37.879  1.00 16.17 ? 64  LYS B O   1 
ATOM   2476 C CB  . LYS B 1 60  ? -11.256 16.232  40.314  1.00 16.27 ? 64  LYS B CB  1 
ATOM   2477 C CG  . LYS B 1 60  ? -11.765 15.851  41.703  1.00 17.14 ? 64  LYS B CG  1 
ATOM   2478 C CD  . LYS B 1 60  ? -11.612 14.357  41.998  1.00 17.46 ? 64  LYS B CD  1 
ATOM   2479 C CE  . LYS B 1 60  ? -12.392 13.997  43.256  1.00 17.56 ? 64  LYS B CE  1 
ATOM   2480 N NZ  . LYS B 1 60  ? -12.407 12.540  43.520  1.00 17.47 ? 64  LYS B NZ  1 
ATOM   2481 N N   . LYS B 1 61  ? -8.272  17.761  38.698  1.00 15.94 ? 65  LYS B N   1 
ATOM   2482 C CA  . LYS B 1 61  ? -7.693  18.120  37.416  1.00 15.68 ? 65  LYS B CA  1 
ATOM   2483 C C   . LYS B 1 61  ? -6.777  16.960  37.003  1.00 15.56 ? 65  LYS B C   1 
ATOM   2484 O O   . LYS B 1 61  ? -5.986  16.488  37.819  1.00 15.63 ? 65  LYS B O   1 
ATOM   2485 C CB  . LYS B 1 61  ? -6.910  19.436  37.563  1.00 15.54 ? 65  LYS B CB  1 
ATOM   2486 C CG  . LYS B 1 61  ? -6.499  20.077  36.258  1.00 15.63 ? 65  LYS B CG  1 
ATOM   2487 C CD  . LYS B 1 61  ? -5.971  21.485  36.453  1.00 15.61 ? 65  LYS B CD  1 
ATOM   2488 C CE  . LYS B 1 61  ? -5.544  22.087  35.116  1.00 15.59 ? 65  LYS B CE  1 
ATOM   2489 N NZ  . LYS B 1 61  ? -5.081  23.480  35.288  1.00 16.32 ? 65  LYS B NZ  1 
ATOM   2490 N N   . PRO B 1 62  ? -6.901  16.467  35.768  1.00 15.42 ? 66  PRO B N   1 
ATOM   2491 C CA  . PRO B 1 62  ? -6.026  15.388  35.295  1.00 15.26 ? 66  PRO B CA  1 
ATOM   2492 C C   . PRO B 1 62  ? -4.572  15.852  35.212  1.00 15.07 ? 66  PRO B C   1 
ATOM   2493 O O   . PRO B 1 62  ? -4.323  16.957  34.745  1.00 15.48 ? 66  PRO B O   1 
ATOM   2494 C CB  . PRO B 1 62  ? -6.590  15.038  33.906  1.00 15.33 ? 66  PRO B CB  1 
ATOM   2495 C CG  . PRO B 1 62  ? -7.432  16.200  33.493  1.00 15.43 ? 66  PRO B CG  1 
ATOM   2496 C CD  . PRO B 1 62  ? -7.892  16.877  34.751  1.00 15.51 ? 66  PRO B CD  1 
ATOM   2497 N N   . ILE B 1 63  ? -3.641  15.015  35.688  1.00 14.70 ? 67  ILE B N   1 
ATOM   2498 C CA  . ILE B 1 63  ? -2.192  15.312  35.758  1.00 13.86 ? 67  ILE B CA  1 
ATOM   2499 C C   . ILE B 1 63  ? -1.364  14.029  35.571  1.00 13.70 ? 67  ILE B C   1 
ATOM   2500 O O   . ILE B 1 63  ? -1.769  12.954  36.023  1.00 13.76 ? 67  ILE B O   1 
ATOM   2501 C CB  . ILE B 1 63  ? -1.838  16.012  37.116  1.00 14.02 ? 67  ILE B CB  1 
ATOM   2502 C CG1 . ILE B 1 63  ? -0.333  16.308  37.233  1.00 13.49 ? 67  ILE B CG1 1 
ATOM   2503 C CG2 . ILE B 1 63  ? -2.312  15.182  38.313  1.00 13.60 ? 67  ILE B CG2 1 
ATOM   2504 C CD1 . ILE B 1 63  ? 0.046   17.218  38.389  1.00 13.28 ? 67  ILE B CD1 1 
ATOM   2505 N N   . ILE B 1 64  ? -0.223  14.143  34.892  1.00 13.27 ? 68  ILE B N   1 
ATOM   2506 C CA  . ILE B 1 64  ? 0.736   13.041  34.761  1.00 12.95 ? 68  ILE B CA  1 
ATOM   2507 C C   . ILE B 1 64  ? 2.099   13.475  35.302  1.00 13.20 ? 68  ILE B C   1 
ATOM   2508 O O   . ILE B 1 64  ? 2.800   14.269  34.669  1.00 13.20 ? 68  ILE B O   1 
ATOM   2509 C CB  . ILE B 1 64  ? 0.891   12.591  33.281  1.00 12.92 ? 68  ILE B CB  1 
ATOM   2510 C CG1 . ILE B 1 64  ? -0.468  12.245  32.657  1.00 12.71 ? 68  ILE B CG1 1 
ATOM   2511 C CG2 . ILE B 1 64  ? 1.887   11.434  33.178  1.00 12.27 ? 68  ILE B CG2 1 
ATOM   2512 C CD1 . ILE B 1 64  ? -0.433  11.975  31.173  1.00 12.46 ? 68  ILE B CD1 1 
ATOM   2513 N N   . ILE B 1 65  ? 2.477   12.959  36.466  1.00 13.43 ? 69  ILE B N   1 
ATOM   2514 C CA  . ILE B 1 65  ? 3.790   13.281  37.040  1.00 13.82 ? 69  ILE B CA  1 
ATOM   2515 C C   . ILE B 1 65  ? 4.833   12.214  36.721  1.00 14.08 ? 69  ILE B C   1 
ATOM   2516 O O   . ILE B 1 65  ? 4.509   11.173  36.133  1.00 14.13 ? 69  ILE B O   1 
ATOM   2517 C CB  . ILE B 1 65  ? 3.705   13.499  38.582  1.00 13.75 ? 69  ILE B CB  1 
ATOM   2518 C CG1 . ILE B 1 65  ? 3.202   12.225  39.280  1.00 13.48 ? 69  ILE B CG1 1 
ATOM   2519 C CG2 . ILE B 1 65  ? 2.838   14.719  38.912  1.00 13.42 ? 69  ILE B CG2 1 
ATOM   2520 C CD1 . ILE B 1 65  ? 3.605   12.086  40.736  1.00 13.46 ? 69  ILE B CD1 1 
ATOM   2521 N N   . THR B 1 66  ? 6.082   12.496  37.095  1.00 14.32 ? 70  THR B N   1 
ATOM   2522 C CA  . THR B 1 66  ? 7.103   11.453  37.247  1.00 14.48 ? 70  THR B CA  1 
ATOM   2523 C C   . THR B 1 66  ? 7.170   11.050  38.729  1.00 14.70 ? 70  THR B C   1 
ATOM   2524 O O   . THR B 1 66  ? 7.640   11.823  39.590  1.00 14.52 ? 70  THR B O   1 
ATOM   2525 C CB  . THR B 1 66  ? 8.496   11.922  36.768  1.00 14.39 ? 70  THR B CB  1 
ATOM   2526 O OG1 . THR B 1 66  ? 8.848   13.145  37.427  1.00 14.47 ? 70  THR B OG1 1 
ATOM   2527 C CG2 . THR B 1 66  ? 8.483   12.296  35.308  1.00 14.46 ? 70  THR B CG2 1 
ATOM   2528 N N   . GLY B 1 67  ? 6.688   9.843   39.021  1.00 14.73 ? 71  GLY B N   1 
ATOM   2529 C CA  . GLY B 1 67  ? 6.663   9.340   40.385  1.00 14.62 ? 71  GLY B CA  1 
ATOM   2530 C C   . GLY B 1 67  ? 7.666   8.234   40.609  1.00 14.73 ? 71  GLY B C   1 
ATOM   2531 O O   . GLY B 1 67  ? 8.026   7.508   39.682  1.00 14.43 ? 71  GLY B O   1 
ATOM   2532 N N   . TRP B 1 68  ? 8.132   8.130   41.847  1.00 15.13 ? 72  TRP B N   1 
ATOM   2533 C CA  . TRP B 1 68  ? 8.962   7.015   42.277  1.00 15.66 ? 72  TRP B CA  1 
ATOM   2534 C C   . TRP B 1 68  ? 8.332   6.445   43.531  1.00 16.22 ? 72  TRP B C   1 
ATOM   2535 O O   . TRP B 1 68  ? 7.719   7.184   44.305  1.00 16.13 ? 72  TRP B O   1 
ATOM   2536 C CB  . TRP B 1 68  ? 10.406  7.449   42.517  1.00 15.36 ? 72  TRP B CB  1 
ATOM   2537 C CG  . TRP B 1 68  ? 10.552  8.650   43.374  1.00 15.21 ? 72  TRP B CG  1 
ATOM   2538 C CD1 . TRP B 1 68  ? 10.899  8.672   44.694  1.00 15.51 ? 72  TRP B CD1 1 
ATOM   2539 C CD2 . TRP B 1 68  ? 10.368  10.018  42.986  1.00 15.33 ? 72  TRP B CD2 1 
ATOM   2540 N NE1 . TRP B 1 68  ? 10.937  9.966   45.155  1.00 15.58 ? 72  TRP B NE1 1 
ATOM   2541 C CE2 . TRP B 1 68  ? 10.612  10.815  44.129  1.00 15.39 ? 72  TRP B CE2 1 
ATOM   2542 C CE3 . TRP B 1 68  ? 10.009  10.657  41.789  1.00 15.54 ? 72  TRP B CE3 1 
ATOM   2543 C CZ2 . TRP B 1 68  ? 10.522  12.216  44.108  1.00 15.08 ? 72  TRP B CZ2 1 
ATOM   2544 C CZ3 . TRP B 1 68  ? 9.913   12.052  41.774  1.00 15.35 ? 72  TRP B CZ3 1 
ATOM   2545 C CH2 . TRP B 1 68  ? 10.172  12.812  42.927  1.00 15.01 ? 72  TRP B CH2 1 
ATOM   2546 N N   . THR B 1 69  ? 8.460   5.132   43.718  1.00 17.08 ? 73  THR B N   1 
ATOM   2547 C CA  . THR B 1 69  ? 7.693   4.441   44.753  1.00 17.82 ? 73  THR B CA  1 
ATOM   2548 C C   . THR B 1 69  ? 8.100   4.786   46.178  1.00 18.26 ? 73  THR B C   1 
ATOM   2549 O O   . THR B 1 69  ? 7.245   5.341   46.890  1.00 19.39 ? 73  THR B O   1 
ATOM   2550 C CB  . THR B 1 69  ? 7.626   2.929   44.533  1.00 17.92 ? 73  THR B CB  1 
ATOM   2551 O OG1 . THR B 1 69  ? 7.045   2.675   43.247  1.00 19.18 ? 73  THR B OG1 1 
ATOM   2552 C CG2 . THR B 1 69  ? 6.618   2.302   45.506  1.00 18.09 ? 73  THR B CG2 1 
ATOM   2553 N N   . PRO B 1 70  ? 9.347   4.504   46.613  1.00 17.79 ? 74  PRO B N   1 
ATOM   2554 C CA  . PRO B 1 70  ? 9.781   4.924   47.970  1.00 17.24 ? 74  PRO B CA  1 
ATOM   2555 C C   . PRO B 1 70  ? 9.594   6.439   48.179  1.00 16.75 ? 74  PRO B C   1 
ATOM   2556 O O   . PRO B 1 70  ? 10.548  7.216   48.090  1.00 16.91 ? 74  PRO B O   1 
ATOM   2557 C CB  . PRO B 1 70  ? 11.265  4.514   48.024  1.00 17.09 ? 74  PRO B CB  1 
ATOM   2558 C CG  . PRO B 1 70  ? 11.375  3.430   47.042  1.00 17.46 ? 74  PRO B CG  1 
ATOM   2559 C CD  . PRO B 1 70  ? 10.418  3.780   45.901  1.00 17.38 ? 74  PRO B CD  1 
ATOM   2560 N N   . HIS B 1 71  ? 8.350   6.834   48.437  1.00 16.24 ? 75  HIS B N   1 
ATOM   2561 C CA  . HIS B 1 71  ? 7.969   8.230   48.602  1.00 15.93 ? 75  HIS B CA  1 
ATOM   2562 C C   . HIS B 1 71  ? 6.595   8.343   49.243  1.00 15.81 ? 75  HIS B C   1 
ATOM   2563 O O   . HIS B 1 71  ? 5.705   7.538   48.971  1.00 15.78 ? 75  HIS B O   1 
ATOM   2564 C CB  . HIS B 1 71  ? 7.957   8.956   47.256  1.00 15.95 ? 75  HIS B CB  1 
ATOM   2565 C CG  . HIS B 1 71  ? 8.074   10.442  47.380  1.00 15.16 ? 75  HIS B CG  1 
ATOM   2566 N ND1 . HIS B 1 71  ? 7.021   11.243  47.756  1.00 14.65 ? 75  HIS B ND1 1 
ATOM   2567 C CD2 . HIS B 1 71  ? 9.128   11.270  47.196  1.00 14.86 ? 75  HIS B CD2 1 
ATOM   2568 C CE1 . HIS B 1 71  ? 7.417   12.502  47.792  1.00 14.71 ? 75  HIS B CE1 1 
ATOM   2569 N NE2 . HIS B 1 71  ? 8.692   12.545  47.457  1.00 15.31 ? 75  HIS B NE2 1 
ATOM   2570 N N   . TRP B 1 72  ? 6.426   9.364   50.077  1.00 15.64 ? 76  TRP B N   1 
ATOM   2571 C CA  . TRP B 1 72  ? 5.163   9.594   50.779  1.00 15.53 ? 76  TRP B CA  1 
ATOM   2572 C C   . TRP B 1 72  ? 3.982   9.959   49.872  1.00 15.57 ? 76  TRP B C   1 
ATOM   2573 O O   . TRP B 1 72  ? 2.838   9.964   50.336  1.00 15.71 ? 76  TRP B O   1 
ATOM   2574 C CB  . TRP B 1 72  ? 5.328   10.650  51.891  1.00 15.34 ? 76  TRP B CB  1 
ATOM   2575 C CG  . TRP B 1 72  ? 5.955   11.958  51.455  1.00 15.17 ? 76  TRP B CG  1 
ATOM   2576 C CD1 . TRP B 1 72  ? 7.246   12.349  51.655  1.00 14.78 ? 76  TRP B CD1 1 
ATOM   2577 C CD2 . TRP B 1 72  ? 5.316   13.042  50.755  1.00 15.28 ? 76  TRP B CD2 1 
ATOM   2578 N NE1 . TRP B 1 72  ? 7.456   13.599  51.124  1.00 14.75 ? 76  TRP B NE1 1 
ATOM   2579 C CE2 . TRP B 1 72  ? 6.290   14.053  50.568  1.00 15.10 ? 76  TRP B CE2 1 
ATOM   2580 C CE3 . TRP B 1 72  ? 4.019   13.260  50.254  1.00 14.72 ? 76  TRP B CE3 1 
ATOM   2581 C CZ2 . TRP B 1 72  ? 6.009   15.260  49.904  1.00 14.90 ? 76  TRP B CZ2 1 
ATOM   2582 C CZ3 . TRP B 1 72  ? 3.739   14.464  49.599  1.00 14.59 ? 76  TRP B CZ3 1 
ATOM   2583 C CH2 . TRP B 1 72  ? 4.732   15.447  49.434  1.00 14.71 ? 76  TRP B CH2 1 
ATOM   2584 N N   . MET B 1 73  ? 4.249   10.262  48.596  1.00 15.60 ? 77  MET B N   1 
ATOM   2585 C CA  . MET B 1 73  ? 3.194   10.687  47.653  1.00 15.74 ? 77  MET B CA  1 
ATOM   2586 C C   . MET B 1 73  ? 2.114   9.642   47.432  1.00 15.44 ? 77  MET B C   1 
ATOM   2587 O O   . MET B 1 73  ? 0.950   9.980   47.270  1.00 15.55 ? 77  MET B O   1 
ATOM   2588 C CB  . MET B 1 73  ? 3.761   11.158  46.308  1.00 15.76 ? 77  MET B CB  1 
ATOM   2589 C CG  . MET B 1 73  ? 4.687   10.180  45.592  1.00 16.37 ? 77  MET B CG  1 
ATOM   2590 S SD  . MET B 1 73  ? 5.141   10.774  43.948  1.00 16.51 ? 77  MET B SD  1 
ATOM   2591 C CE  . MET B 1 73  ? 6.934   10.745  44.060  1.00 16.02 ? 77  MET B CE  1 
ATOM   2592 N N   . PHE B 1 74  ? 2.499   8.375   47.446  1.00 15.42 ? 78  PHE B N   1 
ATOM   2593 C CA  . PHE B 1 74  ? 1.530   7.288   47.355  1.00 15.55 ? 78  PHE B CA  1 
ATOM   2594 C C   . PHE B 1 74  ? 0.727   7.071   48.648  1.00 15.69 ? 78  PHE B C   1 
ATOM   2595 O O   . PHE B 1 74  ? -0.274  6.361   48.645  1.00 16.06 ? 78  PHE B O   1 
ATOM   2596 C CB  . PHE B 1 74  ? 2.206   5.997   46.876  1.00 15.34 ? 78  PHE B CB  1 
ATOM   2597 C CG  . PHE B 1 74  ? 2.444   5.953   45.386  1.00 14.90 ? 78  PHE B CG  1 
ATOM   2598 C CD1 . PHE B 1 74  ? 1.539   5.299   44.543  1.00 14.53 ? 78  PHE B CD1 1 
ATOM   2599 C CD2 . PHE B 1 74  ? 3.562   6.568   44.821  1.00 14.41 ? 78  PHE B CD2 1 
ATOM   2600 C CE1 . PHE B 1 74  ? 1.749   5.246   43.163  1.00 14.30 ? 78  PHE B CE1 1 
ATOM   2601 C CE2 . PHE B 1 74  ? 3.782   6.530   43.429  1.00 13.92 ? 78  PHE B CE2 1 
ATOM   2602 C CZ  . PHE B 1 74  ? 2.877   5.865   42.602  1.00 14.49 ? 78  PHE B CZ  1 
ATOM   2603 N N   . SER B 1 75  ? 1.149   7.704   49.740  1.00 15.80 ? 79  SER B N   1 
ATOM   2604 C CA  . SER B 1 75  ? 0.431   7.611   51.015  1.00 15.80 ? 79  SER B CA  1 
ATOM   2605 C C   . SER B 1 75  ? -0.601  8.729   51.157  1.00 15.81 ? 79  SER B C   1 
ATOM   2606 O O   . SER B 1 75  ? -1.761  8.461   51.481  1.00 15.94 ? 79  SER B O   1 
ATOM   2607 C CB  . SER B 1 75  ? 1.399   7.631   52.207  1.00 15.82 ? 79  SER B CB  1 
ATOM   2608 O OG  . SER B 1 75  ? 2.482   6.738   52.013  1.00 15.98 ? 79  SER B OG  1 
ATOM   2609 N N   . ARG B 1 76  ? -0.177  9.974   50.922  1.00 15.66 ? 80  ARG B N   1 
ATOM   2610 C CA  . ARG B 1 76  ? -1.072  11.137  50.975  1.00 15.66 ? 80  ARG B CA  1 
ATOM   2611 C C   . ARG B 1 76  ? -2.099  11.120  49.821  1.00 15.54 ? 80  ARG B C   1 
ATOM   2612 O O   . ARG B 1 76  ? -3.157  11.740  49.922  1.00 15.45 ? 80  ARG B O   1 
ATOM   2613 C CB  . ARG B 1 76  ? -0.253  12.440  50.975  1.00 15.68 ? 80  ARG B CB  1 
ATOM   2614 C CG  . ARG B 1 76  ? -1.073  13.747  50.980  1.00 16.93 ? 80  ARG B CG  1 
ATOM   2615 C CD  . ARG B 1 76  ? -1.116  14.516  52.305  1.00 18.66 ? 80  ARG B CD  1 
ATOM   2616 N NE  . ARG B 1 76  ? 0.175   15.137  52.643  1.00 20.58 ? 80  ARG B NE  1 
ATOM   2617 C CZ  . ARG B 1 76  ? 0.571   16.356  52.252  1.00 21.14 ? 80  ARG B CZ  1 
ATOM   2618 N NH1 . ARG B 1 76  ? -0.224  17.110  51.496  1.00 21.66 ? 80  ARG B NH1 1 
ATOM   2619 N NH2 . ARG B 1 76  ? 1.765   16.825  52.614  1.00 20.29 ? 80  ARG B NH2 1 
ATOM   2620 N N   . TYR B 1 77  ? -1.789  10.400  48.741  1.00 15.36 ? 81  TYR B N   1 
ATOM   2621 C CA  . TYR B 1 77  ? -2.651  10.362  47.556  1.00 15.20 ? 81  TYR B CA  1 
ATOM   2622 C C   . TYR B 1 77  ? -2.919  8.963   47.007  1.00 15.10 ? 81  TYR B C   1 
ATOM   2623 O O   . TYR B 1 77  ? -2.050  8.082   47.057  1.00 14.83 ? 81  TYR B O   1 
ATOM   2624 C CB  . TYR B 1 77  ? -2.065  11.220  46.421  1.00 15.22 ? 81  TYR B CB  1 
ATOM   2625 C CG  . TYR B 1 77  ? -1.731  12.649  46.809  1.00 15.15 ? 81  TYR B CG  1 
ATOM   2626 C CD1 . TYR B 1 77  ? -2.727  13.632  46.865  1.00 14.76 ? 81  TYR B CD1 1 
ATOM   2627 C CD2 . TYR B 1 77  ? -0.416  13.018  47.114  1.00 14.61 ? 81  TYR B CD2 1 
ATOM   2628 C CE1 . TYR B 1 77  ? -2.418  14.944  47.219  1.00 14.75 ? 81  TYR B CE1 1 
ATOM   2629 C CE2 . TYR B 1 77  ? -0.099  14.324  47.468  1.00 14.57 ? 81  TYR B CE2 1 
ATOM   2630 C CZ  . TYR B 1 77  ? -1.100  15.282  47.517  1.00 14.78 ? 81  TYR B CZ  1 
ATOM   2631 O OH  . TYR B 1 77  ? -0.780  16.574  47.869  1.00 15.05 ? 81  TYR B OH  1 
ATOM   2632 N N   . LYS B 1 78  ? -4.128  8.793   46.467  1.00 14.92 ? 82  LYS B N   1 
ATOM   2633 C CA  . LYS B 1 78  ? -4.493  7.630   45.662  1.00 14.98 ? 82  LYS B CA  1 
ATOM   2634 C C   . LYS B 1 78  ? -3.937  7.767   44.235  1.00 15.01 ? 82  LYS B C   1 
ATOM   2635 O O   . LYS B 1 78  ? -4.604  8.311   43.342  1.00 15.13 ? 82  LYS B O   1 
ATOM   2636 C CB  . LYS B 1 78  ? -6.016  7.457   45.609  1.00 14.98 ? 82  LYS B CB  1 
ATOM   2637 C CG  . LYS B 1 78  ? -6.665  7.023   46.911  1.00 15.15 ? 82  LYS B CG  1 
ATOM   2638 C CD  . LYS B 1 78  ? -8.073  6.487   46.682  1.00 15.10 ? 82  LYS B CD  1 
ATOM   2639 C CE  . LYS B 1 78  ? -8.644  5.903   47.974  1.00 15.73 ? 82  LYS B CE  1 
ATOM   2640 N NZ  . LYS B 1 78  ? -9.938  5.181   47.782  1.00 15.62 ? 82  LYS B NZ  1 
ATOM   2641 N N   . LEU B 1 79  ? -2.720  7.262   44.033  1.00 14.97 ? 83  LEU B N   1 
ATOM   2642 C CA  . LEU B 1 79  ? -2.020  7.349   42.744  1.00 14.76 ? 83  LEU B CA  1 
ATOM   2643 C C   . LEU B 1 79  ? -1.803  5.959   42.132  1.00 14.78 ? 83  LEU B C   1 
ATOM   2644 O O   . LEU B 1 79  ? -2.028  4.947   42.799  1.00 14.96 ? 83  LEU B O   1 
ATOM   2645 C CB  . LEU B 1 79  ? -0.664  8.042   42.931  1.00 14.75 ? 83  LEU B CB  1 
ATOM   2646 C CG  . LEU B 1 79  ? -0.609  9.492   43.413  1.00 13.99 ? 83  LEU B CG  1 
ATOM   2647 C CD1 . LEU B 1 79  ? 0.805   9.806   43.868  1.00 12.76 ? 83  LEU B CD1 1 
ATOM   2648 C CD2 . LEU B 1 79  ? -1.067  10.449  42.320  1.00 13.47 ? 83  LEU B CD2 1 
ATOM   2649 N N   . LYS B 1 80  ? -1.365  5.914   40.871  1.00 14.68 ? 84  LYS B N   1 
ATOM   2650 C CA  . LYS B 1 80  ? -1.076  4.650   40.176  1.00 14.61 ? 84  LYS B CA  1 
ATOM   2651 C C   . LYS B 1 80  ? 0.021   4.797   39.111  1.00 14.75 ? 84  LYS B C   1 
ATOM   2652 O O   . LYS B 1 80  ? 0.222   5.884   38.554  1.00 14.80 ? 84  LYS B O   1 
ATOM   2653 C CB  . LYS B 1 80  ? -2.352  4.082   39.530  1.00 14.44 ? 84  LYS B CB  1 
ATOM   2654 C CG  . LYS B 1 80  ? -2.988  4.974   38.480  1.00 14.34 ? 84  LYS B CG  1 
ATOM   2655 C CD  . LYS B 1 80  ? -4.067  4.243   37.700  1.00 14.45 ? 84  LYS B CD  1 
ATOM   2656 C CE  . LYS B 1 80  ? -4.955  5.220   36.955  1.00 14.22 ? 84  LYS B CE  1 
ATOM   2657 N NZ  . LYS B 1 80  ? -5.960  4.537   36.106  1.00 14.08 ? 84  LYS B NZ  1 
ATOM   2658 N N   . TYR B 1 81  ? 0.722   3.701   38.819  1.00 14.61 ? 85  TYR B N   1 
ATOM   2659 C CA  . TYR B 1 81  ? 1.632   3.685   37.672  1.00 14.52 ? 85  TYR B CA  1 
ATOM   2660 C C   . TYR B 1 81  ? 0.916   3.435   36.350  1.00 14.49 ? 85  TYR B C   1 
ATOM   2661 O O   . TYR B 1 81  ? 0.035   2.576   36.257  1.00 14.31 ? 85  TYR B O   1 
ATOM   2662 C CB  . TYR B 1 81  ? 2.746   2.655   37.857  1.00 14.37 ? 85  TYR B CB  1 
ATOM   2663 C CG  . TYR B 1 81  ? 3.784   3.108   38.836  1.00 14.49 ? 85  TYR B CG  1 
ATOM   2664 C CD1 . TYR B 1 81  ? 4.750   4.038   38.469  1.00 14.65 ? 85  TYR B CD1 1 
ATOM   2665 C CD2 . TYR B 1 81  ? 3.789   2.629   40.144  1.00 14.64 ? 85  TYR B CD2 1 
ATOM   2666 C CE1 . TYR B 1 81  ? 5.704   4.471   39.375  1.00 15.06 ? 85  TYR B CE1 1 
ATOM   2667 C CE2 . TYR B 1 81  ? 4.741   3.059   41.066  1.00 15.33 ? 85  TYR B CE2 1 
ATOM   2668 C CZ  . TYR B 1 81  ? 5.698   3.981   40.675  1.00 15.10 ? 85  TYR B CZ  1 
ATOM   2669 O OH  . TYR B 1 81  ? 6.647   4.411   41.580  1.00 14.15 ? 85  TYR B OH  1 
ATOM   2670 N N   . LEU B 1 82  ? 1.298   4.201   35.336  1.00 14.54 ? 86  LEU B N   1 
ATOM   2671 C CA  . LEU B 1 82  ? 1.005   3.826   33.961  1.00 14.79 ? 86  LEU B CA  1 
ATOM   2672 C C   . LEU B 1 82  ? 1.948   2.669   33.616  1.00 14.85 ? 86  LEU B C   1 
ATOM   2673 O O   . LEU B 1 82  ? 3.138   2.704   33.936  1.00 14.93 ? 86  LEU B O   1 
ATOM   2674 C CB  . LEU B 1 82  ? 1.191   5.007   32.994  1.00 14.88 ? 86  LEU B CB  1 
ATOM   2675 C CG  . LEU B 1 82  ? 0.197   6.179   32.975  1.00 14.85 ? 86  LEU B CG  1 
ATOM   2676 C CD1 . LEU B 1 82  ? 0.330   7.045   34.199  1.00 14.77 ? 86  LEU B CD1 1 
ATOM   2677 C CD2 . LEU B 1 82  ? 0.408   7.035   31.742  1.00 14.83 ? 86  LEU B CD2 1 
ATOM   2678 N N   . ASP B 1 83  ? 1.406   1.628   32.998  1.00 15.02 ? 87  ASP B N   1 
ATOM   2679 C CA  . ASP B 1 83  ? 2.188   0.439   32.672  1.00 14.91 ? 87  ASP B CA  1 
ATOM   2680 C C   . ASP B 1 83  ? 3.310   0.759   31.702  1.00 14.74 ? 87  ASP B C   1 
ATOM   2681 O O   . ASP B 1 83  ? 3.135   1.561   30.780  1.00 14.83 ? 87  ASP B O   1 
ATOM   2682 C CB  . ASP B 1 83  ? 1.294   -0.664  32.097  1.00 14.91 ? 87  ASP B CB  1 
ATOM   2683 C CG  . ASP B 1 83  ? 0.491   -1.373  33.163  1.00 15.38 ? 87  ASP B CG  1 
ATOM   2684 O OD1 . ASP B 1 83  ? 0.881   -1.323  34.351  1.00 16.22 ? 87  ASP B OD1 1 
ATOM   2685 O OD2 . ASP B 1 83  ? -0.549  -2.014  32.908  1.00 16.34 ? 87  ASP B OD2 1 
ATOM   2686 N N   . ASP B 1 84  ? 4.458   0.125   31.932  1.00 14.55 ? 88  ASP B N   1 
ATOM   2687 C CA  . ASP B 1 84  ? 5.639   0.282   31.092  1.00 14.24 ? 88  ASP B CA  1 
ATOM   2688 C C   . ASP B 1 84  ? 5.996   -1.053  30.414  1.00 13.92 ? 88  ASP B C   1 
ATOM   2689 O O   . ASP B 1 84  ? 6.925   -1.735  30.852  1.00 13.70 ? 88  ASP B O   1 
ATOM   2690 C CB  . ASP B 1 84  ? 6.798   0.802   31.951  1.00 14.33 ? 88  ASP B CB  1 
ATOM   2691 C CG  . ASP B 1 84  ? 8.002   1.236   31.138  1.00 14.74 ? 88  ASP B CG  1 
ATOM   2692 O OD1 . ASP B 1 84  ? 7.881   1.441   29.914  1.00 15.71 ? 88  ASP B OD1 1 
ATOM   2693 O OD2 . ASP B 1 84  ? 9.127   1.406   31.654  1.00 15.11 ? 88  ASP B OD2 1 
ATOM   2694 N N   . PRO B 1 85  ? 5.260   -1.433  29.354  1.00 13.77 ? 89  PRO B N   1 
ATOM   2695 C CA  . PRO B 1 85  ? 5.550   -2.687  28.643  1.00 13.52 ? 89  PRO B CA  1 
ATOM   2696 C C   . PRO B 1 85  ? 6.930   -2.709  27.963  1.00 13.38 ? 89  PRO B C   1 
ATOM   2697 O O   . PRO B 1 85  ? 7.545   -3.774  27.875  1.00 13.33 ? 89  PRO B O   1 
ATOM   2698 C CB  . PRO B 1 85  ? 4.403   -2.805  27.620  1.00 13.18 ? 89  PRO B CB  1 
ATOM   2699 C CG  . PRO B 1 85  ? 3.861   -1.441  27.469  1.00 13.40 ? 89  PRO B CG  1 
ATOM   2700 C CD  . PRO B 1 85  ? 4.101   -0.729  28.759  1.00 13.63 ? 89  PRO B CD  1 
ATOM   2701 N N   . LYS B 1 86  ? 7.410   -1.548  27.511  1.00 13.21 ? 90  LYS B N   1 
ATOM   2702 C CA  . LYS B 1 86  ? 8.730   -1.432  26.883  1.00 13.32 ? 90  LYS B CA  1 
ATOM   2703 C C   . LYS B 1 86  ? 9.862   -1.327  27.917  1.00 13.68 ? 90  LYS B C   1 
ATOM   2704 O O   . LYS B 1 86  ? 11.053  -1.287  27.567  1.00 13.49 ? 90  LYS B O   1 
ATOM   2705 C CB  . LYS B 1 86  ? 8.767   -0.252  25.919  1.00 13.10 ? 90  LYS B CB  1 
ATOM   2706 C CG  . LYS B 1 86  ? 7.730   -0.354  24.837  1.00 13.24 ? 90  LYS B CG  1 
ATOM   2707 C CD  . LYS B 1 86  ? 8.161   0.349   23.582  1.00 14.03 ? 90  LYS B CD  1 
ATOM   2708 C CE  . LYS B 1 86  ? 7.316   -0.115  22.406  1.00 14.33 ? 90  LYS B CE  1 
ATOM   2709 N NZ  . LYS B 1 86  ? 5.965   0.501   22.407  1.00 15.09 ? 90  LYS B NZ  1 
ATOM   2710 N N   . GLN B 1 87  ? 9.462   -1.292  29.189  1.00 14.05 ? 91  GLN B N   1 
ATOM   2711 C CA  . GLN B 1 87  ? 10.353  -1.201  30.345  1.00 14.09 ? 91  GLN B CA  1 
ATOM   2712 C C   . GLN B 1 87  ? 11.470  -0.179  30.216  1.00 14.31 ? 91  GLN B C   1 
ATOM   2713 O O   . GLN B 1 87  ? 12.622  -0.444  30.587  1.00 14.14 ? 91  GLN B O   1 
ATOM   2714 C CB  . GLN B 1 87  ? 10.865  -2.577  30.731  1.00 13.97 ? 91  GLN B CB  1 
ATOM   2715 C CG  . GLN B 1 87  ? 9.825   -3.331  31.511  1.00 13.91 ? 91  GLN B CG  1 
ATOM   2716 C CD  . GLN B 1 87  ? 10.268  -4.709  31.888  1.00 13.71 ? 91  GLN B CD  1 
ATOM   2717 O OE1 . GLN B 1 87  ? 10.454  -5.566  31.024  1.00 13.35 ? 91  GLN B OE1 1 
ATOM   2718 N NE2 . GLN B 1 87  ? 10.433  -4.938  33.184  1.00 13.44 ? 91  GLN B NE2 1 
ATOM   2719 N N   . SER B 1 88  ? 11.084  1.003   29.720  1.00 14.55 ? 92  SER B N   1 
ATOM   2720 C CA  . SER B 1 88  ? 11.975  2.152   29.514  1.00 14.85 ? 92  SER B CA  1 
ATOM   2721 C C   . SER B 1 88  ? 12.677  2.560   30.799  1.00 15.01 ? 92  SER B C   1 
ATOM   2722 O O   . SER B 1 88  ? 13.809  3.041   30.767  1.00 15.17 ? 92  SER B O   1 
ATOM   2723 C CB  . SER B 1 88  ? 11.194  3.357   28.986  1.00 14.69 ? 92  SER B CB  1 
ATOM   2724 O OG  . SER B 1 88  ? 10.440  3.022   27.839  1.00 15.09 ? 92  SER B OG  1 
ATOM   2725 N N   . TYR B 1 89  ? 11.995  2.361   31.924  1.00 15.16 ? 93  TYR B N   1 
ATOM   2726 C CA  . TYR B 1 89  ? 12.522  2.722   33.234  1.00 15.27 ? 93  TYR B CA  1 
ATOM   2727 C C   . TYR B 1 89  ? 13.357  1.603   33.857  1.00 15.27 ? 93  TYR B C   1 
ATOM   2728 O O   . TYR B 1 89  ? 13.711  1.670   35.033  1.00 15.29 ? 93  TYR B O   1 
ATOM   2729 C CB  . TYR B 1 89  ? 11.373  3.124   34.168  1.00 15.35 ? 93  TYR B CB  1 
ATOM   2730 C CG  . TYR B 1 89  ? 10.684  4.418   33.776  1.00 15.40 ? 93  TYR B CG  1 
ATOM   2731 C CD1 . TYR B 1 89  ? 11.177  5.652   34.204  1.00 15.31 ? 93  TYR B CD1 1 
ATOM   2732 C CD2 . TYR B 1 89  ? 9.539   4.406   32.978  1.00 14.90 ? 93  TYR B CD2 1 
ATOM   2733 C CE1 . TYR B 1 89  ? 10.549  6.835   33.843  1.00 15.48 ? 93  TYR B CE1 1 
ATOM   2734 C CE2 . TYR B 1 89  ? 8.908   5.576   32.607  1.00 13.96 ? 93  TYR B CE2 1 
ATOM   2735 C CZ  . TYR B 1 89  ? 9.414   6.784   33.040  1.00 15.25 ? 93  TYR B CZ  1 
ATOM   2736 O OH  . TYR B 1 89  ? 8.778   7.951   32.682  1.00 15.87 ? 93  TYR B OH  1 
ATOM   2737 N N   . GLY B 1 90  ? 13.675  0.584   33.062  1.00 15.39 ? 94  GLY B N   1 
ATOM   2738 C CA  . GLY B 1 90  ? 14.373  -0.601  33.556  1.00 15.53 ? 94  GLY B CA  1 
ATOM   2739 C C   . GLY B 1 90  ? 13.547  -1.325  34.601  1.00 15.66 ? 94  GLY B C   1 
ATOM   2740 O O   . GLY B 1 90  ? 12.330  -1.128  34.688  1.00 15.81 ? 94  GLY B O   1 
ATOM   2741 N N   . SER B 1 91  ? 14.211  -2.155  35.402  1.00 15.67 ? 95  SER B N   1 
ATOM   2742 C CA  . SER B 1 91  ? 13.549  -2.897  36.476  1.00 15.62 ? 95  SER B CA  1 
ATOM   2743 C C   . SER B 1 91  ? 14.482  -3.233  37.643  1.00 15.58 ? 95  SER B C   1 
ATOM   2744 O O   . SER B 1 91  ? 15.609  -2.731  37.728  1.00 15.46 ? 95  SER B O   1 
ATOM   2745 C CB  . SER B 1 91  ? 12.940  -4.179  35.926  1.00 15.58 ? 95  SER B CB  1 
ATOM   2746 O OG  . SER B 1 91  ? 13.925  -4.931  35.249  1.00 15.97 ? 95  SER B OG  1 
ATOM   2747 N N   . ALA B 1 92  ? 13.983  -4.081  38.544  1.00 15.40 ? 96  ALA B N   1 
ATOM   2748 C CA  . ALA B 1 92  ? 14.716  -4.536  39.726  1.00 15.11 ? 96  ALA B CA  1 
ATOM   2749 C C   . ALA B 1 92  ? 15.568  -3.456  40.395  1.00 14.94 ? 96  ALA B C   1 
ATOM   2750 O O   . ALA B 1 92  ? 16.695  -3.731  40.829  1.00 15.11 ? 96  ALA B O   1 
ATOM   2751 C CB  . ALA B 1 92  ? 15.566  -5.770  39.385  1.00 15.01 ? 96  ALA B CB  1 
ATOM   2752 N N   . GLU B 1 93  ? 15.036  -2.235  40.474  1.00 14.61 ? 97  GLU B N   1 
ATOM   2753 C CA  . GLU B 1 93  ? 15.764  -1.142  41.115  1.00 14.39 ? 97  GLU B CA  1 
ATOM   2754 C C   . GLU B 1 93  ? 15.913  -1.362  42.625  1.00 14.21 ? 97  GLU B C   1 
ATOM   2755 O O   . GLU B 1 93  ? 15.021  -1.903  43.283  1.00 14.26 ? 97  GLU B O   1 
ATOM   2756 C CB  . GLU B 1 93  ? 15.137  0.219   40.807  1.00 14.32 ? 97  GLU B CB  1 
ATOM   2757 C CG  . GLU B 1 93  ? 16.028  1.413   41.159  1.00 14.17 ? 97  GLU B CG  1 
ATOM   2758 C CD  . GLU B 1 93  ? 17.146  1.679   40.159  1.00 14.11 ? 97  GLU B CD  1 
ATOM   2759 O OE1 . GLU B 1 93  ? 17.546  0.763   39.414  1.00 14.68 ? 97  GLU B OE1 1 
ATOM   2760 O OE2 . GLU B 1 93  ? 17.637  2.822   40.117  1.00 13.50 ? 97  GLU B OE2 1 
ATOM   2761 N N   . GLU B 1 94  ? 17.067  -0.964  43.150  1.00 13.79 ? 98  GLU B N   1 
ATOM   2762 C CA  . GLU B 1 94  ? 17.408  -1.198  44.537  1.00 13.46 ? 98  GLU B CA  1 
ATOM   2763 C C   . GLU B 1 94  ? 18.125  0.007   45.115  1.00 13.09 ? 98  GLU B C   1 
ATOM   2764 O O   . GLU B 1 94  ? 18.798  0.743   44.387  1.00 12.96 ? 98  GLU B O   1 
ATOM   2765 C CB  . GLU B 1 94  ? 18.325  -2.409  44.644  1.00 13.49 ? 98  GLU B CB  1 
ATOM   2766 C CG  . GLU B 1 94  ? 17.646  -3.752  44.455  1.00 13.82 ? 98  GLU B CG  1 
ATOM   2767 C CD  . GLU B 1 94  ? 18.625  -4.916  44.453  1.00 13.82 ? 98  GLU B CD  1 
ATOM   2768 O OE1 . GLU B 1 94  ? 18.169  -6.069  44.385  1.00 13.87 ? 98  GLU B OE1 1 
ATOM   2769 O OE2 . GLU B 1 94  ? 19.849  -4.692  44.515  1.00 15.06 ? 98  GLU B OE2 1 
ATOM   2770 N N   . ILE B 1 95  ? 17.972  0.203   46.424  1.00 12.80 ? 99  ILE B N   1 
ATOM   2771 C CA  . ILE B 1 95  ? 18.795  1.166   47.167  1.00 12.72 ? 99  ILE B CA  1 
ATOM   2772 C C   . ILE B 1 95  ? 20.007  0.462   47.793  1.00 12.76 ? 99  ILE B C   1 
ATOM   2773 O O   . ILE B 1 95  ? 19.860  -0.537  48.498  1.00 12.75 ? 99  ILE B O   1 
ATOM   2774 C CB  . ILE B 1 95  ? 17.972  1.923   48.232  1.00 12.66 ? 99  ILE B CB  1 
ATOM   2775 C CG1 . ILE B 1 95  ? 16.713  2.534   47.601  1.00 12.49 ? 99  ILE B CG1 1 
ATOM   2776 C CG2 . ILE B 1 95  ? 18.835  3.007   48.904  1.00 12.51 ? 99  ILE B CG2 1 
ATOM   2777 C CD1 . ILE B 1 95  ? 15.784  3.223   48.575  1.00 12.40 ? 99  ILE B CD1 1 
ATOM   2778 N N   . HIS B 1 96  ? 21.197  0.981   47.515  1.00 12.75 ? 100 HIS B N   1 
ATOM   2779 C CA  . HIS B 1 96  ? 22.436  0.330   47.910  1.00 13.19 ? 100 HIS B CA  1 
ATOM   2780 C C   . HIS B 1 96  ? 23.217  1.140   48.938  1.00 13.28 ? 100 HIS B C   1 
ATOM   2781 O O   . HIS B 1 96  ? 23.079  2.366   49.013  1.00 13.59 ? 100 HIS B O   1 
ATOM   2782 C CB  . HIS B 1 96  ? 23.308  0.072   46.682  1.00 13.34 ? 100 HIS B CB  1 
ATOM   2783 C CG  . HIS B 1 96  ? 22.880  -1.109  45.867  1.00 13.95 ? 100 HIS B CG  1 
ATOM   2784 N ND1 . HIS B 1 96  ? 23.771  -1.865  45.136  1.00 14.29 ? 100 HIS B ND1 1 
ATOM   2785 C CD2 . HIS B 1 96  ? 21.662  -1.669  45.673  1.00 14.31 ? 100 HIS B CD2 1 
ATOM   2786 C CE1 . HIS B 1 96  ? 23.119  -2.836  44.521  1.00 14.51 ? 100 HIS B CE1 1 
ATOM   2787 N NE2 . HIS B 1 96  ? 21.839  -2.739  44.830  1.00 14.51 ? 100 HIS B NE2 1 
ATOM   2788 N N   . THR B 1 97  ? 24.028  0.438   49.727  1.00 13.06 ? 101 THR B N   1 
ATOM   2789 C CA  . THR B 1 97  ? 24.903  1.051   50.710  1.00 13.09 ? 101 THR B CA  1 
ATOM   2790 C C   . THR B 1 97  ? 26.313  1.024   50.143  1.00 13.00 ? 101 THR B C   1 
ATOM   2791 O O   . THR B 1 97  ? 26.888  -0.047  49.986  1.00 13.16 ? 101 THR B O   1 
ATOM   2792 C CB  . THR B 1 97  ? 24.858  0.246   52.028  1.00 13.36 ? 101 THR B CB  1 
ATOM   2793 O OG1 . THR B 1 97  ? 23.533  0.277   52.582  1.00 13.46 ? 101 THR B OG1 1 
ATOM   2794 C CG2 . THR B 1 97  ? 25.758  0.885   53.113  1.00 13.33 ? 101 THR B CG2 1 
ATOM   2795 N N   . ILE B 1 98  ? 26.869  2.193   49.830  1.00 12.94 ? 102 ILE B N   1 
ATOM   2796 C CA  . ILE B 1 98  ? 28.235  2.280   49.289  1.00 12.66 ? 102 ILE B CA  1 
ATOM   2797 C C   . ILE B 1 98  ? 29.226  3.009   50.207  1.00 12.85 ? 102 ILE B C   1 
ATOM   2798 O O   . ILE B 1 98  ? 28.857  3.926   50.943  1.00 12.66 ? 102 ILE B O   1 
ATOM   2799 C CB  . ILE B 1 98  ? 28.250  2.872   47.838  1.00 12.52 ? 102 ILE B CB  1 
ATOM   2800 C CG1 . ILE B 1 98  ? 27.787  4.331   47.805  1.00 12.29 ? 102 ILE B CG1 1 
ATOM   2801 C CG2 . ILE B 1 98  ? 27.404  2.027   46.898  1.00 12.23 ? 102 ILE B CG2 1 
ATOM   2802 C CD1 . ILE B 1 98  ? 28.311  5.101   46.613  1.00 12.07 ? 102 ILE B CD1 1 
ATOM   2803 N N   . THR B 1 99  ? 30.481  2.572   50.175  1.00 13.37 ? 103 THR B N   1 
ATOM   2804 C CA  . THR B 1 99  ? 31.561  3.245   50.917  1.00 14.07 ? 103 THR B CA  1 
ATOM   2805 C C   . THR B 1 99  ? 32.718  3.620   49.996  1.00 14.48 ? 103 THR B C   1 
ATOM   2806 O O   . THR B 1 99  ? 32.736  3.256   48.812  1.00 14.56 ? 103 THR B O   1 
ATOM   2807 C CB  . THR B 1 99  ? 32.106  2.396   52.114  1.00 13.82 ? 103 THR B CB  1 
ATOM   2808 O OG1 . THR B 1 99  ? 32.543  1.116   51.648  1.00 13.87 ? 103 THR B OG1 1 
ATOM   2809 C CG2 . THR B 1 99  ? 31.017  2.066   53.104  1.00 13.95 ? 103 THR B CG2 1 
ATOM   2810 N N   . ARG B 1 100 ? 33.674  4.358   50.554  1.00 14.92 ? 104 ARG B N   1 
ATOM   2811 C CA  . ARG B 1 100 ? 34.919  4.663   49.865  1.00 15.40 ? 104 ARG B CA  1 
ATOM   2812 C C   . ARG B 1 100 ? 35.802  3.423   49.843  1.00 15.59 ? 104 ARG B C   1 
ATOM   2813 O O   . ARG B 1 100 ? 35.783  2.625   50.785  1.00 15.76 ? 104 ARG B O   1 
ATOM   2814 C CB  . ARG B 1 100 ? 35.642  5.840   50.531  1.00 15.41 ? 104 ARG B CB  1 
ATOM   2815 C CG  . ARG B 1 100 ? 35.948  5.671   52.013  1.00 15.45 ? 104 ARG B CG  1 
ATOM   2816 C CD  . ARG B 1 100 ? 36.757  6.823   52.601  1.00 15.60 ? 104 ARG B CD  1 
ATOM   2817 N NE  . ARG B 1 100 ? 37.181  6.570   53.980  1.00 15.54 ? 104 ARG B NE  1 
ATOM   2818 C CZ  . ARG B 1 100 ? 38.280  5.910   54.323  1.00 14.44 ? 104 ARG B CZ  1 
ATOM   2819 N NH1 . ARG B 1 100 ? 39.084  5.419   53.393  1.00 14.22 ? 104 ARG B NH1 1 
ATOM   2820 N NH2 . ARG B 1 100 ? 38.570  5.736   55.602  1.00 14.73 ? 104 ARG B NH2 1 
ATOM   2821 N N   . LYS B 1 101 ? 36.558  3.263   48.759  1.00 15.83 ? 105 LYS B N   1 
ATOM   2822 C CA  . LYS B 1 101 ? 37.514  2.164   48.626  1.00 16.07 ? 105 LYS B CA  1 
ATOM   2823 C C   . LYS B 1 101 ? 38.370  2.011   49.889  1.00 16.14 ? 105 LYS B C   1 
ATOM   2824 O O   . LYS B 1 101 ? 39.057  2.949   50.309  1.00 15.94 ? 105 LYS B O   1 
ATOM   2825 C CB  . LYS B 1 101 ? 38.405  2.382   47.392  1.00 16.08 ? 105 LYS B CB  1 
ATOM   2826 C CG  . LYS B 1 101 ? 39.093  1.125   46.848  1.00 15.90 ? 105 LYS B CG  1 
ATOM   2827 C CD  . LYS B 1 101 ? 38.079  0.111   46.338  1.00 15.90 ? 105 LYS B CD  1 
ATOM   2828 C CE  . LYS B 1 101 ? 38.537  -0.550  45.052  1.00 16.31 ? 105 LYS B CE  1 
ATOM   2829 N NZ  . LYS B 1 101 ? 39.587  -1.578  45.255  1.00 16.49 ? 105 LYS B NZ  1 
ATOM   2830 N N   . GLY B 1 102 ? 38.283  0.835   50.504  1.00 16.30 ? 106 GLY B N   1 
ATOM   2831 C CA  . GLY B 1 102 ? 39.097  0.506   51.671  1.00 16.66 ? 106 GLY B CA  1 
ATOM   2832 C C   . GLY B 1 102 ? 38.547  0.942   53.020  1.00 16.82 ? 106 GLY B C   1 
ATOM   2833 O O   . GLY B 1 102 ? 39.292  0.990   54.009  1.00 16.80 ? 106 GLY B O   1 
ATOM   2834 N N   . PHE B 1 103 ? 37.249  1.250   53.071  1.00 16.93 ? 107 PHE B N   1 
ATOM   2835 C CA  . PHE B 1 103 ? 36.601  1.633   54.331  1.00 17.00 ? 107 PHE B CA  1 
ATOM   2836 C C   . PHE B 1 103 ? 36.390  0.435   55.261  1.00 17.02 ? 107 PHE B C   1 
ATOM   2837 O O   . PHE B 1 103 ? 36.535  0.559   56.486  1.00 16.99 ? 107 PHE B O   1 
ATOM   2838 C CB  . PHE B 1 103 ? 35.269  2.340   54.079  1.00 16.99 ? 107 PHE B CB  1 
ATOM   2839 C CG  . PHE B 1 103 ? 34.567  2.780   55.339  1.00 17.06 ? 107 PHE B CG  1 
ATOM   2840 C CD1 . PHE B 1 103 ? 34.965  3.937   56.010  1.00 16.99 ? 107 PHE B CD1 1 
ATOM   2841 C CD2 . PHE B 1 103 ? 33.507  2.034   55.854  1.00 16.89 ? 107 PHE B CD2 1 
ATOM   2842 C CE1 . PHE B 1 103 ? 34.314  4.345   57.177  1.00 16.97 ? 107 PHE B CE1 1 
ATOM   2843 C CE2 . PHE B 1 103 ? 32.849  2.431   57.016  1.00 16.60 ? 107 PHE B CE2 1 
ATOM   2844 C CZ  . PHE B 1 103 ? 33.254  3.590   57.680  1.00 16.96 ? 107 PHE B CZ  1 
ATOM   2845 N N   . SER B 1 104 ? 36.050  -0.712  54.664  1.00 16.88 ? 108 SER B N   1 
ATOM   2846 C CA  . SER B 1 104 ? 35.792  -1.956  55.392  1.00 16.68 ? 108 SER B CA  1 
ATOM   2847 C C   . SER B 1 104 ? 36.947  -2.410  56.278  1.00 16.84 ? 108 SER B C   1 
ATOM   2848 O O   . SER B 1 104 ? 36.729  -3.029  57.322  1.00 17.01 ? 108 SER B O   1 
ATOM   2849 C CB  . SER B 1 104 ? 35.432  -3.076  54.419  1.00 16.45 ? 108 SER B CB  1 
ATOM   2850 O OG  . SER B 1 104 ? 34.129  -2.881  53.897  1.00 16.55 ? 108 SER B OG  1 
ATOM   2851 N N   . LYS B 1 105 ? 38.171  -2.107  55.862  1.00 16.82 ? 109 LYS B N   1 
ATOM   2852 C CA  . LYS B 1 105 ? 39.347  -2.551  56.604  1.00 16.91 ? 109 LYS B CA  1 
ATOM   2853 C C   . LYS B 1 105 ? 39.922  -1.445  57.476  1.00 16.79 ? 109 LYS B C   1 
ATOM   2854 O O   . LYS B 1 105 ? 40.555  -1.721  58.492  1.00 16.85 ? 109 LYS B O   1 
ATOM   2855 C CB  . LYS B 1 105 ? 40.389  -3.149  55.657  1.00 16.93 ? 109 LYS B CB  1 
ATOM   2856 C CG  . LYS B 1 105 ? 40.279  -2.671  54.206  1.00 17.49 ? 109 LYS B CG  1 
ATOM   2857 C CD  . LYS B 1 105 ? 40.270  -3.855  53.233  1.00 17.55 ? 109 LYS B CD  1 
ATOM   2858 C CE  . LYS B 1 105 ? 39.735  -3.456  51.860  1.00 17.40 ? 109 LYS B CE  1 
ATOM   2859 N NZ  . LYS B 1 105 ? 38.338  -2.911  51.924  1.00 16.90 ? 109 LYS B NZ  1 
ATOM   2860 N N   . GLU B 1 106 ? 39.677  -0.200  57.067  1.00 16.67 ? 110 GLU B N   1 
ATOM   2861 C CA  . GLU B 1 106 ? 39.983  0.987   57.861  1.00 16.43 ? 110 GLU B CA  1 
ATOM   2862 C C   . GLU B 1 106 ? 39.093  0.975   59.112  1.00 16.27 ? 110 GLU B C   1 
ATOM   2863 O O   . GLU B 1 106 ? 39.546  1.262   60.223  1.00 16.11 ? 110 GLU B O   1 
ATOM   2864 C CB  . GLU B 1 106 ? 39.830  2.252   57.014  1.00 16.55 ? 110 GLU B CB  1 
ATOM   2865 C CG  . GLU B 1 106 ? 40.740  2.299   55.798  1.00 16.78 ? 110 GLU B CG  1 
ATOM   2866 C CD  . GLU B 1 106 ? 40.561  3.565   54.984  1.00 20.00 ? 110 GLU B CD  1 
ATOM   2867 O OE1 . GLU B 1 106 ? 39.724  4.407   55.372  1.00 20.00 ? 110 GLU B OE1 1 
ATOM   2868 O OE2 . GLU B 1 106 ? 41.258  3.716   53.959  1.00 20.00 ? 110 GLU B OE2 1 
ATOM   2869 N N   . GLN B 1 107 ? 37.821  0.632   58.913  1.00 16.14 ? 111 GLN B N   1 
ATOM   2870 C CA  . GLN B 1 107 ? 36.840  0.563   59.995  1.00 16.04 ? 111 GLN B CA  1 
ATOM   2871 C C   . GLN B 1 107 ? 35.907  -0.641  59.834  1.00 15.79 ? 111 GLN B C   1 
ATOM   2872 O O   . GLN B 1 107 ? 34.815  -0.504  59.281  1.00 15.71 ? 111 GLN B O   1 
ATOM   2873 C CB  . GLN B 1 107 ? 36.016  1.846   60.052  1.00 15.98 ? 111 GLN B CB  1 
ATOM   2874 C CG  . GLN B 1 107 ? 36.798  3.064   60.487  1.00 16.70 ? 111 GLN B CG  1 
ATOM   2875 C CD  . GLN B 1 107 ? 35.916  4.268   60.665  1.00 17.39 ? 111 GLN B CD  1 
ATOM   2876 O OE1 . GLN B 1 107 ? 36.132  5.302   60.030  1.00 17.47 ? 111 GLN B OE1 1 
ATOM   2877 N NE2 . GLN B 1 107 ? 34.906  4.141   61.520  1.00 17.89 ? 111 GLN B NE2 1 
ATOM   2878 N N   . PRO B 1 108 ? 36.321  -1.812  60.329  1.00 15.67 ? 112 PRO B N   1 
ATOM   2879 C CA  . PRO B 1 108 ? 35.547  -3.050  60.144  1.00 15.38 ? 112 PRO B CA  1 
ATOM   2880 C C   . PRO B 1 108 ? 34.198  -3.006  60.872  1.00 15.13 ? 112 PRO B C   1 
ATOM   2881 O O   . PRO B 1 108 ? 33.183  -3.466  60.336  1.00 14.93 ? 112 PRO B O   1 
ATOM   2882 C CB  . PRO B 1 108 ? 36.457  -4.131  60.749  1.00 15.35 ? 112 PRO B CB  1 
ATOM   2883 C CG  . PRO B 1 108 ? 37.797  -3.490  60.856  1.00 15.41 ? 112 PRO B CG  1 
ATOM   2884 C CD  . PRO B 1 108 ? 37.543  -2.042  61.124  1.00 15.51 ? 112 PRO B CD  1 
ATOM   2885 N N   . ASN B 1 109 ? 34.212  -2.440  62.079  1.00 14.79 ? 113 ASN B N   1 
ATOM   2886 C CA  . ASN B 1 109 ? 33.028  -2.298  62.922  1.00 14.27 ? 113 ASN B CA  1 
ATOM   2887 C C   . ASN B 1 109 ? 31.875  -1.493  62.282  1.00 14.08 ? 113 ASN B C   1 
ATOM   2888 O O   . ASN B 1 109 ? 30.718  -1.911  62.319  1.00 13.75 ? 113 ASN B O   1 
ATOM   2889 C CB  . ASN B 1 109 ? 33.438  -1.674  64.258  1.00 13.96 ? 113 ASN B CB  1 
ATOM   2890 C CG  . ASN B 1 109 ? 32.314  -1.670  65.269  1.00 13.48 ? 113 ASN B CG  1 
ATOM   2891 O OD1 . ASN B 1 109 ? 31.744  -0.624  65.567  1.00 13.13 ? 113 ASN B OD1 1 
ATOM   2892 N ND2 . ASN B 1 109 ? 31.982  -2.842  65.795  1.00 12.53 ? 113 ASN B ND2 1 
ATOM   2893 N N   . ALA B 1 110 ? 32.206  -0.339  61.710  1.00 13.99 ? 114 ALA B N   1 
ATOM   2894 C CA  . ALA B 1 110 ? 31.220  0.556   61.121  1.00 13.97 ? 114 ALA B CA  1 
ATOM   2895 C C   . ALA B 1 110 ? 30.643  -0.038  59.837  1.00 14.20 ? 114 ALA B C   1 
ATOM   2896 O O   . ALA B 1 110 ? 29.444  0.088   59.563  1.00 14.11 ? 114 ALA B O   1 
ATOM   2897 C CB  . ALA B 1 110 ? 31.848  1.914   60.853  1.00 13.78 ? 114 ALA B CB  1 
ATOM   2898 N N   . ALA B 1 111 ? 31.508  -0.695  59.068  1.00 14.30 ? 115 ALA B N   1 
ATOM   2899 C CA  . ALA B 1 111 ? 31.123  -1.369  57.835  1.00 14.25 ? 115 ALA B CA  1 
ATOM   2900 C C   . ALA B 1 111 ? 30.187  -2.542  58.109  1.00 14.25 ? 115 ALA B C   1 
ATOM   2901 O O   . ALA B 1 111 ? 29.253  -2.789  57.336  1.00 14.52 ? 115 ALA B O   1 
ATOM   2902 C CB  . ALA B 1 111 ? 32.357  -1.835  57.085  1.00 14.26 ? 115 ALA B CB  1 
ATOM   2903 N N   . LYS B 1 112 ? 30.444  -3.254  59.206  1.00 14.03 ? 116 LYS B N   1 
ATOM   2904 C CA  . LYS B 1 112 ? 29.592  -4.353  59.658  1.00 13.89 ? 116 LYS B CA  1 
ATOM   2905 C C   . LYS B 1 112 ? 28.149  -3.880  59.784  1.00 13.83 ? 116 LYS B C   1 
ATOM   2906 O O   . LYS B 1 112 ? 27.237  -4.507  59.238  1.00 13.73 ? 116 LYS B O   1 
ATOM   2907 C CB  . LYS B 1 112 ? 30.093  -4.895  61.003  1.00 14.04 ? 116 LYS B CB  1 
ATOM   2908 C CG  . LYS B 1 112 ? 29.226  -5.969  61.650  1.00 13.92 ? 116 LYS B CG  1 
ATOM   2909 C CD  . LYS B 1 112 ? 29.774  -7.359  61.426  1.00 14.10 ? 116 LYS B CD  1 
ATOM   2910 C CE  . LYS B 1 112 ? 29.232  -8.311  62.473  1.00 14.65 ? 116 LYS B CE  1 
ATOM   2911 N NZ  . LYS B 1 112 ? 29.424  -9.735  62.094  1.00 15.20 ? 116 LYS B NZ  1 
ATOM   2912 N N   . LEU B 1 113 ? 27.958  -2.767  60.494  1.00 13.74 ? 117 LEU B N   1 
ATOM   2913 C CA  . LEU B 1 113 ? 26.634  -2.168  60.688  1.00 13.82 ? 117 LEU B CA  1 
ATOM   2914 C C   . LEU B 1 113 ? 25.985  -1.709  59.365  1.00 13.77 ? 117 LEU B C   1 
ATOM   2915 O O   . LEU B 1 113 ? 24.838  -2.058  59.075  1.00 13.42 ? 117 LEU B O   1 
ATOM   2916 C CB  . LEU B 1 113 ? 26.713  -0.997  61.677  1.00 13.67 ? 117 LEU B CB  1 
ATOM   2917 C CG  . LEU B 1 113 ? 25.440  -0.149  61.821  1.00 14.13 ? 117 LEU B CG  1 
ATOM   2918 C CD1 . LEU B 1 113 ? 24.432  -0.798  62.759  1.00 14.47 ? 117 LEU B CD1 1 
ATOM   2919 C CD2 . LEU B 1 113 ? 25.754  1.257   62.280  1.00 14.24 ? 117 LEU B CD2 1 
ATOM   2920 N N   . LEU B 1 114 ? 26.736  -0.931  58.584  1.00 13.84 ? 118 LEU B N   1 
ATOM   2921 C CA  . LEU B 1 114 ? 26.295  -0.423  57.291  1.00 13.95 ? 118 LEU B CA  1 
ATOM   2922 C C   . LEU B 1 114 ? 25.863  -1.525  56.335  1.00 14.09 ? 118 LEU B C   1 
ATOM   2923 O O   . LEU B 1 114 ? 24.893  -1.358  55.595  1.00 14.15 ? 118 LEU B O   1 
ATOM   2924 C CB  . LEU B 1 114 ? 27.404  0.401   56.631  1.00 13.96 ? 118 LEU B CB  1 
ATOM   2925 C CG  . LEU B 1 114 ? 27.786  1.768   57.195  1.00 13.83 ? 118 LEU B CG  1 
ATOM   2926 C CD1 . LEU B 1 114 ? 28.948  2.308   56.400  1.00 13.67 ? 118 LEU B CD1 1 
ATOM   2927 C CD2 . LEU B 1 114 ? 26.631  2.758   57.178  1.00 13.62 ? 118 LEU B CD2 1 
ATOM   2928 N N   . SER B 1 115 ? 26.593  -2.640  56.351  1.00 14.13 ? 119 SER B N   1 
ATOM   2929 C CA  . SER B 1 115 ? 26.303  -3.773  55.473  1.00 14.18 ? 119 SER B CA  1 
ATOM   2930 C C   . SER B 1 115 ? 25.070  -4.561  55.917  1.00 14.31 ? 119 SER B C   1 
ATOM   2931 O O   . SER B 1 115 ? 24.485  -5.295  55.123  1.00 14.30 ? 119 SER B O   1 
ATOM   2932 C CB  . SER B 1 115 ? 27.512  -4.708  55.393  1.00 14.17 ? 119 SER B CB  1 
ATOM   2933 O OG  . SER B 1 115 ? 27.656  -5.458  56.586  1.00 13.82 ? 119 SER B OG  1 
ATOM   2934 N N   . GLN B 1 116 ? 24.695  -4.415  57.188  1.00 14.56 ? 120 GLN B N   1 
ATOM   2935 C CA  . GLN B 1 116 ? 23.562  -5.142  57.764  1.00 14.59 ? 120 GLN B CA  1 
ATOM   2936 C C   . GLN B 1 116 ? 22.270  -4.321  57.729  1.00 15.14 ? 120 GLN B C   1 
ATOM   2937 O O   . GLN B 1 116 ? 21.191  -4.823  58.067  1.00 15.46 ? 120 GLN B O   1 
ATOM   2938 C CB  . GLN B 1 116 ? 23.888  -5.620  59.185  1.00 14.46 ? 120 GLN B CB  1 
ATOM   2939 C CG  . GLN B 1 116 ? 24.724  -6.894  59.207  1.00 13.98 ? 120 GLN B CG  1 
ATOM   2940 C CD  . GLN B 1 116 ? 25.348  -7.207  60.560  1.00 13.75 ? 120 GLN B CD  1 
ATOM   2941 O OE1 . GLN B 1 116 ? 24.919  -6.700  61.590  1.00 12.97 ? 120 GLN B OE1 1 
ATOM   2942 N NE2 . GLN B 1 116 ? 26.358  -8.060  60.552  1.00 12.68 ? 120 GLN B NE2 1 
ATOM   2943 N N   . PHE B 1 117 ? 22.384  -3.068  57.298  1.00 15.34 ? 121 PHE B N   1 
ATOM   2944 C CA  . PHE B 1 117 ? 21.231  -2.176  57.192  1.00 15.82 ? 121 PHE B CA  1 
ATOM   2945 C C   . PHE B 1 117 ? 20.243  -2.607  56.082  1.00 15.98 ? 121 PHE B C   1 
ATOM   2946 O O   . PHE B 1 117 ? 20.587  -2.630  54.896  1.00 15.98 ? 121 PHE B O   1 
ATOM   2947 C CB  . PHE B 1 117 ? 21.707  -0.714  57.037  1.00 15.79 ? 121 PHE B CB  1 
ATOM   2948 C CG  . PHE B 1 117 ? 20.606  0.279   56.722  1.00 16.11 ? 121 PHE B CG  1 
ATOM   2949 C CD1 . PHE B 1 117 ? 19.569  0.512   57.618  1.00 16.64 ? 121 PHE B CD1 1 
ATOM   2950 C CD2 . PHE B 1 117 ? 20.625  0.998   55.532  1.00 16.50 ? 121 PHE B CD2 1 
ATOM   2951 C CE1 . PHE B 1 117 ? 18.560  1.435   57.328  1.00 16.39 ? 121 PHE B CE1 1 
ATOM   2952 C CE2 . PHE B 1 117 ? 19.628  1.926   55.237  1.00 16.48 ? 121 PHE B CE2 1 
ATOM   2953 C CZ  . PHE B 1 117 ? 18.592  2.140   56.137  1.00 16.31 ? 121 PHE B CZ  1 
ATOM   2954 N N   . LYS B 1 118 ? 19.031  -2.974  56.505  1.00 16.12 ? 122 LYS B N   1 
ATOM   2955 C CA  . LYS B 1 118 ? 17.909  -3.306  55.611  1.00 16.32 ? 122 LYS B CA  1 
ATOM   2956 C C   . LYS B 1 118 ? 16.624  -2.771  56.224  1.00 15.86 ? 122 LYS B C   1 
ATOM   2957 O O   . LYS B 1 118 ? 16.518  -2.680  57.455  1.00 15.76 ? 122 LYS B O   1 
ATOM   2958 C CB  . LYS B 1 118 ? 17.747  -4.824  55.463  1.00 16.34 ? 122 LYS B CB  1 
ATOM   2959 C CG  . LYS B 1 118 ? 18.809  -5.532  54.634  1.00 17.48 ? 122 LYS B CG  1 
ATOM   2960 C CD  . LYS B 1 118 ? 18.366  -6.953  54.241  1.00 17.20 ? 122 LYS B CD  1 
ATOM   2961 C CE  . LYS B 1 118 ? 18.684  -7.987  55.335  1.00 19.02 ? 122 LYS B CE  1 
ATOM   2962 N NZ  . LYS B 1 118 ? 18.127  -9.353  55.044  1.00 18.97 ? 122 LYS B NZ  1 
ATOM   2963 N N   . TRP B 1 119 ? 15.657  -2.422  55.372  1.00 15.36 ? 123 TRP B N   1 
ATOM   2964 C CA  . TRP B 1 119 ? 14.272  -2.148  55.807  1.00 15.12 ? 123 TRP B CA  1 
ATOM   2965 C C   . TRP B 1 119 ? 13.285  -2.083  54.630  1.00 15.38 ? 123 TRP B C   1 
ATOM   2966 O O   . TRP B 1 119 ? 13.693  -2.146  53.467  1.00 15.62 ? 123 TRP B O   1 
ATOM   2967 C CB  . TRP B 1 119 ? 14.191  -0.897  56.703  1.00 14.60 ? 123 TRP B CB  1 
ATOM   2968 C CG  . TRP B 1 119 ? 14.502  0.419   56.040  1.00 14.30 ? 123 TRP B CG  1 
ATOM   2969 C CD1 . TRP B 1 119 ? 15.026  0.623   54.787  1.00 13.81 ? 123 TRP B CD1 1 
ATOM   2970 C CD2 . TRP B 1 119 ? 14.354  1.724   56.622  1.00 13.85 ? 123 TRP B CD2 1 
ATOM   2971 N NE1 . TRP B 1 119 ? 15.182  1.969   54.548  1.00 13.51 ? 123 TRP B NE1 1 
ATOM   2972 C CE2 . TRP B 1 119 ? 14.780  2.671   55.654  1.00 13.53 ? 123 TRP B CE2 1 
ATOM   2973 C CE3 . TRP B 1 119 ? 13.896  2.194   57.863  1.00 13.19 ? 123 TRP B CE3 1 
ATOM   2974 C CZ2 . TRP B 1 119 ? 14.759  4.051   55.888  1.00 13.45 ? 123 TRP B CZ2 1 
ATOM   2975 C CZ3 . TRP B 1 119 ? 13.880  3.567   58.094  1.00 13.57 ? 123 TRP B CZ3 1 
ATOM   2976 C CH2 . TRP B 1 119 ? 14.306  4.478   57.107  1.00 13.66 ? 123 TRP B CH2 1 
ATOM   2977 N N   . THR B 1 120 ? 11.991  -1.982  54.931  1.00 15.57 ? 124 THR B N   1 
ATOM   2978 C CA  . THR B 1 120 ? 10.957  -1.974  53.889  1.00 15.52 ? 124 THR B CA  1 
ATOM   2979 C C   . THR B 1 120 ? 10.511  -0.551  53.556  1.00 15.98 ? 124 THR B C   1 
ATOM   2980 O O   . THR B 1 120 ? 10.908  0.405   54.240  1.00 15.86 ? 124 THR B O   1 
ATOM   2981 C CB  . THR B 1 120 ? 9.731   -2.845  54.281  1.00 15.35 ? 124 THR B CB  1 
ATOM   2982 O OG1 . THR B 1 120 ? 9.200   -2.404  55.538  1.00 14.94 ? 124 THR B OG1 1 
ATOM   2983 C CG2 . THR B 1 120 ? 10.130  -4.290  54.534  1.00 14.82 ? 124 THR B CG2 1 
ATOM   2984 N N   . GLN B 1 121 ? 9.683   -0.438  52.508  1.00 16.30 ? 125 GLN B N   1 
ATOM   2985 C CA  . GLN B 1 121 ? 9.167   0.834   51.990  1.00 16.40 ? 125 GLN B CA  1 
ATOM   2986 C C   . GLN B 1 121 ? 8.268   1.575   52.951  1.00 16.40 ? 125 GLN B C   1 
ATOM   2987 O O   . GLN B 1 121 ? 8.302   2.801   53.023  1.00 16.54 ? 125 GLN B O   1 
ATOM   2988 C CB  . GLN B 1 121 ? 8.346   0.585   50.742  1.00 16.49 ? 125 GLN B CB  1 
ATOM   2989 C CG  . GLN B 1 121 ? 9.143   0.420   49.493  1.00 17.70 ? 125 GLN B CG  1 
ATOM   2990 C CD  . GLN B 1 121 ? 8.278   0.597   48.287  1.00 19.39 ? 125 GLN B CD  1 
ATOM   2991 O OE1 . GLN B 1 121 ? 7.058   0.514   48.388  1.00 20.07 ? 125 GLN B OE1 1 
ATOM   2992 N NE2 . GLN B 1 121 ? 8.893   0.856   47.144  1.00 20.80 ? 125 GLN B NE2 1 
ATOM   2993 N N   . ASP B 1 122 ? 7.423   0.837   53.656  1.00 16.40 ? 126 ASP B N   1 
ATOM   2994 C CA  . ASP B 1 122 ? 6.495   1.462   54.586  1.00 16.54 ? 126 ASP B CA  1 
ATOM   2995 C C   . ASP B 1 122 ? 7.198   1.830   55.878  1.00 16.07 ? 126 ASP B C   1 
ATOM   2996 O O   . ASP B 1 122 ? 6.765   2.746   56.567  1.00 16.25 ? 126 ASP B O   1 
ATOM   2997 C CB  . ASP B 1 122 ? 5.290   0.558   54.857  1.00 16.86 ? 126 ASP B CB  1 
ATOM   2998 C CG  . ASP B 1 122 ? 5.690   -0.876  55.070  1.00 17.62 ? 126 ASP B CG  1 
ATOM   2999 O OD1 . ASP B 1 122 ? 5.902   -1.577  54.052  1.00 18.00 ? 126 ASP B OD1 1 
ATOM   3000 O OD2 . ASP B 1 122 ? 5.832   -1.376  56.210  1.00 18.28 ? 126 ASP B OD2 1 
ATOM   3001 N N   . GLU B 1 123 ? 8.276   1.107   56.192  1.00 15.61 ? 127 GLU B N   1 
ATOM   3002 C CA  . GLU B 1 123 ? 9.147   1.432   57.326  1.00 14.94 ? 127 GLU B CA  1 
ATOM   3003 C C   . GLU B 1 123 ? 9.874   2.755   57.095  1.00 14.84 ? 127 GLU B C   1 
ATOM   3004 O O   . GLU B 1 123 ? 10.003  3.565   58.013  1.00 14.52 ? 127 GLU B O   1 
ATOM   3005 C CB  . GLU B 1 123 ? 10.140  0.296   57.603  1.00 14.91 ? 127 GLU B CB  1 
ATOM   3006 C CG  . GLU B 1 123 ? 9.578   -0.780  58.521  1.00 14.41 ? 127 GLU B CG  1 
ATOM   3007 C CD  . GLU B 1 123 ? 10.399  -2.058  58.564  1.00 14.01 ? 127 GLU B CD  1 
ATOM   3008 O OE1 . GLU B 1 123 ? 11.457  -2.135  57.912  1.00 12.62 ? 127 GLU B OE1 1 
ATOM   3009 O OE2 . GLU B 1 123 ? 9.973   -3.002  59.259  1.00 13.49 ? 127 GLU B OE2 1 
ATOM   3010 N N   . MET B 1 124 ? 10.330  2.967   55.862  1.00 14.81 ? 128 MET B N   1 
ATOM   3011 C CA  . MET B 1 124 ? 10.877  4.258   55.451  1.00 15.25 ? 128 MET B CA  1 
ATOM   3012 C C   . MET B 1 124 ? 9.804   5.372   55.478  1.00 15.71 ? 128 MET B C   1 
ATOM   3013 O O   . MET B 1 124 ? 10.093  6.501   55.915  1.00 16.14 ? 128 MET B O   1 
ATOM   3014 C CB  . MET B 1 124 ? 11.536  4.162   54.069  1.00 15.04 ? 128 MET B CB  1 
ATOM   3015 C CG  . MET B 1 124 ? 12.094  5.489   53.553  1.00 15.25 ? 128 MET B CG  1 
ATOM   3016 S SD  . MET B 1 124 ? 12.796  5.471   51.890  1.00 15.39 ? 128 MET B SD  1 
ATOM   3017 C CE  . MET B 1 124 ? 14.417  4.781   52.205  1.00 15.50 ? 128 MET B CE  1 
ATOM   3018 N N   . GLY B 1 125 ? 8.582   5.048   55.022  1.00 15.59 ? 129 GLY B N   1 
ATOM   3019 C CA  . GLY B 1 125 ? 7.430   5.960   55.077  1.00 15.33 ? 129 GLY B CA  1 
ATOM   3020 C C   . GLY B 1 125 ? 7.040   6.398   56.480  1.00 15.40 ? 129 GLY B C   1 
ATOM   3021 O O   . GLY B 1 125 ? 6.611   7.533   56.684  1.00 15.26 ? 129 GLY B O   1 
ATOM   3022 N N   . GLU B 1 126 ? 7.180   5.481   57.441  1.00 15.68 ? 130 GLU B N   1 
ATOM   3023 C CA  . GLU B 1 126 ? 7.080   5.756   58.881  1.00 15.70 ? 130 GLU B CA  1 
ATOM   3024 C C   . GLU B 1 126 ? 7.863   7.053   59.191  1.00 15.50 ? 130 GLU B C   1 
ATOM   3025 O O   . GLU B 1 126 ? 7.373   7.922   59.907  1.00 15.46 ? 130 GLU B O   1 
ATOM   3026 C CB  . GLU B 1 126 ? 7.557   4.549   59.691  1.00 16.07 ? 130 GLU B CB  1 
ATOM   3027 C CG  . GLU B 1 126 ? 7.268   4.648   61.180  1.00 17.54 ? 130 GLU B CG  1 
ATOM   3028 C CD  . GLU B 1 126 ? 7.754   3.435   61.950  1.00 20.00 ? 130 GLU B CD  1 
ATOM   3029 O OE1 . GLU B 1 126 ? 8.318   2.518   61.318  1.00 20.00 ? 130 GLU B OE1 1 
ATOM   3030 O OE2 . GLU B 1 126 ? 7.572   3.403   63.185  1.00 20.00 ? 130 GLU B OE2 1 
ATOM   3031 N N   . ILE B 1 127 ? 9.051   7.202   58.603  1.00 15.25 ? 131 ILE B N   1 
ATOM   3032 C CA  . ILE B 1 127 ? 9.852   8.420   58.774  1.00 15.07 ? 131 ILE B CA  1 
ATOM   3033 C C   . ILE B 1 127 ? 9.470   9.559   57.811  1.00 15.01 ? 131 ILE B C   1 
ATOM   3034 O O   . ILE B 1 127 ? 9.169   10.675  58.252  1.00 14.94 ? 131 ILE B O   1 
ATOM   3035 C CB  . ILE B 1 127 ? 11.379  8.104   58.701  1.00 15.24 ? 131 ILE B CB  1 
ATOM   3036 C CG1 . ILE B 1 127 ? 11.784  7.171   59.850  1.00 15.10 ? 131 ILE B CG1 1 
ATOM   3037 C CG2 . ILE B 1 127 ? 12.220  9.400   58.750  1.00 15.01 ? 131 ILE B CG2 1 
ATOM   3038 C CD1 . ILE B 1 127 ? 13.219  6.694   59.788  1.00 15.05 ? 131 ILE B CD1 1 
ATOM   3039 N N   . MET B 1 128 ? 9.490   9.273   56.509  1.00 14.91 ? 132 MET B N   1 
ATOM   3040 C CA  . MET B 1 128 ? 9.152   10.256  55.466  1.00 14.81 ? 132 MET B CA  1 
ATOM   3041 C C   . MET B 1 128 ? 7.882   11.070  55.736  1.00 14.79 ? 132 MET B C   1 
ATOM   3042 O O   . MET B 1 128 ? 7.859   12.277  55.483  1.00 14.85 ? 132 MET B O   1 
ATOM   3043 C CB  . MET B 1 128 ? 9.015   9.575   54.104  1.00 14.72 ? 132 MET B CB  1 
ATOM   3044 C CG  . MET B 1 128 ? 10.294  8.992   53.543  1.00 14.66 ? 132 MET B CG  1 
ATOM   3045 S SD  . MET B 1 128 ? 10.093  8.524   51.812  1.00 15.03 ? 132 MET B SD  1 
ATOM   3046 C CE  . MET B 1 128 ? 9.146   7.007   51.950  1.00 14.40 ? 132 MET B CE  1 
ATOM   3047 N N   . ILE B 1 129 ? 6.832   10.407  56.231  1.00 14.77 ? 133 ILE B N   1 
ATOM   3048 C CA  . ILE B 1 129 ? 5.545   11.065  56.487  1.00 14.87 ? 133 ILE B CA  1 
ATOM   3049 C C   . ILE B 1 129 ? 5.642   12.058  57.647  1.00 14.90 ? 133 ILE B C   1 
ATOM   3050 O O   . ILE B 1 129 ? 5.208   13.206  57.524  1.00 14.99 ? 133 ILE B O   1 
ATOM   3051 C CB  . ILE B 1 129 ? 4.399   10.039  56.730  1.00 14.83 ? 133 ILE B CB  1 
ATOM   3052 C CG1 . ILE B 1 129 ? 4.146   9.199   55.476  1.00 14.92 ? 133 ILE B CG1 1 
ATOM   3053 C CG2 . ILE B 1 129 ? 3.112   10.759  57.110  1.00 14.62 ? 133 ILE B CG2 1 
ATOM   3054 C CD1 . ILE B 1 129 ? 3.414   7.886   55.739  1.00 14.28 ? 133 ILE B CD1 1 
ATOM   3055 N N   . LYS B 1 130 ? 6.211   11.608  58.763  1.00 14.89 ? 134 LYS B N   1 
ATOM   3056 C CA  . LYS B 1 130 ? 6.426   12.465  59.924  1.00 14.82 ? 134 LYS B CA  1 
ATOM   3057 C C   . LYS B 1 130 ? 7.309   13.675  59.621  1.00 14.68 ? 134 LYS B C   1 
ATOM   3058 O O   . LYS B 1 130 ? 7.088   14.755  60.183  1.00 14.59 ? 134 LYS B O   1 
ATOM   3059 C CB  . LYS B 1 130 ? 7.014   11.672  61.084  1.00 14.91 ? 134 LYS B CB  1 
ATOM   3060 C CG  . LYS B 1 130 ? 6.092   11.553  62.273  1.00 15.72 ? 134 LYS B CG  1 
ATOM   3061 C CD  . LYS B 1 130 ? 5.566   10.144  62.472  1.00 17.14 ? 134 LYS B CD  1 
ATOM   3062 C CE  . LYS B 1 130 ? 5.101   9.973   63.923  1.00 18.49 ? 134 LYS B CE  1 
ATOM   3063 N NZ  . LYS B 1 130 ? 4.569   8.611   64.209  1.00 19.26 ? 134 LYS B NZ  1 
ATOM   3064 N N   . VAL B 1 131 ? 8.292   13.499  58.733  1.00 14.47 ? 135 VAL B N   1 
ATOM   3065 C CA  . VAL B 1 131 ? 9.184   14.603  58.344  1.00 14.47 ? 135 VAL B CA  1 
ATOM   3066 C C   . VAL B 1 131 ? 8.469   15.637  57.468  1.00 14.63 ? 135 VAL B C   1 
ATOM   3067 O O   . VAL B 1 131 ? 8.614   16.840  57.695  1.00 14.64 ? 135 VAL B O   1 
ATOM   3068 C CB  . VAL B 1 131 ? 10.519  14.114  57.705  1.00 14.42 ? 135 VAL B CB  1 
ATOM   3069 C CG1 . VAL B 1 131 ? 11.287  15.269  57.083  1.00 13.98 ? 135 VAL B CG1 1 
ATOM   3070 C CG2 . VAL B 1 131 ? 11.392  13.405  58.744  1.00 14.03 ? 135 VAL B CG2 1 
ATOM   3071 N N   . GLU B 1 132 ? 7.674   15.177  56.501  1.00 14.94 ? 136 GLU B N   1 
ATOM   3072 C CA  . GLU B 1 132 ? 6.843   16.095  55.703  1.00 15.27 ? 136 GLU B CA  1 
ATOM   3073 C C   . GLU B 1 132 ? 5.773   16.805  56.535  1.00 15.21 ? 136 GLU B C   1 
ATOM   3074 O O   . GLU B 1 132 ? 5.368   17.917  56.207  1.00 15.29 ? 136 GLU B O   1 
ATOM   3075 C CB  . GLU B 1 132 ? 6.158   15.342  54.561  1.00 15.43 ? 136 GLU B CB  1 
ATOM   3076 C CG  . GLU B 1 132 ? 5.474   16.243  53.546  1.00 16.09 ? 136 GLU B CG  1 
ATOM   3077 C CD  . GLU B 1 132 ? 6.461   17.025  52.703  1.00 20.00 ? 136 GLU B CD  1 
ATOM   3078 O OE1 . GLU B 1 132 ? 7.682   16.863  52.914  1.00 20.00 ? 136 GLU B OE1 1 
ATOM   3079 O OE2 . GLU B 1 132 ? 6.015   17.801  51.832  1.00 20.00 ? 136 GLU B OE2 1 
ATOM   3080 N N   . GLU B 1 133 ? 5.321   16.157  57.607  1.00 15.30 ? 137 GLU B N   1 
ATOM   3081 C CA  . GLU B 1 133 ? 4.449   16.790  58.597  1.00 15.34 ? 137 GLU B CA  1 
ATOM   3082 C C   . GLU B 1 133 ? 5.188   17.893  59.361  1.00 15.39 ? 137 GLU B C   1 
ATOM   3083 O O   . GLU B 1 133 ? 4.588   18.607  60.165  1.00 15.47 ? 137 GLU B O   1 
ATOM   3084 C CB  . GLU B 1 133 ? 3.896   15.746  59.569  1.00 15.39 ? 137 GLU B CB  1 
ATOM   3085 C CG  . GLU B 1 133 ? 3.074   14.653  58.904  1.00 15.92 ? 137 GLU B CG  1 
ATOM   3086 C CD  . GLU B 1 133 ? 2.543   13.638  59.897  1.00 20.00 ? 137 GLU B CD  1 
ATOM   3087 O OE1 . GLU B 1 133 ? 2.818   13.790  61.106  1.00 20.00 ? 137 GLU B OE1 1 
ATOM   3088 O OE2 . GLU B 1 133 ? 1.851   12.692  59.467  1.00 20.00 ? 137 GLU B OE2 1 
ATOM   3089 N N   . GLY B 1 134 ? 6.491   18.025  59.115  1.00 15.42 ? 138 GLY B N   1 
ATOM   3090 C CA  . GLY B 1 134 ? 7.292   19.080  59.737  1.00 15.51 ? 138 GLY B CA  1 
ATOM   3091 C C   . GLY B 1 134 ? 8.073   18.668  60.976  1.00 15.56 ? 138 GLY B C   1 
ATOM   3092 O O   . GLY B 1 134 ? 8.761   19.491  61.584  1.00 15.41 ? 138 GLY B O   1 
ATOM   3093 N N   . GLU B 1 135 ? 7.955   17.401  61.364  1.00 15.61 ? 139 GLU B N   1 
ATOM   3094 C CA  . GLU B 1 135 ? 8.791   16.854  62.417  1.00 15.79 ? 139 GLU B CA  1 
ATOM   3095 C C   . GLU B 1 135 ? 10.246  16.849  61.967  1.00 15.82 ? 139 GLU B C   1 
ATOM   3096 O O   . GLU B 1 135 ? 10.551  16.561  60.802  1.00 15.74 ? 139 GLU B O   1 
ATOM   3097 C CB  . GLU B 1 135 ? 8.308   15.457  62.813  1.00 15.98 ? 139 GLU B CB  1 
ATOM   3098 C CG  . GLU B 1 135 ? 6.880   15.418  63.331  1.00 16.94 ? 139 GLU B CG  1 
ATOM   3099 C CD  . GLU B 1 135 ? 6.760   14.695  64.658  1.00 20.00 ? 139 GLU B CD  1 
ATOM   3100 O OE1 . GLU B 1 135 ? 7.796   14.225  65.173  1.00 20.00 ? 139 GLU B OE1 1 
ATOM   3101 O OE2 . GLU B 1 135 ? 5.631   14.600  65.183  1.00 20.00 ? 139 GLU B OE2 1 
ATOM   3102 N N   . LYS B 1 136 ? 11.139  17.167  62.899  1.00 15.84 ? 140 LYS B N   1 
ATOM   3103 C CA  . LYS B 1 136 ? 12.564  17.233  62.606  1.00 15.88 ? 140 LYS B CA  1 
ATOM   3104 C C   . LYS B 1 136 ? 13.175  15.835  62.440  1.00 15.74 ? 140 LYS B C   1 
ATOM   3105 O O   . LYS B 1 136 ? 13.019  14.978  63.323  1.00 15.53 ? 140 LYS B O   1 
ATOM   3106 C CB  . LYS B 1 136 ? 13.294  18.036  63.687  1.00 16.08 ? 140 LYS B CB  1 
ATOM   3107 C CG  . LYS B 1 136 ? 12.871  19.507  63.780  1.00 16.63 ? 140 LYS B CG  1 
ATOM   3108 C CD  . LYS B 1 136 ? 13.456  20.365  62.644  1.00 17.15 ? 140 LYS B CD  1 
ATOM   3109 C CE  . LYS B 1 136 ? 12.456  20.601  61.525  1.00 16.76 ? 140 LYS B CE  1 
ATOM   3110 N NZ  . LYS B 1 136 ? 12.956  21.625  60.571  1.00 16.83 ? 140 LYS B NZ  1 
ATOM   3111 N N   . PRO B 1 137 ? 13.867  15.619  61.308  1.00 15.60 ? 141 PRO B N   1 
ATOM   3112 C CA  . PRO B 1 137 ? 14.413  14.299  60.948  1.00 15.46 ? 141 PRO B CA  1 
ATOM   3113 C C   . PRO B 1 137 ? 15.169  13.578  62.073  1.00 15.61 ? 141 PRO B C   1 
ATOM   3114 O O   . PRO B 1 137 ? 14.949  12.379  62.258  1.00 15.58 ? 141 PRO B O   1 
ATOM   3115 C CB  . PRO B 1 137 ? 15.349  14.618  59.781  1.00 15.21 ? 141 PRO B CB  1 
ATOM   3116 C CG  . PRO B 1 137 ? 14.757  15.814  59.155  1.00 15.07 ? 141 PRO B CG  1 
ATOM   3117 C CD  . PRO B 1 137 ? 14.180  16.630  60.278  1.00 15.36 ? 141 PRO B CD  1 
ATOM   3118 N N   . ALA B 1 138 ? 16.026  14.296  62.812  1.00 15.73 ? 142 ALA B N   1 
ATOM   3119 C CA  . ALA B 1 138 ? 16.803  13.702  63.918  1.00 15.79 ? 142 ALA B CA  1 
ATOM   3120 C C   . ALA B 1 138 ? 15.918  13.202  65.059  1.00 15.94 ? 142 ALA B C   1 
ATOM   3121 O O   . ALA B 1 138 ? 16.240  12.191  65.690  1.00 15.94 ? 142 ALA B O   1 
ATOM   3122 C CB  . ALA B 1 138 ? 17.838  14.677  64.446  1.00 15.82 ? 142 ALA B CB  1 
ATOM   3123 N N   . LYS B 1 139 ? 14.814  13.912  65.317  1.00 16.03 ? 143 LYS B N   1 
ATOM   3124 C CA  . LYS B 1 139 ? 13.808  13.480  66.297  1.00 15.96 ? 143 LYS B CA  1 
ATOM   3125 C C   . LYS B 1 139 ? 13.065  12.229  65.830  1.00 16.03 ? 143 LYS B C   1 
ATOM   3126 O O   . LYS B 1 139 ? 12.944  11.274  66.593  1.00 16.14 ? 143 LYS B O   1 
ATOM   3127 C CB  . LYS B 1 139 ? 12.802  14.595  66.602  1.00 15.95 ? 143 LYS B CB  1 
ATOM   3128 C CG  . LYS B 1 139 ? 13.193  15.521  67.722  1.00 15.77 ? 143 LYS B CG  1 
ATOM   3129 C CD  . LYS B 1 139 ? 12.013  16.368  68.151  1.00 15.61 ? 143 LYS B CD  1 
ATOM   3130 C CE  . LYS B 1 139 ? 12.315  17.105  69.450  1.00 16.07 ? 143 LYS B CE  1 
ATOM   3131 N NZ  . LYS B 1 139 ? 11.255  18.095  69.789  1.00 15.72 ? 143 LYS B NZ  1 
ATOM   3132 N N   . VAL B 1 140 ? 12.574  12.239  64.586  1.00 16.00 ? 144 VAL B N   1 
ATOM   3133 C CA  . VAL B 1 140 ? 11.873  11.081  64.007  1.00 16.01 ? 144 VAL B CA  1 
ATOM   3134 C C   . VAL B 1 140 ? 12.794  9.854   63.976  1.00 16.10 ? 144 VAL B C   1 
ATOM   3135 O O   . VAL B 1 140 ? 12.348  8.735   64.236  1.00 16.20 ? 144 VAL B O   1 
ATOM   3136 C CB  . VAL B 1 140 ? 11.294  11.367  62.571  1.00 16.12 ? 144 VAL B CB  1 
ATOM   3137 C CG1 . VAL B 1 140 ? 10.451  10.203  62.063  1.00 15.59 ? 144 VAL B CG1 1 
ATOM   3138 C CG2 . VAL B 1 140 ? 10.456  12.629  62.552  1.00 16.09 ? 144 VAL B CG2 1 
ATOM   3139 N N   . ALA B 1 141 ? 14.073  10.071  63.665  1.00 16.12 ? 145 ALA B N   1 
ATOM   3140 C CA  . ALA B 1 141 ? 15.072  9.002   63.691  1.00 16.23 ? 145 ALA B CA  1 
ATOM   3141 C C   . ALA B 1 141 ? 15.186  8.392   65.083  1.00 16.44 ? 145 ALA B C   1 
ATOM   3142 O O   . ALA B 1 141 ? 15.174  7.166   65.222  1.00 16.72 ? 145 ALA B O   1 
ATOM   3143 C CB  . ALA B 1 141 ? 16.427  9.509   63.217  1.00 16.22 ? 145 ALA B CB  1 
ATOM   3144 N N   . ALA B 1 142 ? 15.282  9.244   66.107  1.00 16.45 ? 146 ALA B N   1 
ATOM   3145 C CA  . ALA B 1 142 ? 15.307  8.783   67.499  1.00 16.49 ? 146 ALA B CA  1 
ATOM   3146 C C   . ALA B 1 142 ? 14.034  8.006   67.858  1.00 16.50 ? 146 ALA B C   1 
ATOM   3147 O O   . ALA B 1 142 ? 14.117  6.882   68.358  1.00 16.54 ? 146 ALA B O   1 
ATOM   3148 C CB  . ALA B 1 142 ? 15.532  9.952   68.463  1.00 16.38 ? 146 ALA B CB  1 
ATOM   3149 N N   . GLU B 1 143 ? 12.870  8.600   67.579  1.00 16.52 ? 147 GLU B N   1 
ATOM   3150 C CA  . GLU B 1 143 ? 11.568  7.951   67.782  1.00 16.69 ? 147 GLU B CA  1 
ATOM   3151 C C   . GLU B 1 143 ? 11.504  6.575   67.123  1.00 16.69 ? 147 GLU B C   1 
ATOM   3152 O O   . GLU B 1 143 ? 10.963  5.628   67.699  1.00 16.68 ? 147 GLU B O   1 
ATOM   3153 C CB  . GLU B 1 143 ? 10.441  8.826   67.229  1.00 16.91 ? 147 GLU B CB  1 
ATOM   3154 C CG  . GLU B 1 143 ? 10.346  10.198  67.876  1.00 17.48 ? 147 GLU B CG  1 
ATOM   3155 C CD  . GLU B 1 143 ? 10.098  10.122  69.370  1.00 20.00 ? 147 GLU B CD  1 
ATOM   3156 O OE1 . GLU B 1 143 ? 10.001  8.995   69.899  1.00 20.00 ? 147 GLU B OE1 1 
ATOM   3157 O OE2 . GLU B 1 143 ? 10.002  11.189  70.011  1.00 20.00 ? 147 GLU B OE2 1 
ATOM   3158 N N   . TYR B 1 144 ? 12.068  6.481   65.918  1.00 16.72 ? 148 TYR B N   1 
ATOM   3159 C CA  . TYR B 1 144 ? 12.095  5.246   65.138  1.00 16.63 ? 148 TYR B CA  1 
ATOM   3160 C C   . TYR B 1 144 ? 12.913  4.138   65.801  1.00 16.72 ? 148 TYR B C   1 
ATOM   3161 O O   . TYR B 1 144 ? 12.468  2.990   65.852  1.00 16.87 ? 148 TYR B O   1 
ATOM   3162 C CB  . TYR B 1 144 ? 12.634  5.508   63.728  1.00 16.39 ? 148 TYR B CB  1 
ATOM   3163 C CG  . TYR B 1 144 ? 12.490  4.319   62.812  1.00 16.44 ? 148 TYR B CG  1 
ATOM   3164 C CD1 . TYR B 1 144 ? 11.404  4.221   61.936  1.00 16.88 ? 148 TYR B CD1 1 
ATOM   3165 C CD2 . TYR B 1 144 ? 13.428  3.279   62.828  1.00 16.15 ? 148 TYR B CD2 1 
ATOM   3166 C CE1 . TYR B 1 144 ? 11.256  3.116   61.085  1.00 16.91 ? 148 TYR B CE1 1 
ATOM   3167 C CE2 . TYR B 1 144 ? 13.290  2.169   61.993  1.00 16.53 ? 148 TYR B CE2 1 
ATOM   3168 C CZ  . TYR B 1 144 ? 12.200  2.094   61.122  1.00 16.89 ? 148 TYR B CZ  1 
ATOM   3169 O OH  . TYR B 1 144 ? 12.047  1.004   60.289  1.00 16.97 ? 148 TYR B OH  1 
ATOM   3170 N N   . VAL B 1 145 ? 14.105  4.480   66.294  1.00 16.67 ? 149 VAL B N   1 
ATOM   3171 C CA  . VAL B 1 145 ? 15.016  3.479   66.857  1.00 16.71 ? 149 VAL B CA  1 
ATOM   3172 C C   . VAL B 1 145 ? 14.569  2.998   68.236  1.00 16.67 ? 149 VAL B C   1 
ATOM   3173 O O   . VAL B 1 145 ? 14.805  1.852   68.612  1.00 16.72 ? 149 VAL B O   1 
ATOM   3174 C CB  . VAL B 1 145 ? 16.503  3.950   66.873  1.00 16.68 ? 149 VAL B CB  1 
ATOM   3175 C CG1 . VAL B 1 145 ? 16.966  4.352   65.475  1.00 16.71 ? 149 VAL B CG1 1 
ATOM   3176 C CG2 . VAL B 1 145 ? 16.725  5.090   67.850  1.00 17.12 ? 149 VAL B CG2 1 
ATOM   3177 N N   . ASN B 1 146 ? 13.897  3.876   68.970  1.00 16.81 ? 150 ASN B N   1 
ATOM   3178 C CA  . ASN B 1 146 ? 13.375  3.541   70.290  1.00 16.98 ? 150 ASN B CA  1 
ATOM   3179 C C   . ASN B 1 146 ? 11.995  2.882   70.202  1.00 16.99 ? 150 ASN B C   1 
ATOM   3180 O O   . ASN B 1 146 ? 11.343  2.643   71.221  1.00 17.11 ? 150 ASN B O   1 
ATOM   3181 C CB  . ASN B 1 146 ? 13.359  4.788   71.185  1.00 16.97 ? 150 ASN B CB  1 
ATOM   3182 C CG  . ASN B 1 146 ? 14.744  5.422   71.328  1.00 17.29 ? 150 ASN B CG  1 
ATOM   3183 O OD1 . ASN B 1 146 ? 15.708  4.759   71.714  1.00 17.54 ? 150 ASN B OD1 1 
ATOM   3184 N ND2 . ASN B 1 146 ? 14.846  6.709   71.006  1.00 17.05 ? 150 ASN B ND2 1 
ATOM   3185 N N   . LYS B 1 147 ? 11.581  2.577   68.972  1.00 16.90 ? 151 LYS B N   1 
ATOM   3186 C CA  . LYS B 1 147 ? 10.310  1.927   68.670  1.00 16.75 ? 151 LYS B CA  1 
ATOM   3187 C C   . LYS B 1 147 ? 10.540  0.554   68.032  1.00 16.85 ? 151 LYS B C   1 
ATOM   3188 O O   . LYS B 1 147 ? 10.111  -0.464  68.580  1.00 17.02 ? 151 LYS B O   1 
ATOM   3189 C CB  . LYS B 1 147 ? 9.491   2.810   67.732  1.00 16.72 ? 151 LYS B CB  1 
ATOM   3190 C CG  . LYS B 1 147 ? 8.161   2.225   67.293  1.00 16.54 ? 151 LYS B CG  1 
ATOM   3191 C CD  . LYS B 1 147 ? 7.385   3.249   66.511  1.00 15.88 ? 151 LYS B CD  1 
ATOM   3192 C CE  . LYS B 1 147 ? 5.983   2.801   66.284  1.00 15.54 ? 151 LYS B CE  1 
ATOM   3193 N NZ  . LYS B 1 147 ? 5.334   3.774   65.385  1.00 16.34 ? 151 LYS B NZ  1 
ATOM   3194 N N   . HIS B 1 148 ? 11.213  0.537   66.877  1.00 16.80 ? 152 HIS B N   1 
ATOM   3195 C CA  . HIS B 1 148 ? 11.602  -0.699  66.183  1.00 16.76 ? 152 HIS B CA  1 
ATOM   3196 C C   . HIS B 1 148 ? 12.840  -1.363  66.821  1.00 16.64 ? 152 HIS B C   1 
ATOM   3197 O O   . HIS B 1 148 ? 13.843  -1.597  66.144  1.00 16.57 ? 152 HIS B O   1 
ATOM   3198 C CB  . HIS B 1 148 ? 11.877  -0.411  64.702  1.00 16.79 ? 152 HIS B CB  1 
ATOM   3199 C CG  . HIS B 1 148 ? 10.698  0.122   63.947  1.00 17.59 ? 152 HIS B CG  1 
ATOM   3200 N ND1 . HIS B 1 148 ? 9.924   -0.665  63.122  1.00 18.13 ? 152 HIS B ND1 1 
ATOM   3201 C CD2 . HIS B 1 148 ? 10.174  1.370   63.873  1.00 18.30 ? 152 HIS B CD2 1 
ATOM   3202 C CE1 . HIS B 1 148 ? 8.971   0.071   62.578  1.00 18.51 ? 152 HIS B CE1 1 
ATOM   3203 N NE2 . HIS B 1 148 ? 9.102   1.311   63.014  1.00 18.67 ? 152 HIS B NE2 1 
ATOM   3204 N N   . LYS B 1 149 ? 12.750  -1.673  68.116  1.00 16.60 ? 153 LYS B N   1 
ATOM   3205 C CA  . LYS B 1 149 ? 13.863  -2.225  68.920  1.00 16.51 ? 153 LYS B CA  1 
ATOM   3206 C C   . LYS B 1 149 ? 14.547  -3.463  68.317  1.00 16.39 ? 153 LYS B C   1 
ATOM   3207 O O   . LYS B 1 149 ? 15.770  -3.613  68.412  1.00 16.25 ? 153 LYS B O   1 
ATOM   3208 C CB  . LYS B 1 149 ? 13.367  -2.588  70.324  1.00 16.54 ? 153 LYS B CB  1 
ATOM   3209 C CG  . LYS B 1 149 ? 12.808  -1.441  71.146  1.00 16.71 ? 153 LYS B CG  1 
ATOM   3210 C CD  . LYS B 1 149 ? 13.703  -1.122  72.333  1.00 16.80 ? 153 LYS B CD  1 
ATOM   3211 C CE  . LYS B 1 149 ? 12.909  -0.432  73.434  1.00 16.68 ? 153 LYS B CE  1 
ATOM   3212 N NZ  . LYS B 1 149 ? 13.570  -0.557  74.761  1.00 16.67 ? 153 LYS B NZ  1 
ATOM   3213 N N   . ASP B 1 150 ? 13.749  -4.344  67.715  1.00 16.17 ? 154 ASP B N   1 
ATOM   3214 C CA  . ASP B 1 150 ? 14.249  -5.589  67.137  1.00 16.08 ? 154 ASP B CA  1 
ATOM   3215 C C   . ASP B 1 150 ? 14.974  -5.412  65.803  1.00 15.85 ? 154 ASP B C   1 
ATOM   3216 O O   . ASP B 1 150 ? 15.889  -6.170  65.472  1.00 15.81 ? 154 ASP B O   1 
ATOM   3217 C CB  . ASP B 1 150 ? 13.107  -6.588  66.980  1.00 16.20 ? 154 ASP B CB  1 
ATOM   3218 C CG  . ASP B 1 150 ? 12.754  -7.269  68.284  1.00 16.71 ? 154 ASP B CG  1 
ATOM   3219 O OD1 . ASP B 1 150 ? 12.168  -8.369  68.242  1.00 17.14 ? 154 ASP B OD1 1 
ATOM   3220 O OD2 . ASP B 1 150 ? 13.033  -6.785  69.402  1.00 18.00 ? 154 ASP B OD2 1 
ATOM   3221 N N   . GLN B 1 151 ? 14.560  -4.416  65.035  1.00 15.58 ? 155 GLN B N   1 
ATOM   3222 C CA  . GLN B 1 151 ? 15.192  -4.157  63.758  1.00 15.25 ? 155 GLN B CA  1 
ATOM   3223 C C   . GLN B 1 151 ? 16.615  -3.650  63.961  1.00 15.16 ? 155 GLN B C   1 
ATOM   3224 O O   . GLN B 1 151 ? 17.524  -4.034  63.228  1.00 15.26 ? 155 GLN B O   1 
ATOM   3225 C CB  . GLN B 1 151 ? 14.366  -3.171  62.943  1.00 14.97 ? 155 GLN B CB  1 
ATOM   3226 C CG  . GLN B 1 151 ? 14.807  -3.080  61.514  1.00 14.91 ? 155 GLN B CG  1 
ATOM   3227 C CD  . GLN B 1 151 ? 13.807  -2.366  60.652  1.00 15.10 ? 155 GLN B CD  1 
ATOM   3228 O OE1 . GLN B 1 151 ? 13.590  -1.159  60.796  1.00 14.79 ? 155 GLN B OE1 1 
ATOM   3229 N NE2 . GLN B 1 151 ? 13.192  -3.106  59.742  1.00 15.35 ? 155 GLN B NE2 1 
ATOM   3230 N N   . ILE B 1 152 ? 16.803  -2.796  64.964  1.00 15.10 ? 156 ILE B N   1 
ATOM   3231 C CA  . ILE B 1 152 ? 18.133  -2.274  65.300  1.00 15.15 ? 156 ILE B CA  1 
ATOM   3232 C C   . ILE B 1 152 ? 19.082  -3.406  65.732  1.00 15.18 ? 156 ILE B C   1 
ATOM   3233 O O   . ILE B 1 152 ? 20.236  -3.449  65.298  1.00 15.24 ? 156 ILE B O   1 
ATOM   3234 C CB  . ILE B 1 152 ? 18.034  -1.117  66.351  1.00 15.09 ? 156 ILE B CB  1 
ATOM   3235 C CG1 . ILE B 1 152 ? 17.773  0.229   65.658  1.00 15.10 ? 156 ILE B CG1 1 
ATOM   3236 C CG2 . ILE B 1 152 ? 19.317  -0.970  67.162  1.00 14.83 ? 156 ILE B CG2 1 
ATOM   3237 C CD1 . ILE B 1 152 ? 16.392  0.407   65.041  1.00 14.91 ? 156 ILE B CD1 1 
ATOM   3238 N N   . ALA B 1 153 ? 18.573  -4.325  66.552  1.00 15.02 ? 157 ALA B N   1 
ATOM   3239 C CA  . ALA B 1 153 ? 19.302  -5.523  66.949  1.00 15.06 ? 157 ALA B CA  1 
ATOM   3240 C C   . ALA B 1 153 ? 19.862  -6.299  65.751  1.00 15.26 ? 157 ALA B C   1 
ATOM   3241 O O   . ALA B 1 153 ? 21.029  -6.705  65.762  1.00 15.16 ? 157 ALA B O   1 
ATOM   3242 C CB  . ALA B 1 153 ? 18.414  -6.412  67.792  1.00 15.06 ? 157 ALA B CB  1 
ATOM   3243 N N   . GLU B 1 154 ? 19.028  -6.509  64.730  1.00 15.67 ? 158 GLU B N   1 
ATOM   3244 C CA  . GLU B 1 154 ? 19.477  -7.079  63.455  1.00 15.97 ? 158 GLU B CA  1 
ATOM   3245 C C   . GLU B 1 154 ? 20.709  -6.312  62.979  1.00 15.96 ? 158 GLU B C   1 
ATOM   3246 O O   . GLU B 1 154 ? 21.790  -6.892  62.831  1.00 16.02 ? 158 GLU B O   1 
ATOM   3247 C CB  . GLU B 1 154 ? 18.342  -7.058  62.429  1.00 16.26 ? 158 GLU B CB  1 
ATOM   3248 C CG  . GLU B 1 154 ? 17.436  -8.278  62.482  1.00 17.57 ? 158 GLU B CG  1 
ATOM   3249 C CD  . GLU B 1 154 ? 16.677  -8.495  61.187  1.00 20.00 ? 158 GLU B CD  1 
ATOM   3250 O OE1 . GLU B 1 154 ? 16.860  -7.691  60.250  1.00 20.00 ? 158 GLU B OE1 1 
ATOM   3251 O OE2 . GLU B 1 154 ? 15.899  -9.470  61.112  1.00 20.00 ? 158 GLU B OE2 1 
ATOM   3252 N N   . TRP B 1 155 ? 20.534  -5.005  62.775  1.00 15.64 ? 159 TRP B N   1 
ATOM   3253 C CA  . TRP B 1 155 ? 21.568  -4.142  62.229  1.00 15.40 ? 159 TRP B CA  1 
ATOM   3254 C C   . TRP B 1 155 ? 22.845  -4.108  63.075  1.00 15.37 ? 159 TRP B C   1 
ATOM   3255 O O   . TRP B 1 155 ? 23.949  -4.107  62.530  1.00 15.52 ? 159 TRP B O   1 
ATOM   3256 C CB  . TRP B 1 155 ? 21.037  -2.721  62.049  1.00 15.39 ? 159 TRP B CB  1 
ATOM   3257 C CG  . TRP B 1 155 ? 19.809  -2.585  61.173  1.00 15.49 ? 159 TRP B CG  1 
ATOM   3258 C CD1 . TRP B 1 155 ? 19.277  -3.522  60.318  1.00 15.52 ? 159 TRP B CD1 1 
ATOM   3259 C CD2 . TRP B 1 155 ? 18.985  -1.420  61.041  1.00 15.31 ? 159 TRP B CD2 1 
ATOM   3260 N NE1 . TRP B 1 155 ? 18.167  -3.013  59.686  1.00 15.20 ? 159 TRP B NE1 1 
ATOM   3261 C CE2 . TRP B 1 155 ? 17.965  -1.724  60.109  1.00 15.12 ? 159 TRP B CE2 1 
ATOM   3262 C CE3 . TRP B 1 155 ? 19.000  -0.144  61.625  1.00 15.14 ? 159 TRP B CE3 1 
ATOM   3263 C CZ2 . TRP B 1 155 ? 16.977  -0.804  59.751  1.00 15.23 ? 159 TRP B CZ2 1 
ATOM   3264 C CZ3 . TRP B 1 155 ? 18.019  0.768   61.269  1.00 15.30 ? 159 TRP B CZ3 1 
ATOM   3265 C CH2 . TRP B 1 155 ? 17.019  0.432   60.342  1.00 15.34 ? 159 TRP B CH2 1 
ATOM   3266 N N   . THR B 1 156 ? 22.695  -4.082  64.399  1.00 15.14 ? 160 THR B N   1 
ATOM   3267 C CA  . THR B 1 156 ? 23.841  -3.981  65.311  1.00 14.72 ? 160 THR B CA  1 
ATOM   3268 C C   . THR B 1 156 ? 24.358  -5.336  65.785  1.00 14.76 ? 160 THR B C   1 
ATOM   3269 O O   . THR B 1 156 ? 25.140  -5.405  66.737  1.00 14.72 ? 160 THR B O   1 
ATOM   3270 C CB  . THR B 1 156 ? 23.502  -3.106  66.537  1.00 14.52 ? 160 THR B CB  1 
ATOM   3271 O OG1 . THR B 1 156 ? 22.452  -3.718  67.293  1.00 14.07 ? 160 THR B OG1 1 
ATOM   3272 C CG2 . THR B 1 156 ? 22.916  -1.781  66.112  1.00 14.40 ? 160 THR B CG2 1 
ATOM   3273 N N   . LYS B 1 157 ? 23.922  -6.407  65.126  1.00 14.84 ? 161 LYS B N   1 
ATOM   3274 C CA  . LYS B 1 157 ? 24.330  -7.765  65.491  1.00 14.85 ? 161 LYS B CA  1 
ATOM   3275 C C   . LYS B 1 157 ? 25.840  -7.918  65.372  1.00 14.78 ? 161 LYS B C   1 
ATOM   3276 O O   . LYS B 1 157 ? 26.419  -7.647  64.318  1.00 14.75 ? 161 LYS B O   1 
ATOM   3277 C CB  . LYS B 1 157 ? 23.616  -8.799  64.616  1.00 14.94 ? 161 LYS B CB  1 
ATOM   3278 C CG  . LYS B 1 157 ? 24.195  -10.207 64.678  1.00 14.74 ? 161 LYS B CG  1 
ATOM   3279 C CD  . LYS B 1 157 ? 23.525  -11.020 65.753  1.00 15.04 ? 161 LYS B CD  1 
ATOM   3280 C CE  . LYS B 1 157 ? 23.666  -12.502 65.470  1.00 15.39 ? 161 LYS B CE  1 
ATOM   3281 N NZ  . LYS B 1 157 ? 22.578  -13.280 66.125  1.00 15.76 ? 161 LYS B NZ  1 
ATOM   3282 N N   . GLY B 1 158 ? 26.461  -8.341  66.473  1.00 14.71 ? 162 GLY B N   1 
ATOM   3283 C CA  . GLY B 1 158 ? 27.907  -8.505  66.562  1.00 14.57 ? 162 GLY B CA  1 
ATOM   3284 C C   . GLY B 1 158 ? 28.674  -7.233  66.272  1.00 14.62 ? 162 GLY B C   1 
ATOM   3285 O O   . GLY B 1 158 ? 29.773  -7.295  65.724  1.00 14.59 ? 162 GLY B O   1 
ATOM   3286 N N   . VAL B 1 159 ? 28.087  -6.084  66.628  1.00 14.75 ? 163 VAL B N   1 
ATOM   3287 C CA  . VAL B 1 159 ? 28.703  -4.764  66.399  1.00 14.82 ? 163 VAL B CA  1 
ATOM   3288 C C   . VAL B 1 159 ? 29.076  -4.114  67.733  1.00 15.17 ? 163 VAL B C   1 
ATOM   3289 O O   . VAL B 1 159 ? 28.196  -3.783  68.534  1.00 15.15 ? 163 VAL B O   1 
ATOM   3290 C CB  . VAL B 1 159 ? 27.788  -3.814  65.560  1.00 14.65 ? 163 VAL B CB  1 
ATOM   3291 C CG1 . VAL B 1 159 ? 28.466  -2.482  65.292  1.00 14.03 ? 163 VAL B CG1 1 
ATOM   3292 C CG2 . VAL B 1 159 ? 27.413  -4.456  64.238  1.00 14.85 ? 163 VAL B CG2 1 
ATOM   3293 N N   . GLN B 1 160 ? 30.384  -3.947  67.953  1.00 15.53 ? 164 GLN B N   1 
ATOM   3294 C CA  . GLN B 1 160 ? 30.938  -3.351  69.176  1.00 15.93 ? 164 GLN B CA  1 
ATOM   3295 C C   . GLN B 1 160 ? 30.659  -1.845  69.285  1.00 15.95 ? 164 GLN B C   1 
ATOM   3296 O O   . GLN B 1 160 ? 30.259  -1.199  68.307  1.00 15.91 ? 164 GLN B O   1 
ATOM   3297 C CB  . GLN B 1 160 ? 32.460  -3.572  69.248  1.00 16.18 ? 164 GLN B CB  1 
ATOM   3298 C CG  . GLN B 1 160 ? 32.937  -5.012  69.129  1.00 17.23 ? 164 GLN B CG  1 
ATOM   3299 C CD  . GLN B 1 160 ? 32.374  -5.916  70.209  1.00 19.14 ? 164 GLN B CD  1 
ATOM   3300 O OE1 . GLN B 1 160 ? 32.426  -5.591  71.404  1.00 20.02 ? 164 GLN B OE1 1 
ATOM   3301 N NE2 . GLN B 1 160 ? 31.836  -7.058  69.793  1.00 19.78 ? 164 GLN B NE2 1 
ATOM   3302 N N   . LYS B 1 161 ? 30.886  -1.294  70.478  1.00 15.89 ? 165 LYS B N   1 
ATOM   3303 C CA  . LYS B 1 161 ? 30.843  0.154   70.692  1.00 15.72 ? 165 LYS B CA  1 
ATOM   3304 C C   . LYS B 1 161 ? 32.228  0.784   70.537  1.00 15.50 ? 165 LYS B C   1 
ATOM   3305 O O   . LYS B 1 161 ? 33.248  0.129   70.760  1.00 15.45 ? 165 LYS B O   1 
ATOM   3306 C CB  . LYS B 1 161 ? 30.254  0.485   72.065  1.00 15.80 ? 165 LYS B CB  1 
ATOM   3307 C CG  . LYS B 1 161 ? 28.752  0.295   72.148  1.00 15.98 ? 165 LYS B CG  1 
ATOM   3308 C CD  . LYS B 1 161 ? 28.186  0.930   73.400  1.00 16.45 ? 165 LYS B CD  1 
ATOM   3309 C CE  . LYS B 1 161 ? 26.712  0.603   73.541  1.00 17.11 ? 165 LYS B CE  1 
ATOM   3310 N NZ  . LYS B 1 161 ? 26.070  1.398   74.623  1.00 17.72 ? 165 LYS B NZ  1 
ATOM   3311 N N   . VAL B 1 162 ? 32.245  2.059   70.152  1.00 15.34 ? 166 VAL B N   1 
ATOM   3312 C CA  . VAL B 1 162 ? 33.484  2.805   69.897  1.00 15.15 ? 166 VAL B CA  1 
ATOM   3313 C C   . VAL B 1 162 ? 33.594  4.062   70.786  1.00 15.43 ? 166 VAL B C   1 
ATOM   3314 O O   . VAL B 1 162 ? 32.585  4.545   71.319  1.00 15.31 ? 166 VAL B O   1 
ATOM   3315 C CB  . VAL B 1 162 ? 33.630  3.191   68.379  1.00 15.08 ? 166 VAL B CB  1 
ATOM   3316 C CG1 . VAL B 1 162 ? 33.639  1.952   67.482  1.00 14.03 ? 166 VAL B CG1 1 
ATOM   3317 C CG2 . VAL B 1 162 ? 32.550  4.183   67.942  1.00 14.38 ? 166 VAL B CG2 1 
ATOM   3318 N N   . LYS B 1 163 ? 34.813  4.586   70.940  1.00 15.68 ? 167 LYS B N   1 
ATOM   3319 C CA  . LYS B 1 163 ? 35.043  5.794   71.750  1.00 16.01 ? 167 LYS B CA  1 
ATOM   3320 C C   . LYS B 1 163 ? 35.154  7.075   70.909  1.00 16.03 ? 167 LYS B C   1 
ATOM   3321 O O   . LYS B 1 163 ? 36.236  7.662   70.789  1.00 16.21 ? 167 LYS B O   1 
ATOM   3322 C CB  . LYS B 1 163 ? 36.279  5.637   72.664  1.00 16.04 ? 167 LYS B CB  1 
ATOM   3323 C CG  . LYS B 1 163 ? 36.204  4.495   73.685  1.00 16.64 ? 167 LYS B CG  1 
ATOM   3324 C CD  . LYS B 1 163 ? 34.905  4.535   74.486  1.00 17.48 ? 167 LYS B CD  1 
ATOM   3325 C CE  . LYS B 1 163 ? 34.167  3.201   74.379  1.00 17.95 ? 167 LYS B CE  1 
ATOM   3326 N NZ  . LYS B 1 163 ? 32.676  3.357   74.352  1.00 17.29 ? 167 LYS B NZ  1 
ATOM   3327 N N   . GLY B 1 164 ? 34.033  7.502   70.331  1.00 15.95 ? 168 GLY B N   1 
ATOM   3328 C CA  . GLY B 1 164 ? 33.955  8.797   69.646  1.00 15.82 ? 168 GLY B CA  1 
ATOM   3329 C C   . GLY B 1 164 ? 34.584  8.862   68.267  1.00 15.73 ? 168 GLY B C   1 
ATOM   3330 O O   . GLY B 1 164 ? 34.915  9.951   67.784  1.00 15.73 ? 168 GLY B O   1 
ATOM   3331 N N   . ASP B 1 165 ? 34.741  7.699   67.634  1.00 15.64 ? 169 ASP B N   1 
ATOM   3332 C CA  . ASP B 1 165 ? 35.259  7.595   66.266  1.00 15.66 ? 169 ASP B CA  1 
ATOM   3333 C C   . ASP B 1 165 ? 34.499  8.464   65.273  1.00 15.57 ? 169 ASP B C   1 
ATOM   3334 O O   . ASP B 1 165 ? 33.270  8.561   65.331  1.00 15.60 ? 169 ASP B O   1 
ATOM   3335 C CB  . ASP B 1 165 ? 35.216  6.145   65.790  1.00 15.74 ? 169 ASP B CB  1 
ATOM   3336 C CG  . ASP B 1 165 ? 36.300  5.304   66.404  1.00 16.30 ? 169 ASP B CG  1 
ATOM   3337 O OD1 . ASP B 1 165 ? 36.430  5.292   67.652  1.00 16.87 ? 169 ASP B OD1 1 
ATOM   3338 O OD2 . ASP B 1 165 ? 37.074  4.618   65.710  1.00 17.08 ? 169 ASP B OD2 1 
ATOM   3339 N N   . LYS B 1 166 ? 35.236  9.074   64.350  1.00 15.34 ? 170 LYS B N   1 
ATOM   3340 C CA  . LYS B 1 166 ? 34.643  9.972   63.360  1.00 15.21 ? 170 LYS B CA  1 
ATOM   3341 C C   . LYS B 1 166 ? 34.096  9.248   62.120  1.00 14.72 ? 170 LYS B C   1 
ATOM   3342 O O   . LYS B 1 166 ? 34.716  8.326   61.596  1.00 14.39 ? 170 LYS B O   1 
ATOM   3343 C CB  . LYS B 1 166 ? 35.644  11.075  62.983  1.00 15.24 ? 170 LYS B CB  1 
ATOM   3344 C CG  . LYS B 1 166 ? 35.978  11.988  64.155  1.00 15.48 ? 170 LYS B CG  1 
ATOM   3345 C CD  . LYS B 1 166 ? 37.027  13.032  63.835  1.00 15.54 ? 170 LYS B CD  1 
ATOM   3346 C CE  . LYS B 1 166 ? 37.163  13.975  65.018  1.00 16.45 ? 170 LYS B CE  1 
ATOM   3347 N NZ  . LYS B 1 166 ? 38.343  14.865  64.932  1.00 17.44 ? 170 LYS B NZ  1 
ATOM   3348 N N   . ILE B 1 167 ? 32.915  9.659   61.674  1.00 14.49 ? 171 ILE B N   1 
ATOM   3349 C CA  . ILE B 1 167 ? 32.331  9.106   60.446  1.00 14.56 ? 171 ILE B CA  1 
ATOM   3350 C C   . ILE B 1 167 ? 31.554  10.145  59.633  1.00 14.45 ? 171 ILE B C   1 
ATOM   3351 O O   . ILE B 1 167 ? 30.759  10.912  60.171  1.00 14.35 ? 171 ILE B O   1 
ATOM   3352 C CB  . ILE B 1 167 ? 31.485  7.808   60.715  1.00 14.59 ? 171 ILE B CB  1 
ATOM   3353 C CG1 . ILE B 1 167 ? 30.914  7.245   59.399  1.00 14.09 ? 171 ILE B CG1 1 
ATOM   3354 C CG2 . ILE B 1 167 ? 30.393  8.053   61.765  1.00 14.64 ? 171 ILE B CG2 1 
ATOM   3355 C CD1 . ILE B 1 167 ? 30.909  5.737   59.316  1.00 13.22 ? 171 ILE B CD1 1 
ATOM   3356 N N   . ASN B 1 168 ? 31.813  10.157  58.332  1.00 14.47 ? 172 ASN B N   1 
ATOM   3357 C CA  . ASN B 1 168 ? 31.208  11.114  57.430  1.00 14.81 ? 172 ASN B CA  1 
ATOM   3358 C C   . ASN B 1 168 ? 30.227  10.437  56.479  1.00 14.90 ? 172 ASN B C   1 
ATOM   3359 O O   . ASN B 1 168 ? 30.637  9.736   55.552  1.00 15.11 ? 172 ASN B O   1 
ATOM   3360 C CB  . ASN B 1 168 ? 32.303  11.832  56.636  1.00 14.79 ? 172 ASN B CB  1 
ATOM   3361 C CG  . ASN B 1 168 ? 31.787  13.057  55.882  1.00 15.00 ? 172 ASN B CG  1 
ATOM   3362 O OD1 . ASN B 1 168 ? 32.573  13.911  55.478  1.00 15.51 ? 172 ASN B OD1 1 
ATOM   3363 N ND2 . ASN B 1 168 ? 30.473  13.146  55.691  1.00 14.77 ? 172 ASN B ND2 1 
ATOM   3364 N N   . LEU B 1 169 ? 28.933  10.642  56.706  1.00 15.00 ? 173 LEU B N   1 
ATOM   3365 C CA  . LEU B 1 169 ? 27.916  10.074  55.816  1.00 15.24 ? 173 LEU B CA  1 
ATOM   3366 C C   . LEU B 1 169 ? 27.449  11.103  54.800  1.00 15.37 ? 173 LEU B C   1 
ATOM   3367 O O   . LEU B 1 169 ? 26.913  12.148  55.167  1.00 15.43 ? 173 LEU B O   1 
ATOM   3368 C CB  . LEU B 1 169 ? 26.719  9.514   56.599  1.00 15.14 ? 173 LEU B CB  1 
ATOM   3369 C CG  . LEU B 1 169 ? 26.947  8.408   57.640  1.00 14.89 ? 173 LEU B CG  1 
ATOM   3370 C CD1 . LEU B 1 169 ? 25.657  8.133   58.383  1.00 14.90 ? 173 LEU B CD1 1 
ATOM   3371 C CD2 . LEU B 1 169 ? 27.489  7.120   57.022  1.00 14.15 ? 173 LEU B CD2 1 
ATOM   3372 N N   . ALA B 1 170 ? 27.677  10.810  53.525  1.00 15.53 ? 174 ALA B N   1 
ATOM   3373 C CA  . ALA B 1 170 ? 27.192  11.664  52.447  1.00 15.71 ? 174 ALA B CA  1 
ATOM   3374 C C   . ALA B 1 170 ? 25.782  11.242  52.041  1.00 15.88 ? 174 ALA B C   1 
ATOM   3375 O O   . ALA B 1 170 ? 25.509  10.053  51.840  1.00 15.91 ? 174 ALA B O   1 
ATOM   3376 C CB  . ALA B 1 170 ? 28.131  11.614  51.250  1.00 15.64 ? 174 ALA B CB  1 
ATOM   3377 N N   . TYR B 1 171 ? 24.887  12.219  51.934  1.00 15.97 ? 175 TYR B N   1 
ATOM   3378 C CA  . TYR B 1 171 ? 23.531  11.959  51.472  1.00 16.03 ? 175 TYR B CA  1 
ATOM   3379 C C   . TYR B 1 171 ? 23.085  12.948  50.404  1.00 16.04 ? 175 TYR B C   1 
ATOM   3380 O O   . TYR B 1 171 ? 23.496  14.115  50.400  1.00 15.99 ? 175 TYR B O   1 
ATOM   3381 C CB  . TYR B 1 171 ? 22.540  11.959  52.642  1.00 16.18 ? 175 TYR B CB  1 
ATOM   3382 C CG  . TYR B 1 171 ? 22.284  13.310  53.288  1.00 16.20 ? 175 TYR B CG  1 
ATOM   3383 C CD1 . TYR B 1 171 ? 21.122  14.030  53.005  1.00 16.03 ? 175 TYR B CD1 1 
ATOM   3384 C CD2 . TYR B 1 171 ? 23.192  13.855  54.199  1.00 16.13 ? 175 TYR B CD2 1 
ATOM   3385 C CE1 . TYR B 1 171 ? 20.873  15.269  53.604  1.00 16.25 ? 175 TYR B CE1 1 
ATOM   3386 C CE2 . TYR B 1 171 ? 22.956  15.087  54.801  1.00 16.08 ? 175 TYR B CE2 1 
ATOM   3387 C CZ  . TYR B 1 171 ? 21.795  15.786  54.502  1.00 16.54 ? 175 TYR B CZ  1 
ATOM   3388 O OH  . TYR B 1 171 ? 21.566  17.003  55.096  1.00 16.79 ? 175 TYR B OH  1 
ATOM   3389 N N   . VAL B 1 172 ? 22.249  12.458  49.496  1.00 16.02 ? 176 VAL B N   1 
ATOM   3390 C CA  . VAL B 1 172 ? 21.517  13.311  48.579  1.00 16.23 ? 176 VAL B CA  1 
ATOM   3391 C C   . VAL B 1 172 ? 20.146  13.633  49.214  1.00 16.39 ? 176 VAL B C   1 
ATOM   3392 O O   . VAL B 1 172 ? 19.490  12.757  49.789  1.00 16.27 ? 176 VAL B O   1 
ATOM   3393 C CB  . VAL B 1 172 ? 21.399  12.645  47.179  1.00 16.41 ? 176 VAL B CB  1 
ATOM   3394 C CG1 . VAL B 1 172 ? 20.619  13.527  46.181  1.00 15.94 ? 176 VAL B CG1 1 
ATOM   3395 C CG2 . VAL B 1 172 ? 22.796  12.320  46.637  1.00 16.17 ? 176 VAL B CG2 1 
ATOM   3396 N N   . ALA B 1 173 ? 19.728  14.894  49.115  1.00 16.45 ? 177 ALA B N   1 
ATOM   3397 C CA  . ALA B 1 173 ? 18.552  15.389  49.834  1.00 16.47 ? 177 ALA B CA  1 
ATOM   3398 C C   . ALA B 1 173 ? 17.167  15.043  49.249  1.00 16.64 ? 177 ALA B C   1 
ATOM   3399 O O   . ALA B 1 173 ? 16.271  15.891  49.249  1.00 16.60 ? 177 ALA B O   1 
ATOM   3400 C CB  . ALA B 1 173 ? 18.672  16.882  50.037  1.00 16.45 ? 177 ALA B CB  1 
ATOM   3401 N N   . TRP B 1 174 ? 16.989  13.811  48.763  1.00 16.75 ? 178 TRP B N   1 
ATOM   3402 C CA  . TRP B 1 174 ? 15.647  13.283  48.486  1.00 16.86 ? 178 TRP B CA  1 
ATOM   3403 C C   . TRP B 1 174 ? 15.085  12.775  49.802  1.00 16.85 ? 178 TRP B C   1 
ATOM   3404 O O   . TRP B 1 174 ? 15.836  12.307  50.658  1.00 17.16 ? 178 TRP B O   1 
ATOM   3405 C CB  . TRP B 1 174 ? 15.670  12.137  47.468  1.00 17.02 ? 178 TRP B CB  1 
ATOM   3406 C CG  . TRP B 1 174 ? 16.392  12.451  46.192  1.00 17.51 ? 178 TRP B CG  1 
ATOM   3407 C CD1 . TRP B 1 174 ? 17.615  11.980  45.812  1.00 17.98 ? 178 TRP B CD1 1 
ATOM   3408 C CD2 . TRP B 1 174 ? 15.950  13.313  45.132  1.00 17.63 ? 178 TRP B CD2 1 
ATOM   3409 N NE1 . TRP B 1 174 ? 17.959  12.488  44.582  1.00 18.02 ? 178 TRP B NE1 1 
ATOM   3410 C CE2 . TRP B 1 174 ? 16.958  13.312  44.141  1.00 17.46 ? 178 TRP B CE2 1 
ATOM   3411 C CE3 . TRP B 1 174 ? 14.805  14.089  44.917  1.00 17.91 ? 178 TRP B CE3 1 
ATOM   3412 C CZ2 . TRP B 1 174 ? 16.852  14.049  42.953  1.00 16.88 ? 178 TRP B CZ2 1 
ATOM   3413 C CZ3 . TRP B 1 174 ? 14.704  14.823  43.731  1.00 17.70 ? 178 TRP B CZ3 1 
ATOM   3414 C CH2 . TRP B 1 174 ? 15.720  14.789  42.769  1.00 17.38 ? 178 TRP B CH2 1 
ATOM   3415 N N   . ASP B 1 175 ? 13.767  12.863  49.961  1.00 16.98 ? 179 ASP B N   1 
ATOM   3416 C CA  . ASP B 1 175 ? 13.088  12.551  51.235  1.00 16.83 ? 179 ASP B CA  1 
ATOM   3417 C C   . ASP B 1 175 ? 13.342  11.134  51.738  1.00 16.65 ? 179 ASP B C   1 
ATOM   3418 O O   . ASP B 1 175 ? 13.382  10.895  52.950  1.00 16.63 ? 179 ASP B O   1 
ATOM   3419 C CB  . ASP B 1 175 ? 11.579  12.805  51.124  1.00 16.86 ? 179 ASP B CB  1 
ATOM   3420 C CG  . ASP B 1 175 ? 11.227  14.288  51.122  1.00 16.69 ? 179 ASP B CG  1 
ATOM   3421 O OD1 . ASP B 1 175 ? 10.219  14.634  50.478  1.00 17.06 ? 179 ASP B OD1 1 
ATOM   3422 O OD2 . ASP B 1 175 ? 11.883  15.174  51.719  1.00 15.24 ? 179 ASP B OD2 1 
ATOM   3423 N N   . SER B 1 176 ? 13.506  10.207  50.797  1.00 16.37 ? 180 SER B N   1 
ATOM   3424 C CA  . SER B 1 176 ? 13.825  8.823   51.107  1.00 16.24 ? 180 SER B CA  1 
ATOM   3425 C C   . SER B 1 176 ? 15.168  8.725   51.831  1.00 16.33 ? 180 SER B C   1 
ATOM   3426 O O   . SER B 1 176 ? 15.292  8.033   52.851  1.00 16.48 ? 180 SER B O   1 
ATOM   3427 C CB  . SER B 1 176 ? 13.850  7.994   49.822  1.00 16.16 ? 180 SER B CB  1 
ATOM   3428 O OG  . SER B 1 176 ? 14.462  8.710   48.766  1.00 16.08 ? 180 SER B OG  1 
ATOM   3429 N N   . GLU B 1 177 ? 16.160  9.440   51.304  1.00 16.09 ? 181 GLU B N   1 
ATOM   3430 C CA  . GLU B 1 177 ? 17.524  9.371   51.810  1.00 15.81 ? 181 GLU B CA  1 
ATOM   3431 C C   . GLU B 1 177 ? 17.746  10.259  53.028  1.00 15.52 ? 181 GLU B C   1 
ATOM   3432 O O   . GLU B 1 177 ? 18.715  10.066  53.764  1.00 15.37 ? 181 GLU B O   1 
ATOM   3433 C CB  . GLU B 1 177 ? 18.524  9.675   50.697  1.00 15.81 ? 181 GLU B CB  1 
ATOM   3434 C CG  . GLU B 1 177 ? 18.788  8.493   49.778  1.00 16.90 ? 181 GLU B CG  1 
ATOM   3435 C CD  . GLU B 1 177 ? 17.539  7.960   49.084  1.00 18.53 ? 181 GLU B CD  1 
ATOM   3436 O OE1 . GLU B 1 177 ? 16.892  8.721   48.325  1.00 19.20 ? 181 GLU B OE1 1 
ATOM   3437 O OE2 . GLU B 1 177 ? 17.217  6.767   49.287  1.00 18.38 ? 181 GLU B OE2 1 
ATOM   3438 N N   . ILE B 1 178 ? 16.852  11.225  53.242  1.00 15.25 ? 182 ILE B N   1 
ATOM   3439 C CA  . ILE B 1 178 ? 16.811  11.940  54.520  1.00 15.31 ? 182 ILE B CA  1 
ATOM   3440 C C   . ILE B 1 178 ? 16.339  10.963  55.605  1.00 15.44 ? 182 ILE B C   1 
ATOM   3441 O O   . ILE B 1 178 ? 16.798  11.021  56.755  1.00 15.70 ? 182 ILE B O   1 
ATOM   3442 C CB  . ILE B 1 178 ? 15.888  13.188  54.468  1.00 15.21 ? 182 ILE B CB  1 
ATOM   3443 C CG1 . ILE B 1 178 ? 16.386  14.187  53.420  1.00 15.40 ? 182 ILE B CG1 1 
ATOM   3444 C CG2 . ILE B 1 178 ? 15.818  13.856  55.844  1.00 14.75 ? 182 ILE B CG2 1 
ATOM   3445 C CD1 . ILE B 1 178 ? 15.613  15.496  53.368  1.00 15.27 ? 182 ILE B CD1 1 
ATOM   3446 N N   . ALA B 1 179 ? 15.434  10.062  55.227  1.00 15.19 ? 183 ALA B N   1 
ATOM   3447 C CA  . ALA B 1 179 ? 14.947  9.044   56.135  1.00 14.87 ? 183 ALA B CA  1 
ATOM   3448 C C   . ALA B 1 179 ? 16.095  8.148   56.570  1.00 14.80 ? 183 ALA B C   1 
ATOM   3449 O O   . ALA B 1 179 ? 16.470  8.134   57.747  1.00 14.65 ? 183 ALA B O   1 
ATOM   3450 C CB  . ALA B 1 179 ? 13.849  8.233   55.475  1.00 14.81 ? 183 ALA B CB  1 
ATOM   3451 N N   . SER B 1 180 ? 16.673  7.441   55.601  1.00 14.74 ? 184 SER B N   1 
ATOM   3452 C CA  . SER B 1 180 ? 17.692  6.419   55.847  1.00 14.84 ? 184 SER B CA  1 
ATOM   3453 C C   . SER B 1 180 ? 18.970  6.952   56.493  1.00 14.97 ? 184 SER B C   1 
ATOM   3454 O O   . SER B 1 180 ? 19.502  6.376   57.449  1.00 14.75 ? 184 SER B O   1 
ATOM   3455 C CB  . SER B 1 180 ? 18.041  5.718   54.539  1.00 14.77 ? 184 SER B CB  1 
ATOM   3456 O OG  . SER B 1 180 ? 18.348  6.671   53.541  1.00 15.11 ? 184 SER B OG  1 
ATOM   3457 N N   . THR B 1 181 ? 19.468  8.058   55.962  1.00 15.28 ? 185 THR B N   1 
ATOM   3458 C CA  . THR B 1 181 ? 20.725  8.597   56.436  1.00 15.48 ? 185 THR B CA  1 
ATOM   3459 C C   . THR B 1 181 ? 20.618  9.005   57.905  1.00 15.79 ? 185 THR B C   1 
ATOM   3460 O O   . THR B 1 181 ? 21.558  8.798   58.680  1.00 15.94 ? 185 THR B O   1 
ATOM   3461 C CB  . THR B 1 181 ? 21.195  9.761   55.546  1.00 15.48 ? 185 THR B CB  1 
ATOM   3462 O OG1 . THR B 1 181 ? 21.065  9.396   54.162  1.00 14.92 ? 185 THR B OG1 1 
ATOM   3463 C CG2 . THR B 1 181 ? 22.695  9.970   55.708  1.00 15.53 ? 185 THR B CG2 1 
ATOM   3464 N N   . ASN B 1 182 ? 19.467  9.550   58.294  1.00 15.88 ? 186 ASN B N   1 
ATOM   3465 C CA  . ASN B 1 182 ? 19.263  9.951   59.686  1.00 16.03 ? 186 ASN B CA  1 
ATOM   3466 C C   . ASN B 1 182 ? 19.100  8.793   60.653  1.00 15.86 ? 186 ASN B C   1 
ATOM   3467 O O   . ASN B 1 182 ? 19.652  8.825   61.758  1.00 15.88 ? 186 ASN B O   1 
ATOM   3468 C CB  . ASN B 1 182 ? 18.089  10.919  59.816  1.00 16.18 ? 186 ASN B CB  1 
ATOM   3469 C CG  . ASN B 1 182 ? 18.438  12.304  59.336  1.00 16.94 ? 186 ASN B CG  1 
ATOM   3470 O OD1 . ASN B 1 182 ? 18.821  12.490  58.183  1.00 18.26 ? 186 ASN B OD1 1 
ATOM   3471 N ND2 . ASN B 1 182 ? 18.320  13.287  60.223  1.00 17.47 ? 186 ASN B ND2 1 
ATOM   3472 N N   . VAL B 1 183 ? 18.340  7.777   60.240  1.00 15.57 ? 187 VAL B N   1 
ATOM   3473 C CA  . VAL B 1 183 ? 18.100  6.625   61.102  1.00 15.18 ? 187 VAL B CA  1 
ATOM   3474 C C   . VAL B 1 183 ? 19.429  5.925   61.385  1.00 15.02 ? 187 VAL B C   1 
ATOM   3475 O O   . VAL B 1 183 ? 19.760  5.664   62.539  1.00 15.09 ? 187 VAL B O   1 
ATOM   3476 C CB  . VAL B 1 183 ? 16.967  5.670   60.573  1.00 15.07 ? 187 VAL B CB  1 
ATOM   3477 C CG1 . VAL B 1 183 ? 17.299  5.042   59.226  1.00 14.99 ? 187 VAL B CG1 1 
ATOM   3478 C CG2 . VAL B 1 183 ? 16.664  4.592   61.590  1.00 15.05 ? 187 VAL B CG2 1 
ATOM   3479 N N   . ILE B 1 184 ? 20.205  5.682   60.334  1.00 14.88 ? 188 ILE B N   1 
ATOM   3480 C CA  . ILE B 1 184 ? 21.532  5.080   60.475  1.00 14.82 ? 188 ILE B CA  1 
ATOM   3481 C C   . ILE B 1 184 ? 22.484  6.002   61.231  1.00 14.72 ? 188 ILE B C   1 
ATOM   3482 O O   . ILE B 1 184 ? 23.224  5.547   62.099  1.00 14.71 ? 188 ILE B O   1 
ATOM   3483 C CB  . ILE B 1 184 ? 22.098  4.659   59.083  1.00 14.81 ? 188 ILE B CB  1 
ATOM   3484 C CG1 . ILE B 1 184 ? 21.567  3.268   58.697  1.00 14.68 ? 188 ILE B CG1 1 
ATOM   3485 C CG2 . ILE B 1 184 ? 23.635  4.695   59.053  1.00 14.68 ? 188 ILE B CG2 1 
ATOM   3486 C CD1 . ILE B 1 184 ? 21.772  2.179   59.774  1.00 14.49 ? 188 ILE B CD1 1 
ATOM   3487 N N   . GLY B 1 185 ? 22.436  7.291   60.904  1.00 14.64 ? 189 GLY B N   1 
ATOM   3488 C CA  . GLY B 1 185 ? 23.186  8.310   61.623  1.00 14.60 ? 189 GLY B CA  1 
ATOM   3489 C C   . GLY B 1 185 ? 22.961  8.224   63.121  1.00 14.65 ? 189 GLY B C   1 
ATOM   3490 O O   . GLY B 1 185 ? 23.914  8.285   63.902  1.00 14.60 ? 189 GLY B O   1 
ATOM   3491 N N   . LYS B 1 186 ? 21.698  8.056   63.513  1.00 14.60 ? 190 LYS B N   1 
ATOM   3492 C CA  . LYS B 1 186 ? 21.325  7.960   64.922  1.00 14.65 ? 190 LYS B CA  1 
ATOM   3493 C C   . LYS B 1 186 ? 21.867  6.676   65.542  1.00 14.64 ? 190 LYS B C   1 
ATOM   3494 O O   . LYS B 1 186 ? 22.374  6.696   66.668  1.00 14.66 ? 190 LYS B O   1 
ATOM   3495 C CB  . LYS B 1 186 ? 19.800  8.020   65.093  1.00 14.73 ? 190 LYS B CB  1 
ATOM   3496 C CG  . LYS B 1 186 ? 19.310  8.920   66.239  1.00 14.78 ? 190 LYS B CG  1 
ATOM   3497 C CD  . LYS B 1 186 ? 19.626  8.389   67.639  1.00 14.77 ? 190 LYS B CD  1 
ATOM   3498 C CE  . LYS B 1 186 ? 19.215  9.409   68.698  1.00 14.96 ? 190 LYS B CE  1 
ATOM   3499 N NZ  . LYS B 1 186 ? 19.762  9.126   70.060  1.00 14.63 ? 190 LYS B NZ  1 
ATOM   3500 N N   . VAL B 1 187 ? 21.765  5.569   64.804  1.00 14.51 ? 191 VAL B N   1 
ATOM   3501 C CA  . VAL B 1 187 ? 22.248  4.275   65.287  1.00 14.43 ? 191 VAL B CA  1 
ATOM   3502 C C   . VAL B 1 187 ? 23.741  4.363   65.618  1.00 14.65 ? 191 VAL B C   1 
ATOM   3503 O O   . VAL B 1 187 ? 24.182  3.895   66.672  1.00 14.66 ? 191 VAL B O   1 
ATOM   3504 C CB  . VAL B 1 187 ? 21.960  3.135   64.286  1.00 14.29 ? 191 VAL B CB  1 
ATOM   3505 C CG1 . VAL B 1 187 ? 22.494  1.808   64.799  1.00 13.84 ? 191 VAL B CG1 1 
ATOM   3506 C CG2 . VAL B 1 187 ? 20.470  3.014   64.031  1.00 14.30 ? 191 VAL B CG2 1 
ATOM   3507 N N   . LEU B 1 188 ? 24.499  4.994   64.725  1.00 14.71 ? 192 LEU B N   1 
ATOM   3508 C CA  . LEU B 1 188 ? 25.926  5.206   64.918  1.00 14.85 ? 192 LEU B CA  1 
ATOM   3509 C C   . LEU B 1 188 ? 26.218  6.105   66.119  1.00 15.05 ? 192 LEU B C   1 
ATOM   3510 O O   . LEU B 1 188 ? 27.186  5.879   66.850  1.00 14.91 ? 192 LEU B O   1 
ATOM   3511 C CB  . LEU B 1 188 ? 26.543  5.786   63.651  1.00 14.68 ? 192 LEU B CB  1 
ATOM   3512 C CG  . LEU B 1 188 ? 26.712  4.783   62.511  1.00 15.04 ? 192 LEU B CG  1 
ATOM   3513 C CD1 . LEU B 1 188 ? 26.683  5.483   61.173  1.00 15.47 ? 192 LEU B CD1 1 
ATOM   3514 C CD2 . LEU B 1 188 ? 27.994  3.967   62.661  1.00 15.35 ? 192 LEU B CD2 1 
ATOM   3515 N N   . GLU B 1 189 ? 25.374  7.117   66.319  1.00 15.19 ? 193 GLU B N   1 
ATOM   3516 C CA  . GLU B 1 189 ? 25.509  8.020   67.456  1.00 15.32 ? 193 GLU B CA  1 
ATOM   3517 C C   . GLU B 1 189 ? 25.227  7.309   68.774  1.00 15.63 ? 193 GLU B C   1 
ATOM   3518 O O   . GLU B 1 189 ? 25.917  7.543   69.779  1.00 15.58 ? 193 GLU B O   1 
ATOM   3519 C CB  . GLU B 1 189 ? 24.589  9.221   67.297  1.00 15.16 ? 193 GLU B CB  1 
ATOM   3520 C CG  . GLU B 1 189 ? 25.145  10.275  66.366  1.00 15.00 ? 193 GLU B CG  1 
ATOM   3521 C CD  . GLU B 1 189 ? 24.226  11.466  66.221  1.00 15.24 ? 193 GLU B CD  1 
ATOM   3522 O OE1 . GLU B 1 189 ? 23.023  11.269  65.928  1.00 15.91 ? 193 GLU B OE1 1 
ATOM   3523 O OE2 . GLU B 1 189 ? 24.711  12.603  66.393  1.00 15.26 ? 193 GLU B OE2 1 
ATOM   3524 N N   . ASP B 1 190 ? 24.218  6.435   68.758  1.00 15.86 ? 194 ASP B N   1 
ATOM   3525 C CA  . ASP B 1 190 ? 23.900  5.587   69.908  1.00 16.01 ? 194 ASP B CA  1 
ATOM   3526 C C   . ASP B 1 190 ? 25.041  4.609   70.193  1.00 16.08 ? 194 ASP B C   1 
ATOM   3527 O O   . ASP B 1 190 ? 25.189  4.121   71.315  1.00 16.23 ? 194 ASP B O   1 
ATOM   3528 C CB  . ASP B 1 190 ? 22.578  4.834   69.688  1.00 15.92 ? 194 ASP B CB  1 
ATOM   3529 C CG  . ASP B 1 190 ? 21.343  5.723   69.898  1.00 16.18 ? 194 ASP B CG  1 
ATOM   3530 O OD1 . ASP B 1 190 ? 21.488  6.864   70.399  1.00 16.25 ? 194 ASP B OD1 1 
ATOM   3531 O OD2 . ASP B 1 190 ? 20.182  5.360   69.592  1.00 16.15 ? 194 ASP B OD2 1 
ATOM   3532 N N   . LEU B 1 191 ? 25.855  4.358   69.172  1.00 16.09 ? 195 LEU B N   1 
ATOM   3533 C CA  . LEU B 1 191 ? 26.961  3.416   69.251  1.00 16.26 ? 195 LEU B CA  1 
ATOM   3534 C C   . LEU B 1 191 ? 28.261  4.086   69.747  1.00 16.31 ? 195 LEU B C   1 
ATOM   3535 O O   . LEU B 1 191 ? 29.269  3.411   70.005  1.00 16.24 ? 195 LEU B O   1 
ATOM   3536 C CB  . LEU B 1 191 ? 27.158  2.767   67.878  1.00 16.22 ? 195 LEU B CB  1 
ATOM   3537 C CG  . LEU B 1 191 ? 27.141  1.243   67.708  1.00 16.58 ? 195 LEU B CG  1 
ATOM   3538 C CD1 . LEU B 1 191 ? 26.222  0.519   68.703  1.00 16.08 ? 195 LEU B CD1 1 
ATOM   3539 C CD2 . LEU B 1 191 ? 26.740  0.908   66.271  1.00 16.40 ? 195 LEU B CD2 1 
ATOM   3540 N N   . GLY B 1 192 ? 28.220  5.412   69.888  1.00 16.24 ? 196 GLY B N   1 
ATOM   3541 C CA  . GLY B 1 192 ? 29.369  6.195   70.349  1.00 15.89 ? 196 GLY B CA  1 
ATOM   3542 C C   . GLY B 1 192 ? 30.241  6.768   69.242  1.00 15.63 ? 196 GLY B C   1 
ATOM   3543 O O   . GLY B 1 192 ? 31.413  7.043   69.466  1.00 15.56 ? 196 GLY B O   1 
ATOM   3544 N N   . TYR B 1 193 ? 29.670  6.946   68.051  1.00 15.44 ? 197 TYR B N   1 
ATOM   3545 C CA  . TYR B 1 193 ? 30.387  7.504   66.897  1.00 15.16 ? 197 TYR B CA  1 
ATOM   3546 C C   . TYR B 1 193 ? 30.173  9.013   66.803  1.00 15.05 ? 197 TYR B C   1 
ATOM   3547 O O   . TYR B 1 193 ? 29.101  9.512   67.150  1.00 15.13 ? 197 TYR B O   1 
ATOM   3548 C CB  . TYR B 1 193 ? 29.906  6.854   65.585  1.00 15.03 ? 197 TYR B CB  1 
ATOM   3549 C CG  . TYR B 1 193 ? 30.550  5.521   65.243  1.00 14.85 ? 197 TYR B CG  1 
ATOM   3550 C CD1 . TYR B 1 193 ? 29.937  4.316   65.585  1.00 14.58 ? 197 TYR B CD1 1 
ATOM   3551 C CD2 . TYR B 1 193 ? 31.770  5.467   64.563  1.00 14.54 ? 197 TYR B CD2 1 
ATOM   3552 C CE1 . TYR B 1 193 ? 30.530  3.089   65.269  1.00 14.24 ? 197 TYR B CE1 1 
ATOM   3553 C CE2 . TYR B 1 193 ? 32.369  4.247   64.246  1.00 14.32 ? 197 TYR B CE2 1 
ATOM   3554 C CZ  . TYR B 1 193 ? 31.747  3.064   64.603  1.00 14.37 ? 197 TYR B CZ  1 
ATOM   3555 O OH  . TYR B 1 193 ? 32.342  1.858   64.290  1.00 14.32 ? 197 TYR B OH  1 
ATOM   3556 N N   . GLU B 1 194 ? 31.191  9.734   66.333  1.00 14.86 ? 198 GLU B N   1 
ATOM   3557 C CA  . GLU B 1 194 ? 31.047  11.150  65.995  1.00 14.73 ? 198 GLU B CA  1 
ATOM   3558 C C   . GLU B 1 194 ? 30.634  11.261  64.534  1.00 14.56 ? 198 GLU B C   1 
ATOM   3559 O O   . GLU B 1 194 ? 31.464  11.133  63.626  1.00 14.47 ? 198 GLU B O   1 
ATOM   3560 C CB  . GLU B 1 194 ? 32.345  11.920  66.242  1.00 14.83 ? 198 GLU B CB  1 
ATOM   3561 C CG  . GLU B 1 194 ? 32.205  13.424  66.041  1.00 15.46 ? 198 GLU B CG  1 
ATOM   3562 C CD  . GLU B 1 194 ? 33.529  14.111  65.776  1.00 16.17 ? 198 GLU B CD  1 
ATOM   3563 O OE1 . GLU B 1 194 ? 34.292  14.329  66.739  1.00 16.80 ? 198 GLU B OE1 1 
ATOM   3564 O OE2 . GLU B 1 194 ? 33.801  14.442  64.603  1.00 16.78 ? 198 GLU B OE2 1 
ATOM   3565 N N   . VAL B 1 195 ? 29.345  11.501  64.317  1.00 14.39 ? 199 VAL B N   1 
ATOM   3566 C CA  . VAL B 1 195 ? 28.752  11.413  62.981  1.00 14.00 ? 199 VAL B CA  1 
ATOM   3567 C C   . VAL B 1 195 ? 28.559  12.784  62.332  1.00 13.98 ? 199 VAL B C   1 
ATOM   3568 O O   . VAL B 1 195 ? 27.963  13.687  62.920  1.00 13.86 ? 199 VAL B O   1 
ATOM   3569 C CB  . VAL B 1 195 ? 27.404  10.651  63.016  1.00 13.91 ? 199 VAL B CB  1 
ATOM   3570 C CG1 . VAL B 1 195 ? 26.919  10.305  61.602  1.00 13.82 ? 199 VAL B CG1 1 
ATOM   3571 C CG2 . VAL B 1 195 ? 27.527  9.393   63.860  1.00 13.82 ? 199 VAL B CG2 1 
ATOM   3572 N N   . THR B 1 196 ? 29.095  12.926  61.122  1.00 14.02 ? 200 THR B N   1 
ATOM   3573 C CA  . THR B 1 196 ? 28.821  14.064  60.256  1.00 13.95 ? 200 THR B CA  1 
ATOM   3574 C C   . THR B 1 196 ? 27.973  13.563  59.109  1.00 13.98 ? 200 THR B C   1 
ATOM   3575 O O   . THR B 1 196 ? 28.249  12.500  58.550  1.00 13.96 ? 200 THR B O   1 
ATOM   3576 C CB  . THR B 1 196 ? 30.127  14.631  59.684  1.00 14.04 ? 200 THR B CB  1 
ATOM   3577 O OG1 . THR B 1 196 ? 30.946  15.142  60.740  1.00 13.68 ? 200 THR B OG1 1 
ATOM   3578 C CG2 . THR B 1 196 ? 29.845  15.856  58.814  1.00 14.20 ? 200 THR B CG2 1 
ATOM   3579 N N   . LEU B 1 197 ? 26.939  14.322  58.767  1.00 14.19 ? 201 LEU B N   1 
ATOM   3580 C CA  . LEU B 1 197 ? 26.177  14.084  57.539  1.00 14.26 ? 201 LEU B CA  1 
ATOM   3581 C C   . LEU B 1 197 ? 26.478  15.220  56.570  1.00 14.38 ? 201 LEU B C   1 
ATOM   3582 O O   . LEU B 1 197 ? 26.226  16.390  56.873  1.00 14.52 ? 201 LEU B O   1 
ATOM   3583 C CB  . LEU B 1 197 ? 24.676  14.007  57.820  1.00 14.17 ? 201 LEU B CB  1 
ATOM   3584 C CG  . LEU B 1 197 ? 24.176  13.086  58.940  1.00 14.76 ? 201 LEU B CG  1 
ATOM   3585 C CD1 . LEU B 1 197 ? 22.806  13.528  59.427  1.00 15.29 ? 201 LEU B CD1 1 
ATOM   3586 C CD2 . LEU B 1 197 ? 24.138  11.633  58.507  1.00 15.27 ? 201 LEU B CD2 1 
ATOM   3587 N N   . THR B 1 198 ? 27.050  14.880  55.422  1.00 14.60 ? 202 THR B N   1 
ATOM   3588 C CA  . THR B 1 198 ? 27.371  15.879  54.406  1.00 14.97 ? 202 THR B CA  1 
ATOM   3589 C C   . THR B 1 198 ? 26.377  15.811  53.251  1.00 15.12 ? 202 THR B C   1 
ATOM   3590 O O   . THR B 1 198 ? 26.284  14.793  52.555  1.00 14.91 ? 202 THR B O   1 
ATOM   3591 C CB  . THR B 1 198 ? 28.822  15.702  53.905  1.00 15.04 ? 202 THR B CB  1 
ATOM   3592 O OG1 . THR B 1 198 ? 29.725  15.838  55.012  1.00 15.17 ? 202 THR B OG1 1 
ATOM   3593 C CG2 . THR B 1 198 ? 29.224  16.845  52.962  1.00 14.98 ? 202 THR B CG2 1 
ATOM   3594 N N   . GLN B 1 199 ? 25.626  16.896  53.069  1.00 15.48 ? 203 GLN B N   1 
ATOM   3595 C CA  . GLN B 1 199 ? 24.636  16.979  51.994  1.00 15.96 ? 203 GLN B CA  1 
ATOM   3596 C C   . GLN B 1 199 ? 25.312  17.379  50.690  1.00 15.79 ? 203 GLN B C   1 
ATOM   3597 O O   . GLN B 1 199 ? 26.173  18.260  50.678  1.00 15.87 ? 203 GLN B O   1 
ATOM   3598 C CB  . GLN B 1 199 ? 23.542  17.988  52.343  1.00 15.84 ? 203 GLN B CB  1 
ATOM   3599 C CG  . GLN B 1 199 ? 22.320  17.916  51.432  1.00 16.12 ? 203 GLN B CG  1 
ATOM   3600 C CD  . GLN B 1 199 ? 21.315  19.028  51.684  1.00 16.75 ? 203 GLN B CD  1 
ATOM   3601 O OE1 . GLN B 1 199 ? 20.454  19.275  50.845  1.00 18.18 ? 203 GLN B OE1 1 
ATOM   3602 N NE2 . GLN B 1 199 ? 21.417  19.699  52.834  1.00 17.60 ? 203 GLN B NE2 1 
ATOM   3603 N N   . VAL B 1 200 ? 24.926  16.715  49.605  1.00 15.70 ? 204 VAL B N   1 
ATOM   3604 C CA  . VAL B 1 200 ? 25.468  16.986  48.271  1.00 15.85 ? 204 VAL B CA  1 
ATOM   3605 C C   . VAL B 1 200 ? 24.476  16.541  47.195  1.00 15.93 ? 204 VAL B C   1 
ATOM   3606 O O   . VAL B 1 200 ? 23.537  15.795  47.474  1.00 15.96 ? 204 VAL B O   1 
ATOM   3607 C CB  . VAL B 1 200 ? 26.851  16.283  48.032  1.00 15.96 ? 204 VAL B CB  1 
ATOM   3608 C CG1 . VAL B 1 200 ? 28.021  17.182  48.443  1.00 15.77 ? 204 VAL B CG1 1 
ATOM   3609 C CG2 . VAL B 1 200 ? 26.927  14.935  48.743  1.00 15.63 ? 204 VAL B CG2 1 
ATOM   3610 N N   . GLU B 1 201 ? 24.675  17.016  45.969  1.00 16.16 ? 205 GLU B N   1 
ATOM   3611 C CA  . GLU B 1 201 ? 23.918  16.512  44.822  1.00 16.48 ? 205 GLU B CA  1 
ATOM   3612 C C   . GLU B 1 201 ? 24.456  15.126  44.488  1.00 16.75 ? 205 GLU B C   1 
ATOM   3613 O O   . GLU B 1 201 ? 25.554  14.770  44.928  1.00 16.94 ? 205 GLU B O   1 
ATOM   3614 C CB  . GLU B 1 201 ? 23.987  17.502  43.658  1.00 16.47 ? 205 GLU B CB  1 
ATOM   3615 C CG  . GLU B 1 201 ? 23.422  18.877  43.978  1.00 16.52 ? 205 GLU B CG  1 
ATOM   3616 C CD  . GLU B 1 201 ? 23.507  19.830  42.803  1.00 20.00 ? 205 GLU B CD  1 
ATOM   3617 O OE1 . GLU B 1 201 ? 24.008  19.415  41.736  1.00 20.00 ? 205 GLU B OE1 1 
ATOM   3618 O OE2 . GLU B 1 201 ? 23.073  20.992  42.948  1.00 20.00 ? 205 GLU B OE2 1 
ATOM   3619 N N   . ALA B 1 202 ? 23.697  14.338  43.726  1.00 17.04 ? 206 ALA B N   1 
ATOM   3620 C CA  . ALA B 1 202 ? 24.251  13.127  43.100  1.00 17.13 ? 206 ALA B CA  1 
ATOM   3621 C C   . ALA B 1 202 ? 25.293  13.562  42.070  1.00 17.17 ? 206 ALA B C   1 
ATOM   3622 O O   . ALA B 1 202 ? 25.053  14.473  41.262  1.00 17.50 ? 206 ALA B O   1 
ATOM   3623 C CB  . ALA B 1 202 ? 23.161  12.320  42.437  1.00 17.16 ? 206 ALA B CB  1 
ATOM   3624 N N   . GLY B 1 203 ? 26.452  12.924  42.092  1.00 16.88 ? 207 GLY B N   1 
ATOM   3625 C CA  . GLY B 1 203 ? 27.557  13.401  41.280  1.00 16.62 ? 207 GLY B CA  1 
ATOM   3626 C C   . GLY B 1 203 ? 28.614  13.840  42.257  1.00 16.59 ? 207 GLY B C   1 
ATOM   3627 O O   . GLY B 1 203 ? 29.559  13.090  42.494  1.00 16.80 ? 207 GLY B O   1 
ATOM   3628 N N   . PRO B 1 204 ? 28.473  15.042  42.833  1.00 16.44 ? 208 PRO B N   1 
ATOM   3629 C CA  . PRO B 1 204 ? 29.276  15.430  44.002  1.00 16.28 ? 208 PRO B CA  1 
ATOM   3630 C C   . PRO B 1 204 ? 29.294  14.345  45.092  1.00 16.08 ? 208 PRO B C   1 
ATOM   3631 O O   . PRO B 1 204 ? 30.337  14.127  45.722  1.00 16.22 ? 208 PRO B O   1 
ATOM   3632 C CB  . PRO B 1 204 ? 28.585  16.712  44.491  1.00 16.21 ? 208 PRO B CB  1 
ATOM   3633 C CG  . PRO B 1 204 ? 28.026  17.313  43.255  1.00 16.04 ? 208 PRO B CG  1 
ATOM   3634 C CD  . PRO B 1 204 ? 27.603  16.148  42.385  1.00 16.28 ? 208 PRO B CD  1 
ATOM   3635 N N   . MET B 1 205 ? 28.161  13.668  45.288  1.00 15.62 ? 209 MET B N   1 
ATOM   3636 C CA  . MET B 1 205 ? 28.076  12.533  46.205  1.00 15.55 ? 209 MET B CA  1 
ATOM   3637 C C   . MET B 1 205 ? 28.969  11.368  45.762  1.00 15.54 ? 209 MET B C   1 
ATOM   3638 O O   . MET B 1 205 ? 29.744  10.829  46.563  1.00 15.69 ? 209 MET B O   1 
ATOM   3639 C CB  . MET B 1 205 ? 26.621  12.071  46.364  1.00 15.49 ? 209 MET B CB  1 
ATOM   3640 C CG  . MET B 1 205 ? 26.408  10.957  47.384  1.00 15.41 ? 209 MET B CG  1 
ATOM   3641 S SD  . MET B 1 205 ? 26.502  9.299   46.667  1.00 16.66 ? 209 MET B SD  1 
ATOM   3642 C CE  . MET B 1 205 ? 24.915  9.193   45.828  1.00 17.10 ? 209 MET B CE  1 
ATOM   3643 N N   . TRP B 1 206 ? 28.846  10.985  44.493  1.00 15.37 ? 210 TRP B N   1 
ATOM   3644 C CA  . TRP B 1 206 ? 29.626  9.892   43.928  1.00 15.08 ? 210 TRP B CA  1 
ATOM   3645 C C   . TRP B 1 206 ? 31.117  10.219  43.934  1.00 14.95 ? 210 TRP B C   1 
ATOM   3646 O O   . TRP B 1 206 ? 31.945  9.367   44.273  1.00 14.85 ? 210 TRP B O   1 
ATOM   3647 C CB  . TRP B 1 206 ? 29.119  9.545   42.525  1.00 15.10 ? 210 TRP B CB  1 
ATOM   3648 C CG  . TRP B 1 206 ? 27.897  8.682   42.574  1.00 15.39 ? 210 TRP B CG  1 
ATOM   3649 C CD1 . TRP B 1 206 ? 26.587  9.097   42.558  1.00 15.56 ? 210 TRP B CD1 1 
ATOM   3650 C CD2 . TRP B 1 206 ? 27.860  7.252   42.685  1.00 15.24 ? 210 TRP B CD2 1 
ATOM   3651 N NE1 . TRP B 1 206 ? 25.744  8.010   42.638  1.00 15.48 ? 210 TRP B NE1 1 
ATOM   3652 C CE2 . TRP B 1 206 ? 26.496  6.866   42.721  1.00 15.32 ? 210 TRP B CE2 1 
ATOM   3653 C CE3 . TRP B 1 206 ? 28.842  6.252   42.754  1.00 14.68 ? 210 TRP B CE3 1 
ATOM   3654 C CZ2 . TRP B 1 206 ? 26.094  5.528   42.822  1.00 15.09 ? 210 TRP B CZ2 1 
ATOM   3655 C CZ3 . TRP B 1 206 ? 28.444  4.924   42.852  1.00 15.13 ? 210 TRP B CZ3 1 
ATOM   3656 C CH2 . TRP B 1 206 ? 27.079  4.574   42.885  1.00 15.34 ? 210 TRP B CH2 1 
ATOM   3657 N N   . THR B 1 207 ? 31.440  11.464  43.591  1.00 14.80 ? 211 THR B N   1 
ATOM   3658 C CA  . THR B 1 207 ? 32.812  11.950  43.589  1.00 14.73 ? 211 THR B CA  1 
ATOM   3659 C C   . THR B 1 207 ? 33.397  11.864  44.990  1.00 14.97 ? 211 THR B C   1 
ATOM   3660 O O   . THR B 1 207 ? 34.487  11.325  45.170  1.00 15.15 ? 211 THR B O   1 
ATOM   3661 C CB  . THR B 1 207 ? 32.865  13.401  43.082  1.00 14.71 ? 211 THR B CB  1 
ATOM   3662 O OG1 . THR B 1 207 ? 32.177  13.494  41.830  1.00 14.39 ? 211 THR B OG1 1 
ATOM   3663 C CG2 . THR B 1 207 ? 34.303  13.815  42.743  1.00 14.35 ? 211 THR B CG2 1 
ATOM   3664 N N   . ALA B 1 208 ? 32.661  12.381  45.977  1.00 15.14 ? 212 ALA B N   1 
ATOM   3665 C CA  . ALA B 1 208 ? 33.104  12.375  47.375  1.00 15.18 ? 212 ALA B CA  1 
ATOM   3666 C C   . ALA B 1 208 ? 33.487  10.971  47.852  1.00 15.23 ? 212 ALA B C   1 
ATOM   3667 O O   . ALA B 1 208 ? 34.531  10.792  48.486  1.00 15.33 ? 212 ALA B O   1 
ATOM   3668 C CB  . ALA B 1 208 ? 32.040  12.988  48.280  1.00 14.98 ? 212 ALA B CB  1 
ATOM   3669 N N   . ILE B 1 209 ? 32.650  9.987   47.521  1.00 15.22 ? 213 ILE B N   1 
ATOM   3670 C CA  . ILE B 1 209 ? 32.899  8.583   47.860  1.00 15.27 ? 213 ILE B CA  1 
ATOM   3671 C C   . ILE B 1 209 ? 34.102  8.018   47.100  1.00 15.40 ? 213 ILE B C   1 
ATOM   3672 O O   . ILE B 1 209 ? 34.988  7.397   47.699  1.00 15.54 ? 213 ILE B O   1 
ATOM   3673 C CB  . ILE B 1 209 ? 31.641  7.713   47.585  1.00 15.28 ? 213 ILE B CB  1 
ATOM   3674 C CG1 . ILE B 1 209 ? 30.460  8.133   48.475  1.00 15.21 ? 213 ILE B CG1 1 
ATOM   3675 C CG2 . ILE B 1 209 ? 31.962  6.221   47.732  1.00 15.01 ? 213 ILE B CG2 1 
ATOM   3676 C CD1 . ILE B 1 209 ? 30.588  7.763   49.959  1.00 15.23 ? 213 ILE B CD1 1 
ATOM   3677 N N   . ALA B 1 210 ? 34.128  8.240   45.786  1.00 15.32 ? 214 ALA B N   1 
ATOM   3678 C CA  . ALA B 1 210 ? 35.198  7.720   44.932  1.00 15.22 ? 214 ALA B CA  1 
ATOM   3679 C C   . ALA B 1 210 ? 36.564  8.343   45.229  1.00 15.20 ? 214 ALA B C   1 
ATOM   3680 O O   . ALA B 1 210 ? 37.599  7.711   45.001  1.00 15.02 ? 214 ALA B O   1 
ATOM   3681 C CB  . ALA B 1 210 ? 34.842  7.906   43.485  1.00 15.09 ? 214 ALA B CB  1 
ATOM   3682 N N   . THR B 1 211 ? 36.554  9.577   45.737  1.00 15.27 ? 215 THR B N   1 
ATOM   3683 C CA  . THR B 1 211 ? 37.779  10.281  46.124  1.00 15.31 ? 215 THR B CA  1 
ATOM   3684 C C   . THR B 1 211 ? 37.983  10.350  47.650  1.00 15.36 ? 215 THR B C   1 
ATOM   3685 O O   . THR B 1 211 ? 38.642  11.267  48.148  1.00 15.47 ? 215 THR B O   1 
ATOM   3686 C CB  . THR B 1 211 ? 37.817  11.710  45.519  1.00 15.30 ? 215 THR B CB  1 
ATOM   3687 O OG1 . THR B 1 211 ? 36.680  12.456  45.977  1.00 15.09 ? 215 THR B OG1 1 
ATOM   3688 C CG2 . THR B 1 211 ? 37.674  11.670  43.991  1.00 14.98 ? 215 THR B CG2 1 
ATOM   3689 N N   . GLY B 1 212 ? 37.406  9.396   48.381  1.00 15.16 ? 216 GLY B N   1 
ATOM   3690 C CA  . GLY B 1 212 ? 37.614  9.268   49.828  1.00 14.91 ? 216 GLY B CA  1 
ATOM   3691 C C   . GLY B 1 212 ? 37.202  10.417  50.741  1.00 14.88 ? 216 GLY B C   1 
ATOM   3692 O O   . GLY B 1 212 ? 37.352  10.316  51.959  1.00 14.81 ? 216 GLY B O   1 
ATOM   3693 N N   . SER B 1 213 ? 36.678  11.502  50.169  1.00 14.99 ? 217 SER B N   1 
ATOM   3694 C CA  . SER B 1 213 ? 36.324  12.702  50.944  1.00 14.99 ? 217 SER B CA  1 
ATOM   3695 C C   . SER B 1 213 ? 35.011  12.542  51.708  1.00 15.04 ? 217 SER B C   1 
ATOM   3696 O O   . SER B 1 213 ? 34.596  13.445  52.432  1.00 15.17 ? 217 SER B O   1 
ATOM   3697 C CB  . SER B 1 213 ? 36.290  13.956  50.059  1.00 14.89 ? 217 SER B CB  1 
ATOM   3698 O OG  . SER B 1 213 ? 35.148  13.967  49.223  1.00 15.04 ? 217 SER B OG  1 
ATOM   3699 N N   . ALA B 1 214 ? 34.359  11.397  51.523  1.00 15.03 ? 218 ALA B N   1 
ATOM   3700 C CA  . ALA B 1 214 ? 33.270  10.965  52.392  1.00 15.18 ? 218 ALA B CA  1 
ATOM   3701 C C   . ALA B 1 214 ? 33.404  9.465   52.647  1.00 15.41 ? 218 ALA B C   1 
ATOM   3702 O O   . ALA B 1 214 ? 33.891  8.726   51.787  1.00 15.54 ? 218 ALA B O   1 
ATOM   3703 C CB  . ALA B 1 214 ? 31.925  11.296  51.783  1.00 15.05 ? 218 ALA B CB  1 
ATOM   3704 N N   . ASP B 1 215 ? 32.985  9.025   53.832  1.00 15.53 ? 219 ASP B N   1 
ATOM   3705 C CA  . ASP B 1 215 ? 33.113  7.622   54.229  1.00 15.60 ? 219 ASP B CA  1 
ATOM   3706 C C   . ASP B 1 215 ? 32.043  6.710   53.638  1.00 15.66 ? 219 ASP B C   1 
ATOM   3707 O O   . ASP B 1 215 ? 32.369  5.672   53.061  1.00 16.05 ? 219 ASP B O   1 
ATOM   3708 C CB  . ASP B 1 215 ? 33.114  7.490   55.747  1.00 15.65 ? 219 ASP B CB  1 
ATOM   3709 C CG  . ASP B 1 215 ? 34.187  8.309   56.391  1.00 15.77 ? 219 ASP B CG  1 
ATOM   3710 O OD1 . ASP B 1 215 ? 35.277  8.445   55.791  1.00 16.08 ? 219 ASP B OD1 1 
ATOM   3711 O OD2 . ASP B 1 215 ? 34.028  8.855   57.499  1.00 16.73 ? 219 ASP B OD2 1 
ATOM   3712 N N   . ALA B 1 216 ? 30.774  7.077   53.788  1.00 15.46 ? 220 ALA B N   1 
ATOM   3713 C CA  . ALA B 1 216 ? 29.695  6.212   53.322  1.00 15.40 ? 220 ALA B CA  1 
ATOM   3714 C C   . ALA B 1 216 ? 28.471  6.981   52.842  1.00 15.40 ? 220 ALA B C   1 
ATOM   3715 O O   . ALA B 1 216 ? 28.265  8.146   53.196  1.00 15.29 ? 220 ALA B O   1 
ATOM   3716 C CB  . ALA B 1 216 ? 29.305  5.214   54.408  1.00 15.36 ? 220 ALA B CB  1 
ATOM   3717 N N   . SER B 1 217 ? 27.662  6.305   52.031  1.00 15.40 ? 221 SER B N   1 
ATOM   3718 C CA  . SER B 1 217 ? 26.416  6.860   51.525  1.00 15.32 ? 221 SER B CA  1 
ATOM   3719 C C   . SER B 1 217 ? 25.347  5.786   51.388  1.00 15.30 ? 221 SER B C   1 
ATOM   3720 O O   . SER B 1 217 ? 25.635  4.642   51.034  1.00 15.31 ? 221 SER B O   1 
ATOM   3721 C CB  . SER B 1 217 ? 26.637  7.533   50.176  1.00 15.29 ? 221 SER B CB  1 
ATOM   3722 O OG  . SER B 1 217 ? 25.410  8.012   49.668  1.00 15.31 ? 221 SER B OG  1 
ATOM   3723 N N   . LEU B 1 218 ? 24.107  6.175   51.660  1.00 15.32 ? 222 LEU B N   1 
ATOM   3724 C CA  . LEU B 1 218 ? 22.970  5.273   51.574  1.00 15.23 ? 222 LEU B CA  1 
ATOM   3725 C C   . LEU B 1 218 ? 22.032  5.763   50.472  1.00 15.31 ? 222 LEU B C   1 
ATOM   3726 O O   . LEU B 1 218 ? 20.815  5.556   50.524  1.00 15.59 ? 222 LEU B O   1 
ATOM   3727 C CB  . LEU B 1 218 ? 22.258  5.205   52.930  1.00 15.16 ? 222 LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 218 ? 23.136  4.968   54.173  1.00 15.09 ? 222 LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 218 ? 22.466  5.514   55.410  1.00 15.56 ? 222 LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 218 ? 23.480  3.509   54.374  1.00 14.74 ? 222 LEU B CD2 1 
ATOM   3731 N N   . SER B 1 219 ? 22.618  6.401   49.463  1.00 15.15 ? 223 SER B N   1 
ATOM   3732 C CA  . SER B 1 219 ? 21.853  7.108   48.441  1.00 15.08 ? 223 SER B CA  1 
ATOM   3733 C C   . SER B 1 219 ? 22.050  6.554   47.034  1.00 15.06 ? 223 SER B C   1 
ATOM   3734 O O   . SER B 1 219 ? 21.587  7.146   46.062  1.00 14.85 ? 223 SER B O   1 
ATOM   3735 C CB  . SER B 1 219 ? 22.217  8.590   48.464  1.00 15.11 ? 223 SER B CB  1 
ATOM   3736 O OG  . SER B 1 219 ? 21.942  9.148   49.732  1.00 15.41 ? 223 SER B OG  1 
ATOM   3737 N N   . ALA B 1 220 ? 22.754  5.428   46.931  1.00 15.14 ? 224 ALA B N   1 
ATOM   3738 C CA  . ALA B 1 220 ? 22.968  4.760   45.649  1.00 14.72 ? 224 ALA B CA  1 
ATOM   3739 C C   . ALA B 1 220 ? 21.699  4.040   45.228  1.00 14.35 ? 224 ALA B C   1 
ATOM   3740 O O   . ALA B 1 220 ? 21.249  3.122   45.892  1.00 14.29 ? 224 ALA B O   1 
ATOM   3741 C CB  . ALA B 1 220 ? 24.148  3.786   45.737  1.00 14.71 ? 224 ALA B CB  1 
ATOM   3742 N N   . TRP B 1 221 ? 21.108  4.503   44.137  1.00 14.39 ? 225 TRP B N   1 
ATOM   3743 C CA  . TRP B 1 221 ? 19.963  3.846   43.519  1.00 14.36 ? 225 TRP B CA  1 
ATOM   3744 C C   . TRP B 1 221 ? 20.465  3.186   42.240  1.00 14.48 ? 225 TRP B C   1 
ATOM   3745 O O   . TRP B 1 221 ? 20.802  3.860   41.264  1.00 14.28 ? 225 TRP B O   1 
ATOM   3746 C CB  . TRP B 1 221 ? 18.867  4.860   43.200  1.00 14.33 ? 225 TRP B CB  1 
ATOM   3747 C CG  . TRP B 1 221 ? 17.948  5.233   44.337  1.00 14.21 ? 225 TRP B CG  1 
ATOM   3748 C CD1 . TRP B 1 221 ? 18.296  5.563   45.620  1.00 14.29 ? 225 TRP B CD1 1 
ATOM   3749 C CD2 . TRP B 1 221 ? 16.526  5.361   44.268  1.00 14.67 ? 225 TRP B CD2 1 
ATOM   3750 N NE1 . TRP B 1 221 ? 17.176  5.858   46.357  1.00 13.89 ? 225 TRP B NE1 1 
ATOM   3751 C CE2 . TRP B 1 221 ? 16.073  5.745   45.551  1.00 14.57 ? 225 TRP B CE2 1 
ATOM   3752 C CE3 . TRP B 1 221 ? 15.573  5.185   43.242  1.00 14.42 ? 225 TRP B CE3 1 
ATOM   3753 C CZ2 . TRP B 1 221 ? 14.713  5.957   45.837  1.00 14.63 ? 225 TRP B CZ2 1 
ATOM   3754 C CZ3 . TRP B 1 221 ? 14.227  5.392   43.529  1.00 13.85 ? 225 TRP B CZ3 1 
ATOM   3755 C CH2 . TRP B 1 221 ? 13.812  5.774   44.814  1.00 14.30 ? 225 TRP B CH2 1 
ATOM   3756 N N   . LEU B 1 222 ? 20.530  1.858   42.278  1.00 14.65 ? 226 LEU B N   1 
ATOM   3757 C CA  . LEU B 1 222 ? 21.139  1.040   41.235  1.00 14.72 ? 226 LEU B CA  1 
ATOM   3758 C C   . LEU B 1 222 ? 20.153  -0.069  40.854  1.00 14.88 ? 226 LEU B C   1 
ATOM   3759 O O   . LEU B 1 222 ? 19.332  -0.460  41.689  1.00 15.04 ? 226 LEU B O   1 
ATOM   3760 C CB  . LEU B 1 222 ? 22.438  0.424   41.776  1.00 14.73 ? 226 LEU B CB  1 
ATOM   3761 C CG  . LEU B 1 222 ? 23.819  1.076   41.599  1.00 14.77 ? 226 LEU B CG  1 
ATOM   3762 C CD1 . LEU B 1 222 ? 23.786  2.483   41.013  1.00 15.01 ? 226 LEU B CD1 1 
ATOM   3763 C CD2 . LEU B 1 222 ? 24.590  1.056   42.924  1.00 14.81 ? 226 LEU B CD2 1 
ATOM   3764 N N   . PRO B 1 223 ? 20.218  -0.593  39.625  1.00 15.05 ? 227 PRO B N   1 
ATOM   3765 C CA  . PRO B 1 223 ? 21.182  -0.184  38.603  1.00 15.13 ? 227 PRO B CA  1 
ATOM   3766 C C   . PRO B 1 223 ? 20.747  0.968   37.698  1.00 15.19 ? 227 PRO B C   1 
ATOM   3767 O O   . PRO B 1 223 ? 21.598  1.569   37.048  1.00 15.15 ? 227 PRO B O   1 
ATOM   3768 C CB  . PRO B 1 223 ? 21.345  -1.458  37.764  1.00 15.13 ? 227 PRO B CB  1 
ATOM   3769 C CG  . PRO B 1 223 ? 20.027  -2.148  37.864  1.00 15.06 ? 227 PRO B CG  1 
ATOM   3770 C CD  . PRO B 1 223 ? 19.368  -1.702  39.152  1.00 15.07 ? 227 PRO B CD  1 
ATOM   3771 N N   . ASN B 1 224 ? 19.453  1.281   37.668  1.00 15.38 ? 228 ASN B N   1 
ATOM   3772 C CA  . ASN B 1 224 ? 18.901  2.215   36.673  1.00 15.61 ? 228 ASN B CA  1 
ATOM   3773 C C   . ASN B 1 224 ? 19.118  3.710   36.919  1.00 15.87 ? 228 ASN B C   1 
ATOM   3774 O O   . ASN B 1 224 ? 19.348  4.460   35.969  1.00 16.09 ? 228 ASN B O   1 
ATOM   3775 C CB  . ASN B 1 224 ? 17.410  1.948   36.442  1.00 15.42 ? 228 ASN B CB  1 
ATOM   3776 C CG  . ASN B 1 224 ? 17.133  0.528   36.021  1.00 15.18 ? 228 ASN B CG  1 
ATOM   3777 O OD1 . ASN B 1 224 ? 17.575  0.085   34.967  1.00 14.82 ? 228 ASN B OD1 1 
ATOM   3778 N ND2 . ASN B 1 224 ? 16.396  -0.197  36.847  1.00 14.97 ? 228 ASN B ND2 1 
ATOM   3779 N N   . THR B 1 225 ? 19.025  4.147   38.173  1.00 16.00 ? 229 THR B N   1 
ATOM   3780 C CA  . THR B 1 225 ? 19.050  5.584   38.483  1.00 16.16 ? 229 THR B CA  1 
ATOM   3781 C C   . THR B 1 225 ? 20.430  6.227   38.301  1.00 16.30 ? 229 THR B C   1 
ATOM   3782 O O   . THR B 1 225 ? 20.545  7.333   37.755  1.00 16.47 ? 229 THR B O   1 
ATOM   3783 C CB  . THR B 1 225 ? 18.551  5.849   39.917  1.00 16.18 ? 229 THR B CB  1 
ATOM   3784 O OG1 . THR B 1 225 ? 17.330  5.134   40.160  1.00 16.27 ? 229 THR B OG1 1 
ATOM   3785 C CG2 . THR B 1 225 ? 18.161  7.306   40.078  1.00 16.09 ? 229 THR B CG2 1 
ATOM   3786 N N   . HIS B 1 226 ? 21.463  5.535   38.781  1.00 16.14 ? 230 HIS B N   1 
ATOM   3787 C CA  . HIS B 1 226 ? 22.835  6.035   38.742  1.00 15.73 ? 230 HIS B CA  1 
ATOM   3788 C C   . HIS B 1 226 ? 23.711  5.170   37.843  1.00 15.82 ? 230 HIS B C   1 
ATOM   3789 O O   . HIS B 1 226 ? 24.891  4.936   38.150  1.00 15.74 ? 230 HIS B O   1 
ATOM   3790 C CB  . HIS B 1 226 ? 23.425  6.103   40.157  1.00 15.57 ? 230 HIS B CB  1 
ATOM   3791 C CG  . HIS B 1 226 ? 22.713  7.057   41.065  1.00 15.33 ? 230 HIS B CG  1 
ATOM   3792 N ND1 . HIS B 1 226 ? 22.558  6.828   42.414  1.00 14.73 ? 230 HIS B ND1 1 
ATOM   3793 C CD2 . HIS B 1 226 ? 22.099  8.238   40.811  1.00 14.87 ? 230 HIS B CD2 1 
ATOM   3794 C CE1 . HIS B 1 226 ? 21.891  7.832   42.955  1.00 14.49 ? 230 HIS B CE1 1 
ATOM   3795 N NE2 . HIS B 1 226 ? 21.598  8.700   42.004  1.00 14.15 ? 230 HIS B NE2 1 
ATOM   3796 N N   . LYS B 1 227 ? 23.122  4.704   36.736  1.00 15.68 ? 231 LYS B N   1 
ATOM   3797 C CA  . LYS B 1 227 ? 23.819  3.885   35.745  1.00 15.57 ? 231 LYS B CA  1 
ATOM   3798 C C   . LYS B 1 227 ? 25.185  4.487   35.431  1.00 15.42 ? 231 LYS B C   1 
ATOM   3799 O O   . LYS B 1 227 ? 26.219  3.836   35.595  1.00 15.17 ? 231 LYS B O   1 
ATOM   3800 C CB  . LYS B 1 227 ? 22.989  3.797   34.462  1.00 15.53 ? 231 LYS B CB  1 
ATOM   3801 C CG  . LYS B 1 227 ? 23.141  2.489   33.708  1.00 16.17 ? 231 LYS B CG  1 
ATOM   3802 C CD  . LYS B 1 227 ? 23.152  2.712   32.206  1.00 18.13 ? 231 LYS B CD  1 
ATOM   3803 C CE  . LYS B 1 227 ? 22.296  1.681   31.453  1.00 18.77 ? 231 LYS B CE  1 
ATOM   3804 N NZ  . LYS B 1 227 ? 22.643  0.275   31.812  1.00 19.37 ? 231 LYS B NZ  1 
ATOM   3805 N N   . ALA B 1 228 ? 25.152  5.750   35.004  1.00 15.45 ? 232 ALA B N   1 
ATOM   3806 C CA  . ALA B 1 228 ? 26.319  6.500   34.552  1.00 15.24 ? 232 ALA B CA  1 
ATOM   3807 C C   . ALA B 1 228 ? 27.316  6.766   35.680  1.00 15.21 ? 232 ALA B C   1 
ATOM   3808 O O   . ALA B 1 228 ? 28.519  6.545   35.501  1.00 15.02 ? 232 ALA B O   1 
ATOM   3809 C CB  . ALA B 1 228 ? 25.875  7.810   33.904  1.00 15.15 ? 232 ALA B CB  1 
ATOM   3810 N N   . TYR B 1 229 ? 26.811  7.236   36.827  1.00 15.18 ? 233 TYR B N   1 
ATOM   3811 C CA  . TYR B 1 229 ? 27.657  7.505   37.996  1.00 15.16 ? 233 TYR B CA  1 
ATOM   3812 C C   . TYR B 1 229 ? 28.386  6.248   38.491  1.00 15.11 ? 233 TYR B C   1 
ATOM   3813 O O   . TYR B 1 229 ? 29.581  6.306   38.766  1.00 15.37 ? 233 TYR B O   1 
ATOM   3814 C CB  . TYR B 1 229 ? 26.869  8.159   39.142  1.00 15.18 ? 233 TYR B CB  1 
ATOM   3815 C CG  . TYR B 1 229 ? 26.340  9.561   38.868  1.00 15.33 ? 233 TYR B CG  1 
ATOM   3816 C CD1 . TYR B 1 229 ? 27.175  10.573  38.375  1.00 15.39 ? 233 TYR B CD1 1 
ATOM   3817 C CD2 . TYR B 1 229 ? 25.007  9.880   39.134  1.00 15.62 ? 233 TYR B CD2 1 
ATOM   3818 C CE1 . TYR B 1 229 ? 26.684  11.857  38.133  1.00 15.14 ? 233 TYR B CE1 1 
ATOM   3819 C CE2 . TYR B 1 229 ? 24.505  11.153  38.894  1.00 15.68 ? 233 TYR B CE2 1 
ATOM   3820 C CZ  . TYR B 1 229 ? 25.344  12.137  38.397  1.00 15.53 ? 233 TYR B CZ  1 
ATOM   3821 O OH  . TYR B 1 229 ? 24.832  13.396  38.173  1.00 15.46 ? 233 TYR B OH  1 
ATOM   3822 N N   . ALA B 1 230 ? 27.676  5.124   38.586  1.00 14.91 ? 234 ALA B N   1 
ATOM   3823 C CA  . ALA B 1 230 ? 28.282  3.849   38.980  1.00 14.77 ? 234 ALA B CA  1 
ATOM   3824 C C   . ALA B 1 230 ? 29.343  3.383   37.981  1.00 14.88 ? 234 ALA B C   1 
ATOM   3825 O O   . ALA B 1 230 ? 30.419  2.917   38.378  1.00 15.07 ? 234 ALA B O   1 
ATOM   3826 C CB  . ALA B 1 230 ? 27.218  2.786   39.167  1.00 14.63 ? 234 ALA B CB  1 
ATOM   3827 N N   . ALA B 1 231 ? 29.034  3.521   36.691  1.00 14.93 ? 235 ALA B N   1 
ATOM   3828 C CA  . ALA B 1 231 ? 29.970  3.209   35.606  1.00 14.83 ? 235 ALA B CA  1 
ATOM   3829 C C   . ALA B 1 231 ? 31.246  4.045   35.728  1.00 14.89 ? 235 ALA B C   1 
ATOM   3830 O O   . ALA B 1 231 ? 32.346  3.494   35.767  1.00 14.70 ? 235 ALA B O   1 
ATOM   3831 C CB  . ALA B 1 231 ? 29.304  3.433   34.242  1.00 14.48 ? 235 ALA B CB  1 
ATOM   3832 N N   . LYS B 1 232 ? 31.070  5.367   35.812  1.00 15.02 ? 236 LYS B N   1 
ATOM   3833 C CA  . LYS B 1 232 ? 32.156  6.354   35.933  1.00 15.05 ? 236 LYS B CA  1 
ATOM   3834 C C   . LYS B 1 232 ? 33.163  6.043   37.043  1.00 15.17 ? 236 LYS B C   1 
ATOM   3835 O O   . LYS B 1 232 ? 34.355  6.290   36.872  1.00 15.25 ? 236 LYS B O   1 
ATOM   3836 C CB  . LYS B 1 232 ? 31.554  7.740   36.162  1.00 15.12 ? 236 LYS B CB  1 
ATOM   3837 C CG  . LYS B 1 232 ? 32.521  8.907   36.163  1.00 15.27 ? 236 LYS B CG  1 
ATOM   3838 C CD  . LYS B 1 232 ? 31.759  10.189  36.487  1.00 15.71 ? 236 LYS B CD  1 
ATOM   3839 C CE  . LYS B 1 232 ? 32.688  11.374  36.708  1.00 16.38 ? 236 LYS B CE  1 
ATOM   3840 N NZ  . LYS B 1 232 ? 31.908  12.597  37.081  1.00 16.83 ? 236 LYS B NZ  1 
ATOM   3841 N N   . TYR B 1 233 ? 32.683  5.509   38.169  1.00 15.23 ? 237 TYR B N   1 
ATOM   3842 C CA  . TYR B 1 233 ? 33.546  5.159   39.305  1.00 15.25 ? 237 TYR B CA  1 
ATOM   3843 C C   . TYR B 1 233 ? 33.556  3.649   39.564  1.00 15.33 ? 237 TYR B C   1 
ATOM   3844 O O   . TYR B 1 233 ? 33.483  3.196   40.711  1.00 15.27 ? 237 TYR B O   1 
ATOM   3845 C CB  . TYR B 1 233 ? 33.114  5.920   40.565  1.00 15.28 ? 237 TYR B CB  1 
ATOM   3846 C CG  . TYR B 1 233 ? 33.140  7.431   40.435  1.00 15.22 ? 237 TYR B CG  1 
ATOM   3847 C CD1 . TYR B 1 233 ? 34.352  8.126   40.290  1.00 15.09 ? 237 TYR B CD1 1 
ATOM   3848 C CD2 . TYR B 1 233 ? 31.956  8.170   40.473  1.00 14.75 ? 237 TYR B CD2 1 
ATOM   3849 C CE1 . TYR B 1 233 ? 34.380  9.522   40.181  1.00 15.07 ? 237 TYR B CE1 1 
ATOM   3850 C CE2 . TYR B 1 233 ? 31.969  9.563   40.365  1.00 15.04 ? 237 TYR B CE2 1 
ATOM   3851 C CZ  . TYR B 1 233 ? 33.182  10.235  40.220  1.00 15.51 ? 237 TYR B CZ  1 
ATOM   3852 O OH  . TYR B 1 233 ? 33.184  11.611  40.114  1.00 15.58 ? 237 TYR B OH  1 
ATOM   3853 N N   . LYS B 1 234 ? 33.675  2.888   38.477  1.00 15.44 ? 238 LYS B N   1 
ATOM   3854 C CA  . LYS B 1 234 ? 33.541  1.426   38.467  1.00 15.33 ? 238 LYS B CA  1 
ATOM   3855 C C   . LYS B 1 234 ? 34.393  0.716   39.503  1.00 15.11 ? 238 LYS B C   1 
ATOM   3856 O O   . LYS B 1 234 ? 33.874  -0.090  40.269  1.00 15.25 ? 238 LYS B O   1 
ATOM   3857 C CB  . LYS B 1 234 ? 33.847  0.881   37.065  1.00 15.51 ? 238 LYS B CB  1 
ATOM   3858 C CG  . LYS B 1 234 ? 33.351  -0.535  36.768  1.00 15.83 ? 238 LYS B CG  1 
ATOM   3859 C CD  . LYS B 1 234 ? 34.519  -1.520  36.657  1.00 17.31 ? 238 LYS B CD  1 
ATOM   3860 C CE  . LYS B 1 234 ? 34.454  -2.347  35.359  1.00 17.63 ? 238 LYS B CE  1 
ATOM   3861 N NZ  . LYS B 1 234 ? 33.184  -3.113  35.187  1.00 18.01 ? 238 LYS B NZ  1 
ATOM   3862 N N   . GLY B 1 235 ? 35.690  1.010   39.533  1.00 14.79 ? 239 GLY B N   1 
ATOM   3863 C CA  . GLY B 1 235 ? 36.599  0.304   40.438  1.00 14.69 ? 239 GLY B CA  1 
ATOM   3864 C C   . GLY B 1 235 ? 37.078  1.115   41.621  1.00 14.67 ? 239 GLY B C   1 
ATOM   3865 O O   . GLY B 1 235 ? 38.095  0.784   42.222  1.00 14.59 ? 239 GLY B O   1 
ATOM   3866 N N   . LYS B 1 236 ? 36.336  2.165   41.970  1.00 14.79 ? 240 LYS B N   1 
ATOM   3867 C CA  . LYS B 1 236 ? 36.817  3.168   42.927  1.00 14.96 ? 240 LYS B CA  1 
ATOM   3868 C C   . LYS B 1 236 ? 35.937  3.348   44.171  1.00 15.04 ? 240 LYS B C   1 
ATOM   3869 O O   . LYS B 1 236 ? 36.171  4.258   44.976  1.00 15.30 ? 240 LYS B O   1 
ATOM   3870 C CB  . LYS B 1 236 ? 37.028  4.516   42.217  1.00 14.94 ? 240 LYS B CB  1 
ATOM   3871 C CG  . LYS B 1 236 ? 38.079  4.476   41.107  1.00 15.06 ? 240 LYS B CG  1 
ATOM   3872 C CD  . LYS B 1 236 ? 38.312  5.839   40.480  1.00 15.18 ? 240 LYS B CD  1 
ATOM   3873 C CE  . LYS B 1 236 ? 39.374  5.750   39.409  1.00 15.62 ? 240 LYS B CE  1 
ATOM   3874 N NZ  . LYS B 1 236 ? 39.841  7.096   39.006  1.00 16.42 ? 240 LYS B NZ  1 
ATOM   3875 N N   . TYR B 1 237 ? 34.934  2.483   44.324  1.00 14.94 ? 241 TYR B N   1 
ATOM   3876 C CA  . TYR B 1 237 ? 34.084  2.477   45.515  1.00 14.85 ? 241 TYR B CA  1 
ATOM   3877 C C   . TYR B 1 237 ? 33.801  1.043   45.972  1.00 14.85 ? 241 TYR B C   1 
ATOM   3878 O O   . TYR B 1 237 ? 34.193  0.087   45.301  1.00 14.73 ? 241 TYR B O   1 
ATOM   3879 C CB  . TYR B 1 237 ? 32.784  3.273   45.274  1.00 14.89 ? 241 TYR B CB  1 
ATOM   3880 C CG  . TYR B 1 237 ? 31.747  2.594   44.386  1.00 14.99 ? 241 TYR B CG  1 
ATOM   3881 C CD1 . TYR B 1 237 ? 30.858  1.652   44.913  1.00 14.67 ? 241 TYR B CD1 1 
ATOM   3882 C CD2 . TYR B 1 237 ? 31.639  2.910   43.031  1.00 15.14 ? 241 TYR B CD2 1 
ATOM   3883 C CE1 . TYR B 1 237 ? 29.904  1.029   44.116  1.00 14.76 ? 241 TYR B CE1 1 
ATOM   3884 C CE2 . TYR B 1 237 ? 30.681  2.286   42.219  1.00 14.93 ? 241 TYR B CE2 1 
ATOM   3885 C CZ  . TYR B 1 237 ? 29.816  1.348   42.774  1.00 14.92 ? 241 TYR B CZ  1 
ATOM   3886 O OH  . TYR B 1 237 ? 28.859  0.722   41.999  1.00 14.84 ? 241 TYR B OH  1 
ATOM   3887 N N   . ASP B 1 238 ? 33.145  0.903   47.124  1.00 14.97 ? 242 ASP B N   1 
ATOM   3888 C CA  . ASP B 1 238 ? 32.683  -0.400  47.630  1.00 14.97 ? 242 ASP B CA  1 
ATOM   3889 C C   . ASP B 1 238 ? 31.162  -0.405  47.714  1.00 14.82 ? 242 ASP B C   1 
ATOM   3890 O O   . ASP B 1 238 ? 30.574  0.532   48.244  1.00 14.86 ? 242 ASP B O   1 
ATOM   3891 C CB  . ASP B 1 238 ? 33.264  -0.703  49.025  1.00 14.97 ? 242 ASP B CB  1 
ATOM   3892 C CG  . ASP B 1 238 ? 34.706  -1.203  48.983  1.00 15.36 ? 242 ASP B CG  1 
ATOM   3893 O OD1 . ASP B 1 238 ? 35.489  -0.861  49.897  1.00 16.79 ? 242 ASP B OD1 1 
ATOM   3894 O OD2 . ASP B 1 238 ? 35.151  -1.947  48.091  1.00 15.32 ? 242 ASP B OD2 1 
ATOM   3895 N N   . ASP B 1 239 ? 30.538  -1.453  47.177  1.00 14.77 ? 243 ASP B N   1 
ATOM   3896 C CA  . ASP B 1 239 ? 29.097  -1.692  47.324  1.00 14.70 ? 243 ASP B CA  1 
ATOM   3897 C C   . ASP B 1 239 ? 28.877  -2.818  48.340  1.00 14.71 ? 243 ASP B C   1 
ATOM   3898 O O   . ASP B 1 239 ? 28.971  -4.004  48.001  1.00 14.72 ? 243 ASP B O   1 
ATOM   3899 C CB  . ASP B 1 239 ? 28.473  -2.058  45.978  1.00 14.66 ? 243 ASP B CB  1 
ATOM   3900 C CG  . ASP B 1 239 ? 26.952  -2.179  46.040  1.00 14.82 ? 243 ASP B CG  1 
ATOM   3901 O OD1 . ASP B 1 239 ? 26.312  -1.990  44.983  1.00 15.67 ? 243 ASP B OD1 1 
ATOM   3902 O OD2 . ASP B 1 239 ? 26.303  -2.457  47.076  1.00 14.17 ? 243 ASP B OD2 1 
ATOM   3903 N N   . ILE B 1 240 ? 28.572  -2.438  49.580  1.00 14.62 ? 244 ILE B N   1 
ATOM   3904 C CA  . ILE B 1 240 ? 28.640  -3.369  50.713  1.00 14.49 ? 244 ILE B CA  1 
ATOM   3905 C C   . ILE B 1 240 ? 27.290  -3.814  51.286  1.00 14.41 ? 244 ILE B C   1 
ATOM   3906 O O   . ILE B 1 240 ? 27.249  -4.540  52.281  1.00 14.55 ? 244 ILE B O   1 
ATOM   3907 C CB  . ILE B 1 240 ? 29.585  -2.833  51.831  1.00 14.45 ? 244 ILE B CB  1 
ATOM   3908 C CG1 . ILE B 1 240 ? 29.096  -1.486  52.392  1.00 14.38 ? 244 ILE B CG1 1 
ATOM   3909 C CG2 . ILE B 1 240 ? 31.018  -2.750  51.309  1.00 14.16 ? 244 ILE B CG2 1 
ATOM   3910 C CD1 . ILE B 1 240 ? 29.569  -1.198  53.823  1.00 14.61 ? 244 ILE B CD1 1 
ATOM   3911 N N   . GLY B 1 241 ? 26.197  -3.400  50.651  1.00 14.18 ? 245 GLY B N   1 
ATOM   3912 C CA  . GLY B 1 241 ? 24.868  -3.847  51.066  1.00 14.06 ? 245 GLY B CA  1 
ATOM   3913 C C   . GLY B 1 241 ? 23.747  -3.285  50.218  1.00 14.03 ? 245 GLY B C   1 
ATOM   3914 O O   . GLY B 1 241 ? 23.910  -2.247  49.575  1.00 14.22 ? 245 GLY B O   1 
ATOM   3915 N N   . THR B 1 242 ? 22.616  -3.990  50.199  1.00 13.74 ? 246 THR B N   1 
ATOM   3916 C CA  . THR B 1 242 ? 21.378  -3.485  49.610  1.00 13.48 ? 246 THR B CA  1 
ATOM   3917 C C   . THR B 1 242 ? 20.391  -3.169  50.723  1.00 13.46 ? 246 THR B C   1 
ATOM   3918 O O   . THR B 1 242 ? 19.985  -4.062  51.470  1.00 13.38 ? 246 THR B O   1 
ATOM   3919 C CB  . THR B 1 242 ? 20.767  -4.509  48.623  1.00 13.45 ? 246 THR B CB  1 
ATOM   3920 O OG1 . THR B 1 242 ? 21.539  -4.528  47.418  1.00 13.42 ? 246 THR B OG1 1 
ATOM   3921 C CG2 . THR B 1 242 ? 19.386  -4.050  48.133  1.00 13.04 ? 246 THR B CG2 1 
ATOM   3922 N N   . SER B 1 243 ? 20.003  -1.903  50.835  1.00 13.55 ? 247 SER B N   1 
ATOM   3923 C CA  . SER B 1 243 ? 19.109  -1.488  51.914  1.00 13.94 ? 247 SER B CA  1 
ATOM   3924 C C   . SER B 1 243 ? 17.623  -1.586  51.567  1.00 14.20 ? 247 SER B C   1 
ATOM   3925 O O   . SER B 1 243 ? 16.781  -1.581  52.465  1.00 14.41 ? 247 SER B O   1 
ATOM   3926 C CB  . SER B 1 243 ? 19.467  -0.094  52.434  1.00 13.86 ? 247 SER B CB  1 
ATOM   3927 O OG  . SER B 1 243 ? 19.542  0.859   51.396  1.00 14.21 ? 247 SER B OG  1 
ATOM   3928 N N   . MET B 1 244 ? 17.305  -1.697  50.279  1.00 14.33 ? 248 MET B N   1 
ATOM   3929 C CA  . MET B 1 244 ? 15.922  -1.886  49.852  1.00 14.76 ? 248 MET B CA  1 
ATOM   3930 C C   . MET B 1 244 ? 15.786  -2.334  48.403  1.00 14.67 ? 248 MET B C   1 
ATOM   3931 O O   . MET B 1 244 ? 16.534  -1.896  47.529  1.00 14.64 ? 248 MET B O   1 
ATOM   3932 C CB  . MET B 1 244 ? 15.108  -0.613  50.057  1.00 14.66 ? 248 MET B CB  1 
ATOM   3933 C CG  . MET B 1 244 ? 13.614  -0.841  49.953  1.00 15.14 ? 248 MET B CG  1 
ATOM   3934 S SD  . MET B 1 244 ? 12.656  0.672   50.111  1.00 15.79 ? 248 MET B SD  1 
ATOM   3935 C CE  . MET B 1 244 ? 13.163  1.242   51.746  1.00 15.35 ? 248 MET B CE  1 
ATOM   3936 N N   . THR B 1 245 ? 14.800  -3.195  48.166  1.00 14.88 ? 249 THR B N   1 
ATOM   3937 C CA  . THR B 1 245 ? 14.488  -3.698  46.831  1.00 15.12 ? 249 THR B CA  1 
ATOM   3938 C C   . THR B 1 245 ? 13.076  -3.261  46.422  1.00 15.22 ? 249 THR B C   1 
ATOM   3939 O O   . THR B 1 245 ? 12.379  -2.589  47.190  1.00 15.22 ? 249 THR B O   1 
ATOM   3940 C CB  . THR B 1 245 ? 14.630  -5.255  46.769  1.00 15.07 ? 249 THR B CB  1 
ATOM   3941 O OG1 . THR B 1 245 ? 13.393  -5.880  47.129  1.00 15.43 ? 249 THR B OG1 1 
ATOM   3942 C CG2 . THR B 1 245 ? 15.615  -5.774  47.816  1.00 14.80 ? 249 THR B CG2 1 
ATOM   3943 N N   . GLY B 1 246 ? 12.661  -3.629  45.213  1.00 15.33 ? 250 GLY B N   1 
ATOM   3944 C CA  . GLY B 1 246 ? 11.301  -3.351  44.761  1.00 15.59 ? 250 GLY B CA  1 
ATOM   3945 C C   . GLY B 1 246 ? 10.924  -1.886  44.613  1.00 15.72 ? 250 GLY B C   1 
ATOM   3946 O O   . GLY B 1 246 ? 9.740   -1.558  44.548  1.00 15.84 ? 250 GLY B O   1 
ATOM   3947 N N   . VAL B 1 247 ? 11.918  -1.003  44.551  1.00 15.93 ? 251 VAL B N   1 
ATOM   3948 C CA  . VAL B 1 247 ? 11.658  0.409   44.255  1.00 16.33 ? 251 VAL B CA  1 
ATOM   3949 C C   . VAL B 1 247 ? 11.281  0.542   42.769  1.00 16.74 ? 251 VAL B C   1 
ATOM   3950 O O   . VAL B 1 247 ? 11.959  -0.016  41.900  1.00 17.15 ? 251 VAL B O   1 
ATOM   3951 C CB  . VAL B 1 247 ? 12.847  1.345   44.667  1.00 16.17 ? 251 VAL B CB  1 
ATOM   3952 C CG1 . VAL B 1 247 ? 13.842  0.619   45.532  1.00 15.54 ? 251 VAL B CG1 1 
ATOM   3953 C CG2 . VAL B 1 247 ? 13.551  1.934   43.476  1.00 16.22 ? 251 VAL B CG2 1 
ATOM   3954 N N   . LYS B 1 248 ? 10.179  1.234   42.491  1.00 17.05 ? 252 LYS B N   1 
ATOM   3955 C CA  . LYS B 1 248 ? 9.674   1.383   41.119  1.00 17.50 ? 252 LYS B CA  1 
ATOM   3956 C C   . LYS B 1 248 ? 9.707   2.857   40.726  1.00 17.81 ? 252 LYS B C   1 
ATOM   3957 O O   . LYS B 1 248 ? 9.744   3.731   41.589  1.00 17.81 ? 252 LYS B O   1 
ATOM   3958 C CB  . LYS B 1 248 ? 8.242   0.813   40.974  1.00 17.43 ? 252 LYS B CB  1 
ATOM   3959 C CG  . LYS B 1 248 ? 8.107   -0.701  41.253  1.00 17.60 ? 252 LYS B CG  1 
ATOM   3960 C CD  . LYS B 1 248 ? 6.803   -1.036  42.004  1.00 17.48 ? 252 LYS B CD  1 
ATOM   3961 C CE  . LYS B 1 248 ? 5.874   -1.988  41.246  1.00 17.17 ? 252 LYS B CE  1 
ATOM   3962 N NZ  . LYS B 1 248 ? 5.238   -1.386  40.042  1.00 17.24 ? 252 LYS B NZ  1 
ATOM   3963 N N   . MET B 1 249 ? 9.709   3.134   39.424  1.00 18.26 ? 253 MET B N   1 
ATOM   3964 C CA  . MET B 1 249 ? 9.597   4.515   38.936  1.00 18.62 ? 253 MET B CA  1 
ATOM   3965 C C   . MET B 1 249 ? 8.990   4.631   37.540  1.00 17.86 ? 253 MET B C   1 
ATOM   3966 O O   . MET B 1 249 ? 9.118   3.734   36.700  1.00 17.81 ? 253 MET B O   1 
ATOM   3967 C CB  . MET B 1 249 ? 10.938  5.245   39.004  1.00 18.52 ? 253 MET B CB  1 
ATOM   3968 C CG  . MET B 1 249 ? 12.066  4.528   38.314  1.00 19.31 ? 253 MET B CG  1 
ATOM   3969 S SD  . MET B 1 249 ? 13.597  4.708   39.269  1.00 21.01 ? 253 MET B SD  1 
ATOM   3970 C CE  . MET B 1 249 ? 14.626  3.486   38.444  1.00 20.21 ? 253 MET B CE  1 
ATOM   3971 N N   . GLY B 1 250 ? 8.316   5.749   37.307  1.00 17.24 ? 254 GLY B N   1 
ATOM   3972 C CA  . GLY B 1 250 ? 7.751   6.007   36.012  1.00 16.42 ? 254 GLY B CA  1 
ATOM   3973 C C   . GLY B 1 250 ? 6.715   7.090   36.032  1.00 15.89 ? 254 GLY B C   1 
ATOM   3974 O O   . GLY B 1 250 ? 6.761   7.994   36.877  1.00 15.67 ? 254 GLY B O   1 
ATOM   3975 N N   . LEU B 1 251 ? 5.790   6.989   35.076  1.00 15.48 ? 255 LEU B N   1 
ATOM   3976 C CA  . LEU B 1 251 ? 4.714   7.946   34.918  1.00 14.96 ? 255 LEU B CA  1 
ATOM   3977 C C   . LEU B 1 251 ? 3.579   7.579   35.851  1.00 14.71 ? 255 LEU B C   1 
ATOM   3978 O O   . LEU B 1 251 ? 3.087   6.445   35.840  1.00 14.54 ? 255 LEU B O   1 
ATOM   3979 C CB  . LEU B 1 251 ? 4.237   7.995   33.467  1.00 15.06 ? 255 LEU B CB  1 
ATOM   3980 C CG  . LEU B 1 251 ? 5.278   8.310   32.381  1.00 14.90 ? 255 LEU B CG  1 
ATOM   3981 C CD1 . LEU B 1 251 ? 4.609   8.398   30.994  1.00 14.69 ? 255 LEU B CD1 1 
ATOM   3982 C CD2 . LEU B 1 251 ? 6.060   9.575   32.695  1.00 13.70 ? 255 LEU B CD2 1 
ATOM   3983 N N   . VAL B 1 252 ? 3.191   8.556   36.667  1.00 14.43 ? 256 VAL B N   1 
ATOM   3984 C CA  . VAL B 1 252 ? 2.192   8.374   37.707  1.00 14.11 ? 256 VAL B CA  1 
ATOM   3985 C C   . VAL B 1 252 ? 1.023   9.326   37.445  1.00 14.16 ? 256 VAL B C   1 
ATOM   3986 O O   . VAL B 1 252 ? 1.222   10.505  37.164  1.00 14.28 ? 256 VAL B O   1 
ATOM   3987 C CB  . VAL B 1 252 ? 2.822   8.587   39.121  1.00 13.95 ? 256 VAL B CB  1 
ATOM   3988 C CG1 . VAL B 1 252 ? 1.766   8.705   40.214  1.00 13.49 ? 256 VAL B CG1 1 
ATOM   3989 C CG2 . VAL B 1 252 ? 3.785   7.468   39.447  1.00 13.62 ? 256 VAL B CG2 1 
ATOM   3990 N N   . VAL B 1 253 ? -0.188  8.788   37.496  1.00 14.19 ? 257 VAL B N   1 
ATOM   3991 C CA  . VAL B 1 253 ? -1.399  9.588   37.445  1.00 14.35 ? 257 VAL B CA  1 
ATOM   3992 C C   . VAL B 1 253 ? -2.226  9.283   38.690  1.00 14.55 ? 257 VAL B C   1 
ATOM   3993 O O   . VAL B 1 253 ? -2.044  8.225   39.304  1.00 14.53 ? 257 VAL B O   1 
ATOM   3994 C CB  . VAL B 1 253 ? -2.258  9.297   36.168  1.00 14.46 ? 257 VAL B CB  1 
ATOM   3995 C CG1 . VAL B 1 253 ? -1.569  9.799   34.914  1.00 13.83 ? 257 VAL B CG1 1 
ATOM   3996 C CG2 . VAL B 1 253 ? -2.636  7.818   36.059  1.00 14.28 ? 257 VAL B CG2 1 
ATOM   3997 N N   . PRO B 1 254 ? -3.143  10.183  39.058  1.00 14.65 ? 258 PRO B N   1 
ATOM   3998 C CA  . PRO B 1 254 ? -4.054  9.904   40.154  1.00 14.67 ? 258 PRO B CA  1 
ATOM   3999 C C   . PRO B 1 254 ? -5.057  8.861   39.709  1.00 14.81 ? 258 PRO B C   1 
ATOM   4000 O O   . PRO B 1 254 ? -5.332  8.733   38.505  1.00 14.75 ? 258 PRO B O   1 
ATOM   4001 C CB  . PRO B 1 254 ? -4.757  11.243  40.397  1.00 14.68 ? 258 PRO B CB  1 
ATOM   4002 C CG  . PRO B 1 254 ? -4.048  12.241  39.583  1.00 14.64 ? 258 PRO B CG  1 
ATOM   4003 C CD  . PRO B 1 254 ? -3.402  11.504  38.456  1.00 14.60 ? 258 PRO B CD  1 
ATOM   4004 N N   . GLN B 1 255 ? -5.598  8.132   40.679  1.00 14.91 ? 259 GLN B N   1 
ATOM   4005 C CA  . GLN B 1 255 ? -6.525  7.051   40.396  1.00 15.01 ? 259 GLN B CA  1 
ATOM   4006 C C   . GLN B 1 255 ? -7.832  7.490   39.744  1.00 15.04 ? 259 GLN B C   1 
ATOM   4007 O O   . GLN B 1 255 ? -8.502  6.672   39.121  1.00 15.11 ? 259 GLN B O   1 
ATOM   4008 C CB  . GLN B 1 255 ? -6.800  6.251   41.658  1.00 14.96 ? 259 GLN B CB  1 
ATOM   4009 C CG  . GLN B 1 255 ? -5.743  5.206   41.918  1.00 15.78 ? 259 GLN B CG  1 
ATOM   4010 C CD  . GLN B 1 255 ? -5.833  4.613   43.307  1.00 17.13 ? 259 GLN B CD  1 
ATOM   4011 O OE1 . GLN B 1 255 ? -6.924  4.244   43.763  1.00 18.08 ? 259 GLN B OE1 1 
ATOM   4012 N NE2 . GLN B 1 255 ? -4.687  4.516   43.989  1.00 16.45 ? 259 GLN B NE2 1 
ATOM   4013 N N   . TYR B 1 256 ? -8.202  8.763   39.870  1.00 15.10 ? 260 TYR B N   1 
ATOM   4014 C CA  . TYR B 1 256 ? -9.458  9.209   39.271  1.00 15.39 ? 260 TYR B CA  1 
ATOM   4015 C C   . TYR B 1 256 ? -9.433  9.163   37.736  1.00 15.80 ? 260 TYR B C   1 
ATOM   4016 O O   . TYR B 1 256 ? -10.488 9.006   37.095  1.00 15.96 ? 260 TYR B O   1 
ATOM   4017 C CB  . TYR B 1 256 ? -9.966  10.550  39.835  1.00 15.12 ? 260 TYR B CB  1 
ATOM   4018 C CG  . TYR B 1 256 ? -9.000  11.709  39.820  1.00 14.88 ? 260 TYR B CG  1 
ATOM   4019 C CD1 . TYR B 1 256 ? -8.809  12.475  38.664  1.00 14.59 ? 260 TYR B CD1 1 
ATOM   4020 C CD2 . TYR B 1 256 ? -8.313  12.075  40.981  1.00 14.77 ? 260 TYR B CD2 1 
ATOM   4021 C CE1 . TYR B 1 256 ? -7.936  13.558  38.657  1.00 14.29 ? 260 TYR B CE1 1 
ATOM   4022 C CE2 . TYR B 1 256 ? -7.437  13.158  40.993  1.00 14.44 ? 260 TYR B CE2 1 
ATOM   4023 C CZ  . TYR B 1 256 ? -7.245  13.892  39.827  1.00 14.80 ? 260 TYR B CZ  1 
ATOM   4024 O OH  . TYR B 1 256 ? -6.371  14.962  39.836  1.00 14.83 ? 260 TYR B OH  1 
ATOM   4025 N N   . MET B 1 257 ? -8.230  9.266   37.165  1.00 16.06 ? 261 MET B N   1 
ATOM   4026 C CA  . MET B 1 257 ? -8.016  9.094   35.723  1.00 16.42 ? 261 MET B CA  1 
ATOM   4027 C C   . MET B 1 257 ? -8.149  7.611   35.341  1.00 16.61 ? 261 MET B C   1 
ATOM   4028 O O   . MET B 1 257 ? -7.161  6.969   34.958  1.00 16.52 ? 261 MET B O   1 
ATOM   4029 C CB  . MET B 1 257 ? -6.642  9.650   35.310  1.00 16.29 ? 261 MET B CB  1 
ATOM   4030 C CG  . MET B 1 257 ? -6.518  11.177  35.428  1.00 16.57 ? 261 MET B CG  1 
ATOM   4031 S SD  . MET B 1 257 ? -4.881  11.873  35.059  1.00 16.84 ? 261 MET B SD  1 
ATOM   4032 C CE  . MET B 1 257 ? -4.845  11.790  33.262  1.00 15.85 ? 261 MET B CE  1 
ATOM   4033 N N   . LYS B 1 258 ? -9.374  7.080   35.454  1.00 16.93 ? 262 LYS B N   1 
ATOM   4034 C CA  . LYS B 1 258 ? -9.652  5.650   35.244  1.00 17.23 ? 262 LYS B CA  1 
ATOM   4035 C C   . LYS B 1 258 ? -9.224  5.152   33.866  1.00 17.24 ? 262 LYS B C   1 
ATOM   4036 O O   . LYS B 1 258 ? -8.719  4.032   33.739  1.00 17.34 ? 262 LYS B O   1 
ATOM   4037 C CB  . LYS B 1 258 ? -11.139 5.328   35.447  1.00 17.41 ? 262 LYS B CB  1 
ATOM   4038 C CG  . LYS B 1 258 ? -11.554 5.046   36.881  1.00 18.49 ? 262 LYS B CG  1 
ATOM   4039 C CD  . LYS B 1 258 ? -12.396 6.186   37.463  1.00 20.41 ? 262 LYS B CD  1 
ATOM   4040 C CE  . LYS B 1 258 ? -12.039 6.474   38.939  1.00 21.18 ? 262 LYS B CE  1 
ATOM   4041 N NZ  . LYS B 1 258 ? -12.290 5.348   39.893  1.00 20.73 ? 262 LYS B NZ  1 
ATOM   4042 N N   . ASN B 1 259 ? -9.418  5.991   32.848  1.00 17.01 ? 263 ASN B N   1 
ATOM   4043 C CA  . ASN B 1 259 ? -9.220  5.588   31.459  1.00 16.88 ? 263 ASN B CA  1 
ATOM   4044 C C   . ASN B 1 259 ? -7.779  5.661   30.970  1.00 16.64 ? 263 ASN B C   1 
ATOM   4045 O O   . ASN B 1 259 ? -7.486  5.337   29.818  1.00 16.66 ? 263 ASN B O   1 
ATOM   4046 C CB  . ASN B 1 259 ? -10.155 6.388   30.558  1.00 17.04 ? 263 ASN B CB  1 
ATOM   4047 C CG  . ASN B 1 259 ? -11.617 6.227   30.960  1.00 18.05 ? 263 ASN B CG  1 
ATOM   4048 O OD1 . ASN B 1 259 ? -12.388 7.188   30.944  1.00 19.20 ? 263 ASN B OD1 1 
ATOM   4049 N ND2 . ASN B 1 259 ? -11.998 5.008   31.349  1.00 18.33 ? 263 ASN B ND2 1 
ATOM   4050 N N   . VAL B 1 260 ? -6.884  6.087   31.854  1.00 16.35 ? 264 VAL B N   1 
ATOM   4051 C CA  . VAL B 1 260 ? -5.469  6.168   31.535  1.00 16.21 ? 264 VAL B CA  1 
ATOM   4052 C C   . VAL B 1 260 ? -4.717  5.187   32.421  1.00 16.36 ? 264 VAL B C   1 
ATOM   4053 O O   . VAL B 1 260 ? -4.643  5.369   33.646  1.00 16.49 ? 264 VAL B O   1 
ATOM   4054 C CB  . VAL B 1 260 ? -4.916  7.596   31.715  1.00 16.15 ? 264 VAL B CB  1 
ATOM   4055 C CG1 . VAL B 1 260 ? -3.432  7.652   31.368  1.00 15.87 ? 264 VAL B CG1 1 
ATOM   4056 C CG2 . VAL B 1 260 ? -5.705  8.582   30.860  1.00 16.38 ? 264 VAL B CG2 1 
ATOM   4057 N N   . ASN B 1 261 ? -4.164  4.146   31.791  1.00 16.31 ? 265 ASN B N   1 
ATOM   4058 C CA  . ASN B 1 261 ? -3.516  3.039   32.513  1.00 16.00 ? 265 ASN B CA  1 
ATOM   4059 C C   . ASN B 1 261 ? -2.137  2.644   32.003  1.00 15.79 ? 265 ASN B C   1 
ATOM   4060 O O   . ASN B 1 261 ? -1.310  2.154   32.769  1.00 15.65 ? 265 ASN B O   1 
ATOM   4061 C CB  . ASN B 1 261 ? -4.436  1.818   32.546  1.00 15.85 ? 265 ASN B CB  1 
ATOM   4062 C CG  . ASN B 1 261 ? -5.594  2.007   33.489  1.00 15.69 ? 265 ASN B CG  1 
ATOM   4063 O OD1 . ASN B 1 261 ? -5.399  2.170   34.691  1.00 15.94 ? 265 ASN B OD1 1 
ATOM   4064 N ND2 . ASN B 1 261 ? -6.806  2.011   32.952  1.00 15.37 ? 265 ASN B ND2 1 
ATOM   4065 N N   . SER B 1 262 ? -1.904  2.840   30.709  1.00 15.48 ? 266 SER B N   1 
ATOM   4066 C CA  . SER B 1 262 ? -0.606  2.540   30.115  1.00 15.17 ? 266 SER B CA  1 
ATOM   4067 C C   . SER B 1 262 ? 0.052   3.818   29.601  1.00 15.07 ? 266 SER B C   1 
ATOM   4068 O O   . SER B 1 262 ? -0.621  4.824   29.360  1.00 14.99 ? 266 SER B O   1 
ATOM   4069 C CB  . SER B 1 262 ? -0.748  1.516   28.985  1.00 14.95 ? 266 SER B CB  1 
ATOM   4070 O OG  . SER B 1 262 ? 0.511   0.983   28.610  1.00 14.39 ? 266 SER B OG  1 
ATOM   4071 N N   . ILE B 1 263 ? 1.374   3.782   29.459  1.00 14.88 ? 267 ILE B N   1 
ATOM   4072 C CA  . ILE B 1 263 ? 2.077   4.842   28.763  1.00 14.48 ? 267 ILE B CA  1 
ATOM   4073 C C   . ILE B 1 263 ? 1.599   4.829   27.313  1.00 14.68 ? 267 ILE B C   1 
ATOM   4074 O O   . ILE B 1 263 ? 1.574   5.864   26.653  1.00 14.43 ? 267 ILE B O   1 
ATOM   4075 C CB  . ILE B 1 263 ? 3.615   4.665   28.865  1.00 14.47 ? 267 ILE B CB  1 
ATOM   4076 C CG1 . ILE B 1 263 ? 4.073   4.674   30.335  1.00 13.94 ? 267 ILE B CG1 1 
ATOM   4077 C CG2 . ILE B 1 263 ? 4.334   5.768   28.077  1.00 14.61 ? 267 ILE B CG2 1 
ATOM   4078 C CD1 . ILE B 1 263 ? 5.585   4.488   30.549  1.00 13.76 ? 267 ILE B CD1 1 
ATOM   4079 N N   . GLU B 1 264 ? 1.194   3.647   26.846  1.00 15.07 ? 268 GLU B N   1 
ATOM   4080 C CA  . GLU B 1 264 ? 0.648   3.447   25.495  1.00 15.63 ? 268 GLU B CA  1 
ATOM   4081 C C   . GLU B 1 264 ? -0.607  4.271   25.259  1.00 15.76 ? 268 GLU B C   1 
ATOM   4082 O O   . GLU B 1 264 ? -0.912  4.623   24.121  1.00 15.97 ? 268 GLU B O   1 
ATOM   4083 C CB  . GLU B 1 264 ? 0.295   1.973   25.260  1.00 15.78 ? 268 GLU B CB  1 
ATOM   4084 C CG  . GLU B 1 264 ? 1.458   0.993   25.330  1.00 16.57 ? 268 GLU B CG  1 
ATOM   4085 C CD  . GLU B 1 264 ? 2.156   0.806   23.998  1.00 17.61 ? 268 GLU B CD  1 
ATOM   4086 O OE1 . GLU B 1 264 ? 2.060   1.705   23.129  1.00 17.78 ? 268 GLU B OE1 1 
ATOM   4087 O OE2 . GLU B 1 264 ? 2.807   -0.251  23.824  1.00 18.34 ? 268 GLU B OE2 1 
ATOM   4088 N N   . ASP B 1 265 ? -1.337  4.558   26.338  1.00 15.97 ? 269 ASP B N   1 
ATOM   4089 C CA  . ASP B 1 265 ? -2.573  5.334   26.273  1.00 16.11 ? 269 ASP B CA  1 
ATOM   4090 C C   . ASP B 1 265 ? -2.295  6.780   25.905  1.00 16.11 ? 269 ASP B C   1 
ATOM   4091 O O   . ASP B 1 265 ? -3.208  7.503   25.529  1.00 16.35 ? 269 ASP B O   1 
ATOM   4092 C CB  . ASP B 1 265 ? -3.350  5.253   27.594  1.00 16.17 ? 269 ASP B CB  1 
ATOM   4093 C CG  . ASP B 1 265 ? -3.980  3.883   27.829  1.00 16.80 ? 269 ASP B CG  1 
ATOM   4094 O OD1 . ASP B 1 265 ? -4.538  3.666   28.927  1.00 17.58 ? 269 ASP B OD1 1 
ATOM   4095 O OD2 . ASP B 1 265 ? -3.969  2.958   26.986  1.00 17.81 ? 269 ASP B OD2 1 
ATOM   4096 N N   . LEU B 1 266 ? -1.033  7.189   25.999  1.00 16.24 ? 270 LEU B N   1 
ATOM   4097 C CA  . LEU B 1 266 ? -0.623  8.553   25.646  1.00 16.45 ? 270 LEU B CA  1 
ATOM   4098 C C   . LEU B 1 266 ? -0.475  8.735   24.135  1.00 16.61 ? 270 LEU B C   1 
ATOM   4099 O O   . LEU B 1 266 ? -0.593  9.843   23.622  1.00 16.67 ? 270 LEU B O   1 
ATOM   4100 C CB  . LEU B 1 266 ? 0.675   8.954   26.362  1.00 16.29 ? 270 LEU B CB  1 
ATOM   4101 C CG  . LEU B 1 266 ? 0.839   8.696   27.866  1.00 16.34 ? 270 LEU B CG  1 
ATOM   4102 C CD1 . LEU B 1 266 ? 2.058   9.421   28.402  1.00 15.98 ? 270 LEU B CD1 1 
ATOM   4103 C CD2 . LEU B 1 266 ? -0.397  9.094   28.659  1.00 16.70 ? 270 LEU B CD2 1 
ATOM   4104 N N   . LYS B 1 267 ? -0.222  7.642   23.426  1.00 16.91 ? 271 LYS B N   1 
ATOM   4105 C CA  . LYS B 1 267 ? -0.143  7.676   21.966  1.00 17.24 ? 271 LYS B CA  1 
ATOM   4106 C C   . LYS B 1 267 ? -1.493  8.027   21.313  1.00 17.45 ? 271 LYS B C   1 
ATOM   4107 O O   . LYS B 1 267 ? -1.529  8.579   20.206  1.00 17.55 ? 271 LYS B O   1 
ATOM   4108 C CB  . LYS B 1 267 ? 0.385   6.343   21.413  1.00 17.29 ? 271 LYS B CB  1 
ATOM   4109 C CG  . LYS B 1 267 ? 1.853   6.042   21.740  1.00 17.15 ? 271 LYS B CG  1 
ATOM   4110 C CD  . LYS B 1 267 ? 2.344   4.781   21.032  1.00 17.21 ? 271 LYS B CD  1 
ATOM   4111 C CE  . LYS B 1 267 ? 2.618   5.040   19.553  1.00 17.76 ? 271 LYS B CE  1 
ATOM   4112 N NZ  . LYS B 1 267 ? 2.578   3.785   18.726  1.00 17.96 ? 271 LYS B NZ  1 
ATOM   4113 N N   . LYS B 1 268 ? -2.592  7.714   22.004  1.00 17.56 ? 272 LYS B N   1 
ATOM   4114 C CA  . LYS B 1 268 ? -3.945  7.964   21.492  1.00 17.63 ? 272 LYS B CA  1 
ATOM   4115 C C   . LYS B 1 268 ? -4.218  9.462   21.350  1.00 17.65 ? 272 LYS B C   1 
ATOM   4116 O O   . LYS B 1 268 ? -4.356  9.976   20.246  1.00 17.65 ? 272 LYS B O   1 
ATOM   4117 C CB  . LYS B 1 268 ? -4.999  7.303   22.391  1.00 17.57 ? 272 LYS B CB  1 
ATOM   4118 C CG  . LYS B 1 268 ? -4.800  5.806   22.608  1.00 17.68 ? 272 LYS B CG  1 
ATOM   4119 C CD  . LYS B 1 268 ? -5.858  5.236   23.527  1.00 17.78 ? 272 LYS B CD  1 
ATOM   4120 C CE  . LYS B 1 268 ? -5.448  3.872   24.060  1.00 18.32 ? 272 LYS B CE  1 
ATOM   4121 N NZ  . LYS B 1 268 ? -6.231  3.516   25.281  1.00 18.32 ? 272 LYS B NZ  1 
ATOM   4122 O OXT . LYS B 1 268 ? -4.293  10.206  22.329  1.00 17.92 ? 272 LYS B OXT 1 
HETATM 4123 N N   . PBE C 2 .   ? 27.376  2.232   11.226  1.00 32.90 ? 311 PBE A N   1 
HETATM 4124 C CD  . PBE C 2 .   ? 27.040  1.911   9.818   1.00 32.82 ? 311 PBE A CD  1 
HETATM 4125 C CA  . PBE C 2 .   ? 26.084  2.705   11.784  1.00 32.75 ? 311 PBE A CA  1 
HETATM 4126 C CB  . PBE C 2 .   ? 25.081  1.694   11.233  1.00 32.65 ? 311 PBE A CB  1 
HETATM 4127 C CG  . PBE C 2 .   ? 25.541  1.564   9.780   1.00 32.68 ? 311 PBE A CG  1 
HETATM 4128 C CE  . PBE C 2 .   ? 27.978  1.035   11.840  1.00 32.99 ? 311 PBE A CE  1 
HETATM 4129 C CF  . PBE C 2 .   ? 28.350  3.339   11.279  1.00 33.06 ? 311 PBE A CF  1 
HETATM 4130 C C   . PBE C 2 .   ? 26.020  2.829   13.327  1.00 32.69 ? 311 PBE A C   1 
HETATM 4131 O O   . PBE C 2 .   ? 27.003  2.626   14.033  1.00 32.72 ? 311 PBE A O   1 
HETATM 4132 O OXT . PBE C 2 .   ? 24.976  3.163   13.886  1.00 32.73 ? 311 PBE A OXT 1 
HETATM 4133 N N   . PBE D 2 .   ? 14.562  10.009  42.833  1.00 52.12 ? 310 PBE B N   1 
HETATM 4134 C CD  . PBE D 2 .   ? 14.585  9.482   44.216  1.00 52.19 ? 310 PBE B CD  1 
HETATM 4135 C CA  . PBE D 2 .   ? 15.982  10.295  42.485  1.00 52.11 ? 310 PBE B CA  1 
HETATM 4136 C CB  . PBE D 2 .   ? 16.778  9.227   43.240  1.00 52.05 ? 310 PBE B CB  1 
HETATM 4137 C CG  . PBE D 2 .   ? 16.053  9.200   44.580  1.00 52.12 ? 310 PBE B CG  1 
HETATM 4138 C CE  . PBE D 2 .   ? 13.833  9.062   41.976  1.00 52.07 ? 310 PBE B CE  1 
HETATM 4139 C CF  . PBE D 2 .   ? 13.839  11.280  42.809  1.00 52.24 ? 310 PBE B CF  1 
HETATM 4140 C C   . PBE D 2 .   ? 16.306  10.278  40.968  1.00 52.13 ? 310 PBE B C   1 
HETATM 4141 O O   . PBE D 2 .   ? 15.933  9.365   40.240  1.00 52.46 ? 310 PBE B O   1 
HETATM 4142 O OXT . PBE D 2 .   ? 16.958  11.181  40.448  1.00 51.86 ? 310 PBE B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   5   ?   ?   ?   A . n 
A 1 2   GLU 2   6   ?   ?   ?   A . n 
A 1 3   ASN 3   7   ?   ?   ?   A . n 
A 1 4   ALA 4   8   ?   ?   ?   A . n 
A 1 5   SER 5   9   9   SER SER A . n 
A 1 6   ALA 6   10  10  ALA ALA A . n 
A 1 7   ALA 7   11  11  ALA ALA A . n 
A 1 8   GLU 8   12  12  GLU GLU A . n 
A 1 9   GLN 9   13  13  GLN GLN A . n 
A 1 10  VAL 10  14  14  VAL VAL A . n 
A 1 11  ASN 11  15  15  ASN ASN A . n 
A 1 12  LYS 12  16  16  LYS LYS A . n 
A 1 13  THR 13  17  17  THR THR A . n 
A 1 14  ILE 14  18  18  ILE ILE A . n 
A 1 15  ILE 15  19  19  ILE ILE A . n 
A 1 16  GLY 16  20  20  GLY GLY A . n 
A 1 17  ILE 17  21  21  ILE ILE A . n 
A 1 18  ASP 18  22  22  ASP ASP A . n 
A 1 19  PRO 19  23  23  PRO PRO A . n 
A 1 20  GLY 20  24  24  GLY GLY A . n 
A 1 21  SER 21  25  25  SER SER A . n 
A 1 22  GLY 22  26  26  GLY GLY A . n 
A 1 23  ILE 23  27  27  ILE ILE A . n 
A 1 24  MET 24  28  28  MET MET A . n 
A 1 25  SER 25  29  29  SER SER A . n 
A 1 26  LEU 26  30  30  LEU LEU A . n 
A 1 27  THR 27  31  31  THR THR A . n 
A 1 28  ASP 28  32  32  ASP ASP A . n 
A 1 29  LYS 29  33  33  LYS LYS A . n 
A 1 30  ALA 30  34  34  ALA ALA A . n 
A 1 31  MET 31  35  35  MET MET A . n 
A 1 32  LYS 32  36  36  LYS LYS A . n 
A 1 33  ASP 33  37  37  ASP ASP A . n 
A 1 34  TYR 34  38  38  TYR TYR A . n 
A 1 35  ASP 35  39  39  ASP ASP A . n 
A 1 36  LEU 36  40  40  LEU LEU A . n 
A 1 37  ASN 37  41  41  ASN ASN A . n 
A 1 38  ASP 38  42  42  ASP ASP A . n 
A 1 39  TRP 39  43  43  TRP TRP A . n 
A 1 40  THR 40  44  44  THR THR A . n 
A 1 41  LEU 41  45  45  LEU LEU A . n 
A 1 42  ILE 42  46  46  ILE ILE A . n 
A 1 43  SER 43  47  47  SER SER A . n 
A 1 44  ALA 44  48  48  ALA ALA A . n 
A 1 45  SER 45  49  49  SER SER A . n 
A 1 46  SER 46  50  50  SER SER A . n 
A 1 47  ALA 47  51  51  ALA ALA A . n 
A 1 48  ALA 48  52  52  ALA ALA A . n 
A 1 49  MET 49  53  53  MET MET A . n 
A 1 50  THR 50  54  54  THR THR A . n 
A 1 51  ALA 51  55  55  ALA ALA A . n 
A 1 52  THR 52  56  56  THR THR A . n 
A 1 53  LEU 53  57  57  LEU LEU A . n 
A 1 54  LYS 54  58  58  LYS LYS A . n 
A 1 55  LYS 55  59  59  LYS LYS A . n 
A 1 56  SER 56  60  60  SER SER A . n 
A 1 57  TYR 57  61  61  TYR TYR A . n 
A 1 58  ASP 58  62  62  ASP ASP A . n 
A 1 59  ARG 59  63  63  ARG ARG A . n 
A 1 60  LYS 60  64  64  LYS LYS A . n 
A 1 61  LYS 61  65  65  LYS LYS A . n 
A 1 62  PRO 62  66  66  PRO PRO A . n 
A 1 63  ILE 63  67  67  ILE ILE A . n 
A 1 64  ILE 64  68  68  ILE ILE A . n 
A 1 65  ILE 65  69  69  ILE ILE A . n 
A 1 66  THR 66  70  70  THR THR A . n 
A 1 67  GLY 67  71  71  GLY GLY A . n 
A 1 68  TRP 68  72  72  TRP TRP A . n 
A 1 69  THR 69  73  73  THR THR A . n 
A 1 70  PRO 70  74  74  PRO PRO A . n 
A 1 71  HIS 71  75  75  HIS HIS A . n 
A 1 72  TRP 72  76  76  TRP TRP A . n 
A 1 73  MET 73  77  77  MET MET A . n 
A 1 74  PHE 74  78  78  PHE PHE A . n 
A 1 75  SER 75  79  79  SER SER A . n 
A 1 76  ARG 76  80  80  ARG ARG A . n 
A 1 77  TYR 77  81  81  TYR TYR A . n 
A 1 78  LYS 78  82  82  LYS LYS A . n 
A 1 79  LEU 79  83  83  LEU LEU A . n 
A 1 80  LYS 80  84  84  LYS LYS A . n 
A 1 81  TYR 81  85  85  TYR TYR A . n 
A 1 82  LEU 82  86  86  LEU LEU A . n 
A 1 83  ASP 83  87  87  ASP ASP A . n 
A 1 84  ASP 84  88  88  ASP ASP A . n 
A 1 85  PRO 85  89  89  PRO PRO A . n 
A 1 86  LYS 86  90  90  LYS LYS A . n 
A 1 87  GLN 87  91  91  GLN GLN A . n 
A 1 88  SER 88  92  92  SER SER A . n 
A 1 89  TYR 89  93  93  TYR TYR A . n 
A 1 90  GLY 90  94  94  GLY GLY A . n 
A 1 91  SER 91  95  95  SER SER A . n 
A 1 92  ALA 92  96  96  ALA ALA A . n 
A 1 93  GLU 93  97  97  GLU GLU A . n 
A 1 94  GLU 94  98  98  GLU GLU A . n 
A 1 95  ILE 95  99  99  ILE ILE A . n 
A 1 96  HIS 96  100 100 HIS HIS A . n 
A 1 97  THR 97  101 101 THR THR A . n 
A 1 98  ILE 98  102 102 ILE ILE A . n 
A 1 99  THR 99  103 103 THR THR A . n 
A 1 100 ARG 100 104 104 ARG ARG A . n 
A 1 101 LYS 101 105 105 LYS LYS A . n 
A 1 102 GLY 102 106 106 GLY GLY A . n 
A 1 103 PHE 103 107 107 PHE PHE A . n 
A 1 104 SER 104 108 108 SER SER A . n 
A 1 105 LYS 105 109 109 LYS LYS A . n 
A 1 106 GLU 106 110 110 GLU GLU A . n 
A 1 107 GLN 107 111 111 GLN GLN A . n 
A 1 108 PRO 108 112 112 PRO PRO A . n 
A 1 109 ASN 109 113 113 ASN ASN A . n 
A 1 110 ALA 110 114 114 ALA ALA A . n 
A 1 111 ALA 111 115 115 ALA ALA A . n 
A 1 112 LYS 112 116 116 LYS LYS A . n 
A 1 113 LEU 113 117 117 LEU LEU A . n 
A 1 114 LEU 114 118 118 LEU LEU A . n 
A 1 115 SER 115 119 119 SER SER A . n 
A 1 116 GLN 116 120 120 GLN GLN A . n 
A 1 117 PHE 117 121 121 PHE PHE A . n 
A 1 118 LYS 118 122 122 LYS LYS A . n 
A 1 119 TRP 119 123 123 TRP TRP A . n 
A 1 120 THR 120 124 124 THR THR A . n 
A 1 121 GLN 121 125 125 GLN GLN A . n 
A 1 122 ASP 122 126 126 ASP ASP A . n 
A 1 123 GLU 123 127 127 GLU GLU A . n 
A 1 124 MET 124 128 128 MET MET A . n 
A 1 125 GLY 125 129 129 GLY GLY A . n 
A 1 126 GLU 126 130 130 GLU GLU A . n 
A 1 127 ILE 127 131 131 ILE ILE A . n 
A 1 128 MET 128 132 132 MET MET A . n 
A 1 129 ILE 129 133 133 ILE ILE A . n 
A 1 130 LYS 130 134 134 LYS LYS A . n 
A 1 131 VAL 131 135 135 VAL VAL A . n 
A 1 132 GLU 132 136 136 GLU GLU A . n 
A 1 133 GLU 133 137 137 GLU GLU A . n 
A 1 134 GLY 134 138 138 GLY GLY A . n 
A 1 135 GLU 135 139 139 GLU GLU A . n 
A 1 136 LYS 136 140 140 LYS LYS A . n 
A 1 137 PRO 137 141 141 PRO PRO A . n 
A 1 138 ALA 138 142 142 ALA ALA A . n 
A 1 139 LYS 139 143 143 LYS LYS A . n 
A 1 140 VAL 140 144 144 VAL VAL A . n 
A 1 141 ALA 141 145 145 ALA ALA A . n 
A 1 142 ALA 142 146 146 ALA ALA A . n 
A 1 143 GLU 143 147 147 GLU GLU A . n 
A 1 144 TYR 144 148 148 TYR TYR A . n 
A 1 145 VAL 145 149 149 VAL VAL A . n 
A 1 146 ASN 146 150 150 ASN ASN A . n 
A 1 147 LYS 147 151 151 LYS LYS A . n 
A 1 148 HIS 148 152 152 HIS HIS A . n 
A 1 149 LYS 149 153 153 LYS LYS A . n 
A 1 150 ASP 150 154 154 ASP ASP A . n 
A 1 151 GLN 151 155 155 GLN GLN A . n 
A 1 152 ILE 152 156 156 ILE ILE A . n 
A 1 153 ALA 153 157 157 ALA ALA A . n 
A 1 154 GLU 154 158 158 GLU GLU A . n 
A 1 155 TRP 155 159 159 TRP TRP A . n 
A 1 156 THR 156 160 160 THR THR A . n 
A 1 157 LYS 157 161 161 LYS LYS A . n 
A 1 158 GLY 158 162 162 GLY GLY A . n 
A 1 159 VAL 159 163 163 VAL VAL A . n 
A 1 160 GLN 160 164 164 GLN GLN A . n 
A 1 161 LYS 161 165 165 LYS LYS A . n 
A 1 162 VAL 162 166 166 VAL VAL A . n 
A 1 163 LYS 163 167 167 LYS LYS A . n 
A 1 164 GLY 164 168 168 GLY GLY A . n 
A 1 165 ASP 165 169 169 ASP ASP A . n 
A 1 166 LYS 166 170 170 LYS LYS A . n 
A 1 167 ILE 167 171 171 ILE ILE A . n 
A 1 168 ASN 168 172 172 ASN ASN A . n 
A 1 169 LEU 169 173 173 LEU LEU A . n 
A 1 170 ALA 170 174 174 ALA ALA A . n 
A 1 171 TYR 171 175 175 TYR TYR A . n 
A 1 172 VAL 172 176 176 VAL VAL A . n 
A 1 173 ALA 173 177 177 ALA ALA A . n 
A 1 174 TRP 174 178 178 TRP TRP A . n 
A 1 175 ASP 175 179 179 ASP ASP A . n 
A 1 176 SER 176 180 180 SER SER A . n 
A 1 177 GLU 177 181 181 GLU GLU A . n 
A 1 178 ILE 178 182 182 ILE ILE A . n 
A 1 179 ALA 179 183 183 ALA ALA A . n 
A 1 180 SER 180 184 184 SER SER A . n 
A 1 181 THR 181 185 185 THR THR A . n 
A 1 182 ASN 182 186 186 ASN ASN A . n 
A 1 183 VAL 183 187 187 VAL VAL A . n 
A 1 184 ILE 184 188 188 ILE ILE A . n 
A 1 185 GLY 185 189 189 GLY GLY A . n 
A 1 186 LYS 186 190 190 LYS LYS A . n 
A 1 187 VAL 187 191 191 VAL VAL A . n 
A 1 188 LEU 188 192 192 LEU LEU A . n 
A 1 189 GLU 189 193 193 GLU GLU A . n 
A 1 190 ASP 190 194 194 ASP ASP A . n 
A 1 191 LEU 191 195 195 LEU LEU A . n 
A 1 192 GLY 192 196 196 GLY GLY A . n 
A 1 193 TYR 193 197 197 TYR TYR A . n 
A 1 194 GLU 194 198 198 GLU GLU A . n 
A 1 195 VAL 195 199 199 VAL VAL A . n 
A 1 196 THR 196 200 200 THR THR A . n 
A 1 197 LEU 197 201 201 LEU LEU A . n 
A 1 198 THR 198 202 202 THR THR A . n 
A 1 199 GLN 199 203 203 GLN GLN A . n 
A 1 200 VAL 200 204 204 VAL VAL A . n 
A 1 201 GLU 201 205 205 GLU GLU A . n 
A 1 202 ALA 202 206 206 ALA ALA A . n 
A 1 203 GLY 203 207 207 GLY GLY A . n 
A 1 204 PRO 204 208 208 PRO PRO A . n 
A 1 205 MET 205 209 209 MET MET A . n 
A 1 206 TRP 206 210 210 TRP TRP A . n 
A 1 207 THR 207 211 211 THR THR A . n 
A 1 208 ALA 208 212 212 ALA ALA A . n 
A 1 209 ILE 209 213 213 ILE ILE A . n 
A 1 210 ALA 210 214 214 ALA ALA A . n 
A 1 211 THR 211 215 215 THR THR A . n 
A 1 212 GLY 212 216 216 GLY GLY A . n 
A 1 213 SER 213 217 217 SER SER A . n 
A 1 214 ALA 214 218 218 ALA ALA A . n 
A 1 215 ASP 215 219 219 ASP ASP A . n 
A 1 216 ALA 216 220 220 ALA ALA A . n 
A 1 217 SER 217 221 221 SER SER A . n 
A 1 218 LEU 218 222 222 LEU LEU A . n 
A 1 219 SER 219 223 223 SER SER A . n 
A 1 220 ALA 220 224 224 ALA ALA A . n 
A 1 221 TRP 221 225 225 TRP TRP A . n 
A 1 222 LEU 222 226 226 LEU LEU A . n 
A 1 223 PRO 223 227 227 PRO PRO A . n 
A 1 224 ASN 224 228 228 ASN ASN A . n 
A 1 225 THR 225 229 229 THR THR A . n 
A 1 226 HIS 226 230 230 HIS HIS A . n 
A 1 227 LYS 227 231 231 LYS LYS A . n 
A 1 228 ALA 228 232 232 ALA ALA A . n 
A 1 229 TYR 229 233 233 TYR TYR A . n 
A 1 230 ALA 230 234 234 ALA ALA A . n 
A 1 231 ALA 231 235 235 ALA ALA A . n 
A 1 232 LYS 232 236 236 LYS LYS A . n 
A 1 233 TYR 233 237 237 TYR TYR A . n 
A 1 234 LYS 234 238 238 LYS LYS A . n 
A 1 235 GLY 235 239 239 GLY GLY A . n 
A 1 236 LYS 236 240 240 LYS LYS A . n 
A 1 237 TYR 237 241 241 TYR TYR A . n 
A 1 238 ASP 238 242 242 ASP ASP A . n 
A 1 239 ASP 239 243 243 ASP ASP A . n 
A 1 240 ILE 240 244 244 ILE ILE A . n 
A 1 241 GLY 241 245 245 GLY GLY A . n 
A 1 242 THR 242 246 246 THR THR A . n 
A 1 243 SER 243 247 247 SER SER A . n 
A 1 244 MET 244 248 248 MET MET A . n 
A 1 245 THR 245 249 249 THR THR A . n 
A 1 246 GLY 246 250 250 GLY GLY A . n 
A 1 247 VAL 247 251 251 VAL VAL A . n 
A 1 248 LYS 248 252 252 LYS LYS A . n 
A 1 249 MET 249 253 253 MET MET A . n 
A 1 250 GLY 250 254 254 GLY GLY A . n 
A 1 251 LEU 251 255 255 LEU LEU A . n 
A 1 252 VAL 252 256 256 VAL VAL A . n 
A 1 253 VAL 253 257 257 VAL VAL A . n 
A 1 254 PRO 254 258 258 PRO PRO A . n 
A 1 255 GLN 255 259 259 GLN GLN A . n 
A 1 256 TYR 256 260 260 TYR TYR A . n 
A 1 257 MET 257 261 261 MET MET A . n 
A 1 258 LYS 258 262 262 LYS LYS A . n 
A 1 259 ASN 259 263 263 ASN ASN A . n 
A 1 260 VAL 260 264 264 VAL VAL A . n 
A 1 261 ASN 261 265 265 ASN ASN A . n 
A 1 262 SER 262 266 266 SER SER A . n 
A 1 263 ILE 263 267 267 ILE ILE A . n 
A 1 264 GLU 264 268 268 GLU GLU A . n 
A 1 265 ASP 265 269 269 ASP ASP A . n 
A 1 266 LEU 266 270 270 LEU LEU A . n 
A 1 267 LYS 267 271 271 LYS LYS A . n 
A 1 268 LYS 268 272 272 LYS LYS A . n 
B 1 1   ASP 1   5   ?   ?   ?   B . n 
B 1 2   GLU 2   6   ?   ?   ?   B . n 
B 1 3   ASN 3   7   ?   ?   ?   B . n 
B 1 4   ALA 4   8   ?   ?   ?   B . n 
B 1 5   SER 5   9   9   SER SER B . n 
B 1 6   ALA 6   10  10  ALA ALA B . n 
B 1 7   ALA 7   11  11  ALA ALA B . n 
B 1 8   GLU 8   12  12  GLU GLU B . n 
B 1 9   GLN 9   13  13  GLN GLN B . n 
B 1 10  VAL 10  14  14  VAL VAL B . n 
B 1 11  ASN 11  15  15  ASN ASN B . n 
B 1 12  LYS 12  16  16  LYS LYS B . n 
B 1 13  THR 13  17  17  THR THR B . n 
B 1 14  ILE 14  18  18  ILE ILE B . n 
B 1 15  ILE 15  19  19  ILE ILE B . n 
B 1 16  GLY 16  20  20  GLY GLY B . n 
B 1 17  ILE 17  21  21  ILE ILE B . n 
B 1 18  ASP 18  22  22  ASP ASP B . n 
B 1 19  PRO 19  23  23  PRO PRO B . n 
B 1 20  GLY 20  24  24  GLY GLY B . n 
B 1 21  SER 21  25  25  SER SER B . n 
B 1 22  GLY 22  26  26  GLY GLY B . n 
B 1 23  ILE 23  27  27  ILE ILE B . n 
B 1 24  MET 24  28  28  MET MET B . n 
B 1 25  SER 25  29  29  SER SER B . n 
B 1 26  LEU 26  30  30  LEU LEU B . n 
B 1 27  THR 27  31  31  THR THR B . n 
B 1 28  ASP 28  32  32  ASP ASP B . n 
B 1 29  LYS 29  33  33  LYS LYS B . n 
B 1 30  ALA 30  34  34  ALA ALA B . n 
B 1 31  MET 31  35  35  MET MET B . n 
B 1 32  LYS 32  36  36  LYS LYS B . n 
B 1 33  ASP 33  37  37  ASP ASP B . n 
B 1 34  TYR 34  38  38  TYR TYR B . n 
B 1 35  ASP 35  39  39  ASP ASP B . n 
B 1 36  LEU 36  40  40  LEU LEU B . n 
B 1 37  ASN 37  41  41  ASN ASN B . n 
B 1 38  ASP 38  42  42  ASP ASP B . n 
B 1 39  TRP 39  43  43  TRP TRP B . n 
B 1 40  THR 40  44  44  THR THR B . n 
B 1 41  LEU 41  45  45  LEU LEU B . n 
B 1 42  ILE 42  46  46  ILE ILE B . n 
B 1 43  SER 43  47  47  SER SER B . n 
B 1 44  ALA 44  48  48  ALA ALA B . n 
B 1 45  SER 45  49  49  SER SER B . n 
B 1 46  SER 46  50  50  SER SER B . n 
B 1 47  ALA 47  51  51  ALA ALA B . n 
B 1 48  ALA 48  52  52  ALA ALA B . n 
B 1 49  MET 49  53  53  MET MET B . n 
B 1 50  THR 50  54  54  THR THR B . n 
B 1 51  ALA 51  55  55  ALA ALA B . n 
B 1 52  THR 52  56  56  THR THR B . n 
B 1 53  LEU 53  57  57  LEU LEU B . n 
B 1 54  LYS 54  58  58  LYS LYS B . n 
B 1 55  LYS 55  59  59  LYS LYS B . n 
B 1 56  SER 56  60  60  SER SER B . n 
B 1 57  TYR 57  61  61  TYR TYR B . n 
B 1 58  ASP 58  62  62  ASP ASP B . n 
B 1 59  ARG 59  63  63  ARG ARG B . n 
B 1 60  LYS 60  64  64  LYS LYS B . n 
B 1 61  LYS 61  65  65  LYS LYS B . n 
B 1 62  PRO 62  66  66  PRO PRO B . n 
B 1 63  ILE 63  67  67  ILE ILE B . n 
B 1 64  ILE 64  68  68  ILE ILE B . n 
B 1 65  ILE 65  69  69  ILE ILE B . n 
B 1 66  THR 66  70  70  THR THR B . n 
B 1 67  GLY 67  71  71  GLY GLY B . n 
B 1 68  TRP 68  72  72  TRP TRP B . n 
B 1 69  THR 69  73  73  THR THR B . n 
B 1 70  PRO 70  74  74  PRO PRO B . n 
B 1 71  HIS 71  75  75  HIS HIS B . n 
B 1 72  TRP 72  76  76  TRP TRP B . n 
B 1 73  MET 73  77  77  MET MET B . n 
B 1 74  PHE 74  78  78  PHE PHE B . n 
B 1 75  SER 75  79  79  SER SER B . n 
B 1 76  ARG 76  80  80  ARG ARG B . n 
B 1 77  TYR 77  81  81  TYR TYR B . n 
B 1 78  LYS 78  82  82  LYS LYS B . n 
B 1 79  LEU 79  83  83  LEU LEU B . n 
B 1 80  LYS 80  84  84  LYS LYS B . n 
B 1 81  TYR 81  85  85  TYR TYR B . n 
B 1 82  LEU 82  86  86  LEU LEU B . n 
B 1 83  ASP 83  87  87  ASP ASP B . n 
B 1 84  ASP 84  88  88  ASP ASP B . n 
B 1 85  PRO 85  89  89  PRO PRO B . n 
B 1 86  LYS 86  90  90  LYS LYS B . n 
B 1 87  GLN 87  91  91  GLN GLN B . n 
B 1 88  SER 88  92  92  SER SER B . n 
B 1 89  TYR 89  93  93  TYR TYR B . n 
B 1 90  GLY 90  94  94  GLY GLY B . n 
B 1 91  SER 91  95  95  SER SER B . n 
B 1 92  ALA 92  96  96  ALA ALA B . n 
B 1 93  GLU 93  97  97  GLU GLU B . n 
B 1 94  GLU 94  98  98  GLU GLU B . n 
B 1 95  ILE 95  99  99  ILE ILE B . n 
B 1 96  HIS 96  100 100 HIS HIS B . n 
B 1 97  THR 97  101 101 THR THR B . n 
B 1 98  ILE 98  102 102 ILE ILE B . n 
B 1 99  THR 99  103 103 THR THR B . n 
B 1 100 ARG 100 104 104 ARG ARG B . n 
B 1 101 LYS 101 105 105 LYS LYS B . n 
B 1 102 GLY 102 106 106 GLY GLY B . n 
B 1 103 PHE 103 107 107 PHE PHE B . n 
B 1 104 SER 104 108 108 SER SER B . n 
B 1 105 LYS 105 109 109 LYS LYS B . n 
B 1 106 GLU 106 110 110 GLU GLU B . n 
B 1 107 GLN 107 111 111 GLN GLN B . n 
B 1 108 PRO 108 112 112 PRO PRO B . n 
B 1 109 ASN 109 113 113 ASN ASN B . n 
B 1 110 ALA 110 114 114 ALA ALA B . n 
B 1 111 ALA 111 115 115 ALA ALA B . n 
B 1 112 LYS 112 116 116 LYS LYS B . n 
B 1 113 LEU 113 117 117 LEU LEU B . n 
B 1 114 LEU 114 118 118 LEU LEU B . n 
B 1 115 SER 115 119 119 SER SER B . n 
B 1 116 GLN 116 120 120 GLN GLN B . n 
B 1 117 PHE 117 121 121 PHE PHE B . n 
B 1 118 LYS 118 122 122 LYS LYS B . n 
B 1 119 TRP 119 123 123 TRP TRP B . n 
B 1 120 THR 120 124 124 THR THR B . n 
B 1 121 GLN 121 125 125 GLN GLN B . n 
B 1 122 ASP 122 126 126 ASP ASP B . n 
B 1 123 GLU 123 127 127 GLU GLU B . n 
B 1 124 MET 124 128 128 MET MET B . n 
B 1 125 GLY 125 129 129 GLY GLY B . n 
B 1 126 GLU 126 130 130 GLU GLU B . n 
B 1 127 ILE 127 131 131 ILE ILE B . n 
B 1 128 MET 128 132 132 MET MET B . n 
B 1 129 ILE 129 133 133 ILE ILE B . n 
B 1 130 LYS 130 134 134 LYS LYS B . n 
B 1 131 VAL 131 135 135 VAL VAL B . n 
B 1 132 GLU 132 136 136 GLU GLU B . n 
B 1 133 GLU 133 137 137 GLU GLU B . n 
B 1 134 GLY 134 138 138 GLY GLY B . n 
B 1 135 GLU 135 139 139 GLU GLU B . n 
B 1 136 LYS 136 140 140 LYS LYS B . n 
B 1 137 PRO 137 141 141 PRO PRO B . n 
B 1 138 ALA 138 142 142 ALA ALA B . n 
B 1 139 LYS 139 143 143 LYS LYS B . n 
B 1 140 VAL 140 144 144 VAL VAL B . n 
B 1 141 ALA 141 145 145 ALA ALA B . n 
B 1 142 ALA 142 146 146 ALA ALA B . n 
B 1 143 GLU 143 147 147 GLU GLU B . n 
B 1 144 TYR 144 148 148 TYR TYR B . n 
B 1 145 VAL 145 149 149 VAL VAL B . n 
B 1 146 ASN 146 150 150 ASN ASN B . n 
B 1 147 LYS 147 151 151 LYS LYS B . n 
B 1 148 HIS 148 152 152 HIS HIS B . n 
B 1 149 LYS 149 153 153 LYS LYS B . n 
B 1 150 ASP 150 154 154 ASP ASP B . n 
B 1 151 GLN 151 155 155 GLN GLN B . n 
B 1 152 ILE 152 156 156 ILE ILE B . n 
B 1 153 ALA 153 157 157 ALA ALA B . n 
B 1 154 GLU 154 158 158 GLU GLU B . n 
B 1 155 TRP 155 159 159 TRP TRP B . n 
B 1 156 THR 156 160 160 THR THR B . n 
B 1 157 LYS 157 161 161 LYS LYS B . n 
B 1 158 GLY 158 162 162 GLY GLY B . n 
B 1 159 VAL 159 163 163 VAL VAL B . n 
B 1 160 GLN 160 164 164 GLN GLN B . n 
B 1 161 LYS 161 165 165 LYS LYS B . n 
B 1 162 VAL 162 166 166 VAL VAL B . n 
B 1 163 LYS 163 167 167 LYS LYS B . n 
B 1 164 GLY 164 168 168 GLY GLY B . n 
B 1 165 ASP 165 169 169 ASP ASP B . n 
B 1 166 LYS 166 170 170 LYS LYS B . n 
B 1 167 ILE 167 171 171 ILE ILE B . n 
B 1 168 ASN 168 172 172 ASN ASN B . n 
B 1 169 LEU 169 173 173 LEU LEU B . n 
B 1 170 ALA 170 174 174 ALA ALA B . n 
B 1 171 TYR 171 175 175 TYR TYR B . n 
B 1 172 VAL 172 176 176 VAL VAL B . n 
B 1 173 ALA 173 177 177 ALA ALA B . n 
B 1 174 TRP 174 178 178 TRP TRP B . n 
B 1 175 ASP 175 179 179 ASP ASP B . n 
B 1 176 SER 176 180 180 SER SER B . n 
B 1 177 GLU 177 181 181 GLU GLU B . n 
B 1 178 ILE 178 182 182 ILE ILE B . n 
B 1 179 ALA 179 183 183 ALA ALA B . n 
B 1 180 SER 180 184 184 SER SER B . n 
B 1 181 THR 181 185 185 THR THR B . n 
B 1 182 ASN 182 186 186 ASN ASN B . n 
B 1 183 VAL 183 187 187 VAL VAL B . n 
B 1 184 ILE 184 188 188 ILE ILE B . n 
B 1 185 GLY 185 189 189 GLY GLY B . n 
B 1 186 LYS 186 190 190 LYS LYS B . n 
B 1 187 VAL 187 191 191 VAL VAL B . n 
B 1 188 LEU 188 192 192 LEU LEU B . n 
B 1 189 GLU 189 193 193 GLU GLU B . n 
B 1 190 ASP 190 194 194 ASP ASP B . n 
B 1 191 LEU 191 195 195 LEU LEU B . n 
B 1 192 GLY 192 196 196 GLY GLY B . n 
B 1 193 TYR 193 197 197 TYR TYR B . n 
B 1 194 GLU 194 198 198 GLU GLU B . n 
B 1 195 VAL 195 199 199 VAL VAL B . n 
B 1 196 THR 196 200 200 THR THR B . n 
B 1 197 LEU 197 201 201 LEU LEU B . n 
B 1 198 THR 198 202 202 THR THR B . n 
B 1 199 GLN 199 203 203 GLN GLN B . n 
B 1 200 VAL 200 204 204 VAL VAL B . n 
B 1 201 GLU 201 205 205 GLU GLU B . n 
B 1 202 ALA 202 206 206 ALA ALA B . n 
B 1 203 GLY 203 207 207 GLY GLY B . n 
B 1 204 PRO 204 208 208 PRO PRO B . n 
B 1 205 MET 205 209 209 MET MET B . n 
B 1 206 TRP 206 210 210 TRP TRP B . n 
B 1 207 THR 207 211 211 THR THR B . n 
B 1 208 ALA 208 212 212 ALA ALA B . n 
B 1 209 ILE 209 213 213 ILE ILE B . n 
B 1 210 ALA 210 214 214 ALA ALA B . n 
B 1 211 THR 211 215 215 THR THR B . n 
B 1 212 GLY 212 216 216 GLY GLY B . n 
B 1 213 SER 213 217 217 SER SER B . n 
B 1 214 ALA 214 218 218 ALA ALA B . n 
B 1 215 ASP 215 219 219 ASP ASP B . n 
B 1 216 ALA 216 220 220 ALA ALA B . n 
B 1 217 SER 217 221 221 SER SER B . n 
B 1 218 LEU 218 222 222 LEU LEU B . n 
B 1 219 SER 219 223 223 SER SER B . n 
B 1 220 ALA 220 224 224 ALA ALA B . n 
B 1 221 TRP 221 225 225 TRP TRP B . n 
B 1 222 LEU 222 226 226 LEU LEU B . n 
B 1 223 PRO 223 227 227 PRO PRO B . n 
B 1 224 ASN 224 228 228 ASN ASN B . n 
B 1 225 THR 225 229 229 THR THR B . n 
B 1 226 HIS 226 230 230 HIS HIS B . n 
B 1 227 LYS 227 231 231 LYS LYS B . n 
B 1 228 ALA 228 232 232 ALA ALA B . n 
B 1 229 TYR 229 233 233 TYR TYR B . n 
B 1 230 ALA 230 234 234 ALA ALA B . n 
B 1 231 ALA 231 235 235 ALA ALA B . n 
B 1 232 LYS 232 236 236 LYS LYS B . n 
B 1 233 TYR 233 237 237 TYR TYR B . n 
B 1 234 LYS 234 238 238 LYS LYS B . n 
B 1 235 GLY 235 239 239 GLY GLY B . n 
B 1 236 LYS 236 240 240 LYS LYS B . n 
B 1 237 TYR 237 241 241 TYR TYR B . n 
B 1 238 ASP 238 242 242 ASP ASP B . n 
B 1 239 ASP 239 243 243 ASP ASP B . n 
B 1 240 ILE 240 244 244 ILE ILE B . n 
B 1 241 GLY 241 245 245 GLY GLY B . n 
B 1 242 THR 242 246 246 THR THR B . n 
B 1 243 SER 243 247 247 SER SER B . n 
B 1 244 MET 244 248 248 MET MET B . n 
B 1 245 THR 245 249 249 THR THR B . n 
B 1 246 GLY 246 250 250 GLY GLY B . n 
B 1 247 VAL 247 251 251 VAL VAL B . n 
B 1 248 LYS 248 252 252 LYS LYS B . n 
B 1 249 MET 249 253 253 MET MET B . n 
B 1 250 GLY 250 254 254 GLY GLY B . n 
B 1 251 LEU 251 255 255 LEU LEU B . n 
B 1 252 VAL 252 256 256 VAL VAL B . n 
B 1 253 VAL 253 257 257 VAL VAL B . n 
B 1 254 PRO 254 258 258 PRO PRO B . n 
B 1 255 GLN 255 259 259 GLN GLN B . n 
B 1 256 TYR 256 260 260 TYR TYR B . n 
B 1 257 MET 257 261 261 MET MET B . n 
B 1 258 LYS 258 262 262 LYS LYS B . n 
B 1 259 ASN 259 263 263 ASN ASN B . n 
B 1 260 VAL 260 264 264 VAL VAL B . n 
B 1 261 ASN 261 265 265 ASN ASN B . n 
B 1 262 SER 262 266 266 SER SER B . n 
B 1 263 ILE 263 267 267 ILE ILE B . n 
B 1 264 GLU 264 268 268 GLU GLU B . n 
B 1 265 ASP 265 269 269 ASP ASP B . n 
B 1 266 LEU 266 270 270 LEU LEU B . n 
B 1 267 LYS 267 271 271 LYS LYS B . n 
B 1 268 LYS 268 272 272 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PBE 1 311 311 PBE PBE A . 
D 2 PBE 1 310 310 PBE PBE B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 26.9030 0.0370 7.1210  0.2829 0.1465 0.1333 0.0282  -0.1086 -0.0026 2.6778 1.1662 0.9594 0.6295  0.7075 0.2023  0.0132 
0.1177  -0.0278 -0.0270 0.0321  -0.0972 -0.0155 0.0710 -0.0453 'X-RAY DIFFRACTION' 
2 ? refined 14.7690 7.4510 46.7190 0.1903 0.3373 0.1750 -0.0293 -0.0970 0.0105  1.4809 1.5881 2.2104 -0.3098 1.1193 -0.3955 0.0960 
-0.2940 0.0279  0.0598  -0.0501 -0.1686 0.0410  0.1448 -0.0459 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 9 A 5 A 272 A 268 ? 'X-RAY DIFFRACTION' ? 
2 2 B 9 B 5 B 272 B 268 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0000 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
AMoRE     phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    104 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OE1 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   GLU 
_pdbx_validate_close_contact.auth_seq_id_2    110 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.78 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CD  A LYS 140 ? ? 1_555 OE2 A GLU 158 ? ? 1_565 1.89 
2 1 NH1 B ARG 63  ? ? 1_555 OE2 B GLU 137 ? ? 2_556 2.05 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 39  ? ? CG A ASP 39  ? ? OD2 A ASP 39  ? ? 124.56 118.30 6.26 0.90 N 
2 1 CB A ASP 243 ? ? CG A ASP 243 ? ? OD2 A ASP 243 ? ? 124.90 118.30 6.60 0.90 N 
3 1 CB A ASP 269 ? ? CG A ASP 269 ? ? OD2 A ASP 269 ? ? 124.14 118.30 5.84 0.90 N 
4 1 CB B ASP 39  ? ? CG B ASP 39  ? ? OD2 B ASP 39  ? ? 124.27 118.30 5.97 0.90 N 
5 1 CB B ASP 179 ? ? CG B ASP 179 ? ? OD2 B ASP 179 ? ? 124.48 118.30 6.18 0.90 N 
6 1 CB B ASP 243 ? ? CG B ASP 243 ? ? OD2 B ASP 243 ? ? 124.52 118.30 6.22 0.90 N 
7 1 CB B ASP 269 ? ? CG B ASP 269 ? ? OD2 B ASP 269 ? ? 123.79 118.30 5.49 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 21  ? ? -108.63 -147.25 
2  1 ALA A 48  ? ? -148.06 -116.15 
3  1 PRO A 74  ? ? -52.73  80.01   
4  1 ASP A 88  ? ? -115.13 75.32   
5  1 ALA A 96  ? ? 36.20   42.51   
6  1 ALA A 177 ? ? -79.79  41.49   
7  1 ILE B 21  ? ? -108.79 -146.69 
8  1 ALA B 48  ? ? -150.88 -114.85 
9  1 PRO B 74  ? ? -55.16  78.29   
10 1 ASP B 88  ? ? -116.19 77.36   
11 1 ALA B 96  ? ? 38.68   40.11   
12 1 ALA B 177 ? ? -78.62  40.74   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 5 ? A ASP 1 
2 1 Y 1 A GLU 6 ? A GLU 2 
3 1 Y 1 A ASN 7 ? A ASN 3 
4 1 Y 1 A ALA 8 ? A ALA 4 
5 1 Y 1 B ASP 5 ? B ASP 1 
6 1 Y 1 B GLU 6 ? B GLU 2 
7 1 Y 1 B ASN 7 ? B ASN 3 
8 1 Y 1 B ALA 8 ? B ALA 4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        1,1-DIMETHYL-PROLINIUM 
_pdbx_entity_nonpoly.comp_id     PBE 
#