data_2B50
# 
_entry.id   2B50 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2B50         
RCSB  RCSB034682   
WWPDB D_1000034682 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2AWH 
_pdbx_database_related.details        
;2AWH represents the same protein and ligand as the one which is being deposited.  The protein in 2AWH was derived from a commercial source and the data which is being deposited was from an in-house expression system.  Both structres comprise unique unit cell dimensions.
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2B50 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fyffe, S.A.'      1 
'Alphey, M.S.'     2 
'Buetow, L.'       3 
'Smith, T.K.'      4 
'Ferguson, M.A.J.' 5 
'Sorensen, M.D.'   6 
'Bjorkling, F.'    7 
'Hunter, W.N.'     8 
# 
_citation.id                        primary 
_citation.title                     
'Recombinant Human PPAR-beta/delta Ligand-binding Domain is Locked in an Activated Conformation by Endogenous Fatty Acids' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            356 
_citation.page_first                1005 
_citation.page_last                 1013 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16405912 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.047 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fyffe, S.A.'      1 
primary 'Alphey, M.S.'     2 
primary 'Buetow, L.'       3 
primary 'Smith, T.K.'      4 
primary 'Ferguson, M.A.J.' 5 
primary 'Sorensen, M.D.'   6 
primary 'Bjorkling, F.'    7 
primary 'Hunter, W.N.'     8 
# 
_cell.length_a           39.776 
_cell.length_b           92.084 
_cell.length_c           95.017 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.00 
_cell.angle_gamma        90.00 
_cell.entry_id           2B50 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         2B50 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peroxisome proliferator activated receptor delta' 31030.061 2   ? ? 'residues 205-476' ? 
2 non-polymer syn 'CALCIUM ION'                                      40.078    2   ? ? ?                  ? 
3 non-polymer syn HEPTYL-BETA-D-GLUCOPYRANOSIDE                      278.342   2   ? ? ?                  ? 
4 non-polymer syn 'VACCENIC ACID'                                    282.461   2   ? ? ?                  ? 
5 water       nat water                                              18.015    519 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPAR-delta, PPAR- beta, Nuclear hormone receptor 1, NUC1, NUCI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYR
CQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDII
EPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQ
LVTEHAQMMQRIKKTETETSLHPLLQEIYKDM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYR
CQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDII
EPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQ
LVTEHAQMMQRIKKTETETSLHPLLQEIYKDM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   PRO n 
1 3   GLN n 
1 4   VAL n 
1 5   ALA n 
1 6   ASP n 
1 7   LEU n 
1 8   LYS n 
1 9   ALA n 
1 10  PHE n 
1 11  SER n 
1 12  LYS n 
1 13  HIS n 
1 14  ILE n 
1 15  TYR n 
1 16  ASN n 
1 17  ALA n 
1 18  TYR n 
1 19  LEU n 
1 20  LYS n 
1 21  ASN n 
1 22  PHE n 
1 23  ASN n 
1 24  MET n 
1 25  THR n 
1 26  LYS n 
1 27  LYS n 
1 28  LYS n 
1 29  ALA n 
1 30  ARG n 
1 31  SER n 
1 32  ILE n 
1 33  LEU n 
1 34  THR n 
1 35  GLY n 
1 36  LYS n 
1 37  ALA n 
1 38  SER n 
1 39  HIS n 
1 40  THR n 
1 41  ALA n 
1 42  PRO n 
1 43  PHE n 
1 44  VAL n 
1 45  ILE n 
1 46  HIS n 
1 47  ASP n 
1 48  ILE n 
1 49  GLU n 
1 50  THR n 
1 51  LEU n 
1 52  TRP n 
1 53  GLN n 
1 54  ALA n 
1 55  GLU n 
1 56  LYS n 
1 57  GLY n 
1 58  LEU n 
1 59  VAL n 
1 60  TRP n 
1 61  LYS n 
1 62  GLN n 
1 63  LEU n 
1 64  VAL n 
1 65  ASN n 
1 66  GLY n 
1 67  LEU n 
1 68  PRO n 
1 69  PRO n 
1 70  TYR n 
1 71  LYS n 
1 72  GLU n 
1 73  ILE n 
1 74  SER n 
1 75  VAL n 
1 76  HIS n 
1 77  VAL n 
1 78  PHE n 
1 79  TYR n 
1 80  ARG n 
1 81  CYS n 
1 82  GLN n 
1 83  CYS n 
1 84  THR n 
1 85  THR n 
1 86  VAL n 
1 87  GLU n 
1 88  THR n 
1 89  VAL n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  THR n 
1 94  GLU n 
1 95  PHE n 
1 96  ALA n 
1 97  LYS n 
1 98  SER n 
1 99  ILE n 
1 100 PRO n 
1 101 SER n 
1 102 PHE n 
1 103 SER n 
1 104 SER n 
1 105 LEU n 
1 106 PHE n 
1 107 LEU n 
1 108 ASN n 
1 109 ASP n 
1 110 GLN n 
1 111 VAL n 
1 112 THR n 
1 113 LEU n 
1 114 LEU n 
1 115 LYS n 
1 116 TYR n 
1 117 GLY n 
1 118 VAL n 
1 119 HIS n 
1 120 GLU n 
1 121 ALA n 
1 122 ILE n 
1 123 PHE n 
1 124 ALA n 
1 125 MET n 
1 126 LEU n 
1 127 ALA n 
1 128 SER n 
1 129 ILE n 
1 130 VAL n 
1 131 ASN n 
1 132 LYS n 
1 133 ASP n 
1 134 GLY n 
1 135 LEU n 
1 136 LEU n 
1 137 VAL n 
1 138 ALA n 
1 139 ASN n 
1 140 GLY n 
1 141 SER n 
1 142 GLY n 
1 143 PHE n 
1 144 VAL n 
1 145 THR n 
1 146 ARG n 
1 147 GLU n 
1 148 PHE n 
1 149 LEU n 
1 150 ARG n 
1 151 SER n 
1 152 LEU n 
1 153 ARG n 
1 154 LYS n 
1 155 PRO n 
1 156 PHE n 
1 157 SER n 
1 158 ASP n 
1 159 ILE n 
1 160 ILE n 
1 161 GLU n 
1 162 PRO n 
1 163 LYS n 
1 164 PHE n 
1 165 GLU n 
1 166 PHE n 
1 167 ALA n 
1 168 VAL n 
1 169 LYS n 
1 170 PHE n 
1 171 ASN n 
1 172 ALA n 
1 173 LEU n 
1 174 GLU n 
1 175 LEU n 
1 176 ASP n 
1 177 ASP n 
1 178 SER n 
1 179 ASP n 
1 180 LEU n 
1 181 ALA n 
1 182 LEU n 
1 183 PHE n 
1 184 ILE n 
1 185 ALA n 
1 186 ALA n 
1 187 ILE n 
1 188 ILE n 
1 189 LEU n 
1 190 CYS n 
1 191 GLY n 
1 192 ASP n 
1 193 ARG n 
1 194 PRO n 
1 195 GLY n 
1 196 LEU n 
1 197 MET n 
1 198 ASN n 
1 199 VAL n 
1 200 PRO n 
1 201 ARG n 
1 202 VAL n 
1 203 GLU n 
1 204 ALA n 
1 205 ILE n 
1 206 GLN n 
1 207 ASP n 
1 208 THR n 
1 209 ILE n 
1 210 LEU n 
1 211 ARG n 
1 212 ALA n 
1 213 LEU n 
1 214 GLU n 
1 215 PHE n 
1 216 HIS n 
1 217 LEU n 
1 218 GLN n 
1 219 ALA n 
1 220 ASN n 
1 221 HIS n 
1 222 PRO n 
1 223 ASP n 
1 224 ALA n 
1 225 GLN n 
1 226 GLN n 
1 227 LEU n 
1 228 PHE n 
1 229 PRO n 
1 230 LYS n 
1 231 LEU n 
1 232 LEU n 
1 233 GLN n 
1 234 LYS n 
1 235 MET n 
1 236 ALA n 
1 237 ASP n 
1 238 LEU n 
1 239 ARG n 
1 240 GLN n 
1 241 LEU n 
1 242 VAL n 
1 243 THR n 
1 244 GLU n 
1 245 HIS n 
1 246 ALA n 
1 247 GLN n 
1 248 MET n 
1 249 MET n 
1 250 GLN n 
1 251 ARG n 
1 252 ILE n 
1 253 LYS n 
1 254 LYS n 
1 255 THR n 
1 256 GLU n 
1 257 THR n 
1 258 GLU n 
1 259 THR n 
1 260 SER n 
1 261 LEU n 
1 262 HIS n 
1 263 PRO n 
1 264 LEU n 
1 265 LEU n 
1 266 GLN n 
1 267 GLU n 
1 268 ILE n 
1 269 TYR n 
1 270 LYS n 
1 271 ASP n 
1 272 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 GOLD (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPAS_HUMAN 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYR
CQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDII
EPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQ
LVTEHAQMMQRIKKTETETSLHPLLQEIYKDM
;
_struct_ref.pdbx_align_begin           169 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2B50 A 1 ? 272 ? Q03181 169 ? 440 ? 205 476 
2 1 2B50 B 1 ? 272 ? Q03181 169 ? 440 ? 205 476 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2B50 GLN A 226 ? UNP Q03181 TYR 394 CONFLICT 430 1 
2 2B50 GLN B 226 ? UNP Q03181 TYR 394 CONFLICT 430 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                             'C4 H7 N O4'     133.103 
B7G non-polymer         . HEPTYL-BETA-D-GLUCOPYRANOSIDE ?                             'C13 H26 O6'     278.342 
CA  non-polymer         . 'CALCIUM ION'                 ?                             'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                      ?                             'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ?                             'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                    ?                             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ?                             'C5 H11 N O2'    117.146 
VCA non-polymer         . 'VACCENIC ACID'               '(11E)-OCTADEC-11-ENOIC ACID' 'C18 H34 O2'     282.461 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2B50 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   55.79 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'vapour diffusion, hanging drop' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;5% PEG 8000, 200mM KCl, 40mM bis-tris-propane pH 8.5, 2.5% 1,2-propanediol, 0.5% n-heptyl-B-D-glucopyranoside, 1mM EDTA, 10mM DTT, vapour diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           65 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.939261 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_wavelength_list        0.939261 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
# 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             94.490 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.290 
_refine.ls_number_reflns_obs                     44692 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.199 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.249 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2251 
_refine.B_iso_mean                               28.494 
_refine.aniso_B[1][1]                            -0.030 
_refine.aniso_B[2][2]                            2.090 
_refine.aniso_B[3][3]                            -1.910 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.600 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.pdbx_overall_ESU_R                       0.183 
_refine.pdbx_overall_ESU_R_Free                  0.172 
_refine.overall_SU_ML                            0.134 
_refine.overall_SU_B                             4.901 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2B50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     42441 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4198 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         80 
_refine_hist.number_atoms_solvent             519 
_refine_hist.number_atoms_total               4797 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        94.490 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             4364 0.011  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          5881 1.329  1.979  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       519  5.313  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       189  34.279 24.074 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       780  17.047 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22   21.133 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               676  0.097  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         3172 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                2103 0.208  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              2974 0.299  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        411  0.157  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          5    0.163  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       119  0.315  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     51   0.316  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 2    0.143  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2706 0.672  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4237 1.123  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1845 1.622  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1644 2.630  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.400 
_refine_ls_shell.number_reflns_R_work             3081 
_refine_ls_shell.R_factor_R_work                  0.284 
_refine_ls_shell.R_factor_R_free                  0.351 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             163 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3244 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2B50 
_struct.title                     'Human Nuclear Receptor-Ligand Complex 2' 
_struct.pdbx_descriptor           'Peroxisome proliferator activated receptor delta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            'Nuclear Receptor, Protein-Ligand Complex, PPAR, GENE REGULATION' 
_struct_keywords.entry_id        2B50 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological unit is a monomer.  There are 2 biological units the aymmetric unit (chains A and B)' ? 
2 ?                                                                                                     ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 7   ? PHE A 22  ? LEU A 211 PHE A 226 1 ? 16 
HELX_P HELX_P2  2  THR A 25  ? THR A 34  ? THR A 229 THR A 238 1 ? 10 
HELX_P HELX_P3  3  ASP A 47  ? GLY A 57  ? ASP A 251 GLY A 261 1 ? 11 
HELX_P HELX_P4  4  GLU A 72  ? SER A 98  ? GLU A 276 SER A 302 1 ? 27 
HELX_P HELX_P5  5  ILE A 99  ? LEU A 105 ? ILE A 303 LEU A 309 1 ? 7  
HELX_P HELX_P6  6  PHE A 106 ? ALA A 127 ? PHE A 310 ALA A 331 1 ? 22 
HELX_P HELX_P7  7  ALA A 138 ? GLY A 140 ? ALA A 342 GLY A 344 5 ? 3  
HELX_P HELX_P8  8  ARG A 146 ? LEU A 152 ? ARG A 350 LEU A 356 1 ? 7  
HELX_P HELX_P9  9  ARG A 153 ? ALA A 172 ? ARG A 357 ALA A 376 1 ? 20 
HELX_P HELX_P10 10 ASP A 176 ? LEU A 189 ? ASP A 380 LEU A 393 1 ? 14 
HELX_P HELX_P11 11 ASN A 198 ? HIS A 221 ? ASN A 402 HIS A 425 1 ? 24 
HELX_P HELX_P12 12 GLN A 226 ? GLU A 256 ? GLN A 430 GLU A 460 1 ? 31 
HELX_P HELX_P13 13 HIS A 262 ? LYS A 270 ? HIS A 466 LYS A 474 1 ? 9  
HELX_P HELX_P14 14 ASN B 1   ? PHE B 22  ? ASN B 205 PHE B 226 1 ? 22 
HELX_P HELX_P15 15 THR B 25  ? GLY B 35  ? THR B 229 GLY B 239 1 ? 11 
HELX_P HELX_P16 16 ASP B 47  ? LYS B 56  ? ASP B 251 LYS B 260 1 ? 10 
HELX_P HELX_P17 17 GLU B 72  ? SER B 98  ? GLU B 276 SER B 302 1 ? 27 
HELX_P HELX_P18 18 ILE B 99  ? SER B 104 ? ILE B 303 SER B 308 1 ? 6  
HELX_P HELX_P19 19 PHE B 106 ? ALA B 127 ? PHE B 310 ALA B 331 1 ? 22 
HELX_P HELX_P20 20 ARG B 146 ? SER B 151 ? ARG B 350 SER B 355 1 ? 6  
HELX_P HELX_P21 21 ARG B 153 ? ALA B 172 ? ARG B 357 ALA B 376 1 ? 20 
HELX_P HELX_P22 22 ASP B 176 ? LEU B 189 ? ASP B 380 LEU B 393 1 ? 14 
HELX_P HELX_P23 23 ASN B 198 ? HIS B 221 ? ASN B 402 HIS B 425 1 ? 24 
HELX_P HELX_P24 24 GLN B 226 ? GLU B 256 ? GLN B 430 GLU B 460 1 ? 31 
HELX_P HELX_P25 25 HIS B 262 ? LYS B 270 ? HIS B 466 LYS B 474 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 203 OE2 ? ? A CA 1303 A GLU 407  1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc2 metalc ? ? C CA . CA ? ? ? 1_555 A GLN 206 OE1 ? ? A CA 1303 A GLN 410  1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc3 metalc ? ? G CA . CA ? ? ? 1_555 J HOH .   O   ? ? B CA 2303 B HOH 2428 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc4 metalc ? ? G CA . CA ? ? ? 1_555 J HOH .   O   ? ? B CA 2303 B HOH 2578 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc5 metalc ? ? G CA . CA ? ? ? 1_555 B GLU 203 OE2 ? ? B CA 2303 B GLU 407  1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc6 metalc ? ? G CA . CA ? ? ? 1_555 B GLN 206 OE1 ? ? B CA 2303 B GLN 410  1_555 ? ? ? ? ? ? ? 2.392 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 43  ? ILE A 45  ? PHE A 247 ILE A 249 
A 2 GLY A 142 ? THR A 145 ? GLY A 346 THR A 349 
A 3 GLY A 134 ? VAL A 137 ? GLY A 338 VAL A 341 
A 4 VAL A 130 ? ASN A 131 ? VAL A 334 ASN A 335 
B 1 PHE B 43  ? ILE B 45  ? PHE B 247 ILE B 249 
B 2 GLY B 142 ? THR B 145 ? GLY B 346 THR B 349 
B 3 GLY B 134 ? VAL B 137 ? GLY B 338 VAL B 341 
B 4 VAL B 130 ? ASN B 131 ? VAL B 334 ASN B 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 45  ? N ILE A 249 O PHE A 143 ? O PHE A 347 
A 2 3 O VAL A 144 ? O VAL A 348 N LEU A 135 ? N LEU A 339 
A 3 4 O GLY A 134 ? O GLY A 338 N ASN A 131 ? N ASN A 335 
B 1 2 N ILE B 45  ? N ILE B 249 O PHE B 143 ? O PHE B 347 
B 2 3 O GLY B 142 ? O GLY B 346 N VAL B 137 ? N VAL B 341 
B 3 4 O GLY B 134 ? O GLY B 338 N ASN B 131 ? N ASN B 335 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 1303'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B 2303'  
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE B7G A 920'  
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE B7G A 921'  
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE VCA A 1001' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE VCA B 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  GLU A 203 ? GLU A 407  . ? 1_555 ? 
2  AC1 2  GLN A 206 ? GLN A 410  . ? 1_555 ? 
3  AC2 4  GLU B 203 ? GLU B 407  . ? 1_555 ? 
4  AC2 4  GLN B 206 ? GLN B 410  . ? 1_555 ? 
5  AC2 4  HOH J .   ? HOH B 2428 . ? 1_555 ? 
6  AC2 4  HOH J .   ? HOH B 2578 . ? 1_555 ? 
7  AC3 10 PHE A 106 ? PHE A 310  . ? 1_555 ? 
8  AC3 10 LEU A 107 ? LEU A 311  . ? 1_555 ? 
9  AC3 10 ASN A 108 ? ASN A 312  . ? 1_555 ? 
10 AC3 10 VAL A 111 ? VAL A 315  . ? 1_555 ? 
11 AC3 10 THR A 112 ? THR A 316  . ? 1_555 ? 
12 AC3 10 B7G E .   ? B7G A 921  . ? 1_555 ? 
13 AC3 10 THR B 93  ? THR B 297  . ? 1_555 ? 
14 AC3 10 LYS B 115 ? LYS B 319  . ? 1_555 ? 
15 AC3 10 GLU B 267 ? GLU B 471  . ? 1_555 ? 
16 AC3 10 LYS B 270 ? LYS B 474  . ? 1_555 ? 
17 AC4 14 VAL A 89  ? VAL A 293  . ? 1_555 ? 
18 AC4 14 THR A 93  ? THR A 297  . ? 1_555 ? 
19 AC4 14 LYS A 115 ? LYS A 319  . ? 1_555 ? 
20 AC4 14 LEU A 264 ? LEU A 468  . ? 1_555 ? 
21 AC4 14 GLU A 267 ? GLU A 471  . ? 1_555 ? 
22 AC4 14 ILE A 268 ? ILE A 472  . ? 1_555 ? 
23 AC4 14 LYS A 270 ? LYS A 474  . ? 1_555 ? 
24 AC4 14 B7G D .   ? B7G A 920  . ? 1_555 ? 
25 AC4 14 HOH I .   ? HOH A 1470 . ? 1_555 ? 
26 AC4 14 LEU B 107 ? LEU B 311  . ? 1_555 ? 
27 AC4 14 ASN B 108 ? ASN B 312  . ? 1_555 ? 
28 AC4 14 VAL B 111 ? VAL B 315  . ? 1_555 ? 
29 AC4 14 THR B 112 ? THR B 316  . ? 1_555 ? 
30 AC4 14 HOH J .   ? HOH B 2367 . ? 1_555 ? 
31 AC5 10 CYS A 81  ? CYS A 285  . ? 1_555 ? 
32 AC5 10 THR A 85  ? THR A 289  . ? 1_555 ? 
33 AC5 10 HIS A 119 ? HIS A 323  . ? 1_555 ? 
34 AC5 10 VAL A 137 ? VAL A 341  . ? 1_555 ? 
35 AC5 10 HIS A 245 ? HIS A 449  . ? 1_555 ? 
36 AC5 10 MET A 249 ? MET A 453  . ? 1_555 ? 
37 AC5 10 LEU A 265 ? LEU A 469  . ? 1_555 ? 
38 AC5 10 TYR A 269 ? TYR A 473  . ? 1_555 ? 
39 AC5 10 HOH I .   ? HOH A 1452 . ? 1_555 ? 
40 AC5 10 HOH I .   ? HOH A 1496 . ? 1_555 ? 
41 AC6 8  LEU B 51  ? LEU B 255  . ? 1_555 ? 
42 AC6 8  TRP B 60  ? TRP B 264  . ? 1_555 ? 
43 AC6 8  CYS B 81  ? CYS B 285  . ? 1_555 ? 
44 AC6 8  THR B 85  ? THR B 289  . ? 1_555 ? 
45 AC6 8  HIS B 119 ? HIS B 323  . ? 1_555 ? 
46 AC6 8  HIS B 245 ? HIS B 449  . ? 1_555 ? 
47 AC6 8  LEU B 265 ? LEU B 469  . ? 1_555 ? 
48 AC6 8  TYR B 269 ? TYR B 473  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2B50 
_atom_sites.fract_transf_matrix[1][1]   0.02514 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00309 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01086 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01060 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 7   ? 0.985   -0.872  6.710   1.00 40.86  ? 211  LEU A N   1 
ATOM   2    C  CA  . LEU A 1 7   ? 1.771   -0.068  7.686   1.00 40.86  ? 211  LEU A CA  1 
ATOM   3    C  C   . LEU A 1 7   ? 0.872   0.445   8.816   1.00 40.83  ? 211  LEU A C   1 
ATOM   4    O  O   . LEU A 1 7   ? 1.310   0.542   9.967   1.00 40.89  ? 211  LEU A O   1 
ATOM   5    C  CB  . LEU A 1 7   ? 2.469   1.093   6.970   1.00 40.95  ? 211  LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 7   ? 3.993   1.220   7.042   1.00 41.70  ? 211  LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 7   ? 4.692   -0.125  6.815   1.00 41.22  ? 211  LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 7   ? 4.509   2.274   6.058   1.00 41.12  ? 211  LEU A CD2 1 
ATOM   9    N  N   . LYS A 1 8   ? -0.383  0.761   8.493   1.00 40.47  ? 212  LYS A N   1 
ATOM   10   C  CA  . LYS A 1 8   ? -1.347  1.229   9.499   1.00 40.28  ? 212  LYS A CA  1 
ATOM   11   C  C   . LYS A 1 8   ? -1.925  0.069   10.321  1.00 39.46  ? 212  LYS A C   1 
ATOM   12   O  O   . LYS A 1 8   ? -2.053  0.176   11.549  1.00 39.44  ? 212  LYS A O   1 
ATOM   13   C  CB  . LYS A 1 8   ? -2.468  2.062   8.867   1.00 40.18  ? 212  LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 8   ? -3.158  2.999   9.857   1.00 41.53  ? 212  LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 8   ? -4.355  3.706   9.236   1.00 41.18  ? 212  LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 8   ? -5.076  4.577   10.265  1.00 43.64  ? 212  LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 8   ? -6.283  5.244   9.672   1.00 44.74  ? 212  LYS A NZ  1 
ATOM   18   N  N   . ALA A 1 9   ? -2.262  -1.029  9.643   1.00 38.32  ? 213  ALA A N   1 
ATOM   19   C  CA  . ALA A 1 9   ? -2.714  -2.260  10.308  1.00 37.29  ? 213  ALA A CA  1 
ATOM   20   C  C   . ALA A 1 9   ? -1.587  -2.890  11.128  1.00 36.74  ? 213  ALA A C   1 
ATOM   21   O  O   . ALA A 1 9   ? -1.816  -3.421  12.223  1.00 36.39  ? 213  ALA A O   1 
ATOM   22   C  CB  . ALA A 1 9   ? -3.233  -3.247  9.291   1.00 37.06  ? 213  ALA A CB  1 
ATOM   23   N  N   . PHE A 1 10  ? -0.379  -2.834  10.566  1.00 36.15  ? 214  PHE A N   1 
ATOM   24   C  CA  . PHE A 1 10  ? 0.846   -3.292  11.214  1.00 35.55  ? 214  PHE A CA  1 
ATOM   25   C  C   . PHE A 1 10  ? 1.047   -2.547  12.533  1.00 34.86  ? 214  PHE A C   1 
ATOM   26   O  O   . PHE A 1 10  ? 1.202   -3.176  13.577  1.00 34.53  ? 214  PHE A O   1 
ATOM   27   C  CB  . PHE A 1 10  ? 2.036   -3.081  10.263  1.00 35.86  ? 214  PHE A CB  1 
ATOM   28   C  CG  . PHE A 1 10  ? 3.344   -3.611  10.779  1.00 36.83  ? 214  PHE A CG  1 
ATOM   29   C  CD1 . PHE A 1 10  ? 4.254   -2.764  11.400  1.00 37.06  ? 214  PHE A CD1 1 
ATOM   30   C  CD2 . PHE A 1 10  ? 3.673   -4.955  10.632  1.00 37.95  ? 214  PHE A CD2 1 
ATOM   31   C  CE1 . PHE A 1 10  ? 5.474   -3.249  11.866  1.00 38.01  ? 214  PHE A CE1 1 
ATOM   32   C  CE2 . PHE A 1 10  ? 4.890   -5.450  11.101  1.00 38.39  ? 214  PHE A CE2 1 
ATOM   33   C  CZ  . PHE A 1 10  ? 5.791   -4.598  11.724  1.00 37.00  ? 214  PHE A CZ  1 
ATOM   34   N  N   . SER A 1 11  ? 1.009   -1.214  12.469  1.00 34.30  ? 215  SER A N   1 
ATOM   35   C  CA  . SER A 1 11  ? 1.152   -0.335  13.632  1.00 34.28  ? 215  SER A CA  1 
ATOM   36   C  C   . SER A 1 11  ? 0.128   -0.590  14.727  1.00 34.19  ? 215  SER A C   1 
ATOM   37   O  O   . SER A 1 11  ? 0.467   -0.583  15.912  1.00 34.10  ? 215  SER A O   1 
ATOM   38   C  CB  . SER A 1 11  ? 1.044   1.133   13.216  1.00 34.04  ? 215  SER A CB  1 
ATOM   39   O  OG  . SER A 1 11  ? 2.153   1.530   12.440  1.00 35.79  ? 215  SER A OG  1 
ATOM   40   N  N   . LYS A 1 12  ? -1.127  -0.764  14.317  1.00 34.13  ? 216  LYS A N   1 
ATOM   41   C  CA  . LYS A 1 12  ? -2.240  -0.999  15.235  1.00 34.33  ? 216  LYS A CA  1 
ATOM   42   C  C   . LYS A 1 12  ? -2.024  -2.323  15.969  1.00 33.85  ? 216  LYS A C   1 
ATOM   43   O  O   . LYS A 1 12  ? -2.253  -2.413  17.177  1.00 34.11  ? 216  LYS A O   1 
ATOM   44   C  CB  . LYS A 1 12  ? -3.573  -0.994  14.463  1.00 34.71  ? 216  LYS A CB  1 
ATOM   45   C  CG  . LYS A 1 12  ? -4.823  -1.373  15.263  1.00 36.02  ? 216  LYS A CG  1 
ATOM   46   C  CD  . LYS A 1 12  ? -5.395  -0.187  16.044  1.00 37.91  ? 216  LYS A CD  1 
ATOM   47   C  CE  . LYS A 1 12  ? -6.693  -0.573  16.766  1.00 38.11  ? 216  LYS A CE  1 
ATOM   48   N  NZ  . LYS A 1 12  ? -6.998  0.274   17.971  1.00 40.18  ? 216  LYS A NZ  1 
ATOM   49   N  N   . HIS A 1 13  ? -1.556  -3.333  15.243  1.00 33.16  ? 217  HIS A N   1 
ATOM   50   C  CA  . HIS A 1 13  ? -1.320  -4.643  15.831  1.00 32.81  ? 217  HIS A CA  1 
ATOM   51   C  C   . HIS A 1 13  ? -0.278  -4.591  16.959  1.00 32.28  ? 217  HIS A C   1 
ATOM   52   O  O   . HIS A 1 13  ? -0.483  -5.183  18.022  1.00 31.48  ? 217  HIS A O   1 
ATOM   53   C  CB  . HIS A 1 13  ? -0.894  -5.643  14.762  1.00 32.94  ? 217  HIS A CB  1 
ATOM   54   C  CG  . HIS A 1 13  ? -0.542  -6.989  15.307  1.00 34.64  ? 217  HIS A CG  1 
ATOM   55   N  ND1 . HIS A 1 13  ? -1.464  -8.007  15.425  1.00 37.02  ? 217  HIS A ND1 1 
ATOM   56   C  CD2 . HIS A 1 13  ? 0.626   -7.480  15.785  1.00 36.13  ? 217  HIS A CD2 1 
ATOM   57   C  CE1 . HIS A 1 13  ? -0.878  -9.070  15.949  1.00 38.31  ? 217  HIS A CE1 1 
ATOM   58   N  NE2 . HIS A 1 13  ? 0.390   -8.775  16.181  1.00 37.73  ? 217  HIS A NE2 1 
ATOM   59   N  N   . ILE A 1 14  ? 0.831   -3.886  16.710  1.00 31.72  ? 218  ILE A N   1 
ATOM   60   C  CA  . ILE A 1 14  ? 1.915   -3.740  17.694  1.00 31.09  ? 218  ILE A CA  1 
ATOM   61   C  C   . ILE A 1 14  ? 1.428   -2.942  18.907  1.00 31.07  ? 218  ILE A C   1 
ATOM   62   O  O   . ILE A 1 14  ? 1.821   -3.220  20.049  1.00 31.05  ? 218  ILE A O   1 
ATOM   63   C  CB  . ILE A 1 14  ? 3.189   -3.115  17.053  1.00 30.79  ? 218  ILE A CB  1 
ATOM   64   C  CG1 . ILE A 1 14  ? 3.755   -4.071  15.992  1.00 30.79  ? 218  ILE A CG1 1 
ATOM   65   C  CG2 . ILE A 1 14  ? 4.251   -2.798  18.111  1.00 30.64  ? 218  ILE A CG2 1 
ATOM   66   C  CD1 . ILE A 1 14  ? 5.023   -3.595  15.310  1.00 30.90  ? 218  ILE A CD1 1 
ATOM   67   N  N   . TYR A 1 15  ? 0.555   -1.969  18.645  1.00 31.00  ? 219  TYR A N   1 
ATOM   68   C  CA  . TYR A 1 15  ? -0.060  -1.155  19.690  1.00 30.87  ? 219  TYR A CA  1 
ATOM   69   C  C   . TYR A 1 15  ? -0.986  -1.975  20.586  1.00 30.52  ? 219  TYR A C   1 
ATOM   70   O  O   . TYR A 1 15  ? -0.995  -1.793  21.807  1.00 30.37  ? 219  TYR A O   1 
ATOM   71   C  CB  . TYR A 1 15  ? -0.801  0.031   19.078  1.00 31.32  ? 219  TYR A CB  1 
ATOM   72   C  CG  . TYR A 1 15  ? -1.394  0.985   20.086  1.00 32.20  ? 219  TYR A CG  1 
ATOM   73   C  CD1 . TYR A 1 15  ? -0.692  1.343   21.240  1.00 31.87  ? 219  TYR A CD1 1 
ATOM   74   C  CD2 . TYR A 1 15  ? -2.655  1.540   19.883  1.00 32.07  ? 219  TYR A CD2 1 
ATOM   75   C  CE1 . TYR A 1 15  ? -1.235  2.214   22.167  1.00 31.93  ? 219  TYR A CE1 1 
ATOM   76   C  CE2 . TYR A 1 15  ? -3.206  2.423   20.806  1.00 33.03  ? 219  TYR A CE2 1 
ATOM   77   C  CZ  . TYR A 1 15  ? -2.485  2.757   21.944  1.00 32.91  ? 219  TYR A CZ  1 
ATOM   78   O  OH  . TYR A 1 15  ? -3.018  3.631   22.871  1.00 34.31  ? 219  TYR A OH  1 
ATOM   79   N  N   . ASN A 1 16  ? -1.745  -2.885  19.982  1.00 30.02  ? 220  ASN A N   1 
ATOM   80   C  CA  . ASN A 1 16  ? -2.586  -3.806  20.740  1.00 29.68  ? 220  ASN A CA  1 
ATOM   81   C  C   . ASN A 1 16  ? -1.755  -4.750  21.617  1.00 28.57  ? 220  ASN A C   1 
ATOM   82   O  O   . ASN A 1 16  ? -2.096  -4.970  22.774  1.00 28.23  ? 220  ASN A O   1 
ATOM   83   C  CB  . ASN A 1 16  ? -3.543  -4.587  19.822  1.00 30.06  ? 220  ASN A CB  1 
ATOM   84   C  CG  . ASN A 1 16  ? -4.729  -3.742  19.336  1.00 32.07  ? 220  ASN A CG  1 
ATOM   85   O  OD1 . ASN A 1 16  ? -5.136  -2.758  19.983  1.00 33.53  ? 220  ASN A OD1 1 
ATOM   86   N  ND2 . ASN A 1 16  ? -5.281  -4.119  18.181  1.00 32.53  ? 220  ASN A ND2 1 
ATOM   87   N  N   . ALA A 1 17  ? -0.661  -5.273  21.064  1.00 27.74  ? 221  ALA A N   1 
ATOM   88   C  CA  . ALA A 1 17  ? 0.290   -6.123  21.799  1.00 26.74  ? 221  ALA A CA  1 
ATOM   89   C  C   . ALA A 1 17  ? 0.927   -5.401  22.984  1.00 26.91  ? 221  ALA A C   1 
ATOM   90   O  O   . ALA A 1 17  ? 1.170   -6.004  24.037  1.00 26.07  ? 221  ALA A O   1 
ATOM   91   C  CB  . ALA A 1 17  ? 1.363   -6.624  20.865  1.00 26.54  ? 221  ALA A CB  1 
ATOM   92   N  N   . TYR A 1 18  ? 1.190   -4.104  22.795  1.00 26.38  ? 222  TYR A N   1 
ATOM   93   C  CA  . TYR A 1 18  ? 1.699   -3.223  23.838  1.00 26.94  ? 222  TYR A CA  1 
ATOM   94   C  C   . TYR A 1 18  ? 0.650   -3.033  24.955  1.00 27.30  ? 222  TYR A C   1 
ATOM   95   O  O   . TYR A 1 18  ? 0.963   -3.199  26.144  1.00 27.24  ? 222  TYR A O   1 
ATOM   96   C  CB  . TYR A 1 18  ? 2.109   -1.889  23.198  1.00 26.36  ? 222  TYR A CB  1 
ATOM   97   C  CG  . TYR A 1 18  ? 2.550   -0.779  24.126  1.00 27.11  ? 222  TYR A CG  1 
ATOM   98   C  CD1 . TYR A 1 18  ? 1.608   0.060   24.738  1.00 27.88  ? 222  TYR A CD1 1 
ATOM   99   C  CD2 . TYR A 1 18  ? 3.904   -0.520  24.345  1.00 25.89  ? 222  TYR A CD2 1 
ATOM   100  C  CE1 . TYR A 1 18  ? 2.001   1.101   25.564  1.00 27.53  ? 222  TYR A CE1 1 
ATOM   101  C  CE2 . TYR A 1 18  ? 4.309   0.527   25.175  1.00 27.51  ? 222  TYR A CE2 1 
ATOM   102  C  CZ  . TYR A 1 18  ? 3.350   1.329   25.776  1.00 27.53  ? 222  TYR A CZ  1 
ATOM   103  O  OH  . TYR A 1 18  ? 3.713   2.365   26.590  1.00 27.05  ? 222  TYR A OH  1 
ATOM   104  N  N   . LEU A 1 19  ? -0.584  -2.694  24.573  1.00 27.51  ? 223  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 19  ? -1.697  -2.600  25.532  1.00 28.43  ? 223  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 19  ? -1.936  -3.916  26.263  1.00 28.47  ? 223  LEU A C   1 
ATOM   107  O  O   . LEU A 1 19  ? -2.198  -3.921  27.465  1.00 28.83  ? 223  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 19  ? -2.986  -2.154  24.835  1.00 28.65  ? 223  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 19  ? -3.429  -0.689  24.841  1.00 29.92  ? 223  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 19  ? -2.369  0.305   25.343  1.00 29.88  ? 223  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 19  ? -3.962  -0.304  23.445  1.00 30.89  ? 223  LEU A CD2 1 
ATOM   112  N  N   . LYS A 1 20  ? -1.817  -5.028  25.544  1.00 28.60  ? 224  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 20  ? -2.090  -6.340  26.126  1.00 29.30  ? 224  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 20  ? -1.038  -6.786  27.147  1.00 29.12  ? 224  LYS A C   1 
ATOM   115  O  O   . LYS A 1 20  ? -1.360  -7.538  28.082  1.00 29.30  ? 224  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 20  ? -2.249  -7.391  25.026  1.00 29.10  ? 224  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 20  ? -2.665  -8.767  25.536  1.00 31.09  ? 224  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 20  ? -2.794  -9.772  24.391  1.00 30.88  ? 224  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 20  ? -2.831  -11.204 24.926  1.00 33.58  ? 224  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 20  ? -3.125  -12.173 23.833  1.00 32.71  ? 224  LYS A NZ  1 
ATOM   121  N  N   . ASN A 1 21  ? 0.202   -6.321  26.980  1.00 28.41  ? 225  ASN A N   1 
ATOM   122  C  CA  . ASN A 1 21  ? 1.327   -6.895  27.713  1.00 28.38  ? 225  ASN A CA  1 
ATOM   123  C  C   . ASN A 1 21  ? 1.983   -6.057  28.806  1.00 28.65  ? 225  ASN A C   1 
ATOM   124  O  O   . ASN A 1 21  ? 2.690   -6.607  29.646  1.00 28.41  ? 225  ASN A O   1 
ATOM   125  C  CB  . ASN A 1 21  ? 2.380   -7.422  26.735  1.00 28.00  ? 225  ASN A CB  1 
ATOM   126  C  CG  . ASN A 1 21  ? 1.917   -8.669  26.008  1.00 27.85  ? 225  ASN A CG  1 
ATOM   127  O  OD1 . ASN A 1 21  ? 1.894   -9.752  26.582  1.00 26.97  ? 225  ASN A OD1 1 
ATOM   128  N  ND2 . ASN A 1 21  ? 1.544   -8.521  24.733  1.00 25.68  ? 225  ASN A ND2 1 
ATOM   129  N  N   . PHE A 1 22  ? 1.765   -4.740  28.794  1.00 29.52  ? 226  PHE A N   1 
ATOM   130  C  CA  . PHE A 1 22  ? 2.286   -3.865  29.841  1.00 30.37  ? 226  PHE A CA  1 
ATOM   131  C  C   . PHE A 1 22  ? 1.170   -3.338  30.737  1.00 31.48  ? 226  PHE A C   1 
ATOM   132  O  O   . PHE A 1 22  ? 0.277   -2.624  30.274  1.00 31.41  ? 226  PHE A O   1 
ATOM   133  C  CB  . PHE A 1 22  ? 3.099   -2.701  29.243  1.00 30.37  ? 226  PHE A CB  1 
ATOM   134  C  CG  . PHE A 1 22  ? 4.259   -3.151  28.397  1.00 29.66  ? 226  PHE A CG  1 
ATOM   135  C  CD1 . PHE A 1 22  ? 5.396   -3.698  28.987  1.00 28.63  ? 226  PHE A CD1 1 
ATOM   136  C  CD2 . PHE A 1 22  ? 4.205   -3.048  27.011  1.00 29.17  ? 226  PHE A CD2 1 
ATOM   137  C  CE1 . PHE A 1 22  ? 6.453   -4.134  28.217  1.00 28.49  ? 226  PHE A CE1 1 
ATOM   138  C  CE2 . PHE A 1 22  ? 5.274   -3.479  26.232  1.00 29.54  ? 226  PHE A CE2 1 
ATOM   139  C  CZ  . PHE A 1 22  ? 6.392   -4.026  26.838  1.00 29.17  ? 226  PHE A CZ  1 
ATOM   140  N  N   . ASN A 1 23  ? 1.249   -3.679  32.026  1.00 32.54  ? 227  ASN A N   1 
ATOM   141  C  CA  . ASN A 1 23  ? 0.256   -3.253  33.023  1.00 33.62  ? 227  ASN A CA  1 
ATOM   142  C  C   . ASN A 1 23  ? 0.216   -1.730  33.145  1.00 33.39  ? 227  ASN A C   1 
ATOM   143  O  O   . ASN A 1 23  ? -0.865  -1.124  33.138  1.00 33.67  ? 227  ASN A O   1 
ATOM   144  C  CB  . ASN A 1 23  ? 0.548   -3.889  34.392  1.00 34.40  ? 227  ASN A CB  1 
ATOM   145  C  CG  . ASN A 1 23  ? -0.694  -3.981  35.283  1.00 37.02  ? 227  ASN A CG  1 
ATOM   146  O  OD1 . ASN A 1 23  ? -0.947  -5.024  35.902  1.00 40.42  ? 227  ASN A OD1 1 
ATOM   147  N  ND2 . ASN A 1 23  ? -1.474  -2.901  35.345  1.00 37.36  ? 227  ASN A ND2 1 
ATOM   148  N  N   . MET A 1 24  ? 1.397   -1.122  33.242  1.00 32.73  ? 228  MET A N   1 
ATOM   149  C  CA  . MET A 1 24  ? 1.506   0.323   33.290  1.00 32.30  ? 228  MET A CA  1 
ATOM   150  C  C   . MET A 1 24  ? 1.797   0.874   31.903  1.00 31.69  ? 228  MET A C   1 
ATOM   151  O  O   . MET A 1 24  ? 2.774   0.489   31.263  1.00 31.79  ? 228  MET A O   1 
ATOM   152  C  CB  . MET A 1 24  ? 2.600   0.756   34.269  1.00 32.51  ? 228  MET A CB  1 
ATOM   153  C  CG  . MET A 1 24  ? 2.636   2.264   34.522  1.00 33.98  ? 228  MET A CG  1 
ATOM   154  S  SD  . MET A 1 24  ? 1.150   2.913   35.315  1.00 35.72  ? 228  MET A SD  1 
ATOM   155  C  CE  . MET A 1 24  ? 1.250   2.118   36.923  1.00 34.58  ? 228  MET A CE  1 
ATOM   156  N  N   . THR A 1 25  ? 0.917   1.759   31.449  1.00 30.78  ? 229  THR A N   1 
ATOM   157  C  CA  . THR A 1 25  ? 1.099   2.521   30.219  1.00 29.72  ? 229  THR A CA  1 
ATOM   158  C  C   . THR A 1 25  ? 1.373   3.972   30.628  1.00 28.65  ? 229  THR A C   1 
ATOM   159  O  O   . THR A 1 25  ? 1.159   4.336   31.783  1.00 27.94  ? 229  THR A O   1 
ATOM   160  C  CB  . THR A 1 25  ? -0.178  2.480   29.361  1.00 29.73  ? 229  THR A CB  1 
ATOM   161  O  OG1 . THR A 1 25  ? -1.252  3.051   30.101  1.00 30.21  ? 229  THR A OG1 1 
ATOM   162  C  CG2 . THR A 1 25  ? -0.552  1.047   28.992  1.00 31.03  ? 229  THR A CG2 1 
ATOM   163  N  N   . LYS A 1 26  ? 1.834   4.797   29.695  1.00 27.47  ? 230  LYS A N   1 
ATOM   164  C  CA  . LYS A 1 26  ? 2.086   6.208   29.989  1.00 26.51  ? 230  LYS A CA  1 
ATOM   165  C  C   . LYS A 1 26  ? 0.804   6.981   30.357  1.00 26.78  ? 230  LYS A C   1 
ATOM   166  O  O   . LYS A 1 26  ? 0.803   7.798   31.280  1.00 26.20  ? 230  LYS A O   1 
ATOM   167  C  CB  . LYS A 1 26  ? 2.813   6.868   28.819  1.00 26.04  ? 230  LYS A CB  1 
ATOM   168  C  CG  . LYS A 1 26  ? 3.228   8.300   29.077  1.00 24.93  ? 230  LYS A CG  1 
ATOM   169  C  CD  . LYS A 1 26  ? 4.141   8.825   27.981  1.00 22.12  ? 230  LYS A CD  1 
ATOM   170  C  CE  . LYS A 1 26  ? 4.429   10.306  28.214  1.00 22.00  ? 230  LYS A CE  1 
ATOM   171  N  NZ  . LYS A 1 26  ? 5.553   10.802  27.361  1.00 21.14  ? 230  LYS A NZ  1 
ATOM   172  N  N   . LYS A 1 27  ? -0.273  6.721   29.623  1.00 27.10  ? 231  LYS A N   1 
ATOM   173  C  CA  . LYS A 1 27  ? -1.593  7.293   29.901  1.00 28.00  ? 231  LYS A CA  1 
ATOM   174  C  C   . LYS A 1 27  ? -2.036  7.040   31.353  1.00 28.03  ? 231  LYS A C   1 
ATOM   175  O  O   . LYS A 1 27  ? -2.390  7.983   32.056  1.00 27.69  ? 231  LYS A O   1 
ATOM   176  C  CB  . LYS A 1 27  ? -2.623  6.739   28.911  1.00 28.16  ? 231  LYS A CB  1 
ATOM   177  C  CG  . LYS A 1 27  ? -3.985  7.403   28.961  1.00 29.95  ? 231  LYS A CG  1 
ATOM   178  C  CD  . LYS A 1 27  ? -4.800  7.053   27.706  1.00 33.25  ? 231  LYS A CD  1 
ATOM   179  C  CE  . LYS A 1 27  ? -6.246  7.531   27.828  1.00 35.11  ? 231  LYS A CE  1 
ATOM   180  N  NZ  . LYS A 1 27  ? -6.362  9.024   27.930  1.00 36.21  ? 231  LYS A NZ  1 
ATOM   181  N  N   . LYS A 1 28  ? -2.003  5.778   31.788  1.00 28.28  ? 232  LYS A N   1 
ATOM   182  C  CA  . LYS A 1 28  ? -2.264  5.419   33.182  1.00 29.23  ? 232  LYS A CA  1 
ATOM   183  C  C   . LYS A 1 28  ? -1.293  6.108   34.139  1.00 28.87  ? 232  LYS A C   1 
ATOM   184  O  O   . LYS A 1 28  ? -1.704  6.628   35.173  1.00 29.20  ? 232  LYS A O   1 
ATOM   185  C  CB  . LYS A 1 28  ? -2.157  3.903   33.423  1.00 29.18  ? 232  LYS A CB  1 
ATOM   186  C  CG  . LYS A 1 28  ? -2.977  2.994   32.513  1.00 31.00  ? 232  LYS A CG  1 
ATOM   187  C  CD  . LYS A 1 28  ? -3.402  1.673   33.201  1.00 31.01  ? 232  LYS A CD  1 
ATOM   188  C  CE  . LYS A 1 28  ? -2.528  1.298   34.421  1.00 34.07  ? 232  LYS A CE  1 
ATOM   189  N  NZ  . LYS A 1 28  ? -2.935  1.999   35.672  1.00 33.89  ? 232  LYS A NZ  1 
ATOM   190  N  N   . ALA A 1 29  ? -0.004  6.095   33.805  1.00 28.63  ? 233  ALA A N   1 
ATOM   191  C  CA  . ALA A 1 29  ? 1.017   6.669   34.686  1.00 28.95  ? 233  ALA A CA  1 
ATOM   192  C  C   . ALA A 1 29  ? 0.799   8.164   34.876  1.00 29.00  ? 233  ALA A C   1 
ATOM   193  O  O   . ALA A 1 29  ? 0.952   8.682   35.981  1.00 28.76  ? 233  ALA A O   1 
ATOM   194  C  CB  . ALA A 1 29  ? 2.424   6.389   34.154  1.00 28.12  ? 233  ALA A CB  1 
ATOM   195  N  N   . ARG A 1 30  ? 0.416   8.840   33.794  1.00 29.39  ? 234  ARG A N   1 
ATOM   196  C  CA  . ARG A 1 30  ? 0.197   10.283  33.802  1.00 30.64  ? 234  ARG A CA  1 
ATOM   197  C  C   . ARG A 1 30  ? -1.042  10.716  34.600  1.00 31.17  ? 234  ARG A C   1 
ATOM   198  O  O   . ARG A 1 30  ? -1.012  11.740  35.273  1.00 30.99  ? 234  ARG A O   1 
ATOM   199  C  CB  . ARG A 1 30  ? 0.159   10.835  32.367  1.00 30.70  ? 234  ARG A CB  1 
ATOM   200  C  CG  . ARG A 1 30  ? 1.432   11.566  31.926  1.00 32.01  ? 234  ARG A CG  1 
ATOM   201  C  CD  . ARG A 1 30  ? 2.714   10.905  32.417  1.00 34.02  ? 234  ARG A CD  1 
ATOM   202  N  NE  . ARG A 1 30  ? 3.729   11.899  32.787  1.00 36.90  ? 234  ARG A NE  1 
ATOM   203  C  CZ  . ARG A 1 30  ? 4.985   11.623  33.164  1.00 36.47  ? 234  ARG A CZ  1 
ATOM   204  N  NH1 . ARG A 1 30  ? 5.430   10.370  33.221  1.00 32.98  ? 234  ARG A NH1 1 
ATOM   205  N  NH2 . ARG A 1 30  ? 5.813   12.620  33.469  1.00 37.18  ? 234  ARG A NH2 1 
ATOM   206  N  N   . SER A 1 31  ? -2.122  9.949   34.526  1.00 32.29  ? 235  SER A N   1 
ATOM   207  C  CA  . SER A 1 31  ? -3.313  10.285  35.310  1.00 33.33  ? 235  SER A CA  1 
ATOM   208  C  C   . SER A 1 31  ? -3.113  9.984   36.794  1.00 33.68  ? 235  SER A C   1 
ATOM   209  O  O   . SER A 1 31  ? -3.647  10.692  37.641  1.00 34.02  ? 235  SER A O   1 
ATOM   210  C  CB  . SER A 1 31  ? -4.579  9.624   34.756  1.00 33.57  ? 235  SER A CB  1 
ATOM   211  O  OG  . SER A 1 31  ? -4.445  8.217   34.678  1.00 34.41  ? 235  SER A OG  1 
ATOM   212  N  N   . ILE A 1 32  ? -2.329  8.954   37.111  1.00 34.27  ? 236  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 32  ? -1.909  8.735   38.499  1.00 34.69  ? 236  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 32  ? -1.080  9.915   38.983  1.00 35.30  ? 236  ILE A C   1 
ATOM   215  O  O   . ILE A 1 32  ? -1.398  10.492  40.015  1.00 35.73  ? 236  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 32  ? -1.141  7.401   38.710  1.00 34.37  ? 236  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 32  ? -2.051  6.212   38.395  1.00 34.21  ? 236  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 32  ? -0.591  7.295   40.157  1.00 34.02  ? 236  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 32  ? -1.319  4.918   38.143  1.00 33.18  ? 236  ILE A CD1 1 
ATOM   220  N  N   . LEU A 1 33  ? -0.043  10.280  38.228  1.00 36.26  ? 237  LEU A N   1 
ATOM   221  C  CA  . LEU A 1 33  ? 0.890   11.347  38.623  1.00 37.25  ? 237  LEU A CA  1 
ATOM   222  C  C   . LEU A 1 33  ? 0.269   12.749  38.654  1.00 38.27  ? 237  LEU A C   1 
ATOM   223  O  O   . LEU A 1 33  ? 0.810   13.650  39.305  1.00 38.36  ? 237  LEU A O   1 
ATOM   224  C  CB  . LEU A 1 33  ? 2.125   11.368  37.719  1.00 36.85  ? 237  LEU A CB  1 
ATOM   225  C  CG  . LEU A 1 33  ? 3.198   10.280  37.777  1.00 36.76  ? 237  LEU A CG  1 
ATOM   226  C  CD1 . LEU A 1 33  ? 4.058   10.396  36.540  1.00 36.49  ? 237  LEU A CD1 1 
ATOM   227  C  CD2 . LEU A 1 33  ? 4.061   10.343  39.037  1.00 35.76  ? 237  LEU A CD2 1 
ATOM   228  N  N   . THR A 1 34  ? -0.842  12.934  37.938  1.00 39.43  ? 238  THR A N   1 
ATOM   229  C  CA  . THR A 1 34  ? -1.575  14.211  37.934  1.00 40.67  ? 238  THR A CA  1 
ATOM   230  C  C   . THR A 1 34  ? -2.850  14.162  38.792  1.00 41.45  ? 238  THR A C   1 
ATOM   231  O  O   . THR A 1 34  ? -3.635  15.113  38.800  1.00 42.12  ? 238  THR A O   1 
ATOM   232  C  CB  . THR A 1 34  ? -1.943  14.698  36.493  1.00 40.56  ? 238  THR A CB  1 
ATOM   233  O  OG1 . THR A 1 34  ? -2.901  13.808  35.898  1.00 40.60  ? 238  THR A OG1 1 
ATOM   234  C  CG2 . THR A 1 34  ? -0.707  14.813  35.597  1.00 40.97  ? 238  THR A CG2 1 
ATOM   235  N  N   . GLY A 1 35  ? -3.057  13.055  39.501  1.00 42.11  ? 239  GLY A N   1 
ATOM   236  C  CA  . GLY A 1 35  ? -4.183  12.916  40.427  1.00 43.03  ? 239  GLY A CA  1 
ATOM   237  C  C   . GLY A 1 35  ? -5.569  12.858  39.792  1.00 43.71  ? 239  GLY A C   1 
ATOM   238  O  O   . GLY A 1 35  ? -6.528  13.409  40.344  1.00 43.51  ? 239  GLY A O   1 
ATOM   239  N  N   . LYS A 1 36  ? -5.661  12.193  38.634  1.00 44.06  ? 240  LYS A N   1 
ATOM   240  C  CA  . LYS A 1 36  ? -6.927  11.933  37.938  1.00 44.52  ? 240  LYS A CA  1 
ATOM   241  C  C   . LYS A 1 36  ? -7.917  11.184  38.816  1.00 45.00  ? 240  LYS A C   1 
ATOM   242  O  O   . LYS A 1 36  ? -7.532  10.316  39.614  1.00 45.06  ? 240  LYS A O   1 
ATOM   243  N  N   . ALA A 1 37  ? -9.194  11.525  38.656  1.00 45.20  ? 241  ALA A N   1 
ATOM   244  C  CA  . ALA A 1 37  ? -10.266 11.070  39.537  1.00 45.25  ? 241  ALA A CA  1 
ATOM   245  C  C   . ALA A 1 37  ? -10.416 9.572   39.710  1.00 45.28  ? 241  ALA A C   1 
ATOM   246  O  O   . ALA A 1 37  ? -10.842 9.119   40.769  1.00 45.69  ? 241  ALA A O   1 
ATOM   247  N  N   . SER A 1 38  ? -10.058 8.802   38.686  1.00 44.93  ? 242  SER A N   1 
ATOM   248  C  CA  . SER A 1 38  ? -10.255 7.351   38.711  1.00 44.34  ? 242  SER A CA  1 
ATOM   249  C  C   . SER A 1 38  ? -9.101  6.509   39.234  1.00 43.98  ? 242  SER A C   1 
ATOM   250  O  O   . SER A 1 38  ? -9.116  5.280   39.080  1.00 44.28  ? 242  SER A O   1 
ATOM   251  N  N   . HIS A 1 39  ? -8.106  7.153   39.850  1.00 43.26  ? 243  HIS A N   1 
ATOM   252  C  CA  . HIS A 1 39  ? -6.966  6.436   40.441  1.00 42.34  ? 243  HIS A CA  1 
ATOM   253  C  C   . HIS A 1 39  ? -6.724  6.794   41.907  1.00 41.69  ? 243  HIS A C   1 
ATOM   254  O  O   . HIS A 1 39  ? -6.843  7.956   42.303  1.00 41.86  ? 243  HIS A O   1 
ATOM   255  C  CB  . HIS A 1 39  ? -5.686  6.677   39.629  1.00 42.48  ? 243  HIS A CB  1 
ATOM   256  C  CG  . HIS A 1 39  ? -5.727  6.096   38.249  1.00 42.37  ? 243  HIS A CG  1 
ATOM   257  N  ND1 . HIS A 1 39  ? -5.377  4.790   37.982  1.00 42.37  ? 243  HIS A ND1 1 
ATOM   258  C  CD2 . HIS A 1 39  ? -6.091  6.639   37.063  1.00 42.23  ? 243  HIS A CD2 1 
ATOM   259  C  CE1 . HIS A 1 39  ? -5.520  4.554   36.690  1.00 42.94  ? 243  HIS A CE1 1 
ATOM   260  N  NE2 . HIS A 1 39  ? -5.948  5.661   36.109  1.00 42.46  ? 243  HIS A NE2 1 
ATOM   261  N  N   . THR A 1 40  ? -6.375  5.790   42.706  1.00 40.63  ? 244  THR A N   1 
ATOM   262  C  CA  . THR A 1 40  ? -5.975  6.017   44.089  1.00 39.65  ? 244  THR A CA  1 
ATOM   263  C  C   . THR A 1 40  ? -4.541  6.557   44.113  1.00 38.64  ? 244  THR A C   1 
ATOM   264  O  O   . THR A 1 40  ? -3.667  6.017   43.430  1.00 38.79  ? 244  THR A O   1 
ATOM   265  C  CB  . THR A 1 40  ? -6.044  4.719   44.911  1.00 39.83  ? 244  THR A CB  1 
ATOM   266  O  OG1 . THR A 1 40  ? -7.301  4.071   44.683  1.00 40.71  ? 244  THR A OG1 1 
ATOM   267  C  CG2 . THR A 1 40  ? -5.902  5.015   46.383  1.00 39.12  ? 244  THR A CG2 1 
ATOM   268  N  N   . ALA A 1 41  ? -4.306  7.611   44.894  1.00 37.07  ? 245  ALA A N   1 
ATOM   269  C  CA  . ALA A 1 41  ? -2.976  8.217   45.010  1.00 35.78  ? 245  ALA A CA  1 
ATOM   270  C  C   . ALA A 1 41  ? -1.921  7.224   45.511  1.00 34.60  ? 245  ALA A C   1 
ATOM   271  O  O   . ALA A 1 41  ? -2.235  6.343   46.309  1.00 34.96  ? 245  ALA A O   1 
ATOM   272  C  CB  . ALA A 1 41  ? -3.024  9.454   45.904  1.00 35.77  ? 245  ALA A CB  1 
ATOM   273  N  N   . PRO A 1 42  ? -0.668  7.343   45.025  1.00 33.33  ? 246  PRO A N   1 
ATOM   274  C  CA  . PRO A 1 42  ? 0.356   6.428   45.524  1.00 32.22  ? 246  PRO A CA  1 
ATOM   275  C  C   . PRO A 1 42  ? 0.865   6.821   46.911  1.00 30.77  ? 246  PRO A C   1 
ATOM   276  O  O   . PRO A 1 42  ? 0.814   7.996   47.284  1.00 30.84  ? 246  PRO A O   1 
ATOM   277  C  CB  . PRO A 1 42  ? 1.474   6.570   44.491  1.00 31.94  ? 246  PRO A CB  1 
ATOM   278  C  CG  . PRO A 1 42  ? 1.364   7.986   44.040  1.00 32.80  ? 246  PRO A CG  1 
ATOM   279  C  CD  . PRO A 1 42  ? -0.124  8.270   44.012  1.00 33.09  ? 246  PRO A CD  1 
ATOM   280  N  N   . PHE A 1 43  ? 1.347   5.831   47.654  1.00 29.38  ? 247  PHE A N   1 
ATOM   281  C  CA  . PHE A 1 43  ? 2.036   6.045   48.929  1.00 27.80  ? 247  PHE A CA  1 
ATOM   282  C  C   . PHE A 1 43  ? 3.437   6.587   48.619  1.00 27.21  ? 247  PHE A C   1 
ATOM   283  O  O   . PHE A 1 43  ? 4.187   5.956   47.879  1.00 27.42  ? 247  PHE A O   1 
ATOM   284  C  CB  . PHE A 1 43  ? 2.088   4.721   49.713  1.00 27.56  ? 247  PHE A CB  1 
ATOM   285  C  CG  . PHE A 1 43  ? 2.895   4.776   50.997  1.00 26.99  ? 247  PHE A CG  1 
ATOM   286  C  CD1 . PHE A 1 43  ? 2.321   5.250   52.189  1.00 27.80  ? 247  PHE A CD1 1 
ATOM   287  C  CD2 . PHE A 1 43  ? 4.214   4.339   51.022  1.00 24.99  ? 247  PHE A CD2 1 
ATOM   288  C  CE1 . PHE A 1 43  ? 3.054   5.287   53.377  1.00 26.43  ? 247  PHE A CE1 1 
ATOM   289  C  CE2 . PHE A 1 43  ? 4.956   4.371   52.204  1.00 26.43  ? 247  PHE A CE2 1 
ATOM   290  C  CZ  . PHE A 1 43  ? 4.372   4.849   53.382  1.00 26.82  ? 247  PHE A CZ  1 
ATOM   291  N  N   . VAL A 1 44  ? 3.776   7.757   49.164  1.00 26.08  ? 248  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 44  ? 5.055   8.403   48.878  1.00 24.85  ? 248  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 44  ? 6.198   7.866   49.746  1.00 24.39  ? 248  VAL A C   1 
ATOM   294  O  O   . VAL A 1 44  ? 6.165   7.957   50.986  1.00 23.67  ? 248  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 44  ? 4.961   9.956   48.980  1.00 25.02  ? 248  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 44  ? 6.313   10.608  48.708  1.00 24.56  ? 248  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 44  ? 3.930   10.493  47.994  1.00 24.88  ? 248  VAL A CG2 1 
ATOM   298  N  N   . ILE A 1 45  ? 7.195   7.286   49.076  1.00 23.37  ? 249  ILE A N   1 
ATOM   299  C  CA  . ILE A 1 45  ? 8.462   6.894   49.705  1.00 22.87  ? 249  ILE A CA  1 
ATOM   300  C  C   . ILE A 1 45  ? 9.516   8.018   49.558  1.00 22.11  ? 249  ILE A C   1 
ATOM   301  O  O   . ILE A 1 45  ? 10.081  8.233   48.488  1.00 22.07  ? 249  ILE A O   1 
ATOM   302  C  CB  . ILE A 1 45  ? 8.972   5.533   49.148  1.00 22.69  ? 249  ILE A CB  1 
ATOM   303  C  CG1 . ILE A 1 45  ? 7.928   4.440   49.395  1.00 22.03  ? 249  ILE A CG1 1 
ATOM   304  C  CG2 . ILE A 1 45  ? 10.310  5.144   49.773  1.00 22.47  ? 249  ILE A CG2 1 
ATOM   305  C  CD1 . ILE A 1 45  ? 8.176   3.174   48.605  1.00 21.93  ? 249  ILE A CD1 1 
ATOM   306  N  N   . HIS A 1 46  ? 9.765   8.738   50.644  1.00 21.39  ? 250  HIS A N   1 
ATOM   307  C  CA  . HIS A 1 46  ? 10.612  9.934   50.598  1.00 20.67  ? 250  HIS A CA  1 
ATOM   308  C  C   . HIS A 1 46  ? 11.721  9.903   51.653  1.00 20.54  ? 250  HIS A C   1 
ATOM   309  O  O   . HIS A 1 46  ? 12.521  10.831  51.754  1.00 20.19  ? 250  HIS A O   1 
ATOM   310  C  CB  . HIS A 1 46  ? 9.750   11.184  50.788  1.00 20.07  ? 250  HIS A CB  1 
ATOM   311  C  CG  . HIS A 1 46  ? 9.118   11.263  52.140  1.00 19.83  ? 250  HIS A CG  1 
ATOM   312  N  ND1 . HIS A 1 46  ? 9.726   11.887  53.211  1.00 19.38  ? 250  HIS A ND1 1 
ATOM   313  C  CD2 . HIS A 1 46  ? 7.942   10.781  52.602  1.00 18.72  ? 250  HIS A CD2 1 
ATOM   314  C  CE1 . HIS A 1 46  ? 8.953   11.776  54.276  1.00 19.47  ? 250  HIS A CE1 1 
ATOM   315  N  NE2 . HIS A 1 46  ? 7.861   11.117  53.931  1.00 19.08  ? 250  HIS A NE2 1 
ATOM   316  N  N   . ASP A 1 47  ? 11.746  8.839   52.452  1.00 20.35  ? 251  ASP A N   1 
ATOM   317  C  CA  . ASP A 1 47  ? 12.768  8.672   53.504  1.00 20.21  ? 251  ASP A CA  1 
ATOM   318  C  C   . ASP A 1 47  ? 12.870  7.209   53.947  1.00 19.77  ? 251  ASP A C   1 
ATOM   319  O  O   . ASP A 1 47  ? 12.177  6.350   53.413  1.00 19.88  ? 251  ASP A O   1 
ATOM   320  C  CB  . ASP A 1 47  ? 12.542  9.646   54.690  1.00 20.28  ? 251  ASP A CB  1 
ATOM   321  C  CG  . ASP A 1 47  ? 11.265  9.362   55.490  1.00 20.80  ? 251  ASP A CG  1 
ATOM   322  O  OD1 . ASP A 1 47  ? 10.513  8.403   55.197  1.00 22.69  ? 251  ASP A OD1 1 
ATOM   323  O  OD2 . ASP A 1 47  ? 11.008  10.121  56.452  1.00 22.06  ? 251  ASP A OD2 1 
ATOM   324  N  N   . ILE A 1 48  ? 13.751  6.927   54.895  1.00 20.18  ? 252  ILE A N   1 
ATOM   325  C  CA  . ILE A 1 48  ? 13.967  5.563   55.348  1.00 20.60  ? 252  ILE A CA  1 
ATOM   326  C  C   . ILE A 1 48  ? 12.731  4.988   56.042  1.00 20.66  ? 252  ILE A C   1 
ATOM   327  O  O   . ILE A 1 48  ? 12.385  3.819   55.829  1.00 21.06  ? 252  ILE A O   1 
ATOM   328  C  CB  . ILE A 1 48  ? 15.229  5.451   56.235  1.00 20.37  ? 252  ILE A CB  1 
ATOM   329  C  CG1 . ILE A 1 48  ? 16.496  5.645   55.383  1.00 21.16  ? 252  ILE A CG1 1 
ATOM   330  C  CG2 . ILE A 1 48  ? 15.264  4.103   56.985  1.00 20.56  ? 252  ILE A CG2 1 
ATOM   331  C  CD1 . ILE A 1 48  ? 17.713  6.099   56.160  1.00 20.43  ? 252  ILE A CD1 1 
ATOM   332  N  N   . GLU A 1 49  ? 12.058  5.792   56.855  1.00 21.10  ? 253  GLU A N   1 
ATOM   333  C  CA  . GLU A 1 49  ? 10.871  5.294   57.569  1.00 22.25  ? 253  GLU A CA  1 
ATOM   334  C  C   . GLU A 1 49  ? 9.733   4.943   56.626  1.00 22.60  ? 253  GLU A C   1 
ATOM   335  O  O   . GLU A 1 49  ? 9.058   3.941   56.844  1.00 23.59  ? 253  GLU A O   1 
ATOM   336  C  CB  . GLU A 1 49  ? 10.378  6.266   58.650  1.00 22.03  ? 253  GLU A CB  1 
ATOM   337  C  CG  . GLU A 1 49  ? 11.443  6.664   59.651  1.00 23.40  ? 253  GLU A CG  1 
ATOM   338  C  CD  . GLU A 1 49  ? 11.971  8.029   59.318  1.00 26.17  ? 253  GLU A CD  1 
ATOM   339  O  OE1 . GLU A 1 49  ? 12.605  8.211   58.248  1.00 25.46  ? 253  GLU A OE1 1 
ATOM   340  O  OE2 . GLU A 1 49  ? 11.710  8.946   60.110  1.00 26.68  ? 253  GLU A OE2 1 
ATOM   341  N  N   . THR A 1 50  ? 9.536   5.736   55.571  1.00 22.46  ? 254  THR A N   1 
ATOM   342  C  CA  . THR A 1 50  ? 8.482   5.406   54.591  1.00 23.23  ? 254  THR A CA  1 
ATOM   343  C  C   . THR A 1 50  ? 8.830   4.205   53.706  1.00 22.70  ? 254  THR A C   1 
ATOM   344  O  O   . THR A 1 50  ? 7.941   3.433   53.347  1.00 22.82  ? 254  THR A O   1 
ATOM   345  C  CB  . THR A 1 50  ? 8.028   6.595   53.744  1.00 22.68  ? 254  THR A CB  1 
ATOM   346  O  OG1 . THR A 1 50  ? 9.173   7.285   53.229  1.00 23.79  ? 254  THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 50  ? 7.176   7.534   54.599  1.00 24.22  ? 254  THR A CG2 1 
ATOM   348  N  N   . LEU A 1 51  ? 10.113  4.045   53.376  1.00 22.89  ? 255  LEU A N   1 
ATOM   349  C  CA  . LEU A 1 51  ? 10.584  2.837   52.685  1.00 23.37  ? 255  LEU A CA  1 
ATOM   350  C  C   . LEU A 1 51  ? 10.247  1.584   53.497  1.00 23.90  ? 255  LEU A C   1 
ATOM   351  O  O   . LEU A 1 51  ? 9.784   0.584   52.945  1.00 24.24  ? 255  LEU A O   1 
ATOM   352  C  CB  . LEU A 1 51  ? 12.097  2.897   52.406  1.00 22.99  ? 255  LEU A CB  1 
ATOM   353  C  CG  . LEU A 1 51  ? 12.727  1.649   51.745  1.00 22.37  ? 255  LEU A CG  1 
ATOM   354  C  CD1 . LEU A 1 51  ? 12.367  1.557   50.285  1.00 21.18  ? 255  LEU A CD1 1 
ATOM   355  C  CD2 . LEU A 1 51  ? 14.215  1.650   51.900  1.00 21.40  ? 255  LEU A CD2 1 
ATOM   356  N  N   . TRP A 1 52  ? 10.499  1.655   54.804  1.00 24.77  ? 256  TRP A N   1 
ATOM   357  C  CA  . TRP A 1 52  ? 10.202  0.574   55.736  1.00 25.73  ? 256  TRP A CA  1 
ATOM   358  C  C   . TRP A 1 52  ? 8.688   0.328   55.911  1.00 26.68  ? 256  TRP A C   1 
ATOM   359  O  O   . TRP A 1 52  ? 8.254   -0.820  55.957  1.00 27.34  ? 256  TRP A O   1 
ATOM   360  C  CB  . TRP A 1 52  ? 10.891  0.858   57.075  1.00 25.74  ? 256  TRP A CB  1 
ATOM   361  C  CG  . TRP A 1 52  ? 10.536  -0.084  58.166  1.00 25.60  ? 256  TRP A CG  1 
ATOM   362  C  CD1 . TRP A 1 52  ? 10.980  -1.370  58.325  1.00 25.55  ? 256  TRP A CD1 1 
ATOM   363  C  CD2 . TRP A 1 52  ? 9.663   0.179   59.266  1.00 24.81  ? 256  TRP A CD2 1 
ATOM   364  N  NE1 . TRP A 1 52  ? 10.431  -1.920  59.455  1.00 24.22  ? 256  TRP A NE1 1 
ATOM   365  C  CE2 . TRP A 1 52  ? 9.617   -0.993  60.049  1.00 24.90  ? 256  TRP A CE2 1 
ATOM   366  C  CE3 . TRP A 1 52  ? 8.902   1.285   59.656  1.00 24.74  ? 256  TRP A CE3 1 
ATOM   367  C  CZ2 . TRP A 1 52  ? 8.851   -1.086  61.207  1.00 26.58  ? 256  TRP A CZ2 1 
ATOM   368  C  CZ3 . TRP A 1 52  ? 8.133   1.192   60.813  1.00 25.71  ? 256  TRP A CZ3 1 
ATOM   369  C  CH2 . TRP A 1 52  ? 8.119   0.016   61.573  1.00 26.11  ? 256  TRP A CH2 1 
ATOM   370  N  N   . GLN A 1 53  ? 7.890   1.388   55.999  1.00 27.48  ? 257  GLN A N   1 
ATOM   371  C  CA  . GLN A 1 53  ? 6.432   1.256   56.013  1.00 29.42  ? 257  GLN A CA  1 
ATOM   372  C  C   . GLN A 1 53  ? 5.921   0.587   54.724  1.00 29.60  ? 257  GLN A C   1 
ATOM   373  O  O   . GLN A 1 53  ? 5.013   -0.241  54.773  1.00 29.50  ? 257  GLN A O   1 
ATOM   374  C  CB  . GLN A 1 53  ? 5.748   2.617   56.176  1.00 29.22  ? 257  GLN A CB  1 
ATOM   375  C  CG  . GLN A 1 53  ? 5.951   3.300   57.541  1.00 31.49  ? 257  GLN A CG  1 
ATOM   376  C  CD  . GLN A 1 53  ? 5.165   4.594   57.659  1.00 31.92  ? 257  GLN A CD  1 
ATOM   377  O  OE1 . GLN A 1 53  ? 5.742   5.682   57.729  1.00 36.74  ? 257  GLN A OE1 1 
ATOM   378  N  NE2 . GLN A 1 53  ? 3.842   4.487   57.667  1.00 36.18  ? 257  GLN A NE2 1 
ATOM   379  N  N   . ALA A 1 54  ? 6.504   0.955   53.582  1.00 30.02  ? 258  ALA A N   1 
ATOM   380  C  CA  . ALA A 1 54  ? 6.090   0.397   52.291  1.00 31.03  ? 258  ALA A CA  1 
ATOM   381  C  C   . ALA A 1 54  ? 6.340   -1.119  52.230  1.00 31.66  ? 258  ALA A C   1 
ATOM   382  O  O   . ALA A 1 54  ? 5.548   -1.874  51.658  1.00 31.49  ? 258  ALA A O   1 
ATOM   383  C  CB  . ALA A 1 54  ? 6.802   1.112   51.162  1.00 30.44  ? 258  ALA A CB  1 
ATOM   384  N  N   . GLU A 1 55  ? 7.434   -1.556  52.850  1.00 33.10  ? 259  GLU A N   1 
ATOM   385  C  CA  . GLU A 1 55  ? 7.771   -2.979  52.921  1.00 34.84  ? 259  GLU A CA  1 
ATOM   386  C  C   . GLU A 1 55  ? 6.858   -3.761  53.866  1.00 35.99  ? 259  GLU A C   1 
ATOM   387  O  O   . GLU A 1 55  ? 6.731   -4.977  53.747  1.00 36.64  ? 259  GLU A O   1 
ATOM   388  C  CB  . GLU A 1 55  ? 9.233   -3.169  53.341  1.00 34.77  ? 259  GLU A CB  1 
ATOM   389  C  CG  . GLU A 1 55  ? 10.249  -2.752  52.287  1.00 35.59  ? 259  GLU A CG  1 
ATOM   390  C  CD  . GLU A 1 55  ? 10.197  -3.594  51.012  1.00 36.02  ? 259  GLU A CD  1 
ATOM   391  O  OE1 . GLU A 1 55  ? 9.764   -4.772  51.059  1.00 38.40  ? 259  GLU A OE1 1 
ATOM   392  O  OE2 . GLU A 1 55  ? 10.609  -3.078  49.953  1.00 35.37  ? 259  GLU A OE2 1 
ATOM   393  N  N   . LYS A 1 56  ? 6.230   -3.061  54.806  1.00 37.43  ? 260  LYS A N   1 
ATOM   394  C  CA  . LYS A 1 56  ? 5.388   -3.707  55.797  1.00 39.04  ? 260  LYS A CA  1 
ATOM   395  C  C   . LYS A 1 56  ? 4.005   -4.028  55.246  1.00 40.02  ? 260  LYS A C   1 
ATOM   396  O  O   . LYS A 1 56  ? 3.434   -5.065  55.580  1.00 40.37  ? 260  LYS A O   1 
ATOM   397  C  CB  . LYS A 1 56  ? 5.320   -2.893  57.092  1.00 38.78  ? 260  LYS A CB  1 
ATOM   398  C  CG  . LYS A 1 56  ? 6.622   -2.938  57.887  1.00 39.11  ? 260  LYS A CG  1 
ATOM   399  C  CD  . LYS A 1 56  ? 6.380   -3.182  59.357  1.00 39.85  ? 260  LYS A CD  1 
ATOM   400  C  CE  . LYS A 1 56  ? 5.597   -2.054  60.000  1.00 41.24  ? 260  LYS A CE  1 
ATOM   401  N  NZ  . LYS A 1 56  ? 5.022   -2.506  61.298  1.00 42.03  ? 260  LYS A NZ  1 
ATOM   402  N  N   . GLY A 1 57  ? 3.474   -3.164  54.386  1.00 41.06  ? 261  GLY A N   1 
ATOM   403  C  CA  . GLY A 1 57  ? 2.240   -3.507  53.683  1.00 42.19  ? 261  GLY A CA  1 
ATOM   404  C  C   . GLY A 1 57  ? 1.549   -2.391  52.936  1.00 43.00  ? 261  GLY A C   1 
ATOM   405  O  O   . GLY A 1 57  ? 0.615   -2.642  52.170  1.00 42.61  ? 261  GLY A O   1 
ATOM   406  N  N   . LEU A 1 58  ? 1.997   -1.156  53.158  1.00 43.98  ? 262  LEU A N   1 
ATOM   407  C  CA  . LEU A 1 58  ? 1.350   0.004   52.540  1.00 45.01  ? 262  LEU A CA  1 
ATOM   408  C  C   . LEU A 1 58  ? 1.554   0.045   51.019  1.00 45.64  ? 262  LEU A C   1 
ATOM   409  O  O   . LEU A 1 58  ? 0.802   0.713   50.298  1.00 45.94  ? 262  LEU A O   1 
ATOM   410  C  CB  . LEU A 1 58  ? 1.805   1.305   53.215  1.00 44.83  ? 262  LEU A CB  1 
ATOM   411  C  CG  . LEU A 1 58  ? 1.299   1.479   54.649  1.00 45.36  ? 262  LEU A CG  1 
ATOM   412  C  CD1 . LEU A 1 58  ? 2.154   2.465   55.416  1.00 45.45  ? 262  LEU A CD1 1 
ATOM   413  C  CD2 . LEU A 1 58  ? -0.165  1.911   54.664  1.00 46.49  ? 262  LEU A CD2 1 
ATOM   414  N  N   . VAL A 1 59  ? 2.568   -0.679  50.547  1.00 46.32  ? 263  VAL A N   1 
ATOM   415  C  CA  . VAL A 1 59  ? 2.859   -0.797  49.124  1.00 46.92  ? 263  VAL A CA  1 
ATOM   416  C  C   . VAL A 1 59  ? 3.058   -2.274  48.736  1.00 47.86  ? 263  VAL A C   1 
ATOM   417  O  O   . VAL A 1 59  ? 2.387   -2.773  47.830  1.00 48.11  ? 263  VAL A O   1 
ATOM   418  C  CB  . VAL A 1 59  ? 4.082   0.068   48.722  1.00 46.75  ? 263  VAL A CB  1 
ATOM   419  C  CG1 . VAL A 1 59  ? 4.482   -0.189  47.288  1.00 46.35  ? 263  VAL A CG1 1 
ATOM   420  C  CG2 . VAL A 1 59  ? 3.783   1.546   48.912  1.00 46.24  ? 263  VAL A CG2 1 
ATOM   421  N  N   . TRP A 1 60  ? 3.969   -2.961  49.431  1.00 48.82  ? 264  TRP A N   1 
ATOM   422  C  CA  . TRP A 1 60  ? 4.327   -4.353  49.120  1.00 49.61  ? 264  TRP A CA  1 
ATOM   423  C  C   . TRP A 1 60  ? 3.862   -5.333  50.199  1.00 50.57  ? 264  TRP A C   1 
ATOM   424  O  O   . TRP A 1 60  ? 4.073   -5.100  51.394  1.00 50.76  ? 264  TRP A O   1 
ATOM   425  C  CB  . TRP A 1 60  ? 5.840   -4.489  48.940  1.00 49.17  ? 264  TRP A CB  1 
ATOM   426  C  CG  . TRP A 1 60  ? 6.387   -3.916  47.655  1.00 49.08  ? 264  TRP A CG  1 
ATOM   427  C  CD1 . TRP A 1 60  ? 6.293   -4.468  46.408  1.00 48.98  ? 264  TRP A CD1 1 
ATOM   428  C  CD2 . TRP A 1 60  ? 7.144   -2.700  47.498  1.00 48.57  ? 264  TRP A CD2 1 
ATOM   429  N  NE1 . TRP A 1 60  ? 6.928   -3.664  45.483  1.00 49.68  ? 264  TRP A NE1 1 
ATOM   430  C  CE2 . TRP A 1 60  ? 7.460   -2.576  46.125  1.00 48.84  ? 264  TRP A CE2 1 
ATOM   431  C  CE3 . TRP A 1 60  ? 7.580   -1.703  48.383  1.00 48.01  ? 264  TRP A CE3 1 
ATOM   432  C  CZ2 . TRP A 1 60  ? 8.188   -1.493  45.614  1.00 48.68  ? 264  TRP A CZ2 1 
ATOM   433  C  CZ3 . TRP A 1 60  ? 8.298   -0.625  47.871  1.00 48.71  ? 264  TRP A CZ3 1 
ATOM   434  C  CH2 . TRP A 1 60  ? 8.598   -0.533  46.500  1.00 48.57  ? 264  TRP A CH2 1 
ATOM   435  N  N   . LYS A 1 61  ? 3.240   -6.432  49.764  1.00 51.74  ? 265  LYS A N   1 
ATOM   436  C  CA  . LYS A 1 61  ? 2.760   -7.490  50.665  1.00 52.44  ? 265  LYS A CA  1 
ATOM   437  C  C   . LYS A 1 61  ? 3.905   -8.234  51.349  1.00 52.67  ? 265  LYS A C   1 
ATOM   438  O  O   . LYS A 1 61  ? 4.001   -8.232  52.579  1.00 53.09  ? 265  LYS A O   1 
ATOM   439  C  CB  . LYS A 1 61  ? 1.855   -8.479  49.912  1.00 52.70  ? 265  LYS A CB  1 
ATOM   440  C  CG  . LYS A 1 61  ? 0.346   -8.419  50.245  1.00 53.51  ? 265  LYS A CG  1 
ATOM   441  C  CD  . LYS A 1 61  ? -0.221  -7.000  50.418  1.00 54.96  ? 265  LYS A CD  1 
ATOM   442  C  CE  . LYS A 1 61  ? -0.434  -6.656  51.900  1.00 55.35  ? 265  LYS A CE  1 
ATOM   443  N  NZ  . LYS A 1 61  ? -0.772  -5.219  52.115  1.00 55.38  ? 265  LYS A NZ  1 
ATOM   444  N  N   . LEU A 1 67  ? 12.616  -11.783 48.728  1.00 36.27  ? 271  LEU A N   1 
ATOM   445  C  CA  . LEU A 1 67  ? 13.898  -11.119 48.498  1.00 36.12  ? 271  LEU A CA  1 
ATOM   446  C  C   . LEU A 1 67  ? 15.024  -11.847 49.228  1.00 35.77  ? 271  LEU A C   1 
ATOM   447  O  O   . LEU A 1 67  ? 14.751  -12.640 50.130  1.00 36.11  ? 271  LEU A O   1 
ATOM   448  C  CB  . LEU A 1 67  ? 13.826  -9.644  48.922  1.00 36.02  ? 271  LEU A CB  1 
ATOM   449  C  CG  . LEU A 1 67  ? 13.053  -8.694  48.003  1.00 36.22  ? 271  LEU A CG  1 
ATOM   450  C  CD1 . LEU A 1 67  ? 12.887  -7.342  48.668  1.00 36.91  ? 271  LEU A CD1 1 
ATOM   451  C  CD2 . LEU A 1 67  ? 13.728  -8.534  46.650  1.00 36.26  ? 271  LEU A CD2 1 
ATOM   452  N  N   . PRO A 1 68  ? 16.293  -11.621 48.818  1.00 35.58  ? 272  PRO A N   1 
ATOM   453  C  CA  . PRO A 1 68  ? 17.409  -12.242 49.549  1.00 35.34  ? 272  PRO A CA  1 
ATOM   454  C  C   . PRO A 1 68  ? 17.531  -11.654 50.964  1.00 35.11  ? 272  PRO A C   1 
ATOM   455  O  O   . PRO A 1 68  ? 16.912  -10.627 51.243  1.00 35.26  ? 272  PRO A O   1 
ATOM   456  C  CB  . PRO A 1 68  ? 18.635  -11.881 48.692  1.00 35.33  ? 272  PRO A CB  1 
ATOM   457  C  CG  . PRO A 1 68  ? 18.084  -11.454 47.352  1.00 35.09  ? 272  PRO A CG  1 
ATOM   458  C  CD  . PRO A 1 68  ? 16.766  -10.829 47.665  1.00 35.43  ? 272  PRO A CD  1 
ATOM   459  N  N   . PRO A 1 69  ? 18.318  -12.288 51.859  1.00 34.85  ? 273  PRO A N   1 
ATOM   460  C  CA  . PRO A 1 69  ? 18.437  -11.742 53.225  1.00 33.98  ? 273  PRO A CA  1 
ATOM   461  C  C   . PRO A 1 69  ? 18.806  -10.248 53.259  1.00 33.10  ? 273  PRO A C   1 
ATOM   462  O  O   . PRO A 1 69  ? 19.691  -9.813  52.514  1.00 33.27  ? 273  PRO A O   1 
ATOM   463  C  CB  . PRO A 1 69  ? 19.555  -12.583 53.838  1.00 34.14  ? 273  PRO A CB  1 
ATOM   464  C  CG  . PRO A 1 69  ? 19.482  -13.884 53.102  1.00 35.11  ? 273  PRO A CG  1 
ATOM   465  C  CD  . PRO A 1 69  ? 19.122  -13.514 51.688  1.00 34.97  ? 273  PRO A CD  1 
ATOM   466  N  N   . TYR A 1 70  ? 18.114  -9.480  54.104  1.00 31.54  ? 274  TYR A N   1 
ATOM   467  C  CA  . TYR A 1 70  ? 18.354  -8.038  54.245  1.00 30.10  ? 274  TYR A CA  1 
ATOM   468  C  C   . TYR A 1 70  ? 19.813  -7.718  54.612  1.00 29.68  ? 274  TYR A C   1 
ATOM   469  O  O   . TYR A 1 70  ? 20.395  -8.363  55.480  1.00 29.26  ? 274  TYR A O   1 
ATOM   470  C  CB  . TYR A 1 70  ? 17.388  -7.417  55.266  1.00 29.35  ? 274  TYR A CB  1 
ATOM   471  C  CG  . TYR A 1 70  ? 17.648  -5.943  55.520  1.00 28.76  ? 274  TYR A CG  1 
ATOM   472  C  CD1 . TYR A 1 70  ? 17.192  -4.975  54.622  1.00 26.56  ? 274  TYR A CD1 1 
ATOM   473  C  CD2 . TYR A 1 70  ? 18.372  -5.520  56.644  1.00 27.35  ? 274  TYR A CD2 1 
ATOM   474  C  CE1 . TYR A 1 70  ? 17.439  -3.633  54.833  1.00 26.36  ? 274  TYR A CE1 1 
ATOM   475  C  CE2 . TYR A 1 70  ? 18.620  -4.178  56.861  1.00 26.29  ? 274  TYR A CE2 1 
ATOM   476  C  CZ  . TYR A 1 70  ? 18.154  -3.244  55.947  1.00 26.36  ? 274  TYR A CZ  1 
ATOM   477  O  OH  . TYR A 1 70  ? 18.387  -1.911  56.152  1.00 27.43  ? 274  TYR A OH  1 
ATOM   478  N  N   . LYS A 1 71  ? 20.388  -6.719  53.939  1.00 29.13  ? 275  LYS A N   1 
ATOM   479  C  CA  . LYS A 1 71  ? 21.789  -6.348  54.142  1.00 28.70  ? 275  LYS A CA  1 
ATOM   480  C  C   . LYS A 1 71  ? 21.899  -4.917  54.664  1.00 27.87  ? 275  LYS A C   1 
ATOM   481  O  O   . LYS A 1 71  ? 22.394  -4.675  55.770  1.00 27.51  ? 275  LYS A O   1 
ATOM   482  C  CB  . LYS A 1 71  ? 22.587  -6.518  52.836  1.00 29.28  ? 275  LYS A CB  1 
ATOM   483  C  CG  . LYS A 1 71  ? 22.761  -7.977  52.378  1.00 30.50  ? 275  LYS A CG  1 
ATOM   484  C  CD  . LYS A 1 71  ? 23.875  -8.675  53.171  1.00 33.89  ? 275  LYS A CD  1 
ATOM   485  C  CE  . LYS A 1 71  ? 23.943  -10.170 52.836  1.00 36.15  ? 275  LYS A CE  1 
ATOM   486  N  NZ  . LYS A 1 71  ? 25.281  -10.734 53.203  1.00 37.63  ? 275  LYS A NZ  1 
ATOM   487  N  N   . GLU A 1 72  ? 21.409  -3.980  53.865  1.00 26.20  ? 276  GLU A N   1 
ATOM   488  C  CA  . GLU A 1 72  ? 21.390  -2.563  54.237  1.00 25.37  ? 276  GLU A CA  1 
ATOM   489  C  C   . GLU A 1 72  ? 20.404  -1.829  53.353  1.00 24.31  ? 276  GLU A C   1 
ATOM   490  O  O   . GLU A 1 72  ? 19.941  -2.383  52.350  1.00 23.71  ? 276  GLU A O   1 
ATOM   491  C  CB  . GLU A 1 72  ? 22.782  -1.947  54.114  1.00 25.30  ? 276  GLU A CB  1 
ATOM   492  C  CG  . GLU A 1 72  ? 23.266  -1.755  52.695  1.00 25.26  ? 276  GLU A CG  1 
ATOM   493  C  CD  . GLU A 1 72  ? 24.687  -1.268  52.639  1.00 23.37  ? 276  GLU A CD  1 
ATOM   494  O  OE1 . GLU A 1 72  ? 24.891  -0.052  52.497  1.00 25.07  ? 276  GLU A OE1 1 
ATOM   495  O  OE2 . GLU A 1 72  ? 25.606  -2.099  52.741  1.00 24.55  ? 276  GLU A OE2 1 
ATOM   496  N  N   . ILE A 1 73  ? 20.089  -0.586  53.725  1.00 23.79  ? 277  ILE A N   1 
ATOM   497  C  CA  . ILE A 1 73  ? 19.078  0.210   53.021  1.00 23.34  ? 277  ILE A CA  1 
ATOM   498  C  C   . ILE A 1 73  ? 19.362  0.307   51.526  1.00 23.11  ? 277  ILE A C   1 
ATOM   499  O  O   . ILE A 1 73  ? 18.469  0.076   50.713  1.00 23.12  ? 277  ILE A O   1 
ATOM   500  C  CB  . ILE A 1 73  ? 18.946  1.634   53.611  1.00 23.34  ? 277  ILE A CB  1 
ATOM   501  C  CG1 . ILE A 1 73  ? 18.377  1.570   55.030  1.00 23.31  ? 277  ILE A CG1 1 
ATOM   502  C  CG2 . ILE A 1 73  ? 18.056  2.512   52.714  1.00 23.36  ? 277  ILE A CG2 1 
ATOM   503  C  CD1 . ILE A 1 73  ? 18.917  2.680   55.939  1.00 23.94  ? 277  ILE A CD1 1 
ATOM   504  N  N   . SER A 1 74  ? 20.607  0.630   51.182  1.00 23.03  ? 278  SER A N   1 
ATOM   505  C  CA  . SER A 1 74  ? 20.999  0.871   49.789  1.00 23.51  ? 278  SER A CA  1 
ATOM   506  C  C   . SER A 1 74  ? 20.839  -0.373  48.957  1.00 22.96  ? 278  SER A C   1 
ATOM   507  O  O   . SER A 1 74  ? 20.322  -0.317  47.835  1.00 22.45  ? 278  SER A O   1 
ATOM   508  C  CB  . SER A 1 74  ? 22.452  1.322   49.712  1.00 23.87  ? 278  SER A CB  1 
ATOM   509  O  OG  . SER A 1 74  ? 22.563  2.652   50.152  1.00 25.68  ? 278  SER A OG  1 
ATOM   510  N  N   . VAL A 1 75  ? 21.296  -1.491  49.525  1.00 22.70  ? 279  VAL A N   1 
ATOM   511  C  CA  . VAL A 1 75  ? 21.194  -2.792  48.885  1.00 22.72  ? 279  VAL A CA  1 
ATOM   512  C  C   . VAL A 1 75  ? 19.743  -3.217  48.734  1.00 22.31  ? 279  VAL A C   1 
ATOM   513  O  O   . VAL A 1 75  ? 19.366  -3.702  47.672  1.00 22.96  ? 279  VAL A O   1 
ATOM   514  C  CB  . VAL A 1 75  ? 22.029  -3.873  49.591  1.00 21.70  ? 279  VAL A CB  1 
ATOM   515  C  CG1 . VAL A 1 75  ? 21.902  -5.187  48.856  1.00 23.47  ? 279  VAL A CG1 1 
ATOM   516  C  CG2 . VAL A 1 75  ? 23.512  -3.464  49.632  1.00 22.66  ? 279  VAL A CG2 1 
ATOM   517  N  N   . HIS A 1 76  ? 18.930  -3.032  49.773  1.00 22.49  ? 280  HIS A N   1 
ATOM   518  C  CA  . HIS A 1 76  ? 17.486  -3.324  49.676  1.00 22.43  ? 280  HIS A CA  1 
ATOM   519  C  C   . HIS A 1 76  ? 16.800  -2.607  48.490  1.00 22.25  ? 280  HIS A C   1 
ATOM   520  O  O   . HIS A 1 76  ? 16.061  -3.225  47.730  1.00 21.65  ? 280  HIS A O   1 
ATOM   521  C  CB  . HIS A 1 76  ? 16.758  -3.014  50.999  1.00 22.82  ? 280  HIS A CB  1 
ATOM   522  C  CG  . HIS A 1 76  ? 15.285  -3.269  50.945  1.00 24.42  ? 280  HIS A CG  1 
ATOM   523  N  ND1 . HIS A 1 76  ? 14.743  -4.531  51.083  1.00 26.14  ? 280  HIS A ND1 1 
ATOM   524  C  CD2 . HIS A 1 76  ? 14.242  -2.431  50.738  1.00 26.16  ? 280  HIS A CD2 1 
ATOM   525  C  CE1 . HIS A 1 76  ? 13.430  -4.457  50.979  1.00 26.63  ? 280  HIS A CE1 1 
ATOM   526  N  NE2 . HIS A 1 76  ? 13.101  -3.195  50.764  1.00 27.75  ? 280  HIS A NE2 1 
ATOM   527  N  N   . VAL A 1 77  ? 17.042  -1.305  48.343  1.00 22.29  ? 281  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 77  ? 16.565  -0.557  47.175  1.00 22.09  ? 281  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 77  ? 17.062  -1.173  45.853  1.00 22.36  ? 281  VAL A C   1 
ATOM   530  O  O   . VAL A 1 77  ? 16.286  -1.319  44.920  1.00 21.59  ? 281  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 77  ? 16.950  0.946   47.265  1.00 22.35  ? 281  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 77  ? 16.738  1.654   45.921  1.00 23.03  ? 281  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 77  ? 16.160  1.634   48.400  1.00 22.51  ? 281  VAL A CG2 1 
ATOM   534  N  N   . PHE A 1 78  ? 18.348  -1.525  45.789  1.00 22.47  ? 282  PHE A N   1 
ATOM   535  C  CA  . PHE A 1 78  ? 18.921  -2.256  44.646  1.00 23.28  ? 282  PHE A CA  1 
ATOM   536  C  C   . PHE A 1 78  ? 18.153  -3.555  44.346  1.00 23.33  ? 282  PHE A C   1 
ATOM   537  O  O   . PHE A 1 78  ? 17.792  -3.821  43.180  1.00 22.33  ? 282  PHE A O   1 
ATOM   538  C  CB  . PHE A 1 78  ? 20.434  -2.512  44.857  1.00 23.63  ? 282  PHE A CB  1 
ATOM   539  C  CG  . PHE A 1 78  ? 21.163  -3.051  43.636  1.00 25.10  ? 282  PHE A CG  1 
ATOM   540  C  CD1 . PHE A 1 78  ? 21.179  -2.342  42.430  1.00 25.66  ? 282  PHE A CD1 1 
ATOM   541  C  CD2 . PHE A 1 78  ? 21.871  -4.252  43.711  1.00 26.46  ? 282  PHE A CD2 1 
ATOM   542  C  CE1 . PHE A 1 78  ? 21.862  -2.847  41.310  1.00 27.22  ? 282  PHE A CE1 1 
ATOM   543  C  CE2 . PHE A 1 78  ? 22.568  -4.763  42.604  1.00 25.70  ? 282  PHE A CE2 1 
ATOM   544  C  CZ  . PHE A 1 78  ? 22.559  -4.065  41.401  1.00 25.90  ? 282  PHE A CZ  1 
ATOM   545  N  N   . TYR A 1 79  ? 17.861  -4.337  45.389  1.00 23.17  ? 283  TYR A N   1 
ATOM   546  C  CA  . TYR A 1 79  ? 17.074  -5.568  45.216  1.00 23.32  ? 283  TYR A CA  1 
ATOM   547  C  C   . TYR A 1 79  ? 15.698  -5.293  44.604  1.00 23.48  ? 283  TYR A C   1 
ATOM   548  O  O   . TYR A 1 79  ? 15.259  -6.030  43.725  1.00 23.06  ? 283  TYR A O   1 
ATOM   549  C  CB  . TYR A 1 79  ? 16.941  -6.360  46.530  1.00 23.51  ? 283  TYR A CB  1 
ATOM   550  C  CG  . TYR A 1 79  ? 18.216  -7.036  47.005  1.00 22.77  ? 283  TYR A CG  1 
ATOM   551  C  CD1 . TYR A 1 79  ? 19.261  -7.300  46.126  1.00 21.92  ? 283  TYR A CD1 1 
ATOM   552  C  CD2 . TYR A 1 79  ? 18.355  -7.440  48.336  1.00 22.14  ? 283  TYR A CD2 1 
ATOM   553  C  CE1 . TYR A 1 79  ? 20.433  -7.910  46.564  1.00 23.82  ? 283  TYR A CE1 1 
ATOM   554  C  CE2 . TYR A 1 79  ? 19.501  -8.060  48.779  1.00 23.06  ? 283  TYR A CE2 1 
ATOM   555  C  CZ  . TYR A 1 79  ? 20.541  -8.295  47.888  1.00 23.47  ? 283  TYR A CZ  1 
ATOM   556  O  OH  . TYR A 1 79  ? 21.688  -8.910  48.310  1.00 24.32  ? 283  TYR A OH  1 
ATOM   557  N  N   . ARG A 1 80  ? 15.040  -4.221  45.052  1.00 23.67  ? 284  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 80  ? 13.746  -3.793  44.480  1.00 24.03  ? 284  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 80  ? 13.866  -3.332  43.013  1.00 23.86  ? 284  ARG A C   1 
ATOM   560  O  O   . ARG A 1 80  ? 12.939  -3.497  42.227  1.00 23.34  ? 284  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 80  ? 13.107  -2.677  45.331  1.00 24.62  ? 284  ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 80  ? 12.393  -3.137  46.607  1.00 25.74  ? 284  ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 80  ? 11.041  -3.763  46.303  1.00 28.55  ? 284  ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 80  ? 10.521  -4.516  47.441  1.00 31.28  ? 284  ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 80  ? 9.783   -5.616  47.336  1.00 31.59  ? 284  ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 80  ? 9.479   -6.110  46.140  1.00 32.05  ? 284  ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 80  ? 9.356   -6.227  48.428  1.00 31.94  ? 284  ARG A NH2 1 
ATOM   568  N  N   . CYS A 1 81  ? 15.001  -2.741  42.657  1.00 24.08  ? 285  CYS A N   1 
ATOM   569  C  CA  . CYS A 1 81  ? 15.266  -2.357  41.261  1.00 24.62  ? 285  CYS A CA  1 
ATOM   570  C  C   . CYS A 1 81  ? 15.328  -3.583  40.358  1.00 24.89  ? 285  CYS A C   1 
ATOM   571  O  O   . CYS A 1 81  ? 14.784  -3.563  39.243  1.00 24.50  ? 285  CYS A O   1 
ATOM   572  C  CB  . CYS A 1 81  ? 16.585  -1.605  41.140  1.00 24.39  ? 285  CYS A CB  1 
ATOM   573  S  SG  . CYS A 1 81  ? 16.586  0.076   41.758  1.00 25.81  ? 285  CYS A SG  1 
ATOM   574  N  N   . GLN A 1 82  ? 16.005  -4.624  40.854  1.00 25.07  ? 286  GLN A N   1 
ATOM   575  C  CA  . GLN A 1 82  ? 16.121  -5.933  40.187  1.00 26.45  ? 286  GLN A CA  1 
ATOM   576  C  C   . GLN A 1 82  ? 14.782  -6.648  39.990  1.00 26.86  ? 286  GLN A C   1 
ATOM   577  O  O   . GLN A 1 82  ? 14.542  -7.227  38.928  1.00 26.77  ? 286  GLN A O   1 
ATOM   578  C  CB  . GLN A 1 82  ? 17.085  -6.847  40.953  1.00 26.07  ? 286  GLN A CB  1 
ATOM   579  C  CG  . GLN A 1 82  ? 18.563  -6.478  40.803  1.00 26.58  ? 286  GLN A CG  1 
ATOM   580  C  CD  . GLN A 1 82  ? 19.474  -7.528  41.392  1.00 27.10  ? 286  GLN A CD  1 
ATOM   581  O  OE1 . GLN A 1 82  ? 19.521  -8.661  40.913  1.00 28.24  ? 286  GLN A OE1 1 
ATOM   582  N  NE2 . GLN A 1 82  ? 20.200  -7.160  42.444  1.00 28.37  ? 286  GLN A NE2 1 
ATOM   583  N  N   . CYS A 1 83  ? 13.919  -6.617  41.005  1.00 27.46  ? 287  CYS A N   1 
ATOM   584  C  CA  . CYS A 1 83  ? 12.576  -7.203  40.890  1.00 28.45  ? 287  CYS A CA  1 
ATOM   585  C  C   . CYS A 1 83  ? 11.786  -6.600  39.750  1.00 27.76  ? 287  CYS A C   1 
ATOM   586  O  O   . CYS A 1 83  ? 11.137  -7.321  38.986  1.00 27.32  ? 287  CYS A O   1 
ATOM   587  C  CB  . CYS A 1 83  ? 11.761  -6.964  42.151  1.00 29.07  ? 287  CYS A CB  1 
ATOM   588  S  SG  . CYS A 1 83  ? 12.337  -7.821  43.564  1.00 35.13  ? 287  CYS A SG  1 
ATOM   589  N  N   . THR A 1 84  ? 11.812  -5.268  39.677  1.00 27.33  ? 288  THR A N   1 
ATOM   590  C  CA  . THR A 1 84  ? 11.086  -4.543  38.659  1.00 27.17  ? 288  THR A CA  1 
ATOM   591  C  C   . THR A 1 84  ? 11.640  -4.787  37.246  1.00 26.39  ? 288  THR A C   1 
ATOM   592  O  O   . THR A 1 84  ? 10.867  -4.997  36.312  1.00 25.89  ? 288  THR A O   1 
ATOM   593  C  CB  . THR A 1 84  ? 11.056  -3.016  38.934  1.00 27.32  ? 288  THR A CB  1 
ATOM   594  O  OG1 . THR A 1 84  ? 10.979  -2.770  40.345  1.00 29.57  ? 288  THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 84  ? 9.853   -2.399  38.257  1.00 27.87  ? 288  THR A CG2 1 
ATOM   596  N  N   . THR A 1 85  ? 12.961  -4.734  37.078  1.00 25.81  ? 289  THR A N   1 
ATOM   597  C  CA  . THR A 1 85  ? 13.525  -4.938  35.744  1.00 25.25  ? 289  THR A CA  1 
ATOM   598  C  C   . THR A 1 85  ? 13.307  -6.376  35.255  1.00 25.31  ? 289  THR A C   1 
ATOM   599  O  O   . THR A 1 85  ? 13.003  -6.590  34.073  1.00 25.48  ? 289  THR A O   1 
ATOM   600  C  CB  . THR A 1 85  ? 15.002  -4.500  35.621  1.00 25.19  ? 289  THR A CB  1 
ATOM   601  O  OG1 . THR A 1 85  ? 15.810  -5.284  36.490  1.00 23.62  ? 289  THR A OG1 1 
ATOM   602  C  CG2 . THR A 1 85  ? 15.167  -3.024  35.975  1.00 25.40  ? 289  THR A CG2 1 
ATOM   603  N  N   . VAL A 1 86  ? 13.428  -7.355  36.152  1.00 25.45  ? 290  VAL A N   1 
ATOM   604  C  CA  . VAL A 1 86  ? 13.174  -8.771  35.798  1.00 25.74  ? 290  VAL A CA  1 
ATOM   605  C  C   . VAL A 1 86  ? 11.686  -9.003  35.421  1.00 26.63  ? 290  VAL A C   1 
ATOM   606  O  O   . VAL A 1 86  ? 11.387  -9.695  34.448  1.00 26.21  ? 290  VAL A O   1 
ATOM   607  C  CB  . VAL A 1 86  ? 13.639  -9.748  36.905  1.00 25.90  ? 290  VAL A CB  1 
ATOM   608  C  CG1 . VAL A 1 86  ? 13.210  -11.190 36.605  1.00 25.13  ? 290  VAL A CG1 1 
ATOM   609  C  CG2 . VAL A 1 86  ? 15.170  -9.685  37.069  1.00 25.40  ? 290  VAL A CG2 1 
ATOM   610  N  N   . GLU A 1 87  ? 10.765  -8.405  36.169  1.00 27.26  ? 291  GLU A N   1 
ATOM   611  C  CA  . GLU A 1 87  ? 9.350   -8.474  35.794  1.00 28.05  ? 291  GLU A CA  1 
ATOM   612  C  C   . GLU A 1 87  ? 9.102   -7.834  34.411  1.00 27.88  ? 291  GLU A C   1 
ATOM   613  O  O   . GLU A 1 87  ? 8.339   -8.378  33.590  1.00 27.57  ? 291  GLU A O   1 
ATOM   614  C  CB  . GLU A 1 87  ? 8.470   -7.827  36.868  1.00 28.73  ? 291  GLU A CB  1 
ATOM   615  C  CG  . GLU A 1 87  ? 6.948   -7.891  36.590  1.00 32.09  ? 291  GLU A CG  1 
ATOM   616  C  CD  . GLU A 1 87  ? 6.410   -9.313  36.345  1.00 36.95  ? 291  GLU A CD  1 
ATOM   617  O  OE1 . GLU A 1 87  ? 6.948   -10.299 36.917  1.00 37.96  ? 291  GLU A OE1 1 
ATOM   618  O  OE2 . GLU A 1 87  ? 5.427   -9.435  35.571  1.00 39.87  ? 291  GLU A OE2 1 
ATOM   619  N  N   . THR A 1 88  ? 9.767   -6.703  34.157  1.00 26.53  ? 292  THR A N   1 
ATOM   620  C  CA  . THR A 1 88  ? 9.640   -5.998  32.884  1.00 26.15  ? 292  THR A CA  1 
ATOM   621  C  C   . THR A 1 88  ? 10.194  -6.814  31.705  1.00 25.80  ? 292  THR A C   1 
ATOM   622  O  O   . THR A 1 88  ? 9.606   -6.812  30.614  1.00 25.55  ? 292  THR A O   1 
ATOM   623  C  CB  . THR A 1 88  ? 10.268  -4.572  32.956  1.00 26.18  ? 292  THR A CB  1 
ATOM   624  O  OG1 . THR A 1 88  ? 9.781   -3.908  34.126  1.00 25.39  ? 292  THR A OG1 1 
ATOM   625  C  CG2 . THR A 1 88  ? 9.895   -3.744  31.735  1.00 24.97  ? 292  THR A CG2 1 
ATOM   626  N  N   . VAL A 1 89  ? 11.311  -7.510  31.931  1.00 25.70  ? 293  VAL A N   1 
ATOM   627  C  CA  . VAL A 1 89  ? 11.848  -8.484  30.963  1.00 25.62  ? 293  VAL A CA  1 
ATOM   628  C  C   . VAL A 1 89  ? 10.794  -9.532  30.562  1.00 26.24  ? 293  VAL A C   1 
ATOM   629  O  O   . VAL A 1 89  ? 10.691  -9.906  29.388  1.00 26.00  ? 293  VAL A O   1 
ATOM   630  C  CB  . VAL A 1 89  ? 13.151  -9.152  31.481  1.00 25.81  ? 293  VAL A CB  1 
ATOM   631  C  CG1 . VAL A 1 89  ? 13.544  -10.346 30.619  1.00 24.57  ? 293  VAL A CG1 1 
ATOM   632  C  CG2 . VAL A 1 89  ? 14.300  -8.128  31.530  1.00 24.53  ? 293  VAL A CG2 1 
ATOM   633  N  N   . ARG A 1 90  ? 10.008  -9.974  31.546  1.00 26.34  ? 294  ARG A N   1 
ATOM   634  C  CA  . ARG A 1 90  ? 8.883   -10.892 31.332  1.00 26.58  ? 294  ARG A CA  1 
ATOM   635  C  C   . ARG A 1 90  ? 7.820   -10.298 30.396  1.00 25.92  ? 294  ARG A C   1 
ATOM   636  O  O   . ARG A 1 90  ? 7.393   -10.950 29.427  1.00 24.98  ? 294  ARG A O   1 
ATOM   637  C  CB  . ARG A 1 90  ? 8.243   -11.262 32.675  1.00 26.91  ? 294  ARG A CB  1 
ATOM   638  C  CG  . ARG A 1 90  ? 9.135   -12.079 33.604  1.00 30.23  ? 294  ARG A CG  1 
ATOM   639  C  CD  . ARG A 1 90  ? 8.266   -12.923 34.566  1.00 36.43  ? 294  ARG A CD  1 
ATOM   640  N  NE  . ARG A 1 90  ? 8.927   -13.170 35.852  1.00 39.54  ? 294  ARG A NE  1 
ATOM   641  C  CZ  . ARG A 1 90  ? 9.397   -14.352 36.255  1.00 41.43  ? 294  ARG A CZ  1 
ATOM   642  N  NH1 . ARG A 1 90  ? 9.287   -15.428 35.475  1.00 42.70  ? 294  ARG A NH1 1 
ATOM   643  N  NH2 . ARG A 1 90  ? 9.979   -14.462 37.450  1.00 41.54  ? 294  ARG A NH2 1 
ATOM   644  N  N   . GLU A 1 91  ? 7.402   -9.067  30.696  1.00 25.04  ? 295  GLU A N   1 
ATOM   645  C  CA  . GLU A 1 91  ? 6.425   -8.344  29.870  1.00 25.04  ? 295  GLU A CA  1 
ATOM   646  C  C   . GLU A 1 91  ? 6.941   -8.092  28.446  1.00 24.30  ? 295  GLU A C   1 
ATOM   647  O  O   . GLU A 1 91  ? 6.195   -8.257  27.471  1.00 23.95  ? 295  GLU A O   1 
ATOM   648  C  CB  . GLU A 1 91  ? 6.047   -7.002  30.525  1.00 25.16  ? 295  GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 91  ? 5.426   -7.101  31.925  1.00 25.86  ? 295  GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 91  ? 4.804   -5.790  32.392  1.00 26.36  ? 295  GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 91  ? 5.467   -4.728  32.308  1.00 27.06  ? 295  GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 91  ? 3.640   -5.820  32.849  1.00 29.39  ? 295  GLU A OE2 1 
ATOM   653  N  N   . LEU A 1 92  ? 8.210   -7.683  28.334  1.00 23.76  ? 296  LEU A N   1 
ATOM   654  C  CA  . LEU A 1 92  ? 8.849   -7.431  27.030  1.00 22.95  ? 296  LEU A CA  1 
ATOM   655  C  C   . LEU A 1 92  ? 8.952   -8.690  26.166  1.00 23.28  ? 296  LEU A C   1 
ATOM   656  O  O   . LEU A 1 92  ? 8.783   -8.617  24.939  1.00 23.35  ? 296  LEU A O   1 
ATOM   657  C  CB  . LEU A 1 92  ? 10.239  -6.793  27.211  1.00 22.80  ? 296  LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 92  ? 10.314  -5.282  27.454  1.00 21.59  ? 296  LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 92  ? 11.698  -4.862  28.034  1.00 20.26  ? 296  LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 92  ? 9.976   -4.491  26.199  1.00 18.32  ? 296  LEU A CD2 1 
ATOM   661  N  N   . THR A 1 93  ? 9.238   -9.832  26.795  1.00 22.96  ? 297  THR A N   1 
ATOM   662  C  CA  . THR A 1 93  ? 9.285   -11.126 26.084  1.00 23.44  ? 297  THR A CA  1 
ATOM   663  C  C   . THR A 1 93  ? 7.926   -11.441 25.451  1.00 23.35  ? 297  THR A C   1 
ATOM   664  O  O   . THR A 1 93  ? 7.866   -11.781 24.275  1.00 22.83  ? 297  THR A O   1 
ATOM   665  C  CB  . THR A 1 93  ? 9.717   -12.296 26.993  1.00 23.26  ? 297  THR A CB  1 
ATOM   666  O  OG1 . THR A 1 93  ? 10.972  -11.992 27.608  1.00 23.94  ? 297  THR A OG1 1 
ATOM   667  C  CG2 . THR A 1 93  ? 9.876   -13.594 26.182  1.00 23.61  ? 297  THR A CG2 1 
ATOM   668  N  N   . GLU A 1 94  ? 6.857   -11.307 26.244  1.00 24.01  ? 298  GLU A N   1 
ATOM   669  C  CA  . GLU A 1 94  ? 5.484   -11.543 25.789  1.00 24.74  ? 298  GLU A CA  1 
ATOM   670  C  C   . GLU A 1 94  ? 5.060   -10.560 24.717  1.00 24.45  ? 298  GLU A C   1 
ATOM   671  O  O   . GLU A 1 94  ? 4.344   -10.928 23.785  1.00 24.15  ? 298  GLU A O   1 
ATOM   672  C  CB  . GLU A 1 94  ? 4.487   -11.467 26.954  1.00 25.11  ? 298  GLU A CB  1 
ATOM   673  C  CG  . GLU A 1 94  ? 4.629   -12.559 28.011  1.00 27.80  ? 298  GLU A CG  1 
ATOM   674  C  CD  . GLU A 1 94  ? 4.853   -13.933 27.416  1.00 31.69  ? 298  GLU A CD  1 
ATOM   675  O  OE1 . GLU A 1 94  ? 4.015   -14.382 26.601  1.00 31.55  ? 298  GLU A OE1 1 
ATOM   676  O  OE2 . GLU A 1 94  ? 5.881   -14.560 27.764  1.00 34.54  ? 298  GLU A OE2 1 
ATOM   677  N  N   . PHE A 1 95  ? 5.477   -9.303  24.874  1.00 24.53  ? 299  PHE A N   1 
ATOM   678  C  CA  . PHE A 1 95  ? 5.210   -8.267  23.881  1.00 24.60  ? 299  PHE A CA  1 
ATOM   679  C  C   . PHE A 1 95  ? 5.867   -8.631  22.557  1.00 24.78  ? 299  PHE A C   1 
ATOM   680  O  O   . PHE A 1 95  ? 5.215   -8.611  21.514  1.00 24.60  ? 299  PHE A O   1 
ATOM   681  C  CB  . PHE A 1 95  ? 5.671   -6.897  24.392  1.00 23.78  ? 299  PHE A CB  1 
ATOM   682  C  CG  . PHE A 1 95  ? 5.733   -5.811  23.323  1.00 23.56  ? 299  PHE A CG  1 
ATOM   683  C  CD1 . PHE A 1 95  ? 4.569   -5.272  22.769  1.00 22.99  ? 299  PHE A CD1 1 
ATOM   684  C  CD2 . PHE A 1 95  ? 6.967   -5.306  22.901  1.00 22.89  ? 299  PHE A CD2 1 
ATOM   685  C  CE1 . PHE A 1 95  ? 4.631   -4.251  21.805  1.00 22.25  ? 299  PHE A CE1 1 
ATOM   686  C  CE2 . PHE A 1 95  ? 7.039   -4.288  21.936  1.00 22.35  ? 299  PHE A CE2 1 
ATOM   687  C  CZ  . PHE A 1 95  ? 5.872   -3.762  21.392  1.00 22.45  ? 299  PHE A CZ  1 
ATOM   688  N  N   . ALA A 1 96  ? 7.144   -9.002  22.621  1.00 25.56  ? 300  ALA A N   1 
ATOM   689  C  CA  . ALA A 1 96  ? 7.933   -9.348  21.449  1.00 26.49  ? 300  ALA A CA  1 
ATOM   690  C  C   . ALA A 1 96  ? 7.349   -10.564 20.720  1.00 27.65  ? 300  ALA A C   1 
ATOM   691  O  O   . ALA A 1 96  ? 7.243   -10.572 19.488  1.00 27.21  ? 300  ALA A O   1 
ATOM   692  C  CB  . ALA A 1 96  ? 9.388   -9.598  21.853  1.00 26.27  ? 300  ALA A CB  1 
ATOM   693  N  N   . LYS A 1 97  ? 6.963   -11.580 21.492  1.00 28.89  ? 301  LYS A N   1 
ATOM   694  C  CA  . LYS A 1 97  ? 6.326   -12.784 20.944  1.00 30.68  ? 301  LYS A CA  1 
ATOM   695  C  C   . LYS A 1 97  ? 5.007   -12.485 20.212  1.00 31.56  ? 301  LYS A C   1 
ATOM   696  O  O   . LYS A 1 97  ? 4.629   -13.215 19.285  1.00 31.47  ? 301  LYS A O   1 
ATOM   697  C  CB  . LYS A 1 97  ? 6.088   -13.811 22.050  1.00 30.64  ? 301  LYS A CB  1 
ATOM   698  C  CG  . LYS A 1 97  ? 7.324   -14.595 22.443  1.00 32.42  ? 301  LYS A CG  1 
ATOM   699  C  CD  . LYS A 1 97  ? 6.960   -15.790 23.321  1.00 37.30  ? 301  LYS A CD  1 
ATOM   700  C  CE  . LYS A 1 97  ? 6.972   -15.450 24.799  1.00 39.54  ? 301  LYS A CE  1 
ATOM   701  N  NZ  . LYS A 1 97  ? 6.115   -16.383 25.603  1.00 43.51  ? 301  LYS A NZ  1 
ATOM   702  N  N   . SER A 1 98  ? 4.344   -11.395 20.616  1.00 32.53  ? 302  SER A N   1 
ATOM   703  C  CA  . SER A 1 98  ? 3.042   -10.991 20.067  1.00 33.71  ? 302  SER A CA  1 
ATOM   704  C  C   . SER A 1 98  ? 3.156   -10.306 18.710  1.00 34.09  ? 302  SER A C   1 
ATOM   705  O  O   . SER A 1 98  ? 2.153   -9.904  18.119  1.00 34.19  ? 302  SER A O   1 
ATOM   706  C  CB  . SER A 1 98  ? 2.325   -10.058 21.032  1.00 33.36  ? 302  SER A CB  1 
ATOM   707  O  OG  . SER A 1 98  ? 1.948   -10.733 22.211  1.00 35.10  ? 302  SER A OG  1 
ATOM   708  N  N   . ILE A 1 99  ? 4.388   -10.151 18.246  1.00 34.83  ? 303  ILE A N   1 
ATOM   709  C  CA  . ILE A 1 99  ? 4.676   -9.668  16.904  1.00 35.37  ? 303  ILE A CA  1 
ATOM   710  C  C   . ILE A 1 99  ? 5.055   -10.876 16.026  1.00 35.85  ? 303  ILE A C   1 
ATOM   711  O  O   . ILE A 1 99  ? 6.170   -11.387 16.147  1.00 36.09  ? 303  ILE A O   1 
ATOM   712  C  CB  . ILE A 1 99  ? 5.835   -8.652  16.937  1.00 34.92  ? 303  ILE A CB  1 
ATOM   713  C  CG1 . ILE A 1 99  ? 5.637   -7.650  18.086  1.00 35.51  ? 303  ILE A CG1 1 
ATOM   714  C  CG2 . ILE A 1 99  ? 5.970   -7.973  15.596  1.00 35.31  ? 303  ILE A CG2 1 
ATOM   715  C  CD1 . ILE A 1 99  ? 6.860   -6.745  18.382  1.00 35.47  ? 303  ILE A CD1 1 
ATOM   716  N  N   . PRO A 1 100 ? 4.124   -11.348 15.154  1.00 36.27  ? 304  PRO A N   1 
ATOM   717  C  CA  . PRO A 1 100 ? 4.328   -12.532 14.288  1.00 36.17  ? 304  PRO A CA  1 
ATOM   718  C  C   . PRO A 1 100 ? 5.725   -12.686 13.658  1.00 35.97  ? 304  PRO A C   1 
ATOM   719  O  O   . PRO A 1 100 ? 6.286   -13.790 13.676  1.00 36.10  ? 304  PRO A O   1 
ATOM   720  C  CB  . PRO A 1 100 ? 3.259   -12.356 13.205  1.00 36.28  ? 304  PRO A CB  1 
ATOM   721  C  CG  . PRO A 1 100 ? 2.128   -11.694 13.940  1.00 36.21  ? 304  PRO A CG  1 
ATOM   722  C  CD  . PRO A 1 100 ? 2.775   -10.773 14.959  1.00 36.46  ? 304  PRO A CD  1 
ATOM   723  N  N   . SER A 1 101 ? 6.270   -11.597 13.111  1.00 35.38  ? 305  SER A N   1 
ATOM   724  C  CA  . SER A 1 101 ? 7.630   -11.592 12.558  1.00 34.98  ? 305  SER A CA  1 
ATOM   725  C  C   . SER A 1 101 ? 8.718   -12.008 13.572  1.00 34.20  ? 305  SER A C   1 
ATOM   726  O  O   . SER A 1 101 ? 9.609   -12.801 13.247  1.00 34.34  ? 305  SER A O   1 
ATOM   727  C  CB  . SER A 1 101 ? 7.940   -10.219 11.967  1.00 35.27  ? 305  SER A CB  1 
ATOM   728  O  OG  . SER A 1 101 ? 7.304   -9.204  12.724  1.00 36.32  ? 305  SER A OG  1 
ATOM   729  N  N   . PHE A 1 102 ? 8.630   -11.494 14.796  1.00 33.18  ? 306  PHE A N   1 
ATOM   730  C  CA  . PHE A 1 102 ? 9.530   -11.913 15.878  1.00 32.23  ? 306  PHE A CA  1 
ATOM   731  C  C   . PHE A 1 102 ? 9.436   -13.420 16.158  1.00 32.35  ? 306  PHE A C   1 
ATOM   732  O  O   . PHE A 1 102 ? 10.461  -14.094 16.239  1.00 31.40  ? 306  PHE A O   1 
ATOM   733  C  CB  . PHE A 1 102 ? 9.247   -11.110 17.149  1.00 31.72  ? 306  PHE A CB  1 
ATOM   734  C  CG  . PHE A 1 102 ? 10.208  -11.378 18.281  1.00 30.42  ? 306  PHE A CG  1 
ATOM   735  C  CD1 . PHE A 1 102 ? 9.933   -12.369 19.227  1.00 29.55  ? 306  PHE A CD1 1 
ATOM   736  C  CD2 . PHE A 1 102 ? 11.367  -10.618 18.421  1.00 28.73  ? 306  PHE A CD2 1 
ATOM   737  C  CE1 . PHE A 1 102 ? 10.808  -12.617 20.289  1.00 28.07  ? 306  PHE A CE1 1 
ATOM   738  C  CE2 . PHE A 1 102 ? 12.250  -10.850 19.484  1.00 29.02  ? 306  PHE A CE2 1 
ATOM   739  C  CZ  . PHE A 1 102 ? 11.970  -11.857 20.421  1.00 28.47  ? 306  PHE A CZ  1 
ATOM   740  N  N   . SER A 1 103 ? 8.213   -13.942 16.288  1.00 32.86  ? 307  SER A N   1 
ATOM   741  C  CA  . SER A 1 103 ? 8.014   -15.362 16.642  1.00 33.69  ? 307  SER A CA  1 
ATOM   742  C  C   . SER A 1 103 ? 8.409   -16.375 15.565  1.00 34.09  ? 307  SER A C   1 
ATOM   743  O  O   . SER A 1 103 ? 8.572   -17.564 15.860  1.00 34.82  ? 307  SER A O   1 
ATOM   744  C  CB  . SER A 1 103 ? 6.581   -15.618 17.109  1.00 33.70  ? 307  SER A CB  1 
ATOM   745  O  OG  . SER A 1 103 ? 6.414   -15.190 18.446  1.00 35.68  ? 307  SER A OG  1 
ATOM   746  N  N   . SER A 1 104 ? 8.566   -15.917 14.324  1.00 34.37  ? 308  SER A N   1 
ATOM   747  C  CA  . SER A 1 104 ? 8.990   -16.796 13.237  1.00 34.23  ? 308  SER A CA  1 
ATOM   748  C  C   . SER A 1 104 ? 10.502  -17.023 13.266  1.00 33.95  ? 308  SER A C   1 
ATOM   749  O  O   . SER A 1 104 ? 10.994  -17.997 12.692  1.00 34.35  ? 308  SER A O   1 
ATOM   750  C  CB  . SER A 1 104 ? 8.548   -16.238 11.880  1.00 34.60  ? 308  SER A CB  1 
ATOM   751  O  OG  . SER A 1 104 ? 9.392   -15.174 11.459  1.00 36.54  ? 308  SER A OG  1 
ATOM   752  N  N   . LEU A 1 105 ? 11.235  -16.133 13.941  1.00 33.00  ? 309  LEU A N   1 
ATOM   753  C  CA  . LEU A 1 105 ? 12.687  -16.273 14.081  1.00 32.03  ? 309  LEU A CA  1 
ATOM   754  C  C   . LEU A 1 105 ? 12.996  -17.502 14.910  1.00 31.30  ? 309  LEU A C   1 
ATOM   755  O  O   . LEU A 1 105 ? 12.188  -17.896 15.742  1.00 31.68  ? 309  LEU A O   1 
ATOM   756  C  CB  . LEU A 1 105 ? 13.306  -15.036 14.743  1.00 32.12  ? 309  LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 105 ? 13.170  -13.680 14.034  1.00 32.30  ? 309  LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 105 ? 13.585  -12.571 14.967  1.00 32.62  ? 309  LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 105 ? 13.964  -13.600 12.733  1.00 30.76  ? 309  LEU A CD2 1 
ATOM   760  N  N   . PHE A 1 106 ? 14.151  -18.117 14.678  1.00 30.54  ? 310  PHE A N   1 
ATOM   761  C  CA  . PHE A 1 106 ? 14.582  -19.247 15.496  1.00 29.92  ? 310  PHE A CA  1 
ATOM   762  C  C   . PHE A 1 106 ? 14.757  -18.776 16.946  1.00 29.22  ? 310  PHE A C   1 
ATOM   763  O  O   . PHE A 1 106 ? 15.100  -17.614 17.189  1.00 28.43  ? 310  PHE A O   1 
ATOM   764  C  CB  . PHE A 1 106 ? 15.866  -19.864 14.948  1.00 30.61  ? 310  PHE A CB  1 
ATOM   765  C  CG  . PHE A 1 106 ? 15.639  -20.947 13.920  1.00 31.84  ? 310  PHE A CG  1 
ATOM   766  C  CD1 . PHE A 1 106 ? 15.182  -22.214 14.306  1.00 33.16  ? 310  PHE A CD1 1 
ATOM   767  C  CD2 . PHE A 1 106 ? 15.901  -20.711 12.577  1.00 32.96  ? 310  PHE A CD2 1 
ATOM   768  C  CE1 . PHE A 1 106 ? 14.972  -23.230 13.366  1.00 32.92  ? 310  PHE A CE1 1 
ATOM   769  C  CE2 . PHE A 1 106 ? 15.702  -21.723 11.621  1.00 34.28  ? 310  PHE A CE2 1 
ATOM   770  C  CZ  . PHE A 1 106 ? 15.238  -22.989 12.026  1.00 32.82  ? 310  PHE A CZ  1 
ATOM   771  N  N   . LEU A 1 107 ? 14.503  -19.665 17.904  1.00 28.38  ? 311  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 107 ? 14.400  -19.248 19.308  1.00 27.99  ? 311  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 107 ? 15.668  -18.582 19.832  1.00 27.24  ? 311  LEU A C   1 
ATOM   774  O  O   . LEU A 1 107 ? 15.588  -17.638 20.615  1.00 27.85  ? 311  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 107 ? 13.989  -20.417 20.212  1.00 27.98  ? 311  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 107 ? 13.000  -20.123 21.349  1.00 28.45  ? 311  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 107 ? 11.658  -19.589 20.819  1.00 29.44  ? 311  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 107 ? 12.773  -21.366 22.186  1.00 27.77  ? 311  LEU A CD2 1 
ATOM   779  N  N   . ASN A 1 108 ? 16.823  -19.070 19.381  1.00 26.68  ? 312  ASN A N   1 
ATOM   780  C  CA  . ASN A 1 108 ? 18.133  -18.523 19.745  1.00 25.44  ? 312  ASN A CA  1 
ATOM   781  C  C   . ASN A 1 108 ? 18.359  -17.068 19.290  1.00 25.19  ? 312  ASN A C   1 
ATOM   782  O  O   . ASN A 1 108 ? 18.963  -16.281 20.007  1.00 24.36  ? 312  ASN A O   1 
ATOM   783  C  CB  . ASN A 1 108 ? 19.259  -19.447 19.261  1.00 25.61  ? 312  ASN A CB  1 
ATOM   784  C  CG  . ASN A 1 108 ? 19.286  -19.626 17.741  1.00 25.51  ? 312  ASN A CG  1 
ATOM   785  O  OD1 . ASN A 1 108 ? 20.318  -19.429 17.117  1.00 27.58  ? 312  ASN A OD1 1 
ATOM   786  N  ND2 . ASN A 1 108 ? 18.159  -19.991 17.150  1.00 24.92  ? 312  ASN A ND2 1 
ATOM   787  N  N   . ASP A 1 109 ? 17.846  -16.716 18.114  1.00 24.70  ? 313  ASP A N   1 
ATOM   788  C  CA  . ASP A 1 109 ? 17.820  -15.315 17.670  1.00 25.12  ? 313  ASP A CA  1 
ATOM   789  C  C   . ASP A 1 109 ? 16.893  -14.432 18.511  1.00 24.77  ? 313  ASP A C   1 
ATOM   790  O  O   . ASP A 1 109 ? 17.209  -13.269 18.770  1.00 24.87  ? 313  ASP A O   1 
ATOM   791  C  CB  . ASP A 1 109 ? 17.430  -15.222 16.192  1.00 25.02  ? 313  ASP A CB  1 
ATOM   792  C  CG  . ASP A 1 109 ? 18.628  -15.344 15.255  1.00 26.56  ? 313  ASP A CG  1 
ATOM   793  O  OD1 . ASP A 1 109 ? 19.803  -15.247 15.719  1.00 26.03  ? 313  ASP A OD1 1 
ATOM   794  O  OD2 . ASP A 1 109 ? 18.386  -15.525 14.038  1.00 27.60  ? 313  ASP A OD2 1 
ATOM   795  N  N   . GLN A 1 110 ? 15.746  -14.979 18.918  1.00 24.75  ? 314  GLN A N   1 
ATOM   796  C  CA  . GLN A 1 110 ? 14.824  -14.275 19.813  1.00 24.49  ? 314  GLN A CA  1 
ATOM   797  C  C   . GLN A 1 110 ? 15.498  -13.925 21.150  1.00 24.00  ? 314  GLN A C   1 
ATOM   798  O  O   . GLN A 1 110 ? 15.348  -12.812 21.664  1.00 23.80  ? 314  GLN A O   1 
ATOM   799  C  CB  . GLN A 1 110 ? 13.580  -15.121 20.072  1.00 24.76  ? 314  GLN A CB  1 
ATOM   800  C  CG  . GLN A 1 110 ? 12.631  -15.257 18.890  1.00 24.79  ? 314  GLN A CG  1 
ATOM   801  C  CD  . GLN A 1 110 ? 11.411  -16.080 19.247  1.00 25.19  ? 314  GLN A CD  1 
ATOM   802  O  OE1 . GLN A 1 110 ? 10.815  -15.897 20.311  1.00 25.90  ? 314  GLN A OE1 1 
ATOM   803  N  NE2 . GLN A 1 110 ? 11.037  -17.005 18.364  1.00 25.81  ? 314  GLN A NE2 1 
ATOM   804  N  N   . VAL A 1 111 ? 16.239  -14.882 21.697  1.00 23.73  ? 315  VAL A N   1 
ATOM   805  C  CA  . VAL A 1 111 ? 17.028  -14.687 22.929  1.00 23.88  ? 315  VAL A CA  1 
ATOM   806  C  C   . VAL A 1 111 ? 18.125  -13.621 22.765  1.00 23.07  ? 315  VAL A C   1 
ATOM   807  O  O   . VAL A 1 111 ? 18.283  -12.758 23.630  1.00 22.95  ? 315  VAL A O   1 
ATOM   808  C  CB  . VAL A 1 111 ? 17.592  -16.042 23.451  1.00 23.73  ? 315  VAL A CB  1 
ATOM   809  C  CG1 . VAL A 1 111 ? 18.614  -15.862 24.576  1.00 24.17  ? 315  VAL A CG1 1 
ATOM   810  C  CG2 . VAL A 1 111 ? 16.446  -16.926 23.923  1.00 23.80  ? 315  VAL A CG2 1 
ATOM   811  N  N   . THR A 1 112 ? 18.855  -13.669 21.649  1.00 22.67  ? 316  THR A N   1 
ATOM   812  C  CA  . THR A 1 112 ? 19.909  -12.678 21.362  1.00 22.12  ? 316  THR A CA  1 
ATOM   813  C  C   . THR A 1 112 ? 19.344  -11.242 21.350  1.00 21.27  ? 316  THR A C   1 
ATOM   814  O  O   . THR A 1 112 ? 19.918  -10.326 21.936  1.00 20.79  ? 316  THR A O   1 
ATOM   815  C  CB  . THR A 1 112 ? 20.617  -12.986 20.020  1.00 22.14  ? 316  THR A CB  1 
ATOM   816  O  OG1 . THR A 1 112 ? 21.369  -14.198 20.143  1.00 22.83  ? 316  THR A OG1 1 
ATOM   817  C  CG2 . THR A 1 112 ? 21.557  -11.856 19.621  1.00 21.51  ? 316  THR A CG2 1 
ATOM   818  N  N   . LEU A 1 113 ? 18.209  -11.078 20.682  1.00 20.65  ? 317  LEU A N   1 
ATOM   819  C  CA  . LEU A 1 113 ? 17.515  -9.789  20.581  1.00 20.31  ? 317  LEU A CA  1 
ATOM   820  C  C   . LEU A 1 113 ? 17.105  -9.224  21.951  1.00 20.24  ? 317  LEU A C   1 
ATOM   821  O  O   . LEU A 1 113 ? 17.348  -8.050  22.249  1.00 19.74  ? 317  LEU A O   1 
ATOM   822  C  CB  . LEU A 1 113 ? 16.296  -9.957  19.666  1.00 19.60  ? 317  LEU A CB  1 
ATOM   823  C  CG  . LEU A 1 113 ? 16.377  -9.526  18.189  1.00 21.79  ? 317  LEU A CG  1 
ATOM   824  C  CD1 . LEU A 1 113 ? 17.767  -9.351  17.600  1.00 20.78  ? 317  LEU A CD1 1 
ATOM   825  C  CD2 . LEU A 1 113 ? 15.455  -10.291 17.263  1.00 19.59  ? 317  LEU A CD2 1 
ATOM   826  N  N   . LEU A 1 114 ? 16.489  -10.072 22.776  1.00 20.08  ? 318  LEU A N   1 
ATOM   827  C  CA  . LEU A 1 114 ? 16.039  -9.671  24.111  1.00 20.20  ? 318  LEU A CA  1 
ATOM   828  C  C   . LEU A 1 114 ? 17.220  -9.418  25.047  1.00 20.41  ? 318  LEU A C   1 
ATOM   829  O  O   . LEU A 1 114 ? 17.265  -8.390  25.727  1.00 20.19  ? 318  LEU A O   1 
ATOM   830  C  CB  . LEU A 1 114 ? 15.047  -10.681 24.692  1.00 19.71  ? 318  LEU A CB  1 
ATOM   831  C  CG  . LEU A 1 114 ? 13.682  -10.799 24.000  1.00 19.55  ? 318  LEU A CG  1 
ATOM   832  C  CD1 . LEU A 1 114 ? 13.017  -12.136 24.348  1.00 17.34  ? 318  LEU A CD1 1 
ATOM   833  C  CD2 . LEU A 1 114 ? 12.742  -9.622  24.311  1.00 17.67  ? 318  LEU A CD2 1 
ATOM   834  N  N   . LYS A 1 115 ? 18.201  -10.317 25.043  1.00 20.84  ? 319  LYS A N   1 
ATOM   835  C  CA  . LYS A 1 115 ? 19.432  -10.104 25.814  1.00 20.86  ? 319  LYS A CA  1 
ATOM   836  C  C   . LYS A 1 115 ? 20.053  -8.702  25.591  1.00 21.36  ? 319  LYS A C   1 
ATOM   837  O  O   . LYS A 1 115 ? 20.374  -8.009  26.548  1.00 20.44  ? 319  LYS A O   1 
ATOM   838  C  CB  . LYS A 1 115 ? 20.453  -11.195 25.485  1.00 21.53  ? 319  LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 115 ? 21.868  -10.886 25.941  1.00 21.40  ? 319  LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 115 ? 22.822  -11.942 25.456  1.00 22.98  ? 319  LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 115 ? 24.239  -11.669 25.903  1.00 25.04  ? 319  LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 115 ? 24.970  -12.962 25.945  1.00 27.68  ? 319  LYS A NZ  1 
ATOM   843  N  N   . TYR A 1 116 ? 20.217  -8.296  24.330  1.00 21.64  ? 320  TYR A N   1 
ATOM   844  C  CA  . TYR A 1 116 ? 20.876  -7.027  24.020  1.00 22.28  ? 320  TYR A CA  1 
ATOM   845  C  C   . TYR A 1 116 ? 19.899  -5.845  23.858  1.00 21.73  ? 320  TYR A C   1 
ATOM   846  O  O   . TYR A 1 116 ? 20.331  -4.721  23.705  1.00 21.63  ? 320  TYR A O   1 
ATOM   847  C  CB  . TYR A 1 116 ? 21.759  -7.152  22.758  1.00 23.18  ? 320  TYR A CB  1 
ATOM   848  C  CG  . TYR A 1 116 ? 22.994  -8.002  22.929  1.00 24.45  ? 320  TYR A CG  1 
ATOM   849  C  CD1 . TYR A 1 116 ? 24.176  -7.458  23.459  1.00 25.53  ? 320  TYR A CD1 1 
ATOM   850  C  CD2 . TYR A 1 116 ? 22.985  -9.352  22.566  1.00 24.95  ? 320  TYR A CD2 1 
ATOM   851  C  CE1 . TYR A 1 116 ? 25.322  -8.244  23.618  1.00 26.53  ? 320  TYR A CE1 1 
ATOM   852  C  CE2 . TYR A 1 116 ? 24.111  -10.143 22.718  1.00 26.22  ? 320  TYR A CE2 1 
ATOM   853  C  CZ  . TYR A 1 116 ? 25.278  -9.590  23.246  1.00 26.63  ? 320  TYR A CZ  1 
ATOM   854  O  OH  . TYR A 1 116 ? 26.398  -10.390 23.407  1.00 27.32  ? 320  TYR A OH  1 
ATOM   855  N  N   . GLY A 1 117 ? 18.596  -6.105  23.887  1.00 21.31  ? 321  GLY A N   1 
ATOM   856  C  CA  . GLY A 1 117 ? 17.601  -5.065  23.669  1.00 20.98  ? 321  GLY A CA  1 
ATOM   857  C  C   . GLY A 1 117 ? 16.749  -4.649  24.868  1.00 20.28  ? 321  GLY A C   1 
ATOM   858  O  O   . GLY A 1 117 ? 16.254  -3.520  24.905  1.00 19.98  ? 321  GLY A O   1 
ATOM   859  N  N   . VAL A 1 118 ? 16.567  -5.545  25.839  1.00 20.28  ? 322  VAL A N   1 
ATOM   860  C  CA  . VAL A 1 118 ? 15.581  -5.314  26.922  1.00 20.11  ? 322  VAL A CA  1 
ATOM   861  C  C   . VAL A 1 118 ? 15.853  -4.071  27.779  1.00 19.67  ? 322  VAL A C   1 
ATOM   862  O  O   . VAL A 1 118 ? 14.917  -3.356  28.131  1.00 18.79  ? 322  VAL A O   1 
ATOM   863  C  CB  . VAL A 1 118 ? 15.317  -6.553  27.853  1.00 20.33  ? 322  VAL A CB  1 
ATOM   864  C  CG1 . VAL A 1 118 ? 14.510  -7.629  27.125  1.00 20.66  ? 322  VAL A CG1 1 
ATOM   865  C  CG2 . VAL A 1 118 ? 16.602  -7.118  28.453  1.00 20.49  ? 322  VAL A CG2 1 
ATOM   866  N  N   . HIS A 1 119 ? 17.124  -3.820  28.100  1.00 19.79  ? 323  HIS A N   1 
ATOM   867  C  CA  . HIS A 1 119 ? 17.498  -2.663  28.921  1.00 19.80  ? 323  HIS A CA  1 
ATOM   868  C  C   . HIS A 1 119 ? 17.384  -1.322  28.211  1.00 19.62  ? 323  HIS A C   1 
ATOM   869  O  O   . HIS A 1 119 ? 17.051  -0.331  28.853  1.00 19.75  ? 323  HIS A O   1 
ATOM   870  C  CB  . HIS A 1 119 ? 18.886  -2.828  29.555  1.00 19.77  ? 323  HIS A CB  1 
ATOM   871  C  CG  . HIS A 1 119 ? 18.884  -3.756  30.723  1.00 21.19  ? 323  HIS A CG  1 
ATOM   872  N  ND1 . HIS A 1 119 ? 19.115  -5.109  30.594  1.00 20.77  ? 323  HIS A ND1 1 
ATOM   873  C  CD2 . HIS A 1 119 ? 18.617  -3.541  32.033  1.00 22.37  ? 323  HIS A CD2 1 
ATOM   874  C  CE1 . HIS A 1 119 ? 19.033  -5.680  31.782  1.00 23.34  ? 323  HIS A CE1 1 
ATOM   875  N  NE2 . HIS A 1 119 ? 18.722  -4.753  32.672  1.00 22.81  ? 323  HIS A NE2 1 
ATOM   876  N  N   . GLU A 1 120 ? 17.645  -1.292  26.906  1.00 19.51  ? 324  GLU A N   1 
ATOM   877  C  CA  . GLU A 1 120 ? 17.324  -0.124  26.090  1.00 19.54  ? 324  GLU A CA  1 
ATOM   878  C  C   . GLU A 1 120 ? 15.808  0.140   26.132  1.00 19.57  ? 324  GLU A C   1 
ATOM   879  O  O   . GLU A 1 120 ? 15.372  1.288   26.329  1.00 19.04  ? 324  GLU A O   1 
ATOM   880  C  CB  . GLU A 1 120 ? 17.792  -0.307  24.644  1.00 19.48  ? 324  GLU A CB  1 
ATOM   881  C  CG  . GLU A 1 120 ? 19.302  -0.346  24.458  1.00 20.01  ? 324  GLU A CG  1 
ATOM   882  C  CD  . GLU A 1 120 ? 19.714  -0.614  23.014  1.00 19.75  ? 324  GLU A CD  1 
ATOM   883  O  OE1 . GLU A 1 120 ? 18.863  -0.508  22.104  1.00 20.67  ? 324  GLU A OE1 1 
ATOM   884  O  OE2 . GLU A 1 120 ? 20.893  -0.961  22.781  1.00 22.98  ? 324  GLU A OE2 1 
ATOM   885  N  N   . ALA A 1 121 ? 15.010  -0.921  25.983  1.00 19.02  ? 325  ALA A N   1 
ATOM   886  C  CA  . ALA A 1 121 ? 13.552  -0.798  26.097  1.00 19.14  ? 325  ALA A CA  1 
ATOM   887  C  C   . ALA A 1 121 ? 13.078  -0.386  27.517  1.00 19.10  ? 325  ALA A C   1 
ATOM   888  O  O   . ALA A 1 121 ? 12.164  0.425   27.639  1.00 19.51  ? 325  ALA A O   1 
ATOM   889  C  CB  . ALA A 1 121 ? 12.853  -2.072  25.615  1.00 19.52  ? 325  ALA A CB  1 
ATOM   890  N  N   . ILE A 1 122 ? 13.722  -0.907  28.569  1.00 18.50  ? 326  ILE A N   1 
ATOM   891  C  CA  . ILE A 1 122 ? 13.346  -0.605  29.980  1.00 17.85  ? 326  ILE A CA  1 
ATOM   892  C  C   . ILE A 1 122 ? 13.567  0.883   30.312  1.00 18.10  ? 326  ILE A C   1 
ATOM   893  O  O   . ILE A 1 122 ? 12.664  1.572   30.790  1.00 16.69  ? 326  ILE A O   1 
ATOM   894  C  CB  . ILE A 1 122 ? 14.099  -1.532  30.972  1.00 18.15  ? 326  ILE A CB  1 
ATOM   895  C  CG1 . ILE A 1 122 ? 13.484  -2.957  30.948  1.00 17.72  ? 326  ILE A CG1 1 
ATOM   896  C  CG2 . ILE A 1 122 ? 14.090  -0.961  32.411  1.00 17.62  ? 326  ILE A CG2 1 
ATOM   897  C  CD1 . ILE A 1 122 ? 14.398  -4.043  31.571  1.00 18.35  ? 326  ILE A CD1 1 
ATOM   898  N  N   . PHE A 1 123 ? 14.763  1.370   29.995  1.00 18.56  ? 327  PHE A N   1 
ATOM   899  C  CA  . PHE A 1 123 ? 15.132  2.763   30.229  1.00 20.02  ? 327  PHE A CA  1 
ATOM   900  C  C   . PHE A 1 123 ? 14.301  3.748   29.395  1.00 20.49  ? 327  PHE A C   1 
ATOM   901  O  O   . PHE A 1 123 ? 14.021  4.862   29.851  1.00 22.12  ? 327  PHE A O   1 
ATOM   902  C  CB  . PHE A 1 123 ? 16.643  2.942   30.043  1.00 19.62  ? 327  PHE A CB  1 
ATOM   903  C  CG  . PHE A 1 123 ? 17.492  2.052   30.957  1.00 20.62  ? 327  PHE A CG  1 
ATOM   904  C  CD1 . PHE A 1 123 ? 17.002  1.594   32.183  1.00 20.34  ? 327  PHE A CD1 1 
ATOM   905  C  CD2 . PHE A 1 123 ? 18.799  1.700   30.594  1.00 19.86  ? 327  PHE A CD2 1 
ATOM   906  C  CE1 . PHE A 1 123 ? 17.790  0.791   33.028  1.00 21.70  ? 327  PHE A CE1 1 
ATOM   907  C  CE2 . PHE A 1 123 ? 19.603  0.907   31.430  1.00 19.68  ? 327  PHE A CE2 1 
ATOM   908  C  CZ  . PHE A 1 123 ? 19.106  0.454   32.648  1.00 19.46  ? 327  PHE A CZ  1 
ATOM   909  N  N   . ALA A 1 124 ? 13.887  3.344   28.194  1.00 20.99  ? 328  ALA A N   1 
ATOM   910  C  CA  . ALA A 1 124 ? 12.936  4.135   27.399  1.00 22.11  ? 328  ALA A CA  1 
ATOM   911  C  C   . ALA A 1 124 ? 11.543  4.219   28.048  1.00 22.40  ? 328  ALA A C   1 
ATOM   912  O  O   . ALA A 1 124 ? 10.984  5.313   28.217  1.00 23.09  ? 328  ALA A O   1 
ATOM   913  C  CB  . ALA A 1 124 ? 12.840  3.599   25.961  1.00 22.01  ? 328  ALA A CB  1 
ATOM   914  N  N   . MET A 1 125 ? 10.997  3.070   28.429  1.00 22.71  ? 329  MET A N   1 
ATOM   915  C  CA  . MET A 1 125 ? 9.692   3.014   29.098  1.00 23.46  ? 329  MET A CA  1 
ATOM   916  C  C   . MET A 1 125 ? 9.659   3.666   30.487  1.00 22.16  ? 329  MET A C   1 
ATOM   917  O  O   . MET A 1 125 ? 8.626   4.214   30.903  1.00 21.25  ? 329  MET A O   1 
ATOM   918  C  CB  . MET A 1 125 ? 9.204   1.572   29.187  1.00 23.39  ? 329  MET A CB  1 
ATOM   919  C  CG  . MET A 1 125 ? 8.852   0.991   27.827  1.00 25.24  ? 329  MET A CG  1 
ATOM   920  S  SD  . MET A 1 125 ? 8.176   -0.674  27.876  1.00 27.77  ? 329  MET A SD  1 
ATOM   921  C  CE  . MET A 1 125 ? 9.498   -1.584  28.663  1.00 28.51  ? 329  MET A CE  1 
ATOM   922  N  N   . LEU A 1 126 ? 10.787  3.608   31.193  1.00 21.37  ? 330  LEU A N   1 
ATOM   923  C  CA  . LEU A 1 126 ? 10.918  4.214   32.523  1.00 21.12  ? 330  LEU A CA  1 
ATOM   924  C  C   . LEU A 1 126 ? 10.447  5.682   32.514  1.00 20.47  ? 330  LEU A C   1 
ATOM   925  O  O   . LEU A 1 126 ? 9.825   6.156   33.470  1.00 19.83  ? 330  LEU A O   1 
ATOM   926  C  CB  . LEU A 1 126 ? 12.385  4.166   32.972  1.00 21.57  ? 330  LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 126 ? 12.798  3.913   34.418  1.00 23.59  ? 330  LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 126 ? 14.111  4.634   34.672  1.00 26.72  ? 330  LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 126 ? 11.754  4.322   35.448  1.00 25.24  ? 330  LEU A CD2 1 
ATOM   930  N  N   . ALA A 1 127 ? 10.729  6.379   31.419  1.00 20.03  ? 331  ALA A N   1 
ATOM   931  C  CA  . ALA A 1 127 ? 10.350  7.789   31.266  1.00 19.80  ? 331  ALA A CA  1 
ATOM   932  C  C   . ALA A 1 127 ? 8.843   8.004   31.432  1.00 19.60  ? 331  ALA A C   1 
ATOM   933  O  O   . ALA A 1 127 ? 8.403   9.086   31.866  1.00 18.98  ? 331  ALA A O   1 
ATOM   934  C  CB  . ALA A 1 127 ? 10.811  8.302   29.917  1.00 19.65  ? 331  ALA A CB  1 
ATOM   935  N  N   . SER A 1 128 ? 8.064   6.972   31.092  1.00 19.42  ? 332  SER A N   1 
ATOM   936  C  CA  . SER A 1 128 ? 6.598   7.019   31.186  1.00 19.70  ? 332  SER A CA  1 
ATOM   937  C  C   . SER A 1 128 ? 6.110   7.152   32.642  1.00 20.38  ? 332  SER A C   1 
ATOM   938  O  O   . SER A 1 128 ? 5.076   7.767   32.895  1.00 19.04  ? 332  SER A O   1 
ATOM   939  C  CB  . SER A 1 128 ? 5.958   5.782   30.536  1.00 19.74  ? 332  SER A CB  1 
ATOM   940  O  OG  . SER A 1 128 ? 6.171   5.724   29.126  1.00 19.52  ? 332  SER A OG  1 
ATOM   941  N  N   . ILE A 1 129 ? 6.864   6.580   33.585  1.00 21.27  ? 333  ILE A N   1 
ATOM   942  C  CA  . ILE A 1 129 ? 6.468   6.570   35.000  1.00 22.62  ? 333  ILE A CA  1 
ATOM   943  C  C   . ILE A 1 129 ? 7.263   7.538   35.877  1.00 23.69  ? 333  ILE A C   1 
ATOM   944  O  O   . ILE A 1 129 ? 7.229   7.436   37.123  1.00 23.54  ? 333  ILE A O   1 
ATOM   945  C  CB  . ILE A 1 129 ? 6.523   5.131   35.607  1.00 22.70  ? 333  ILE A CB  1 
ATOM   946  C  CG1 . ILE A 1 129 ? 7.928   4.527   35.498  1.00 23.17  ? 333  ILE A CG1 1 
ATOM   947  C  CG2 . ILE A 1 129 ? 5.468   4.247   34.972  1.00 22.55  ? 333  ILE A CG2 1 
ATOM   948  C  CD1 . ILE A 1 129 ? 8.036   3.075   36.024  1.00 23.46  ? 333  ILE A CD1 1 
ATOM   949  N  N   . VAL A 1 130 ? 7.947   8.487   35.222  1.00 24.64  ? 334  VAL A N   1 
ATOM   950  C  CA  . VAL A 1 130 ? 8.880   9.417   35.861  1.00 25.56  ? 334  VAL A CA  1 
ATOM   951  C  C   . VAL A 1 130 ? 8.396   10.864  35.692  1.00 26.09  ? 334  VAL A C   1 
ATOM   952  O  O   . VAL A 1 130 ? 7.845   11.210  34.643  1.00 26.64  ? 334  VAL A O   1 
ATOM   953  C  CB  . VAL A 1 130 ? 10.317  9.273   35.216  1.00 25.81  ? 334  VAL A CB  1 
ATOM   954  C  CG1 . VAL A 1 130 ? 11.174  10.518  35.389  1.00 26.21  ? 334  VAL A CG1 1 
ATOM   955  C  CG2 . VAL A 1 130 ? 11.053  8.052   35.753  1.00 26.40  ? 334  VAL A CG2 1 
ATOM   956  N  N   . ASN A 1 131 ? 8.566   11.680  36.732  1.00 25.90  ? 335  ASN A N   1 
ATOM   957  C  CA  . ASN A 1 131 ? 8.716   13.140  36.578  1.00 26.21  ? 335  ASN A CA  1 
ATOM   958  C  C   . ASN A 1 131 ? 10.039  13.605  37.214  1.00 26.71  ? 335  ASN A C   1 
ATOM   959  O  O   . ASN A 1 131 ? 10.832  12.767  37.667  1.00 26.24  ? 335  ASN A O   1 
ATOM   960  C  CB  . ASN A 1 131 ? 7.488   13.947  37.075  1.00 26.12  ? 335  ASN A CB  1 
ATOM   961  C  CG  . ASN A 1 131 ? 7.176   13.743  38.556  1.00 25.74  ? 335  ASN A CG  1 
ATOM   962  O  OD1 . ASN A 1 131 ? 8.064   13.531  39.369  1.00 27.05  ? 335  ASN A OD1 1 
ATOM   963  N  ND2 . ASN A 1 131 ? 5.894   13.826  38.908  1.00 25.43  ? 335  ASN A ND2 1 
ATOM   964  N  N   . LYS A 1 132 ? 10.291  14.918  37.234  1.00 26.57  ? 336  LYS A N   1 
ATOM   965  C  CA  . LYS A 1 132 ? 11.559  15.430  37.725  1.00 26.87  ? 336  LYS A CA  1 
ATOM   966  C  C   . LYS A 1 132 ? 11.757  15.151  39.216  1.00 26.70  ? 336  LYS A C   1 
ATOM   967  O  O   . LYS A 1 132 ? 12.878  15.211  39.704  1.00 26.35  ? 336  LYS A O   1 
ATOM   968  C  CB  . LYS A 1 132 ? 11.741  16.933  37.401  1.00 26.87  ? 336  LYS A CB  1 
ATOM   969  C  CG  . LYS A 1 132 ? 10.850  17.913  38.175  1.00 27.58  ? 336  LYS A CG  1 
ATOM   970  C  CD  . LYS A 1 132 ? 11.042  19.338  37.623  1.00 28.18  ? 336  LYS A CD  1 
ATOM   971  C  CE  . LYS A 1 132 ? 10.086  20.347  38.258  1.00 30.56  ? 336  LYS A CE  1 
ATOM   972  N  NZ  . LYS A 1 132 ? 10.443  20.633  39.689  1.00 32.45  ? 336  LYS A NZ  1 
ATOM   973  N  N   . ASP A 1 133 ? 10.668  14.807  39.912  1.00 26.75  ? 337  ASP A N   1 
ATOM   974  C  CA  . ASP A 1 133 ? 10.698  14.563  41.354  1.00 26.82  ? 337  ASP A CA  1 
ATOM   975  C  C   . ASP A 1 133 ? 10.815  13.094  41.756  1.00 26.33  ? 337  ASP A C   1 
ATOM   976  O  O   . ASP A 1 133 ? 11.176  12.792  42.892  1.00 26.27  ? 337  ASP A O   1 
ATOM   977  C  CB  . ASP A 1 133 ? 9.471   15.192  42.028  1.00 27.31  ? 337  ASP A CB  1 
ATOM   978  C  CG  . ASP A 1 133 ? 9.407   16.704  41.823  1.00 29.38  ? 337  ASP A CG  1 
ATOM   979  O  OD1 . ASP A 1 133 ? 10.471  17.366  41.897  1.00 29.87  ? 337  ASP A OD1 1 
ATOM   980  O  OD2 . ASP A 1 133 ? 8.291   17.222  41.576  1.00 33.26  ? 337  ASP A OD2 1 
ATOM   981  N  N   . GLY A 1 134 ? 10.512  12.177  40.853  1.00 25.53  ? 338  GLY A N   1 
ATOM   982  C  CA  . GLY A 1 134 ? 10.543  10.763  41.237  1.00 24.85  ? 338  GLY A CA  1 
ATOM   983  C  C   . GLY A 1 134 ? 9.801   9.844   40.304  1.00 24.48  ? 338  GLY A C   1 
ATOM   984  O  O   . GLY A 1 134 ? 9.337   10.268  39.247  1.00 24.09  ? 338  GLY A O   1 
ATOM   985  N  N   . LEU A 1 135 ? 9.693   8.578   40.704  1.00 24.66  ? 339  LEU A N   1 
ATOM   986  C  CA  . LEU A 1 135 ? 9.118   7.539   39.850  1.00 25.04  ? 339  LEU A CA  1 
ATOM   987  C  C   . LEU A 1 135 ? 8.053   6.699   40.549  1.00 24.80  ? 339  LEU A C   1 
ATOM   988  O  O   . LEU A 1 135 ? 8.122   6.477   41.768  1.00 24.01  ? 339  LEU A O   1 
ATOM   989  C  CB  . LEU A 1 135 ? 10.220  6.651   39.241  1.00 25.49  ? 339  LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 135 ? 11.068  5.605   39.978  1.00 25.64  ? 339  LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 135 ? 12.297  5.348   39.128  1.00 26.69  ? 339  LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 135 ? 11.520  6.071   41.340  1.00 26.83  ? 339  LEU A CD2 1 
ATOM   993  N  N   . LEU A 1 136 ? 7.055   6.268   39.776  1.00 24.55  ? 340  LEU A N   1 
ATOM   994  C  CA  . LEU A 1 136 ? 6.079   5.299   40.263  1.00 25.40  ? 340  LEU A CA  1 
ATOM   995  C  C   . LEU A 1 136 ? 6.738   3.940   40.463  1.00 25.99  ? 340  LEU A C   1 
ATOM   996  O  O   . LEU A 1 136 ? 7.597   3.534   39.669  1.00 25.92  ? 340  LEU A O   1 
ATOM   997  C  CB  . LEU A 1 136 ? 4.859   5.180   39.336  1.00 25.16  ? 340  LEU A CB  1 
ATOM   998  C  CG  . LEU A 1 136 ? 3.961   6.417   39.178  1.00 25.03  ? 340  LEU A CG  1 
ATOM   999  C  CD1 . LEU A 1 136 ? 2.980   6.282   38.002  1.00 24.03  ? 340  LEU A CD1 1 
ATOM   1000 C  CD2 . LEU A 1 136 ? 3.214   6.743   40.479  1.00 24.82  ? 340  LEU A CD2 1 
ATOM   1001 N  N   . VAL A 1 137 ? 6.356   3.266   41.548  1.00 26.78  ? 341  VAL A N   1 
ATOM   1002 C  CA  . VAL A 1 137 ? 6.764   1.880   41.806  1.00 27.64  ? 341  VAL A CA  1 
ATOM   1003 C  C   . VAL A 1 137 ? 5.538   1.037   42.140  1.00 28.43  ? 341  VAL A C   1 
ATOM   1004 O  O   . VAL A 1 137 ? 4.445   1.578   42.338  1.00 28.58  ? 341  VAL A O   1 
ATOM   1005 C  CB  . VAL A 1 137 ? 7.826   1.755   42.951  1.00 27.36  ? 341  VAL A CB  1 
ATOM   1006 C  CG1 . VAL A 1 137 ? 9.141   2.419   42.567  1.00 26.29  ? 341  VAL A CG1 1 
ATOM   1007 C  CG2 . VAL A 1 137 ? 7.292   2.315   44.264  1.00 27.51  ? 341  VAL A CG2 1 
ATOM   1008 N  N   . ALA A 1 138 ? 5.723   -0.278  42.193  1.00 29.51  ? 342  ALA A N   1 
ATOM   1009 C  CA  . ALA A 1 138 ? 4.685   -1.200  42.620  1.00 30.81  ? 342  ALA A CA  1 
ATOM   1010 C  C   . ALA A 1 138 ? 3.365   -0.971  41.885  1.00 31.95  ? 342  ALA A C   1 
ATOM   1011 O  O   . ALA A 1 138 ? 2.324   -0.744  42.503  1.00 32.21  ? 342  ALA A O   1 
ATOM   1012 C  CB  . ALA A 1 138 ? 4.497   -1.105  44.135  1.00 30.86  ? 342  ALA A CB  1 
ATOM   1013 N  N   . ASN A 1 139 ? 3.420   -1.012  40.552  1.00 33.35  ? 343  ASN A N   1 
ATOM   1014 C  CA  . ASN A 1 139 ? 2.234   -0.840  39.706  1.00 33.98  ? 343  ASN A CA  1 
ATOM   1015 C  C   . ASN A 1 139 ? 1.439   0.443   40.003  1.00 33.49  ? 343  ASN A C   1 
ATOM   1016 O  O   . ASN A 1 139 ? 0.205   0.446   39.960  1.00 33.95  ? 343  ASN A O   1 
ATOM   1017 C  CB  . ASN A 1 139 ? 1.341   -2.088  39.789  1.00 34.97  ? 343  ASN A CB  1 
ATOM   1018 C  CG  . ASN A 1 139 ? 0.359   -2.197  38.628  1.00 37.71  ? 343  ASN A CG  1 
ATOM   1019 O  OD1 . ASN A 1 139 ? 0.613   -1.700  37.524  1.00 41.75  ? 343  ASN A OD1 1 
ATOM   1020 N  ND2 . ASN A 1 139 ? -0.773  -2.854  38.874  1.00 40.19  ? 343  ASN A ND2 1 
ATOM   1021 N  N   . GLY A 1 140 ? 2.154   1.533   40.294  1.00 32.80  ? 344  GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 140 ? 1.529   2.830   40.572  1.00 31.66  ? 344  GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 140 ? 1.035   3.015   42.000  1.00 31.00  ? 344  GLY A C   1 
ATOM   1024 O  O   . GLY A 1 140 ? 0.472   4.060   42.329  1.00 30.75  ? 344  GLY A O   1 
ATOM   1025 N  N   . SER A 1 141 ? 1.240   2.001   42.843  1.00 30.02  ? 345  SER A N   1 
ATOM   1026 C  CA  . SER A 1 141 ? 0.850   2.053   44.264  1.00 29.77  ? 345  SER A CA  1 
ATOM   1027 C  C   . SER A 1 141 ? 1.807   2.858   45.149  1.00 28.99  ? 345  SER A C   1 
ATOM   1028 O  O   . SER A 1 141 ? 1.483   3.185   46.301  1.00 29.17  ? 345  SER A O   1 
ATOM   1029 C  CB  . SER A 1 141 ? 0.730   0.642   44.834  1.00 29.38  ? 345  SER A CB  1 
ATOM   1030 O  OG  . SER A 1 141 ? -0.625  0.242   44.828  1.00 31.93  ? 345  SER A OG  1 
ATOM   1031 N  N   . GLY A 1 142 ? 2.995   3.137   44.627  1.00 27.81  ? 346  GLY A N   1 
ATOM   1032 C  CA  . GLY A 1 142 ? 3.972   3.924   45.348  1.00 26.80  ? 346  GLY A CA  1 
ATOM   1033 C  C   . GLY A 1 142 ? 4.637   4.947   44.459  1.00 25.96  ? 346  GLY A C   1 
ATOM   1034 O  O   . GLY A 1 142 ? 4.622   4.831   43.224  1.00 25.63  ? 346  GLY A O   1 
ATOM   1035 N  N   . PHE A 1 143 ? 5.204   5.959   45.100  1.00 24.73  ? 347  PHE A N   1 
ATOM   1036 C  CA  . PHE A 1 143 ? 6.005   6.956   44.428  1.00 24.08  ? 347  PHE A CA  1 
ATOM   1037 C  C   . PHE A 1 143 ? 7.314   7.099   45.218  1.00 23.92  ? 347  PHE A C   1 
ATOM   1038 O  O   . PHE A 1 143 ? 7.284   7.458   46.385  1.00 23.89  ? 347  PHE A O   1 
ATOM   1039 C  CB  . PHE A 1 143 ? 5.232   8.277   44.355  1.00 23.89  ? 347  PHE A CB  1 
ATOM   1040 C  CG  . PHE A 1 143 ? 5.952   9.371   43.607  1.00 23.87  ? 347  PHE A CG  1 
ATOM   1041 C  CD1 . PHE A 1 143 ? 5.898   9.436   42.220  1.00 22.97  ? 347  PHE A CD1 1 
ATOM   1042 C  CD2 . PHE A 1 143 ? 6.677   10.339  44.294  1.00 23.87  ? 347  PHE A CD2 1 
ATOM   1043 C  CE1 . PHE A 1 143 ? 6.561   10.456  41.533  1.00 24.53  ? 347  PHE A CE1 1 
ATOM   1044 C  CE2 . PHE A 1 143 ? 7.341   11.354  43.624  1.00 23.11  ? 347  PHE A CE2 1 
ATOM   1045 C  CZ  . PHE A 1 143 ? 7.282   11.410  42.233  1.00 24.28  ? 347  PHE A CZ  1 
ATOM   1046 N  N   . VAL A 1 144 ? 8.452   6.785   44.599  1.00 23.51  ? 348  VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 144 ? 9.763   6.984   45.248  1.00 23.19  ? 348  VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 144 ? 10.409  8.280   44.762  1.00 23.00  ? 348  VAL A C   1 
ATOM   1049 O  O   . VAL A 1 144 ? 10.495  8.522   43.546  1.00 22.99  ? 348  VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 144 ? 10.739  5.822   45.000  1.00 22.84  ? 348  VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 144 ? 12.024  6.060   45.745  1.00 23.22  ? 348  VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 144 ? 10.138  4.516   45.459  1.00 24.23  ? 348  VAL A CG2 1 
ATOM   1053 N  N   . THR A 1 145 ? 10.868  9.109   45.697  1.00 22.44  ? 349  THR A N   1 
ATOM   1054 C  CA  . THR A 1 145 ? 11.434  10.401  45.323  1.00 22.46  ? 349  THR A CA  1 
ATOM   1055 C  C   . THR A 1 145 ? 12.858  10.294  44.775  1.00 22.24  ? 349  THR A C   1 
ATOM   1056 O  O   . THR A 1 145 ? 13.673  9.481   45.225  1.00 22.77  ? 349  THR A O   1 
ATOM   1057 C  CB  . THR A 1 145 ? 11.423  11.422  46.478  1.00 22.47  ? 349  THR A CB  1 
ATOM   1058 O  OG1 . THR A 1 145 ? 12.422  11.065  47.445  1.00 21.03  ? 349  THR A OG1 1 
ATOM   1059 C  CG2 . THR A 1 145 ? 10.013  11.530  47.136  1.00 21.83  ? 349  THR A CG2 1 
ATOM   1060 N  N   . ARG A 1 146 ? 13.146  11.137  43.801  1.00 22.45  ? 350  ARG A N   1 
ATOM   1061 C  CA  . ARG A 1 146 ? 14.477  11.236  43.226  1.00 22.62  ? 350  ARG A CA  1 
ATOM   1062 C  C   . ARG A 1 146 ? 15.496  11.614  44.309  1.00 22.30  ? 350  ARG A C   1 
ATOM   1063 O  O   . ARG A 1 146 ? 16.605  11.106  44.310  1.00 21.59  ? 350  ARG A O   1 
ATOM   1064 C  CB  . ARG A 1 146 ? 14.470  12.264  42.105  1.00 22.25  ? 350  ARG A CB  1 
ATOM   1065 C  CG  . ARG A 1 146 ? 15.762  12.376  41.303  1.00 22.90  ? 350  ARG A CG  1 
ATOM   1066 C  CD  . ARG A 1 146 ? 15.472  13.207  40.064  1.00 24.22  ? 350  ARG A CD  1 
ATOM   1067 N  NE  . ARG A 1 146 ? 16.629  13.470  39.211  1.00 23.46  ? 350  ARG A NE  1 
ATOM   1068 C  CZ  . ARG A 1 146 ? 16.581  14.221  38.111  1.00 23.61  ? 350  ARG A CZ  1 
ATOM   1069 N  NH1 . ARG A 1 146 ? 15.435  14.784  37.730  1.00 24.60  ? 350  ARG A NH1 1 
ATOM   1070 N  NH2 . ARG A 1 146 ? 17.673  14.410  37.392  1.00 22.72  ? 350  ARG A NH2 1 
ATOM   1071 N  N   . GLU A 1 147 ? 15.095  12.492  45.230  1.00 22.60  ? 351  GLU A N   1 
ATOM   1072 C  CA  . GLU A 1 147 ? 15.941  12.899  46.348  1.00 23.58  ? 351  GLU A CA  1 
ATOM   1073 C  C   . GLU A 1 147 ? 16.314  11.730  47.265  1.00 23.06  ? 351  GLU A C   1 
ATOM   1074 O  O   . GLU A 1 147 ? 17.463  11.612  47.669  1.00 23.00  ? 351  GLU A O   1 
ATOM   1075 C  CB  . GLU A 1 147 ? 15.244  13.973  47.175  1.00 24.27  ? 351  GLU A CB  1 
ATOM   1076 C  CG  . GLU A 1 147 ? 16.183  14.852  47.917  1.00 28.55  ? 351  GLU A CG  1 
ATOM   1077 C  CD  . GLU A 1 147 ? 16.628  16.038  47.071  1.00 34.46  ? 351  GLU A CD  1 
ATOM   1078 O  OE1 . GLU A 1 147 ? 17.568  15.882  46.246  1.00 35.20  ? 351  GLU A OE1 1 
ATOM   1079 O  OE2 . GLU A 1 147 ? 16.028  17.131  47.242  1.00 37.76  ? 351  GLU A OE2 1 
ATOM   1080 N  N   . PHE A 1 148 ? 15.344  10.881  47.605  1.00 23.32  ? 352  PHE A N   1 
ATOM   1081 C  CA  . PHE A 1 148 ? 15.636  9.721   48.448  1.00 23.11  ? 352  PHE A CA  1 
ATOM   1082 C  C   . PHE A 1 148 ? 16.677  8.824   47.773  1.00 23.34  ? 352  PHE A C   1 
ATOM   1083 O  O   . PHE A 1 148 ? 17.641  8.417   48.404  1.00 23.44  ? 352  PHE A O   1 
ATOM   1084 C  CB  . PHE A 1 148 ? 14.373  8.924   48.826  1.00 22.82  ? 352  PHE A CB  1 
ATOM   1085 C  CG  . PHE A 1 148 ? 14.671  7.664   49.597  1.00 22.65  ? 352  PHE A CG  1 
ATOM   1086 C  CD1 . PHE A 1 148 ? 15.200  7.731   50.889  1.00 22.11  ? 352  PHE A CD1 1 
ATOM   1087 C  CD2 . PHE A 1 148 ? 14.453  6.412   49.033  1.00 22.27  ? 352  PHE A CD2 1 
ATOM   1088 C  CE1 . PHE A 1 148 ? 15.498  6.570   51.607  1.00 20.81  ? 352  PHE A CE1 1 
ATOM   1089 C  CE2 . PHE A 1 148 ? 14.756  5.238   49.750  1.00 22.37  ? 352  PHE A CE2 1 
ATOM   1090 C  CZ  . PHE A 1 148 ? 15.280  5.320   51.040  1.00 19.76  ? 352  PHE A CZ  1 
ATOM   1091 N  N   . LEU A 1 149 ? 16.491  8.540   46.487  1.00 23.12  ? 353  LEU A N   1 
ATOM   1092 C  CA  . LEU A 1 149 ? 17.439  7.722   45.716  1.00 23.14  ? 353  LEU A CA  1 
ATOM   1093 C  C   . LEU A 1 149 ? 18.876  8.274   45.631  1.00 23.28  ? 353  LEU A C   1 
ATOM   1094 O  O   . LEU A 1 149 ? 19.838  7.510   45.611  1.00 22.62  ? 353  LEU A O   1 
ATOM   1095 C  CB  . LEU A 1 149 ? 16.871  7.456   44.319  1.00 23.35  ? 353  LEU A CB  1 
ATOM   1096 C  CG  . LEU A 1 149 ? 15.984  6.215   44.131  1.00 23.58  ? 353  LEU A CG  1 
ATOM   1097 C  CD1 . LEU A 1 149 ? 15.638  5.493   45.425  1.00 25.37  ? 353  LEU A CD1 1 
ATOM   1098 C  CD2 . LEU A 1 149 ? 14.750  6.548   43.322  1.00 23.13  ? 353  LEU A CD2 1 
ATOM   1099 N  N   . ARG A 1 150 ? 19.015  9.595   45.597  1.00 23.10  ? 354  ARG A N   1 
ATOM   1100 C  CA  . ARG A 1 150 ? 20.316  10.236  45.513  1.00 24.54  ? 354  ARG A CA  1 
ATOM   1101 C  C   . ARG A 1 150 ? 21.070  10.141  46.844  1.00 24.77  ? 354  ARG A C   1 
ATOM   1102 O  O   . ARG A 1 150 ? 22.306  10.323  46.899  1.00 24.62  ? 354  ARG A O   1 
ATOM   1103 C  CB  . ARG A 1 150 ? 20.146  11.721  45.145  1.00 24.84  ? 354  ARG A CB  1 
ATOM   1104 C  CG  . ARG A 1 150 ? 19.639  12.016  43.724  1.00 25.83  ? 354  ARG A CG  1 
ATOM   1105 C  CD  . ARG A 1 150 ? 19.226  13.493  43.602  1.00 27.01  ? 354  ARG A CD  1 
ATOM   1106 N  NE  . ARG A 1 150 ? 19.437  14.000  42.253  1.00 32.01  ? 354  ARG A NE  1 
ATOM   1107 C  CZ  . ARG A 1 150 ? 18.841  15.074  41.736  1.00 33.83  ? 354  ARG A CZ  1 
ATOM   1108 N  NH1 . ARG A 1 150 ? 17.962  15.773  42.455  1.00 36.12  ? 354  ARG A NH1 1 
ATOM   1109 N  NH2 . ARG A 1 150 ? 19.112  15.439  40.486  1.00 32.98  ? 354  ARG A NH2 1 
ATOM   1110 N  N   . SER A 1 151 ? 20.316  9.880   47.908  1.00 25.20  ? 355  SER A N   1 
ATOM   1111 C  CA  . SER A 1 151 ? 20.839  9.867   49.276  1.00 26.17  ? 355  SER A CA  1 
ATOM   1112 C  C   . SER A 1 151 ? 21.567  8.584   49.620  1.00 26.97  ? 355  SER A C   1 
ATOM   1113 O  O   . SER A 1 151 ? 22.387  8.574   50.528  1.00 28.07  ? 355  SER A O   1 
ATOM   1114 C  CB  . SER A 1 151 ? 19.711  10.096  50.291  1.00 25.78  ? 355  SER A CB  1 
ATOM   1115 O  OG  . SER A 1 151 ? 18.953  8.919   50.502  1.00 24.04  ? 355  SER A OG  1 
ATOM   1116 N  N   . LEU A 1 152 ? 21.253  7.503   48.910  1.00 27.88  ? 356  LEU A N   1 
ATOM   1117 C  CA  . LEU A 1 152 ? 21.875  6.203   49.150  1.00 28.70  ? 356  LEU A CA  1 
ATOM   1118 C  C   . LEU A 1 152 ? 23.403  6.212   48.940  1.00 29.56  ? 356  LEU A C   1 
ATOM   1119 O  O   . LEU A 1 152 ? 23.969  7.176   48.391  1.00 29.20  ? 356  LEU A O   1 
ATOM   1120 C  CB  . LEU A 1 152 ? 21.219  5.133   48.267  1.00 28.41  ? 356  LEU A CB  1 
ATOM   1121 C  CG  . LEU A 1 152 ? 19.694  5.038   48.253  1.00 28.88  ? 356  LEU A CG  1 
ATOM   1122 C  CD1 . LEU A 1 152 ? 19.249  4.065   47.182  1.00 30.17  ? 356  LEU A CD1 1 
ATOM   1123 C  CD2 . LEU A 1 152 ? 19.147  4.629   49.603  1.00 28.82  ? 356  LEU A CD2 1 
ATOM   1124 N  N   . ARG A 1 153 ? 24.054  5.136   49.390  1.00 30.34  ? 357  ARG A N   1 
ATOM   1125 C  CA  . ARG A 1 153 ? 25.497  4.923   49.205  1.00 31.49  ? 357  ARG A CA  1 
ATOM   1126 C  C   . ARG A 1 153 ? 25.899  5.026   47.740  1.00 32.16  ? 357  ARG A C   1 
ATOM   1127 O  O   . ARG A 1 153 ? 25.102  4.709   46.870  1.00 32.73  ? 357  ARG A O   1 
ATOM   1128 C  CB  . ARG A 1 153 ? 25.891  3.525   49.703  1.00 31.37  ? 357  ARG A CB  1 
ATOM   1129 C  CG  . ARG A 1 153 ? 26.493  3.478   51.074  1.00 31.66  ? 357  ARG A CG  1 
ATOM   1130 C  CD  . ARG A 1 153 ? 27.565  2.410   51.151  1.00 30.91  ? 357  ARG A CD  1 
ATOM   1131 N  NE  . ARG A 1 153 ? 27.102  1.018   51.075  1.00 28.11  ? 357  ARG A NE  1 
ATOM   1132 C  CZ  . ARG A 1 153 ? 27.539  0.133   50.175  1.00 28.86  ? 357  ARG A CZ  1 
ATOM   1133 N  NH1 . ARG A 1 153 ? 28.406  0.499   49.241  1.00 28.54  ? 357  ARG A NH1 1 
ATOM   1134 N  NH2 . ARG A 1 153 ? 27.105  -1.122  50.194  1.00 28.27  ? 357  ARG A NH2 1 
ATOM   1135 N  N   . LYS A 1 154 ? 27.157  5.408   47.498  1.00 33.70  ? 358  LYS A N   1 
ATOM   1136 C  CA  . LYS A 1 154 ? 27.759  5.642   46.149  1.00 34.92  ? 358  LYS A CA  1 
ATOM   1137 C  C   . LYS A 1 154 ? 27.398  4.767   44.928  1.00 35.14  ? 358  LYS A C   1 
ATOM   1138 O  O   . LYS A 1 154 ? 26.942  5.321   43.904  1.00 36.29  ? 358  LYS A O   1 
ATOM   1139 C  CB  . LYS A 1 154 ? 29.291  5.777   46.237  1.00 35.22  ? 358  LYS A CB  1 
ATOM   1140 C  CG  . LYS A 1 154 ? 29.922  6.438   45.022  1.00 36.74  ? 358  LYS A CG  1 
ATOM   1141 C  CD  . LYS A 1 154 ? 29.912  7.965   45.114  1.00 38.24  ? 358  LYS A CD  1 
ATOM   1142 C  CE  . LYS A 1 154 ? 29.919  8.590   43.723  1.00 39.31  ? 358  LYS A CE  1 
ATOM   1143 N  NZ  . LYS A 1 154 ? 30.785  9.803   43.574  1.00 41.64  ? 358  LYS A NZ  1 
ATOM   1144 N  N   . PRO A 1 155 ? 27.608  3.420   44.981  1.00 34.43  ? 359  PRO A N   1 
ATOM   1145 C  CA  . PRO A 1 155 ? 27.369  2.793   43.684  1.00 33.49  ? 359  PRO A CA  1 
ATOM   1146 C  C   . PRO A 1 155 ? 25.879  2.777   43.378  1.00 33.16  ? 359  PRO A C   1 
ATOM   1147 O  O   . PRO A 1 155 ? 25.481  2.871   42.217  1.00 33.88  ? 359  PRO A O   1 
ATOM   1148 C  CB  . PRO A 1 155 ? 27.930  1.373   43.851  1.00 33.61  ? 359  PRO A CB  1 
ATOM   1149 C  CG  . PRO A 1 155 ? 27.901  1.112   45.299  1.00 33.50  ? 359  PRO A CG  1 
ATOM   1150 C  CD  . PRO A 1 155 ? 27.978  2.435   46.011  1.00 34.10  ? 359  PRO A CD  1 
ATOM   1151 N  N   . PHE A 1 156 ? 25.063  2.711   44.423  1.00 32.14  ? 360  PHE A N   1 
ATOM   1152 C  CA  . PHE A 1 156 ? 23.630  2.548   44.250  1.00 31.24  ? 360  PHE A CA  1 
ATOM   1153 C  C   . PHE A 1 156 ? 22.913  3.847   43.863  1.00 31.78  ? 360  PHE A C   1 
ATOM   1154 O  O   . PHE A 1 156 ? 22.035  3.839   42.998  1.00 31.92  ? 360  PHE A O   1 
ATOM   1155 C  CB  . PHE A 1 156 ? 23.026  1.876   45.479  1.00 30.10  ? 360  PHE A CB  1 
ATOM   1156 C  CG  . PHE A 1 156 ? 23.679  0.556   45.827  1.00 28.23  ? 360  PHE A CG  1 
ATOM   1157 C  CD1 . PHE A 1 156 ? 23.483  -0.565  45.028  1.00 25.25  ? 360  PHE A CD1 1 
ATOM   1158 C  CD2 . PHE A 1 156 ? 24.476  0.436   46.962  1.00 26.16  ? 360  PHE A CD2 1 
ATOM   1159 C  CE1 . PHE A 1 156 ? 24.069  -1.784  45.345  1.00 25.24  ? 360  PHE A CE1 1 
ATOM   1160 C  CE2 . PHE A 1 156 ? 25.069  -0.781  47.297  1.00 26.93  ? 360  PHE A CE2 1 
ATOM   1161 C  CZ  . PHE A 1 156 ? 24.869  -1.902  46.483  1.00 27.12  ? 360  PHE A CZ  1 
ATOM   1162 N  N   . SER A 1 157 ? 23.291  4.966   44.470  1.00 32.18  ? 361  SER A N   1 
ATOM   1163 C  CA  . SER A 1 157 ? 22.768  6.258   44.019  1.00 32.62  ? 361  SER A CA  1 
ATOM   1164 C  C   . SER A 1 157 ? 23.184  6.594   42.569  1.00 32.98  ? 361  SER A C   1 
ATOM   1165 O  O   . SER A 1 157 ? 22.377  7.104   41.789  1.00 33.03  ? 361  SER A O   1 
ATOM   1166 C  CB  . SER A 1 157 ? 23.171  7.364   44.987  1.00 32.75  ? 361  SER A CB  1 
ATOM   1167 O  OG  . SER A 1 157 ? 24.542  7.268   45.307  1.00 33.10  ? 361  SER A OG  1 
ATOM   1168 N  N   . ASP A 1 158 ? 24.420  6.269   42.193  1.00 33.30  ? 362  ASP A N   1 
ATOM   1169 C  CA  . ASP A 1 158 ? 24.932  6.587   40.845  1.00 33.99  ? 362  ASP A CA  1 
ATOM   1170 C  C   . ASP A 1 158 ? 24.269  5.866   39.670  1.00 33.51  ? 362  ASP A C   1 
ATOM   1171 O  O   . ASP A 1 158 ? 24.416  6.299   38.534  1.00 32.88  ? 362  ASP A O   1 
ATOM   1172 C  CB  . ASP A 1 158 ? 26.435  6.341   40.745  1.00 34.42  ? 362  ASP A CB  1 
ATOM   1173 C  CG  . ASP A 1 158 ? 27.230  7.116   41.770  1.00 37.49  ? 362  ASP A CG  1 
ATOM   1174 O  OD1 . ASP A 1 158 ? 26.707  8.105   42.357  1.00 40.99  ? 362  ASP A OD1 1 
ATOM   1175 O  OD2 . ASP A 1 158 ? 28.400  6.721   41.980  1.00 40.13  ? 362  ASP A OD2 1 
ATOM   1176 N  N   . ILE A 1 159 ? 23.572  4.763   39.936  1.00 33.41  ? 363  ILE A N   1 
ATOM   1177 C  CA  . ILE A 1 159 ? 23.015  3.952   38.856  1.00 33.47  ? 363  ILE A CA  1 
ATOM   1178 C  C   . ILE A 1 159 ? 21.644  4.412   38.369  1.00 32.15  ? 363  ILE A C   1 
ATOM   1179 O  O   . ILE A 1 159 ? 21.342  4.241   37.194  1.00 31.88  ? 363  ILE A O   1 
ATOM   1180 C  CB  . ILE A 1 159 ? 23.010  2.429   39.178  1.00 33.79  ? 363  ILE A CB  1 
ATOM   1181 C  CG1 . ILE A 1 159 ? 22.179  2.140   40.426  1.00 34.30  ? 363  ILE A CG1 1 
ATOM   1182 C  CG2 . ILE A 1 159 ? 24.451  1.898   39.280  1.00 35.34  ? 363  ILE A CG2 1 
ATOM   1183 C  CD1 . ILE A 1 159 ? 22.446  0.789   41.086  1.00 34.51  ? 363  ILE A CD1 1 
ATOM   1184 N  N   . ILE A 1 160 ? 20.825  4.985   39.254  1.00 30.79  ? 364  ILE A N   1 
ATOM   1185 C  CA  . ILE A 1 160 ? 19.489  5.479   38.866  1.00 29.78  ? 364  ILE A CA  1 
ATOM   1186 C  C   . ILE A 1 160 ? 19.502  6.897   38.285  1.00 28.73  ? 364  ILE A C   1 
ATOM   1187 O  O   . ILE A 1 160 ? 18.808  7.175   37.303  1.00 28.45  ? 364  ILE A O   1 
ATOM   1188 C  CB  . ILE A 1 160 ? 18.479  5.468   40.036  1.00 30.43  ? 364  ILE A CB  1 
ATOM   1189 C  CG1 . ILE A 1 160 ? 18.496  4.131   40.770  1.00 31.57  ? 364  ILE A CG1 1 
ATOM   1190 C  CG2 . ILE A 1 160 ? 17.076  5.857   39.554  1.00 30.24  ? 364  ILE A CG2 1 
ATOM   1191 C  CD1 . ILE A 1 160 ? 19.369  4.164   42.013  1.00 32.88  ? 364  ILE A CD1 1 
ATOM   1192 N  N   . GLU A 1 161 ? 20.284  7.788   38.886  1.00 27.15  ? 365  GLU A N   1 
ATOM   1193 C  CA  . GLU A 1 161 ? 20.298  9.191   38.453  1.00 26.70  ? 365  GLU A CA  1 
ATOM   1194 C  C   . GLU A 1 161 ? 20.406  9.407   36.929  1.00 25.78  ? 365  GLU A C   1 
ATOM   1195 O  O   . GLU A 1 161 ? 19.628  10.185  36.397  1.00 25.98  ? 365  GLU A O   1 
ATOM   1196 C  CB  . GLU A 1 161 ? 21.331  10.017  39.225  1.00 26.28  ? 365  GLU A CB  1 
ATOM   1197 C  CG  . GLU A 1 161 ? 21.416  11.526  38.838  1.00 27.33  ? 365  GLU A CG  1 
ATOM   1198 C  CD  . GLU A 1 161 ? 20.139  12.338  39.047  1.00 27.45  ? 365  GLU A CD  1 
ATOM   1199 O  OE1 . GLU A 1 161 ? 19.119  11.820  39.545  1.00 29.54  ? 365  GLU A OE1 1 
ATOM   1200 O  OE2 . GLU A 1 161 ? 20.159  13.538  38.720  1.00 29.54  ? 365  GLU A OE2 1 
ATOM   1201 N  N   . PRO A 1 162 ? 21.335  8.710   36.227  1.00 25.27  ? 366  PRO A N   1 
ATOM   1202 C  CA  . PRO A 1 162 ? 21.430  8.933   34.769  1.00 24.96  ? 366  PRO A CA  1 
ATOM   1203 C  C   . PRO A 1 162 ? 20.165  8.570   33.984  1.00 24.31  ? 366  PRO A C   1 
ATOM   1204 O  O   . PRO A 1 162 ? 19.953  9.102   32.901  1.00 23.68  ? 366  PRO A O   1 
ATOM   1205 C  CB  . PRO A 1 162 ? 22.596  8.021   34.349  1.00 24.94  ? 366  PRO A CB  1 
ATOM   1206 C  CG  . PRO A 1 162 ? 23.390  7.823   35.610  1.00 25.83  ? 366  PRO A CG  1 
ATOM   1207 C  CD  . PRO A 1 162 ? 22.348  7.729   36.671  1.00 25.08  ? 366  PRO A CD  1 
ATOM   1208 N  N   . LYS A 1 163 ? 19.353  7.665   34.533  1.00 23.89  ? 367  LYS A N   1 
ATOM   1209 C  CA  . LYS A 1 163 ? 18.090  7.258   33.916  1.00 23.68  ? 367  LYS A CA  1 
ATOM   1210 C  C   . LYS A 1 163 ? 17.032  8.342   34.021  1.00 23.33  ? 367  LYS A C   1 
ATOM   1211 O  O   . LYS A 1 163 ? 16.304  8.590   33.052  1.00 23.18  ? 367  LYS A O   1 
ATOM   1212 C  CB  . LYS A 1 163 ? 17.575  5.946   34.510  1.00 23.36  ? 367  LYS A CB  1 
ATOM   1213 C  CG  . LYS A 1 163 ? 18.319  4.705   34.037  1.00 24.75  ? 367  LYS A CG  1 
ATOM   1214 C  CD  . LYS A 1 163 ? 19.752  4.639   34.555  1.00 23.58  ? 367  LYS A CD  1 
ATOM   1215 C  CE  . LYS A 1 163 ? 20.404  3.327   34.150  1.00 24.07  ? 367  LYS A CE  1 
ATOM   1216 N  NZ  . LYS A 1 163 ? 21.814  3.158   34.646  1.00 23.74  ? 367  LYS A NZ  1 
ATOM   1217 N  N   . PHE A 1 164 ? 16.952  8.974   35.188  1.00 23.59  ? 368  PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 164 ? 16.143  10.187  35.374  1.00 24.33  ? 368  PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 164 ? 16.549  11.258  34.385  1.00 24.53  ? 368  PHE A C   1 
ATOM   1220 O  O   . PHE A 1 164 ? 15.698  11.869  33.752  1.00 25.44  ? 368  PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 164 ? 16.304  10.758  36.786  1.00 24.49  ? 368  PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 164 ? 15.346  10.206  37.784  1.00 24.61  ? 368  PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 164 ? 14.015  10.609  37.784  1.00 24.52  ? 368  PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 164 ? 15.783  9.311   38.753  1.00 24.68  ? 368  PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 164 ? 13.126  10.103  38.718  1.00 25.24  ? 368  PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 164 ? 14.899  8.803   39.699  1.00 26.81  ? 368  PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 164 ? 13.566  9.198   39.680  1.00 24.98  ? 368  PHE A CZ  1 
ATOM   1228 N  N   . GLU A 1 165 ? 17.853  11.479  34.251  1.00 24.99  ? 369  GLU A N   1 
ATOM   1229 C  CA  . GLU A 1 165 ? 18.378  12.512  33.361  1.00 25.70  ? 369  GLU A CA  1 
ATOM   1230 C  C   . GLU A 1 165 ? 17.948  12.296  31.917  1.00 25.24  ? 369  GLU A C   1 
ATOM   1231 O  O   . GLU A 1 165 ? 17.470  13.226  31.262  1.00 25.24  ? 369  GLU A O   1 
ATOM   1232 C  CB  . GLU A 1 165 ? 19.899  12.564  33.443  1.00 26.43  ? 369  GLU A CB  1 
ATOM   1233 C  CG  . GLU A 1 165 ? 20.424  13.168  34.729  1.00 29.44  ? 369  GLU A CG  1 
ATOM   1234 C  CD  . GLU A 1 165 ? 21.932  13.262  34.723  1.00 35.38  ? 369  GLU A CD  1 
ATOM   1235 O  OE1 . GLU A 1 165 ? 22.512  13.348  33.611  1.00 38.49  ? 369  GLU A OE1 1 
ATOM   1236 O  OE2 . GLU A 1 165 ? 22.541  13.248  35.819  1.00 36.16  ? 369  GLU A OE2 1 
ATOM   1237 N  N   . PHE A 1 166 ? 18.131  11.067  31.433  1.00 24.60  ? 370  PHE A N   1 
ATOM   1238 C  CA  . PHE A 1 166 ? 17.642  10.659  30.114  1.00 24.13  ? 370  PHE A CA  1 
ATOM   1239 C  C   . PHE A 1 166 ? 16.119  10.829  29.988  1.00 24.27  ? 370  PHE A C   1 
ATOM   1240 O  O   . PHE A 1 166 ? 15.637  11.316  28.969  1.00 24.45  ? 370  PHE A O   1 
ATOM   1241 C  CB  . PHE A 1 166 ? 18.011  9.190   29.818  1.00 23.39  ? 370  PHE A CB  1 
ATOM   1242 C  CG  . PHE A 1 166 ? 17.444  8.694   28.525  1.00 23.78  ? 370  PHE A CG  1 
ATOM   1243 C  CD1 . PHE A 1 166 ? 16.136  8.222   28.463  1.00 22.35  ? 370  PHE A CD1 1 
ATOM   1244 C  CD2 . PHE A 1 166 ? 18.198  8.751   27.353  1.00 23.56  ? 370  PHE A CD2 1 
ATOM   1245 C  CE1 . PHE A 1 166 ? 15.584  7.812   27.246  1.00 24.56  ? 370  PHE A CE1 1 
ATOM   1246 C  CE2 . PHE A 1 166 ? 17.658  8.331   26.140  1.00 24.87  ? 370  PHE A CE2 1 
ATOM   1247 C  CZ  . PHE A 1 166 ? 16.354  7.863   26.085  1.00 22.79  ? 370  PHE A CZ  1 
ATOM   1248 N  N   . ALA A 1 167 ? 15.383  10.400  31.016  1.00 24.59  ? 371  ALA A N   1 
ATOM   1249 C  CA  . ALA A 1 167 ? 13.918  10.340  31.012  1.00 24.87  ? 371  ALA A CA  1 
ATOM   1250 C  C   . ALA A 1 167 ? 13.270  11.702  30.836  1.00 25.54  ? 371  ALA A C   1 
ATOM   1251 O  O   . ALA A 1 167 ? 12.380  11.862  29.999  1.00 25.67  ? 371  ALA A O   1 
ATOM   1252 C  CB  . ALA A 1 167 ? 13.403  9.683   32.286  1.00 24.23  ? 371  ALA A CB  1 
ATOM   1253 N  N   . VAL A 1 168 ? 13.713  12.686  31.615  1.00 26.23  ? 372  VAL A N   1 
ATOM   1254 C  CA  . VAL A 1 168 ? 13.114  14.016  31.531  1.00 26.96  ? 372  VAL A CA  1 
ATOM   1255 C  C   . VAL A 1 168 ? 13.322  14.692  30.171  1.00 27.04  ? 372  VAL A C   1 
ATOM   1256 O  O   . VAL A 1 168 ? 12.422  15.393  29.701  1.00 27.56  ? 372  VAL A O   1 
ATOM   1257 C  CB  . VAL A 1 168 ? 13.465  14.941  32.750  1.00 26.98  ? 372  VAL A CB  1 
ATOM   1258 C  CG1 . VAL A 1 168 ? 13.115  14.257  34.069  1.00 27.41  ? 372  VAL A CG1 1 
ATOM   1259 C  CG2 . VAL A 1 168 ? 14.923  15.332  32.758  1.00 29.17  ? 372  VAL A CG2 1 
ATOM   1260 N  N   . LYS A 1 169 ? 14.472  14.471  29.523  1.00 27.05  ? 373  LYS A N   1 
ATOM   1261 C  CA  . LYS A 1 169 ? 14.675  14.981  28.153  1.00 26.58  ? 373  LYS A CA  1 
ATOM   1262 C  C   . LYS A 1 169 ? 13.817  14.198  27.157  1.00 25.83  ? 373  LYS A C   1 
ATOM   1263 O  O   . LYS A 1 169 ? 13.204  14.788  26.277  1.00 25.34  ? 373  LYS A O   1 
ATOM   1264 C  CB  . LYS A 1 169 ? 16.153  14.983  27.713  1.00 27.15  ? 373  LYS A CB  1 
ATOM   1265 C  CG  . LYS A 1 169 ? 17.164  15.572  28.726  1.00 26.72  ? 373  LYS A CG  1 
ATOM   1266 C  CD  . LYS A 1 169 ? 18.533  15.835  28.106  1.00 28.32  ? 373  LYS A CD  1 
ATOM   1267 C  CE  . LYS A 1 169 ? 19.278  14.559  27.694  1.00 32.09  ? 373  LYS A CE  1 
ATOM   1268 N  NZ  . LYS A 1 169 ? 20.311  14.117  28.683  1.00 35.72  ? 373  LYS A NZ  1 
ATOM   1269 N  N   . PHE A 1 170 ? 13.761  12.871  27.317  1.00 24.58  ? 374  PHE A N   1 
ATOM   1270 C  CA  . PHE A 1 170 ? 12.908  12.020  26.492  1.00 23.95  ? 374  PHE A CA  1 
ATOM   1271 C  C   . PHE A 1 170 ? 11.427  12.414  26.586  1.00 23.61  ? 374  PHE A C   1 
ATOM   1272 O  O   . PHE A 1 170 ? 10.714  12.472  25.570  1.00 23.28  ? 374  PHE A O   1 
ATOM   1273 C  CB  . PHE A 1 170 ? 13.087  10.540  26.874  1.00 23.39  ? 374  PHE A CB  1 
ATOM   1274 C  CG  . PHE A 1 170 ? 12.411  9.579   25.922  1.00 23.30  ? 374  PHE A CG  1 
ATOM   1275 C  CD1 . PHE A 1 170 ? 12.886  9.410   24.617  1.00 24.17  ? 374  PHE A CD1 1 
ATOM   1276 C  CD2 . PHE A 1 170 ? 11.318  8.825   26.327  1.00 22.77  ? 374  PHE A CD2 1 
ATOM   1277 C  CE1 . PHE A 1 170 ? 12.266  8.510   23.736  1.00 23.67  ? 374  PHE A CE1 1 
ATOM   1278 C  CE2 . PHE A 1 170 ? 10.694  7.922   25.451  1.00 23.24  ? 374  PHE A CE2 1 
ATOM   1279 C  CZ  . PHE A 1 170 ? 11.174  7.761   24.156  1.00 23.76  ? 374  PHE A CZ  1 
ATOM   1280 N  N   . ASN A 1 171 ? 10.977  12.674  27.815  1.00 23.81  ? 375  ASN A N   1 
ATOM   1281 C  CA  . ASN A 1 171 ? 9.597   13.105  28.093  1.00 23.88  ? 375  ASN A CA  1 
ATOM   1282 C  C   . ASN A 1 171 ? 9.223   14.407  27.414  1.00 23.97  ? 375  ASN A C   1 
ATOM   1283 O  O   . ASN A 1 171 ? 8.052   14.634  27.096  1.00 24.06  ? 375  ASN A O   1 
ATOM   1284 C  CB  . ASN A 1 171 ? 9.340   13.193  29.607  1.00 23.60  ? 375  ASN A CB  1 
ATOM   1285 C  CG  . ASN A 1 171 ? 8.890   11.867  30.194  1.00 23.84  ? 375  ASN A CG  1 
ATOM   1286 O  OD1 . ASN A 1 171 ? 8.436   10.981  29.466  1.00 24.60  ? 375  ASN A OD1 1 
ATOM   1287 N  ND2 . ASN A 1 171 ? 9.000   11.729  31.509  1.00 22.15  ? 375  ASN A ND2 1 
ATOM   1288 N  N   . ALA A 1 172 ? 10.225  15.254  27.187  1.00 24.82  ? 376  ALA A N   1 
ATOM   1289 C  CA  . ALA A 1 172 ? 10.034  16.513  26.469  1.00 24.95  ? 376  ALA A CA  1 
ATOM   1290 C  C   . ALA A 1 172 ? 9.661   16.300  24.994  1.00 25.15  ? 376  ALA A C   1 
ATOM   1291 O  O   . ALA A 1 172 ? 9.254   17.237  24.328  1.00 25.80  ? 376  ALA A O   1 
ATOM   1292 C  CB  . ALA A 1 172 ? 11.260  17.381  26.588  1.00 25.06  ? 376  ALA A CB  1 
ATOM   1293 N  N   . LEU A 1 173 ? 9.782   15.072  24.490  1.00 24.81  ? 377  LEU A N   1 
ATOM   1294 C  CA  . LEU A 1 173 ? 9.365   14.776  23.111  1.00 24.25  ? 377  LEU A CA  1 
ATOM   1295 C  C   . LEU A 1 173 ? 7.857   14.530  23.001  1.00 24.50  ? 377  LEU A C   1 
ATOM   1296 O  O   . LEU A 1 173 ? 7.298   14.550  21.900  1.00 23.84  ? 377  LEU A O   1 
ATOM   1297 C  CB  . LEU A 1 173 ? 10.139  13.585  22.536  1.00 24.40  ? 377  LEU A CB  1 
ATOM   1298 C  CG  . LEU A 1 173 ? 11.648  13.734  22.279  1.00 24.49  ? 377  LEU A CG  1 
ATOM   1299 C  CD1 . LEU A 1 173 ? 12.223  12.443  21.701  1.00 24.71  ? 377  LEU A CD1 1 
ATOM   1300 C  CD2 . LEU A 1 173 ? 11.988  14.904  21.369  1.00 24.48  ? 377  LEU A CD2 1 
ATOM   1301 N  N   . GLU A 1 174 ? 7.218   14.264  24.140  1.00 24.84  ? 378  GLU A N   1 
ATOM   1302 C  CA  . GLU A 1 174 ? 5.759   14.119  24.228  1.00 25.58  ? 378  GLU A CA  1 
ATOM   1303 C  C   . GLU A 1 174 ? 5.177   12.967  23.423  1.00 25.14  ? 378  GLU A C   1 
ATOM   1304 O  O   . GLU A 1 174 ? 4.100   13.081  22.818  1.00 24.95  ? 378  GLU A O   1 
ATOM   1305 C  CB  . GLU A 1 174 ? 5.051   15.435  23.894  1.00 25.81  ? 378  GLU A CB  1 
ATOM   1306 C  CG  . GLU A 1 174 ? 5.162   16.450  25.002  1.00 28.61  ? 378  GLU A CG  1 
ATOM   1307 C  CD  . GLU A 1 174 ? 4.570   17.785  24.625  1.00 33.66  ? 378  GLU A CD  1 
ATOM   1308 O  OE1 . GLU A 1 174 ? 5.282   18.791  24.786  1.00 36.66  ? 378  GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A 1 174 ? 3.402   17.834  24.166  1.00 35.75  ? 378  GLU A OE2 1 
ATOM   1310 N  N   . LEU A 1 175 ? 5.873   11.838  23.442  1.00 24.58  ? 379  LEU A N   1 
ATOM   1311 C  CA  . LEU A 1 175 ? 5.317   10.641  22.847  1.00 23.83  ? 379  LEU A CA  1 
ATOM   1312 C  C   . LEU A 1 175 ? 4.123   10.146  23.649  1.00 24.07  ? 379  LEU A C   1 
ATOM   1313 O  O   . LEU A 1 175 ? 4.000   10.424  24.851  1.00 24.81  ? 379  LEU A O   1 
ATOM   1314 C  CB  . LEU A 1 175 ? 6.363   9.534   22.747  1.00 23.46  ? 379  LEU A CB  1 
ATOM   1315 C  CG  . LEU A 1 175 ? 7.640   9.748   21.926  1.00 23.34  ? 379  LEU A CG  1 
ATOM   1316 C  CD1 . LEU A 1 175 ? 8.265   8.361   21.659  1.00 23.38  ? 379  LEU A CD1 1 
ATOM   1317 C  CD2 . LEU A 1 175 ? 7.401   10.502  20.614  1.00 21.01  ? 379  LEU A CD2 1 
ATOM   1318 N  N   . ASP A 1 176 ? 3.250   9.410   22.975  1.00 23.21  ? 380  ASP A N   1 
ATOM   1319 C  CA  . ASP A 1 176 ? 2.149   8.730   23.622  1.00 23.42  ? 380  ASP A CA  1 
ATOM   1320 C  C   . ASP A 1 176 ? 2.352   7.224   23.454  1.00 22.76  ? 380  ASP A C   1 
ATOM   1321 O  O   . ASP A 1 176 ? 3.300   6.802   22.789  1.00 22.60  ? 380  ASP A O   1 
ATOM   1322 C  CB  . ASP A 1 176 ? 0.799   9.214   23.059  1.00 23.41  ? 380  ASP A CB  1 
ATOM   1323 C  CG  . ASP A 1 176 ? 0.483   8.672   21.658  1.00 24.47  ? 380  ASP A CG  1 
ATOM   1324 O  OD1 . ASP A 1 176 ? 1.081   7.664   21.173  1.00 23.94  ? 380  ASP A OD1 1 
ATOM   1325 O  OD2 . ASP A 1 176 ? -0.422  9.271   21.045  1.00 25.68  ? 380  ASP A OD2 1 
ATOM   1326 N  N   . ASP A 1 177 ? 1.472   6.426   24.047  1.00 22.37  ? 381  ASP A N   1 
ATOM   1327 C  CA  . ASP A 1 177 ? 1.611   4.963   24.031  1.00 22.46  ? 381  ASP A CA  1 
ATOM   1328 C  C   . ASP A 1 177 ? 1.645   4.333   22.634  1.00 22.36  ? 381  ASP A C   1 
ATOM   1329 O  O   . ASP A 1 177 ? 2.293   3.298   22.437  1.00 22.22  ? 381  ASP A O   1 
ATOM   1330 C  CB  . ASP A 1 177 ? 0.493   4.302   24.840  1.00 22.19  ? 381  ASP A CB  1 
ATOM   1331 C  CG  . ASP A 1 177 ? 0.654   4.491   26.339  1.00 23.38  ? 381  ASP A CG  1 
ATOM   1332 O  OD1 . ASP A 1 177 ? 1.723   4.138   26.898  1.00 22.49  ? 381  ASP A OD1 1 
ATOM   1333 O  OD2 . ASP A 1 177 ? -0.303  4.999   26.958  1.00 24.00  ? 381  ASP A OD2 1 
ATOM   1334 N  N   . SER A 1 178 ? 0.915   4.923   21.685  1.00 22.16  ? 382  SER A N   1 
ATOM   1335 C  CA  . SER A 1 178 ? 0.880   4.394   20.318  1.00 22.69  ? 382  SER A CA  1 
ATOM   1336 C  C   . SER A 1 178 ? 2.222   4.597   19.629  1.00 22.30  ? 382  SER A C   1 
ATOM   1337 O  O   . SER A 1 178 ? 2.666   3.724   18.871  1.00 22.95  ? 382  SER A O   1 
ATOM   1338 C  CB  . SER A 1 178 ? -0.279  4.978   19.488  1.00 22.54  ? 382  SER A CB  1 
ATOM   1339 O  OG  . SER A 1 178 ? -0.130  6.385   19.300  1.00 23.31  ? 382  SER A OG  1 
ATOM   1340 N  N   . ASP A 1 179 ? 2.845   5.749   19.890  1.00 21.98  ? 383  ASP A N   1 
ATOM   1341 C  CA  . ASP A 1 179 ? 4.235   6.021   19.498  1.00 21.91  ? 383  ASP A CA  1 
ATOM   1342 C  C   . ASP A 1 179 ? 5.207   5.058   20.176  1.00 21.82  ? 383  ASP A C   1 
ATOM   1343 O  O   . ASP A 1 179 ? 6.021   4.415   19.501  1.00 21.23  ? 383  ASP A O   1 
ATOM   1344 C  CB  . ASP A 1 179 ? 4.666   7.461   19.858  1.00 22.11  ? 383  ASP A CB  1 
ATOM   1345 C  CG  . ASP A 1 179 ? 3.732   8.532   19.299  1.00 22.75  ? 383  ASP A CG  1 
ATOM   1346 O  OD1 . ASP A 1 179 ? 3.204   8.387   18.170  1.00 24.87  ? 383  ASP A OD1 1 
ATOM   1347 O  OD2 . ASP A 1 179 ? 3.547   9.545   19.999  1.00 22.47  ? 383  ASP A OD2 1 
ATOM   1348 N  N   . LEU A 1 180 ? 5.122   4.966   21.511  1.00 21.20  ? 384  LEU A N   1 
ATOM   1349 C  CA  . LEU A 1 180 ? 6.000   4.085   22.286  1.00 20.99  ? 384  LEU A CA  1 
ATOM   1350 C  C   . LEU A 1 180 ? 5.952   2.618   21.866  1.00 20.45  ? 384  LEU A C   1 
ATOM   1351 O  O   . LEU A 1 180 ? 6.981   1.967   21.866  1.00 20.33  ? 384  LEU A O   1 
ATOM   1352 C  CB  . LEU A 1 180 ? 5.757   4.213   23.803  1.00 20.54  ? 384  LEU A CB  1 
ATOM   1353 C  CG  . LEU A 1 180 ? 6.102   5.561   24.422  1.00 21.57  ? 384  LEU A CG  1 
ATOM   1354 C  CD1 . LEU A 1 180 ? 5.379   5.737   25.756  1.00 22.40  ? 384  LEU A CD1 1 
ATOM   1355 C  CD2 . LEU A 1 180 ? 7.612   5.716   24.601  1.00 22.43  ? 384  LEU A CD2 1 
ATOM   1356 N  N   . ALA A 1 181 ? 4.778   2.101   21.508  1.00 20.64  ? 385  ALA A N   1 
ATOM   1357 C  CA  . ALA A 1 181 ? 4.679   0.718   21.011  1.00 20.80  ? 385  ALA A CA  1 
ATOM   1358 C  C   . ALA A 1 181 ? 5.657   0.440   19.852  1.00 20.94  ? 385  ALA A C   1 
ATOM   1359 O  O   . ALA A 1 181 ? 6.389   -0.549  19.850  1.00 20.54  ? 385  ALA A O   1 
ATOM   1360 C  CB  . ALA A 1 181 ? 3.239   0.418   20.579  1.00 21.35  ? 385  ALA A CB  1 
ATOM   1361 N  N   . LEU A 1 182 ? 5.674   1.346   18.879  1.00 21.44  ? 386  LEU A N   1 
ATOM   1362 C  CA  . LEU A 1 182 ? 6.490   1.191   17.668  1.00 21.57  ? 386  LEU A CA  1 
ATOM   1363 C  C   . LEU A 1 182 ? 7.973   1.402   17.985  1.00 21.15  ? 386  LEU A C   1 
ATOM   1364 O  O   . LEU A 1 182 ? 8.829   0.671   17.500  1.00 21.29  ? 386  LEU A O   1 
ATOM   1365 C  CB  . LEU A 1 182 ? 6.016   2.151   16.578  1.00 21.15  ? 386  LEU A CB  1 
ATOM   1366 C  CG  . LEU A 1 182 ? 4.690   1.837   15.877  1.00 22.06  ? 386  LEU A CG  1 
ATOM   1367 C  CD1 . LEU A 1 182 ? 4.236   3.005   15.028  1.00 19.44  ? 386  LEU A CD1 1 
ATOM   1368 C  CD2 . LEU A 1 182 ? 4.810   0.577   15.028  1.00 22.85  ? 386  LEU A CD2 1 
ATOM   1369 N  N   . PHE A 1 183 ? 8.245   2.382   18.835  1.00 21.09  ? 387  PHE A N   1 
ATOM   1370 C  CA  . PHE A 1 183 ? 9.599   2.707   19.278  1.00 21.49  ? 387  PHE A CA  1 
ATOM   1371 C  C   . PHE A 1 183 ? 10.284  1.548   20.007  1.00 21.37  ? 387  PHE A C   1 
ATOM   1372 O  O   . PHE A 1 183 ? 11.452  1.251   19.759  1.00 21.74  ? 387  PHE A O   1 
ATOM   1373 C  CB  . PHE A 1 183 ? 9.551   3.941   20.191  1.00 21.15  ? 387  PHE A CB  1 
ATOM   1374 C  CG  . PHE A 1 183 ? 10.901  4.490   20.548  1.00 20.19  ? 387  PHE A CG  1 
ATOM   1375 C  CD1 . PHE A 1 183 ? 11.714  5.055   19.582  1.00 20.27  ? 387  PHE A CD1 1 
ATOM   1376 C  CD2 . PHE A 1 183 ? 11.356  4.446   21.861  1.00 21.47  ? 387  PHE A CD2 1 
ATOM   1377 C  CE1 . PHE A 1 183 ? 12.979  5.572   19.921  1.00 20.87  ? 387  PHE A CE1 1 
ATOM   1378 C  CE2 . PHE A 1 183 ? 12.612  4.959   22.215  1.00 20.26  ? 387  PHE A CE2 1 
ATOM   1379 C  CZ  . PHE A 1 183 ? 13.423  5.525   21.253  1.00 20.07  ? 387  PHE A CZ  1 
ATOM   1380 N  N   . ILE A 1 184 ? 9.556   0.919   20.926  1.00 21.11  ? 388  ILE A N   1 
ATOM   1381 C  CA  . ILE A 1 184 ? 10.063  -0.243  21.667  1.00 20.75  ? 388  ILE A CA  1 
ATOM   1382 C  C   . ILE A 1 184 ? 10.203  -1.471  20.770  1.00 19.90  ? 388  ILE A C   1 
ATOM   1383 O  O   . ILE A 1 184 ? 11.193  -2.191  20.866  1.00 19.72  ? 388  ILE A O   1 
ATOM   1384 C  CB  . ILE A 1 184 ? 9.204   -0.517  22.919  1.00 21.01  ? 388  ILE A CB  1 
ATOM   1385 C  CG1 . ILE A 1 184 ? 9.560   0.518   23.995  1.00 21.50  ? 388  ILE A CG1 1 
ATOM   1386 C  CG2 . ILE A 1 184 ? 9.452   -1.890  23.473  1.00 20.87  ? 388  ILE A CG2 1 
ATOM   1387 C  CD1 . ILE A 1 184 ? 8.366   1.059   24.657  1.00 23.40  ? 388  ILE A CD1 1 
ATOM   1388 N  N   . ALA A 1 185 ? 9.236   -1.696  19.877  1.00 19.55  ? 389  ALA A N   1 
ATOM   1389 C  CA  . ALA A 1 185 ? 9.378   -2.756  18.864  1.00 19.19  ? 389  ALA A CA  1 
ATOM   1390 C  C   . ALA A 1 185 ? 10.648  -2.586  18.007  1.00 18.88  ? 389  ALA A C   1 
ATOM   1391 O  O   . ALA A 1 185 ? 11.335  -3.568  17.719  1.00 18.63  ? 389  ALA A O   1 
ATOM   1392 C  CB  . ALA A 1 185 ? 8.122   -2.845  17.982  1.00 18.70  ? 389  ALA A CB  1 
ATOM   1393 N  N   . ALA A 1 186 ? 10.949  -1.346  17.607  1.00 18.57  ? 390  ALA A N   1 
ATOM   1394 C  CA  . ALA A 1 186 ? 12.167  -1.003  16.823  1.00 19.20  ? 390  ALA A CA  1 
ATOM   1395 C  C   . ALA A 1 186 ? 13.480  -1.237  17.588  1.00 19.34  ? 390  ALA A C   1 
ATOM   1396 O  O   . ALA A 1 186 ? 14.503  -1.623  17.007  1.00 19.54  ? 390  ALA A O   1 
ATOM   1397 C  CB  . ALA A 1 186 ? 12.099  0.462   16.347  1.00 18.87  ? 390  ALA A CB  1 
ATOM   1398 N  N   . ILE A 1 187 ? 13.443  -1.002  18.894  1.00 19.70  ? 391  ILE A N   1 
ATOM   1399 C  CA  . ILE A 1 187 ? 14.572  -1.278  19.766  1.00 19.83  ? 391  ILE A CA  1 
ATOM   1400 C  C   . ILE A 1 187 ? 14.893  -2.781  19.860  1.00 20.86  ? 391  ILE A C   1 
ATOM   1401 O  O   . ILE A 1 187 ? 16.068  -3.178  19.765  1.00 20.61  ? 391  ILE A O   1 
ATOM   1402 C  CB  . ILE A 1 187 ? 14.308  -0.726  21.176  1.00 20.05  ? 391  ILE A CB  1 
ATOM   1403 C  CG1 . ILE A 1 187 ? 14.316  0.815   21.157  1.00 19.42  ? 391  ILE A CG1 1 
ATOM   1404 C  CG2 . ILE A 1 187 ? 15.344  -1.266  22.168  1.00 20.85  ? 391  ILE A CG2 1 
ATOM   1405 C  CD1 . ILE A 1 187 ? 13.804  1.436   22.437  1.00 22.54  ? 391  ILE A CD1 1 
ATOM   1406 N  N   . ILE A 1 188 ? 13.855  -3.593  20.067  1.00 20.90  ? 392  ILE A N   1 
ATOM   1407 C  CA  . ILE A 1 188 ? 14.003  -5.034  20.268  1.00 22.63  ? 392  ILE A CA  1 
ATOM   1408 C  C   . ILE A 1 188 ? 14.427  -5.728  18.977  1.00 24.10  ? 392  ILE A C   1 
ATOM   1409 O  O   . ILE A 1 188 ? 15.328  -6.580  18.991  1.00 24.54  ? 392  ILE A O   1 
ATOM   1410 C  CB  . ILE A 1 188 ? 12.691  -5.667  20.795  1.00 22.78  ? 392  ILE A CB  1 
ATOM   1411 C  CG1 . ILE A 1 188 ? 12.346  -5.127  22.186  1.00 23.22  ? 392  ILE A CG1 1 
ATOM   1412 C  CG2 . ILE A 1 188 ? 12.772  -7.202  20.844  1.00 21.04  ? 392  ILE A CG2 1 
ATOM   1413 C  CD1 . ILE A 1 188 ? 10.950  -5.502  22.606  1.00 25.54  ? 392  ILE A CD1 1 
ATOM   1414 N  N   . LEU A 1 189 ? 13.776  -5.352  17.873  1.00 25.44  ? 393  LEU A N   1 
ATOM   1415 C  CA  . LEU A 1 189 ? 14.052  -5.944  16.571  1.00 27.22  ? 393  LEU A CA  1 
ATOM   1416 C  C   . LEU A 1 189 ? 15.198  -5.276  15.844  1.00 28.15  ? 393  LEU A C   1 
ATOM   1417 O  O   . LEU A 1 189 ? 15.024  -4.692  14.779  1.00 29.72  ? 393  LEU A O   1 
ATOM   1418 C  CB  . LEU A 1 189 ? 12.778  -6.015  15.720  1.00 27.39  ? 393  LEU A CB  1 
ATOM   1419 C  CG  . LEU A 1 189 ? 12.171  -7.403  16.000  1.00 28.70  ? 393  LEU A CG  1 
ATOM   1420 C  CD1 . LEU A 1 189 ? 10.672  -7.368  16.271  1.00 29.20  ? 393  LEU A CD1 1 
ATOM   1421 C  CD2 . LEU A 1 189 ? 12.556  -8.410  14.923  1.00 28.13  ? 393  LEU A CD2 1 
ATOM   1422 N  N   . CYS A 1 190 ? 16.380  -5.381  16.430  1.00 29.00  ? 394  CYS A N   1 
ATOM   1423 C  CA  . CYS A 1 190 ? 17.552  -4.665  15.972  1.00 28.64  ? 394  CYS A CA  1 
ATOM   1424 C  C   . CYS A 1 190 ? 18.539  -5.646  15.354  1.00 28.49  ? 394  CYS A C   1 
ATOM   1425 O  O   . CYS A 1 190 ? 19.009  -6.569  16.020  1.00 28.08  ? 394  CYS A O   1 
ATOM   1426 C  CB  . CYS A 1 190 ? 18.164  -3.926  17.159  1.00 29.12  ? 394  CYS A CB  1 
ATOM   1427 S  SG  . CYS A 1 190 ? 19.785  -3.294  16.878  1.00 30.76  ? 394  CYS A SG  1 
ATOM   1428 N  N   . GLY A 1 191 ? 18.848  -5.438  14.075  1.00 27.96  ? 395  GLY A N   1 
ATOM   1429 C  CA  . GLY A 1 191 ? 19.605  -6.411  13.294  1.00 27.50  ? 395  GLY A CA  1 
ATOM   1430 C  C   . GLY A 1 191 ? 21.096  -6.467  13.538  1.00 27.54  ? 395  GLY A C   1 
ATOM   1431 O  O   . GLY A 1 191 ? 21.759  -7.397  13.090  1.00 26.99  ? 395  GLY A O   1 
ATOM   1432 N  N   . ASP A 1 192 ? 21.639  -5.477  14.238  1.00 27.85  ? 396  ASP A N   1 
ATOM   1433 C  CA  . ASP A 1 192 ? 23.082  -5.434  14.425  1.00 28.34  ? 396  ASP A CA  1 
ATOM   1434 C  C   . ASP A 1 192 ? 23.552  -5.901  15.799  1.00 28.06  ? 396  ASP A C   1 
ATOM   1435 O  O   . ASP A 1 192 ? 24.657  -5.569  16.222  1.00 28.18  ? 396  ASP A O   1 
ATOM   1436 C  CB  . ASP A 1 192 ? 23.655  -4.068  14.035  1.00 28.94  ? 396  ASP A CB  1 
ATOM   1437 C  CG  . ASP A 1 192 ? 23.194  -2.959  14.948  1.00 30.90  ? 396  ASP A CG  1 
ATOM   1438 O  OD1 . ASP A 1 192 ? 22.037  -2.510  14.834  1.00 33.87  ? 396  ASP A OD1 1 
ATOM   1439 O  OD2 . ASP A 1 192 ? 24.002  -2.526  15.776  1.00 32.14  ? 396  ASP A OD2 1 
ATOM   1440 N  N   . ARG A 1 193 ? 22.729  -6.716  16.466  1.00 27.99  ? 397  ARG A N   1 
ATOM   1441 C  CA  . ARG A 1 193 ? 23.089  -7.308  17.767  1.00 27.44  ? 397  ARG A CA  1 
ATOM   1442 C  C   . ARG A 1 193 ? 24.142  -8.413  17.577  1.00 27.68  ? 397  ARG A C   1 
ATOM   1443 O  O   . ARG A 1 193 ? 24.055  -9.185  16.622  1.00 26.94  ? 397  ARG A O   1 
ATOM   1444 C  CB  . ARG A 1 193 ? 21.858  -7.870  18.501  1.00 26.91  ? 397  ARG A CB  1 
ATOM   1445 C  CG  . ARG A 1 193 ? 20.715  -6.873  18.782  1.00 25.26  ? 397  ARG A CG  1 
ATOM   1446 C  CD  . ARG A 1 193 ? 21.117  -5.695  19.686  1.00 22.71  ? 397  ARG A CD  1 
ATOM   1447 N  NE  . ARG A 1 193 ? 19.952  -4.890  20.063  1.00 22.98  ? 397  ARG A NE  1 
ATOM   1448 C  CZ  . ARG A 1 193 ? 20.008  -3.664  20.579  1.00 21.83  ? 397  ARG A CZ  1 
ATOM   1449 N  NH1 . ARG A 1 193 ? 21.184  -3.084  20.791  1.00 20.79  ? 397  ARG A NH1 1 
ATOM   1450 N  NH2 . ARG A 1 193 ? 18.884  -3.013  20.867  1.00 19.75  ? 397  ARG A NH2 1 
ATOM   1451 N  N   . PRO A 1 194 ? 25.152  -8.472  18.477  1.00 27.90  ? 398  PRO A N   1 
ATOM   1452 C  CA  . PRO A 1 194 ? 26.212  -9.488  18.388  1.00 28.18  ? 398  PRO A CA  1 
ATOM   1453 C  C   . PRO A 1 194 ? 25.658  -10.918 18.389  1.00 28.28  ? 398  PRO A C   1 
ATOM   1454 O  O   . PRO A 1 194 ? 24.716  -11.215 19.121  1.00 28.55  ? 398  PRO A O   1 
ATOM   1455 C  CB  . PRO A 1 194 ? 27.048  -9.249  19.658  1.00 28.43  ? 398  PRO A CB  1 
ATOM   1456 C  CG  . PRO A 1 194 ? 26.767  -7.830  20.052  1.00 27.65  ? 398  PRO A CG  1 
ATOM   1457 C  CD  . PRO A 1 194 ? 25.346  -7.564  19.627  1.00 27.64  ? 398  PRO A CD  1 
ATOM   1458 N  N   . GLY A 1 195 ? 26.219  -11.781 17.550  1.00 28.24  ? 399  GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 195 ? 25.866  -13.201 17.553  1.00 28.00  ? 399  GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 195 ? 24.580  -13.551 16.834  1.00 28.16  ? 399  GLY A C   1 
ATOM   1461 O  O   . GLY A 1 195 ? 24.196  -14.728 16.781  1.00 27.94  ? 399  GLY A O   1 
ATOM   1462 N  N   . LEU A 1 196 ? 23.908  -12.541 16.281  1.00 28.48  ? 400  LEU A N   1 
ATOM   1463 C  CA  . LEU A 1 196 ? 22.680  -12.778 15.513  1.00 28.79  ? 400  LEU A CA  1 
ATOM   1464 C  C   . LEU A 1 196 ? 22.955  -13.682 14.325  1.00 28.92  ? 400  LEU A C   1 
ATOM   1465 O  O   . LEU A 1 196 ? 23.983  -13.551 13.654  1.00 28.85  ? 400  LEU A O   1 
ATOM   1466 C  CB  . LEU A 1 196 ? 22.058  -11.479 15.001  1.00 28.68  ? 400  LEU A CB  1 
ATOM   1467 C  CG  . LEU A 1 196 ? 20.780  -10.905 15.610  1.00 29.52  ? 400  LEU A CG  1 
ATOM   1468 C  CD1 . LEU A 1 196 ? 20.272  -9.799  14.700  1.00 29.29  ? 400  LEU A CD1 1 
ATOM   1469 C  CD2 . LEU A 1 196 ? 19.680  -11.951 15.830  1.00 29.68  ? 400  LEU A CD2 1 
ATOM   1470 N  N   . MET A 1 197 ? 22.007  -14.573 14.065  1.00 28.78  ? 401  MET A N   1 
ATOM   1471 C  CA  . MET A 1 197 ? 22.135  -15.582 13.036  1.00 29.06  ? 401  MET A CA  1 
ATOM   1472 C  C   . MET A 1 197 ? 21.584  -15.093 11.695  1.00 28.40  ? 401  MET A C   1 
ATOM   1473 O  O   . MET A 1 197 ? 22.321  -15.009 10.722  1.00 28.85  ? 401  MET A O   1 
ATOM   1474 C  CB  . MET A 1 197 ? 21.409  -16.842 13.491  1.00 28.73  ? 401  MET A CB  1 
ATOM   1475 C  CG  . MET A 1 197 ? 21.953  -18.128 12.942  1.00 30.44  ? 401  MET A CG  1 
ATOM   1476 S  SD  . MET A 1 197 ? 21.005  -19.527 13.583  1.00 30.84  ? 401  MET A SD  1 
ATOM   1477 C  CE  . MET A 1 197 ? 19.390  -19.259 12.826  1.00 29.46  ? 401  MET A CE  1 
ATOM   1478 N  N   . ASN A 1 198 ? 20.291  -14.781 11.648  1.00 27.93  ? 402  ASN A N   1 
ATOM   1479 C  CA  . ASN A 1 198 ? 19.645  -14.324 10.422  1.00 27.60  ? 402  ASN A CA  1 
ATOM   1480 C  C   . ASN A 1 198 ? 19.528  -12.807 10.421  1.00 27.17  ? 402  ASN A C   1 
ATOM   1481 O  O   . ASN A 1 198 ? 18.439  -12.267 10.601  1.00 26.87  ? 402  ASN A O   1 
ATOM   1482 C  CB  . ASN A 1 198 ? 18.255  -14.965 10.262  1.00 27.41  ? 402  ASN A CB  1 
ATOM   1483 C  CG  . ASN A 1 198 ? 17.642  -14.735 8.863   1.00 27.97  ? 402  ASN A CG  1 
ATOM   1484 O  OD1 . ASN A 1 198 ? 18.056  -13.852 8.120   1.00 28.54  ? 402  ASN A OD1 1 
ATOM   1485 N  ND2 . ASN A 1 198 ? 16.637  -15.532 8.524   1.00 27.32  ? 402  ASN A ND2 1 
ATOM   1486 N  N   . VAL A 1 199 ? 20.658  -12.136 10.220  1.00 26.76  ? 403  VAL A N   1 
ATOM   1487 C  CA  . VAL A 1 199 ? 20.723  -10.671 10.159  1.00 26.45  ? 403  VAL A CA  1 
ATOM   1488 C  C   . VAL A 1 199 ? 19.799  -10.045 9.081   1.00 27.01  ? 403  VAL A C   1 
ATOM   1489 O  O   . VAL A 1 199 ? 19.047  -9.120  9.395   1.00 27.04  ? 403  VAL A O   1 
ATOM   1490 C  CB  . VAL A 1 199 ? 22.194  -10.183 10.006  1.00 25.93  ? 403  VAL A CB  1 
ATOM   1491 C  CG1 . VAL A 1 199 ? 22.278  -8.669  9.904   1.00 25.41  ? 403  VAL A CG1 1 
ATOM   1492 C  CG2 . VAL A 1 199 ? 23.046  -10.677 11.167  1.00 26.14  ? 403  VAL A CG2 1 
ATOM   1493 N  N   . PRO A 1 200 ? 19.838  -10.550 7.812   1.00 27.49  ? 404  PRO A N   1 
ATOM   1494 C  CA  . PRO A 1 200 ? 19.015  -9.914  6.771   1.00 27.45  ? 404  PRO A CA  1 
ATOM   1495 C  C   . PRO A 1 200 ? 17.503  -9.882  7.073   1.00 27.79  ? 404  PRO A C   1 
ATOM   1496 O  O   . PRO A 1 200 ? 16.840  -8.877  6.790   1.00 27.55  ? 404  PRO A O   1 
ATOM   1497 C  CB  . PRO A 1 200 ? 19.335  -10.741 5.512   1.00 27.75  ? 404  PRO A CB  1 
ATOM   1498 C  CG  . PRO A 1 200 ? 20.726  -11.307 5.793   1.00 27.51  ? 404  PRO A CG  1 
ATOM   1499 C  CD  . PRO A 1 200 ? 20.633  -11.668 7.253   1.00 27.27  ? 404  PRO A CD  1 
ATOM   1500 N  N   . ARG A 1 201 ? 16.972  -10.952 7.660   1.00 27.81  ? 405  ARG A N   1 
ATOM   1501 C  CA  . ARG A 1 201 ? 15.554  -11.008 8.025   1.00 27.95  ? 405  ARG A CA  1 
ATOM   1502 C  C   . ARG A 1 201 ? 15.217  -9.997  9.124   1.00 27.14  ? 405  ARG A C   1 
ATOM   1503 O  O   . ARG A 1 201 ? 14.218  -9.281  9.032   1.00 27.27  ? 405  ARG A O   1 
ATOM   1504 C  CB  . ARG A 1 201 ? 15.186  -12.428 8.476   1.00 28.62  ? 405  ARG A CB  1 
ATOM   1505 C  CG  . ARG A 1 201 ? 13.720  -12.666 8.823   1.00 31.16  ? 405  ARG A CG  1 
ATOM   1506 C  CD  . ARG A 1 201 ? 13.580  -14.084 9.366   1.00 35.72  ? 405  ARG A CD  1 
ATOM   1507 N  NE  . ARG A 1 201 ? 12.320  -14.736 9.000   1.00 39.44  ? 405  ARG A NE  1 
ATOM   1508 C  CZ  . ARG A 1 201 ? 11.995  -15.980 9.349   1.00 40.76  ? 405  ARG A CZ  1 
ATOM   1509 N  NH1 . ARG A 1 201 ? 12.825  -16.712 10.085  1.00 40.77  ? 405  ARG A NH1 1 
ATOM   1510 N  NH2 . ARG A 1 201 ? 10.833  -16.496 8.968   1.00 42.95  ? 405  ARG A NH2 1 
ATOM   1511 N  N   . VAL A 1 202 ? 16.050  -9.947  10.160  1.00 25.90  ? 406  VAL A N   1 
ATOM   1512 C  CA  . VAL A 1 202 ? 15.820  -9.043  11.275  1.00 24.89  ? 406  VAL A CA  1 
ATOM   1513 C  C   . VAL A 1 202 ? 15.910  -7.574  10.818  1.00 24.76  ? 406  VAL A C   1 
ATOM   1514 O  O   . VAL A 1 202 ? 15.067  -6.760  11.199  1.00 23.78  ? 406  VAL A O   1 
ATOM   1515 C  CB  . VAL A 1 202 ? 16.783  -9.343  12.476  1.00 25.04  ? 406  VAL A CB  1 
ATOM   1516 C  CG1 . VAL A 1 202 ? 16.621  -8.316  13.581  1.00 23.59  ? 406  VAL A CG1 1 
ATOM   1517 C  CG2 . VAL A 1 202 ? 16.543  -10.757 13.037  1.00 24.12  ? 406  VAL A CG2 1 
ATOM   1518 N  N   . GLU A 1 203 ? 16.920  -7.251  9.999   1.00 24.78  ? 407  GLU A N   1 
ATOM   1519 C  CA  . GLU A 1 203 ? 17.076  -5.895  9.441   1.00 25.74  ? 407  GLU A CA  1 
ATOM   1520 C  C   . GLU A 1 203 ? 15.847  -5.475  8.618   1.00 25.81  ? 407  GLU A C   1 
ATOM   1521 O  O   . GLU A 1 203 ? 15.456  -4.297  8.628   1.00 26.37  ? 407  GLU A O   1 
ATOM   1522 C  CB  . GLU A 1 203 ? 18.353  -5.768  8.588   1.00 25.91  ? 407  GLU A CB  1 
ATOM   1523 C  CG  . GLU A 1 203 ? 19.693  -5.833  9.338   1.00 26.70  ? 407  GLU A CG  1 
ATOM   1524 C  CD  . GLU A 1 203 ? 19.959  -4.643  10.263  1.00 30.36  ? 407  GLU A CD  1 
ATOM   1525 O  OE1 . GLU A 1 203 ? 21.107  -4.509  10.751  1.00 32.12  ? 407  GLU A OE1 1 
ATOM   1526 O  OE2 . GLU A 1 203 ? 19.035  -3.847  10.542  1.00 31.11  ? 407  GLU A OE2 1 
ATOM   1527 N  N   . ALA A 1 204 ? 15.249  -6.444  7.928   1.00 25.42  ? 408  ALA A N   1 
ATOM   1528 C  CA  . ALA A 1 204 ? 14.074  -6.218  7.074   1.00 25.60  ? 408  ALA A CA  1 
ATOM   1529 C  C   . ALA A 1 204 ? 12.825  -5.971  7.911   1.00 25.41  ? 408  ALA A C   1 
ATOM   1530 O  O   . ALA A 1 204 ? 12.074  -5.036  7.644   1.00 25.37  ? 408  ALA A O   1 
ATOM   1531 C  CB  . ALA A 1 204 ? 13.863  -7.398  6.152   1.00 25.79  ? 408  ALA A CB  1 
ATOM   1532 N  N   . ILE A 1 205 ? 12.616  -6.811  8.930   1.00 25.18  ? 409  ILE A N   1 
ATOM   1533 C  CA  . ILE A 1 205 ? 11.577  -6.573  9.935   1.00 24.82  ? 409  ILE A CA  1 
ATOM   1534 C  C   . ILE A 1 205 ? 11.740  -5.188  10.609  1.00 24.15  ? 409  ILE A C   1 
ATOM   1535 O  O   . ILE A 1 205 ? 10.764  -4.470  10.784  1.00 23.14  ? 409  ILE A O   1 
ATOM   1536 C  CB  . ILE A 1 205 ? 11.551  -7.679  11.028  1.00 24.67  ? 409  ILE A CB  1 
ATOM   1537 C  CG1 . ILE A 1 205 ? 11.369  -9.071  10.405  1.00 25.45  ? 409  ILE A CG1 1 
ATOM   1538 C  CG2 . ILE A 1 205 ? 10.460  -7.382  12.058  1.00 25.57  ? 409  ILE A CG2 1 
ATOM   1539 C  CD1 . ILE A 1 205 ? 11.598  -10.246 11.383  1.00 25.05  ? 409  ILE A CD1 1 
ATOM   1540 N  N   . GLN A 1 206 ? 12.967  -4.833  10.984  1.00 23.85  ? 410  GLN A N   1 
ATOM   1541 C  CA  . GLN A 1 206 ? 13.209  -3.591  11.705  1.00 24.44  ? 410  GLN A CA  1 
ATOM   1542 C  C   . GLN A 1 206 ? 12.921  -2.359  10.863  1.00 24.81  ? 410  GLN A C   1 
ATOM   1543 O  O   . GLN A 1 206 ? 12.368  -1.373  11.367  1.00 24.69  ? 410  GLN A O   1 
ATOM   1544 C  CB  . GLN A 1 206 ? 14.643  -3.517  12.257  1.00 24.36  ? 410  GLN A CB  1 
ATOM   1545 C  CG  . GLN A 1 206 ? 14.859  -2.293  13.173  1.00 24.61  ? 410  GLN A CG  1 
ATOM   1546 C  CD  . GLN A 1 206 ? 16.278  -2.160  13.688  1.00 24.53  ? 410  GLN A CD  1 
ATOM   1547 O  OE1 . GLN A 1 206 ? 17.224  -2.624  13.051  1.00 24.38  ? 410  GLN A OE1 1 
ATOM   1548 N  NE2 . GLN A 1 206 ? 16.438  -1.511  14.842  1.00 24.40  ? 410  GLN A NE2 1 
ATOM   1549 N  N   . ASP A 1 207 ? 13.304  -2.399  9.586   1.00 25.23  ? 411  ASP A N   1 
ATOM   1550 C  CA  . ASP A 1 207 ? 13.028  -1.258  8.699   1.00 25.84  ? 411  ASP A CA  1 
ATOM   1551 C  C   . ASP A 1 207 ? 11.519  -1.052  8.501   1.00 25.07  ? 411  ASP A C   1 
ATOM   1552 O  O   . ASP A 1 207 ? 11.038  0.079   8.489   1.00 24.83  ? 411  ASP A O   1 
ATOM   1553 C  CB  . ASP A 1 207 ? 13.770  -1.386  7.366   1.00 26.45  ? 411  ASP A CB  1 
ATOM   1554 C  CG  . ASP A 1 207 ? 15.103  -0.632  7.353   1.00 29.59  ? 411  ASP A CG  1 
ATOM   1555 O  OD1 . ASP A 1 207 ? 15.637  -0.295  8.437   1.00 32.20  ? 411  ASP A OD1 1 
ATOM   1556 O  OD2 . ASP A 1 207 ? 15.627  -0.385  6.239   1.00 32.68  ? 411  ASP A OD2 1 
ATOM   1557 N  N   . THR A 1 208 ? 10.783  -2.150  8.392   1.00 24.72  ? 412  THR A N   1 
ATOM   1558 C  CA  . THR A 1 208 ? 9.323   -2.104  8.317   1.00 25.16  ? 412  THR A CA  1 
ATOM   1559 C  C   . THR A 1 208 ? 8.729   -1.419  9.547   1.00 24.81  ? 412  THR A C   1 
ATOM   1560 O  O   . THR A 1 208 ? 7.841   -0.586  9.423   1.00 25.10  ? 412  THR A O   1 
ATOM   1561 C  CB  . THR A 1 208 ? 8.726   -3.515  8.185   1.00 24.95  ? 412  THR A CB  1 
ATOM   1562 O  OG1 . THR A 1 208 ? 9.322   -4.175  7.059   1.00 26.02  ? 412  THR A OG1 1 
ATOM   1563 C  CG2 . THR A 1 208 ? 7.211   -3.457  7.992   1.00 24.79  ? 412  THR A CG2 1 
ATOM   1564 N  N   . ILE A 1 209 ? 9.220   -1.791  10.730  1.00 24.54  ? 413  ILE A N   1 
ATOM   1565 C  CA  . ILE A 1 209 ? 8.814   -1.153  11.976  1.00 23.69  ? 413  ILE A CA  1 
ATOM   1566 C  C   . ILE A 1 209 ? 9.158   0.338   11.967  1.00 23.49  ? 413  ILE A C   1 
ATOM   1567 O  O   . ILE A 1 209 ? 8.333   1.166   12.348  1.00 23.63  ? 413  ILE A O   1 
ATOM   1568 C  CB  . ILE A 1 209 ? 9.445   -1.850  13.210  1.00 23.44  ? 413  ILE A CB  1 
ATOM   1569 C  CG1 . ILE A 1 209 ? 8.889   -3.278  13.374  1.00 23.50  ? 413  ILE A CG1 1 
ATOM   1570 C  CG2 . ILE A 1 209 ? 9.199   -1.033  14.457  1.00 22.99  ? 413  ILE A CG2 1 
ATOM   1571 C  CD1 . ILE A 1 209 ? 9.627   -4.135  14.411  1.00 23.54  ? 413  ILE A CD1 1 
ATOM   1572 N  N   . LEU A 1 210 ? 10.372  0.671   11.529  1.00 23.28  ? 414  LEU A N   1 
ATOM   1573 C  CA  . LEU A 1 210 ? 10.835  2.071   11.462  1.00 23.34  ? 414  LEU A CA  1 
ATOM   1574 C  C   . LEU A 1 210 ? 10.027  2.933   10.481  1.00 24.14  ? 414  LEU A C   1 
ATOM   1575 O  O   . LEU A 1 210 ? 9.644   4.062   10.806  1.00 23.98  ? 414  LEU A O   1 
ATOM   1576 C  CB  . LEU A 1 210 ? 12.333  2.128   11.142  1.00 22.88  ? 414  LEU A CB  1 
ATOM   1577 C  CG  . LEU A 1 210 ? 13.269  1.727   12.302  1.00 23.00  ? 414  LEU A CG  1 
ATOM   1578 C  CD1 . LEU A 1 210 ? 14.668  1.514   11.806  1.00 22.86  ? 414  LEU A CD1 1 
ATOM   1579 C  CD2 . LEU A 1 210 ? 13.261  2.761   13.416  1.00 21.26  ? 414  LEU A CD2 1 
ATOM   1580 N  N   . ARG A 1 211 ? 9.784   2.393   9.287   1.00 24.94  ? 415  ARG A N   1 
ATOM   1581 C  CA  . ARG A 1 211 ? 8.892   3.013   8.303   1.00 25.91  ? 415  ARG A CA  1 
ATOM   1582 C  C   . ARG A 1 211 ? 7.503   3.253   8.876   1.00 25.84  ? 415  ARG A C   1 
ATOM   1583 O  O   . ARG A 1 211 ? 6.952   4.349   8.720   1.00 25.72  ? 415  ARG A O   1 
ATOM   1584 C  CB  . ARG A 1 211 ? 8.800   2.158   7.037   1.00 26.01  ? 415  ARG A CB  1 
ATOM   1585 C  CG  . ARG A 1 211 ? 9.849   2.519   5.975   1.00 28.02  ? 415  ARG A CG  1 
ATOM   1586 C  CD  . ARG A 1 211 ? 9.652   1.736   4.667   1.00 27.26  ? 415  ARG A CD  1 
ATOM   1587 N  NE  . ARG A 1 211 ? 10.642  0.667   4.639   1.00 32.03  ? 415  ARG A NE  1 
ATOM   1588 C  CZ  . ARG A 1 211 ? 10.371  -0.631  4.727   1.00 31.20  ? 415  ARG A CZ  1 
ATOM   1589 N  NH1 . ARG A 1 211 ? 9.117   -1.062  4.791   1.00 29.80  ? 415  ARG A NH1 1 
ATOM   1590 N  NH2 . ARG A 1 211 ? 11.374  -1.494  4.726   1.00 31.53  ? 415  ARG A NH2 1 
ATOM   1591 N  N   . ALA A 1 212 ? 6.954   2.234   9.548   1.00 25.76  ? 416  ALA A N   1 
ATOM   1592 C  CA  . ALA A 1 212 ? 5.652   2.337   10.216  1.00 25.62  ? 416  ALA A CA  1 
ATOM   1593 C  C   . ALA A 1 212 ? 5.663   3.470   11.243  1.00 25.87  ? 416  ALA A C   1 
ATOM   1594 O  O   . ALA A 1 212 ? 4.744   4.308   11.256  1.00 25.35  ? 416  ALA A O   1 
ATOM   1595 C  CB  . ALA A 1 212 ? 5.288   1.026   10.872  1.00 26.05  ? 416  ALA A CB  1 
ATOM   1596 N  N   . LEU A 1 213 ? 6.719   3.501   12.070  1.00 25.37  ? 417  LEU A N   1 
ATOM   1597 C  CA  . LEU A 1 213 ? 6.933   4.561   13.051  1.00 25.58  ? 417  LEU A CA  1 
ATOM   1598 C  C   . LEU A 1 213 ? 6.937   5.955   12.416  1.00 26.26  ? 417  LEU A C   1 
ATOM   1599 O  O   . LEU A 1 213 ? 6.252   6.840   12.905  1.00 26.23  ? 417  LEU A O   1 
ATOM   1600 C  CB  . LEU A 1 213 ? 8.210   4.306   13.886  1.00 25.67  ? 417  LEU A CB  1 
ATOM   1601 C  CG  . LEU A 1 213 ? 8.663   5.359   14.918  1.00 25.25  ? 417  LEU A CG  1 
ATOM   1602 C  CD1 . LEU A 1 213 ? 7.643   5.544   16.031  1.00 25.81  ? 417  LEU A CD1 1 
ATOM   1603 C  CD2 . LEU A 1 213 ? 10.027  5.044   15.520  1.00 25.02  ? 417  LEU A CD2 1 
ATOM   1604 N  N   . GLU A 1 214 ? 7.690   6.146   11.329  1.00 27.40  ? 418  GLU A N   1 
ATOM   1605 C  CA  . GLU A 1 214 ? 7.694   7.435   10.624  1.00 28.01  ? 418  GLU A CA  1 
ATOM   1606 C  C   . GLU A 1 214 ? 6.322   7.778   10.060  1.00 28.45  ? 418  GLU A C   1 
ATOM   1607 O  O   . GLU A 1 214 ? 5.876   8.922   10.155  1.00 28.60  ? 418  GLU A O   1 
ATOM   1608 C  CB  . GLU A 1 214 ? 8.728   7.495   9.492   1.00 28.16  ? 418  GLU A CB  1 
ATOM   1609 C  CG  . GLU A 1 214 ? 8.762   8.908   8.870   1.00 28.49  ? 418  GLU A CG  1 
ATOM   1610 C  CD  . GLU A 1 214 ? 9.926   9.174   7.944   1.00 29.12  ? 418  GLU A CD  1 
ATOM   1611 O  OE1 . GLU A 1 214 ? 10.078  8.458   6.934   1.00 28.26  ? 418  GLU A OE1 1 
ATOM   1612 O  OE2 . GLU A 1 214 ? 10.668  10.143  8.216   1.00 30.76  ? 418  GLU A OE2 1 
ATOM   1613 N  N   . PHE A 1 215 ? 5.677   6.784   9.464   1.00 29.11  ? 419  PHE A N   1 
ATOM   1614 C  CA  . PHE A 1 215 ? 4.319   6.913   8.930   1.00 30.21  ? 419  PHE A CA  1 
ATOM   1615 C  C   . PHE A 1 215 ? 3.353   7.330   10.044  1.00 29.87  ? 419  PHE A C   1 
ATOM   1616 O  O   . PHE A 1 215 ? 2.451   8.136   9.827   1.00 29.81  ? 419  PHE A O   1 
ATOM   1617 C  CB  . PHE A 1 215 ? 3.899   5.571   8.291   1.00 31.26  ? 419  PHE A CB  1 
ATOM   1618 C  CG  . PHE A 1 215 ? 2.484   5.542   7.760   1.00 34.04  ? 419  PHE A CG  1 
ATOM   1619 C  CD1 . PHE A 1 215 ? 2.190   6.007   6.484   1.00 36.84  ? 419  PHE A CD1 1 
ATOM   1620 C  CD2 . PHE A 1 215 ? 1.446   5.017   8.535   1.00 37.58  ? 419  PHE A CD2 1 
ATOM   1621 C  CE1 . PHE A 1 215 ? 0.875   5.970   5.987   1.00 38.24  ? 419  PHE A CE1 1 
ATOM   1622 C  CE2 . PHE A 1 215 ? 0.129   4.983   8.060   1.00 38.40  ? 419  PHE A CE2 1 
ATOM   1623 C  CZ  . PHE A 1 215 ? -0.155  5.460   6.776   1.00 37.12  ? 419  PHE A CZ  1 
ATOM   1624 N  N   . HIS A 1 216 ? 3.559   6.785   11.242  1.00 29.49  ? 420  HIS A N   1 
ATOM   1625 C  CA  . HIS A 1 216 ? 2.659   7.038   12.367  1.00 28.90  ? 420  HIS A CA  1 
ATOM   1626 C  C   . HIS A 1 216 ? 2.876   8.425   12.957  1.00 28.88  ? 420  HIS A C   1 
ATOM   1627 O  O   . HIS A 1 216 ? 1.922   9.140   13.217  1.00 28.31  ? 420  HIS A O   1 
ATOM   1628 C  CB  . HIS A 1 216 ? 2.837   5.978   13.445  1.00 28.77  ? 420  HIS A CB  1 
ATOM   1629 C  CG  . HIS A 1 216 ? 1.963   6.179   14.640  1.00 28.15  ? 420  HIS A CG  1 
ATOM   1630 N  ND1 . HIS A 1 216 ? 0.596   5.987   14.605  1.00 27.41  ? 420  HIS A ND1 1 
ATOM   1631 C  CD2 . HIS A 1 216 ? 2.261   6.541   15.911  1.00 27.23  ? 420  HIS A CD2 1 
ATOM   1632 C  CE1 . HIS A 1 216 ? 0.094   6.219   15.805  1.00 26.02  ? 420  HIS A CE1 1 
ATOM   1633 N  NE2 . HIS A 1 216 ? 1.083   6.558   16.613  1.00 26.37  ? 420  HIS A NE2 1 
ATOM   1634 N  N   . LEU A 1 217 ? 4.138   8.791   13.150  1.00 28.83  ? 421  LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 217 ? 4.501   10.076  13.699  1.00 29.44  ? 421  LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 217 ? 4.012   11.240  12.849  1.00 30.35  ? 421  LEU A C   1 
ATOM   1637 O  O   . LEU A 1 217 ? 3.671   12.290  13.392  1.00 30.42  ? 421  LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 217 ? 6.021   10.163  13.888  1.00 29.52  ? 421  LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 217 ? 6.650   9.219   14.921  1.00 28.42  ? 421  LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 217 ? 8.166   9.247   14.800  1.00 26.35  ? 421  LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 217 ? 6.196   9.535   16.346  1.00 27.46  ? 421  LEU A CD2 1 
ATOM   1642 N  N   . GLN A 1 218 ? 3.999   11.058  11.524  1.00 31.74  ? 422  GLN A N   1 
ATOM   1643 C  CA  . GLN A 1 218 ? 3.443   12.048  10.584  1.00 33.05  ? 422  GLN A CA  1 
ATOM   1644 C  C   . GLN A 1 218 ? 1.951   12.307  10.844  1.00 33.33  ? 422  GLN A C   1 
ATOM   1645 O  O   . GLN A 1 218 ? 1.491   13.443  10.780  1.00 33.84  ? 422  GLN A O   1 
ATOM   1646 C  CB  . GLN A 1 218 ? 3.672   11.618  9.124   1.00 32.77  ? 422  GLN A CB  1 
ATOM   1647 C  CG  . GLN A 1 218 ? 5.151   11.496  8.717   1.00 34.07  ? 422  GLN A CG  1 
ATOM   1648 C  CD  . GLN A 1 218 ? 5.335   11.131  7.250   1.00 34.99  ? 422  GLN A CD  1 
ATOM   1649 O  OE1 . GLN A 1 218 ? 5.197   11.979  6.380   1.00 38.43  ? 422  GLN A OE1 1 
ATOM   1650 N  NE2 . GLN A 1 218 ? 5.663   9.863   6.972   1.00 37.39  ? 422  GLN A NE2 1 
ATOM   1651 N  N   . ALA A 1 219 ? 1.210   11.252  11.170  1.00 33.76  ? 423  ALA A N   1 
ATOM   1652 C  CA  . ALA A 1 219 ? -0.224  11.357  11.444  1.00 34.03  ? 423  ALA A CA  1 
ATOM   1653 C  C   . ALA A 1 219 ? -0.503  11.812  12.870  1.00 34.49  ? 423  ALA A C   1 
ATOM   1654 O  O   . ALA A 1 219 ? -1.393  12.628  13.097  1.00 34.70  ? 423  ALA A O   1 
ATOM   1655 C  CB  . ALA A 1 219 ? -0.918  10.027  11.165  1.00 34.05  ? 423  ALA A CB  1 
ATOM   1656 N  N   . ASN A 1 220 ? 0.274   11.298  13.824  1.00 34.84  ? 424  ASN A N   1 
ATOM   1657 C  CA  . ASN A 1 220 ? 0.045   11.557  15.252  1.00 35.22  ? 424  ASN A CA  1 
ATOM   1658 C  C   . ASN A 1 220 ? 0.636   12.874  15.743  1.00 35.22  ? 424  ASN A C   1 
ATOM   1659 O  O   . ASN A 1 220 ? 0.048   13.535  16.595  1.00 35.26  ? 424  ASN A O   1 
ATOM   1660 C  CB  . ASN A 1 220 ? 0.574   10.386  16.083  1.00 34.99  ? 424  ASN A CB  1 
ATOM   1661 C  CG  . ASN A 1 220 ? 0.042   10.376  17.507  1.00 35.69  ? 424  ASN A CG  1 
ATOM   1662 O  OD1 . ASN A 1 220 ? -0.928  11.061  17.837  1.00 34.77  ? 424  ASN A OD1 1 
ATOM   1663 N  ND2 . ASN A 1 220 ? 0.679   9.575   18.361  1.00 35.09  ? 424  ASN A ND2 1 
ATOM   1664 N  N   . HIS A 1 221 ? 1.800   13.242  15.204  1.00 35.55  ? 425  HIS A N   1 
ATOM   1665 C  CA  . HIS A 1 221 ? 2.471   14.499  15.522  1.00 35.77  ? 425  HIS A CA  1 
ATOM   1666 C  C   . HIS A 1 221 ? 2.715   15.294  14.224  1.00 36.66  ? 425  HIS A C   1 
ATOM   1667 O  O   . HIS A 1 221 ? 3.855   15.364  13.741  1.00 36.44  ? 425  HIS A O   1 
ATOM   1668 C  CB  . HIS A 1 221 ? 3.816   14.227  16.215  1.00 35.72  ? 425  HIS A CB  1 
ATOM   1669 C  CG  . HIS A 1 221 ? 3.716   13.402  17.462  1.00 34.54  ? 425  HIS A CG  1 
ATOM   1670 N  ND1 . HIS A 1 221 ? 3.782   13.953  18.724  1.00 33.94  ? 425  HIS A ND1 1 
ATOM   1671 C  CD2 . HIS A 1 221 ? 3.582   12.067  17.640  1.00 32.49  ? 425  HIS A CD2 1 
ATOM   1672 C  CE1 . HIS A 1 221 ? 3.673   12.994  19.626  1.00 34.12  ? 425  HIS A CE1 1 
ATOM   1673 N  NE2 . HIS A 1 221 ? 3.549   11.840  18.994  1.00 32.92  ? 425  HIS A NE2 1 
ATOM   1674 N  N   . PRO A 1 222 ? 1.651   15.899  13.652  1.00 37.32  ? 426  PRO A N   1 
ATOM   1675 C  CA  . PRO A 1 222 ? 1.789   16.505  12.317  1.00 38.03  ? 426  PRO A CA  1 
ATOM   1676 C  C   . PRO A 1 222 ? 2.712   17.727  12.287  1.00 38.71  ? 426  PRO A C   1 
ATOM   1677 O  O   . PRO A 1 222 ? 3.373   17.977  11.280  1.00 38.97  ? 426  PRO A O   1 
ATOM   1678 C  CB  . PRO A 1 222 ? 0.349   16.905  11.952  1.00 37.94  ? 426  PRO A CB  1 
ATOM   1679 C  CG  . PRO A 1 222 ? -0.538  16.203  12.954  1.00 37.91  ? 426  PRO A CG  1 
ATOM   1680 C  CD  . PRO A 1 222 ? 0.290   16.067  14.191  1.00 37.31  ? 426  PRO A CD  1 
ATOM   1681 N  N   . ASP A 1 223 ? 2.765   18.472  13.387  1.00 39.44  ? 427  ASP A N   1 
ATOM   1682 C  CA  . ASP A 1 223 ? 3.585   19.681  13.468  1.00 40.10  ? 427  ASP A CA  1 
ATOM   1683 C  C   . ASP A 1 223 ? 4.985   19.420  14.005  1.00 39.98  ? 427  ASP A C   1 
ATOM   1684 O  O   . ASP A 1 223 ? 5.782   20.354  14.161  1.00 40.09  ? 427  ASP A O   1 
ATOM   1685 C  CB  . ASP A 1 223 ? 2.890   20.730  14.342  1.00 40.69  ? 427  ASP A CB  1 
ATOM   1686 C  CG  . ASP A 1 223 ? 1.543   21.161  13.780  1.00 42.29  ? 427  ASP A CG  1 
ATOM   1687 O  OD1 . ASP A 1 223 ? 1.370   21.154  12.532  1.00 43.69  ? 427  ASP A OD1 1 
ATOM   1688 O  OD2 . ASP A 1 223 ? 0.660   21.514  14.592  1.00 44.23  ? 427  ASP A OD2 1 
ATOM   1689 N  N   . ALA A 1 224 ? 5.283   18.156  14.297  1.00 39.49  ? 428  ALA A N   1 
ATOM   1690 C  CA  . ALA A 1 224 ? 6.602   17.791  14.799  1.00 39.14  ? 428  ALA A CA  1 
ATOM   1691 C  C   . ALA A 1 224 ? 7.503   17.318  13.653  1.00 39.10  ? 428  ALA A C   1 
ATOM   1692 O  O   . ALA A 1 224 ? 7.804   16.119  13.497  1.00 38.74  ? 428  ALA A O   1 
ATOM   1693 C  CB  . ALA A 1 224 ? 6.501   16.748  15.914  1.00 39.11  ? 428  ALA A CB  1 
ATOM   1694 N  N   . GLN A 1 225 ? 7.903   18.277  12.825  1.00 38.51  ? 429  GLN A N   1 
ATOM   1695 C  CA  . GLN A 1 225 ? 8.956   18.043  11.861  1.00 38.37  ? 429  GLN A CA  1 
ATOM   1696 C  C   . GLN A 1 225 ? 10.244  17.798  12.651  1.00 37.89  ? 429  GLN A C   1 
ATOM   1697 O  O   . GLN A 1 225 ? 10.496  18.470  13.673  1.00 38.76  ? 429  GLN A O   1 
ATOM   1698 C  CB  . GLN A 1 225 ? 9.106   19.240  10.920  1.00 38.48  ? 429  GLN A CB  1 
ATOM   1699 N  N   . GLN A 1 226 ? 11.027  16.825  12.178  1.00 36.44  ? 430  GLN A N   1 
ATOM   1700 C  CA  . GLN A 1 226 ? 12.303  16.366  12.777  1.00 34.79  ? 430  GLN A CA  1 
ATOM   1701 C  C   . GLN A 1 226 ? 12.160  15.311  13.890  1.00 32.95  ? 430  GLN A C   1 
ATOM   1702 O  O   . GLN A 1 226 ? 13.166  14.887  14.450  1.00 32.63  ? 430  GLN A O   1 
ATOM   1703 C  CB  . GLN A 1 226 ? 13.218  17.525  13.241  1.00 35.11  ? 430  GLN A CB  1 
ATOM   1704 C  CG  . GLN A 1 226 ? 13.302  18.766  12.309  1.00 37.27  ? 430  GLN A CG  1 
ATOM   1705 C  CD  . GLN A 1 226 ? 14.014  18.520  10.986  1.00 39.65  ? 430  GLN A CD  1 
ATOM   1706 O  OE1 . GLN A 1 226 ? 14.626  17.467  10.774  1.00 40.26  ? 430  GLN A OE1 1 
ATOM   1707 N  NE2 . GLN A 1 226 ? 13.941  19.510  10.082  1.00 40.55  ? 430  GLN A NE2 1 
ATOM   1708 N  N   . LEU A 1 227 ? 10.935  14.880  14.195  1.00 30.82  ? 431  LEU A N   1 
ATOM   1709 C  CA  . LEU A 1 227 ? 10.701  13.921  15.295  1.00 29.28  ? 431  LEU A CA  1 
ATOM   1710 C  C   . LEU A 1 227 ? 11.289  12.528  15.037  1.00 28.36  ? 431  LEU A C   1 
ATOM   1711 O  O   . LEU A 1 227 ? 11.792  11.877  15.963  1.00 27.72  ? 431  LEU A O   1 
ATOM   1712 C  CB  . LEU A 1 227 ? 9.207   13.804  15.654  1.00 28.98  ? 431  LEU A CB  1 
ATOM   1713 C  CG  . LEU A 1 227 ? 8.836   12.988  16.913  1.00 29.86  ? 431  LEU A CG  1 
ATOM   1714 C  CD1 . LEU A 1 227 ? 9.630   13.435  18.160  1.00 28.60  ? 431  LEU A CD1 1 
ATOM   1715 C  CD2 . LEU A 1 227 ? 7.344   13.020  17.209  1.00 28.73  ? 431  LEU A CD2 1 
ATOM   1716 N  N   . PHE A 1 228 ? 11.218  12.073  13.787  1.00 26.96  ? 432  PHE A N   1 
ATOM   1717 C  CA  . PHE A 1 228 ? 11.757  10.759  13.435  1.00 25.89  ? 432  PHE A CA  1 
ATOM   1718 C  C   . PHE A 1 228 ? 13.296  10.680  13.608  1.00 25.80  ? 432  PHE A C   1 
ATOM   1719 O  O   . PHE A 1 228 ? 13.774  9.838   14.370  1.00 25.92  ? 432  PHE A O   1 
ATOM   1720 C  CB  . PHE A 1 228 ? 11.270  10.303  12.059  1.00 25.28  ? 432  PHE A CB  1 
ATOM   1721 C  CG  . PHE A 1 228 ? 11.730  8.932   11.684  1.00 24.10  ? 432  PHE A CG  1 
ATOM   1722 C  CD1 . PHE A 1 228 ? 11.232  7.812   12.346  1.00 22.53  ? 432  PHE A CD1 1 
ATOM   1723 C  CD2 . PHE A 1 228 ? 12.669  8.761   10.680  1.00 22.39  ? 432  PHE A CD2 1 
ATOM   1724 C  CE1 . PHE A 1 228 ? 11.655  6.534   12.002  1.00 23.19  ? 432  PHE A CE1 1 
ATOM   1725 C  CE2 . PHE A 1 228 ? 13.114  7.472   10.325  1.00 22.50  ? 432  PHE A CE2 1 
ATOM   1726 C  CZ  . PHE A 1 228 ? 12.598  6.364   10.984  1.00 23.24  ? 432  PHE A CZ  1 
ATOM   1727 N  N   . PRO A 1 229 ? 14.077  11.560  12.933  1.00 25.32  ? 433  PRO A N   1 
ATOM   1728 C  CA  . PRO A 1 229 ? 15.513  11.564  13.246  1.00 25.04  ? 433  PRO A CA  1 
ATOM   1729 C  C   . PRO A 1 229 ? 15.878  11.856  14.711  1.00 24.55  ? 433  PRO A C   1 
ATOM   1730 O  O   . PRO A 1 229 ? 16.917  11.394  15.161  1.00 25.18  ? 433  PRO A O   1 
ATOM   1731 C  CB  . PRO A 1 229 ? 16.090  12.656  12.330  1.00 24.91  ? 433  PRO A CB  1 
ATOM   1732 C  CG  . PRO A 1 229 ? 14.926  13.443  11.873  1.00 25.22  ? 433  PRO A CG  1 
ATOM   1733 C  CD  . PRO A 1 229 ? 13.758  12.511  11.853  1.00 25.46  ? 433  PRO A CD  1 
ATOM   1734 N  N   . LYS A 1 230 ? 15.065  12.638  15.424  1.00 23.77  ? 434  LYS A N   1 
ATOM   1735 C  CA  . LYS A 1 230 ? 15.267  12.866  16.864  1.00 23.33  ? 434  LYS A CA  1 
ATOM   1736 C  C   . LYS A 1 230 ? 15.198  11.558  17.639  1.00 22.35  ? 434  LYS A C   1 
ATOM   1737 O  O   . LYS A 1 230 ? 16.011  11.303  18.517  1.00 22.46  ? 434  LYS A O   1 
ATOM   1738 C  CB  . LYS A 1 230 ? 14.242  13.855  17.420  1.00 22.57  ? 434  LYS A CB  1 
ATOM   1739 C  CG  . LYS A 1 230 ? 14.709  15.289  17.350  1.00 24.70  ? 434  LYS A CG  1 
ATOM   1740 C  CD  . LYS A 1 230 ? 13.603  16.238  17.743  1.00 24.91  ? 434  LYS A CD  1 
ATOM   1741 C  CE  . LYS A 1 230 ? 14.036  17.666  17.546  1.00 25.87  ? 434  LYS A CE  1 
ATOM   1742 N  NZ  . LYS A 1 230 ? 12.857  18.585  17.586  1.00 29.95  ? 434  LYS A NZ  1 
ATOM   1743 N  N   . LEU A 1 231 ? 14.211  10.743  17.290  1.00 21.99  ? 435  LEU A N   1 
ATOM   1744 C  CA  . LEU A 1 231 ? 14.034  9.412   17.856  1.00 20.83  ? 435  LEU A CA  1 
ATOM   1745 C  C   . LEU A 1 231 ? 15.126  8.403   17.473  1.00 21.03  ? 435  LEU A C   1 
ATOM   1746 O  O   . LEU A 1 231 ? 15.499  7.570   18.298  1.00 20.55  ? 435  LEU A O   1 
ATOM   1747 C  CB  . LEU A 1 231 ? 12.648  8.872   17.520  1.00 20.88  ? 435  LEU A CB  1 
ATOM   1748 C  CG  . LEU A 1 231 ? 11.446  9.477   18.261  1.00 20.00  ? 435  LEU A CG  1 
ATOM   1749 C  CD1 . LEU A 1 231 ? 10.205  8.731   17.884  1.00 21.38  ? 435  LEU A CD1 1 
ATOM   1750 C  CD2 . LEU A 1 231 ? 11.637  9.430   19.785  1.00 20.78  ? 435  LEU A CD2 1 
ATOM   1751 N  N   . LEU A 1 232 ? 15.646  8.462   16.244  1.00 20.83  ? 436  LEU A N   1 
ATOM   1752 C  CA  . LEU A 1 232 ? 16.777  7.597   15.889  1.00 20.65  ? 436  LEU A CA  1 
ATOM   1753 C  C   . LEU A 1 232 ? 17.983  7.908   16.782  1.00 21.05  ? 436  LEU A C   1 
ATOM   1754 O  O   . LEU A 1 232 ? 18.711  7.000   17.171  1.00 21.04  ? 436  LEU A O   1 
ATOM   1755 C  CB  . LEU A 1 232 ? 17.158  7.702   14.409  1.00 20.56  ? 436  LEU A CB  1 
ATOM   1756 C  CG  . LEU A 1 232 ? 16.178  7.186   13.356  1.00 19.50  ? 436  LEU A CG  1 
ATOM   1757 C  CD1 . LEU A 1 232 ? 16.578  7.737   11.990  1.00 19.67  ? 436  LEU A CD1 1 
ATOM   1758 C  CD2 . LEU A 1 232 ? 16.117  5.637   13.335  1.00 19.92  ? 436  LEU A CD2 1 
ATOM   1759 N  N   . GLN A 1 233 ? 18.167  9.183   17.132  1.00 20.73  ? 437  GLN A N   1 
ATOM   1760 C  CA  . GLN A 1 233 ? 19.233  9.582   18.052  1.00 20.90  ? 437  GLN A CA  1 
ATOM   1761 C  C   . GLN A 1 233 ? 19.014  9.090   19.491  1.00 20.59  ? 437  GLN A C   1 
ATOM   1762 O  O   . GLN A 1 233 ? 19.967  8.731   20.160  1.00 20.34  ? 437  GLN A O   1 
ATOM   1763 C  CB  . GLN A 1 233 ? 19.418  11.107  18.045  1.00 21.42  ? 437  GLN A CB  1 
ATOM   1764 C  CG  . GLN A 1 233 ? 20.533  11.583  18.977  1.00 23.21  ? 437  GLN A CG  1 
ATOM   1765 C  CD  . GLN A 1 233 ? 21.903  11.199  18.471  1.00 25.50  ? 437  GLN A CD  1 
ATOM   1766 O  OE1 . GLN A 1 233 ? 22.674  10.510  19.152  1.00 26.81  ? 437  GLN A OE1 1 
ATOM   1767 N  NE2 . GLN A 1 233 ? 22.212  11.624  17.262  1.00 27.08  ? 437  GLN A NE2 1 
ATOM   1768 N  N   . LYS A 1 234 ? 17.763  9.092   19.955  1.00 21.01  ? 438  LYS A N   1 
ATOM   1769 C  CA  . LYS A 1 234 ? 17.402  8.536   21.271  1.00 21.12  ? 438  LYS A CA  1 
ATOM   1770 C  C   . LYS A 1 234 ? 17.733  7.039   21.357  1.00 21.31  ? 438  LYS A C   1 
ATOM   1771 O  O   . LYS A 1 234 ? 18.157  6.552   22.416  1.00 20.61  ? 438  LYS A O   1 
ATOM   1772 C  CB  . LYS A 1 234 ? 15.908  8.751   21.572  1.00 21.20  ? 438  LYS A CB  1 
ATOM   1773 C  CG  . LYS A 1 234 ? 15.490  10.216  21.758  1.00 22.60  ? 438  LYS A CG  1 
ATOM   1774 C  CD  . LYS A 1 234 ? 16.212  10.877  22.922  1.00 23.33  ? 438  LYS A CD  1 
ATOM   1775 C  CE  . LYS A 1 234 ? 15.819  12.341  23.028  1.00 24.28  ? 438  LYS A CE  1 
ATOM   1776 N  NZ  . LYS A 1 234 ? 16.755  13.035  23.933  1.00 23.40  ? 438  LYS A NZ  1 
ATOM   1777 N  N   . MET A 1 235 ? 17.553  6.321   20.245  1.00 21.47  ? 439  MET A N   1 
ATOM   1778 C  CA  . MET A 1 235 ? 17.952  4.897   20.167  1.00 22.34  ? 439  MET A CA  1 
ATOM   1779 C  C   . MET A 1 235 ? 19.471  4.775   20.358  1.00 21.75  ? 439  MET A C   1 
ATOM   1780 O  O   . MET A 1 235 ? 19.942  3.916   21.112  1.00 21.67  ? 439  MET A O   1 
ATOM   1781 C  CB  . MET A 1 235 ? 17.502  4.253   18.851  1.00 21.58  ? 439  MET A CB  1 
ATOM   1782 C  CG  . MET A 1 235 ? 15.980  4.084   18.730  1.00 23.26  ? 439  MET A CG  1 
ATOM   1783 S  SD  . MET A 1 235 ? 15.416  3.519   17.100  1.00 25.95  ? 439  MET A SD  1 
ATOM   1784 C  CE  . MET A 1 235 ? 15.875  1.790   17.157  1.00 24.03  ? 439  MET A CE  1 
ATOM   1785 N  N   . ALA A 1 236 ? 20.232  5.671   19.730  1.00 21.72  ? 440  ALA A N   1 
ATOM   1786 C  CA  . ALA A 1 236 ? 21.707  5.681   19.888  1.00 21.34  ? 440  ALA A CA  1 
ATOM   1787 C  C   . ALA A 1 236 ? 22.122  6.023   21.325  1.00 21.18  ? 440  ALA A C   1 
ATOM   1788 O  O   . ALA A 1 236 ? 22.986  5.373   21.889  1.00 20.90  ? 440  ALA A O   1 
ATOM   1789 C  CB  . ALA A 1 236 ? 22.347  6.648   18.902  1.00 21.41  ? 440  ALA A CB  1 
ATOM   1790 N  N   . ASP A 1 237 ? 21.498  7.061   21.891  1.00 21.69  ? 441  ASP A N   1 
ATOM   1791 C  CA  . ASP A 1 237 ? 21.670  7.454   23.288  1.00 21.72  ? 441  ASP A CA  1 
ATOM   1792 C  C   . ASP A 1 237 ? 21.376  6.298   24.275  1.00 21.71  ? 441  ASP A C   1 
ATOM   1793 O  O   . ASP A 1 237 ? 22.117  6.089   25.251  1.00 21.55  ? 441  ASP A O   1 
ATOM   1794 C  CB  . ASP A 1 237 ? 20.765  8.655   23.606  1.00 21.50  ? 441  ASP A CB  1 
ATOM   1795 C  CG  . ASP A 1 237 ? 21.135  9.916   22.810  1.00 22.96  ? 441  ASP A CG  1 
ATOM   1796 O  OD1 . ASP A 1 237 ? 22.210  9.963   22.155  1.00 22.51  ? 441  ASP A OD1 1 
ATOM   1797 O  OD2 . ASP A 1 237 ? 20.321  10.867  22.835  1.00 24.56  ? 441  ASP A OD2 1 
ATOM   1798 N  N   . LEU A 1 238 ? 20.283  5.576   24.030  1.00 20.92  ? 442  LEU A N   1 
ATOM   1799 C  CA  . LEU A 1 238 ? 19.921  4.415   24.850  1.00 20.46  ? 442  LEU A CA  1 
ATOM   1800 C  C   . LEU A 1 238 ? 20.960  3.305   24.817  1.00 20.77  ? 442  LEU A C   1 
ATOM   1801 O  O   . LEU A 1 238 ? 21.296  2.744   25.863  1.00 19.82  ? 442  LEU A O   1 
ATOM   1802 C  CB  . LEU A 1 238 ? 18.560  3.859   24.445  1.00 19.95  ? 442  LEU A CB  1 
ATOM   1803 C  CG  . LEU A 1 238 ? 17.372  4.622   25.020  1.00 19.06  ? 442  LEU A CG  1 
ATOM   1804 C  CD1 . LEU A 1 238 ? 16.120  4.290   24.205  1.00 19.94  ? 442  LEU A CD1 1 
ATOM   1805 C  CD2 . LEU A 1 238 ? 17.193  4.305   26.502  1.00 18.59  ? 442  LEU A CD2 1 
ATOM   1806 N  N   . ARG A 1 239 ? 21.458  2.987   23.623  1.00 20.62  ? 443  ARG A N   1 
ATOM   1807 C  CA  . ARG A 1 239 ? 22.580  2.054   23.503  1.00 21.81  ? 443  ARG A CA  1 
ATOM   1808 C  C   . ARG A 1 239 ? 23.789  2.453   24.376  1.00 21.32  ? 443  ARG A C   1 
ATOM   1809 O  O   . ARG A 1 239 ? 24.387  1.602   25.036  1.00 21.30  ? 443  ARG A O   1 
ATOM   1810 C  CB  . ARG A 1 239 ? 22.998  1.874   22.045  1.00 21.80  ? 443  ARG A CB  1 
ATOM   1811 C  CG  . ARG A 1 239 ? 23.948  0.680   21.877  1.00 26.22  ? 443  ARG A CG  1 
ATOM   1812 C  CD  . ARG A 1 239 ? 24.152  0.252   20.427  1.00 29.51  ? 443  ARG A CD  1 
ATOM   1813 N  NE  . ARG A 1 239 ? 22.915  -0.156  19.760  1.00 31.89  ? 443  ARG A NE  1 
ATOM   1814 C  CZ  . ARG A 1 239 ? 22.904  -0.802  18.601  1.00 33.02  ? 443  ARG A CZ  1 
ATOM   1815 N  NH1 . ARG A 1 239 ? 24.055  -1.105  18.019  1.00 32.68  ? 443  ARG A NH1 1 
ATOM   1816 N  NH2 . ARG A 1 239 ? 21.759  -1.144  18.024  1.00 33.67  ? 443  ARG A NH2 1 
ATOM   1817 N  N   . GLN A 1 240 ? 24.125  3.746   24.395  1.00 20.87  ? 444  GLN A N   1 
ATOM   1818 C  CA  . GLN A 1 240 ? 25.244  4.231   25.192  1.00 21.16  ? 444  GLN A CA  1 
ATOM   1819 C  C   . GLN A 1 240 ? 24.922  4.237   26.698  1.00 20.23  ? 444  GLN A C   1 
ATOM   1820 O  O   . GLN A 1 240 ? 25.793  3.960   27.516  1.00 19.31  ? 444  GLN A O   1 
ATOM   1821 C  CB  . GLN A 1 240 ? 25.700  5.617   24.700  1.00 21.62  ? 444  GLN A CB  1 
ATOM   1822 C  CG  . GLN A 1 240 ? 26.915  6.244   25.440  1.00 25.03  ? 444  GLN A CG  1 
ATOM   1823 C  CD  . GLN A 1 240 ? 28.209  5.418   25.357  1.00 28.92  ? 444  GLN A CD  1 
ATOM   1824 O  OE1 . GLN A 1 240 ? 29.001  5.392   26.307  1.00 31.17  ? 444  GLN A OE1 1 
ATOM   1825 N  NE2 . GLN A 1 240 ? 28.423  4.745   24.233  1.00 30.29  ? 444  GLN A NE2 1 
ATOM   1826 N  N   . LEU A 1 241 ? 23.670  4.542   27.046  1.00 20.52  ? 445  LEU A N   1 
ATOM   1827 C  CA  . LEU A 1 241 ? 23.229  4.552   28.453  1.00 20.26  ? 445  LEU A CA  1 
ATOM   1828 C  C   . LEU A 1 241 ? 23.236  3.133   29.030  1.00 20.42  ? 445  LEU A C   1 
ATOM   1829 O  O   . LEU A 1 241 ? 23.539  2.930   30.204  1.00 19.73  ? 445  LEU A O   1 
ATOM   1830 C  CB  . LEU A 1 241 ? 21.846  5.217   28.590  1.00 20.46  ? 445  LEU A CB  1 
ATOM   1831 C  CG  . LEU A 1 241 ? 21.187  5.458   29.963  1.00 20.93  ? 445  LEU A CG  1 
ATOM   1832 C  CD1 . LEU A 1 241 ? 21.764  6.696   30.710  1.00 21.79  ? 445  LEU A CD1 1 
ATOM   1833 C  CD2 . LEU A 1 241 ? 19.700  5.582   29.777  1.00 19.85  ? 445  LEU A CD2 1 
ATOM   1834 N  N   . VAL A 1 242 ? 22.925  2.152   28.192  1.00 20.53  ? 446  VAL A N   1 
ATOM   1835 C  CA  . VAL A 1 242 ? 23.036  0.747   28.588  1.00 20.89  ? 446  VAL A CA  1 
ATOM   1836 C  C   . VAL A 1 242 ? 24.499  0.251   28.711  1.00 21.58  ? 446  VAL A C   1 
ATOM   1837 O  O   . VAL A 1 242 ? 24.823  -0.534  29.618  1.00 21.49  ? 446  VAL A O   1 
ATOM   1838 C  CB  . VAL A 1 242 ? 22.206  -0.149  27.658  1.00 20.98  ? 446  VAL A CB  1 
ATOM   1839 C  CG1 . VAL A 1 242 ? 22.474  -1.617  27.941  1.00 19.81  ? 446  VAL A CG1 1 
ATOM   1840 C  CG2 . VAL A 1 242 ? 20.708  0.150   27.850  1.00 19.79  ? 446  VAL A CG2 1 
ATOM   1841 N  N   . THR A 1 243 ? 25.372  0.695   27.800  1.00 22.13  ? 447  THR A N   1 
ATOM   1842 C  CA  . THR A 1 243 ? 26.815  0.376   27.891  1.00 22.66  ? 447  THR A CA  1 
ATOM   1843 C  C   . THR A 1 243 ? 27.390  0.835   29.240  1.00 22.30  ? 447  THR A C   1 
ATOM   1844 O  O   . THR A 1 243 ? 28.076  0.072   29.930  1.00 22.10  ? 447  THR A O   1 
ATOM   1845 C  CB  . THR A 1 243 ? 27.617  0.975   26.714  1.00 22.49  ? 447  THR A CB  1 
ATOM   1846 O  OG1 . THR A 1 243 ? 27.176  0.389   25.488  1.00 24.07  ? 447  THR A OG1 1 
ATOM   1847 C  CG2 . THR A 1 243 ? 29.107  0.698   26.867  1.00 24.08  ? 447  THR A CG2 1 
ATOM   1848 N  N   . GLU A 1 244 ? 27.091  2.078   29.613  1.00 22.08  ? 448  GLU A N   1 
ATOM   1849 C  CA  . GLU A 1 244 ? 27.484  2.612   30.913  1.00 22.56  ? 448  GLU A CA  1 
ATOM   1850 C  C   . GLU A 1 244 ? 26.857  1.869   32.083  1.00 21.96  ? 448  GLU A C   1 
ATOM   1851 O  O   . GLU A 1 244 ? 27.523  1.623   33.084  1.00 21.45  ? 448  GLU A O   1 
ATOM   1852 C  CB  . GLU A 1 244 ? 27.145  4.097   30.984  1.00 22.99  ? 448  GLU A CB  1 
ATOM   1853 C  CG  . GLU A 1 244 ? 27.952  4.886   29.963  1.00 26.22  ? 448  GLU A CG  1 
ATOM   1854 C  CD  . GLU A 1 244 ? 27.331  6.206   29.598  1.00 29.57  ? 448  GLU A CD  1 
ATOM   1855 O  OE1 . GLU A 1 244 ? 26.191  6.495   30.054  1.00 33.05  ? 448  GLU A OE1 1 
ATOM   1856 O  OE2 . GLU A 1 244 ? 27.983  6.948   28.840  1.00 30.11  ? 448  GLU A OE2 1 
ATOM   1857 N  N   . HIS A 1 245 ? 25.585  1.491   31.949  1.00 21.90  ? 449  HIS A N   1 
ATOM   1858 C  CA  . HIS A 1 245 ? 24.896  0.752   33.003  1.00 22.14  ? 449  HIS A CA  1 
ATOM   1859 C  C   . HIS A 1 245 ? 25.517  -0.635  33.229  1.00 22.48  ? 449  HIS A C   1 
ATOM   1860 O  O   . HIS A 1 245 ? 25.734  -1.048  34.380  1.00 21.37  ? 449  HIS A O   1 
ATOM   1861 C  CB  . HIS A 1 245 ? 23.380  0.669   32.718  1.00 21.70  ? 449  HIS A CB  1 
ATOM   1862 C  CG  . HIS A 1 245 ? 22.621  -0.158  33.710  1.00 21.32  ? 449  HIS A CG  1 
ATOM   1863 N  ND1 . HIS A 1 245 ? 22.279  0.306   34.962  1.00 20.66  ? 449  HIS A ND1 1 
ATOM   1864 C  CD2 . HIS A 1 245 ? 22.147  -1.427  33.637  1.00 21.32  ? 449  HIS A CD2 1 
ATOM   1865 C  CE1 . HIS A 1 245 ? 21.620  -0.636  35.615  1.00 21.38  ? 449  HIS A CE1 1 
ATOM   1866 N  NE2 . HIS A 1 245 ? 21.537  -1.702  34.838  1.00 21.68  ? 449  HIS A NE2 1 
ATOM   1867 N  N   . ALA A 1 246 ? 25.819  -1.342  32.137  1.00 23.41  ? 450  ALA A N   1 
ATOM   1868 C  CA  . ALA A 1 246 ? 26.444  -2.669  32.236  1.00 24.46  ? 450  ALA A CA  1 
ATOM   1869 C  C   . ALA A 1 246 ? 27.824  -2.621  32.927  1.00 25.28  ? 450  ALA A C   1 
ATOM   1870 O  O   . ALA A 1 246 ? 28.182  -3.541  33.660  1.00 24.84  ? 450  ALA A O   1 
ATOM   1871 C  CB  . ALA A 1 246 ? 26.529  -3.351  30.861  1.00 24.47  ? 450  ALA A CB  1 
ATOM   1872 N  N   . GLN A 1 247 ? 28.567  -1.536  32.709  1.00 26.38  ? 451  GLN A N   1 
ATOM   1873 C  CA  . GLN A 1 247 ? 29.868  -1.322  33.359  1.00 27.90  ? 451  GLN A CA  1 
ATOM   1874 C  C   . GLN A 1 247 ? 29.696  -1.070  34.869  1.00 28.22  ? 451  GLN A C   1 
ATOM   1875 O  O   . GLN A 1 247 ? 30.464  -1.592  35.691  1.00 27.67  ? 451  GLN A O   1 
ATOM   1876 C  CB  . GLN A 1 247 ? 30.619  -0.158  32.692  1.00 27.87  ? 451  GLN A CB  1 
ATOM   1877 C  CG  . GLN A 1 247 ? 31.170  -0.469  31.294  1.00 29.40  ? 451  GLN A CG  1 
ATOM   1878 C  CD  . GLN A 1 247 ? 31.481  0.776   30.459  1.00 29.81  ? 451  GLN A CD  1 
ATOM   1879 O  OE1 . GLN A 1 247 ? 31.417  1.913   30.942  1.00 34.04  ? 451  GLN A OE1 1 
ATOM   1880 N  NE2 . GLN A 1 247 ? 31.824  0.560   29.195  1.00 32.48  ? 451  GLN A NE2 1 
ATOM   1881 N  N   . MET A 1 248 ? 28.681  -0.278  35.225  1.00 28.87  ? 452  MET A N   1 
ATOM   1882 C  CA  . MET A 1 248 ? 28.326  -0.052  36.626  1.00 30.43  ? 452  MET A CA  1 
ATOM   1883 C  C   . MET A 1 248 ? 27.964  -1.379  37.311  1.00 29.67  ? 452  MET A C   1 
ATOM   1884 O  O   . MET A 1 248 ? 28.423  -1.663  38.431  1.00 29.53  ? 452  MET A O   1 
ATOM   1885 C  CB  . MET A 1 248 ? 27.163  0.933   36.730  1.00 30.26  ? 452  MET A CB  1 
ATOM   1886 C  CG  . MET A 1 248 ? 27.531  2.371   36.326  1.00 32.85  ? 452  MET A CG  1 
ATOM   1887 S  SD  . MET A 1 248 ? 26.314  3.653   36.754  1.00 35.59  ? 452  MET A SD  1 
ATOM   1888 C  CE  . MET A 1 248 ? 25.104  3.489   35.442  1.00 35.81  ? 452  MET A CE  1 
ATOM   1889 N  N   . MET A 1 249 ? 27.146  -2.175  36.627  1.00 28.58  ? 453  MET A N   1 
ATOM   1890 C  CA  . MET A 1 249 ? 26.704  -3.475  37.119  1.00 28.98  ? 453  MET A CA  1 
ATOM   1891 C  C   . MET A 1 249 ? 27.863  -4.448  37.349  1.00 29.06  ? 453  MET A C   1 
ATOM   1892 O  O   . MET A 1 249 ? 27.848  -5.198  38.315  1.00 28.86  ? 453  MET A O   1 
ATOM   1893 C  CB  . MET A 1 249 ? 25.656  -4.085  36.184  1.00 28.49  ? 453  MET A CB  1 
ATOM   1894 C  CG  . MET A 1 249 ? 24.308  -3.359  36.200  1.00 27.14  ? 453  MET A CG  1 
ATOM   1895 S  SD  . MET A 1 249 ? 23.559  -3.265  37.847  1.00 26.56  ? 453  MET A SD  1 
ATOM   1896 C  CE  . MET A 1 249 ? 22.769  -4.876  37.882  1.00 26.74  ? 453  MET A CE  1 
ATOM   1897 N  N   . GLN A 1 250 ? 28.858  -4.413  36.465  1.00 29.69  ? 454  GLN A N   1 
ATOM   1898 C  CA  . GLN A 1 250 ? 30.058  -5.245  36.588  1.00 30.53  ? 454  GLN A CA  1 
ATOM   1899 C  C   . GLN A 1 250 ? 30.938  -4.826  37.766  1.00 30.57  ? 454  GLN A C   1 
ATOM   1900 O  O   . GLN A 1 250 ? 31.520  -5.683  38.439  1.00 29.77  ? 454  GLN A O   1 
ATOM   1901 C  CB  . GLN A 1 250 ? 30.866  -5.214  35.295  1.00 30.88  ? 454  GLN A CB  1 
ATOM   1902 C  CG  . GLN A 1 250 ? 30.311  -6.150  34.218  1.00 34.28  ? 454  GLN A CG  1 
ATOM   1903 C  CD  . GLN A 1 250 ? 30.784  -5.796  32.825  1.00 38.12  ? 454  GLN A CD  1 
ATOM   1904 O  OE1 . GLN A 1 250 ? 31.475  -4.790  32.620  1.00 39.04  ? 454  GLN A OE1 1 
ATOM   1905 N  NE2 . GLN A 1 250 ? 30.409  -6.622  31.849  1.00 39.58  ? 454  GLN A NE2 1 
ATOM   1906 N  N   . ARG A 1 251 ? 31.036  -3.513  37.992  1.00 30.75  ? 455  ARG A N   1 
ATOM   1907 C  CA  . ARG A 1 251 ? 31.726  -2.957  39.157  1.00 32.37  ? 455  ARG A CA  1 
ATOM   1908 C  C   . ARG A 1 251 ? 31.091  -3.434  40.475  1.00 31.64  ? 455  ARG A C   1 
ATOM   1909 O  O   . ARG A 1 251 ? 31.795  -3.920  41.370  1.00 31.72  ? 455  ARG A O   1 
ATOM   1910 C  CB  . ARG A 1 251 ? 31.746  -1.421  39.091  1.00 32.12  ? 455  ARG A CB  1 
ATOM   1911 C  CG  . ARG A 1 251 ? 33.128  -0.798  38.866  1.00 34.56  ? 455  ARG A CG  1 
ATOM   1912 C  CD  . ARG A 1 251 ? 33.067  0.741   38.631  1.00 35.08  ? 455  ARG A CD  1 
ATOM   1913 N  NE  . ARG A 1 251 ? 32.924  1.056   37.208  1.00 41.38  ? 455  ARG A NE  1 
ATOM   1914 C  CZ  . ARG A 1 251 ? 31.960  1.801   36.667  1.00 42.41  ? 455  ARG A CZ  1 
ATOM   1915 N  NH1 . ARG A 1 251 ? 31.029  2.376   37.419  1.00 44.29  ? 455  ARG A NH1 1 
ATOM   1916 N  NH2 . ARG A 1 251 ? 31.943  1.986   35.353  1.00 43.93  ? 455  ARG A NH2 1 
ATOM   1917 N  N   . ILE A 1 252 ? 29.767  -3.291  40.582  1.00 31.28  ? 456  ILE A N   1 
ATOM   1918 C  CA  . ILE A 1 252 ? 28.997  -3.819  41.711  1.00 30.84  ? 456  ILE A CA  1 
ATOM   1919 C  C   . ILE A 1 252 ? 29.300  -5.312  41.926  1.00 31.34  ? 456  ILE A C   1 
ATOM   1920 O  O   . ILE A 1 252 ? 29.602  -5.724  43.045  1.00 30.79  ? 456  ILE A O   1 
ATOM   1921 C  CB  . ILE A 1 252 ? 27.451  -3.584  41.544  1.00 30.75  ? 456  ILE A CB  1 
ATOM   1922 C  CG1 . ILE A 1 252 ? 27.090  -2.095  41.705  1.00 30.16  ? 456  ILE A CG1 1 
ATOM   1923 C  CG2 . ILE A 1 252 ? 26.646  -4.417  42.545  1.00 30.54  ? 456  ILE A CG2 1 
ATOM   1924 C  CD1 . ILE A 1 252 ? 25.685  -1.730  41.238  1.00 30.18  ? 456  ILE A CD1 1 
ATOM   1925 N  N   . LYS A 1 253 ? 29.225  -6.113  40.864  1.00 31.62  ? 457  LYS A N   1 
ATOM   1926 C  CA  . LYS A 1 253 ? 29.530  -7.550  40.962  1.00 32.79  ? 457  LYS A CA  1 
ATOM   1927 C  C   . LYS A 1 253 ? 30.918  -7.792  41.573  1.00 33.39  ? 457  LYS A C   1 
ATOM   1928 O  O   . LYS A 1 253 ? 31.098  -8.694  42.396  1.00 33.54  ? 457  LYS A O   1 
ATOM   1929 C  CB  . LYS A 1 253 ? 29.438  -8.220  39.591  1.00 32.72  ? 457  LYS A CB  1 
ATOM   1930 C  CG  . LYS A 1 253 ? 29.805  -9.703  39.581  1.00 34.23  ? 457  LYS A CG  1 
ATOM   1931 C  CD  . LYS A 1 253 ? 30.244  -10.149 38.198  1.00 37.37  ? 457  LYS A CD  1 
ATOM   1932 C  CE  . LYS A 1 253 ? 31.047  -11.448 38.248  1.00 39.76  ? 457  LYS A CE  1 
ATOM   1933 N  NZ  . LYS A 1 253 ? 30.175  -12.645 38.412  1.00 40.93  ? 457  LYS A NZ  1 
ATOM   1934 N  N   . LYS A 1 254 ? 31.878  -6.961  41.175  1.00 33.88  ? 458  LYS A N   1 
ATOM   1935 C  CA  . LYS A 1 254 ? 33.270  -7.093  41.596  1.00 34.71  ? 458  LYS A CA  1 
ATOM   1936 C  C   . LYS A 1 254 ? 33.527  -6.596  43.029  1.00 34.68  ? 458  LYS A C   1 
ATOM   1937 O  O   . LYS A 1 254 ? 34.295  -7.223  43.768  1.00 34.46  ? 458  LYS A O   1 
ATOM   1938 C  CB  . LYS A 1 254 ? 34.182  -6.378  40.588  1.00 35.03  ? 458  LYS A CB  1 
ATOM   1939 C  CG  . LYS A 1 254 ? 35.678  -6.394  40.914  1.00 37.44  ? 458  LYS A CG  1 
ATOM   1940 C  CD  . LYS A 1 254 ? 36.513  -6.630  39.651  1.00 41.33  ? 458  LYS A CD  1 
ATOM   1941 C  CE  . LYS A 1 254 ? 36.681  -8.137  39.351  1.00 43.71  ? 458  LYS A CE  1 
ATOM   1942 N  NZ  . LYS A 1 254 ? 37.575  -8.406  38.173  1.00 44.36  ? 458  LYS A NZ  1 
ATOM   1943 N  N   . THR A 1 255 ? 32.885  -5.486  43.415  1.00 34.30  ? 459  THR A N   1 
ATOM   1944 C  CA  . THR A 1 255 ? 33.175  -4.827  44.693  1.00 34.32  ? 459  THR A CA  1 
ATOM   1945 C  C   . THR A 1 255 ? 32.114  -4.969  45.803  1.00 34.09  ? 459  THR A C   1 
ATOM   1946 O  O   . THR A 1 255 ? 32.437  -4.830  46.985  1.00 34.03  ? 459  THR A O   1 
ATOM   1947 C  CB  . THR A 1 255 ? 33.486  -3.332  44.499  1.00 34.50  ? 459  THR A CB  1 
ATOM   1948 O  OG1 . THR A 1 255 ? 32.296  -2.654  44.081  1.00 35.45  ? 459  THR A OG1 1 
ATOM   1949 C  CG2 . THR A 1 255 ? 34.593  -3.135  43.449  1.00 34.42  ? 459  THR A CG2 1 
ATOM   1950 N  N   . GLU A 1 256 ? 30.867  -5.246  45.432  1.00 33.72  ? 460  GLU A N   1 
ATOM   1951 C  CA  . GLU A 1 256 ? 29.792  -5.463  46.404  1.00 33.45  ? 460  GLU A CA  1 
ATOM   1952 C  C   . GLU A 1 256 ? 29.449  -6.958  46.509  1.00 34.05  ? 460  GLU A C   1 
ATOM   1953 O  O   . GLU A 1 256 ? 28.401  -7.409  46.028  1.00 34.02  ? 460  GLU A O   1 
ATOM   1954 C  CB  . GLU A 1 256 ? 28.553  -4.635  46.023  1.00 33.33  ? 460  GLU A CB  1 
ATOM   1955 C  CG  . GLU A 1 256 ? 28.755  -3.109  46.039  1.00 31.42  ? 460  GLU A CG  1 
ATOM   1956 C  CD  . GLU A 1 256 ? 28.935  -2.546  47.447  1.00 29.59  ? 460  GLU A CD  1 
ATOM   1957 O  OE1 . GLU A 1 256 ? 28.403  -3.140  48.406  1.00 29.38  ? 460  GLU A OE1 1 
ATOM   1958 O  OE2 . GLU A 1 256 ? 29.611  -1.509  47.600  1.00 29.18  ? 460  GLU A OE2 1 
ATOM   1959 N  N   . THR A 1 257 ? 30.337  -7.716  47.145  1.00 34.53  ? 461  THR A N   1 
ATOM   1960 C  CA  . THR A 1 257 ? 30.284  -9.188  47.137  1.00 35.54  ? 461  THR A CA  1 
ATOM   1961 C  C   . THR A 1 257 ? 29.180  -9.793  48.026  1.00 35.66  ? 461  THR A C   1 
ATOM   1962 O  O   . THR A 1 257 ? 28.812  -10.955 47.850  1.00 36.51  ? 461  THR A O   1 
ATOM   1963 C  CB  . THR A 1 257 ? 31.675  -9.830  47.476  1.00 35.93  ? 461  THR A CB  1 
ATOM   1964 O  OG1 . THR A 1 257 ? 32.076  -9.468  48.812  1.00 36.65  ? 461  THR A OG1 1 
ATOM   1965 C  CG2 . THR A 1 257 ? 32.746  -9.380  46.470  1.00 35.29  ? 461  THR A CG2 1 
ATOM   1966 N  N   . GLU A 1 258 ? 28.650  -9.010  48.963  1.00 35.41  ? 462  GLU A N   1 
ATOM   1967 C  CA  . GLU A 1 258 ? 27.469  -9.423  49.728  1.00 34.80  ? 462  GLU A CA  1 
ATOM   1968 C  C   . GLU A 1 258 ? 26.144  -9.080  49.022  1.00 34.38  ? 462  GLU A C   1 
ATOM   1969 O  O   . GLU A 1 258 ? 25.071  -9.475  49.492  1.00 33.82  ? 462  GLU A O   1 
ATOM   1970 C  CB  . GLU A 1 258 ? 27.498  -8.824  51.131  1.00 35.10  ? 462  GLU A CB  1 
ATOM   1971 N  N   . THR A 1 259 ? 26.227  -8.340  47.911  1.00 33.73  ? 463  THR A N   1 
ATOM   1972 C  CA  . THR A 1 259 ? 25.051  -7.972  47.109  1.00 33.22  ? 463  THR A CA  1 
ATOM   1973 C  C   . THR A 1 259 ? 24.687  -9.071  46.089  1.00 32.95  ? 463  THR A C   1 
ATOM   1974 O  O   . THR A 1 259 ? 25.489  -9.422  45.218  1.00 32.21  ? 463  THR A O   1 
ATOM   1975 C  CB  . THR A 1 259 ? 25.237  -6.590  46.409  1.00 33.21  ? 463  THR A CB  1 
ATOM   1976 O  OG1 . THR A 1 259 ? 25.502  -5.581  47.394  1.00 33.21  ? 463  THR A OG1 1 
ATOM   1977 C  CG2 . THR A 1 259 ? 23.995  -6.188  45.648  1.00 32.56  ? 463  THR A CG2 1 
ATOM   1978 N  N   . SER A 1 260 ? 23.472  -9.599  46.225  1.00 32.90  ? 464  SER A N   1 
ATOM   1979 C  CA  . SER A 1 260 ? 22.932  -10.641 45.342  1.00 33.20  ? 464  SER A CA  1 
ATOM   1980 C  C   . SER A 1 260 ? 22.409  -10.082 44.010  1.00 32.69  ? 464  SER A C   1 
ATOM   1981 O  O   . SER A 1 260 ? 21.811  -9.009  43.974  1.00 32.51  ? 464  SER A O   1 
ATOM   1982 C  CB  . SER A 1 260 ? 21.821  -11.409 46.064  1.00 33.19  ? 464  SER A CB  1 
ATOM   1983 O  OG  . SER A 1 260 ? 21.323  -12.464 45.261  1.00 35.39  ? 464  SER A OG  1 
ATOM   1984 N  N   . LEU A 1 261 ? 22.648  -10.817 42.924  1.00 32.50  ? 465  LEU A N   1 
ATOM   1985 C  CA  . LEU A 1 261 ? 22.201  -10.416 41.575  1.00 32.08  ? 465  LEU A CA  1 
ATOM   1986 C  C   . LEU A 1 261 ? 21.435  -11.556 40.898  1.00 31.09  ? 465  LEU A C   1 
ATOM   1987 O  O   . LEU A 1 261 ? 21.952  -12.659 40.803  1.00 31.43  ? 465  LEU A O   1 
ATOM   1988 C  CB  . LEU A 1 261 ? 23.407  -9.971  40.728  1.00 32.24  ? 465  LEU A CB  1 
ATOM   1989 C  CG  . LEU A 1 261 ? 23.276  -9.631  39.233  1.00 33.03  ? 465  LEU A CG  1 
ATOM   1990 C  CD1 . LEU A 1 261 ? 22.382  -8.421  38.962  1.00 34.04  ? 465  LEU A CD1 1 
ATOM   1991 C  CD2 . LEU A 1 261 ? 24.654  -9.398  38.632  1.00 32.88  ? 465  LEU A CD2 1 
ATOM   1992 N  N   . HIS A 1 262 ? 20.199  -11.281 40.463  1.00 30.01  ? 466  HIS A N   1 
ATOM   1993 C  CA  . HIS A 1 262 ? 19.295  -12.272 39.845  1.00 28.70  ? 466  HIS A CA  1 
ATOM   1994 C  C   . HIS A 1 262 ? 20.002  -13.020 38.722  1.00 27.91  ? 466  HIS A C   1 
ATOM   1995 O  O   . HIS A 1 262 ? 20.672  -12.388 37.908  1.00 27.62  ? 466  HIS A O   1 
ATOM   1996 C  CB  . HIS A 1 262 ? 18.049  -11.569 39.285  1.00 28.56  ? 466  HIS A CB  1 
ATOM   1997 C  CG  . HIS A 1 262 ? 16.910  -12.491 38.963  1.00 28.92  ? 466  HIS A CG  1 
ATOM   1998 N  ND1 . HIS A 1 262 ? 16.913  -13.336 37.873  1.00 28.85  ? 466  HIS A ND1 1 
ATOM   1999 C  CD2 . HIS A 1 262 ? 15.720  -12.682 39.579  1.00 28.68  ? 466  HIS A CD2 1 
ATOM   2000 C  CE1 . HIS A 1 262 ? 15.783  -14.017 37.841  1.00 28.55  ? 466  HIS A CE1 1 
ATOM   2001 N  NE2 . HIS A 1 262 ? 15.042  -13.640 38.867  1.00 27.74  ? 466  HIS A NE2 1 
ATOM   2002 N  N   . PRO A 1 263 ? 19.863  -14.367 38.676  1.00 27.23  ? 467  PRO A N   1 
ATOM   2003 C  CA  . PRO A 1 263 ? 20.572  -15.171 37.657  1.00 26.72  ? 467  PRO A CA  1 
ATOM   2004 C  C   . PRO A 1 263 ? 20.313  -14.709 36.205  1.00 26.36  ? 467  PRO A C   1 
ATOM   2005 O  O   . PRO A 1 263 ? 21.251  -14.667 35.404  1.00 26.25  ? 467  PRO A O   1 
ATOM   2006 C  CB  . PRO A 1 263 ? 20.045  -16.601 37.889  1.00 26.61  ? 467  PRO A CB  1 
ATOM   2007 C  CG  . PRO A 1 263 ? 19.497  -16.604 39.274  1.00 26.89  ? 467  PRO A CG  1 
ATOM   2008 C  CD  . PRO A 1 263 ? 19.033  -15.205 39.567  1.00 27.20  ? 467  PRO A CD  1 
ATOM   2009 N  N   . LEU A 1 264 ? 19.068  -14.349 35.883  1.00 26.48  ? 468  LEU A N   1 
ATOM   2010 C  CA  . LEU A 1 264 ? 18.724  -13.788 34.562  1.00 26.39  ? 468  LEU A CA  1 
ATOM   2011 C  C   . LEU A 1 264 ? 19.569  -12.554 34.234  1.00 27.18  ? 468  LEU A C   1 
ATOM   2012 O  O   . LEU A 1 264 ? 20.067  -12.418 33.118  1.00 27.09  ? 468  LEU A O   1 
ATOM   2013 C  CB  . LEU A 1 264 ? 17.230  -13.436 34.474  1.00 26.07  ? 468  LEU A CB  1 
ATOM   2014 C  CG  . LEU A 1 264 ? 16.727  -12.914 33.122  1.00 26.15  ? 468  LEU A CG  1 
ATOM   2015 C  CD1 . LEU A 1 264 ? 16.673  -14.045 32.113  1.00 26.47  ? 468  LEU A CD1 1 
ATOM   2016 C  CD2 . LEU A 1 264 ? 15.374  -12.260 33.258  1.00 25.72  ? 468  LEU A CD2 1 
ATOM   2017 N  N   . LEU A 1 265 ? 19.743  -11.667 35.213  1.00 28.12  ? 469  LEU A N   1 
ATOM   2018 C  CA  . LEU A 1 265 ? 20.569  -10.467 35.009  1.00 29.31  ? 469  LEU A CA  1 
ATOM   2019 C  C   . LEU A 1 265 ? 22.052  -10.803 34.817  1.00 29.83  ? 469  LEU A C   1 
ATOM   2020 O  O   . LEU A 1 265 ? 22.713  -10.219 33.960  1.00 29.69  ? 469  LEU A O   1 
ATOM   2021 C  CB  . LEU A 1 265 ? 20.357  -9.447  36.138  1.00 29.36  ? 469  LEU A CB  1 
ATOM   2022 C  CG  . LEU A 1 265 ? 19.271  -8.351  36.044  1.00 30.19  ? 469  LEU A CG  1 
ATOM   2023 C  CD1 . LEU A 1 265 ? 18.176  -8.608  35.037  1.00 28.93  ? 469  LEU A CD1 1 
ATOM   2024 C  CD2 . LEU A 1 265 ? 18.677  -8.094  37.406  1.00 29.69  ? 469  LEU A CD2 1 
ATOM   2025 N  N   . GLN A 1 266 ? 22.568  -11.756 35.593  1.00 31.05  ? 470  GLN A N   1 
ATOM   2026 C  CA  . GLN A 1 266 ? 23.938  -12.264 35.377  1.00 32.58  ? 470  GLN A CA  1 
ATOM   2027 C  C   . GLN A 1 266 ? 24.142  -12.744 33.921  1.00 32.44  ? 470  GLN A C   1 
ATOM   2028 O  O   . GLN A 1 266 ? 25.190  -12.501 33.322  1.00 32.54  ? 470  GLN A O   1 
ATOM   2029 C  CB  . GLN A 1 266 ? 24.272  -13.407 36.348  1.00 32.47  ? 470  GLN A CB  1 
ATOM   2030 C  CG  . GLN A 1 266 ? 24.586  -13.002 37.798  1.00 34.17  ? 470  GLN A CG  1 
ATOM   2031 C  CD  . GLN A 1 266 ? 24.628  -14.210 38.752  1.00 34.50  ? 470  GLN A CD  1 
ATOM   2032 O  OE1 . GLN A 1 266 ? 25.258  -15.231 38.458  1.00 38.64  ? 470  GLN A OE1 1 
ATOM   2033 N  NE2 . GLN A 1 266 ? 23.955  -14.092 39.892  1.00 35.64  ? 470  GLN A NE2 1 
ATOM   2034 N  N   . GLU A 1 267 ? 23.137  -13.423 33.369  1.00 32.90  ? 471  GLU A N   1 
ATOM   2035 C  CA  . GLU A 1 267 ? 23.199  -13.949 31.997  1.00 33.63  ? 471  GLU A CA  1 
ATOM   2036 C  C   . GLU A 1 267 ? 23.165  -12.844 30.939  1.00 33.50  ? 471  GLU A C   1 
ATOM   2037 O  O   . GLU A 1 267 ? 23.829  -12.948 29.903  1.00 33.58  ? 471  GLU A O   1 
ATOM   2038 C  CB  . GLU A 1 267 ? 22.076  -14.959 31.748  1.00 33.72  ? 471  GLU A CB  1 
ATOM   2039 C  CG  . GLU A 1 267 ? 22.212  -16.270 32.531  1.00 36.28  ? 471  GLU A CG  1 
ATOM   2040 C  CD  . GLU A 1 267 ? 23.269  -17.220 31.972  1.00 38.87  ? 471  GLU A CD  1 
ATOM   2041 O  OE1 . GLU A 1 267 ? 23.092  -18.447 32.128  1.00 42.19  ? 471  GLU A OE1 1 
ATOM   2042 O  OE2 . GLU A 1 267 ? 24.274  -16.765 31.384  1.00 39.98  ? 471  GLU A OE2 1 
ATOM   2043 N  N   . ILE A 1 268 ? 22.394  -11.790 31.199  1.00 33.45  ? 472  ILE A N   1 
ATOM   2044 C  CA  . ILE A 1 268 ? 22.368  -10.631 30.308  1.00 33.40  ? 472  ILE A CA  1 
ATOM   2045 C  C   . ILE A 1 268 ? 23.733  -9.940  30.237  1.00 33.99  ? 472  ILE A C   1 
ATOM   2046 O  O   . ILE A 1 268 ? 24.260  -9.716  29.153  1.00 34.25  ? 472  ILE A O   1 
ATOM   2047 C  CB  . ILE A 1 268 ? 21.234  -9.627  30.665  1.00 32.80  ? 472  ILE A CB  1 
ATOM   2048 C  CG1 . ILE A 1 268 ? 19.872  -10.235 30.326  1.00 31.78  ? 472  ILE A CG1 1 
ATOM   2049 C  CG2 . ILE A 1 268 ? 21.401  -8.331  29.879  1.00 32.84  ? 472  ILE A CG2 1 
ATOM   2050 C  CD1 . ILE A 1 268 ? 18.685  -9.554  30.971  1.00 28.96  ? 472  ILE A CD1 1 
ATOM   2051 N  N   . TYR A 1 269 ? 24.313  -9.625  31.390  1.00 34.81  ? 473  TYR A N   1 
ATOM   2052 C  CA  . TYR A 1 269 ? 25.501  -8.757  31.444  1.00 35.60  ? 473  TYR A CA  1 
ATOM   2053 C  C   . TYR A 1 269 ? 26.815  -9.463  31.131  1.00 36.74  ? 473  TYR A C   1 
ATOM   2054 O  O   . TYR A 1 269 ? 27.822  -8.812  30.838  1.00 36.48  ? 473  TYR A O   1 
ATOM   2055 C  CB  . TYR A 1 269 ? 25.583  -8.017  32.785  1.00 35.17  ? 473  TYR A CB  1 
ATOM   2056 C  CG  . TYR A 1 269 ? 24.480  -7.000  32.952  1.00 34.73  ? 473  TYR A CG  1 
ATOM   2057 C  CD1 . TYR A 1 269 ? 24.371  -5.916  32.083  1.00 34.32  ? 473  TYR A CD1 1 
ATOM   2058 C  CD2 . TYR A 1 269 ? 23.539  -7.126  33.968  1.00 34.14  ? 473  TYR A CD2 1 
ATOM   2059 C  CE1 . TYR A 1 269 ? 23.353  -4.987  32.223  1.00 34.16  ? 473  TYR A CE1 1 
ATOM   2060 C  CE2 . TYR A 1 269 ? 22.515  -6.196  34.117  1.00 33.02  ? 473  TYR A CE2 1 
ATOM   2061 C  CZ  . TYR A 1 269 ? 22.433  -5.134  33.245  1.00 33.65  ? 473  TYR A CZ  1 
ATOM   2062 O  OH  . TYR A 1 269 ? 21.428  -4.215  33.389  1.00 34.07  ? 473  TYR A OH  1 
ATOM   2063 N  N   . LYS A 1 270 ? 26.792  -10.790 31.208  1.00 38.28  ? 474  LYS A N   1 
ATOM   2064 C  CA  . LYS A 1 270 ? 27.888  -11.631 30.738  1.00 39.89  ? 474  LYS A CA  1 
ATOM   2065 C  C   . LYS A 1 270 ? 28.163  -11.321 29.259  1.00 40.72  ? 474  LYS A C   1 
ATOM   2066 O  O   . LYS A 1 270 ? 27.227  -11.263 28.438  1.00 41.24  ? 474  LYS A O   1 
ATOM   2067 C  CB  . LYS A 1 270 ? 27.502  -13.101 30.923  1.00 39.96  ? 474  LYS A CB  1 
ATOM   2068 C  CG  . LYS A 1 270 ? 28.582  -14.104 30.584  1.00 40.72  ? 474  LYS A CG  1 
ATOM   2069 C  CD  . LYS A 1 270 ? 28.066  -15.524 30.762  1.00 42.33  ? 474  LYS A CD  1 
ATOM   2070 C  CE  . LYS A 1 270 ? 27.124  -15.930 29.646  1.00 42.68  ? 474  LYS A CE  1 
ATOM   2071 N  NZ  . LYS A 1 270 ? 26.481  -17.253 29.908  1.00 43.87  ? 474  LYS A NZ  1 
ATOM   2072 N  N   . ASP A 1 271 ? 29.436  -11.097 28.928  1.00 41.31  ? 475  ASP A N   1 
ATOM   2073 C  CA  . ASP A 1 271 ? 29.870  -10.766 27.555  1.00 42.22  ? 475  ASP A CA  1 
ATOM   2074 C  C   . ASP A 1 271 ? 29.758  -9.278  27.172  1.00 42.35  ? 475  ASP A C   1 
ATOM   2075 O  O   . ASP A 1 271 ? 30.182  -8.896  26.078  1.00 42.82  ? 475  ASP A O   1 
ATOM   2076 C  CB  . ASP A 1 271 ? 29.151  -11.613 26.478  1.00 42.44  ? 475  ASP A CB  1 
ATOM   2077 C  CG  . ASP A 1 271 ? 29.033  -13.084 26.847  1.00 43.52  ? 475  ASP A CG  1 
ATOM   2078 O  OD1 . ASP A 1 271 ? 29.921  -13.629 27.544  1.00 44.49  ? 475  ASP A OD1 1 
ATOM   2079 O  OD2 . ASP A 1 271 ? 28.027  -13.692 26.431  1.00 45.28  ? 475  ASP A OD2 1 
ATOM   2080 N  N   . MET A 1 272 ? 29.189  -8.443  28.040  1.00 42.47  ? 476  MET A N   1 
ATOM   2081 C  CA  . MET A 1 272 ? 29.088  -7.008  27.738  1.00 42.53  ? 476  MET A CA  1 
ATOM   2082 C  C   . MET A 1 272 ? 30.314  -6.254  28.243  1.00 42.72  ? 476  MET A C   1 
ATOM   2083 O  O   . MET A 1 272 ? 30.818  -5.349  27.569  1.00 42.98  ? 476  MET A O   1 
ATOM   2084 C  CB  . MET A 1 272 ? 27.798  -6.395  28.308  1.00 42.47  ? 476  MET A CB  1 
ATOM   2085 C  CG  . MET A 1 272 ? 26.523  -6.777  27.550  1.00 42.19  ? 476  MET A CG  1 
ATOM   2086 S  SD  . MET A 1 272 ? 25.037  -5.873  28.059  1.00 42.73  ? 476  MET A SD  1 
ATOM   2087 C  CE  . MET A 1 272 ? 23.791  -6.907  27.292  1.00 42.38  ? 476  MET A CE  1 
ATOM   2088 N  N   . ASN B 1 1   ? -6.819  -42.865 42.729  1.00 42.40  ? 205  ASN B N   1 
ATOM   2089 C  CA  . ASN B 1 1   ? -5.604  -42.116 43.168  1.00 42.49  ? 205  ASN B CA  1 
ATOM   2090 C  C   . ASN B 1 1   ? -5.536  -40.715 42.550  1.00 42.58  ? 205  ASN B C   1 
ATOM   2091 O  O   . ASN B 1 1   ? -5.581  -40.572 41.320  1.00 42.50  ? 205  ASN B O   1 
ATOM   2092 C  CB  . ASN B 1 1   ? -4.325  -42.908 42.849  1.00 42.52  ? 205  ASN B CB  1 
ATOM   2093 C  CG  . ASN B 1 1   ? -3.087  -42.318 43.510  1.00 42.98  ? 205  ASN B CG  1 
ATOM   2094 O  OD1 . ASN B 1 1   ? -2.788  -42.602 44.677  1.00 42.84  ? 205  ASN B OD1 1 
ATOM   2095 N  ND2 . ASN B 1 1   ? -2.351  -41.497 42.762  1.00 43.50  ? 205  ASN B ND2 1 
ATOM   2096 N  N   . PRO B 1 2   ? -5.425  -39.674 43.403  1.00 42.60  ? 206  PRO B N   1 
ATOM   2097 C  CA  . PRO B 1 2   ? -5.370  -38.285 42.922  1.00 42.17  ? 206  PRO B CA  1 
ATOM   2098 C  C   . PRO B 1 2   ? -4.248  -38.035 41.909  1.00 41.68  ? 206  PRO B C   1 
ATOM   2099 O  O   . PRO B 1 2   ? -4.536  -37.500 40.831  1.00 41.25  ? 206  PRO B O   1 
ATOM   2100 C  CB  . PRO B 1 2   ? -5.156  -37.467 44.208  1.00 42.46  ? 206  PRO B CB  1 
ATOM   2101 C  CG  . PRO B 1 2   ? -5.698  -38.335 45.306  1.00 42.44  ? 206  PRO B CG  1 
ATOM   2102 C  CD  . PRO B 1 2   ? -5.360  -39.744 44.877  1.00 42.53  ? 206  PRO B CD  1 
ATOM   2103 N  N   . GLN B 1 3   ? -3.004  -38.424 42.244  1.00 40.90  ? 207  GLN B N   1 
ATOM   2104 C  CA  . GLN B 1 3   ? -1.836  -38.198 41.368  1.00 40.03  ? 207  GLN B CA  1 
ATOM   2105 C  C   . GLN B 1 3   ? -1.987  -38.882 40.022  1.00 39.32  ? 207  GLN B C   1 
ATOM   2106 O  O   . GLN B 1 3   ? -1.805  -38.240 38.997  1.00 38.85  ? 207  GLN B O   1 
ATOM   2107 C  CB  . GLN B 1 3   ? -0.502  -38.627 42.014  1.00 40.13  ? 207  GLN B CB  1 
ATOM   2108 C  CG  . GLN B 1 3   ? 0.733   -38.290 41.132  1.00 40.58  ? 207  GLN B CG  1 
ATOM   2109 C  CD  . GLN B 1 3   ? 2.085   -38.707 41.722  1.00 39.84  ? 207  GLN B CD  1 
ATOM   2110 O  OE1 . GLN B 1 3   ? 2.520   -38.192 42.755  1.00 40.38  ? 207  GLN B OE1 1 
ATOM   2111 N  NE2 . GLN B 1 3   ? 2.763   -39.619 41.045  1.00 39.09  ? 207  GLN B NE2 1 
ATOM   2112 N  N   . VAL B 1 4   ? -2.317  -40.180 40.040  1.00 38.72  ? 208  VAL B N   1 
ATOM   2113 C  CA  . VAL B 1 4   ? -2.461  -40.991 38.828  1.00 38.18  ? 208  VAL B CA  1 
ATOM   2114 C  C   . VAL B 1 4   ? -3.551  -40.442 37.910  1.00 37.95  ? 208  VAL B C   1 
ATOM   2115 O  O   . VAL B 1 4   ? -3.420  -40.498 36.682  1.00 37.93  ? 208  VAL B O   1 
ATOM   2116 C  CB  . VAL B 1 4   ? -2.731  -42.497 39.148  1.00 38.34  ? 208  VAL B CB  1 
ATOM   2117 C  CG1 . VAL B 1 4   ? -3.015  -43.300 37.873  1.00 38.27  ? 208  VAL B CG1 1 
ATOM   2118 C  CG2 . VAL B 1 4   ? -1.551  -43.108 39.891  1.00 38.80  ? 208  VAL B CG2 1 
ATOM   2119 N  N   . ALA B 1 5   ? -4.620  -39.913 38.501  1.00 37.39  ? 209  ALA B N   1 
ATOM   2120 C  CA  . ALA B 1 5   ? -5.693  -39.316 37.717  1.00 37.08  ? 209  ALA B CA  1 
ATOM   2121 C  C   . ALA B 1 5   ? -5.277  -37.985 37.074  1.00 36.99  ? 209  ALA B C   1 
ATOM   2122 O  O   . ALA B 1 5   ? -5.606  -37.733 35.912  1.00 36.80  ? 209  ALA B O   1 
ATOM   2123 C  CB  . ALA B 1 5   ? -6.965  -39.146 38.561  1.00 37.36  ? 209  ALA B CB  1 
ATOM   2124 N  N   . ASP B 1 6   ? -4.569  -37.121 37.802  1.00 36.36  ? 210  ASP B N   1 
ATOM   2125 C  CA  . ASP B 1 6   ? -4.191  -35.840 37.178  1.00 36.34  ? 210  ASP B CA  1 
ATOM   2126 C  C   . ASP B 1 6   ? -2.922  -35.895 36.301  1.00 35.48  ? 210  ASP B C   1 
ATOM   2127 O  O   . ASP B 1 6   ? -2.698  -35.009 35.474  1.00 35.39  ? 210  ASP B O   1 
ATOM   2128 C  CB  . ASP B 1 6   ? -4.246  -34.633 38.144  1.00 36.74  ? 210  ASP B CB  1 
ATOM   2129 C  CG  . ASP B 1 6   ? -3.416  -34.822 39.393  1.00 38.74  ? 210  ASP B CG  1 
ATOM   2130 O  OD1 . ASP B 1 6   ? -2.266  -35.300 39.282  1.00 40.32  ? 210  ASP B OD1 1 
ATOM   2131 O  OD2 . ASP B 1 6   ? -3.915  -34.458 40.493  1.00 39.94  ? 210  ASP B OD2 1 
ATOM   2132 N  N   . LEU B 1 7   ? -2.129  -36.951 36.472  1.00 34.70  ? 211  LEU B N   1 
ATOM   2133 C  CA  . LEU B 1 7   ? -1.045  -37.297 35.556  1.00 34.08  ? 211  LEU B CA  1 
ATOM   2134 C  C   . LEU B 1 7   ? -1.588  -37.720 34.201  1.00 33.67  ? 211  LEU B C   1 
ATOM   2135 O  O   . LEU B 1 7   ? -0.963  -37.465 33.170  1.00 33.78  ? 211  LEU B O   1 
ATOM   2136 C  CB  . LEU B 1 7   ? -0.193  -38.426 36.138  1.00 33.89  ? 211  LEU B CB  1 
ATOM   2137 C  CG  . LEU B 1 7   ? 1.171   -38.030 36.725  1.00 34.78  ? 211  LEU B CG  1 
ATOM   2138 C  CD1 . LEU B 1 7   ? 1.175   -36.621 37.355  1.00 33.53  ? 211  LEU B CD1 1 
ATOM   2139 C  CD2 . LEU B 1 7   ? 1.670   -39.080 37.699  1.00 33.68  ? 211  LEU B CD2 1 
ATOM   2140 N  N   . LYS B 1 8   ? -2.747  -38.373 34.220  1.00 33.26  ? 212  LYS B N   1 
ATOM   2141 C  CA  . LYS B 1 8   ? -3.464  -38.779 33.013  1.00 32.99  ? 212  LYS B CA  1 
ATOM   2142 C  C   . LYS B 1 8   ? -3.965  -37.573 32.193  1.00 32.51  ? 212  LYS B C   1 
ATOM   2143 O  O   . LYS B 1 8   ? -3.897  -37.578 30.955  1.00 32.37  ? 212  LYS B O   1 
ATOM   2144 C  CB  . LYS B 1 8   ? -4.616  -39.714 33.380  1.00 33.21  ? 212  LYS B CB  1 
ATOM   2145 C  CG  . LYS B 1 8   ? -5.217  -40.441 32.203  1.00 34.93  ? 212  LYS B CG  1 
ATOM   2146 C  CD  . LYS B 1 8   ? -6.544  -41.085 32.563  1.00 37.70  ? 212  LYS B CD  1 
ATOM   2147 C  CE  . LYS B 1 8   ? -7.056  -41.941 31.411  1.00 38.93  ? 212  LYS B CE  1 
ATOM   2148 N  NZ  . LYS B 1 8   ? -8.360  -42.582 31.753  1.00 41.21  ? 212  LYS B NZ  1 
ATOM   2149 N  N   . ALA B 1 9   ? -4.457  -36.549 32.887  1.00 31.73  ? 213  ALA B N   1 
ATOM   2150 C  CA  . ALA B 1 9   ? -4.834  -35.270 32.262  1.00 31.01  ? 213  ALA B CA  1 
ATOM   2151 C  C   . ALA B 1 9   ? -3.621  -34.539 31.643  1.00 30.36  ? 213  ALA B C   1 
ATOM   2152 O  O   . ALA B 1 9   ? -3.701  -33.998 30.539  1.00 30.38  ? 213  ALA B O   1 
ATOM   2153 C  CB  . ALA B 1 9   ? -5.522  -34.385 33.283  1.00 30.86  ? 213  ALA B CB  1 
ATOM   2154 N  N   . PHE B 1 10  ? -2.518  -34.533 32.387  1.00 29.66  ? 214  PHE B N   1 
ATOM   2155 C  CA  . PHE B 1 10  ? -1.209  -34.023 31.960  1.00 28.35  ? 214  PHE B CA  1 
ATOM   2156 C  C   . PHE B 1 10  ? -0.674  -34.747 30.702  1.00 27.85  ? 214  PHE B C   1 
ATOM   2157 O  O   . PHE B 1 10  ? -0.264  -34.091 29.736  1.00 27.07  ? 214  PHE B O   1 
ATOM   2158 C  CB  . PHE B 1 10  ? -0.252  -34.145 33.153  1.00 28.19  ? 214  PHE B CB  1 
ATOM   2159 C  CG  . PHE B 1 10  ? 1.115   -33.558 32.937  1.00 28.86  ? 214  PHE B CG  1 
ATOM   2160 C  CD1 . PHE B 1 10  ? 2.223   -34.387 32.817  1.00 28.25  ? 214  PHE B CD1 1 
ATOM   2161 C  CD2 . PHE B 1 10  ? 1.307   -32.178 32.896  1.00 29.97  ? 214  PHE B CD2 1 
ATOM   2162 C  CE1 . PHE B 1 10  ? 3.507   -33.856 32.637  1.00 29.86  ? 214  PHE B CE1 1 
ATOM   2163 C  CE2 . PHE B 1 10  ? 2.595   -31.633 32.711  1.00 29.32  ? 214  PHE B CE2 1 
ATOM   2164 C  CZ  . PHE B 1 10  ? 3.691   -32.472 32.586  1.00 28.90  ? 214  PHE B CZ  1 
ATOM   2165 N  N   . SER B 1 11  ? -0.690  -36.087 30.715  1.00 26.81  ? 215  SER B N   1 
ATOM   2166 C  CA  . SER B 1 11  ? -0.282  -36.891 29.564  1.00 26.27  ? 215  SER B CA  1 
ATOM   2167 C  C   . SER B 1 11  ? -1.118  -36.619 28.309  1.00 26.40  ? 215  SER B C   1 
ATOM   2168 O  O   . SER B 1 11  ? -0.594  -36.599 27.193  1.00 25.13  ? 215  SER B O   1 
ATOM   2169 C  CB  . SER B 1 11  ? -0.361  -38.384 29.887  1.00 26.20  ? 215  SER B CB  1 
ATOM   2170 O  OG  . SER B 1 11  ? 0.451   -38.698 30.998  1.00 27.11  ? 215  SER B OG  1 
ATOM   2171 N  N   . LYS B 1 12  ? -2.423  -36.434 28.489  1.00 26.30  ? 216  LYS B N   1 
ATOM   2172 C  CA  . LYS B 1 12  ? -3.291  -36.167 27.361  1.00 26.58  ? 216  LYS B CA  1 
ATOM   2173 C  C   . LYS B 1 12  ? -2.965  -34.796 26.749  1.00 26.23  ? 216  LYS B C   1 
ATOM   2174 O  O   . LYS B 1 12  ? -3.003  -34.639 25.525  1.00 25.33  ? 216  LYS B O   1 
ATOM   2175 C  CB  . LYS B 1 12  ? -4.761  -36.275 27.776  1.00 26.94  ? 216  LYS B CB  1 
ATOM   2176 C  CG  . LYS B 1 12  ? -5.676  -36.695 26.650  1.00 30.79  ? 216  LYS B CG  1 
ATOM   2177 C  CD  . LYS B 1 12  ? -5.731  -38.226 26.474  1.00 34.21  ? 216  LYS B CD  1 
ATOM   2178 C  CE  . LYS B 1 12  ? -5.716  -38.588 24.989  1.00 36.06  ? 216  LYS B CE  1 
ATOM   2179 N  NZ  . LYS B 1 12  ? -6.244  -39.953 24.652  1.00 38.23  ? 216  LYS B NZ  1 
ATOM   2180 N  N   . HIS B 1 13  ? -2.618  -33.816 27.583  1.00 25.86  ? 217  HIS B N   1 
ATOM   2181 C  CA  . HIS B 1 13  ? -2.216  -32.507 27.035  1.00 26.42  ? 217  HIS B CA  1 
ATOM   2182 C  C   . HIS B 1 13  ? -0.927  -32.573 26.215  1.00 25.47  ? 217  HIS B C   1 
ATOM   2183 O  O   . HIS B 1 13  ? -0.864  -32.010 25.117  1.00 25.29  ? 217  HIS B O   1 
ATOM   2184 C  CB  . HIS B 1 13  ? -2.069  -31.407 28.083  1.00 27.21  ? 217  HIS B CB  1 
ATOM   2185 C  CG  . HIS B 1 13  ? -1.594  -30.113 27.493  1.00 30.86  ? 217  HIS B CG  1 
ATOM   2186 N  ND1 . HIS B 1 13  ? -2.418  -29.017 27.332  1.00 35.26  ? 217  HIS B ND1 1 
ATOM   2187 C  CD2 . HIS B 1 13  ? -0.400  -29.765 26.950  1.00 33.41  ? 217  HIS B CD2 1 
ATOM   2188 C  CE1 . HIS B 1 13  ? -1.744  -28.039 26.749  1.00 35.91  ? 217  HIS B CE1 1 
ATOM   2189 N  NE2 . HIS B 1 13  ? -0.518  -28.471 26.501  1.00 35.73  ? 217  HIS B NE2 1 
ATOM   2190 N  N   . ILE B 1 14  ? 0.095   -33.234 26.754  1.00 24.20  ? 218  ILE B N   1 
ATOM   2191 C  CA  . ILE B 1 14  ? 1.352   -33.436 26.016  1.00 23.20  ? 218  ILE B CA  1 
ATOM   2192 C  C   . ILE B 1 14  ? 1.126   -34.175 24.672  1.00 22.83  ? 218  ILE B C   1 
ATOM   2193 O  O   . ILE B 1 14  ? 1.694   -33.797 23.654  1.00 22.00  ? 218  ILE B O   1 
ATOM   2194 C  CB  . ILE B 1 14  ? 2.419   -34.134 26.901  1.00 23.42  ? 218  ILE B CB  1 
ATOM   2195 C  CG1 . ILE B 1 14  ? 2.850   -33.185 28.037  1.00 23.56  ? 218  ILE B CG1 1 
ATOM   2196 C  CG2 . ILE B 1 14  ? 3.635   -34.582 26.067  1.00 21.94  ? 218  ILE B CG2 1 
ATOM   2197 C  CD1 . ILE B 1 14  ? 3.595   -33.875 29.129  1.00 25.54  ? 218  ILE B CD1 1 
ATOM   2198 N  N   . TYR B 1 15  ? 0.283   -35.206 24.681  1.00 22.61  ? 219  TYR B N   1 
ATOM   2199 C  CA  . TYR B 1 15  ? -0.116  -35.910 23.457  1.00 23.16  ? 219  TYR B CA  1 
ATOM   2200 C  C   . TYR B 1 15  ? -0.756  -34.987 22.420  1.00 22.92  ? 219  TYR B C   1 
ATOM   2201 O  O   . TYR B 1 15  ? -0.448  -35.075 21.217  1.00 23.00  ? 219  TYR B O   1 
ATOM   2202 C  CB  . TYR B 1 15  ? -1.060  -37.074 23.791  1.00 23.70  ? 219  TYR B CB  1 
ATOM   2203 C  CG  . TYR B 1 15  ? -1.382  -38.023 22.633  1.00 24.88  ? 219  TYR B CG  1 
ATOM   2204 C  CD1 . TYR B 1 15  ? -0.449  -38.282 21.617  1.00 25.72  ? 219  TYR B CD1 1 
ATOM   2205 C  CD2 . TYR B 1 15  ? -2.602  -38.705 22.591  1.00 25.42  ? 219  TYR B CD2 1 
ATOM   2206 C  CE1 . TYR B 1 15  ? -0.739  -39.165 20.575  1.00 25.92  ? 219  TYR B CE1 1 
ATOM   2207 C  CE2 . TYR B 1 15  ? -2.909  -39.602 21.543  1.00 26.34  ? 219  TYR B CE2 1 
ATOM   2208 C  CZ  . TYR B 1 15  ? -1.974  -39.821 20.539  1.00 26.36  ? 219  TYR B CZ  1 
ATOM   2209 O  OH  . TYR B 1 15  ? -2.270  -40.693 19.507  1.00 25.68  ? 219  TYR B OH  1 
ATOM   2210 N  N   . ASN B 1 16  ? -1.650  -34.116 22.872  1.00 22.48  ? 220  ASN B N   1 
ATOM   2211 C  CA  . ASN B 1 16  ? -2.292  -33.155 21.979  1.00 22.70  ? 220  ASN B CA  1 
ATOM   2212 C  C   . ASN B 1 16  ? -1.274  -32.158 21.387  1.00 21.68  ? 220  ASN B C   1 
ATOM   2213 O  O   . ASN B 1 16  ? -1.374  -31.795 20.215  1.00 20.61  ? 220  ASN B O   1 
ATOM   2214 C  CB  . ASN B 1 16  ? -3.463  -32.438 22.679  1.00 23.67  ? 220  ASN B CB  1 
ATOM   2215 C  CG  . ASN B 1 16  ? -4.663  -33.373 22.951  1.00 25.45  ? 220  ASN B CG  1 
ATOM   2216 O  OD1 . ASN B 1 16  ? -4.896  -34.353 22.232  1.00 30.10  ? 220  ASN B OD1 1 
ATOM   2217 N  ND2 . ASN B 1 16  ? -5.421  -33.064 23.992  1.00 25.75  ? 220  ASN B ND2 1 
ATOM   2218 N  N   . ALA B 1 17  ? -0.285  -31.762 22.190  1.00 20.40  ? 221  ALA B N   1 
ATOM   2219 C  CA  . ALA B 1 17  ? 0.834   -30.927 21.709  1.00 20.36  ? 221  ALA B CA  1 
ATOM   2220 C  C   . ALA B 1 17  ? 1.607   -31.591 20.561  1.00 20.07  ? 221  ALA B C   1 
ATOM   2221 O  O   . ALA B 1 17  ? 1.986   -30.937 19.598  1.00 19.69  ? 221  ALA B O   1 
ATOM   2222 C  CB  . ALA B 1 17  ? 1.781   -30.583 22.858  1.00 20.45  ? 221  ALA B CB  1 
ATOM   2223 N  N   . TYR B 1 18  ? 1.814   -32.898 20.693  1.00 19.55  ? 222  TYR B N   1 
ATOM   2224 C  CA  . TYR B 1 18  ? 2.512   -33.752 19.734  1.00 19.34  ? 222  TYR B CA  1 
ATOM   2225 C  C   . TYR B 1 18  ? 1.708   -33.886 18.443  1.00 19.37  ? 222  TYR B C   1 
ATOM   2226 O  O   . TYR B 1 18  ? 2.244   -33.732 17.344  1.00 18.42  ? 222  TYR B O   1 
ATOM   2227 C  CB  . TYR B 1 18  ? 2.690   -35.118 20.409  1.00 19.12  ? 222  TYR B CB  1 
ATOM   2228 C  CG  . TYR B 1 18  ? 3.387   -36.223 19.646  1.00 19.73  ? 222  TYR B CG  1 
ATOM   2229 C  CD1 . TYR B 1 18  ? 2.688   -37.041 18.750  1.00 20.44  ? 222  TYR B CD1 1 
ATOM   2230 C  CD2 . TYR B 1 18  ? 4.731   -36.512 19.887  1.00 20.82  ? 222  TYR B CD2 1 
ATOM   2231 C  CE1 . TYR B 1 18  ? 3.323   -38.087 18.079  1.00 19.50  ? 222  TYR B CE1 1 
ATOM   2232 C  CE2 . TYR B 1 18  ? 5.378   -37.550 19.219  1.00 20.25  ? 222  TYR B CE2 1 
ATOM   2233 C  CZ  . TYR B 1 18  ? 4.671   -38.323 18.322  1.00 20.29  ? 222  TYR B CZ  1 
ATOM   2234 O  OH  . TYR B 1 18  ? 5.315   -39.348 17.693  1.00 19.81  ? 222  TYR B OH  1 
ATOM   2235 N  N   . LEU B 1 19  ? 0.421   -34.186 18.590  1.00 19.44  ? 223  LEU B N   1 
ATOM   2236 C  CA  . LEU B 1 19  ? -0.514  -34.304 17.473  1.00 20.05  ? 223  LEU B CA  1 
ATOM   2237 C  C   . LEU B 1 19  ? -0.671  -33.002 16.675  1.00 20.69  ? 223  LEU B C   1 
ATOM   2238 O  O   . LEU B 1 19  ? -0.859  -33.024 15.449  1.00 20.69  ? 223  LEU B O   1 
ATOM   2239 C  CB  . LEU B 1 19  ? -1.877  -34.741 18.019  1.00 19.97  ? 223  LEU B CB  1 
ATOM   2240 C  CG  . LEU B 1 19  ? -2.334  -36.209 17.992  1.00 20.49  ? 223  LEU B CG  1 
ATOM   2241 C  CD1 . LEU B 1 19  ? -1.259  -37.244 17.745  1.00 21.62  ? 223  LEU B CD1 1 
ATOM   2242 C  CD2 . LEU B 1 19  ? -3.141  -36.511 19.246  1.00 21.22  ? 223  LEU B CD2 1 
ATOM   2243 N  N   . LYS B 1 20  ? -0.596  -31.875 17.372  1.00 20.82  ? 224  LYS B N   1 
ATOM   2244 C  CA  . LYS B 1 20  ? -0.717  -30.563 16.738  1.00 22.45  ? 224  LYS B CA  1 
ATOM   2245 C  C   . LYS B 1 20  ? 0.553   -30.141 15.973  1.00 22.40  ? 224  LYS B C   1 
ATOM   2246 O  O   . LYS B 1 20  ? 0.459   -29.419 14.981  1.00 22.40  ? 224  LYS B O   1 
ATOM   2247 C  CB  . LYS B 1 20  ? -1.099  -29.521 17.805  1.00 22.06  ? 224  LYS B CB  1 
ATOM   2248 C  CG  . LYS B 1 20  ? -1.080  -28.063 17.365  1.00 23.16  ? 224  LYS B CG  1 
ATOM   2249 C  CD  . LYS B 1 20  ? -1.476  -27.147 18.511  1.00 24.18  ? 224  LYS B CD  1 
ATOM   2250 C  CE  . LYS B 1 20  ? -1.268  -25.669 18.153  1.00 28.86  ? 224  LYS B CE  1 
ATOM   2251 N  NZ  . LYS B 1 20  ? -2.029  -25.238 16.922  1.00 32.06  ? 224  LYS B NZ  1 
ATOM   2252 N  N   . ASN B 1 21  ? 1.719   -30.616 16.415  1.00 22.67  ? 225  ASN B N   1 
ATOM   2253 C  CA  . ASN B 1 21  ? 3.007   -30.041 15.987  1.00 23.50  ? 225  ASN B CA  1 
ATOM   2254 C  C   . ASN B 1 21  ? 3.974   -30.872 15.113  1.00 23.67  ? 225  ASN B C   1 
ATOM   2255 O  O   . ASN B 1 21  ? 4.870   -30.308 14.482  1.00 24.27  ? 225  ASN B O   1 
ATOM   2256 C  CB  . ASN B 1 21  ? 3.739   -29.474 17.209  1.00 23.04  ? 225  ASN B CB  1 
ATOM   2257 C  CG  . ASN B 1 21  ? 3.081   -28.212 17.744  1.00 23.71  ? 225  ASN B CG  1 
ATOM   2258 O  OD1 . ASN B 1 21  ? 3.079   -27.181 17.079  1.00 23.47  ? 225  ASN B OD1 1 
ATOM   2259 N  ND2 . ASN B 1 21  ? 2.527   -28.286 18.961  1.00 23.05  ? 225  ASN B ND2 1 
ATOM   2260 N  N   . PHE B 1 22  ? 3.817   -32.192 15.073  1.00 24.18  ? 226  PHE B N   1 
ATOM   2261 C  CA  . PHE B 1 22  ? 4.650   -33.017 14.191  1.00 24.21  ? 226  PHE B CA  1 
ATOM   2262 C  C   . PHE B 1 22  ? 3.916   -33.369 12.883  1.00 24.45  ? 226  PHE B C   1 
ATOM   2263 O  O   . PHE B 1 22  ? 2.797   -33.862 12.916  1.00 23.69  ? 226  PHE B O   1 
ATOM   2264 C  CB  . PHE B 1 22  ? 5.145   -34.264 14.930  1.00 23.99  ? 226  PHE B CB  1 
ATOM   2265 C  CG  . PHE B 1 22  ? 6.079   -33.951 16.080  1.00 23.81  ? 226  PHE B CG  1 
ATOM   2266 C  CD1 . PHE B 1 22  ? 7.412   -33.596 15.841  1.00 24.16  ? 226  PHE B CD1 1 
ATOM   2267 C  CD2 . PHE B 1 22  ? 5.616   -33.968 17.392  1.00 22.19  ? 226  PHE B CD2 1 
ATOM   2268 C  CE1 . PHE B 1 22  ? 8.289   -33.292 16.907  1.00 22.91  ? 226  PHE B CE1 1 
ATOM   2269 C  CE2 . PHE B 1 22  ? 6.470   -33.659 18.457  1.00 23.35  ? 226  PHE B CE2 1 
ATOM   2270 C  CZ  . PHE B 1 22  ? 7.811   -33.324 18.216  1.00 22.71  ? 226  PHE B CZ  1 
ATOM   2271 N  N   . ASN B 1 23  ? 4.532   -33.105 11.730  1.00 25.31  ? 227  ASN B N   1 
ATOM   2272 C  CA  . ASN B 1 23  ? 3.824   -33.375 10.481  1.00 26.15  ? 227  ASN B CA  1 
ATOM   2273 C  C   . ASN B 1 23  ? 3.752   -34.852 10.120  1.00 25.58  ? 227  ASN B C   1 
ATOM   2274 O  O   . ASN B 1 23  ? 3.005   -35.224 9.232   1.00 25.89  ? 227  ASN B O   1 
ATOM   2275 C  CB  . ASN B 1 23  ? 4.321   -32.529 9.298   1.00 27.32  ? 227  ASN B CB  1 
ATOM   2276 C  CG  . ASN B 1 23  ? 3.183   -32.180 8.318   1.00 29.79  ? 227  ASN B CG  1 
ATOM   2277 O  OD1 . ASN B 1 23  ? 2.765   -33.008 7.489   1.00 33.25  ? 227  ASN B OD1 1 
ATOM   2278 N  ND2 . ASN B 1 23  ? 2.681   -30.951 8.414   1.00 30.93  ? 227  ASN B ND2 1 
ATOM   2279 N  N   . MET B 1 24  ? 4.507   -35.684 10.825  1.00 24.90  ? 228  MET B N   1 
ATOM   2280 C  CA  . MET B 1 24  ? 4.448   -37.125 10.633  1.00 24.62  ? 228  MET B CA  1 
ATOM   2281 C  C   . MET B 1 24  ? 4.401   -37.858 11.983  1.00 24.08  ? 228  MET B C   1 
ATOM   2282 O  O   . MET B 1 24  ? 5.244   -37.638 12.848  1.00 24.17  ? 228  MET B O   1 
ATOM   2283 C  CB  . MET B 1 24  ? 5.637   -37.563 9.769   1.00 25.56  ? 228  MET B CB  1 
ATOM   2284 C  CG  . MET B 1 24  ? 5.920   -39.066 9.692   1.00 27.44  ? 228  MET B CG  1 
ATOM   2285 S  SD  . MET B 1 24  ? 5.121   -39.895 8.327   1.00 30.48  ? 228  MET B SD  1 
ATOM   2286 C  CE  . MET B 1 24  ? 5.729   -39.029 6.896   1.00 27.20  ? 228  MET B CE  1 
ATOM   2287 N  N   . THR B 1 25  ? 3.388   -38.700 12.163  1.00 23.27  ? 229  THR B N   1 
ATOM   2288 C  CA  . THR B 1 25  ? 3.239   -39.524 13.375  1.00 22.25  ? 229  THR B CA  1 
ATOM   2289 C  C   . THR B 1 25  ? 3.762   -40.925 13.060  1.00 21.35  ? 229  THR B C   1 
ATOM   2290 O  O   . THR B 1 25  ? 3.829   -41.304 11.894  1.00 20.59  ? 229  THR B O   1 
ATOM   2291 C  CB  . THR B 1 25  ? 1.755   -39.672 13.801  1.00 22.04  ? 229  THR B CB  1 
ATOM   2292 O  OG1 . THR B 1 25  ? 1.011   -40.318 12.751  1.00 23.15  ? 229  THR B OG1 1 
ATOM   2293 C  CG2 . THR B 1 25  ? 1.132   -38.321 14.122  1.00 22.42  ? 229  THR B CG2 1 
ATOM   2294 N  N   . LYS B 1 26  ? 4.100   -41.694 14.090  1.00 20.52  ? 230  LYS B N   1 
ATOM   2295 C  CA  . LYS B 1 26  ? 4.474   -43.097 13.897  1.00 20.22  ? 230  LYS B CA  1 
ATOM   2296 C  C   . LYS B 1 26  ? 3.367   -43.904 13.240  1.00 20.45  ? 230  LYS B C   1 
ATOM   2297 O  O   . LYS B 1 26  ? 3.640   -44.751 12.384  1.00 20.14  ? 230  LYS B O   1 
ATOM   2298 C  CB  . LYS B 1 26  ? 4.908   -43.750 15.209  1.00 19.76  ? 230  LYS B CB  1 
ATOM   2299 C  CG  . LYS B 1 26  ? 5.500   -45.141 15.013  1.00 19.25  ? 230  LYS B CG  1 
ATOM   2300 C  CD  . LYS B 1 26  ? 6.154   -45.672 16.262  1.00 16.11  ? 230  LYS B CD  1 
ATOM   2301 C  CE  . LYS B 1 26  ? 6.475   -47.181 16.084  1.00 15.09  ? 230  LYS B CE  1 
ATOM   2302 N  NZ  . LYS B 1 26  ? 7.167   -47.727 17.265  1.00 15.90  ? 230  LYS B NZ  1 
ATOM   2303 N  N   . LYS B 1 27  ? 2.115   -43.643 13.629  1.00 21.13  ? 231  LYS B N   1 
ATOM   2304 C  CA  . LYS B 1 27  ? 0.970   -44.340 13.037  1.00 22.20  ? 231  LYS B CA  1 
ATOM   2305 C  C   . LYS B 1 27  ? 0.895   -44.131 11.518  1.00 22.22  ? 231  LYS B C   1 
ATOM   2306 O  O   . LYS B 1 27  ? 0.710   -45.090 10.759  1.00 21.53  ? 231  LYS B O   1 
ATOM   2307 C  CB  . LYS B 1 27  ? -0.358  -43.917 13.698  1.00 21.62  ? 231  LYS B CB  1 
ATOM   2308 C  CG  . LYS B 1 27  ? -1.542  -44.791 13.283  1.00 22.92  ? 231  LYS B CG  1 
ATOM   2309 C  CD  . LYS B 1 27  ? -2.852  -44.341 13.936  1.00 24.48  ? 231  LYS B CD  1 
ATOM   2310 C  CE  . LYS B 1 27  ? -4.028  -45.147 13.420  1.00 27.59  ? 231  LYS B CE  1 
ATOM   2311 N  NZ  . LYS B 1 27  ? -3.764  -46.636 13.419  1.00 30.70  ? 231  LYS B NZ  1 
ATOM   2312 N  N   . LYS B 1 28  ? 1.030   -42.880 11.080  1.00 22.79  ? 232  LYS B N   1 
ATOM   2313 C  CA  . LYS B 1 28  ? 1.028   -42.596 9.659   1.00 23.09  ? 232  LYS B CA  1 
ATOM   2314 C  C   . LYS B 1 28  ? 2.238   -43.253 9.000   1.00 23.25  ? 232  LYS B C   1 
ATOM   2315 O  O   . LYS B 1 28  ? 2.091   -43.936 7.992   1.00 23.16  ? 232  LYS B O   1 
ATOM   2316 C  CB  . LYS B 1 28  ? 1.041   -41.092 9.380   1.00 24.00  ? 232  LYS B CB  1 
ATOM   2317 C  CG  . LYS B 1 28  ? 0.699   -40.753 7.920   1.00 24.02  ? 232  LYS B CG  1 
ATOM   2318 C  CD  . LYS B 1 28  ? 1.604   -39.658 7.395   1.00 27.88  ? 232  LYS B CD  1 
ATOM   2319 C  CE  . LYS B 1 28  ? 0.978   -38.272 7.502   1.00 29.22  ? 232  LYS B CE  1 
ATOM   2320 N  NZ  . LYS B 1 28  ? 1.937   -37.173 7.162   1.00 29.30  ? 232  LYS B NZ  1 
ATOM   2321 N  N   . ALA B 1 29  ? 3.421   -43.066 9.593   1.00 22.88  ? 233  ALA B N   1 
ATOM   2322 C  CA  . ALA B 1 29  ? 4.652   -43.613 9.038   1.00 23.25  ? 233  ALA B CA  1 
ATOM   2323 C  C   . ALA B 1 29  ? 4.588   -45.127 8.865   1.00 23.93  ? 233  ALA B C   1 
ATOM   2324 O  O   . ALA B 1 29  ? 5.026   -45.646 7.828   1.00 23.43  ? 233  ALA B O   1 
ATOM   2325 C  CB  . ALA B 1 29  ? 5.841   -43.227 9.886   1.00 22.84  ? 233  ALA B CB  1 
ATOM   2326 N  N   . ARG B 1 30  ? 4.044   -45.831 9.863   1.00 24.74  ? 234  ARG B N   1 
ATOM   2327 C  CA  . ARG B 1 30  ? 3.971   -47.298 9.800   1.00 26.50  ? 234  ARG B CA  1 
ATOM   2328 C  C   . ARG B 1 30  ? 3.032   -47.783 8.706   1.00 27.28  ? 234  ARG B C   1 
ATOM   2329 O  O   . ARG B 1 30  ? 3.310   -48.802 8.069   1.00 27.63  ? 234  ARG B O   1 
ATOM   2330 C  CB  . ARG B 1 30  ? 3.577   -47.947 11.130  1.00 26.12  ? 234  ARG B CB  1 
ATOM   2331 C  CG  . ARG B 1 30  ? 4.564   -47.806 12.286  1.00 27.51  ? 234  ARG B CG  1 
ATOM   2332 C  CD  . ARG B 1 30  ? 6.002   -47.493 11.856  1.00 28.56  ? 234  ARG B CD  1 
ATOM   2333 N  NE  . ARG B 1 30  ? 6.838   -48.685 11.743  1.00 29.29  ? 234  ARG B NE  1 
ATOM   2334 C  CZ  . ARG B 1 30  ? 8.160   -48.646 11.578  1.00 29.72  ? 234  ARG B CZ  1 
ATOM   2335 N  NH1 . ARG B 1 30  ? 8.784   -47.475 11.498  1.00 26.63  ? 234  ARG B NH1 1 
ATOM   2336 N  NH2 . ARG B 1 30  ? 8.857   -49.775 11.487  1.00 29.69  ? 234  ARG B NH2 1 
ATOM   2337 N  N   . SER B 1 31  ? 1.932   -47.066 8.493   1.00 28.37  ? 235  SER B N   1 
ATOM   2338 C  CA  . SER B 1 31  ? 1.006   -47.431 7.419   1.00 30.04  ? 235  SER B CA  1 
ATOM   2339 C  C   . SER B 1 31  ? 1.652   -47.253 6.042   1.00 30.61  ? 235  SER B C   1 
ATOM   2340 O  O   . SER B 1 31  ? 1.551   -48.147 5.217   1.00 31.31  ? 235  SER B O   1 
ATOM   2341 C  CB  . SER B 1 31  ? -0.351  -46.726 7.522   1.00 29.68  ? 235  SER B CB  1 
ATOM   2342 O  OG  . SER B 1 31  ? -0.220  -45.314 7.625   1.00 32.00  ? 235  SER B OG  1 
ATOM   2343 N  N   . ILE B 1 32  ? 2.329   -46.122 5.815   1.00 31.47  ? 236  ILE B N   1 
ATOM   2344 C  CA  . ILE B 1 32  ? 3.153   -45.931 4.605   1.00 32.06  ? 236  ILE B CA  1 
ATOM   2345 C  C   . ILE B 1 32  ? 4.144   -47.094 4.384   1.00 32.99  ? 236  ILE B C   1 
ATOM   2346 O  O   . ILE B 1 32  ? 4.116   -47.738 3.333   1.00 32.80  ? 236  ILE B O   1 
ATOM   2347 C  CB  . ILE B 1 32  ? 3.913   -44.567 4.597   1.00 31.86  ? 236  ILE B CB  1 
ATOM   2348 C  CG1 . ILE B 1 32  ? 2.933   -43.394 4.553   1.00 31.24  ? 236  ILE B CG1 1 
ATOM   2349 C  CG2 . ILE B 1 32  ? 4.855   -44.477 3.409   1.00 31.62  ? 236  ILE B CG2 1 
ATOM   2350 C  CD1 . ILE B 1 32  ? 3.577   -42.035 4.847   1.00 32.02  ? 236  ILE B CD1 1 
ATOM   2351 N  N   . LEU B 1 33  ? 4.993   -47.369 5.379   1.00 33.73  ? 237  LEU B N   1 
ATOM   2352 C  CA  . LEU B 1 33  ? 6.074   -48.361 5.245   1.00 34.90  ? 237  LEU B CA  1 
ATOM   2353 C  C   . LEU B 1 33  ? 5.544   -49.780 5.005   1.00 36.17  ? 237  LEU B C   1 
ATOM   2354 O  O   . LEU B 1 33  ? 6.236   -50.640 4.451   1.00 36.88  ? 237  LEU B O   1 
ATOM   2355 C  CB  . LEU B 1 33  ? 6.976   -48.351 6.485   1.00 34.20  ? 237  LEU B CB  1 
ATOM   2356 C  CG  . LEU B 1 33  ? 7.882   -47.139 6.754   1.00 32.94  ? 237  LEU B CG  1 
ATOM   2357 C  CD1 . LEU B 1 33  ? 8.310   -47.109 8.208   1.00 30.77  ? 237  LEU B CD1 1 
ATOM   2358 C  CD2 . LEU B 1 33  ? 9.096   -47.145 5.858   1.00 31.12  ? 237  LEU B CD2 1 
ATOM   2359 N  N   . THR B 1 34  ? 4.309   -49.997 5.433   1.00 37.46  ? 238  THR B N   1 
ATOM   2360 C  CA  . THR B 1 34  ? 3.634   -51.286 5.373   1.00 38.66  ? 238  THR B CA  1 
ATOM   2361 C  C   . THR B 1 34  ? 2.879   -51.450 4.047   1.00 39.57  ? 238  THR B C   1 
ATOM   2362 O  O   . THR B 1 34  ? 2.550   -52.570 3.648   1.00 40.27  ? 238  THR B O   1 
ATOM   2363 C  CB  . THR B 1 34  ? 2.723   -51.437 6.624   1.00 38.37  ? 238  THR B CB  1 
ATOM   2364 O  OG1 . THR B 1 34  ? 3.361   -52.304 7.564   1.00 38.78  ? 238  THR B OG1 1 
ATOM   2365 C  CG2 . THR B 1 34  ? 1.330   -51.941 6.301   1.00 39.16  ? 238  THR B CG2 1 
ATOM   2366 N  N   . GLY B 1 35  ? 2.635   -50.331 3.363   1.00 40.13  ? 239  GLY B N   1 
ATOM   2367 C  CA  . GLY B 1 35  ? 1.940   -50.330 2.080   1.00 40.55  ? 239  GLY B CA  1 
ATOM   2368 C  C   . GLY B 1 35  ? 0.451   -50.573 2.217   1.00 40.92  ? 239  GLY B C   1 
ATOM   2369 O  O   . GLY B 1 35  ? -0.343  -49.630 2.233   1.00 41.23  ? 239  GLY B O   1 
ATOM   2370 N  N   . HIS B 1 39  ? -4.185  -42.905 -2.296  1.00 52.76  ? 243  HIS B N   1 
ATOM   2371 C  CA  . HIS B 1 39  ? -2.819  -42.454 -2.565  1.00 52.67  ? 243  HIS B CA  1 
ATOM   2372 C  C   . HIS B 1 39  ? -1.817  -43.620 -2.650  1.00 51.87  ? 243  HIS B C   1 
ATOM   2373 O  O   . HIS B 1 39  ? -2.166  -44.782 -2.390  1.00 52.00  ? 243  HIS B O   1 
ATOM   2374 C  CB  . HIS B 1 39  ? -2.377  -41.416 -1.516  1.00 53.18  ? 243  HIS B CB  1 
ATOM   2375 C  CG  . HIS B 1 39  ? -1.165  -40.624 -1.913  1.00 54.76  ? 243  HIS B CG  1 
ATOM   2376 N  ND1 . HIS B 1 39  ? 0.122   -41.061 -1.676  1.00 55.58  ? 243  HIS B ND1 1 
ATOM   2377 C  CD2 . HIS B 1 39  ? -1.045  -39.423 -2.531  1.00 56.29  ? 243  HIS B CD2 1 
ATOM   2378 C  CE1 . HIS B 1 39  ? 0.981   -40.165 -2.131  1.00 56.46  ? 243  HIS B CE1 1 
ATOM   2379 N  NE2 . HIS B 1 39  ? 0.299   -39.161 -2.654  1.00 56.60  ? 243  HIS B NE2 1 
ATOM   2380 N  N   . THR B 1 40  ? -0.575  -43.278 -2.999  1.00 50.89  ? 244  THR B N   1 
ATOM   2381 C  CA  . THR B 1 40  ? 0.491   -44.232 -3.334  1.00 49.69  ? 244  THR B CA  1 
ATOM   2382 C  C   . THR B 1 40  ? 1.603   -44.414 -2.290  1.00 48.07  ? 244  THR B C   1 
ATOM   2383 O  O   . THR B 1 40  ? 1.653   -43.737 -1.259  1.00 48.37  ? 244  THR B O   1 
ATOM   2384 C  CB  . THR B 1 40  ? 1.221   -43.806 -4.633  1.00 50.06  ? 244  THR B CB  1 
ATOM   2385 O  OG1 . THR B 1 40  ? 1.820   -42.509 -4.453  1.00 50.93  ? 244  THR B OG1 1 
ATOM   2386 C  CG2 . THR B 1 40  ? 0.272   -43.764 -5.793  1.00 50.22  ? 244  THR B CG2 1 
ATOM   2387 N  N   . ALA B 1 41  ? 2.507   -45.335 -2.612  1.00 45.81  ? 245  ALA B N   1 
ATOM   2388 C  CA  . ALA B 1 41  ? 3.752   -45.522 -1.894  1.00 43.22  ? 245  ALA B CA  1 
ATOM   2389 C  C   . ALA B 1 41  ? 4.744   -44.374 -2.197  1.00 40.98  ? 245  ALA B C   1 
ATOM   2390 O  O   . ALA B 1 41  ? 4.563   -43.619 -3.161  1.00 40.54  ? 245  ALA B O   1 
ATOM   2391 C  CB  . ALA B 1 41  ? 4.349   -46.881 -2.268  1.00 43.52  ? 245  ALA B CB  1 
ATOM   2392 N  N   . PRO B 1 42  ? 5.783   -44.223 -1.360  1.00 38.64  ? 246  PRO B N   1 
ATOM   2393 C  CA  . PRO B 1 42  ? 6.831   -43.241 -1.647  1.00 36.66  ? 246  PRO B CA  1 
ATOM   2394 C  C   . PRO B 1 42  ? 7.727   -43.609 -2.845  1.00 34.71  ? 246  PRO B C   1 
ATOM   2395 O  O   . PRO B 1 42  ? 7.843   -44.787 -3.213  1.00 33.83  ? 246  PRO B O   1 
ATOM   2396 C  CB  . PRO B 1 42  ? 7.659   -43.236 -0.356  1.00 36.87  ? 246  PRO B CB  1 
ATOM   2397 C  CG  . PRO B 1 42  ? 7.448   -44.581 0.235   1.00 37.78  ? 246  PRO B CG  1 
ATOM   2398 C  CD  . PRO B 1 42  ? 6.023   -44.924 -0.084  1.00 38.73  ? 246  PRO B CD  1 
ATOM   2399 N  N   . PHE B 1 43  ? 8.356   -42.597 -3.437  1.00 32.15  ? 247  PHE B N   1 
ATOM   2400 C  CA  . PHE B 1 43  ? 9.385   -42.813 -4.453  1.00 30.35  ? 247  PHE B CA  1 
ATOM   2401 C  C   . PHE B 1 43  ? 10.638  -43.419 -3.813  1.00 28.79  ? 247  PHE B C   1 
ATOM   2402 O  O   . PHE B 1 43  ? 11.203  -42.861 -2.867  1.00 28.21  ? 247  PHE B O   1 
ATOM   2403 C  CB  . PHE B 1 43  ? 9.706   -41.493 -5.161  1.00 30.30  ? 247  PHE B CB  1 
ATOM   2404 C  CG  . PHE B 1 43  ? 10.736  -41.606 -6.260  1.00 29.99  ? 247  PHE B CG  1 
ATOM   2405 C  CD1 . PHE B 1 43  ? 10.371  -42.039 -7.540  1.00 30.56  ? 247  PHE B CD1 1 
ATOM   2406 C  CD2 . PHE B 1 43  ? 12.063  -41.235 -6.029  1.00 28.68  ? 247  PHE B CD2 1 
ATOM   2407 C  CE1 . PHE B 1 43  ? 11.317  -42.113 -8.559  1.00 29.78  ? 247  PHE B CE1 1 
ATOM   2408 C  CE2 . PHE B 1 43  ? 13.010  -41.300 -7.034  1.00 28.30  ? 247  PHE B CE2 1 
ATOM   2409 C  CZ  . PHE B 1 43  ? 12.644  -41.744 -8.301  1.00 30.11  ? 247  PHE B CZ  1 
ATOM   2410 N  N   . VAL B 1 44  ? 11.052  -44.574 -4.321  1.00 27.24  ? 248  VAL B N   1 
ATOM   2411 C  CA  . VAL B 1 44  ? 12.197  -45.284 -3.766  1.00 26.08  ? 248  VAL B CA  1 
ATOM   2412 C  C   . VAL B 1 44  ? 13.527  -44.747 -4.297  1.00 25.49  ? 248  VAL B C   1 
ATOM   2413 O  O   . VAL B 1 44  ? 13.790  -44.765 -5.506  1.00 25.42  ? 248  VAL B O   1 
ATOM   2414 C  CB  . VAL B 1 44  ? 12.119  -46.804 -4.032  1.00 26.13  ? 248  VAL B CB  1 
ATOM   2415 C  CG1 . VAL B 1 44  ? 13.348  -47.519 -3.481  1.00 25.31  ? 248  VAL B CG1 1 
ATOM   2416 C  CG2 . VAL B 1 44  ? 10.846  -47.374 -3.436  1.00 26.62  ? 248  VAL B CG2 1 
ATOM   2417 N  N   . ILE B 1 45  ? 14.375  -44.300 -3.373  1.00 24.13  ? 249  ILE B N   1 
ATOM   2418 C  CA  . ILE B 1 45  ? 15.736  -43.909 -3.703  1.00 22.63  ? 249  ILE B CA  1 
ATOM   2419 C  C   . ILE B 1 45  ? 16.670  -45.042 -3.274  1.00 22.53  ? 249  ILE B C   1 
ATOM   2420 O  O   . ILE B 1 45  ? 16.968  -45.205 -2.085  1.00 21.89  ? 249  ILE B O   1 
ATOM   2421 C  CB  . ILE B 1 45  ? 16.108  -42.551 -3.049  1.00 22.93  ? 249  ILE B CB  1 
ATOM   2422 C  CG1 . ILE B 1 45  ? 15.062  -41.491 -3.409  1.00 22.44  ? 249  ILE B CG1 1 
ATOM   2423 C  CG2 . ILE B 1 45  ? 17.515  -42.111 -3.457  1.00 22.67  ? 249  ILE B CG2 1 
ATOM   2424 C  CD1 . ILE B 1 45  ? 15.187  -40.183 -2.634  1.00 21.78  ? 249  ILE B CD1 1 
ATOM   2425 N  N   . HIS B 1 46  ? 17.111  -45.827 -4.261  1.00 21.90  ? 250  HIS B N   1 
ATOM   2426 C  CA  . HIS B 1 46  ? 17.928  -47.024 -4.040  1.00 21.74  ? 250  HIS B CA  1 
ATOM   2427 C  C   . HIS B 1 46  ? 19.269  -46.975 -4.797  1.00 21.65  ? 250  HIS B C   1 
ATOM   2428 O  O   . HIS B 1 46  ? 20.104  -47.856 -4.640  1.00 21.51  ? 250  HIS B O   1 
ATOM   2429 C  CB  . HIS B 1 46  ? 17.150  -48.276 -4.459  1.00 21.24  ? 250  HIS B CB  1 
ATOM   2430 C  CG  . HIS B 1 46  ? 16.870  -48.341 -5.931  1.00 22.10  ? 250  HIS B CG  1 
ATOM   2431 N  ND1 . HIS B 1 46  ? 17.715  -48.969 -6.824  1.00 21.47  ? 250  HIS B ND1 1 
ATOM   2432 C  CD2 . HIS B 1 46  ? 15.847  -47.844 -6.665  1.00 22.09  ? 250  HIS B CD2 1 
ATOM   2433 C  CE1 . HIS B 1 46  ? 17.219  -48.854 -8.043  1.00 22.06  ? 250  HIS B CE1 1 
ATOM   2434 N  NE2 . HIS B 1 46  ? 16.091  -48.169 -7.975  1.00 21.92  ? 250  HIS B NE2 1 
ATOM   2435 N  N   . ASP B 1 47  ? 19.459  -45.952 -5.629  1.00 21.56  ? 251  ASP B N   1 
ATOM   2436 C  CA  . ASP B 1 47  ? 20.704  -45.776 -6.380  1.00 21.74  ? 251  ASP B CA  1 
ATOM   2437 C  C   . ASP B 1 47  ? 20.886  -44.313 -6.760  1.00 21.49  ? 251  ASP B C   1 
ATOM   2438 O  O   . ASP B 1 47  ? 20.039  -43.481 -6.417  1.00 22.33  ? 251  ASP B O   1 
ATOM   2439 C  CB  . ASP B 1 47  ? 20.762  -46.700 -7.612  1.00 21.24  ? 251  ASP B CB  1 
ATOM   2440 C  CG  . ASP B 1 47  ? 19.666  -46.406 -8.659  1.00 22.58  ? 251  ASP B CG  1 
ATOM   2441 O  OD1 . ASP B 1 47  ? 18.945  -45.375 -8.585  1.00 21.17  ? 251  ASP B OD1 1 
ATOM   2442 O  OD2 . ASP B 1 47  ? 19.546  -47.236 -9.587  1.00 21.40  ? 251  ASP B OD2 1 
ATOM   2443 N  N   . ILE B 1 48  ? 21.977  -44.017 -7.468  1.00 21.60  ? 252  ILE B N   1 
ATOM   2444 C  CA  . ILE B 1 48  ? 22.338  -42.655 -7.858  1.00 21.18  ? 252  ILE B CA  1 
ATOM   2445 C  C   . ILE B 1 48  ? 21.329  -42.031 -8.817  1.00 21.99  ? 252  ILE B C   1 
ATOM   2446 O  O   . ILE B 1 48  ? 20.982  -40.858 -8.659  1.00 22.22  ? 252  ILE B O   1 
ATOM   2447 C  CB  . ILE B 1 48  ? 23.793  -42.553 -8.419  1.00 21.03  ? 252  ILE B CB  1 
ATOM   2448 C  CG1 . ILE B 1 48  ? 24.806  -42.774 -7.287  1.00 19.84  ? 252  ILE B CG1 1 
ATOM   2449 C  CG2 . ILE B 1 48  ? 24.042  -41.169 -9.116  1.00 20.69  ? 252  ILE B CG2 1 
ATOM   2450 C  CD1 . ILE B 1 48  ? 26.234  -42.994 -7.708  1.00 20.40  ? 252  ILE B CD1 1 
ATOM   2451 N  N   . GLU B 1 49  ? 20.839  -42.800 -9.792  1.00 22.68  ? 253  GLU B N   1 
ATOM   2452 C  CA  . GLU B 1 49  ? 19.896  -42.226 -10.759 1.00 22.89  ? 253  GLU B CA  1 
ATOM   2453 C  C   . GLU B 1 49  ? 18.576  -41.829 -10.094 1.00 23.38  ? 253  GLU B C   1 
ATOM   2454 O  O   . GLU B 1 49  ? 18.024  -40.770 -10.409 1.00 23.39  ? 253  GLU B O   1 
ATOM   2455 C  CB  . GLU B 1 49  ? 19.638  -43.153 -11.947 1.00 23.24  ? 253  GLU B CB  1 
ATOM   2456 C  CG  . GLU B 1 49  ? 20.877  -43.621 -12.696 1.00 23.61  ? 253  GLU B CG  1 
ATOM   2457 C  CD  . GLU B 1 49  ? 21.340  -44.981 -12.214 1.00 26.07  ? 253  GLU B CD  1 
ATOM   2458 O  OE1 . GLU B 1 49  ? 21.812  -45.083 -11.056 1.00 24.34  ? 253  GLU B OE1 1 
ATOM   2459 O  OE2 . GLU B 1 49  ? 21.222  -45.957 -12.999 1.00 25.33  ? 253  GLU B OE2 1 
ATOM   2460 N  N   . THR B 1 50  ? 18.073  -42.666 -9.179  1.00 23.07  ? 254  THR B N   1 
ATOM   2461 C  CA  . THR B 1 50  ? 16.831  -42.321 -8.444  1.00 23.12  ? 254  THR B CA  1 
ATOM   2462 C  C   . THR B 1 50  ? 17.003  -41.135 -7.483  1.00 23.56  ? 254  THR B C   1 
ATOM   2463 O  O   . THR B 1 50  ? 16.084  -40.320 -7.344  1.00 22.90  ? 254  THR B O   1 
ATOM   2464 C  CB  . THR B 1 50  ? 16.188  -43.514 -7.720  1.00 22.95  ? 254  THR B CB  1 
ATOM   2465 O  OG1 . THR B 1 50  ? 17.156  -44.153 -6.886  1.00 21.23  ? 254  THR B OG1 1 
ATOM   2466 C  CG2 . THR B 1 50  ? 15.639  -44.493 -8.720  1.00 22.23  ? 254  THR B CG2 1 
ATOM   2467 N  N   . LEU B 1 51  ? 18.180  -41.037 -6.853  1.00 23.76  ? 255  LEU B N   1 
ATOM   2468 C  CA  . LEU B 1 51  ? 18.538  -39.865 -6.059  1.00 24.86  ? 255  LEU B CA  1 
ATOM   2469 C  C   . LEU B 1 51  ? 18.408  -38.598 -6.912  1.00 25.31  ? 255  LEU B C   1 
ATOM   2470 O  O   . LEU B 1 51  ? 17.752  -37.629 -6.521  1.00 25.45  ? 255  LEU B O   1 
ATOM   2471 C  CB  . LEU B 1 51  ? 19.962  -39.991 -5.490  1.00 24.45  ? 255  LEU B CB  1 
ATOM   2472 C  CG  . LEU B 1 51  ? 20.505  -38.752 -4.757  1.00 25.53  ? 255  LEU B CG  1 
ATOM   2473 C  CD1 . LEU B 1 51  ? 19.624  -38.408 -3.574  1.00 25.78  ? 255  LEU B CD1 1 
ATOM   2474 C  CD2 . LEU B 1 51  ? 21.964  -38.917 -4.315  1.00 25.21  ? 255  LEU B CD2 1 
ATOM   2475 N  N   . TRP B 1 52  ? 19.042  -38.639 -8.079  1.00 25.71  ? 256  TRP B N   1 
ATOM   2476 C  CA  . TRP B 1 52  ? 18.950  -37.589 -9.087  1.00 25.91  ? 256  TRP B CA  1 
ATOM   2477 C  C   . TRP B 1 52  ? 17.515  -37.297 -9.552  1.00 26.07  ? 256  TRP B C   1 
ATOM   2478 O  O   . TRP B 1 52  ? 17.117  -36.130 -9.614  1.00 25.45  ? 256  TRP B O   1 
ATOM   2479 C  CB  . TRP B 1 52  ? 19.869  -37.920 -10.268 1.00 25.52  ? 256  TRP B CB  1 
ATOM   2480 C  CG  . TRP B 1 52  ? 19.796  -36.939 -11.407 1.00 25.32  ? 256  TRP B CG  1 
ATOM   2481 C  CD1 . TRP B 1 52  ? 20.254  -35.648 -11.426 1.00 25.44  ? 256  TRP B CD1 1 
ATOM   2482 C  CD2 . TRP B 1 52  ? 19.238  -37.187 -12.696 1.00 24.25  ? 256  TRP B CD2 1 
ATOM   2483 N  NE1 . TRP B 1 52  ? 19.998  -35.074 -12.653 1.00 25.35  ? 256  TRP B NE1 1 
ATOM   2484 C  CE2 . TRP B 1 52  ? 19.378  -36.003 -13.450 1.00 25.20  ? 256  TRP B CE2 1 
ATOM   2485 C  CE3 . TRP B 1 52  ? 18.628  -38.300 -13.288 1.00 24.71  ? 256  TRP B CE3 1 
ATOM   2486 C  CZ2 . TRP B 1 52  ? 18.941  -35.905 -14.771 1.00 25.61  ? 256  TRP B CZ2 1 
ATOM   2487 C  CZ3 . TRP B 1 52  ? 18.182  -38.199 -14.598 1.00 24.88  ? 256  TRP B CZ3 1 
ATOM   2488 C  CH2 . TRP B 1 52  ? 18.345  -37.010 -15.323 1.00 25.68  ? 256  TRP B CH2 1 
ATOM   2489 N  N   . GLN B 1 53  ? 16.746  -38.339 -9.859  1.00 26.59  ? 257  GLN B N   1 
ATOM   2490 C  CA  . GLN B 1 53  ? 15.334  -38.173 -10.261 1.00 28.22  ? 257  GLN B CA  1 
ATOM   2491 C  C   . GLN B 1 53  ? 14.465  -37.521 -9.192  1.00 28.74  ? 257  GLN B C   1 
ATOM   2492 O  O   . GLN B 1 53  ? 13.618  -36.699 -9.515  1.00 28.44  ? 257  GLN B O   1 
ATOM   2493 C  CB  . GLN B 1 53  ? 14.708  -39.511 -10.633 1.00 28.56  ? 257  GLN B CB  1 
ATOM   2494 C  CG  . GLN B 1 53  ? 14.897  -39.898 -12.072 1.00 30.70  ? 257  GLN B CG  1 
ATOM   2495 C  CD  . GLN B 1 53  ? 15.177  -41.367 -12.223 1.00 32.84  ? 257  GLN B CD  1 
ATOM   2496 O  OE1 . GLN B 1 53  ? 16.172  -41.749 -12.835 1.00 34.19  ? 257  GLN B OE1 1 
ATOM   2497 N  NE2 . GLN B 1 53  ? 14.319  -42.206 -11.643 1.00 32.35  ? 257  GLN B NE2 1 
ATOM   2498 N  N   . ALA B 1 54  ? 14.671  -37.897 -7.925  1.00 29.74  ? 258  ALA B N   1 
ATOM   2499 C  CA  . ALA B 1 54  ? 13.945  -37.292 -6.802  1.00 30.93  ? 258  ALA B CA  1 
ATOM   2500 C  C   . ALA B 1 54  ? 14.197  -35.779 -6.657  1.00 32.16  ? 258  ALA B C   1 
ATOM   2501 O  O   . ALA B 1 54  ? 13.306  -35.046 -6.220  1.00 32.15  ? 258  ALA B O   1 
ATOM   2502 C  CB  . ALA B 1 54  ? 14.286  -38.002 -5.517  1.00 30.59  ? 258  ALA B CB  1 
ATOM   2503 N  N   . GLU B 1 55  ? 15.409  -35.329 -7.007  1.00 33.84  ? 259  GLU B N   1 
ATOM   2504 C  CA  . GLU B 1 55  ? 15.768  -33.902 -6.992  1.00 35.76  ? 259  GLU B CA  1 
ATOM   2505 C  C   . GLU B 1 55  ? 15.156  -33.121 -8.157  1.00 37.60  ? 259  GLU B C   1 
ATOM   2506 O  O   . GLU B 1 55  ? 14.981  -31.898 -8.074  1.00 37.62  ? 259  GLU B O   1 
ATOM   2507 C  CB  . GLU B 1 55  ? 17.288  -33.699 -6.987  1.00 35.28  ? 259  GLU B CB  1 
ATOM   2508 C  CG  . GLU B 1 55  ? 18.000  -34.127 -5.713  1.00 35.38  ? 259  GLU B CG  1 
ATOM   2509 C  CD  . GLU B 1 55  ? 17.619  -33.320 -4.467  1.00 35.29  ? 259  GLU B CD  1 
ATOM   2510 O  OE1 . GLU B 1 55  ? 17.440  -33.943 -3.400  1.00 34.68  ? 259  GLU B OE1 1 
ATOM   2511 O  OE2 . GLU B 1 55  ? 17.523  -32.072 -4.528  1.00 35.38  ? 259  GLU B OE2 1 
ATOM   2512 N  N   . LYS B 1 56  ? 14.832  -33.821 -9.242  1.00 39.64  ? 260  LYS B N   1 
ATOM   2513 C  CA  . LYS B 1 56  ? 14.194  -33.185 -10.395 1.00 42.12  ? 260  LYS B CA  1 
ATOM   2514 C  C   . LYS B 1 56  ? 12.741  -32.824 -10.090 1.00 43.58  ? 260  LYS B C   1 
ATOM   2515 O  O   . LYS B 1 56  ? 11.898  -32.749 -10.990 1.00 43.83  ? 260  LYS B O   1 
ATOM   2516 C  CB  . LYS B 1 56  ? 14.306  -34.071 -11.632 1.00 41.99  ? 260  LYS B CB  1 
ATOM   2517 C  CG  . LYS B 1 56  ? 15.671  -33.994 -12.310 1.00 43.35  ? 260  LYS B CG  1 
ATOM   2518 C  CD  . LYS B 1 56  ? 15.951  -35.239 -13.154 1.00 45.77  ? 260  LYS B CD  1 
ATOM   2519 C  CE  . LYS B 1 56  ? 15.029  -35.371 -14.369 1.00 46.66  ? 260  LYS B CE  1 
ATOM   2520 N  NZ  . LYS B 1 56  ? 15.229  -34.272 -15.358 1.00 47.61  ? 260  LYS B NZ  1 
ATOM   2521 N  N   . GLY B 1 57  ? 12.473  -32.590 -8.804  1.00 45.50  ? 261  GLY B N   1 
ATOM   2522 C  CA  . GLY B 1 57  ? 11.161  -32.181 -8.321  1.00 47.36  ? 261  GLY B CA  1 
ATOM   2523 C  C   . GLY B 1 57  ? 10.202  -33.328 -8.109  1.00 48.80  ? 261  GLY B C   1 
ATOM   2524 O  O   . GLY B 1 57  ? 9.041   -33.108 -7.775  1.00 49.04  ? 261  GLY B O   1 
ATOM   2525 N  N   . LEU B 1 58  ? 10.678  -34.556 -8.305  1.00 50.50  ? 262  LEU B N   1 
ATOM   2526 C  CA  . LEU B 1 58  ? 9.824   -35.734 -8.135  1.00 52.19  ? 262  LEU B CA  1 
ATOM   2527 C  C   . LEU B 1 58  ? 9.340   -35.887 -6.682  1.00 53.19  ? 262  LEU B C   1 
ATOM   2528 O  O   . LEU B 1 58  ? 8.198   -36.309 -6.439  1.00 53.55  ? 262  LEU B O   1 
ATOM   2529 C  CB  . LEU B 1 58  ? 10.542  -37.009 -8.614  1.00 52.21  ? 262  LEU B CB  1 
ATOM   2530 C  CG  . LEU B 1 58  ? 9.711   -38.112 -9.297  1.00 52.80  ? 262  LEU B CG  1 
ATOM   2531 C  CD1 . LEU B 1 58  ? 10.569  -39.004 -10.194 1.00 52.71  ? 262  LEU B CD1 1 
ATOM   2532 C  CD2 . LEU B 1 58  ? 8.927   -38.954 -8.290  1.00 53.09  ? 262  LEU B CD2 1 
ATOM   2533 N  N   . VAL B 1 59  ? 10.201  -35.514 -5.731  1.00 54.22  ? 263  VAL B N   1 
ATOM   2534 C  CA  . VAL B 1 59  ? 9.980   -35.768 -4.299  1.00 54.97  ? 263  VAL B CA  1 
ATOM   2535 C  C   . VAL B 1 59  ? 10.146  -34.495 -3.435  1.00 55.61  ? 263  VAL B C   1 
ATOM   2536 O  O   . VAL B 1 59  ? 9.471   -34.329 -2.413  1.00 55.20  ? 263  VAL B O   1 
ATOM   2537 C  CB  . VAL B 1 59  ? 10.900  -36.930 -3.822  1.00 54.86  ? 263  VAL B CB  1 
ATOM   2538 C  CG1 . VAL B 1 59  ? 10.823  -37.144 -2.326  1.00 55.07  ? 263  VAL B CG1 1 
ATOM   2539 C  CG2 . VAL B 1 59  ? 10.525  -38.209 -4.532  1.00 54.70  ? 263  VAL B CG2 1 
ATOM   2540 N  N   . TRP B 1 60  ? 11.037  -33.600 -3.862  1.00 56.81  ? 264  TRP B N   1 
ATOM   2541 C  CA  . TRP B 1 60  ? 11.225  -32.299 -3.205  1.00 57.80  ? 264  TRP B CA  1 
ATOM   2542 C  C   . TRP B 1 60  ? 10.702  -31.137 -4.077  1.00 58.56  ? 264  TRP B C   1 
ATOM   2543 O  O   . TRP B 1 60  ? 11.139  -30.963 -5.226  1.00 58.90  ? 264  TRP B O   1 
ATOM   2544 C  CB  . TRP B 1 60  ? 12.700  -32.074 -2.840  1.00 57.52  ? 264  TRP B CB  1 
ATOM   2545 C  CG  . TRP B 1 60  ? 13.165  -32.801 -1.607  1.00 57.17  ? 264  TRP B CG  1 
ATOM   2546 C  CD1 . TRP B 1 60  ? 13.019  -32.395 -0.314  1.00 57.21  ? 264  TRP B CD1 1 
ATOM   2547 C  CD2 . TRP B 1 60  ? 13.872  -34.046 -1.556  1.00 56.77  ? 264  TRP B CD2 1 
ATOM   2548 N  NE1 . TRP B 1 60  ? 13.580  -33.314 0.543   1.00 56.61  ? 264  TRP B NE1 1 
ATOM   2549 C  CE2 . TRP B 1 60  ? 14.111  -34.337 -0.195  1.00 56.61  ? 264  TRP B CE2 1 
ATOM   2550 C  CE3 . TRP B 1 60  ? 14.321  -34.949 -2.527  1.00 56.58  ? 264  TRP B CE3 1 
ATOM   2551 C  CZ2 . TRP B 1 60  ? 14.780  -35.493 0.219   1.00 56.79  ? 264  TRP B CZ2 1 
ATOM   2552 C  CZ3 . TRP B 1 60  ? 14.981  -36.097 -2.112  1.00 56.87  ? 264  TRP B CZ3 1 
ATOM   2553 C  CH2 . TRP B 1 60  ? 15.205  -36.357 -0.751  1.00 56.80  ? 264  TRP B CH2 1 
ATOM   2554 N  N   . LYS B 1 61  ? 9.773   -30.353 -3.521  1.00 59.19  ? 265  LYS B N   1 
ATOM   2555 C  CA  . LYS B 1 61  ? 9.131   -29.236 -4.238  1.00 59.70  ? 265  LYS B CA  1 
ATOM   2556 C  C   . LYS B 1 61  ? 10.071  -28.062 -4.512  1.00 59.82  ? 265  LYS B C   1 
ATOM   2557 O  O   . LYS B 1 61  ? 9.689   -27.090 -5.169  1.00 59.93  ? 265  LYS B O   1 
ATOM   2558 C  CB  . LYS B 1 61  ? 7.887   -28.740 -3.479  1.00 59.92  ? 265  LYS B CB  1 
ATOM   2559 C  CG  . LYS B 1 61  ? 6.598   -29.460 -3.842  1.00 60.03  ? 265  LYS B CG  1 
ATOM   2560 C  CD  . LYS B 1 61  ? 6.102   -29.047 -5.222  1.00 60.38  ? 265  LYS B CD  1 
ATOM   2561 C  CE  . LYS B 1 61  ? 4.881   -29.852 -5.627  1.00 60.97  ? 265  LYS B CE  1 
ATOM   2562 N  NZ  . LYS B 1 61  ? 4.388   -29.451 -6.972  1.00 61.50  ? 265  LYS B NZ  1 
ATOM   2563 N  N   . LEU B 1 67  ? 19.434  -25.136 -1.758  1.00 36.76  ? 271  LEU B N   1 
ATOM   2564 C  CA  . LEU B 1 67  ? 20.612  -25.850 -1.260  1.00 36.52  ? 271  LEU B CA  1 
ATOM   2565 C  C   . LEU B 1 67  ? 21.903  -25.159 -1.692  1.00 36.21  ? 271  LEU B C   1 
ATOM   2566 O  O   . LEU B 1 67  ? 21.895  -24.429 -2.684  1.00 36.37  ? 271  LEU B O   1 
ATOM   2567 C  CB  . LEU B 1 67  ? 20.605  -27.291 -1.772  1.00 36.67  ? 271  LEU B CB  1 
ATOM   2568 C  CG  . LEU B 1 67  ? 19.649  -28.325 -1.166  1.00 36.66  ? 271  LEU B CG  1 
ATOM   2569 C  CD1 . LEU B 1 67  ? 19.809  -29.625 -1.929  1.00 35.95  ? 271  LEU B CD1 1 
ATOM   2570 C  CD2 . LEU B 1 67  ? 19.895  -28.546 0.327   1.00 35.89  ? 271  LEU B CD2 1 
ATOM   2571 N  N   . PRO B 1 68  ? 23.022  -25.382 -0.959  1.00 35.59  ? 272  PRO B N   1 
ATOM   2572 C  CA  . PRO B 1 68  ? 24.289  -24.838 -1.445  1.00 35.35  ? 272  PRO B CA  1 
ATOM   2573 C  C   . PRO B 1 68  ? 24.717  -25.479 -2.778  1.00 35.08  ? 272  PRO B C   1 
ATOM   2574 O  O   . PRO B 1 68  ? 24.228  -26.556 -3.124  1.00 34.96  ? 272  PRO B O   1 
ATOM   2575 C  CB  . PRO B 1 68  ? 25.283  -25.195 -0.325  1.00 35.18  ? 272  PRO B CB  1 
ATOM   2576 C  CG  . PRO B 1 68  ? 24.443  -25.473 0.870   1.00 35.26  ? 272  PRO B CG  1 
ATOM   2577 C  CD  . PRO B 1 68  ? 23.204  -26.100 0.316   1.00 35.70  ? 272  PRO B CD  1 
ATOM   2578 N  N   . PRO B 1 69  ? 25.623  -24.815 -3.525  1.00 35.03  ? 273  PRO B N   1 
ATOM   2579 C  CA  . PRO B 1 69  ? 26.143  -25.337 -4.802  1.00 34.43  ? 273  PRO B CA  1 
ATOM   2580 C  C   . PRO B 1 69  ? 26.515  -26.830 -4.734  1.00 33.83  ? 273  PRO B C   1 
ATOM   2581 O  O   . PRO B 1 69  ? 27.066  -27.283 -3.722  1.00 33.72  ? 273  PRO B O   1 
ATOM   2582 C  CB  . PRO B 1 69  ? 27.389  -24.478 -5.060  1.00 34.52  ? 273  PRO B CB  1 
ATOM   2583 C  CG  . PRO B 1 69  ? 27.550  -23.575 -3.836  1.00 35.07  ? 273  PRO B CG  1 
ATOM   2584 C  CD  . PRO B 1 69  ? 26.212  -23.505 -3.189  1.00 35.12  ? 273  PRO B CD  1 
ATOM   2585 N  N   . TYR B 1 70  ? 26.193  -27.573 -5.795  1.00 32.90  ? 274  TYR B N   1 
ATOM   2586 C  CA  . TYR B 1 70  ? 26.422  -29.019 -5.855  1.00 32.34  ? 274  TYR B CA  1 
ATOM   2587 C  C   . TYR B 1 70  ? 27.922  -29.375 -5.795  1.00 31.89  ? 274  TYR B C   1 
ATOM   2588 O  O   . TYR B 1 70  ? 28.753  -28.729 -6.432  1.00 31.98  ? 274  TYR B O   1 
ATOM   2589 C  CB  . TYR B 1 70  ? 25.735  -29.639 -7.094  1.00 31.93  ? 274  TYR B CB  1 
ATOM   2590 C  CG  . TYR B 1 70  ? 25.973  -31.136 -7.247  1.00 32.17  ? 274  TYR B CG  1 
ATOM   2591 C  CD1 . TYR B 1 70  ? 25.288  -32.062 -6.454  1.00 31.05  ? 274  TYR B CD1 1 
ATOM   2592 C  CD2 . TYR B 1 70  ? 26.897  -31.623 -8.177  1.00 31.89  ? 274  TYR B CD2 1 
ATOM   2593 C  CE1 . TYR B 1 70  ? 25.517  -33.428 -6.589  1.00 31.80  ? 274  TYR B CE1 1 
ATOM   2594 C  CE2 . TYR B 1 70  ? 27.137  -32.979 -8.310  1.00 31.30  ? 274  TYR B CE2 1 
ATOM   2595 C  CZ  . TYR B 1 70  ? 26.448  -33.876 -7.514  1.00 31.41  ? 274  TYR B CZ  1 
ATOM   2596 O  OH  . TYR B 1 70  ? 26.687  -35.219 -7.647  1.00 30.96  ? 274  TYR B OH  1 
ATOM   2597 N  N   . LYS B 1 71  ? 28.259  -30.398 -5.014  1.00 31.28  ? 275  LYS B N   1 
ATOM   2598 C  CA  . LYS B 1 71  ? 29.648  -30.839 -4.894  1.00 30.75  ? 275  LYS B CA  1 
ATOM   2599 C  C   . LYS B 1 71  ? 29.843  -32.264 -5.424  1.00 29.93  ? 275  LYS B C   1 
ATOM   2600 O  O   . LYS B 1 71  ? 30.627  -32.483 -6.350  1.00 29.95  ? 275  LYS B O   1 
ATOM   2601 C  CB  . LYS B 1 71  ? 30.144  -30.719 -3.436  1.00 31.05  ? 275  LYS B CB  1 
ATOM   2602 C  CG  . LYS B 1 71  ? 30.191  -29.287 -2.886  1.00 32.77  ? 275  LYS B CG  1 
ATOM   2603 C  CD  . LYS B 1 71  ? 31.113  -28.417 -3.735  1.00 36.34  ? 275  LYS B CD  1 
ATOM   2604 C  CE  . LYS B 1 71  ? 31.262  -27.024 -3.158  1.00 38.08  ? 275  LYS B CE  1 
ATOM   2605 N  NZ  . LYS B 1 71  ? 32.378  -26.336 -3.864  1.00 40.20  ? 275  LYS B NZ  1 
ATOM   2606 N  N   . GLU B 1 72  ? 29.121  -33.210 -4.825  1.00 28.49  ? 276  GLU B N   1 
ATOM   2607 C  CA  . GLU B 1 72  ? 29.196  -34.637 -5.148  1.00 27.71  ? 276  GLU B CA  1 
ATOM   2608 C  C   . GLU B 1 72  ? 28.040  -35.339 -4.455  1.00 26.88  ? 276  GLU B C   1 
ATOM   2609 O  O   . GLU B 1 72  ? 27.461  -34.786 -3.520  1.00 26.76  ? 276  GLU B O   1 
ATOM   2610 C  CB  . GLU B 1 72  ? 30.519  -35.241 -4.670  1.00 27.90  ? 276  GLU B CB  1 
ATOM   2611 C  CG  . GLU B 1 72  ? 30.735  -35.155 -3.163  1.00 28.02  ? 276  GLU B CG  1 
ATOM   2612 C  CD  . GLU B 1 72  ? 32.041  -35.754 -2.728  1.00 28.98  ? 276  GLU B CD  1 
ATOM   2613 O  OE1 . GLU B 1 72  ? 32.122  -36.996 -2.635  1.00 30.32  ? 276  GLU B OE1 1 
ATOM   2614 O  OE2 . GLU B 1 72  ? 32.984  -34.981 -2.460  1.00 30.31  ? 276  GLU B OE2 1 
ATOM   2615 N  N   . ILE B 1 73  ? 27.717  -36.563 -4.872  1.00 26.57  ? 277  ILE B N   1 
ATOM   2616 C  CA  . ILE B 1 73  ? 26.516  -37.225 -4.333  1.00 26.24  ? 277  ILE B CA  1 
ATOM   2617 C  C   . ILE B 1 73  ? 26.482  -37.358 -2.799  1.00 25.32  ? 277  ILE B C   1 
ATOM   2618 O  O   . ILE B 1 73  ? 25.428  -37.180 -2.211  1.00 25.28  ? 277  ILE B O   1 
ATOM   2619 C  CB  . ILE B 1 73  ? 26.123  -38.596 -5.021  1.00 26.75  ? 277  ILE B CB  1 
ATOM   2620 C  CG1 . ILE B 1 73  ? 26.536  -39.792 -4.175  1.00 27.86  ? 277  ILE B CG1 1 
ATOM   2621 C  CG2 . ILE B 1 73  ? 26.608  -38.695 -6.477  1.00 27.02  ? 277  ILE B CG2 1 
ATOM   2622 C  CD1 . ILE B 1 73  ? 25.661  -41.020 -4.375  1.00 30.86  ? 277  ILE B CD1 1 
ATOM   2623 N  N   . SER B 1 74  ? 27.620  -37.645 -2.168  1.00 24.34  ? 278  SER B N   1 
ATOM   2624 C  CA  . SER B 1 74  ? 27.682  -37.877 -0.713  1.00 23.69  ? 278  SER B CA  1 
ATOM   2625 C  C   . SER B 1 74  ? 27.440  -36.616 0.101   1.00 23.27  ? 278  SER B C   1 
ATOM   2626 O  O   . SER B 1 74  ? 26.702  -36.650 1.087   1.00 23.65  ? 278  SER B O   1 
ATOM   2627 C  CB  . SER B 1 74  ? 29.022  -38.489 -0.326  1.00 23.88  ? 278  SER B CB  1 
ATOM   2628 O  OG  . SER B 1 74  ? 29.148  -39.790 -0.884  1.00 25.53  ? 278  SER B OG  1 
ATOM   2629 N  N   . VAL B 1 75  ? 28.078  -35.522 -0.318  1.00 22.21  ? 279  VAL B N   1 
ATOM   2630 C  CA  . VAL B 1 75  ? 27.827  -34.174 0.214   1.00 21.74  ? 279  VAL B CA  1 
ATOM   2631 C  C   . VAL B 1 75  ? 26.375  -33.729 -0.010  1.00 21.61  ? 279  VAL B C   1 
ATOM   2632 O  O   . VAL B 1 75  ? 25.751  -33.157 0.886   1.00 21.65  ? 279  VAL B O   1 
ATOM   2633 C  CB  . VAL B 1 75  ? 28.806  -33.125 -0.370  1.00 20.79  ? 279  VAL B CB  1 
ATOM   2634 C  CG1 . VAL B 1 75  ? 28.422  -31.711 0.079   1.00 22.11  ? 279  VAL B CG1 1 
ATOM   2635 C  CG2 . VAL B 1 75  ? 30.246  -33.422 0.042   1.00 20.34  ? 279  VAL B CG2 1 
ATOM   2636 N  N   . HIS B 1 76  ? 25.841  -33.983 -1.204  1.00 21.77  ? 280  HIS B N   1 
ATOM   2637 C  CA  . HIS B 1 76  ? 24.451  -33.659 -1.486  1.00 21.49  ? 280  HIS B CA  1 
ATOM   2638 C  C   . HIS B 1 76  ? 23.474  -34.331 -0.501  1.00 21.11  ? 280  HIS B C   1 
ATOM   2639 O  O   . HIS B 1 76  ? 22.613  -33.662 0.066   1.00 21.05  ? 280  HIS B O   1 
ATOM   2640 C  CB  . HIS B 1 76  ? 24.083  -33.983 -2.936  1.00 22.14  ? 280  HIS B CB  1 
ATOM   2641 C  CG  . HIS B 1 76  ? 22.629  -33.777 -3.229  1.00 23.78  ? 280  HIS B CG  1 
ATOM   2642 N  ND1 . HIS B 1 76  ? 22.087  -32.528 -3.441  1.00 25.14  ? 280  HIS B ND1 1 
ATOM   2643 C  CD2 . HIS B 1 76  ? 21.596  -34.653 -3.283  1.00 24.95  ? 280  HIS B CD2 1 
ATOM   2644 C  CE1 . HIS B 1 76  ? 20.785  -32.643 -3.629  1.00 25.51  ? 280  HIS B CE1 1 
ATOM   2645 N  NE2 . HIS B 1 76  ? 20.463  -33.922 -3.542  1.00 25.96  ? 280  HIS B NE2 1 
ATOM   2646 N  N   . VAL B 1 77  ? 23.596  -35.645 -0.312  1.00 20.15  ? 281  VAL B N   1 
ATOM   2647 C  CA  . VAL B 1 77  ? 22.796  -36.368 0.681   1.00 19.89  ? 281  VAL B CA  1 
ATOM   2648 C  C   . VAL B 1 77  ? 22.948  -35.783 2.109   1.00 20.02  ? 281  VAL B C   1 
ATOM   2649 O  O   . VAL B 1 77  ? 21.960  -35.664 2.837   1.00 19.17  ? 281  VAL B O   1 
ATOM   2650 C  CB  . VAL B 1 77  ? 23.146  -37.882 0.704   1.00 19.78  ? 281  VAL B CB  1 
ATOM   2651 C  CG1 . VAL B 1 77  ? 22.337  -38.608 1.763   1.00 19.75  ? 281  VAL B CG1 1 
ATOM   2652 C  CG2 . VAL B 1 77  ? 22.938  -38.518 -0.665  1.00 20.45  ? 281  VAL B CG2 1 
ATOM   2653 N  N   . PHE B 1 78  ? 24.181  -35.430 2.490   1.00 20.31  ? 282  PHE B N   1 
ATOM   2654 C  CA  . PHE B 1 78  ? 24.469  -34.794 3.787   1.00 20.62  ? 282  PHE B CA  1 
ATOM   2655 C  C   . PHE B 1 78  ? 23.727  -33.453 3.909   1.00 21.08  ? 282  PHE B C   1 
ATOM   2656 O  O   . PHE B 1 78  ? 23.237  -33.113 4.997   1.00 20.82  ? 282  PHE B O   1 
ATOM   2657 C  CB  . PHE B 1 78  ? 25.993  -34.636 3.997   1.00 20.46  ? 282  PHE B CB  1 
ATOM   2658 C  CG  . PHE B 1 78  ? 26.395  -34.099 5.373   1.00 20.96  ? 282  PHE B CG  1 
ATOM   2659 C  CD1 . PHE B 1 78  ? 26.240  -34.873 6.522   1.00 20.48  ? 282  PHE B CD1 1 
ATOM   2660 C  CD2 . PHE B 1 78  ? 26.964  -32.834 5.501   1.00 20.68  ? 282  PHE B CD2 1 
ATOM   2661 C  CE1 . PHE B 1 78  ? 26.620  -34.379 7.798   1.00 20.64  ? 282  PHE B CE1 1 
ATOM   2662 C  CE2 . PHE B 1 78  ? 27.352  -32.334 6.758   1.00 20.69  ? 282  PHE B CE2 1 
ATOM   2663 C  CZ  . PHE B 1 78  ? 27.163  -33.103 7.908   1.00 19.84  ? 282  PHE B CZ  1 
ATOM   2664 N  N   . TYR B 1 79  ? 23.602  -32.719 2.796   1.00 21.09  ? 283  TYR B N   1 
ATOM   2665 C  CA  . TYR B 1 79  ? 22.811  -31.474 2.790   1.00 21.83  ? 283  TYR B CA  1 
ATOM   2666 C  C   . TYR B 1 79  ? 21.323  -31.766 3.002   1.00 22.25  ? 283  TYR B C   1 
ATOM   2667 O  O   . TYR B 1 79  ? 20.618  -30.977 3.636   1.00 22.32  ? 283  TYR B O   1 
ATOM   2668 C  CB  . TYR B 1 79  ? 22.998  -30.660 1.502   1.00 21.69  ? 283  TYR B CB  1 
ATOM   2669 C  CG  . TYR B 1 79  ? 24.352  -29.998 1.333   1.00 21.87  ? 283  TYR B CG  1 
ATOM   2670 C  CD1 . TYR B 1 79  ? 25.171  -29.731 2.432   1.00 21.98  ? 283  TYR B CD1 1 
ATOM   2671 C  CD2 . TYR B 1 79  ? 24.799  -29.612 0.070   1.00 20.07  ? 283  TYR B CD2 1 
ATOM   2672 C  CE1 . TYR B 1 79  ? 26.415  -29.116 2.271   1.00 21.74  ? 283  TYR B CE1 1 
ATOM   2673 C  CE2 . TYR B 1 79  ? 26.037  -29.000 -0.099  1.00 21.12  ? 283  TYR B CE2 1 
ATOM   2674 C  CZ  . TYR B 1 79  ? 26.831  -28.753 1.005   1.00 21.13  ? 283  TYR B CZ  1 
ATOM   2675 O  OH  . TYR B 1 79  ? 28.052  -28.159 0.848   1.00 22.12  ? 283  TYR B OH  1 
ATOM   2676 N  N   . ARG B 1 80  ? 20.859  -32.907 2.486   1.00 22.76  ? 284  ARG B N   1 
ATOM   2677 C  CA  . ARG B 1 80  ? 19.474  -33.350 2.693   1.00 22.65  ? 284  ARG B CA  1 
ATOM   2678 C  C   . ARG B 1 80  ? 19.209  -33.873 4.115   1.00 22.64  ? 284  ARG B C   1 
ATOM   2679 O  O   . ARG B 1 80  ? 18.109  -33.704 4.641   1.00 22.88  ? 284  ARG B O   1 
ATOM   2680 C  CB  . ARG B 1 80  ? 19.056  -34.373 1.631   1.00 22.97  ? 284  ARG B CB  1 
ATOM   2681 C  CG  . ARG B 1 80  ? 18.789  -33.777 0.233   1.00 23.97  ? 284  ARG B CG  1 
ATOM   2682 C  CD  . ARG B 1 80  ? 17.490  -32.982 0.232   1.00 27.05  ? 284  ARG B CD  1 
ATOM   2683 N  NE  . ARG B 1 80  ? 17.162  -32.390 -1.063  1.00 28.20  ? 284  ARG B NE  1 
ATOM   2684 C  CZ  . ARG B 1 80  ? 16.425  -31.295 -1.208  1.00 29.70  ? 284  ARG B CZ  1 
ATOM   2685 N  NH1 . ARG B 1 80  ? 15.955  -30.666 -0.138  1.00 28.29  ? 284  ARG B NH1 1 
ATOM   2686 N  NH2 . ARG B 1 80  ? 16.170  -30.820 -2.422  1.00 31.63  ? 284  ARG B NH2 1 
ATOM   2687 N  N   . CYS B 1 81  ? 20.208  -34.507 4.729   1.00 22.61  ? 285  CYS B N   1 
ATOM   2688 C  CA  . CYS B 1 81  ? 20.191  -34.828 6.172   1.00 22.65  ? 285  CYS B CA  1 
ATOM   2689 C  C   . CYS B 1 81  ? 20.042  -33.559 7.011   1.00 22.04  ? 285  CYS B C   1 
ATOM   2690 O  O   . CYS B 1 81  ? 19.219  -33.511 7.933   1.00 21.97  ? 285  CYS B O   1 
ATOM   2691 C  CB  . CYS B 1 81  ? 21.478  -35.550 6.586   1.00 22.74  ? 285  CYS B CB  1 
ATOM   2692 S  SG  . CYS B 1 81  ? 21.670  -37.193 5.869   1.00 25.57  ? 285  CYS B SG  1 
ATOM   2693 N  N   . GLN B 1 82  ? 20.835  -32.537 6.684   1.00 21.46  ? 286  GLN B N   1 
ATOM   2694 C  CA  . GLN B 1 82  ? 20.751  -31.232 7.350   1.00 21.85  ? 286  GLN B CA  1 
ATOM   2695 C  C   . GLN B 1 82  ? 19.382  -30.551 7.215   1.00 21.95  ? 286  GLN B C   1 
ATOM   2696 O  O   . GLN B 1 82  ? 18.853  -30.059 8.192   1.00 21.30  ? 286  GLN B O   1 
ATOM   2697 C  CB  . GLN B 1 82  ? 21.853  -30.282 6.873   1.00 22.11  ? 286  GLN B CB  1 
ATOM   2698 C  CG  . GLN B 1 82  ? 23.265  -30.611 7.377   1.00 21.51  ? 286  GLN B CG  1 
ATOM   2699 C  CD  . GLN B 1 82  ? 24.251  -29.537 6.976   1.00 21.62  ? 286  GLN B CD  1 
ATOM   2700 O  OE1 . GLN B 1 82  ? 24.106  -28.389 7.370   1.00 22.67  ? 286  GLN B OE1 1 
ATOM   2701 N  NE2 . GLN B 1 82  ? 25.249  -29.899 6.180   1.00 19.98  ? 286  GLN B NE2 1 
ATOM   2702 N  N   . CYS B 1 83  ? 18.826  -30.510 6.006   1.00 22.92  ? 287  CYS B N   1 
ATOM   2703 C  CA  . CYS B 1 83  ? 17.451  -30.024 5.787   1.00 23.85  ? 287  CYS B CA  1 
ATOM   2704 C  C   . CYS B 1 83  ? 16.455  -30.671 6.737   1.00 23.32  ? 287  CYS B C   1 
ATOM   2705 O  O   . CYS B 1 83  ? 15.636  -29.986 7.359   1.00 23.88  ? 287  CYS B O   1 
ATOM   2706 C  CB  . CYS B 1 83  ? 16.990  -30.348 4.364   1.00 24.54  ? 287  CYS B CB  1 
ATOM   2707 S  SG  . CYS B 1 83  ? 17.798  -29.386 3.112   1.00 31.21  ? 287  CYS B SG  1 
ATOM   2708 N  N   . THR B 1 84  ? 16.527  -31.999 6.798   1.00 22.88  ? 288  THR B N   1 
ATOM   2709 C  CA  . THR B 1 84  ? 15.665  -32.849 7.589   1.00 22.69  ? 288  THR B CA  1 
ATOM   2710 C  C   . THR B 1 84  ? 15.782  -32.506 9.081   1.00 22.90  ? 288  THR B C   1 
ATOM   2711 O  O   . THR B 1 84  ? 14.770  -32.300 9.762   1.00 22.85  ? 288  THR B O   1 
ATOM   2712 C  CB  . THR B 1 84  ? 16.037  -34.351 7.364   1.00 22.77  ? 288  THR B CB  1 
ATOM   2713 O  OG1 . THR B 1 84  ? 16.020  -34.658 5.968   1.00 24.40  ? 288  THR B OG1 1 
ATOM   2714 C  CG2 . THR B 1 84  ? 15.076  -35.274 8.086   1.00 22.37  ? 288  THR B CG2 1 
ATOM   2715 N  N   . THR B 1 85  ? 17.012  -32.443 9.593   1.00 22.43  ? 289  THR B N   1 
ATOM   2716 C  CA  . THR B 1 85  ? 17.192  -32.244 11.028  1.00 21.78  ? 289  THR B CA  1 
ATOM   2717 C  C   . THR B 1 85  ? 16.782  -30.824 11.425  1.00 21.47  ? 289  THR B C   1 
ATOM   2718 O  O   . THR B 1 85  ? 16.187  -30.623 12.480  1.00 21.30  ? 289  THR B O   1 
ATOM   2719 C  CB  . THR B 1 85  ? 18.623  -32.616 11.532  1.00 21.68  ? 289  THR B CB  1 
ATOM   2720 O  OG1 . THR B 1 85  ? 19.602  -31.820 10.870  1.00 21.89  ? 289  THR B OG1 1 
ATOM   2721 C  CG2 . THR B 1 85  ? 18.947  -34.098 11.298  1.00 21.88  ? 289  THR B CG2 1 
ATOM   2722 N  N   . VAL B 1 86  ? 17.089  -29.846 10.581  1.00 21.54  ? 290  VAL B N   1 
ATOM   2723 C  CA  . VAL B 1 86  ? 16.707  -28.450 10.847  1.00 21.70  ? 290  VAL B CA  1 
ATOM   2724 C  C   . VAL B 1 86  ? 15.175  -28.264 10.844  1.00 22.23  ? 290  VAL B C   1 
ATOM   2725 O  O   . VAL B 1 86  ? 14.631  -27.609 11.727  1.00 21.89  ? 290  VAL B O   1 
ATOM   2726 C  CB  . VAL B 1 86  ? 17.400  -27.466 9.881   1.00 21.85  ? 290  VAL B CB  1 
ATOM   2727 C  CG1 . VAL B 1 86  ? 16.794  -26.064 9.990   1.00 21.54  ? 290  VAL B CG1 1 
ATOM   2728 C  CG2 . VAL B 1 86  ? 18.930  -27.448 10.133  1.00 21.55  ? 290  VAL B CG2 1 
ATOM   2729 N  N   . GLU B 1 87  ? 14.490  -28.865 9.874   1.00 22.85  ? 291  GLU B N   1 
ATOM   2730 C  CA  . GLU B 1 87  ? 13.014  -28.929 9.889   1.00 24.02  ? 291  GLU B CA  1 
ATOM   2731 C  C   . GLU B 1 87  ? 12.463  -29.571 11.185  1.00 23.68  ? 291  GLU B C   1 
ATOM   2732 O  O   . GLU B 1 87  ? 11.516  -29.060 11.793  1.00 23.98  ? 291  GLU B O   1 
ATOM   2733 C  CB  . GLU B 1 87  ? 12.492  -29.633 8.623   1.00 23.69  ? 291  GLU B CB  1 
ATOM   2734 C  CG  . GLU B 1 87  ? 10.988  -29.908 8.573   1.00 28.58  ? 291  GLU B CG  1 
ATOM   2735 C  CD  . GLU B 1 87  ? 10.123  -28.656 8.662   1.00 32.75  ? 291  GLU B CD  1 
ATOM   2736 O  OE1 . GLU B 1 87  ? 10.613  -27.536 8.363   1.00 33.49  ? 291  GLU B OE1 1 
ATOM   2737 O  OE2 . GLU B 1 87  ? 8.936   -28.801 9.036   1.00 36.33  ? 291  GLU B OE2 1 
ATOM   2738 N  N   . THR B 1 88  ? 13.082  -30.659 11.623  1.00 23.56  ? 292  THR B N   1 
ATOM   2739 C  CA  . THR B 1 88  ? 12.674  -31.342 12.860  1.00 23.73  ? 292  THR B CA  1 
ATOM   2740 C  C   . THR B 1 88  ? 12.927  -30.488 14.126  1.00 23.60  ? 292  THR B C   1 
ATOM   2741 O  O   . THR B 1 88  ? 12.142  -30.515 15.071  1.00 23.32  ? 292  THR B O   1 
ATOM   2742 C  CB  . THR B 1 88  ? 13.356  -32.705 12.979  1.00 23.83  ? 292  THR B CB  1 
ATOM   2743 O  OG1 . THR B 1 88  ? 13.246  -33.395 11.725  1.00 24.66  ? 292  THR B OG1 1 
ATOM   2744 C  CG2 . THR B 1 88  ? 12.690  -33.546 14.056  1.00 23.69  ? 292  THR B CG2 1 
ATOM   2745 N  N   . VAL B 1 89  ? 14.016  -29.725 14.130  1.00 23.53  ? 293  VAL B N   1 
ATOM   2746 C  CA  . VAL B 1 89  ? 14.255  -28.751 15.191  1.00 23.85  ? 293  VAL B CA  1 
ATOM   2747 C  C   . VAL B 1 89  ? 13.105  -27.719 15.266  1.00 24.43  ? 293  VAL B C   1 
ATOM   2748 O  O   . VAL B 1 89  ? 12.658  -27.375 16.364  1.00 24.68  ? 293  VAL B O   1 
ATOM   2749 C  CB  . VAL B 1 89  ? 15.660  -28.101 15.081  1.00 24.06  ? 293  VAL B CB  1 
ATOM   2750 C  CG1 . VAL B 1 89  ? 15.823  -26.969 16.102  1.00 22.96  ? 293  VAL B CG1 1 
ATOM   2751 C  CG2 . VAL B 1 89  ? 16.747  -29.162 15.274  1.00 22.69  ? 293  VAL B CG2 1 
ATOM   2752 N  N   . ARG B 1 90  ? 12.601  -27.269 14.113  1.00 24.22  ? 294  ARG B N   1 
ATOM   2753 C  CA  . ARG B 1 90  ? 11.429  -26.371 14.059  1.00 24.07  ? 294  ARG B CA  1 
ATOM   2754 C  C   . ARG B 1 90  ? 10.198  -26.972 14.741  1.00 23.36  ? 294  ARG B C   1 
ATOM   2755 O  O   . ARG B 1 90  ? 9.517   -26.292 15.518  1.00 23.35  ? 294  ARG B O   1 
ATOM   2756 C  CB  . ARG B 1 90  ? 11.052  -26.032 12.610  1.00 24.74  ? 294  ARG B CB  1 
ATOM   2757 C  CG  . ARG B 1 90  ? 12.001  -25.114 11.888  1.00 27.28  ? 294  ARG B CG  1 
ATOM   2758 C  CD  . ARG B 1 90  ? 11.216  -24.303 10.874  1.00 32.65  ? 294  ARG B CD  1 
ATOM   2759 N  NE  . ARG B 1 90  ? 12.065  -23.449 10.050  1.00 35.92  ? 294  ARG B NE  1 
ATOM   2760 C  CZ  . ARG B 1 90  ? 12.337  -22.172 10.307  1.00 38.13  ? 294  ARG B CZ  1 
ATOM   2761 N  NH1 . ARG B 1 90  ? 11.843  -21.571 11.389  1.00 37.93  ? 294  ARG B NH1 1 
ATOM   2762 N  NH2 . ARG B 1 90  ? 13.122  -21.493 9.475   1.00 39.12  ? 294  ARG B NH2 1 
ATOM   2763 N  N   . GLU B 1 91  ? 9.926   -28.238 14.434  1.00 21.98  ? 295  GLU B N   1 
ATOM   2764 C  CA  . GLU B 1 91  ? 8.791   -28.973 14.987  1.00 22.22  ? 295  GLU B CA  1 
ATOM   2765 C  C   . GLU B 1 91  ? 8.933   -29.277 16.476  1.00 21.07  ? 295  GLU B C   1 
ATOM   2766 O  O   . GLU B 1 91  ? 7.967   -29.137 17.221  1.00 21.04  ? 295  GLU B O   1 
ATOM   2767 C  CB  . GLU B 1 91  ? 8.563   -30.267 14.229  1.00 22.17  ? 295  GLU B CB  1 
ATOM   2768 C  CG  . GLU B 1 91  ? 8.259   -30.075 12.738  1.00 25.48  ? 295  GLU B CG  1 
ATOM   2769 C  CD  . GLU B 1 91  ? 7.727   -31.328 12.089  1.00 29.42  ? 295  GLU B CD  1 
ATOM   2770 O  OE1 . GLU B 1 91  ? 8.151   -32.447 12.468  1.00 29.90  ? 295  GLU B OE1 1 
ATOM   2771 O  OE2 . GLU B 1 91  ? 6.868   -31.190 11.188  1.00 33.97  ? 295  GLU B OE2 1 
ATOM   2772 N  N   . LEU B 1 92  ? 10.130  -29.675 16.903  1.00 19.72  ? 296  LEU B N   1 
ATOM   2773 C  CA  . LEU B 1 92  ? 10.409  -29.887 18.336  1.00 18.76  ? 296  LEU B CA  1 
ATOM   2774 C  C   . LEU B 1 92  ? 10.252  -28.597 19.130  1.00 19.05  ? 296  LEU B C   1 
ATOM   2775 O  O   . LEU B 1 92  ? 9.797   -28.641 20.286  1.00 19.98  ? 296  LEU B O   1 
ATOM   2776 C  CB  . LEU B 1 92  ? 11.802  -30.498 18.561  1.00 17.55  ? 296  LEU B CB  1 
ATOM   2777 C  CG  . LEU B 1 92  ? 11.963  -31.984 18.208  1.00 16.66  ? 296  LEU B CG  1 
ATOM   2778 C  CD1 . LEU B 1 92  ? 13.450  -32.390 18.033  1.00 13.29  ? 296  LEU B CD1 1 
ATOM   2779 C  CD2 . LEU B 1 92  ? 11.239  -32.893 19.207  1.00 14.64  ? 296  LEU B CD2 1 
ATOM   2780 N  N   . THR B 1 93  ? 10.613  -27.463 18.519  1.00 18.30  ? 297  THR B N   1 
ATOM   2781 C  CA  . THR B 1 93  ? 10.480  -26.152 19.172  1.00 18.99  ? 297  THR B CA  1 
ATOM   2782 C  C   . THR B 1 93  ? 9.011   -25.795 19.432  1.00 18.58  ? 297  THR B C   1 
ATOM   2783 O  O   . THR B 1 93  ? 8.668   -25.320 20.518  1.00 19.03  ? 297  THR B O   1 
ATOM   2784 C  CB  . THR B 1 93  ? 11.200  -25.011 18.374  1.00 18.88  ? 297  THR B CB  1 
ATOM   2785 O  OG1 . THR B 1 93  ? 12.603  -25.274 18.311  1.00 19.74  ? 297  THR B OG1 1 
ATOM   2786 C  CG2 . THR B 1 93  ? 10.990  -23.634 19.038  1.00 19.42  ? 297  THR B CG2 1 
ATOM   2787 N  N   . GLU B 1 94  ? 8.156   -26.035 18.437  1.00 18.97  ? 298  GLU B N   1 
ATOM   2788 C  CA  . GLU B 1 94  ? 6.720   -25.786 18.567  1.00 19.04  ? 298  GLU B CA  1 
ATOM   2789 C  C   . GLU B 1 94  ? 6.047   -26.747 19.528  1.00 18.41  ? 298  GLU B C   1 
ATOM   2790 O  O   . GLU B 1 94  ? 5.182   -26.338 20.285  1.00 18.41  ? 298  GLU B O   1 
ATOM   2791 C  CB  . GLU B 1 94  ? 6.024   -25.844 17.199  1.00 19.54  ? 298  GLU B CB  1 
ATOM   2792 C  CG  . GLU B 1 94  ? 6.504   -24.822 16.188  1.00 23.42  ? 298  GLU B CG  1 
ATOM   2793 C  CD  . GLU B 1 94  ? 6.505   -23.394 16.748  1.00 28.11  ? 298  GLU B CD  1 
ATOM   2794 O  OE1 . GLU B 1 94  ? 5.556   -23.011 17.468  1.00 30.21  ? 298  GLU B OE1 1 
ATOM   2795 O  OE2 . GLU B 1 94  ? 7.469   -22.654 16.473  1.00 31.04  ? 298  GLU B OE2 1 
ATOM   2796 N  N   . PHE B 1 95  ? 6.408   -28.031 19.461  1.00 17.98  ? 299  PHE B N   1 
ATOM   2797 C  CA  . PHE B 1 95  ? 5.935   -29.027 20.425  1.00 17.84  ? 299  PHE B CA  1 
ATOM   2798 C  C   . PHE B 1 95  ? 6.219   -28.585 21.866  1.00 18.07  ? 299  PHE B C   1 
ATOM   2799 O  O   . PHE B 1 95  ? 5.321   -28.535 22.698  1.00 17.64  ? 299  PHE B O   1 
ATOM   2800 C  CB  . PHE B 1 95  ? 6.573   -30.395 20.115  1.00 17.24  ? 299  PHE B CB  1 
ATOM   2801 C  CG  . PHE B 1 95  ? 6.388   -31.447 21.196  1.00 17.46  ? 299  PHE B CG  1 
ATOM   2802 C  CD1 . PHE B 1 95  ? 5.121   -31.906 21.553  1.00 17.16  ? 299  PHE B CD1 1 
ATOM   2803 C  CD2 . PHE B 1 95  ? 7.499   -32.016 21.823  1.00 19.10  ? 299  PHE B CD2 1 
ATOM   2804 C  CE1 . PHE B 1 95  ? 4.962   -32.906 22.537  1.00 16.97  ? 299  PHE B CE1 1 
ATOM   2805 C  CE2 . PHE B 1 95  ? 7.353   -33.007 22.820  1.00 16.21  ? 299  PHE B CE2 1 
ATOM   2806 C  CZ  . PHE B 1 95  ? 6.084   -33.449 23.165  1.00 16.91  ? 299  PHE B CZ  1 
ATOM   2807 N  N   . ALA B 1 96  ? 7.464   -28.228 22.137  1.00 18.38  ? 300  ALA B N   1 
ATOM   2808 C  CA  . ALA B 1 96  ? 7.877   -27.782 23.458  1.00 19.57  ? 300  ALA B CA  1 
ATOM   2809 C  C   . ALA B 1 96  ? 7.147   -26.479 23.889  1.00 20.54  ? 300  ALA B C   1 
ATOM   2810 O  O   . ALA B 1 96  ? 6.772   -26.317 25.055  1.00 20.00  ? 300  ALA B O   1 
ATOM   2811 C  CB  . ALA B 1 96  ? 9.394   -27.594 23.476  1.00 18.78  ? 300  ALA B CB  1 
ATOM   2812 N  N   . LYS B 1 97  ? 6.918   -25.568 22.945  1.00 21.83  ? 301  LYS B N   1 
ATOM   2813 C  CA  . LYS B 1 97  ? 6.197   -24.339 23.273  1.00 23.23  ? 301  LYS B CA  1 
ATOM   2814 C  C   . LYS B 1 97  ? 4.721   -24.599 23.617  1.00 24.03  ? 301  LYS B C   1 
ATOM   2815 O  O   . LYS B 1 97  ? 4.109   -23.779 24.296  1.00 24.93  ? 301  LYS B O   1 
ATOM   2816 C  CB  . LYS B 1 97  ? 6.328   -23.290 22.171  1.00 23.59  ? 301  LYS B CB  1 
ATOM   2817 C  CG  . LYS B 1 97  ? 7.733   -22.756 21.986  1.00 25.12  ? 301  LYS B CG  1 
ATOM   2818 C  CD  . LYS B 1 97  ? 7.730   -21.412 21.312  1.00 29.11  ? 301  LYS B CD  1 
ATOM   2819 C  CE  . LYS B 1 97  ? 7.010   -21.424 19.984  1.00 31.53  ? 301  LYS B CE  1 
ATOM   2820 N  NZ  . LYS B 1 97  ? 7.951   -21.799 18.892  1.00 35.23  ? 301  LYS B NZ  1 
ATOM   2821 N  N   . SER B 1 98  ? 4.181   -25.747 23.187  1.00 24.05  ? 302  SER B N   1 
ATOM   2822 C  CA  . SER B 1 98  ? 2.776   -26.139 23.456  1.00 24.48  ? 302  SER B CA  1 
ATOM   2823 C  C   . SER B 1 98  ? 2.575   -26.872 24.786  1.00 25.04  ? 302  SER B C   1 
ATOM   2824 O  O   . SER B 1 98  ? 1.446   -27.214 25.163  1.00 25.03  ? 302  SER B O   1 
ATOM   2825 C  CB  . SER B 1 98  ? 2.217   -26.989 22.319  1.00 23.86  ? 302  SER B CB  1 
ATOM   2826 O  OG  . SER B 1 98  ? 2.102   -26.212 21.154  1.00 24.04  ? 302  SER B OG  1 
ATOM   2827 N  N   . ILE B 1 99  ? 3.679   -27.113 25.480  1.00 25.53  ? 303  ILE B N   1 
ATOM   2828 C  CA  . ILE B 1 99  ? 3.667   -27.609 26.847  1.00 26.41  ? 303  ILE B CA  1 
ATOM   2829 C  C   . ILE B 1 99  ? 3.746   -26.340 27.707  1.00 27.02  ? 303  ILE B C   1 
ATOM   2830 O  O   . ILE B 1 99  ? 4.752   -25.635 27.645  1.00 27.31  ? 303  ILE B O   1 
ATOM   2831 C  CB  . ILE B 1 99  ? 4.907   -28.480 27.113  1.00 26.35  ? 303  ILE B CB  1 
ATOM   2832 C  CG1 . ILE B 1 99  ? 4.931   -29.682 26.153  1.00 26.18  ? 303  ILE B CG1 1 
ATOM   2833 C  CG2 . ILE B 1 99  ? 4.974   -28.900 28.584  1.00 26.64  ? 303  ILE B CG2 1 
ATOM   2834 C  CD1 . ILE B 1 99  ? 6.170   -30.543 26.254  1.00 26.12  ? 303  ILE B CD1 1 
ATOM   2835 N  N   . PRO B 1 100 ? 2.691   -26.048 28.506  1.00 27.34  ? 304  PRO B N   1 
ATOM   2836 C  CA  . PRO B 1 100 ? 2.677   -24.804 29.294  1.00 27.27  ? 304  PRO B CA  1 
ATOM   2837 C  C   . PRO B 1 100 ? 3.858   -24.689 30.254  1.00 26.95  ? 304  PRO B C   1 
ATOM   2838 O  O   . PRO B 1 100 ? 4.368   -23.590 30.459  1.00 26.75  ? 304  PRO B O   1 
ATOM   2839 C  CB  . PRO B 1 100 ? 1.356   -24.886 30.076  1.00 27.15  ? 304  PRO B CB  1 
ATOM   2840 C  CG  . PRO B 1 100 ? 0.492   -25.811 29.253  1.00 28.10  ? 304  PRO B CG  1 
ATOM   2841 C  CD  . PRO B 1 100 ? 1.463   -26.837 28.721  1.00 27.27  ? 304  PRO B CD  1 
ATOM   2842 N  N   . SER B 1 101 ? 4.289   -25.814 30.819  1.00 26.57  ? 305  SER B N   1 
ATOM   2843 C  CA  . SER B 1 101 ? 5.394   -25.813 31.773  1.00 26.59  ? 305  SER B CA  1 
ATOM   2844 C  C   . SER B 1 101 ? 6.738   -25.417 31.137  1.00 26.39  ? 305  SER B C   1 
ATOM   2845 O  O   . SER B 1 101 ? 7.552   -24.768 31.789  1.00 25.90  ? 305  SER B O   1 
ATOM   2846 C  CB  . SER B 1 101 ? 5.482   -27.156 32.506  1.00 27.16  ? 305  SER B CB  1 
ATOM   2847 O  OG  . SER B 1 101 ? 5.556   -28.233 31.591  1.00 28.59  ? 305  SER B OG  1 
ATOM   2848 N  N   . PHE B 1 102 ? 6.947   -25.777 29.866  1.00 25.82  ? 306  PHE B N   1 
ATOM   2849 C  CA  . PHE B 1 102 ? 8.106   -25.314 29.075  1.00 25.41  ? 306  PHE B CA  1 
ATOM   2850 C  C   . PHE B 1 102 ? 8.030   -23.805 28.748  1.00 25.41  ? 306  PHE B C   1 
ATOM   2851 O  O   . PHE B 1 102 ? 8.997   -23.063 28.935  1.00 24.95  ? 306  PHE B O   1 
ATOM   2852 C  CB  . PHE B 1 102 ? 8.185   -26.129 27.772  1.00 25.32  ? 306  PHE B CB  1 
ATOM   2853 C  CG  . PHE B 1 102 ? 9.371   -25.797 26.893  1.00 25.40  ? 306  PHE B CG  1 
ATOM   2854 C  CD1 . PHE B 1 102 ? 9.302   -24.760 25.950  1.00 24.25  ? 306  PHE B CD1 1 
ATOM   2855 C  CD2 . PHE B 1 102 ? 10.555  -26.539 26.990  1.00 25.84  ? 306  PHE B CD2 1 
ATOM   2856 C  CE1 . PHE B 1 102 ? 10.400  -24.460 25.124  1.00 24.37  ? 306  PHE B CE1 1 
ATOM   2857 C  CE2 . PHE B 1 102 ? 11.660  -26.244 26.174  1.00 25.61  ? 306  PHE B CE2 1 
ATOM   2858 C  CZ  . PHE B 1 102 ? 11.579  -25.201 25.236  1.00 24.61  ? 306  PHE B CZ  1 
ATOM   2859 N  N   . SER B 1 103 ? 6.875   -23.368 28.258  1.00 25.45  ? 307  SER B N   1 
ATOM   2860 C  CA  . SER B 1 103 ? 6.654   -21.977 27.831  1.00 25.73  ? 307  SER B CA  1 
ATOM   2861 C  C   . SER B 1 103 ? 6.737   -20.931 28.916  1.00 25.76  ? 307  SER B C   1 
ATOM   2862 O  O   . SER B 1 103 ? 6.889   -19.738 28.607  1.00 25.81  ? 307  SER B O   1 
ATOM   2863 C  CB  . SER B 1 103 ? 5.293   -21.838 27.160  1.00 25.82  ? 307  SER B CB  1 
ATOM   2864 O  OG  . SER B 1 103 ? 5.444   -21.836 25.763  1.00 29.40  ? 307  SER B OG  1 
ATOM   2865 N  N   . SER B 1 104 ? 6.602   -21.343 30.174  1.00 25.93  ? 308  SER B N   1 
ATOM   2866 C  CA  . SER B 1 104 ? 6.728   -20.395 31.286  1.00 26.45  ? 308  SER B CA  1 
ATOM   2867 C  C   . SER B 1 104 ? 8.153   -20.246 31.824  1.00 26.07  ? 308  SER B C   1 
ATOM   2868 O  O   . SER B 1 104 ? 8.418   -19.358 32.635  1.00 26.23  ? 308  SER B O   1 
ATOM   2869 C  CB  . SER B 1 104 ? 5.715   -20.679 32.402  1.00 26.74  ? 308  SER B CB  1 
ATOM   2870 O  OG  . SER B 1 104 ? 5.544   -22.061 32.611  1.00 30.02  ? 308  SER B OG  1 
ATOM   2871 N  N   . LEU B 1 105 ? 9.076   -21.089 31.346  1.00 25.51  ? 309  LEU B N   1 
ATOM   2872 C  CA  . LEU B 1 105 ? 10.506  -20.902 31.608  1.00 25.24  ? 309  LEU B CA  1 
ATOM   2873 C  C   . LEU B 1 105 ? 10.974  -19.634 30.923  1.00 25.09  ? 309  LEU B C   1 
ATOM   2874 O  O   . LEU B 1 105 ? 10.401  -19.222 29.919  1.00 25.21  ? 309  LEU B O   1 
ATOM   2875 C  CB  . LEU B 1 105 ? 11.338  -22.102 31.116  1.00 24.86  ? 309  LEU B CB  1 
ATOM   2876 C  CG  . LEU B 1 105 ? 11.056  -23.453 31.784  1.00 24.92  ? 309  LEU B CG  1 
ATOM   2877 C  CD1 . LEU B 1 105 ? 11.687  -24.593 31.001  1.00 23.38  ? 309  LEU B CD1 1 
ATOM   2878 C  CD2 . LEU B 1 105 ? 11.552  -23.446 33.250  1.00 23.61  ? 309  LEU B CD2 1 
ATOM   2879 N  N   . PHE B 1 106 ? 12.008  -19.005 31.462  1.00 25.43  ? 310  PHE B N   1 
ATOM   2880 C  CA  . PHE B 1 106 ? 12.595  -17.869 30.769  1.00 25.71  ? 310  PHE B CA  1 
ATOM   2881 C  C   . PHE B 1 106 ? 13.113  -18.380 29.431  1.00 25.51  ? 310  PHE B C   1 
ATOM   2882 O  O   . PHE B 1 106 ? 13.501  -19.546 29.313  1.00 25.25  ? 310  PHE B O   1 
ATOM   2883 C  CB  . PHE B 1 106 ? 13.734  -17.245 31.568  1.00 25.90  ? 310  PHE B CB  1 
ATOM   2884 C  CG  . PHE B 1 106 ? 13.282  -16.309 32.649  1.00 26.44  ? 310  PHE B CG  1 
ATOM   2885 C  CD1 . PHE B 1 106 ? 12.758  -15.055 32.327  1.00 26.91  ? 310  PHE B CD1 1 
ATOM   2886 C  CD2 . PHE B 1 106 ? 13.403  -16.668 33.991  1.00 26.49  ? 310  PHE B CD2 1 
ATOM   2887 C  CE1 . PHE B 1 106 ? 12.343  -14.179 33.337  1.00 28.69  ? 310  PHE B CE1 1 
ATOM   2888 C  CE2 . PHE B 1 106 ? 12.992  -15.791 35.016  1.00 27.85  ? 310  PHE B CE2 1 
ATOM   2889 C  CZ  . PHE B 1 106 ? 12.463  -14.550 34.680  1.00 26.86  ? 310  PHE B CZ  1 
ATOM   2890 N  N   . LEU B 1 107 ? 13.113  -17.506 28.433  1.00 25.31  ? 311  LEU B N   1 
ATOM   2891 C  CA  . LEU B 1 107 ? 13.456  -17.889 27.068  1.00 24.90  ? 311  LEU B CA  1 
ATOM   2892 C  C   . LEU B 1 107 ? 14.882  -18.441 26.913  1.00 24.58  ? 311  LEU B C   1 
ATOM   2893 O  O   . LEU B 1 107 ? 15.116  -19.329 26.077  1.00 24.83  ? 311  LEU B O   1 
ATOM   2894 C  CB  . LEU B 1 107 ? 13.243  -16.710 26.125  1.00 25.31  ? 311  LEU B CB  1 
ATOM   2895 C  CG  . LEU B 1 107 ? 12.715  -17.054 24.741  1.00 25.57  ? 311  LEU B CG  1 
ATOM   2896 C  CD1 . LEU B 1 107 ? 11.272  -17.534 24.830  1.00 26.17  ? 311  LEU B CD1 1 
ATOM   2897 C  CD2 . LEU B 1 107 ? 12.820  -15.817 23.871  1.00 26.00  ? 311  LEU B CD2 1 
ATOM   2898 N  N   . ASN B 1 108 ? 15.828  -17.924 27.699  1.00 23.71  ? 312  ASN B N   1 
ATOM   2899 C  CA  . ASN B 1 108 ? 17.180  -18.477 27.681  1.00 23.06  ? 312  ASN B CA  1 
ATOM   2900 C  C   . ASN B 1 108 ? 17.229  -19.939 28.122  1.00 22.57  ? 312  ASN B C   1 
ATOM   2901 O  O   . ASN B 1 108 ? 18.022  -20.711 27.604  1.00 22.03  ? 312  ASN B O   1 
ATOM   2902 C  CB  . ASN B 1 108 ? 18.197  -17.617 28.445  1.00 23.52  ? 312  ASN B CB  1 
ATOM   2903 C  CG  . ASN B 1 108 ? 17.806  -17.337 29.911  1.00 23.61  ? 312  ASN B CG  1 
ATOM   2904 O  OD1 . ASN B 1 108 ? 18.648  -17.443 30.816  1.00 24.15  ? 312  ASN B OD1 1 
ATOM   2905 N  ND2 . ASN B 1 108 ? 16.566  -16.927 30.139  1.00 20.11  ? 312  ASN B ND2 1 
ATOM   2906 N  N   . ASP B 1 109 ? 16.360  -20.312 29.060  1.00 22.46  ? 313  ASP B N   1 
ATOM   2907 C  CA  . ASP B 1 109 ? 16.300  -21.693 29.550  1.00 21.98  ? 313  ASP B CA  1 
ATOM   2908 C  C   . ASP B 1 109 ? 15.641  -22.591 28.498  1.00 21.80  ? 313  ASP B C   1 
ATOM   2909 O  O   . ASP B 1 109 ? 16.036  -23.740 28.322  1.00 22.05  ? 313  ASP B O   1 
ATOM   2910 C  CB  . ASP B 1 109 ? 15.570  -21.760 30.894  1.00 21.81  ? 313  ASP B CB  1 
ATOM   2911 C  CG  . ASP B 1 109 ? 16.517  -21.711 32.095  1.00 22.74  ? 313  ASP B CG  1 
ATOM   2912 O  OD1 . ASP B 1 109 ? 17.754  -21.641 31.935  1.00 23.10  ? 313  ASP B OD1 1 
ATOM   2913 O  OD2 . ASP B 1 109 ? 16.004  -21.764 33.223  1.00 24.36  ? 313  ASP B OD2 1 
ATOM   2914 N  N   . GLN B 1 110 ? 14.651  -22.054 27.784  1.00 21.57  ? 314  GLN B N   1 
ATOM   2915 C  CA  . GLN B 1 110 ? 14.033  -22.761 26.657  1.00 21.37  ? 314  GLN B CA  1 
ATOM   2916 C  C   . GLN B 1 110 ? 15.072  -23.139 25.585  1.00 20.55  ? 314  GLN B C   1 
ATOM   2917 O  O   . GLN B 1 110 ? 15.182  -24.304 25.183  1.00 20.32  ? 314  GLN B O   1 
ATOM   2918 C  CB  . GLN B 1 110 ? 12.915  -21.913 26.049  1.00 21.50  ? 314  GLN B CB  1 
ATOM   2919 C  CG  . GLN B 1 110 ? 11.758  -21.664 26.996  1.00 22.55  ? 314  GLN B CG  1 
ATOM   2920 C  CD  . GLN B 1 110 ? 10.630  -20.871 26.362  1.00 22.80  ? 314  GLN B CD  1 
ATOM   2921 O  OE1 . GLN B 1 110 ? 10.306  -21.045 25.185  1.00 25.53  ? 314  GLN B OE1 1 
ATOM   2922 N  NE2 . GLN B 1 110 ? 10.014  -20.001 27.150  1.00 24.02  ? 314  GLN B NE2 1 
ATOM   2923 N  N   . VAL B 1 111 ? 15.854  -22.152 25.161  1.00 20.02  ? 315  VAL B N   1 
ATOM   2924 C  CA  . VAL B 1 111 ? 16.939  -22.340 24.183  1.00 19.62  ? 315  VAL B CA  1 
ATOM   2925 C  C   . VAL B 1 111 ? 18.030  -23.322 24.634  1.00 18.72  ? 315  VAL B C   1 
ATOM   2926 O  O   . VAL B 1 111 ? 18.556  -24.071 23.819  1.00 18.76  ? 315  VAL B O   1 
ATOM   2927 C  CB  . VAL B 1 111 ? 17.599  -20.977 23.819  1.00 18.98  ? 315  VAL B CB  1 
ATOM   2928 C  CG1 . VAL B 1 111 ? 18.952  -21.185 23.130  1.00 20.34  ? 315  VAL B CG1 1 
ATOM   2929 C  CG2 . VAL B 1 111 ? 16.679  -20.193 22.952  1.00 19.36  ? 315  VAL B CG2 1 
ATOM   2930 N  N   . THR B 1 112 ? 18.402  -23.280 25.907  1.00 18.20  ? 316  THR B N   1 
ATOM   2931 C  CA  . THR B 1 112 ? 19.389  -24.215 26.448  1.00 18.47  ? 316  THR B CA  1 
ATOM   2932 C  C   . THR B 1 112 ? 18.835  -25.644 26.388  1.00 18.12  ? 316  THR B C   1 
ATOM   2933 O  O   . THR B 1 112 ? 19.558  -26.602 26.093  1.00 17.23  ? 316  THR B O   1 
ATOM   2934 C  CB  . THR B 1 112 ? 19.735  -23.866 27.925  1.00 18.90  ? 316  THR B CB  1 
ATOM   2935 O  OG1 . THR B 1 112 ? 20.497  -22.650 27.983  1.00 19.97  ? 316  THR B OG1 1 
ATOM   2936 C  CG2 . THR B 1 112 ? 20.518  -24.985 28.602  1.00 19.27  ? 316  THR B CG2 1 
ATOM   2937 N  N   . LEU B 1 113 ? 17.546  -25.780 26.696  1.00 18.12  ? 317  LEU B N   1 
ATOM   2938 C  CA  . LEU B 1 113 ? 16.890  -27.093 26.700  1.00 19.06  ? 317  LEU B CA  1 
ATOM   2939 C  C   . LEU B 1 113 ? 16.842  -27.720 25.290  1.00 18.62  ? 317  LEU B C   1 
ATOM   2940 O  O   . LEU B 1 113 ? 17.169  -28.899 25.096  1.00 19.06  ? 317  LEU B O   1 
ATOM   2941 C  CB  . LEU B 1 113 ? 15.495  -26.957 27.316  1.00 18.77  ? 317  LEU B CB  1 
ATOM   2942 C  CG  . LEU B 1 113 ? 15.266  -27.506 28.727  1.00 20.88  ? 317  LEU B CG  1 
ATOM   2943 C  CD1 . LEU B 1 113 ? 16.511  -27.611 29.622  1.00 20.03  ? 317  LEU B CD1 1 
ATOM   2944 C  CD2 . LEU B 1 113 ? 14.054  -26.901 29.446  1.00 19.54  ? 317  LEU B CD2 1 
ATOM   2945 N  N   . LEU B 1 114 ? 16.463  -26.914 24.308  1.00 18.38  ? 318  LEU B N   1 
ATOM   2946 C  CA  . LEU B 1 114 ? 16.417  -27.357 22.917  1.00 17.95  ? 318  LEU B CA  1 
ATOM   2947 C  C   . LEU B 1 114 ? 17.819  -27.578 22.316  1.00 18.31  ? 318  LEU B C   1 
ATOM   2948 O  O   . LEU B 1 114 ? 18.086  -28.627 21.707  1.00 17.63  ? 318  LEU B O   1 
ATOM   2949 C  CB  . LEU B 1 114 ? 15.596  -26.383 22.078  1.00 17.77  ? 318  LEU B CB  1 
ATOM   2950 C  CG  . LEU B 1 114 ? 14.081  -26.420 22.329  1.00 17.64  ? 318  LEU B CG  1 
ATOM   2951 C  CD1 . LEU B 1 114 ? 13.459  -25.102 21.892  1.00 14.91  ? 318  LEU B CD1 1 
ATOM   2952 C  CD2 . LEU B 1 114 ? 13.399  -27.617 21.627  1.00 16.41  ? 318  LEU B CD2 1 
ATOM   2953 N  N   . LYS B 1 115 ? 18.721  -26.616 22.517  1.00 18.38  ? 319  LYS B N   1 
ATOM   2954 C  CA  . LYS B 1 115 ? 20.144  -26.794 22.158  1.00 18.32  ? 319  LYS B CA  1 
ATOM   2955 C  C   . LYS B 1 115 ? 20.699  -28.187 22.499  1.00 17.94  ? 319  LYS B C   1 
ATOM   2956 O  O   . LYS B 1 115 ? 21.285  -28.867 21.639  1.00 17.33  ? 319  LYS B O   1 
ATOM   2957 C  CB  . LYS B 1 115 ? 20.994  -25.729 22.846  1.00 17.98  ? 319  LYS B CB  1 
ATOM   2958 C  CG  . LYS B 1 115 ? 22.483  -25.951 22.736  1.00 20.50  ? 319  LYS B CG  1 
ATOM   2959 C  CD  . LYS B 1 115 ? 23.270  -24.695 23.031  1.00 21.70  ? 319  LYS B CD  1 
ATOM   2960 C  CE  . LYS B 1 115 ? 24.781  -24.981 22.927  1.00 24.77  ? 319  LYS B CE  1 
ATOM   2961 N  NZ  . LYS B 1 115 ? 25.554  -23.721 22.976  1.00 26.30  ? 319  LYS B NZ  1 
ATOM   2962 N  N   . TYR B 1 116 ? 20.527  -28.593 23.755  1.00 17.59  ? 320  TYR B N   1 
ATOM   2963 C  CA  . TYR B 1 116 ? 21.156  -29.796 24.267  1.00 17.93  ? 320  TYR B CA  1 
ATOM   2964 C  C   . TYR B 1 116 ? 20.288  -31.051 24.173  1.00 17.44  ? 320  TYR B C   1 
ATOM   2965 O  O   . TYR B 1 116 ? 20.777  -32.158 24.382  1.00 18.19  ? 320  TYR B O   1 
ATOM   2966 C  CB  . TYR B 1 116 ? 21.639  -29.573 25.708  1.00 18.98  ? 320  TYR B CB  1 
ATOM   2967 C  CG  . TYR B 1 116 ? 22.823  -28.650 25.798  1.00 21.03  ? 320  TYR B CG  1 
ATOM   2968 C  CD1 . TYR B 1 116 ? 24.110  -29.102 25.469  1.00 23.12  ? 320  TYR B CD1 1 
ATOM   2969 C  CD2 . TYR B 1 116 ? 22.667  -27.321 26.202  1.00 21.76  ? 320  TYR B CD2 1 
ATOM   2970 C  CE1 . TYR B 1 116 ? 25.217  -28.256 25.543  1.00 23.10  ? 320  TYR B CE1 1 
ATOM   2971 C  CE2 . TYR B 1 116 ? 23.766  -26.465 26.284  1.00 22.22  ? 320  TYR B CE2 1 
ATOM   2972 C  CZ  . TYR B 1 116 ? 25.036  -26.943 25.954  1.00 22.27  ? 320  TYR B CZ  1 
ATOM   2973 O  OH  . TYR B 1 116 ? 26.127  -26.110 26.024  1.00 22.90  ? 320  TYR B OH  1 
ATOM   2974 N  N   . GLY B 1 117 ? 19.016  -30.884 23.839  1.00 16.91  ? 321  GLY B N   1 
ATOM   2975 C  CA  . GLY B 1 117 ? 18.076  -32.003 23.781  1.00 16.46  ? 321  GLY B CA  1 
ATOM   2976 C  C   . GLY B 1 117 ? 17.522  -32.351 22.410  1.00 16.81  ? 321  GLY B C   1 
ATOM   2977 O  O   . GLY B 1 117 ? 16.993  -33.462 22.229  1.00 17.34  ? 321  GLY B O   1 
ATOM   2978 N  N   . VAL B 1 118 ? 17.631  -31.437 21.436  1.00 16.16  ? 322  VAL B N   1 
ATOM   2979 C  CA  . VAL B 1 118 ? 16.946  -31.657 20.137  1.00 16.01  ? 322  VAL B CA  1 
ATOM   2980 C  C   . VAL B 1 118 ? 17.425  -32.903 19.402  1.00 15.67  ? 322  VAL B C   1 
ATOM   2981 O  O   . VAL B 1 118 ? 16.599  -33.635 18.885  1.00 15.80  ? 322  VAL B O   1 
ATOM   2982 C  CB  . VAL B 1 118 ? 16.950  -30.451 19.158  1.00 15.95  ? 322  VAL B CB  1 
ATOM   2983 C  CG1 . VAL B 1 118 ? 15.957  -29.395 19.615  1.00 16.17  ? 322  VAL B CG1 1 
ATOM   2984 C  CG2 . VAL B 1 118 ? 18.367  -29.885 18.944  1.00 15.37  ? 322  VAL B CG2 1 
ATOM   2985 N  N   . HIS B 1 119 ? 18.741  -33.148 19.374  1.00 15.66  ? 323  HIS B N   1 
ATOM   2986 C  CA  . HIS B 1 119 ? 19.287  -34.318 18.650  1.00 15.60  ? 323  HIS B CA  1 
ATOM   2987 C  C   . HIS B 1 119 ? 18.961  -35.661 19.308  1.00 15.16  ? 323  HIS B C   1 
ATOM   2988 O  O   . HIS B 1 119 ? 18.700  -36.630 18.596  1.00 16.49  ? 323  HIS B O   1 
ATOM   2989 C  CB  . HIS B 1 119 ? 20.785  -34.160 18.301  1.00 15.44  ? 323  HIS B CB  1 
ATOM   2990 C  CG  . HIS B 1 119 ? 21.043  -33.198 17.173  1.00 16.16  ? 323  HIS B CG  1 
ATOM   2991 N  ND1 . HIS B 1 119 ? 21.275  -31.851 17.375  1.00 16.64  ? 323  HIS B ND1 1 
ATOM   2992 C  CD2 . HIS B 1 119 ? 21.052  -33.381 15.829  1.00 16.96  ? 323  HIS B CD2 1 
ATOM   2993 C  CE1 . HIS B 1 119 ? 21.432  -31.251 16.208  1.00 17.62  ? 323  HIS B CE1 1 
ATOM   2994 N  NE2 . HIS B 1 119 ? 21.300  -32.157 15.253  1.00 17.68  ? 323  HIS B NE2 1 
ATOM   2995 N  N   . GLU B 1 120 ? 18.956  -35.726 20.639  1.00 15.13  ? 324  GLU B N   1 
ATOM   2996 C  CA  . GLU B 1 120 ? 18.446  -36.906 21.366  1.00 15.47  ? 324  GLU B CA  1 
ATOM   2997 C  C   . GLU B 1 120 ? 16.996  -37.201 20.932  1.00 15.73  ? 324  GLU B C   1 
ATOM   2998 O  O   . GLU B 1 120 ? 16.662  -38.350 20.610  1.00 16.10  ? 324  GLU B O   1 
ATOM   2999 C  CB  . GLU B 1 120 ? 18.501  -36.721 22.886  1.00 15.02  ? 324  GLU B CB  1 
ATOM   3000 C  CG  . GLU B 1 120 ? 19.921  -36.642 23.473  1.00 16.03  ? 324  GLU B CG  1 
ATOM   3001 C  CD  . GLU B 1 120 ? 19.956  -36.503 24.994  1.00 16.62  ? 324  GLU B CD  1 
ATOM   3002 O  OE1 . GLU B 1 120 ? 18.894  -36.584 25.664  1.00 18.67  ? 324  GLU B OE1 1 
ATOM   3003 O  OE2 . GLU B 1 120 ? 21.070  -36.308 25.533  1.00 18.83  ? 324  GLU B OE2 1 
ATOM   3004 N  N   . ALA B 1 121 ? 16.164  -36.164 20.923  1.00 15.70  ? 325  ALA B N   1 
ATOM   3005 C  CA  . ALA B 1 121 ? 14.759  -36.256 20.467  1.00 16.88  ? 325  ALA B CA  1 
ATOM   3006 C  C   . ALA B 1 121 ? 14.637  -36.633 18.972  1.00 17.40  ? 325  ALA B C   1 
ATOM   3007 O  O   . ALA B 1 121 ? 13.818  -37.494 18.616  1.00 19.09  ? 325  ALA B O   1 
ATOM   3008 C  CB  . ALA B 1 121 ? 14.005  -34.952 20.783  1.00 15.87  ? 325  ALA B CB  1 
ATOM   3009 N  N   . ILE B 1 122 ? 15.471  -36.039 18.114  1.00 17.22  ? 326  ILE B N   1 
ATOM   3010 C  CA  . ILE B 1 122 ? 15.492  -36.384 16.678  1.00 17.85  ? 326  ILE B CA  1 
ATOM   3011 C  C   . ILE B 1 122 ? 15.749  -37.877 16.433  1.00 17.67  ? 326  ILE B C   1 
ATOM   3012 O  O   . ILE B 1 122 ? 14.994  -38.512 15.718  1.00 17.18  ? 326  ILE B O   1 
ATOM   3013 C  CB  . ILE B 1 122 ? 16.517  -35.518 15.880  1.00 18.12  ? 326  ILE B CB  1 
ATOM   3014 C  CG1 . ILE B 1 122 ? 16.030  -34.056 15.822  1.00 17.52  ? 326  ILE B CG1 1 
ATOM   3015 C  CG2 . ILE B 1 122 ? 16.786  -36.122 14.477  1.00 19.49  ? 326  ILE B CG2 1 
ATOM   3016 C  CD1 . ILE B 1 122 ? 17.059  -33.039 15.289  1.00 18.07  ? 326  ILE B CD1 1 
ATOM   3017 N  N   . PHE B 1 123 ? 16.788  -38.420 17.065  1.00 18.14  ? 327  PHE B N   1 
ATOM   3018 C  CA  . PHE B 1 123 ? 17.206  -39.820 16.883  1.00 18.33  ? 327  PHE B CA  1 
ATOM   3019 C  C   . PHE B 1 123 ? 16.215  -40.852 17.461  1.00 18.35  ? 327  PHE B C   1 
ATOM   3020 O  O   . PHE B 1 123 ? 16.109  -41.985 16.938  1.00 18.80  ? 327  PHE B O   1 
ATOM   3021 C  CB  . PHE B 1 123 ? 18.650  -40.030 17.394  1.00 18.58  ? 327  PHE B CB  1 
ATOM   3022 C  CG  . PHE B 1 123 ? 19.699  -39.134 16.716  1.00 18.75  ? 327  PHE B CG  1 
ATOM   3023 C  CD1 . PHE B 1 123 ? 19.557  -38.735 15.386  1.00 19.67  ? 327  PHE B CD1 1 
ATOM   3024 C  CD2 . PHE B 1 123 ? 20.833  -38.716 17.414  1.00 17.51  ? 327  PHE B CD2 1 
ATOM   3025 C  CE1 . PHE B 1 123 ? 20.512  -37.918 14.764  1.00 20.05  ? 327  PHE B CE1 1 
ATOM   3026 C  CE2 . PHE B 1 123 ? 21.789  -37.908 16.812  1.00 18.54  ? 327  PHE B CE2 1 
ATOM   3027 C  CZ  . PHE B 1 123 ? 21.630  -37.506 15.477  1.00 18.78  ? 327  PHE B CZ  1 
ATOM   3028 N  N   . ALA B 1 124 ? 15.507  -40.471 18.535  1.00 18.37  ? 328  ALA B N   1 
ATOM   3029 C  CA  . ALA B 1 124 ? 14.351  -41.230 19.052  1.00 18.76  ? 328  ALA B CA  1 
ATOM   3030 C  C   . ALA B 1 124 ? 13.197  -41.275 18.045  1.00 18.83  ? 328  ALA B C   1 
ATOM   3031 O  O   . ALA B 1 124 ? 12.703  -42.353 17.714  1.00 18.88  ? 328  ALA B O   1 
ATOM   3032 C  CB  . ALA B 1 124 ? 13.870  -40.679 20.413  1.00 18.47  ? 328  ALA B CB  1 
ATOM   3033 N  N   . MET B 1 125 ? 12.814  -40.111 17.529  1.00 19.54  ? 329  MET B N   1 
ATOM   3034 C  CA  . MET B 1 125 ? 11.718  -39.983 16.555  1.00 20.51  ? 329  MET B CA  1 
ATOM   3035 C  C   . MET B 1 125 ? 12.016  -40.519 15.150  1.00 19.07  ? 329  MET B C   1 
ATOM   3036 O  O   . MET B 1 125 ? 11.105  -40.852 14.394  1.00 18.83  ? 329  MET B O   1 
ATOM   3037 C  CB  . MET B 1 125 ? 11.266  -38.527 16.466  1.00 19.85  ? 329  MET B CB  1 
ATOM   3038 C  CG  . MET B 1 125 ? 10.391  -38.101 17.632  1.00 21.55  ? 329  MET B CG  1 
ATOM   3039 S  SD  . MET B 1 125 ? 9.828   -36.387 17.510  1.00 25.94  ? 329  MET B SD  1 
ATOM   3040 C  CE  . MET B 1 125 ? 11.177  -35.656 16.583  1.00 23.32  ? 329  MET B CE  1 
ATOM   3041 N  N   . LEU B 1 126 ? 13.296  -40.567 14.807  1.00 18.27  ? 330  LEU B N   1 
ATOM   3042 C  CA  . LEU B 1 126 ? 13.784  -41.188 13.583  1.00 17.78  ? 330  LEU B CA  1 
ATOM   3043 C  C   . LEU B 1 126 ? 13.351  -42.674 13.492  1.00 17.18  ? 330  LEU B C   1 
ATOM   3044 O  O   . LEU B 1 126 ? 13.018  -43.179 12.417  1.00 16.33  ? 330  LEU B O   1 
ATOM   3045 C  CB  . LEU B 1 126 ? 15.319  -41.052 13.564  1.00 18.00  ? 330  LEU B CB  1 
ATOM   3046 C  CG  . LEU B 1 126 ? 16.185  -41.095 12.304  1.00 20.23  ? 330  LEU B CG  1 
ATOM   3047 C  CD1 . LEU B 1 126 ? 16.659  -42.513 12.003  1.00 25.64  ? 330  LEU B CD1 1 
ATOM   3048 C  CD2 . LEU B 1 126 ? 15.466  -40.468 11.114  1.00 23.12  ? 330  LEU B CD2 1 
ATOM   3049 N  N   . ALA B 1 127 ? 13.292  -43.353 14.631  1.00 16.82  ? 331  ALA B N   1 
ATOM   3050 C  CA  . ALA B 1 127 ? 12.859  -44.772 14.654  1.00 16.90  ? 331  ALA B CA  1 
ATOM   3051 C  C   . ALA B 1 127 ? 11.443  -44.980 14.071  1.00 17.63  ? 331  ALA B C   1 
ATOM   3052 O  O   . ALA B 1 127 ? 11.106  -46.059 13.532  1.00 17.60  ? 331  ALA B O   1 
ATOM   3053 C  CB  . ALA B 1 127 ? 12.937  -45.310 16.056  1.00 16.77  ? 331  ALA B CB  1 
ATOM   3054 N  N   . SER B 1 128 ? 10.624  -43.932 14.153  1.00 17.21  ? 332  SER B N   1 
ATOM   3055 C  CA  . SER B 1 128 ? 9.227   -44.012 13.760  1.00 17.57  ? 332  SER B CA  1 
ATOM   3056 C  C   . SER B 1 128 ? 9.093   -44.167 12.248  1.00 17.82  ? 332  SER B C   1 
ATOM   3057 O  O   . SER B 1 128 ? 8.119   -44.731 11.764  1.00 17.30  ? 332  SER B O   1 
ATOM   3058 C  CB  . SER B 1 128 ? 8.503   -42.753 14.220  1.00 16.94  ? 332  SER B CB  1 
ATOM   3059 O  OG  . SER B 1 128 ? 8.487   -42.688 15.637  1.00 16.97  ? 332  SER B OG  1 
ATOM   3060 N  N   . ILE B 1 129 ? 10.089  -43.666 11.519  1.00 18.12  ? 333  ILE B N   1 
ATOM   3061 C  CA  . ILE B 1 129 ? 10.082  -43.640 10.054  1.00 18.99  ? 333  ILE B CA  1 
ATOM   3062 C  C   . ILE B 1 129 ? 11.143  -44.596 9.443   1.00 19.71  ? 333  ILE B C   1 
ATOM   3063 O  O   . ILE B 1 129 ? 11.479  -44.479 8.263   1.00 19.43  ? 333  ILE B O   1 
ATOM   3064 C  CB  . ILE B 1 129 ? 10.292  -42.171 9.522   1.00 18.98  ? 333  ILE B CB  1 
ATOM   3065 C  CG1 . ILE B 1 129 ? 11.602  -41.572 10.068  1.00 18.40  ? 333  ILE B CG1 1 
ATOM   3066 C  CG2 . ILE B 1 129 ? 9.078   -41.287 9.859   1.00 18.99  ? 333  ILE B CG2 1 
ATOM   3067 C  CD1 . ILE B 1 129 ? 12.095  -40.309 9.366   1.00 18.55  ? 333  ILE B CD1 1 
ATOM   3068 N  N   . VAL B 1 130 ? 11.641  -45.536 10.257  1.00 20.44  ? 334  VAL B N   1 
ATOM   3069 C  CA  . VAL B 1 130 ? 12.736  -46.447 9.902   1.00 21.64  ? 334  VAL B CA  1 
ATOM   3070 C  C   . VAL B 1 130 ? 12.248  -47.896 9.947   1.00 22.31  ? 334  VAL B C   1 
ATOM   3071 O  O   . VAL B 1 130 ? 11.430  -48.241 10.804  1.00 22.91  ? 334  VAL B O   1 
ATOM   3072 C  CB  . VAL B 1 130 ? 13.937  -46.303 10.913  1.00 21.38  ? 334  VAL B CB  1 
ATOM   3073 C  CG1 . VAL B 1 130 ? 14.811  -47.564 10.972  1.00 21.06  ? 334  VAL B CG1 1 
ATOM   3074 C  CG2 . VAL B 1 130 ? 14.792  -45.094 10.585  1.00 22.13  ? 334  VAL B CG2 1 
ATOM   3075 N  N   . ASN B 1 131 ? 12.718  -48.719 9.010   1.00 23.14  ? 335  ASN B N   1 
ATOM   3076 C  CA  . ASN B 1 131 ? 12.713  -50.185 9.174   1.00 24.03  ? 335  ASN B CA  1 
ATOM   3077 C  C   . ASN B 1 131 ? 14.124  -50.713 8.860   1.00 24.48  ? 335  ASN B C   1 
ATOM   3078 O  O   . ASN B 1 131 ? 15.049  -49.903 8.676   1.00 24.60  ? 335  ASN B O   1 
ATOM   3079 C  CB  . ASN B 1 131 ? 11.555  -50.886 8.416   1.00 24.59  ? 335  ASN B CB  1 
ATOM   3080 C  CG  . ASN B 1 131 ? 11.595  -50.688 6.890   1.00 25.88  ? 335  ASN B CG  1 
ATOM   3081 O  OD1 . ASN B 1 131 ? 12.657  -50.551 6.290   1.00 28.08  ? 335  ASN B OD1 1 
ATOM   3082 N  ND2 . ASN B 1 131 ? 10.414  -50.710 6.259   1.00 26.63  ? 335  ASN B ND2 1 
ATOM   3083 N  N   . LYS B 1 132 ? 14.325  -52.033 8.841   1.00 24.60  ? 336  LYS B N   1 
ATOM   3084 C  CA  . LYS B 1 132 ? 15.661  -52.571 8.600   1.00 25.04  ? 336  LYS B CA  1 
ATOM   3085 C  C   . LYS B 1 132 ? 16.158  -52.253 7.200   1.00 24.40  ? 336  LYS B C   1 
ATOM   3086 O  O   . LYS B 1 132 ? 17.359  -52.206 6.960   1.00 24.21  ? 336  LYS B O   1 
ATOM   3087 C  CB  . LYS B 1 132 ? 15.736  -54.084 8.877   1.00 25.21  ? 336  LYS B CB  1 
ATOM   3088 C  CG  . LYS B 1 132 ? 14.672  -54.920 8.204   1.00 26.85  ? 336  LYS B CG  1 
ATOM   3089 C  CD  . LYS B 1 132 ? 14.791  -56.384 8.610   1.00 27.78  ? 336  LYS B CD  1 
ATOM   3090 C  CE  . LYS B 1 132 ? 15.729  -57.133 7.669   1.00 32.93  ? 336  LYS B CE  1 
ATOM   3091 N  NZ  . LYS B 1 132 ? 15.244  -57.044 6.240   1.00 34.47  ? 336  LYS B NZ  1 
ATOM   3092 N  N   . ASP B 1 133 ? 15.228  -52.007 6.283   1.00 24.07  ? 337  ASP B N   1 
ATOM   3093 C  CA  . ASP B 1 133 ? 15.569  -51.779 4.890   1.00 23.82  ? 337  ASP B CA  1 
ATOM   3094 C  C   . ASP B 1 133 ? 15.793  -50.310 4.494   1.00 22.78  ? 337  ASP B C   1 
ATOM   3095 O  O   . ASP B 1 133 ? 16.323  -50.039 3.417   1.00 21.97  ? 337  ASP B O   1 
ATOM   3096 C  CB  . ASP B 1 133 ? 14.511  -52.430 4.009   1.00 24.88  ? 337  ASP B CB  1 
ATOM   3097 C  CG  . ASP B 1 133 ? 14.439  -53.937 4.231   1.00 27.33  ? 337  ASP B CG  1 
ATOM   3098 O  OD1 . ASP B 1 133 ? 15.507  -54.581 4.223   1.00 31.00  ? 337  ASP B OD1 1 
ATOM   3099 O  OD2 . ASP B 1 133 ? 13.330  -54.468 4.453   1.00 33.33  ? 337  ASP B OD2 1 
ATOM   3100 N  N   . GLY B 1 134 ? 15.393  -49.375 5.345   1.00 22.09  ? 338  GLY B N   1 
ATOM   3101 C  CA  . GLY B 1 134 ? 15.547  -47.947 5.004   1.00 21.67  ? 338  GLY B CA  1 
ATOM   3102 C  C   . GLY B 1 134 ? 14.645  -46.997 5.762   1.00 21.64  ? 338  GLY B C   1 
ATOM   3103 O  O   . GLY B 1 134 ? 14.044  -47.373 6.762   1.00 21.63  ? 338  GLY B O   1 
ATOM   3104 N  N   . LEU B 1 135 ? 14.556  -45.754 5.292   1.00 21.14  ? 339  LEU B N   1 
ATOM   3105 C  CA  . LEU B 1 135 ? 13.766  -44.746 6.005   1.00 21.21  ? 339  LEU B CA  1 
ATOM   3106 C  C   . LEU B 1 135 ? 12.994  -43.826 5.069   1.00 20.50  ? 339  LEU B C   1 
ATOM   3107 O  O   . LEU B 1 135 ? 13.410  -43.595 3.928   1.00 20.30  ? 339  LEU B O   1 
ATOM   3108 C  CB  . LEU B 1 135 ? 14.652  -43.932 6.970   1.00 21.47  ? 339  LEU B CB  1 
ATOM   3109 C  CG  . LEU B 1 135 ? 15.274  -42.599 6.520   1.00 22.69  ? 339  LEU B CG  1 
ATOM   3110 C  CD1 . LEU B 1 135 ? 15.662  -41.770 7.731   1.00 22.34  ? 339  LEU B CD1 1 
ATOM   3111 C  CD2 . LEU B 1 135 ? 16.449  -42.824 5.618   1.00 23.41  ? 339  LEU B CD2 1 
ATOM   3112 N  N   . LEU B 1 136 ? 11.860  -43.322 5.554   1.00 19.59  ? 340  LEU B N   1 
ATOM   3113 C  CA  . LEU B 1 136 ? 11.067  -42.358 4.818   1.00 19.91  ? 340  LEU B CA  1 
ATOM   3114 C  C   . LEU B 1 136 ? 11.765  -41.020 4.787   1.00 19.59  ? 340  LEU B C   1 
ATOM   3115 O  O   . LEU B 1 136 ? 12.387  -40.617 5.758   1.00 19.54  ? 340  LEU B O   1 
ATOM   3116 C  CB  . LEU B 1 136 ? 9.668   -42.170 5.446   1.00 19.87  ? 340  LEU B CB  1 
ATOM   3117 C  CG  . LEU B 1 136 ? 8.703   -43.351 5.488   1.00 19.13  ? 340  LEU B CG  1 
ATOM   3118 C  CD1 . LEU B 1 136 ? 7.450   -42.962 6.280   1.00 17.42  ? 340  LEU B CD1 1 
ATOM   3119 C  CD2 . LEU B 1 136 ? 8.351   -43.805 4.072   1.00 19.55  ? 340  LEU B CD2 1 
ATOM   3120 N  N   . VAL B 1 137 ? 11.651  -40.325 3.667   1.00 20.21  ? 341  VAL B N   1 
ATOM   3121 C  CA  . VAL B 1 137 ? 12.205  -38.975 3.557   1.00 20.41  ? 341  VAL B CA  1 
ATOM   3122 C  C   . VAL B 1 137 ? 11.190  -38.034 2.913   1.00 21.87  ? 341  VAL B C   1 
ATOM   3123 O  O   . VAL B 1 137 ? 10.201  -38.488 2.324   1.00 21.94  ? 341  VAL B O   1 
ATOM   3124 C  CB  . VAL B 1 137 ? 13.583  -38.942 2.799   1.00 20.47  ? 341  VAL B CB  1 
ATOM   3125 C  CG1 . VAL B 1 137 ? 14.669  -39.658 3.582   1.00 18.13  ? 341  VAL B CG1 1 
ATOM   3126 C  CG2 . VAL B 1 137 ? 13.466  -39.492 1.373   1.00 18.93  ? 341  VAL B CG2 1 
ATOM   3127 N  N   . ALA B 1 138 ? 11.430  -36.723 3.036   1.00 23.60  ? 342  ALA B N   1 
ATOM   3128 C  CA  . ALA B 1 138 ? 10.601  -35.711 2.365   1.00 24.75  ? 342  ALA B CA  1 
ATOM   3129 C  C   . ALA B 1 138 ? 9.120   -35.789 2.752   1.00 25.69  ? 342  ALA B C   1 
ATOM   3130 O  O   . ALA B 1 138 ? 8.230   -35.820 1.893   1.00 26.33  ? 342  ALA B O   1 
ATOM   3131 C  CB  . ALA B 1 138 ? 10.776  -35.794 0.837   1.00 24.58  ? 342  ALA B CB  1 
ATOM   3132 N  N   . ASN B 1 139 ? 8.872   -35.809 4.058   1.00 26.73  ? 343  ASN B N   1 
ATOM   3133 C  CA  . ASN B 1 139 ? 7.536   -36.011 4.621   1.00 27.41  ? 343  ASN B CA  1 
ATOM   3134 C  C   . ASN B 1 139 ? 6.803   -37.232 4.046   1.00 27.07  ? 343  ASN B C   1 
ATOM   3135 O  O   . ASN B 1 139 ? 5.600   -37.183 3.796   1.00 27.04  ? 343  ASN B O   1 
ATOM   3136 C  CB  . ASN B 1 139 ? 6.684   -34.730 4.523   1.00 28.15  ? 343  ASN B CB  1 
ATOM   3137 C  CG  . ASN B 1 139 ? 5.604   -34.643 5.625   1.00 30.32  ? 343  ASN B CG  1 
ATOM   3138 O  OD1 . ASN B 1 139 ? 5.858   -34.950 6.796   1.00 31.94  ? 343  ASN B OD1 1 
ATOM   3139 N  ND2 . ASN B 1 139 ? 4.406   -34.206 5.245   1.00 31.42  ? 343  ASN B ND2 1 
ATOM   3140 N  N   . GLY B 1 140 ? 7.533   -38.332 3.862   1.00 26.83  ? 344  GLY B N   1 
ATOM   3141 C  CA  . GLY B 1 140 ? 6.943   -39.582 3.372   1.00 26.78  ? 344  GLY B CA  1 
ATOM   3142 C  C   . GLY B 1 140 ? 6.847   -39.769 1.862   1.00 26.75  ? 344  GLY B C   1 
ATOM   3143 O  O   . GLY B 1 140 ? 6.498   -40.859 1.413   1.00 27.12  ? 344  GLY B O   1 
ATOM   3144 N  N   . SER B 1 141 ? 7.159   -38.730 1.078   1.00 26.60  ? 345  SER B N   1 
ATOM   3145 C  CA  . SER B 1 141 ? 7.116   -38.814 -0.402  1.00 26.37  ? 345  SER B CA  1 
ATOM   3146 C  C   . SER B 1 141 ? 8.199   -39.724 -0.995  1.00 26.07  ? 345  SER B C   1 
ATOM   3147 O  O   . SER B 1 141 ? 8.072   -40.204 -2.133  1.00 26.19  ? 345  SER B O   1 
ATOM   3148 C  CB  . SER B 1 141 ? 7.284   -37.436 -1.042  1.00 26.51  ? 345  SER B CB  1 
ATOM   3149 O  OG  . SER B 1 141 ? 6.470   -36.464 -0.437  1.00 27.54  ? 345  SER B OG  1 
ATOM   3150 N  N   . GLY B 1 142 ? 9.275   -39.922 -0.239  1.00 24.95  ? 346  GLY B N   1 
ATOM   3151 C  CA  . GLY B 1 142 ? 10.382  -40.773 -0.657  1.00 23.68  ? 346  GLY B CA  1 
ATOM   3152 C  C   . GLY B 1 142 ? 10.771  -41.795 0.394   1.00 22.65  ? 346  GLY B C   1 
ATOM   3153 O  O   . GLY B 1 142 ? 10.475  -41.622 1.571   1.00 22.87  ? 346  GLY B O   1 
ATOM   3154 N  N   . PHE B 1 143 ? 11.408  -42.874 -0.053  1.00 21.85  ? 347  PHE B N   1 
ATOM   3155 C  CA  . PHE B 1 143 ? 11.979  -43.887 0.817   1.00 21.24  ? 347  PHE B CA  1 
ATOM   3156 C  C   . PHE B 1 143 ? 13.422  -44.073 0.374   1.00 21.25  ? 347  PHE B C   1 
ATOM   3157 O  O   . PHE B 1 143 ? 13.667  -44.296 -0.813  1.00 21.53  ? 347  PHE B O   1 
ATOM   3158 C  CB  . PHE B 1 143 ? 11.208  -45.203 0.661   1.00 21.08  ? 347  PHE B CB  1 
ATOM   3159 C  CG  . PHE B 1 143 ? 11.725  -46.326 1.511   1.00 20.50  ? 347  PHE B CG  1 
ATOM   3160 C  CD1 . PHE B 1 143 ? 11.432  -46.384 2.870   1.00 19.73  ? 347  PHE B CD1 1 
ATOM   3161 C  CD2 . PHE B 1 143 ? 12.490  -47.346 0.949   1.00 20.48  ? 347  PHE B CD2 1 
ATOM   3162 C  CE1 . PHE B 1 143 ? 11.904  -47.438 3.653   1.00 20.50  ? 347  PHE B CE1 1 
ATOM   3163 C  CE2 . PHE B 1 143 ? 12.962  -48.410 1.728   1.00 18.90  ? 347  PHE B CE2 1 
ATOM   3164 C  CZ  . PHE B 1 143 ? 12.671  -48.455 3.079   1.00 21.19  ? 347  PHE B CZ  1 
ATOM   3165 N  N   . VAL B 1 144 ? 14.377  -43.945 1.295   1.00 21.03  ? 348  VAL B N   1 
ATOM   3166 C  CA  . VAL B 1 144 ? 15.787  -44.167 0.947   1.00 20.70  ? 348  VAL B CA  1 
ATOM   3167 C  C   . VAL B 1 144 ? 16.271  -45.456 1.573   1.00 20.34  ? 348  VAL B C   1 
ATOM   3168 O  O   . VAL B 1 144 ? 16.066  -45.678 2.762   1.00 20.06  ? 348  VAL B O   1 
ATOM   3169 C  CB  . VAL B 1 144 ? 16.708  -43.022 1.380   1.00 20.89  ? 348  VAL B CB  1 
ATOM   3170 C  CG1 . VAL B 1 144 ? 18.101  -43.206 0.785   1.00 19.22  ? 348  VAL B CG1 1 
ATOM   3171 C  CG2 . VAL B 1 144 ? 16.142  -41.697 0.920   1.00 21.79  ? 348  VAL B CG2 1 
ATOM   3172 N  N   . THR B 1 145 ? 16.926  -46.295 0.775   1.00 20.47  ? 349  THR B N   1 
ATOM   3173 C  CA  . THR B 1 145 ? 17.333  -47.612 1.265   1.00 20.70  ? 349  THR B CA  1 
ATOM   3174 C  C   . THR B 1 145 ? 18.566  -47.499 2.142   1.00 20.44  ? 349  THR B C   1 
ATOM   3175 O  O   . THR B 1 145 ? 19.433  -46.652 1.915   1.00 20.37  ? 349  THR B O   1 
ATOM   3176 C  CB  . THR B 1 145 ? 17.614  -48.618 0.138   1.00 20.72  ? 349  THR B CB  1 
ATOM   3177 O  OG1 . THR B 1 145 ? 18.730  -48.159 -0.644  1.00 20.75  ? 349  THR B OG1 1 
ATOM   3178 C  CG2 . THR B 1 145 ? 16.364  -48.828 -0.732  1.00 21.03  ? 349  THR B CG2 1 
ATOM   3179 N  N   . ARG B 1 146 ? 18.622  -48.350 3.151   1.00 20.39  ? 350  ARG B N   1 
ATOM   3180 C  CA  . ARG B 1 146 ? 19.765  -48.415 4.037   1.00 20.78  ? 350  ARG B CA  1 
ATOM   3181 C  C   . ARG B 1 146 ? 21.017  -48.768 3.239   1.00 21.13  ? 350  ARG B C   1 
ATOM   3182 O  O   . ARG B 1 146 ? 22.092  -48.274 3.540   1.00 21.39  ? 350  ARG B O   1 
ATOM   3183 C  CB  . ARG B 1 146 ? 19.504  -49.444 5.130   1.00 20.76  ? 350  ARG B CB  1 
ATOM   3184 C  CG  . ARG B 1 146 ? 20.545  -49.538 6.240   1.00 19.56  ? 350  ARG B CG  1 
ATOM   3185 C  CD  . ARG B 1 146 ? 19.994  -50.467 7.310   1.00 19.96  ? 350  ARG B CD  1 
ATOM   3186 N  NE  . ARG B 1 146 ? 20.867  -50.589 8.478   1.00 19.74  ? 350  ARG B NE  1 
ATOM   3187 C  CZ  . ARG B 1 146 ? 20.591  -51.322 9.552   1.00 20.84  ? 350  ARG B CZ  1 
ATOM   3188 N  NH1 . ARG B 1 146 ? 19.463  -52.016 9.620   1.00 20.58  ? 350  ARG B NH1 1 
ATOM   3189 N  NH2 . ARG B 1 146 ? 21.449  -51.361 10.560  1.00 19.84  ? 350  ARG B NH2 1 
ATOM   3190 N  N   . GLU B 1 147 ? 20.869  -49.633 2.235   1.00 22.06  ? 351  GLU B N   1 
ATOM   3191 C  CA  . GLU B 1 147 ? 21.991  -50.060 1.388   1.00 22.81  ? 351  GLU B CA  1 
ATOM   3192 C  C   . GLU B 1 147 ? 22.588  -48.907 0.584   1.00 22.49  ? 351  GLU B C   1 
ATOM   3193 O  O   . GLU B 1 147 ? 23.811  -48.776 0.493   1.00 22.10  ? 351  GLU B O   1 
ATOM   3194 C  CB  . GLU B 1 147 ? 21.577  -51.213 0.462   1.00 23.40  ? 351  GLU B CB  1 
ATOM   3195 C  CG  . GLU B 1 147 ? 22.594  -52.353 0.401   1.00 28.06  ? 351  GLU B CG  1 
ATOM   3196 C  CD  . GLU B 1 147 ? 23.075  -52.807 1.783   1.00 33.23  ? 351  GLU B CD  1 
ATOM   3197 O  OE1 . GLU B 1 147 ? 24.306  -52.778 2.041   1.00 35.80  ? 351  GLU B OE1 1 
ATOM   3198 O  OE2 . GLU B 1 147 ? 22.227  -53.175 2.626   1.00 35.25  ? 351  GLU B OE2 1 
ATOM   3199 N  N   . PHE B 1 148 ? 21.734  -48.076 -0.003  1.00 22.77  ? 352  PHE B N   1 
ATOM   3200 C  CA  . PHE B 1 148 ? 22.217  -46.884 -0.723  1.00 23.30  ? 352  PHE B CA  1 
ATOM   3201 C  C   . PHE B 1 148 ? 23.040  -45.947 0.184   1.00 23.30  ? 352  PHE B C   1 
ATOM   3202 O  O   . PHE B 1 148 ? 24.091  -45.453 -0.219  1.00 23.88  ? 352  PHE B O   1 
ATOM   3203 C  CB  . PHE B 1 148 ? 21.079  -46.099 -1.376  1.00 22.84  ? 352  PHE B CB  1 
ATOM   3204 C  CG  . PHE B 1 148 ? 21.538  -44.829 -2.046  1.00 23.90  ? 352  PHE B CG  1 
ATOM   3205 C  CD1 . PHE B 1 148 ? 22.384  -44.876 -3.145  1.00 25.16  ? 352  PHE B CD1 1 
ATOM   3206 C  CD2 . PHE B 1 148 ? 21.150  -43.590 -1.565  1.00 24.68  ? 352  PHE B CD2 1 
ATOM   3207 C  CE1 . PHE B 1 148 ? 22.833  -43.703 -3.758  1.00 25.87  ? 352  PHE B CE1 1 
ATOM   3208 C  CE2 . PHE B 1 148 ? 21.588  -42.418 -2.176  1.00 23.54  ? 352  PHE B CE2 1 
ATOM   3209 C  CZ  . PHE B 1 148 ? 22.430  -42.478 -3.273  1.00 23.57  ? 352  PHE B CZ  1 
ATOM   3210 N  N   . LEU B 1 149 ? 22.550  -45.709 1.394   1.00 23.07  ? 353  LEU B N   1 
ATOM   3211 C  CA  . LEU B 1 149 ? 23.235  -44.862 2.375   1.00 22.98  ? 353  LEU B CA  1 
ATOM   3212 C  C   . LEU B 1 149 ? 24.570  -45.459 2.830   1.00 23.08  ? 353  LEU B C   1 
ATOM   3213 O  O   . LEU B 1 149 ? 25.517  -44.729 3.057   1.00 22.54  ? 353  LEU B O   1 
ATOM   3214 C  CB  . LEU B 1 149 ? 22.328  -44.608 3.580   1.00 22.92  ? 353  LEU B CB  1 
ATOM   3215 C  CG  . LEU B 1 149 ? 21.345  -43.432 3.689   1.00 22.68  ? 353  LEU B CG  1 
ATOM   3216 C  CD1 . LEU B 1 149 ? 21.100  -42.669 2.406   1.00 23.52  ? 353  LEU B CD1 1 
ATOM   3217 C  CD2 . LEU B 1 149 ? 20.046  -43.936 4.288   1.00 21.22  ? 353  LEU B CD2 1 
ATOM   3218 N  N   . ARG B 1 150 ? 24.642  -46.788 2.931   1.00 23.21  ? 354  ARG B N   1 
ATOM   3219 C  CA  . ARG B 1 150 ? 25.895  -47.477 3.262   1.00 24.00  ? 354  ARG B CA  1 
ATOM   3220 C  C   . ARG B 1 150 ? 26.968  -47.331 2.175   1.00 24.24  ? 354  ARG B C   1 
ATOM   3221 O  O   . ARG B 1 150 ? 28.165  -47.436 2.461   1.00 24.13  ? 354  ARG B O   1 
ATOM   3222 C  CB  . ARG B 1 150 ? 25.634  -48.966 3.521   1.00 24.28  ? 354  ARG B CB  1 
ATOM   3223 C  CG  . ARG B 1 150 ? 25.111  -49.294 4.905   1.00 24.53  ? 354  ARG B CG  1 
ATOM   3224 C  CD  . ARG B 1 150 ? 24.855  -50.797 5.003   1.00 28.46  ? 354  ARG B CD  1 
ATOM   3225 N  NE  . ARG B 1 150 ? 24.465  -51.207 6.343   1.00 29.81  ? 354  ARG B NE  1 
ATOM   3226 C  CZ  . ARG B 1 150 ? 23.825  -52.337 6.639   1.00 31.52  ? 354  ARG B CZ  1 
ATOM   3227 N  NH1 . ARG B 1 150 ? 23.482  -53.191 5.681   1.00 32.44  ? 354  ARG B NH1 1 
ATOM   3228 N  NH2 . ARG B 1 150 ? 23.527  -52.612 7.906   1.00 31.53  ? 354  ARG B NH2 1 
ATOM   3229 N  N   . SER B 1 151 ? 26.521  -47.089 0.940   1.00 24.39  ? 355  SER B N   1 
ATOM   3230 C  CA  . SER B 1 151 ? 27.376  -47.051 -0.241  1.00 24.82  ? 355  SER B CA  1 
ATOM   3231 C  C   . SER B 1 151 ? 28.077  -45.708 -0.432  1.00 25.77  ? 355  SER B C   1 
ATOM   3232 O  O   . SER B 1 151 ? 29.014  -45.601 -1.235  1.00 26.06  ? 355  SER B O   1 
ATOM   3233 C  CB  . SER B 1 151 ? 26.545  -47.372 -1.497  1.00 24.90  ? 355  SER B CB  1 
ATOM   3234 O  OG  . SER B 1 151 ? 25.871  -46.221 -1.982  1.00 24.80  ? 355  SER B OG  1 
ATOM   3235 N  N   . LEU B 1 152 ? 27.632  -44.688 0.303   1.00 26.29  ? 356  LEU B N   1 
ATOM   3236 C  CA  . LEU B 1 152 ? 28.206  -43.348 0.190   1.00 26.91  ? 356  LEU B CA  1 
ATOM   3237 C  C   . LEU B 1 152 ? 29.646  -43.294 0.716   1.00 27.68  ? 356  LEU B C   1 
ATOM   3238 O  O   . LEU B 1 152 ? 30.113  -44.230 1.366   1.00 27.67  ? 356  LEU B O   1 
ATOM   3239 C  CB  . LEU B 1 152 ? 27.327  -42.318 0.909   1.00 26.75  ? 356  LEU B CB  1 
ATOM   3240 C  CG  . LEU B 1 152 ? 25.815  -42.257 0.639   1.00 26.54  ? 356  LEU B CG  1 
ATOM   3241 C  CD1 . LEU B 1 152 ? 25.127  -41.368 1.661   1.00 26.73  ? 356  LEU B CD1 1 
ATOM   3242 C  CD2 . LEU B 1 152 ? 25.493  -41.793 -0.767  1.00 26.02  ? 356  LEU B CD2 1 
ATOM   3243 N  N   . ARG B 1 153 ? 30.331  -42.188 0.409   1.00 28.69  ? 357  ARG B N   1 
ATOM   3244 C  CA  . ARG B 1 153 ? 31.720  -41.932 0.784   1.00 29.38  ? 357  ARG B CA  1 
ATOM   3245 C  C   . ARG B 1 153 ? 31.803  -41.936 2.310   1.00 29.99  ? 357  ARG B C   1 
ATOM   3246 O  O   . ARG B 1 153 ? 30.915  -41.372 2.959   1.00 29.70  ? 357  ARG B O   1 
ATOM   3247 C  CB  . ARG B 1 153 ? 32.115  -40.530 0.290   1.00 29.53  ? 357  ARG B CB  1 
ATOM   3248 C  CG  . ARG B 1 153 ? 33.327  -40.467 -0.584  1.00 29.30  ? 357  ARG B CG  1 
ATOM   3249 C  CD  . ARG B 1 153 ? 34.218  -39.348 -0.171  1.00 29.22  ? 357  ARG B CD  1 
ATOM   3250 N  NE  . ARG B 1 153 ? 33.737  -37.992 -0.452  1.00 28.40  ? 357  ARG B NE  1 
ATOM   3251 C  CZ  . ARG B 1 153 ? 33.938  -36.962 0.371   1.00 26.97  ? 357  ARG B CZ  1 
ATOM   3252 N  NH1 . ARG B 1 153 ? 34.538  -37.163 1.536   1.00 27.44  ? 357  ARG B NH1 1 
ATOM   3253 N  NH2 . ARG B 1 153 ? 33.519  -35.741 0.058   1.00 26.44  ? 357  ARG B NH2 1 
ATOM   3254 N  N   . LYS B 1 154 ? 32.896  -42.484 2.859   1.00 29.99  ? 358  LYS B N   1 
ATOM   3255 C  CA  . LYS B 1 154 ? 33.057  -42.735 4.310   1.00 30.67  ? 358  LYS B CA  1 
ATOM   3256 C  C   . LYS B 1 154 ? 32.427  -41.848 5.367   1.00 30.98  ? 358  LYS B C   1 
ATOM   3257 O  O   . LYS B 1 154 ? 31.474  -42.302 6.036   1.00 32.68  ? 358  LYS B O   1 
ATOM   3258 C  CB  . LYS B 1 154 ? 34.491  -43.068 4.725   1.00 30.83  ? 358  LYS B CB  1 
ATOM   3259 C  CG  . LYS B 1 154 ? 34.593  -44.504 5.229   1.00 31.41  ? 358  LYS B CG  1 
ATOM   3260 C  CD  . LYS B 1 154 ? 35.469  -44.612 6.468   1.00 32.52  ? 358  LYS B CD  1 
ATOM   3261 C  CE  . LYS B 1 154 ? 35.046  -45.794 7.332   1.00 33.60  ? 358  LYS B CE  1 
ATOM   3262 N  NZ  . LYS B 1 154 ? 35.001  -47.034 6.519   1.00 35.73  ? 358  LYS B NZ  1 
ATOM   3263 N  N   . PRO B 1 155 ? 32.908  -40.582 5.536   1.00 29.68  ? 359  PRO B N   1 
ATOM   3264 C  CA  . PRO B 1 155 ? 32.440  -39.953 6.768   1.00 28.45  ? 359  PRO B CA  1 
ATOM   3265 C  C   . PRO B 1 155 ? 30.917  -39.892 6.751   1.00 27.56  ? 359  PRO B C   1 
ATOM   3266 O  O   . PRO B 1 155 ? 30.290  -39.981 7.811   1.00 27.92  ? 359  PRO B O   1 
ATOM   3267 C  CB  . PRO B 1 155 ? 33.059  -38.542 6.730   1.00 28.45  ? 359  PRO B CB  1 
ATOM   3268 C  CG  . PRO B 1 155 ? 33.421  -38.307 5.305   1.00 28.27  ? 359  PRO B CG  1 
ATOM   3269 C  CD  . PRO B 1 155 ? 33.727  -39.665 4.728   1.00 29.60  ? 359  PRO B CD  1 
ATOM   3270 N  N   . PHE B 1 156 ? 30.344  -39.791 5.549   1.00 26.06  ? 360  PHE B N   1 
ATOM   3271 C  CA  . PHE B 1 156 ? 28.893  -39.671 5.364   1.00 25.05  ? 360  PHE B CA  1 
ATOM   3272 C  C   . PHE B 1 156 ? 28.115  -40.986 5.572   1.00 25.47  ? 360  PHE B C   1 
ATOM   3273 O  O   . PHE B 1 156 ? 27.086  -40.996 6.250   1.00 25.79  ? 360  PHE B O   1 
ATOM   3274 C  CB  . PHE B 1 156 ? 28.595  -38.982 4.026   1.00 24.29  ? 360  PHE B CB  1 
ATOM   3275 C  CG  . PHE B 1 156 ? 29.306  -37.652 3.873   1.00 22.82  ? 360  PHE B CG  1 
ATOM   3276 C  CD1 . PHE B 1 156 ? 28.942  -36.563 4.655   1.00 20.82  ? 360  PHE B CD1 1 
ATOM   3277 C  CD2 . PHE B 1 156 ? 30.365  -37.501 2.978   1.00 22.84  ? 360  PHE B CD2 1 
ATOM   3278 C  CE1 . PHE B 1 156 ? 29.596  -35.337 4.537   1.00 19.93  ? 360  PHE B CE1 1 
ATOM   3279 C  CE2 . PHE B 1 156 ? 31.031  -36.265 2.847   1.00 22.86  ? 360  PHE B CE2 1 
ATOM   3280 C  CZ  . PHE B 1 156 ? 30.638  -35.182 3.628   1.00 21.62  ? 360  PHE B CZ  1 
ATOM   3281 N  N   . SER B 1 157 ? 28.607  -42.099 5.042   1.00 25.52  ? 361  SER B N   1 
ATOM   3282 C  CA  . SER B 1 157 ? 27.993  -43.404 5.368   1.00 26.19  ? 361  SER B CA  1 
ATOM   3283 C  C   . SER B 1 157 ? 28.019  -43.697 6.880   1.00 26.31  ? 361  SER B C   1 
ATOM   3284 O  O   . SER B 1 157 ? 27.024  -44.150 7.451   1.00 26.44  ? 361  SER B O   1 
ATOM   3285 C  CB  . SER B 1 157 ? 28.671  -44.529 4.583   1.00 26.42  ? 361  SER B CB  1 
ATOM   3286 O  OG  . SER B 1 157 ? 30.082  -44.442 4.697   1.00 26.92  ? 361  SER B OG  1 
ATOM   3287 N  N   . ASP B 1 158 ? 29.150  -43.400 7.521   1.00 26.47  ? 362  ASP B N   1 
ATOM   3288 C  CA  . ASP B 1 158 ? 29.368  -43.658 8.955   1.00 26.57  ? 362  ASP B CA  1 
ATOM   3289 C  C   . ASP B 1 158 ? 28.481  -42.901 9.955   1.00 25.36  ? 362  ASP B C   1 
ATOM   3290 O  O   . ASP B 1 158 ? 28.200  -43.426 11.028  1.00 24.57  ? 362  ASP B O   1 
ATOM   3291 C  CB  . ASP B 1 158 ? 30.830  -43.385 9.325   1.00 27.41  ? 362  ASP B CB  1 
ATOM   3292 C  CG  . ASP B 1 158 ? 31.797  -44.360 8.684   1.00 30.35  ? 362  ASP B CG  1 
ATOM   3293 O  OD1 . ASP B 1 158 ? 31.369  -45.263 7.931   1.00 34.30  ? 362  ASP B OD1 1 
ATOM   3294 O  OD2 . ASP B 1 158 ? 33.010  -44.208 8.940   1.00 34.29  ? 362  ASP B OD2 1 
ATOM   3295 N  N   . ILE B 1 159 ? 28.085  -41.664 9.652   1.00 25.13  ? 363  ILE B N   1 
ATOM   3296 C  CA  . ILE B 1 159 ? 27.212  -40.915 10.589  1.00 24.98  ? 363  ILE B CA  1 
ATOM   3297 C  C   . ILE B 1 159 ? 25.821  -41.502 10.686  1.00 24.41  ? 363  ILE B C   1 
ATOM   3298 O  O   . ILE B 1 159 ? 25.196  -41.439 11.741  1.00 23.89  ? 363  ILE B O   1 
ATOM   3299 C  CB  . ILE B 1 159 ? 26.997  -39.416 10.255  1.00 25.34  ? 363  ILE B CB  1 
ATOM   3300 C  CG1 . ILE B 1 159 ? 27.419  -39.083 8.837   1.00 25.88  ? 363  ILE B CG1 1 
ATOM   3301 C  CG2 . ILE B 1 159 ? 27.655  -38.524 11.304  1.00 24.25  ? 363  ILE B CG2 1 
ATOM   3302 C  CD1 . ILE B 1 159 ? 26.705  -37.865 8.283   1.00 28.77  ? 363  ILE B CD1 1 
ATOM   3303 N  N   . ILE B 1 160 ? 25.356  -42.081 9.583   1.00 23.47  ? 364  ILE B N   1 
ATOM   3304 C  CA  . ILE B 1 160 ? 23.979  -42.523 9.458   1.00 23.02  ? 364  ILE B CA  1 
ATOM   3305 C  C   . ILE B 1 160 ? 23.708  -43.927 10.035  1.00 22.66  ? 364  ILE B C   1 
ATOM   3306 O  O   . ILE B 1 160 ? 22.722  -44.124 10.757  1.00 21.36  ? 364  ILE B O   1 
ATOM   3307 C  CB  . ILE B 1 160 ? 23.525  -42.409 7.980   1.00 23.60  ? 364  ILE B CB  1 
ATOM   3308 C  CG1 . ILE B 1 160 ? 23.701  -40.967 7.485   1.00 23.59  ? 364  ILE B CG1 1 
ATOM   3309 C  CG2 . ILE B 1 160 ? 22.079  -42.859 7.825   1.00 24.80  ? 364  ILE B CG2 1 
ATOM   3310 C  CD1 . ILE B 1 160 ? 23.711  -40.790 5.962   1.00 23.99  ? 364  ILE B CD1 1 
ATOM   3311 N  N   . GLU B 1 161 ? 24.584  -44.892 9.736   1.00 21.51  ? 365  GLU B N   1 
ATOM   3312 C  CA  . GLU B 1 161 ? 24.365  -46.305 10.137  1.00 21.23  ? 365  GLU B CA  1 
ATOM   3313 C  C   . GLU B 1 161 ? 24.036  -46.553 11.645  1.00 20.72  ? 365  GLU B C   1 
ATOM   3314 O  O   . GLU B 1 161 ? 23.090  -47.301 11.945  1.00 20.43  ? 365  GLU B O   1 
ATOM   3315 C  CB  . GLU B 1 161 ? 25.532  -47.196 9.653   1.00 20.90  ? 365  GLU B CB  1 
ATOM   3316 C  CG  . GLU B 1 161 ? 25.415  -48.721 9.944   1.00 22.22  ? 365  GLU B CG  1 
ATOM   3317 C  CD  . GLU B 1 161 ? 24.173  -49.398 9.366   1.00 23.27  ? 365  GLU B CD  1 
ATOM   3318 O  OE1 . GLU B 1 161 ? 23.472  -48.815 8.504   1.00 25.43  ? 365  GLU B OE1 1 
ATOM   3319 O  OE2 . GLU B 1 161 ? 23.887  -50.545 9.781   1.00 26.21  ? 365  GLU B OE2 1 
ATOM   3320 N  N   . PRO B 1 162 ? 24.776  -45.906 12.587  1.00 20.15  ? 366  PRO B N   1 
ATOM   3321 C  CA  . PRO B 1 162 ? 24.462  -46.143 14.015  1.00 20.05  ? 366  PRO B CA  1 
ATOM   3322 C  C   . PRO B 1 162 ? 23.056  -45.701 14.446  1.00 19.98  ? 366  PRO B C   1 
ATOM   3323 O  O   . PRO B 1 162 ? 22.548  -46.192 15.460  1.00 19.40  ? 366  PRO B O   1 
ATOM   3324 C  CB  . PRO B 1 162 ? 25.525  -45.335 14.776  1.00 20.31  ? 366  PRO B CB  1 
ATOM   3325 C  CG  . PRO B 1 162 ? 26.526  -44.870 13.749  1.00 20.65  ? 366  PRO B CG  1 
ATOM   3326 C  CD  . PRO B 1 162 ? 25.884  -44.943 12.409  1.00 20.05  ? 366  PRO B CD  1 
ATOM   3327 N  N   . LYS B 1 163 ? 22.447  -44.787 13.688  1.00 19.91  ? 367  LYS B N   1 
ATOM   3328 C  CA  . LYS B 1 163 ? 21.070  -44.355 13.936  1.00 19.97  ? 367  LYS B CA  1 
ATOM   3329 C  C   . LYS B 1 163 ? 20.078  -45.433 13.543  1.00 20.26  ? 367  LYS B C   1 
ATOM   3330 O  O   . LYS B 1 163 ? 19.060  -45.593 14.220  1.00 20.39  ? 367  LYS B O   1 
ATOM   3331 C  CB  . LYS B 1 163 ? 20.744  -43.040 13.214  1.00 19.90  ? 367  LYS B CB  1 
ATOM   3332 C  CG  . LYS B 1 163 ? 21.256  -41.779 13.912  1.00 19.30  ? 367  LYS B CG  1 
ATOM   3333 C  CD  . LYS B 1 163 ? 22.767  -41.689 13.839  1.00 17.20  ? 367  LYS B CD  1 
ATOM   3334 C  CE  . LYS B 1 163 ? 23.289  -40.307 14.215  1.00 18.86  ? 367  LYS B CE  1 
ATOM   3335 N  NZ  . LYS B 1 163 ? 24.799  -40.281 14.227  1.00 20.83  ? 367  LYS B NZ  1 
ATOM   3336 N  N   . PHE B 1 164 ? 20.355  -46.133 12.437  1.00 20.50  ? 368  PHE B N   1 
ATOM   3337 C  CA  . PHE B 1 164 ? 19.630  -47.370 12.080  1.00 20.55  ? 368  PHE B CA  1 
ATOM   3338 C  C   . PHE B 1 164 ? 19.740  -48.439 13.156  1.00 20.39  ? 368  PHE B C   1 
ATOM   3339 O  O   . PHE B 1 164 ? 18.734  -49.022 13.555  1.00 20.06  ? 368  PHE B O   1 
ATOM   3340 C  CB  . PHE B 1 164 ? 20.105  -47.955 10.744  1.00 21.00  ? 368  PHE B CB  1 
ATOM   3341 C  CG  . PHE B 1 164 ? 19.428  -47.362 9.532   1.00 21.46  ? 368  PHE B CG  1 
ATOM   3342 C  CD1 . PHE B 1 164 ? 18.227  -47.892 9.059   1.00 20.54  ? 368  PHE B CD1 1 
ATOM   3343 C  CD2 . PHE B 1 164 ? 20.002  -46.276 8.859   1.00 20.66  ? 368  PHE B CD2 1 
ATOM   3344 C  CE1 . PHE B 1 164 ? 17.603  -47.354 7.918   1.00 19.96  ? 368  PHE B CE1 1 
ATOM   3345 C  CE2 . PHE B 1 164 ? 19.393  -45.729 7.728   1.00 21.93  ? 368  PHE B CE2 1 
ATOM   3346 C  CZ  . PHE B 1 164 ? 18.185  -46.262 7.252   1.00 21.47  ? 368  PHE B CZ  1 
ATOM   3347 N  N   . GLU B 1 165 ? 20.959  -48.707 13.615  1.00 20.68  ? 369  GLU B N   1 
ATOM   3348 C  CA  . GLU B 1 165 ? 21.178  -49.710 14.665  1.00 21.92  ? 369  GLU B CA  1 
ATOM   3349 C  C   . GLU B 1 165 ? 20.361  -49.380 15.912  1.00 21.30  ? 369  GLU B C   1 
ATOM   3350 O  O   . GLU B 1 165 ? 19.712  -50.260 16.465  1.00 21.86  ? 369  GLU B O   1 
ATOM   3351 C  CB  . GLU B 1 165 ? 22.655  -49.847 15.034  1.00 21.27  ? 369  GLU B CB  1 
ATOM   3352 C  CG  . GLU B 1 165 ? 23.534  -50.406 13.933  1.00 23.90  ? 369  GLU B CG  1 
ATOM   3353 C  CD  . GLU B 1 165 ? 25.013  -50.314 14.275  1.00 25.21  ? 369  GLU B CD  1 
ATOM   3354 O  OE1 . GLU B 1 165 ? 25.368  -50.540 15.455  1.00 30.88  ? 369  GLU B OE1 1 
ATOM   3355 O  OE2 . GLU B 1 165 ? 25.824  -49.999 13.371  1.00 30.41  ? 369  GLU B OE2 1 
ATOM   3356 N  N   . PHE B 1 166 ? 20.376  -48.113 16.346  1.00 20.75  ? 370  PHE B N   1 
ATOM   3357 C  CA  . PHE B 1 166 ? 19.564  -47.701 17.493  1.00 20.24  ? 370  PHE B CA  1 
ATOM   3358 C  C   . PHE B 1 166 ? 18.062  -47.922 17.235  1.00 20.48  ? 370  PHE B C   1 
ATOM   3359 O  O   . PHE B 1 166 ? 17.352  -48.471 18.082  1.00 20.32  ? 370  PHE B O   1 
ATOM   3360 C  CB  . PHE B 1 166 ? 19.801  -46.223 17.888  1.00 20.09  ? 370  PHE B CB  1 
ATOM   3361 C  CG  . PHE B 1 166 ? 18.870  -45.754 18.969  1.00 19.79  ? 370  PHE B CG  1 
ATOM   3362 C  CD1 . PHE B 1 166 ? 17.600  -45.278 18.651  1.00 19.99  ? 370  PHE B CD1 1 
ATOM   3363 C  CD2 . PHE B 1 166 ? 19.233  -45.854 20.310  1.00 19.35  ? 370  PHE B CD2 1 
ATOM   3364 C  CE1 . PHE B 1 166 ? 16.707  -44.883 19.658  1.00 20.65  ? 370  PHE B CE1 1 
ATOM   3365 C  CE2 . PHE B 1 166 ? 18.357  -45.469 21.315  1.00 19.92  ? 370  PHE B CE2 1 
ATOM   3366 C  CZ  . PHE B 1 166 ? 17.086  -44.988 20.985  1.00 20.89  ? 370  PHE B CZ  1 
ATOM   3367 N  N   . ALA B 1 167 ? 17.602  -47.483 16.061  1.00 20.60  ? 371  ALA B N   1 
ATOM   3368 C  CA  . ALA B 1 167 ? 16.188  -47.481 15.705  1.00 20.78  ? 371  ALA B CA  1 
ATOM   3369 C  C   . ALA B 1 167 ? 15.590  -48.882 15.674  1.00 21.38  ? 371  ALA B C   1 
ATOM   3370 O  O   . ALA B 1 167 ? 14.534  -49.120 16.266  1.00 21.71  ? 371  ALA B O   1 
ATOM   3371 C  CB  . ALA B 1 167 ? 15.987  -46.788 14.383  1.00 20.36  ? 371  ALA B CB  1 
ATOM   3372 N  N   . VAL B 1 168 ? 16.255  -49.809 14.997  1.00 21.78  ? 372  VAL B N   1 
ATOM   3373 C  CA  . VAL B 1 168 ? 15.743  -51.180 14.940  1.00 22.44  ? 372  VAL B CA  1 
ATOM   3374 C  C   . VAL B 1 168 ? 15.458  -51.710 16.347  1.00 22.22  ? 372  VAL B C   1 
ATOM   3375 O  O   . VAL B 1 168 ? 14.319  -52.065 16.630  1.00 22.45  ? 372  VAL B O   1 
ATOM   3376 C  CB  . VAL B 1 168 ? 16.594  -52.149 14.035  1.00 22.20  ? 372  VAL B CB  1 
ATOM   3377 C  CG1 . VAL B 1 168 ? 16.464  -51.760 12.577  1.00 22.38  ? 372  VAL B CG1 1 
ATOM   3378 C  CG2 . VAL B 1 168 ? 18.042  -52.129 14.411  1.00 24.84  ? 372  VAL B CG2 1 
ATOM   3379 N  N   . LYS B 1 169 ? 16.455  -51.707 17.235  1.00 22.34  ? 373  LYS B N   1 
ATOM   3380 C  CA  . LYS B 1 169 ? 16.245  -52.088 18.641  1.00 22.73  ? 373  LYS B CA  1 
ATOM   3381 C  C   . LYS B 1 169 ? 15.151  -51.261 19.364  1.00 22.24  ? 373  LYS B C   1 
ATOM   3382 O  O   . LYS B 1 169 ? 14.354  -51.817 20.101  1.00 21.92  ? 373  LYS B O   1 
ATOM   3383 C  CB  . LYS B 1 169 ? 17.556  -52.063 19.439  1.00 23.23  ? 373  LYS B CB  1 
ATOM   3384 C  CG  . LYS B 1 169 ? 18.693  -52.899 18.845  1.00 24.76  ? 373  LYS B CG  1 
ATOM   3385 C  CD  . LYS B 1 169 ? 19.972  -52.844 19.705  1.00 24.70  ? 373  LYS B CD  1 
ATOM   3386 C  CE  . LYS B 1 169 ? 20.962  -51.821 19.177  1.00 29.93  ? 373  LYS B CE  1 
ATOM   3387 N  NZ  . LYS B 1 169 ? 22.167  -51.688 20.049  1.00 31.79  ? 373  LYS B NZ  1 
ATOM   3388 N  N   . PHE B 1 170 ? 15.120  -49.940 19.155  1.00 21.49  ? 374  PHE B N   1 
ATOM   3389 C  CA  . PHE B 1 170 ? 14.083  -49.088 19.758  1.00 21.44  ? 374  PHE B CA  1 
ATOM   3390 C  C   . PHE B 1 170 ? 12.673  -49.513 19.316  1.00 21.44  ? 374  PHE B C   1 
ATOM   3391 O  O   . PHE B 1 170 ? 11.769  -49.611 20.142  1.00 21.90  ? 374  PHE B O   1 
ATOM   3392 C  CB  . PHE B 1 170 ? 14.353  -47.598 19.456  1.00 21.21  ? 374  PHE B CB  1 
ATOM   3393 C  CG  . PHE B 1 170 ? 13.507  -46.620 20.276  1.00 21.11  ? 374  PHE B CG  1 
ATOM   3394 C  CD1 . PHE B 1 170 ? 13.685  -46.495 21.659  1.00 22.12  ? 374  PHE B CD1 1 
ATOM   3395 C  CD2 . PHE B 1 170 ? 12.559  -45.809 19.654  1.00 20.81  ? 374  PHE B CD2 1 
ATOM   3396 C  CE1 . PHE B 1 170 ? 12.916  -45.584 22.403  1.00 20.79  ? 374  PHE B CE1 1 
ATOM   3397 C  CE2 . PHE B 1 170 ? 11.783  -44.902 20.382  1.00 19.87  ? 374  PHE B CE2 1 
ATOM   3398 C  CZ  . PHE B 1 170 ? 11.965  -44.790 21.760  1.00 20.84  ? 374  PHE B CZ  1 
ATOM   3399 N  N   . ASN B 1 171 ? 12.504  -49.803 18.025  1.00 21.30  ? 375  ASN B N   1 
ATOM   3400 C  CA  . ASN B 1 171 ? 11.200  -50.195 17.475  1.00 21.44  ? 375  ASN B CA  1 
ATOM   3401 C  C   . ASN B 1 171 ? 10.666  -51.532 18.007  1.00 21.73  ? 375  ASN B C   1 
ATOM   3402 O  O   . ASN B 1 171 ? 9.451   -51.750 18.021  1.00 21.80  ? 375  ASN B O   1 
ATOM   3403 C  CB  . ASN B 1 171 ? 11.209  -50.182 15.933  1.00 20.75  ? 375  ASN B CB  1 
ATOM   3404 C  CG  . ASN B 1 171 ? 11.143  -48.774 15.341  1.00 20.88  ? 375  ASN B CG  1 
ATOM   3405 O  OD1 . ASN B 1 171 ? 10.760  -47.810 16.007  1.00 22.07  ? 375  ASN B OD1 1 
ATOM   3406 N  ND2 . ASN B 1 171 ? 11.502  -48.657 14.067  1.00 20.92  ? 375  ASN B ND2 1 
ATOM   3407 N  N   . ALA B 1 172 ? 11.566  -52.408 18.457  1.00 22.46  ? 376  ALA B N   1 
ATOM   3408 C  CA  . ALA B 1 172 ? 11.175  -53.660 19.121  1.00 23.54  ? 376  ALA B CA  1 
ATOM   3409 C  C   . ALA B 1 172 ? 10.432  -53.439 20.440  1.00 23.73  ? 376  ALA B C   1 
ATOM   3410 O  O   . ALA B 1 172 ? 9.790   -54.356 20.945  1.00 24.06  ? 376  ALA B O   1 
ATOM   3411 C  CB  . ALA B 1 172 ? 12.384  -54.573 19.342  1.00 23.84  ? 376  ALA B CB  1 
ATOM   3412 N  N   . LEU B 1 173 ? 10.501  -52.229 20.989  1.00 23.98  ? 377  LEU B N   1 
ATOM   3413 C  CA  . LEU B 1 173 ? 9.759   -51.928 22.211  1.00 24.30  ? 377  LEU B CA  1 
ATOM   3414 C  C   . LEU B 1 173 ? 8.277   -51.686 21.913  1.00 24.64  ? 377  LEU B C   1 
ATOM   3415 O  O   . LEU B 1 173 ? 7.447   -51.753 22.822  1.00 25.12  ? 377  LEU B O   1 
ATOM   3416 C  CB  . LEU B 1 173 ? 10.382  -50.756 22.980  1.00 24.15  ? 377  LEU B CB  1 
ATOM   3417 C  CG  . LEU B 1 173 ? 11.803  -50.967 23.536  1.00 25.13  ? 377  LEU B CG  1 
ATOM   3418 C  CD1 . LEU B 1 173 ? 12.284  -49.774 24.365  1.00 24.04  ? 377  LEU B CD1 1 
ATOM   3419 C  CD2 . LEU B 1 173 ? 11.878  -52.259 24.359  1.00 24.74  ? 377  LEU B CD2 1 
ATOM   3420 N  N   . GLU B 1 174 ? 7.959   -51.413 20.642  1.00 24.99  ? 378  GLU B N   1 
ATOM   3421 C  CA  . GLU B 1 174 ? 6.585   -51.184 20.174  1.00 25.81  ? 378  GLU B CA  1 
ATOM   3422 C  C   . GLU B 1 174 ? 5.847   -50.023 20.862  1.00 24.62  ? 378  GLU B C   1 
ATOM   3423 O  O   . GLU B 1 174 ? 4.661   -50.129 21.184  1.00 24.42  ? 378  GLU B O   1 
ATOM   3424 C  CB  . GLU B 1 174 ? 5.758   -52.482 20.232  1.00 25.88  ? 378  GLU B CB  1 
ATOM   3425 C  CG  . GLU B 1 174 ? 6.359   -53.609 19.378  1.00 27.62  ? 378  GLU B CG  1 
ATOM   3426 C  CD  . GLU B 1 174 ? 5.448   -54.805 19.224  1.00 29.52  ? 378  GLU B CD  1 
ATOM   3427 O  OE1 . GLU B 1 174 ? 5.913   -55.839 18.684  1.00 34.70  ? 378  GLU B OE1 1 
ATOM   3428 O  OE2 . GLU B 1 174 ? 4.266   -54.721 19.629  1.00 35.14  ? 378  GLU B OE2 1 
ATOM   3429 N  N   . LEU B 1 175 ? 6.538   -48.905 21.063  1.00 23.74  ? 379  LEU B N   1 
ATOM   3430 C  CA  . LEU B 1 175 ? 5.868   -47.712 21.555  1.00 23.00  ? 379  LEU B CA  1 
ATOM   3431 C  C   . LEU B 1 175 ? 4.890   -47.204 20.506  1.00 22.88  ? 379  LEU B C   1 
ATOM   3432 O  O   . LEU B 1 175 ? 5.099   -47.416 19.310  1.00 23.46  ? 379  LEU B O   1 
ATOM   3433 C  CB  . LEU B 1 175 ? 6.871   -46.613 21.905  1.00 23.23  ? 379  LEU B CB  1 
ATOM   3434 C  CG  . LEU B 1 175 ? 7.986   -46.932 22.915  1.00 23.25  ? 379  LEU B CG  1 
ATOM   3435 C  CD1 . LEU B 1 175 ? 8.735   -45.648 23.266  1.00 22.41  ? 379  LEU B CD1 1 
ATOM   3436 C  CD2 . LEU B 1 175 ? 7.465   -47.641 24.180  1.00 23.40  ? 379  LEU B CD2 1 
ATOM   3437 N  N   . ASP B 1 176 ? 3.824   -46.541 20.949  1.00 21.79  ? 380  ASP B N   1 
ATOM   3438 C  CA  . ASP B 1 176 ? 2.974   -45.794 20.026  1.00 21.49  ? 380  ASP B CA  1 
ATOM   3439 C  C   . ASP B 1 176 ? 3.149   -44.280 20.211  1.00 20.48  ? 380  ASP B C   1 
ATOM   3440 O  O   . ASP B 1 176 ? 3.945   -43.839 21.050  1.00 19.67  ? 380  ASP B O   1 
ATOM   3441 C  CB  . ASP B 1 176 ? 1.498   -46.228 20.120  1.00 21.85  ? 380  ASP B CB  1 
ATOM   3442 C  CG  . ASP B 1 176 ? 0.882   -45.961 21.479  1.00 22.59  ? 380  ASP B CG  1 
ATOM   3443 O  OD1 . ASP B 1 176 ? 1.224   -44.957 22.135  1.00 23.20  ? 380  ASP B OD1 1 
ATOM   3444 O  OD2 . ASP B 1 176 ? 0.021   -46.766 21.880  1.00 24.62  ? 380  ASP B OD2 1 
ATOM   3445 N  N   . ASP B 1 177 ? 2.425   -43.498 19.418  1.00 19.37  ? 381  ASP B N   1 
ATOM   3446 C  CA  . ASP B 1 177 ? 2.525   -42.028 19.477  1.00 18.85  ? 381  ASP B CA  1 
ATOM   3447 C  C   . ASP B 1 177 ? 2.230   -41.408 20.848  1.00 18.63  ? 381  ASP B C   1 
ATOM   3448 O  O   . ASP B 1 177 ? 2.782   -40.359 21.175  1.00 18.12  ? 381  ASP B O   1 
ATOM   3449 C  CB  . ASP B 1 177 ? 1.642   -41.385 18.413  1.00 18.15  ? 381  ASP B CB  1 
ATOM   3450 C  CG  . ASP B 1 177 ? 2.193   -41.581 16.995  1.00 19.35  ? 381  ASP B CG  1 
ATOM   3451 O  OD1 . ASP B 1 177 ? 3.289   -41.062 16.706  1.00 18.23  ? 381  ASP B OD1 1 
ATOM   3452 O  OD2 . ASP B 1 177 ? 1.539   -42.253 16.172  1.00 19.05  ? 381  ASP B OD2 1 
ATOM   3453 N  N   . SER B 1 178 ? 1.347   -42.034 21.628  1.00 18.16  ? 382  SER B N   1 
ATOM   3454 C  CA  . SER B 1 178 ? 0.975   -41.493 22.942  1.00 18.06  ? 382  SER B CA  1 
ATOM   3455 C  C   . SER B 1 178 ? 2.108   -41.665 23.952  1.00 17.61  ? 382  SER B C   1 
ATOM   3456 O  O   . SER B 1 178 ? 2.319   -40.800 24.809  1.00 17.65  ? 382  SER B O   1 
ATOM   3457 C  CB  . SER B 1 178 ? -0.343  -42.084 23.472  1.00 18.06  ? 382  SER B CB  1 
ATOM   3458 O  OG  . SER B 1 178 ? -0.203  -43.447 23.850  1.00 18.21  ? 382  SER B OG  1 
ATOM   3459 N  N   . ASP B 1 179 ? 2.821   -42.784 23.840  1.00 17.28  ? 383  ASP B N   1 
ATOM   3460 C  CA  . ASP B 1 179 ? 4.025   -43.044 24.618  1.00 17.30  ? 383  ASP B CA  1 
ATOM   3461 C  C   . ASP B 1 179 ? 5.133   -42.067 24.253  1.00 17.07  ? 383  ASP B C   1 
ATOM   3462 O  O   . ASP B 1 179 ? 5.795   -41.509 25.133  1.00 16.20  ? 383  ASP B O   1 
ATOM   3463 C  CB  . ASP B 1 179 ? 4.568   -44.449 24.318  1.00 17.84  ? 383  ASP B CB  1 
ATOM   3464 C  CG  . ASP B 1 179 ? 3.558   -45.554 24.567  1.00 19.05  ? 383  ASP B CG  1 
ATOM   3465 O  OD1 . ASP B 1 179 ? 2.716   -45.435 25.484  1.00 19.79  ? 383  ASP B OD1 1 
ATOM   3466 O  OD2 . ASP B 1 179 ? 3.646   -46.574 23.860  1.00 21.49  ? 383  ASP B OD2 1 
ATOM   3467 N  N   . LEU B 1 180 ? 5.348   -41.908 22.938  1.00 16.65  ? 384  LEU B N   1 
ATOM   3468 C  CA  . LEU B 1 180 ? 6.422   -41.089 22.387  1.00 16.30  ? 384  LEU B CA  1 
ATOM   3469 C  C   . LEU B 1 180 ? 6.294   -39.620 22.769  1.00 16.27  ? 384  LEU B C   1 
ATOM   3470 O  O   . LEU B 1 180 ? 7.308   -38.940 22.981  1.00 16.37  ? 384  LEU B O   1 
ATOM   3471 C  CB  . LEU B 1 180 ? 6.529   -41.264 20.858  1.00 16.65  ? 384  LEU B CB  1 
ATOM   3472 C  CG  . LEU B 1 180 ? 7.045   -42.617 20.301  1.00 16.51  ? 384  LEU B CG  1 
ATOM   3473 C  CD1 . LEU B 1 180 ? 6.758   -42.735 18.793  1.00 16.32  ? 384  LEU B CD1 1 
ATOM   3474 C  CD2 . LEU B 1 180 ? 8.533   -42.844 20.557  1.00 16.21  ? 384  LEU B CD2 1 
ATOM   3475 N  N   . ALA B 1 181 ? 5.059   -39.130 22.872  1.00 16.47  ? 385  ALA B N   1 
ATOM   3476 C  CA  . ALA B 1 181 ? 4.818   -37.747 23.277  1.00 16.55  ? 385  ALA B CA  1 
ATOM   3477 C  C   . ALA B 1 181 ? 5.470   -37.499 24.635  1.00 17.47  ? 385  ALA B C   1 
ATOM   3478 O  O   . ALA B 1 181 ? 6.169   -36.507 24.830  1.00 16.97  ? 385  ALA B O   1 
ATOM   3479 C  CB  . ALA B 1 181 ? 3.320   -37.467 23.333  1.00 16.59  ? 385  ALA B CB  1 
ATOM   3480 N  N   . LEU B 1 182 ? 5.291   -38.447 25.555  1.00 17.67  ? 386  LEU B N   1 
ATOM   3481 C  CA  . LEU B 1 182 ? 5.847   -38.323 26.903  1.00 17.74  ? 386  LEU B CA  1 
ATOM   3482 C  C   . LEU B 1 182 ? 7.353   -38.595 26.950  1.00 17.28  ? 386  LEU B C   1 
ATOM   3483 O  O   . LEU B 1 182 ? 8.065   -37.995 27.734  1.00 18.03  ? 386  LEU B O   1 
ATOM   3484 C  CB  . LEU B 1 182 ? 5.100   -39.236 27.881  1.00 17.47  ? 386  LEU B CB  1 
ATOM   3485 C  CG  . LEU B 1 182 ? 3.629   -38.968 28.228  1.00 18.57  ? 386  LEU B CG  1 
ATOM   3486 C  CD1 . LEU B 1 182 ? 3.052   -40.187 28.943  1.00 19.56  ? 386  LEU B CD1 1 
ATOM   3487 C  CD2 . LEU B 1 182 ? 3.445   -37.725 29.083  1.00 20.36  ? 386  LEU B CD2 1 
ATOM   3488 N  N   . PHE B 1 183 ? 7.823   -39.518 26.127  1.00 17.80  ? 387  PHE B N   1 
ATOM   3489 C  CA  . PHE B 1 183 ? 9.250   -39.846 26.030  1.00 18.08  ? 387  PHE B CA  1 
ATOM   3490 C  C   . PHE B 1 183 ? 10.074  -38.653 25.512  1.00 17.73  ? 387  PHE B C   1 
ATOM   3491 O  O   . PHE B 1 183 ? 11.087  -38.264 26.116  1.00 17.67  ? 387  PHE B O   1 
ATOM   3492 C  CB  . PHE B 1 183 ? 9.420   -41.092 25.130  1.00 18.73  ? 387  PHE B CB  1 
ATOM   3493 C  CG  . PHE B 1 183 ? 10.802  -41.655 25.127  1.00 18.93  ? 387  PHE B CG  1 
ATOM   3494 C  CD1 . PHE B 1 183 ? 11.291  -42.338 26.238  1.00 20.82  ? 387  PHE B CD1 1 
ATOM   3495 C  CD2 . PHE B 1 183 ? 11.617  -41.501 24.023  1.00 20.23  ? 387  PHE B CD2 1 
ATOM   3496 C  CE1 . PHE B 1 183 ? 12.587  -42.861 26.247  1.00 20.96  ? 387  PHE B CE1 1 
ATOM   3497 C  CE2 . PHE B 1 183 ? 12.921  -42.022 24.015  1.00 20.83  ? 387  PHE B CE2 1 
ATOM   3498 C  CZ  . PHE B 1 183 ? 13.401  -42.711 25.130  1.00 19.85  ? 387  PHE B CZ  1 
ATOM   3499 N  N   . ILE B 1 184 ? 9.614   -38.058 24.418  1.00 16.93  ? 388  ILE B N   1 
ATOM   3500 C  CA  . ILE B 1 184 ? 10.245  -36.870 23.826  1.00 16.78  ? 388  ILE B CA  1 
ATOM   3501 C  C   . ILE B 1 184 ? 10.181  -35.674 24.763  1.00 16.66  ? 388  ILE B C   1 
ATOM   3502 O  O   . ILE B 1 184 ? 11.198  -35.019 24.977  1.00 17.67  ? 388  ILE B O   1 
ATOM   3503 C  CB  . ILE B 1 184 ? 9.639   -36.510 22.436  1.00 16.13  ? 388  ILE B CB  1 
ATOM   3504 C  CG1 . ILE B 1 184 ? 9.817   -37.682 21.462  1.00 17.37  ? 388  ILE B CG1 1 
ATOM   3505 C  CG2 . ILE B 1 184 ? 10.283  -35.248 21.877  1.00 15.60  ? 388  ILE B CG2 1 
ATOM   3506 C  CD1 . ILE B 1 184 ? 11.259  -38.217 21.362  1.00 20.27  ? 388  ILE B CD1 1 
ATOM   3507 N  N   . ALA B 1 185 ? 9.014   -35.419 25.353  1.00 16.68  ? 389  ALA B N   1 
ATOM   3508 C  CA  . ALA B 1 185 ? 8.871   -34.361 26.371  1.00 16.41  ? 389  ALA B CA  1 
ATOM   3509 C  C   . ALA B 1 185 ? 9.908   -34.489 27.498  1.00 16.18  ? 389  ALA B C   1 
ATOM   3510 O  O   . ALA B 1 185 ? 10.457  -33.490 27.952  1.00 15.71  ? 389  ALA B O   1 
ATOM   3511 C  CB  . ALA B 1 185 ? 7.468   -34.354 26.941  1.00 16.01  ? 389  ALA B CB  1 
ATOM   3512 N  N   . ALA B 1 186 ? 10.193  -35.723 27.922  1.00 16.09  ? 390  ALA B N   1 
ATOM   3513 C  CA  . ALA B 1 186 ? 11.107  -35.969 29.045  1.00 16.19  ? 390  ALA B CA  1 
ATOM   3514 C  C   . ALA B 1 186 ? 12.571  -35.818 28.624  1.00 16.14  ? 390  ALA B C   1 
ATOM   3515 O  O   . ALA B 1 186 ? 13.438  -35.568 29.459  1.00 16.04  ? 390  ALA B O   1 
ATOM   3516 C  CB  . ALA B 1 186 ? 10.870  -37.376 29.636  1.00 15.97  ? 390  ALA B CB  1 
ATOM   3517 N  N   . ILE B 1 187 ? 12.846  -36.013 27.334  1.00 16.61  ? 391  ILE B N   1 
ATOM   3518 C  CA  . ILE B 1 187 ? 14.166  -35.732 26.766  1.00 17.19  ? 391  ILE B CA  1 
ATOM   3519 C  C   . ILE B 1 187 ? 14.421  -34.202 26.748  1.00 18.10  ? 391  ILE B C   1 
ATOM   3520 O  O   . ILE B 1 187 ? 15.496  -33.724 27.161  1.00 18.10  ? 391  ILE B O   1 
ATOM   3521 C  CB  . ILE B 1 187 ? 14.282  -36.320 25.338  1.00 16.79  ? 391  ILE B CB  1 
ATOM   3522 C  CG1 . ILE B 1 187 ? 14.478  -37.856 25.381  1.00 16.66  ? 391  ILE B CG1 1 
ATOM   3523 C  CG2 . ILE B 1 187 ? 15.418  -35.664 24.558  1.00 16.46  ? 391  ILE B CG2 1 
ATOM   3524 C  CD1 . ILE B 1 187 ? 14.291  -38.516 24.010  1.00 17.75  ? 391  ILE B CD1 1 
ATOM   3525 N  N   . ILE B 1 188 ? 13.438  -33.447 26.260  1.00 18.51  ? 392  ILE B N   1 
ATOM   3526 C  CA  . ILE B 1 188 ? 13.590  -31.989 26.104  1.00 19.96  ? 392  ILE B CA  1 
ATOM   3527 C  C   . ILE B 1 188 ? 13.608  -31.296 27.466  1.00 20.83  ? 392  ILE B C   1 
ATOM   3528 O  O   . ILE B 1 188 ? 14.473  -30.439 27.722  1.00 21.70  ? 392  ILE B O   1 
ATOM   3529 C  CB  . ILE B 1 188 ? 12.516  -31.380 25.168  1.00 19.81  ? 392  ILE B CB  1 
ATOM   3530 C  CG1 . ILE B 1 188 ? 12.767  -31.827 23.727  1.00 20.70  ? 392  ILE B CG1 1 
ATOM   3531 C  CG2 . ILE B 1 188 ? 12.530  -29.851 25.224  1.00 19.77  ? 392  ILE B CG2 1 
ATOM   3532 C  CD1 . ILE B 1 188 ? 11.528  -31.812 22.898  1.00 24.46  ? 392  ILE B CD1 1 
ATOM   3533 N  N   . LEU B 1 189 ? 12.677  -31.676 28.345  1.00 21.61  ? 393  LEU B N   1 
ATOM   3534 C  CA  . LEU B 1 189 ? 12.632  -31.108 29.694  1.00 22.36  ? 393  LEU B CA  1 
ATOM   3535 C  C   . LEU B 1 189 ? 13.620  -31.803 30.617  1.00 23.19  ? 393  LEU B C   1 
ATOM   3536 O  O   . LEU B 1 189 ? 13.248  -32.666 31.419  1.00 23.95  ? 393  LEU B O   1 
ATOM   3537 C  CB  . LEU B 1 189 ? 11.199  -31.077 30.243  1.00 22.04  ? 393  LEU B CB  1 
ATOM   3538 C  CG  . LEU B 1 189 ? 10.485  -29.839 29.666  1.00 23.15  ? 393  LEU B CG  1 
ATOM   3539 C  CD1 . LEU B 1 189 ? 9.048   -30.092 29.329  1.00 24.65  ? 393  LEU B CD1 1 
ATOM   3540 C  CD2 . LEU B 1 189 ? 10.646  -28.592 30.551  1.00 20.72  ? 393  LEU B CD2 1 
ATOM   3541 N  N   . CYS B 1 190 ? 14.892  -31.438 30.482  1.00 23.28  ? 394  CYS B N   1 
ATOM   3542 C  CA  . CYS B 1 190 ? 15.968  -32.167 31.134  1.00 23.34  ? 394  CYS B CA  1 
ATOM   3543 C  C   . CYS B 1 190 ? 16.778  -31.248 32.035  1.00 23.39  ? 394  CYS B C   1 
ATOM   3544 O  O   . CYS B 1 190 ? 17.404  -30.300 31.569  1.00 23.07  ? 394  CYS B O   1 
ATOM   3545 C  CB  . CYS B 1 190 ? 16.857  -32.830 30.082  1.00 23.70  ? 394  CYS B CB  1 
ATOM   3546 S  SG  . CYS B 1 190 ? 18.311  -33.636 30.753  1.00 23.76  ? 394  CYS B SG  1 
ATOM   3547 N  N   . GLY B 1 191 ? 16.770  -31.546 33.329  1.00 23.27  ? 395  GLY B N   1 
ATOM   3548 C  CA  . GLY B 1 191 ? 17.300  -30.631 34.329  1.00 24.12  ? 395  GLY B CA  1 
ATOM   3549 C  C   . GLY B 1 191 ? 18.809  -30.550 34.455  1.00 24.83  ? 395  GLY B C   1 
ATOM   3550 O  O   . GLY B 1 191 ? 19.309  -29.646 35.121  1.00 24.69  ? 395  GLY B O   1 
ATOM   3551 N  N   . ASP B 1 192 ? 19.539  -31.493 33.851  1.00 25.43  ? 396  ASP B N   1 
ATOM   3552 C  CA  . ASP B 1 192 ? 21.009  -31.454 33.919  1.00 26.50  ? 396  ASP B CA  1 
ATOM   3553 C  C   . ASP B 1 192 ? 21.728  -30.869 32.702  1.00 26.30  ? 396  ASP B C   1 
ATOM   3554 O  O   . ASP B 1 192 ? 22.948  -30.979 32.609  1.00 27.32  ? 396  ASP B O   1 
ATOM   3555 C  CB  . ASP B 1 192 ? 21.625  -32.806 34.333  1.00 27.29  ? 396  ASP B CB  1 
ATOM   3556 C  CG  . ASP B 1 192 ? 21.266  -33.944 33.390  1.00 29.75  ? 396  ASP B CG  1 
ATOM   3557 O  OD1 . ASP B 1 192 ? 20.067  -34.286 33.268  1.00 33.83  ? 396  ASP B OD1 1 
ATOM   3558 O  OD2 . ASP B 1 192 ? 22.189  -34.532 32.802  1.00 32.93  ? 396  ASP B OD2 1 
ATOM   3559 N  N   . ARG B 1 193 ? 21.001  -30.218 31.796  1.00 25.70  ? 397  ARG B N   1 
ATOM   3560 C  CA  . ARG B 1 193 ? 21.651  -29.543 30.657  1.00 25.41  ? 397  ARG B CA  1 
ATOM   3561 C  C   . ARG B 1 193 ? 22.608  -28.439 31.140  1.00 25.31  ? 397  ARG B C   1 
ATOM   3562 O  O   . ARG B 1 193 ? 22.288  -27.718 32.085  1.00 24.69  ? 397  ARG B O   1 
ATOM   3563 C  CB  . ARG B 1 193 ? 20.634  -28.970 29.668  1.00 24.42  ? 397  ARG B CB  1 
ATOM   3564 C  CG  . ARG B 1 193 ? 19.642  -29.970 29.093  1.00 24.63  ? 397  ARG B CG  1 
ATOM   3565 C  CD  . ARG B 1 193 ? 20.285  -31.264 28.570  1.00 22.50  ? 397  ARG B CD  1 
ATOM   3566 N  NE  . ARG B 1 193 ? 19.309  -32.045 27.819  1.00 22.16  ? 397  ARG B NE  1 
ATOM   3567 C  CZ  . ARG B 1 193 ? 19.510  -33.272 27.345  1.00 20.24  ? 397  ARG B CZ  1 
ATOM   3568 N  NH1 . ARG B 1 193 ? 20.684  -33.877 27.504  1.00 17.34  ? 397  ARG B NH1 1 
ATOM   3569 N  NH2 . ARG B 1 193 ? 18.537  -33.884 26.687  1.00 18.84  ? 397  ARG B NH2 1 
ATOM   3570 N  N   . PRO B 1 194 ? 23.797  -28.333 30.508  1.00 25.75  ? 398  PRO B N   1 
ATOM   3571 C  CA  . PRO B 1 194 ? 24.806  -27.327 30.870  1.00 25.69  ? 398  PRO B CA  1 
ATOM   3572 C  C   . PRO B 1 194 ? 24.269  -25.892 30.768  1.00 25.35  ? 398  PRO B C   1 
ATOM   3573 O  O   . PRO B 1 194 ? 23.641  -25.545 29.773  1.00 25.96  ? 398  PRO B O   1 
ATOM   3574 C  CB  . PRO B 1 194 ? 25.895  -27.545 29.809  1.00 25.59  ? 398  PRO B CB  1 
ATOM   3575 C  CG  . PRO B 1 194 ? 25.737  -28.980 29.392  1.00 26.07  ? 398  PRO B CG  1 
ATOM   3576 C  CD  . PRO B 1 194 ? 24.260  -29.199 29.402  1.00 25.50  ? 398  PRO B CD  1 
ATOM   3577 N  N   . GLY B 1 195 ? 24.517  -25.071 31.783  1.00 25.10  ? 399  GLY B N   1 
ATOM   3578 C  CA  . GLY B 1 195 ? 24.165  -23.654 31.735  1.00 24.46  ? 399  GLY B CA  1 
ATOM   3579 C  C   . GLY B 1 195 ? 22.717  -23.335 32.038  1.00 24.91  ? 399  GLY B C   1 
ATOM   3580 O  O   . GLY B 1 195 ? 22.309  -22.170 31.970  1.00 24.52  ? 399  GLY B O   1 
ATOM   3581 N  N   . LEU B 1 196 ? 21.936  -24.366 32.370  1.00 24.92  ? 400  LEU B N   1 
ATOM   3582 C  CA  . LEU B 1 196 ? 20.534  -24.190 32.762  1.00 25.39  ? 400  LEU B CA  1 
ATOM   3583 C  C   . LEU B 1 196 ? 20.460  -23.300 34.008  1.00 25.79  ? 400  LEU B C   1 
ATOM   3584 O  O   . LEU B 1 196 ? 21.252  -23.448 34.942  1.00 25.50  ? 400  LEU B O   1 
ATOM   3585 C  CB  . LEU B 1 196 ? 19.880  -25.548 33.054  1.00 25.10  ? 400  LEU B CB  1 
ATOM   3586 C  CG  . LEU B 1 196 ? 18.605  -26.021 32.356  1.00 25.42  ? 400  LEU B CG  1 
ATOM   3587 C  CD1 . LEU B 1 196 ? 17.754  -26.774 33.359  1.00 24.65  ? 400  LEU B CD1 1 
ATOM   3588 C  CD2 . LEU B 1 196 ? 17.767  -24.916 31.694  1.00 25.39  ? 400  LEU B CD2 1 
ATOM   3589 N  N   . MET B 1 197 ? 19.503  -22.384 34.010  1.00 26.26  ? 401  MET B N   1 
ATOM   3590 C  CA  . MET B 1 197 ? 19.380  -21.381 35.053  1.00 27.49  ? 401  MET B CA  1 
ATOM   3591 C  C   . MET B 1 197 ? 18.487  -21.881 36.190  1.00 26.84  ? 401  MET B C   1 
ATOM   3592 O  O   . MET B 1 197 ? 18.909  -21.913 37.341  1.00 26.69  ? 401  MET B O   1 
ATOM   3593 C  CB  . MET B 1 197 ? 18.823  -20.101 34.432  1.00 27.23  ? 401  MET B CB  1 
ATOM   3594 C  CG  . MET B 1 197 ? 18.875  -18.848 35.269  1.00 29.57  ? 401  MET B CG  1 
ATOM   3595 S  SD  . MET B 1 197 ? 18.484  -17.408 34.220  1.00 29.91  ? 401  MET B SD  1 
ATOM   3596 C  CE  . MET B 1 197 ? 16.718  -17.605 33.976  1.00 29.91  ? 401  MET B CE  1 
ATOM   3597 N  N   . ASN B 1 198 ? 17.254  -22.269 35.874  1.00 26.38  ? 402  ASN B N   1 
ATOM   3598 C  CA  . ASN B 1 198 ? 16.341  -22.741 36.915  1.00 26.21  ? 402  ASN B CA  1 
ATOM   3599 C  C   . ASN B 1 198 ? 16.306  -24.272 36.989  1.00 25.93  ? 402  ASN B C   1 
ATOM   3600 O  O   . ASN B 1 198 ? 15.358  -24.900 36.512  1.00 25.74  ? 402  ASN B O   1 
ATOM   3601 C  CB  . ASN B 1 198 ? 14.930  -22.167 36.704  1.00 26.32  ? 402  ASN B CB  1 
ATOM   3602 C  CG  . ASN B 1 198 ? 14.037  -22.299 37.947  1.00 26.40  ? 402  ASN B CG  1 
ATOM   3603 O  OD1 . ASN B 1 198 ? 14.428  -22.887 38.965  1.00 26.22  ? 402  ASN B OD1 1 
ATOM   3604 N  ND2 . ASN B 1 198 ? 12.822  -21.753 37.856  1.00 26.63  ? 402  ASN B ND2 1 
ATOM   3605 N  N   . VAL B 1 199 ? 17.339  -24.853 37.594  1.00 25.77  ? 403  VAL B N   1 
ATOM   3606 C  CA  . VAL B 1 199 ? 17.492  -26.320 37.670  1.00 26.23  ? 403  VAL B CA  1 
ATOM   3607 C  C   . VAL B 1 199 ? 16.382  -27.017 38.486  1.00 26.58  ? 403  VAL B C   1 
ATOM   3608 O  O   . VAL B 1 199 ? 15.800  -27.994 38.003  1.00 27.34  ? 403  VAL B O   1 
ATOM   3609 C  CB  . VAL B 1 199 ? 18.916  -26.750 38.178  1.00 25.55  ? 403  VAL B CB  1 
ATOM   3610 C  CG1 . VAL B 1 199 ? 19.052  -28.269 38.233  1.00 26.91  ? 403  VAL B CG1 1 
ATOM   3611 C  CG2 . VAL B 1 199 ? 20.012  -26.172 37.307  1.00 25.11  ? 403  VAL B CG2 1 
ATOM   3612 N  N   . PRO B 1 200 ? 16.083  -26.532 39.718  1.00 26.81  ? 404  PRO B N   1 
ATOM   3613 C  CA  . PRO B 1 200 ? 15.006  -27.177 40.482  1.00 26.60  ? 404  PRO B CA  1 
ATOM   3614 C  C   . PRO B 1 200 ? 13.658  -27.226 39.754  1.00 26.26  ? 404  PRO B C   1 
ATOM   3615 O  O   . PRO B 1 200 ? 12.998  -28.247 39.805  1.00 26.46  ? 404  PRO B O   1 
ATOM   3616 C  CB  . PRO B 1 200 ? 14.900  -26.316 41.752  1.00 26.56  ? 404  PRO B CB  1 
ATOM   3617 C  CG  . PRO B 1 200 ? 16.254  -25.705 41.897  1.00 26.93  ? 404  PRO B CG  1 
ATOM   3618 C  CD  . PRO B 1 200 ? 16.692  -25.420 40.482  1.00 26.80  ? 404  PRO B CD  1 
ATOM   3619 N  N   . ARG B 1 201 ? 13.250  -26.150 39.084  1.00 26.36  ? 405  ARG B N   1 
ATOM   3620 C  CA  . ARG B 1 201 ? 11.959  -26.142 38.383  1.00 26.14  ? 405  ARG B CA  1 
ATOM   3621 C  C   . ARG B 1 201 ? 11.902  -27.165 37.241  1.00 25.41  ? 405  ARG B C   1 
ATOM   3622 O  O   . ARG B 1 201 ? 10.961  -27.973 37.164  1.00 25.22  ? 405  ARG B O   1 
ATOM   3623 C  CB  . ARG B 1 201 ? 11.598  -24.747 37.867  1.00 26.73  ? 405  ARG B CB  1 
ATOM   3624 C  CG  . ARG B 1 201 ? 10.179  -24.670 37.302  1.00 29.71  ? 405  ARG B CG  1 
ATOM   3625 C  CD  . ARG B 1 201 ? 9.939   -23.423 36.460  1.00 35.53  ? 405  ARG B CD  1 
ATOM   3626 N  NE  . ARG B 1 201 ? 9.028   -22.469 37.102  1.00 40.27  ? 405  ARG B NE  1 
ATOM   3627 C  CZ  . ARG B 1 201 ? 8.400   -21.463 36.482  1.00 41.95  ? 405  ARG B CZ  1 
ATOM   3628 N  NH1 . ARG B 1 201 ? 8.564   -21.256 35.182  1.00 40.96  ? 405  ARG B NH1 1 
ATOM   3629 N  NH2 . ARG B 1 201 ? 7.593   -20.659 37.173  1.00 43.02  ? 405  ARG B NH2 1 
ATOM   3630 N  N   . VAL B 1 202 ? 12.903  -27.122 36.356  1.00 24.57  ? 406  VAL B N   1 
ATOM   3631 C  CA  . VAL B 1 202 ? 12.990  -28.059 35.218  1.00 22.98  ? 406  VAL B CA  1 
ATOM   3632 C  C   . VAL B 1 202 ? 13.126  -29.513 35.712  1.00 22.74  ? 406  VAL B C   1 
ATOM   3633 O  O   . VAL B 1 202 ? 12.517  -30.422 35.134  1.00 21.84  ? 406  VAL B O   1 
ATOM   3634 C  CB  . VAL B 1 202 ? 14.169  -27.711 34.251  1.00 23.16  ? 406  VAL B CB  1 
ATOM   3635 C  CG1 . VAL B 1 202 ? 14.238  -28.708 33.091  1.00 21.53  ? 406  VAL B CG1 1 
ATOM   3636 C  CG2 . VAL B 1 202 ? 14.052  -26.265 33.715  1.00 21.78  ? 406  VAL B CG2 1 
ATOM   3637 N  N   . GLU B 1 203 ? 13.923  -29.724 36.767  1.00 22.23  ? 407  GLU B N   1 
ATOM   3638 C  CA  . GLU B 1 203 ? 14.059  -31.057 37.377  1.00 21.89  ? 407  GLU B CA  1 
ATOM   3639 C  C   . GLU B 1 203 ? 12.722  -31.551 37.921  1.00 21.74  ? 407  GLU B C   1 
ATOM   3640 O  O   . GLU B 1 203 ? 12.410  -32.739 37.815  1.00 22.07  ? 407  GLU B O   1 
ATOM   3641 C  CB  . GLU B 1 203 ? 15.125  -31.107 38.496  1.00 21.97  ? 407  GLU B CB  1 
ATOM   3642 C  CG  . GLU B 1 203 ? 16.602  -31.178 38.045  1.00 21.57  ? 407  GLU B CG  1 
ATOM   3643 C  CD  . GLU B 1 203 ? 16.978  -32.386 37.179  1.00 22.89  ? 407  GLU B CD  1 
ATOM   3644 O  OE1 . GLU B 1 203 ? 18.195  -32.667 37.121  1.00 25.97  ? 407  GLU B OE1 1 
ATOM   3645 O  OE2 . GLU B 1 203 ? 16.112  -33.023 36.507  1.00 20.05  ? 407  GLU B OE2 1 
ATOM   3646 N  N   . ALA B 1 204 ? 11.941  -30.636 38.499  1.00 21.48  ? 408  ALA B N   1 
ATOM   3647 C  CA  . ALA B 1 204 ? 10.612  -30.958 39.025  1.00 20.88  ? 408  ALA B CA  1 
ATOM   3648 C  C   . ALA B 1 204 ? 9.646   -31.297 37.898  1.00 20.80  ? 408  ALA B C   1 
ATOM   3649 O  O   . ALA B 1 204 ? 8.924   -32.299 37.974  1.00 20.78  ? 408  ALA B O   1 
ATOM   3650 C  CB  . ALA B 1 204 ? 10.073  -29.823 39.869  1.00 20.88  ? 408  ALA B CB  1 
ATOM   3651 N  N   . ILE B 1 205 ? 9.644   -30.472 36.855  1.00 20.16  ? 409  ILE B N   1 
ATOM   3652 C  CA  . ILE B 1 205 ? 8.864   -30.757 35.632  1.00 20.01  ? 409  ILE B CA  1 
ATOM   3653 C  C   . ILE B 1 205 ? 9.181   -32.118 34.996  1.00 19.63  ? 409  ILE B C   1 
ATOM   3654 O  O   . ILE B 1 205 ? 8.260   -32.842 34.616  1.00 19.42  ? 409  ILE B O   1 
ATOM   3655 C  CB  . ILE B 1 205 ? 9.028   -29.658 34.560  1.00 19.53  ? 409  ILE B CB  1 
ATOM   3656 C  CG1 . ILE B 1 205 ? 8.486   -28.326 35.084  1.00 18.54  ? 409  ILE B CG1 1 
ATOM   3657 C  CG2 . ILE B 1 205 ? 8.315   -30.056 33.276  1.00 20.08  ? 409  ILE B CG2 1 
ATOM   3658 C  CD1 . ILE B 1 205 ? 8.899   -27.138 34.259  1.00 17.33  ? 409  ILE B CD1 1 
ATOM   3659 N  N   . GLN B 1 206 ? 10.472  -32.451 34.894  1.00 19.58  ? 410  GLN B N   1 
ATOM   3660 C  CA  . GLN B 1 206 ? 10.912  -33.674 34.228  1.00 19.59  ? 410  GLN B CA  1 
ATOM   3661 C  C   . GLN B 1 206 ? 10.489  -34.930 34.983  1.00 19.60  ? 410  GLN B C   1 
ATOM   3662 O  O   . GLN B 1 206 ? 10.093  -35.907 34.360  1.00 19.99  ? 410  GLN B O   1 
ATOM   3663 C  CB  . GLN B 1 206 ? 12.438  -33.694 33.994  1.00 19.65  ? 410  GLN B CB  1 
ATOM   3664 C  CG  . GLN B 1 206 ? 12.914  -34.976 33.263  1.00 18.27  ? 410  GLN B CG  1 
ATOM   3665 C  CD  . GLN B 1 206 ? 14.392  -35.006 32.975  1.00 20.21  ? 410  GLN B CD  1 
ATOM   3666 O  OE1 . GLN B 1 206 ? 15.199  -34.579 33.794  1.00 21.64  ? 410  GLN B OE1 1 
ATOM   3667 N  NE2 . GLN B 1 206 ? 14.766  -35.538 31.805  1.00 18.62  ? 410  GLN B NE2 1 
ATOM   3668 N  N   . ASP B 1 207 ? 10.618  -34.915 36.311  1.00 19.90  ? 411  ASP B N   1 
ATOM   3669 C  CA  . ASP B 1 207 ? 10.165  -36.039 37.141  1.00 20.19  ? 411  ASP B CA  1 
ATOM   3670 C  C   . ASP B 1 207 ? 8.641   -36.242 37.055  1.00 19.90  ? 411  ASP B C   1 
ATOM   3671 O  O   . ASP B 1 207 ? 8.168   -37.367 37.090  1.00 20.09  ? 411  ASP B O   1 
ATOM   3672 C  CB  . ASP B 1 207 ? 10.618  -35.873 38.603  1.00 20.61  ? 411  ASP B CB  1 
ATOM   3673 C  CG  . ASP B 1 207 ? 11.853  -36.706 38.942  1.00 21.94  ? 411  ASP B CG  1 
ATOM   3674 O  OD1 . ASP B 1 207 ? 12.141  -36.870 40.159  1.00 22.28  ? 411  ASP B OD1 1 
ATOM   3675 O  OD2 . ASP B 1 207 ? 12.537  -37.204 38.008  1.00 22.44  ? 411  ASP B OD2 1 
ATOM   3676 N  N   . THR B 1 208 ? 7.891   -35.154 36.934  1.00 19.80  ? 412  THR B N   1 
ATOM   3677 C  CA  . THR B 1 208 ? 6.444   -35.225 36.710  1.00 20.58  ? 412  THR B CA  1 
ATOM   3678 C  C   . THR B 1 208 ? 6.100   -35.889 35.368  1.00 20.27  ? 412  THR B C   1 
ATOM   3679 O  O   . THR B 1 208 ? 5.106   -36.630 35.264  1.00 20.89  ? 412  THR B O   1 
ATOM   3680 C  CB  . THR B 1 208 ? 5.814   -33.818 36.806  1.00 20.95  ? 412  THR B CB  1 
ATOM   3681 O  OG1 . THR B 1 208 ? 6.149   -33.258 38.077  1.00 22.17  ? 412  THR B OG1 1 
ATOM   3682 C  CG2 . THR B 1 208 ? 4.273   -33.842 36.650  1.00 21.26  ? 412  THR B CG2 1 
ATOM   3683 N  N   . ILE B 1 209 ? 6.914   -35.637 34.342  1.00 20.14  ? 413  ILE B N   1 
ATOM   3684 C  CA  . ILE B 1 209 ? 6.673   -36.250 33.016  1.00 19.38  ? 413  ILE B CA  1 
ATOM   3685 C  C   . ILE B 1 209 ? 7.043   -37.725 33.066  1.00 19.03  ? 413  ILE B C   1 
ATOM   3686 O  O   . ILE B 1 209 ? 6.403   -38.558 32.409  1.00 18.92  ? 413  ILE B O   1 
ATOM   3687 C  CB  . ILE B 1 209 ? 7.464   -35.527 31.906  1.00 19.46  ? 413  ILE B CB  1 
ATOM   3688 C  CG1 . ILE B 1 209 ? 7.083   -34.040 31.866  1.00 19.43  ? 413  ILE B CG1 1 
ATOM   3689 C  CG2 . ILE B 1 209 ? 7.234   -36.172 30.526  1.00 18.98  ? 413  ILE B CG2 1 
ATOM   3690 C  CD1 . ILE B 1 209 ? 8.094   -33.164 31.153  1.00 20.44  ? 413  ILE B CD1 1 
ATOM   3691 N  N   . LEU B 1 210 ? 8.065   -38.046 33.865  1.00 18.48  ? 414  LEU B N   1 
ATOM   3692 C  CA  . LEU B 1 210 ? 8.563   -39.419 33.952  1.00 19.10  ? 414  LEU B CA  1 
ATOM   3693 C  C   . LEU B 1 210 ? 7.608   -40.294 34.738  1.00 19.29  ? 414  LEU B C   1 
ATOM   3694 O  O   . LEU B 1 210 ? 7.389   -41.446 34.365  1.00 19.88  ? 414  LEU B O   1 
ATOM   3695 C  CB  . LEU B 1 210 ? 10.003  -39.484 34.504  1.00 18.73  ? 414  LEU B CB  1 
ATOM   3696 C  CG  . LEU B 1 210 ? 11.144  -39.042 33.566  1.00 19.04  ? 414  LEU B CG  1 
ATOM   3697 C  CD1 . LEU B 1 210 ? 12.432  -38.779 34.353  1.00 20.72  ? 414  LEU B CD1 1 
ATOM   3698 C  CD2 . LEU B 1 210 ? 11.400  -40.039 32.441  1.00 17.78  ? 414  LEU B CD2 1 
ATOM   3699 N  N   . ARG B 1 211 ? 7.043   -39.748 35.822  1.00 19.88  ? 415  ARG B N   1 
ATOM   3700 C  CA  . ARG B 1 211 ? 5.957   -40.410 36.553  1.00 20.15  ? 415  ARG B CA  1 
ATOM   3701 C  C   . ARG B 1 211 ? 4.717   -40.561 35.668  1.00 19.90  ? 415  ARG B C   1 
ATOM   3702 O  O   . ARG B 1 211 ? 4.111   -41.628 35.648  1.00 19.70  ? 415  ARG B O   1 
ATOM   3703 C  CB  . ARG B 1 211 ? 5.614   -39.670 37.850  1.00 20.13  ? 415  ARG B CB  1 
ATOM   3704 C  CG  . ARG B 1 211 ? 6.707   -39.783 38.926  1.00 21.36  ? 415  ARG B CG  1 
ATOM   3705 C  CD  . ARG B 1 211 ? 6.243   -39.327 40.303  1.00 20.72  ? 415  ARG B CD  1 
ATOM   3706 N  NE  . ARG B 1 211 ? 5.454   -38.095 40.259  1.00 22.40  ? 415  ARG B NE  1 
ATOM   3707 C  CZ  . ARG B 1 211 ? 5.968   -36.872 40.277  1.00 21.90  ? 415  ARG B CZ  1 
ATOM   3708 N  NH1 . ARG B 1 211 ? 7.283   -36.691 40.341  1.00 24.08  ? 415  ARG B NH1 1 
ATOM   3709 N  NH2 . ARG B 1 211 ? 5.163   -35.832 40.226  1.00 22.90  ? 415  ARG B NH2 1 
ATOM   3710 N  N   . ALA B 1 212 ? 4.357   -39.514 34.922  1.00 19.40  ? 416  ALA B N   1 
ATOM   3711 C  CA  . ALA B 1 212 ? 3.237   -39.628 33.971  1.00 19.41  ? 416  ALA B CA  1 
ATOM   3712 C  C   . ALA B 1 212 ? 3.478   -40.732 32.946  1.00 19.39  ? 416  ALA B C   1 
ATOM   3713 O  O   . ALA B 1 212 ? 2.565   -41.480 32.620  1.00 19.69  ? 416  ALA B O   1 
ATOM   3714 C  CB  . ALA B 1 212 ? 2.968   -38.297 33.269  1.00 18.80  ? 416  ALA B CB  1 
ATOM   3715 N  N   . LEU B 1 213 ? 4.715   -40.826 32.452  1.00 19.70  ? 417  LEU B N   1 
ATOM   3716 C  CA  . LEU B 1 213 ? 5.131   -41.872 31.519  1.00 19.63  ? 417  LEU B CA  1 
ATOM   3717 C  C   . LEU B 1 213 ? 5.012   -43.274 32.100  1.00 19.99  ? 417  LEU B C   1 
ATOM   3718 O  O   . LEU B 1 213 ? 4.472   -44.154 31.452  1.00 20.30  ? 417  LEU B O   1 
ATOM   3719 C  CB  . LEU B 1 213 ? 6.565   -41.615 30.997  1.00 19.65  ? 417  LEU B CB  1 
ATOM   3720 C  CG  . LEU B 1 213 ? 7.185   -42.572 29.954  1.00 19.55  ? 417  LEU B CG  1 
ATOM   3721 C  CD1 . LEU B 1 213 ? 6.371   -42.603 28.659  1.00 18.91  ? 417  LEU B CD1 1 
ATOM   3722 C  CD2 . LEU B 1 213 ? 8.647   -42.235 29.641  1.00 19.27  ? 417  LEU B CD2 1 
ATOM   3723 N  N   . GLU B 1 214 ? 5.520   -43.488 33.314  1.00 20.58  ? 418  GLU B N   1 
ATOM   3724 C  CA  . GLU B 1 214 ? 5.431   -44.810 33.938  1.00 21.01  ? 418  GLU B CA  1 
ATOM   3725 C  C   . GLU B 1 214 ? 3.976   -45.286 34.091  1.00 21.36  ? 418  GLU B C   1 
ATOM   3726 O  O   . GLU B 1 214 ? 3.661   -46.428 33.791  1.00 21.75  ? 418  GLU B O   1 
ATOM   3727 C  CB  . GLU B 1 214 ? 6.156   -44.856 35.298  1.00 20.87  ? 418  GLU B CB  1 
ATOM   3728 C  CG  . GLU B 1 214 ? 6.138   -46.271 35.885  1.00 21.29  ? 418  GLU B CG  1 
ATOM   3729 C  CD  . GLU B 1 214 ? 6.987   -46.434 37.120  1.00 24.09  ? 418  GLU B CD  1 
ATOM   3730 O  OE1 . GLU B 1 214 ? 6.870   -45.615 38.056  1.00 24.16  ? 418  GLU B OE1 1 
ATOM   3731 O  OE2 . GLU B 1 214 ? 7.765   -47.405 37.153  1.00 25.13  ? 418  GLU B OE2 1 
ATOM   3732 N  N   . PHE B 1 215 ? 3.094   -44.408 34.545  1.00 22.01  ? 419  PHE B N   1 
ATOM   3733 C  CA  . PHE B 1 215 ? 1.684   -44.775 34.685  1.00 22.69  ? 419  PHE B CA  1 
ATOM   3734 C  C   . PHE B 1 215 ? 1.010   -44.980 33.351  1.00 22.70  ? 419  PHE B C   1 
ATOM   3735 O  O   . PHE B 1 215 ? 0.204   -45.902 33.204  1.00 22.72  ? 419  PHE B O   1 
ATOM   3736 C  CB  . PHE B 1 215 ? 0.930   -43.760 35.531  1.00 22.93  ? 419  PHE B CB  1 
ATOM   3737 C  CG  . PHE B 1 215 ? 1.368   -43.741 36.974  1.00 24.73  ? 419  PHE B CG  1 
ATOM   3738 C  CD1 . PHE B 1 215 ? 1.614   -42.528 37.626  1.00 26.06  ? 419  PHE B CD1 1 
ATOM   3739 C  CD2 . PHE B 1 215 ? 1.549   -44.934 37.682  1.00 26.83  ? 419  PHE B CD2 1 
ATOM   3740 C  CE1 . PHE B 1 215 ? 2.019   -42.495 38.974  1.00 25.70  ? 419  PHE B CE1 1 
ATOM   3741 C  CE2 . PHE B 1 215 ? 1.964   -44.908 39.028  1.00 26.29  ? 419  PHE B CE2 1 
ATOM   3742 C  CZ  . PHE B 1 215 ? 2.188   -43.684 39.666  1.00 25.35  ? 419  PHE B CZ  1 
ATOM   3743 N  N   . HIS B 1 216 ? 1.354   -44.137 32.376  1.00 23.00  ? 420  HIS B N   1 
ATOM   3744 C  CA  . HIS B 1 216 ? 0.838   -44.290 31.018  1.00 23.17  ? 420  HIS B CA  1 
ATOM   3745 C  C   . HIS B 1 216 ? 1.208   -45.666 30.442  1.00 23.77  ? 420  HIS B C   1 
ATOM   3746 O  O   . HIS B 1 216 ? 0.363   -46.345 29.850  1.00 23.55  ? 420  HIS B O   1 
ATOM   3747 C  CB  . HIS B 1 216 ? 1.338   -43.155 30.110  1.00 23.13  ? 420  HIS B CB  1 
ATOM   3748 C  CG  . HIS B 1 216 ? 0.758   -43.198 28.734  1.00 22.26  ? 420  HIS B CG  1 
ATOM   3749 N  ND1 . HIS B 1 216 ? -0.548  -42.854 28.468  1.00 23.61  ? 420  HIS B ND1 1 
ATOM   3750 C  CD2 . HIS B 1 216 ? 1.295   -43.574 27.552  1.00 21.87  ? 420  HIS B CD2 1 
ATOM   3751 C  CE1 . HIS B 1 216 ? -0.793  -43.014 27.180  1.00 22.69  ? 420  HIS B CE1 1 
ATOM   3752 N  NE2 . HIS B 1 216 ? 0.309   -43.456 26.602  1.00 22.91  ? 420  HIS B NE2 1 
ATOM   3753 N  N   . LEU B 1 217 ? 2.463   -46.075 30.640  1.00 24.18  ? 421  LEU B N   1 
ATOM   3754 C  CA  . LEU B 1 217 ? 2.944   -47.382 30.191  1.00 25.08  ? 421  LEU B CA  1 
ATOM   3755 C  C   . LEU B 1 217 ? 2.253   -48.563 30.881  1.00 26.44  ? 421  LEU B C   1 
ATOM   3756 O  O   . LEU B 1 217 ? 2.040   -49.593 30.257  1.00 26.63  ? 421  LEU B O   1 
ATOM   3757 C  CB  . LEU B 1 217 ? 4.467   -47.503 30.346  1.00 24.81  ? 421  LEU B CB  1 
ATOM   3758 C  CG  . LEU B 1 217 ? 5.391   -46.641 29.476  1.00 22.31  ? 421  LEU B CG  1 
ATOM   3759 C  CD1 . LEU B 1 217 ? 6.848   -46.845 29.887  1.00 22.49  ? 421  LEU B CD1 1 
ATOM   3760 C  CD2 . LEU B 1 217 ? 5.209   -46.858 27.978  1.00 20.34  ? 421  LEU B CD2 1 
ATOM   3761 N  N   . GLN B 1 218 ? 1.927   -48.412 32.163  1.00 28.18  ? 422  GLN B N   1 
ATOM   3762 C  CA  . GLN B 1 218 ? 1.169   -49.421 32.909  1.00 29.95  ? 422  GLN B CA  1 
ATOM   3763 C  C   . GLN B 1 218 ? -0.212  -49.631 32.292  1.00 30.43  ? 422  GLN B C   1 
ATOM   3764 O  O   . GLN B 1 218 ? -0.640  -50.773 32.092  1.00 30.80  ? 422  GLN B O   1 
ATOM   3765 C  CB  . GLN B 1 218 ? 1.025   -49.024 34.381  1.00 29.73  ? 422  GLN B CB  1 
ATOM   3766 C  CG  . GLN B 1 218 ? 2.289   -49.240 35.215  1.00 30.99  ? 422  GLN B CG  1 
ATOM   3767 C  CD  . GLN B 1 218 ? 2.162   -48.715 36.642  1.00 31.42  ? 422  GLN B CD  1 
ATOM   3768 O  OE1 . GLN B 1 218 ? 1.059   -48.555 37.169  1.00 33.50  ? 422  GLN B OE1 1 
ATOM   3769 N  NE2 . GLN B 1 218 ? 3.299   -48.444 37.274  1.00 34.64  ? 422  GLN B NE2 1 
ATOM   3770 N  N   . ALA B 1 219 ? -0.896  -48.531 31.983  1.00 30.62  ? 423  ALA B N   1 
ATOM   3771 C  CA  . ALA B 1 219 ? -2.222  -48.595 31.374  1.00 31.44  ? 423  ALA B CA  1 
ATOM   3772 C  C   . ALA B 1 219 ? -2.187  -49.056 29.908  1.00 31.97  ? 423  ALA B C   1 
ATOM   3773 O  O   . ALA B 1 219 ? -2.923  -49.972 29.538  1.00 32.34  ? 423  ALA B O   1 
ATOM   3774 C  CB  . ALA B 1 219 ? -2.937  -47.248 31.502  1.00 31.48  ? 423  ALA B CB  1 
ATOM   3775 N  N   . ASN B 1 220 ? -1.326  -48.427 29.101  1.00 31.90  ? 424  ASN B N   1 
ATOM   3776 C  CA  . ASN B 1 220 ? -1.214  -48.665 27.651  1.00 32.39  ? 424  ASN B CA  1 
ATOM   3777 C  C   . ASN B 1 220 ? -0.498  -49.983 27.280  1.00 32.28  ? 424  ASN B C   1 
ATOM   3778 O  O   . ASN B 1 220 ? -0.838  -50.605 26.278  1.00 32.27  ? 424  ASN B O   1 
ATOM   3779 C  CB  . ASN B 1 220 ? -0.532  -47.439 26.981  1.00 32.26  ? 424  ASN B CB  1 
ATOM   3780 C  CG  . ASN B 1 220 ? -0.697  -47.389 25.449  1.00 33.34  ? 424  ASN B CG  1 
ATOM   3781 O  OD1 . ASN B 1 220 ? -1.682  -47.875 24.879  1.00 32.66  ? 424  ASN B OD1 1 
ATOM   3782 N  ND2 . ASN B 1 220 ? 0.282   -46.770 24.781  1.00 32.18  ? 424  ASN B ND2 1 
ATOM   3783 N  N   . HIS B 1 221 ? 0.480   -50.405 28.090  1.00 32.51  ? 425  HIS B N   1 
ATOM   3784 C  CA  . HIS B 1 221 ? 1.230   -51.655 27.860  1.00 32.74  ? 425  HIS B CA  1 
ATOM   3785 C  C   . HIS B 1 221 ? 1.222   -52.574 29.108  1.00 33.51  ? 425  HIS B C   1 
ATOM   3786 O  O   . HIS B 1 221 ? 2.281   -52.844 29.691  1.00 33.17  ? 425  HIS B O   1 
ATOM   3787 C  CB  . HIS B 1 221 ? 2.689   -51.361 27.453  1.00 32.53  ? 425  HIS B CB  1 
ATOM   3788 C  CG  . HIS B 1 221 ? 2.829   -50.465 26.260  1.00 33.07  ? 425  HIS B CG  1 
ATOM   3789 N  ND1 . HIS B 1 221 ? 3.050   -50.947 24.988  1.00 33.97  ? 425  HIS B ND1 1 
ATOM   3790 C  CD2 . HIS B 1 221 ? 2.782   -49.117 26.146  1.00 32.26  ? 425  HIS B CD2 1 
ATOM   3791 C  CE1 . HIS B 1 221 ? 3.130   -49.936 24.141  1.00 33.37  ? 425  HIS B CE1 1 
ATOM   3792 N  NE2 . HIS B 1 221 ? 2.966   -48.814 24.819  1.00 33.02  ? 425  HIS B NE2 1 
ATOM   3793 N  N   . PRO B 1 222 ? 0.041   -53.088 29.502  1.00 34.13  ? 426  PRO B N   1 
ATOM   3794 C  CA  . PRO B 1 222 ? -0.060  -53.833 30.772  1.00 34.86  ? 426  PRO B CA  1 
ATOM   3795 C  C   . PRO B 1 222 ? 0.900   -55.024 30.909  1.00 35.36  ? 426  PRO B C   1 
ATOM   3796 O  O   . PRO B 1 222 ? 1.399   -55.284 32.008  1.00 35.78  ? 426  PRO B O   1 
ATOM   3797 C  CB  . PRO B 1 222 ? -1.514  -54.317 30.787  1.00 34.79  ? 426  PRO B CB  1 
ATOM   3798 C  CG  . PRO B 1 222 ? -1.974  -54.233 29.358  1.00 34.70  ? 426  PRO B CG  1 
ATOM   3799 C  CD  . PRO B 1 222 ? -1.256  -53.037 28.806  1.00 34.21  ? 426  PRO B CD  1 
ATOM   3800 N  N   . ASP B 1 223 ? 1.181   -55.726 29.816  1.00 35.74  ? 427  ASP B N   1 
ATOM   3801 C  CA  . ASP B 1 223 ? 1.987   -56.946 29.908  1.00 36.15  ? 427  ASP B CA  1 
ATOM   3802 C  C   . ASP B 1 223 ? 3.497   -56.762 29.747  1.00 35.89  ? 427  ASP B C   1 
ATOM   3803 O  O   . ASP B 1 223 ? 4.225   -57.757 29.664  1.00 35.65  ? 427  ASP B O   1 
ATOM   3804 C  CB  . ASP B 1 223 ? 1.471   -58.012 28.937  1.00 36.55  ? 427  ASP B CB  1 
ATOM   3805 C  CG  . ASP B 1 223 ? 0.028   -58.394 29.211  1.00 38.26  ? 427  ASP B CG  1 
ATOM   3806 O  OD1 . ASP B 1 223 ? -0.346  -58.525 30.401  1.00 39.23  ? 427  ASP B OD1 1 
ATOM   3807 O  OD2 . ASP B 1 223 ? -0.734  -58.555 28.233  1.00 40.68  ? 427  ASP B OD2 1 
ATOM   3808 N  N   . ALA B 1 224 ? 3.953   -55.505 29.712  1.00 35.25  ? 428  ALA B N   1 
ATOM   3809 C  CA  . ALA B 1 224 ? 5.384   -55.173 29.630  1.00 34.67  ? 428  ALA B CA  1 
ATOM   3810 C  C   . ALA B 1 224 ? 5.927   -54.684 30.985  1.00 34.38  ? 428  ALA B C   1 
ATOM   3811 O  O   . ALA B 1 224 ? 5.982   -53.475 31.268  1.00 34.18  ? 428  ALA B O   1 
ATOM   3812 C  CB  . ALA B 1 224 ? 5.644   -54.135 28.513  1.00 34.82  ? 428  ALA B CB  1 
ATOM   3813 N  N   . GLN B 1 225 ? 6.336   -55.648 31.806  1.00 33.53  ? 429  GLN B N   1 
ATOM   3814 C  CA  . GLN B 1 225 ? 6.744   -55.423 33.197  1.00 32.68  ? 429  GLN B CA  1 
ATOM   3815 C  C   . GLN B 1 225 ? 7.861   -54.390 33.416  1.00 31.61  ? 429  GLN B C   1 
ATOM   3816 O  O   . GLN B 1 225 ? 7.764   -53.565 34.326  1.00 31.61  ? 429  GLN B O   1 
ATOM   3817 C  CB  . GLN B 1 225 ? 7.135   -56.761 33.843  1.00 32.80  ? 429  GLN B CB  1 
ATOM   3818 N  N   . GLN B 1 226 ? 8.917   -54.444 32.607  1.00 30.10  ? 430  GLN B N   1 
ATOM   3819 C  CA  . GLN B 1 226 ? 10.100  -53.613 32.856  1.00 28.93  ? 430  GLN B CA  1 
ATOM   3820 C  C   . GLN B 1 226 ? 10.296  -52.538 31.776  1.00 27.32  ? 430  GLN B C   1 
ATOM   3821 O  O   . GLN B 1 226 ? 11.425  -52.143 31.495  1.00 27.11  ? 430  GLN B O   1 
ATOM   3822 C  CB  . GLN B 1 226 ? 11.369  -54.483 33.014  1.00 29.22  ? 430  GLN B CB  1 
ATOM   3823 C  CG  . GLN B 1 226 ? 11.152  -55.900 33.593  1.00 31.58  ? 430  GLN B CG  1 
ATOM   3824 C  CD  . GLN B 1 226 ? 11.228  -56.002 35.116  1.00 35.82  ? 430  GLN B CD  1 
ATOM   3825 O  OE1 . GLN B 1 226 ? 11.743  -55.113 35.799  1.00 39.03  ? 430  GLN B OE1 1 
ATOM   3826 N  NE2 . GLN B 1 226 ? 10.733  -57.119 35.653  1.00 37.18  ? 430  GLN B NE2 1 
ATOM   3827 N  N   . LEU B 1 227 ? 9.199   -52.060 31.189  1.00 25.53  ? 431  LEU B N   1 
ATOM   3828 C  CA  . LEU B 1 227 ? 9.274   -51.165 30.032  1.00 24.65  ? 431  LEU B CA  1 
ATOM   3829 C  C   . LEU B 1 227 ? 9.775   -49.771 30.399  1.00 24.21  ? 431  LEU B C   1 
ATOM   3830 O  O   . LEU B 1 227 ? 10.516  -49.155 29.632  1.00 24.17  ? 431  LEU B O   1 
ATOM   3831 C  CB  . LEU B 1 227 ? 7.944   -51.100 29.257  1.00 24.15  ? 431  LEU B CB  1 
ATOM   3832 C  CG  . LEU B 1 227 ? 7.940   -50.326 27.926  1.00 24.96  ? 431  LEU B CG  1 
ATOM   3833 C  CD1 . LEU B 1 227 ? 8.997   -50.854 26.923  1.00 23.94  ? 431  LEU B CD1 1 
ATOM   3834 C  CD2 . LEU B 1 227 ? 6.564   -50.309 27.294  1.00 24.33  ? 431  LEU B CD2 1 
ATOM   3835 N  N   . PHE B 1 228 ? 9.399   -49.292 31.583  1.00 23.56  ? 432  PHE B N   1 
ATOM   3836 C  CA  . PHE B 1 228 ? 9.840   -47.971 32.035  1.00 22.89  ? 432  PHE B CA  1 
ATOM   3837 C  C   . PHE B 1 228 ? 11.357  -47.919 32.303  1.00 22.78  ? 432  PHE B C   1 
ATOM   3838 O  O   . PHE B 1 228 ? 12.016  -47.002 31.819  1.00 22.59  ? 432  PHE B O   1 
ATOM   3839 C  CB  . PHE B 1 228 ? 9.011   -47.465 33.232  1.00 22.01  ? 432  PHE B CB  1 
ATOM   3840 C  CG  . PHE B 1 228 ? 9.401   -46.089 33.710  1.00 20.90  ? 432  PHE B CG  1 
ATOM   3841 C  CD1 . PHE B 1 228 ? 9.085   -44.959 32.959  1.00 18.11  ? 432  PHE B CD1 1 
ATOM   3842 C  CD2 . PHE B 1 228 ? 10.086  -45.926 34.909  1.00 19.33  ? 432  PHE B CD2 1 
ATOM   3843 C  CE1 . PHE B 1 228 ? 9.448   -43.683 33.397  1.00 19.29  ? 432  PHE B CE1 1 
ATOM   3844 C  CE2 . PHE B 1 228 ? 10.462  -44.651 35.349  1.00 20.15  ? 432  PHE B CE2 1 
ATOM   3845 C  CZ  . PHE B 1 228 ? 10.138  -43.533 34.600  1.00 18.85  ? 432  PHE B CZ  1 
ATOM   3846 N  N   . PRO B 1 229 ? 11.911  -48.874 33.085  1.00 22.70  ? 433  PRO B N   1 
ATOM   3847 C  CA  . PRO B 1 229 ? 13.388  -48.888 33.201  1.00 22.72  ? 433  PRO B CA  1 
ATOM   3848 C  C   . PRO B 1 229 ? 14.143  -49.148 31.888  1.00 21.75  ? 433  PRO B C   1 
ATOM   3849 O  O   . PRO B 1 229 ? 15.236  -48.646 31.722  1.00 22.16  ? 433  PRO B O   1 
ATOM   3850 C  CB  . PRO B 1 229 ? 13.676  -50.003 34.223  1.00 22.41  ? 433  PRO B CB  1 
ATOM   3851 C  CG  . PRO B 1 229 ? 12.404  -50.777 34.343  1.00 23.28  ? 433  PRO B CG  1 
ATOM   3852 C  CD  . PRO B 1 229 ? 11.275  -49.885 33.954  1.00 22.95  ? 433  PRO B CD  1 
ATOM   3853 N  N   . LYS B 1 230 ? 13.572  -49.925 30.976  1.00 21.33  ? 434  LYS B N   1 
ATOM   3854 C  CA  . LYS B 1 230 ? 14.148  -50.083 29.633  1.00 20.52  ? 434  LYS B CA  1 
ATOM   3855 C  C   . LYS B 1 230 ? 14.236  -48.743 28.912  1.00 19.78  ? 434  LYS B C   1 
ATOM   3856 O  O   . LYS B 1 230 ? 15.219  -48.454 28.230  1.00 20.46  ? 434  LYS B O   1 
ATOM   3857 C  CB  . LYS B 1 230 ? 13.324  -51.071 28.819  1.00 20.82  ? 434  LYS B CB  1 
ATOM   3858 C  CG  . LYS B 1 230 ? 13.676  -52.521 29.123  1.00 22.24  ? 434  LYS B CG  1 
ATOM   3859 C  CD  . LYS B 1 230 ? 12.684  -53.481 28.501  1.00 23.97  ? 434  LYS B CD  1 
ATOM   3860 C  CE  . LYS B 1 230 ? 13.248  -54.883 28.576  1.00 27.14  ? 434  LYS B CE  1 
ATOM   3861 N  NZ  . LYS B 1 230 ? 12.168  -55.891 28.598  1.00 28.34  ? 434  LYS B NZ  1 
ATOM   3862 N  N   . LEU B 1 231 ? 13.196  -47.938 29.061  1.00 18.92  ? 435  LEU B N   1 
ATOM   3863 C  CA  . LEU B 1 231 ? 13.132  -46.630 28.453  1.00 18.39  ? 435  LEU B CA  1 
ATOM   3864 C  C   . LEU B 1 231 ? 14.110  -45.647 29.078  1.00 17.92  ? 435  LEU B C   1 
ATOM   3865 O  O   . LEU B 1 231 ? 14.692  -44.825 28.376  1.00 18.41  ? 435  LEU B O   1 
ATOM   3866 C  CB  . LEU B 1 231 ? 11.697  -46.096 28.465  1.00 18.46  ? 435  LEU B CB  1 
ATOM   3867 C  CG  . LEU B 1 231 ? 10.786  -46.698 27.378  1.00 18.51  ? 435  LEU B CG  1 
ATOM   3868 C  CD1 . LEU B 1 231 ? 9.389   -46.109 27.381  1.00 18.10  ? 435  LEU B CD1 1 
ATOM   3869 C  CD2 . LEU B 1 231 ? 11.405  -46.568 25.994  1.00 18.67  ? 435  LEU B CD2 1 
ATOM   3870 N  N   . LEU B 1 232 ? 14.287  -45.713 30.394  1.00 16.95  ? 436  LEU B N   1 
ATOM   3871 C  CA  . LEU B 1 232 ? 15.358  -44.956 31.050  1.00 16.56  ? 436  LEU B CA  1 
ATOM   3872 C  C   . LEU B 1 232 ? 16.734  -45.302 30.456  1.00 15.99  ? 436  LEU B C   1 
ATOM   3873 O  O   . LEU B 1 232 ? 17.533  -44.414 30.196  1.00 14.79  ? 436  LEU B O   1 
ATOM   3874 C  CB  . LEU B 1 232 ? 15.334  -45.180 32.573  1.00 16.64  ? 436  LEU B CB  1 
ATOM   3875 C  CG  . LEU B 1 232 ? 14.166  -44.631 33.398  1.00 17.00  ? 436  LEU B CG  1 
ATOM   3876 C  CD1 . LEU B 1 232 ? 14.303  -45.086 34.840  1.00 17.86  ? 436  LEU B CD1 1 
ATOM   3877 C  CD2 . LEU B 1 232 ? 14.062  -43.073 33.356  1.00 15.44  ? 436  LEU B CD2 1 
ATOM   3878 N  N   . GLN B 1 233 ? 17.002  -46.591 30.233  1.00 16.15  ? 437  GLN B N   1 
ATOM   3879 C  CA  . GLN B 1 233 ? 18.217  -47.017 29.544  1.00 16.72  ? 437  GLN B CA  1 
ATOM   3880 C  C   . GLN B 1 233 ? 18.328  -46.440 28.121  1.00 16.84  ? 437  GLN B C   1 
ATOM   3881 O  O   . GLN B 1 233 ? 19.406  -45.994 27.725  1.00 15.87  ? 437  GLN B O   1 
ATOM   3882 C  CB  . GLN B 1 233 ? 18.364  -48.553 29.539  1.00 17.03  ? 437  GLN B CB  1 
ATOM   3883 C  CG  . GLN B 1 233 ? 19.683  -49.065 28.955  1.00 17.78  ? 437  GLN B CG  1 
ATOM   3884 C  CD  . GLN B 1 233 ? 20.904  -48.570 29.724  1.00 20.71  ? 437  GLN B CD  1 
ATOM   3885 O  OE1 . GLN B 1 233 ? 21.692  -47.759 29.221  1.00 22.62  ? 437  GLN B OE1 1 
ATOM   3886 N  NE2 . GLN B 1 233 ? 21.051  -49.035 30.954  1.00 18.76  ? 437  GLN B NE2 1 
ATOM   3887 N  N   . LYS B 1 234 ? 17.216  -46.404 27.380  1.00 17.03  ? 438  LYS B N   1 
ATOM   3888 C  CA  . LYS B 1 234 ? 17.227  -45.822 26.037  1.00 17.77  ? 438  LYS B CA  1 
ATOM   3889 C  C   . LYS B 1 234 ? 17.612  -44.333 26.063  1.00 18.38  ? 438  LYS B C   1 
ATOM   3890 O  O   . LYS B 1 234 ? 18.332  -43.878 25.174  1.00 17.91  ? 438  LYS B O   1 
ATOM   3891 C  CB  . LYS B 1 234 ? 15.881  -46.005 25.314  1.00 17.45  ? 438  LYS B CB  1 
ATOM   3892 C  CG  . LYS B 1 234 ? 15.514  -47.457 24.958  1.00 16.48  ? 438  LYS B CG  1 
ATOM   3893 C  CD  . LYS B 1 234 ? 16.491  -48.107 23.997  1.00 16.33  ? 438  LYS B CD  1 
ATOM   3894 C  CE  . LYS B 1 234 ? 16.120  -49.584 23.837  1.00 18.68  ? 438  LYS B CE  1 
ATOM   3895 N  NZ  . LYS B 1 234 ? 17.139  -50.389 23.135  1.00 18.87  ? 438  LYS B NZ  1 
ATOM   3896 N  N   . MET B 1 235 ? 17.149  -43.591 27.078  1.00 19.01  ? 439  MET B N   1 
ATOM   3897 C  CA  . MET B 1 235 ? 17.524  -42.170 27.227  1.00 20.27  ? 439  MET B CA  1 
ATOM   3898 C  C   . MET B 1 235 ? 19.028  -42.050 27.448  1.00 20.05  ? 439  MET B C   1 
ATOM   3899 O  O   . MET B 1 235 ? 19.659  -41.113 26.954  1.00 19.66  ? 439  MET B O   1 
ATOM   3900 C  CB  . MET B 1 235 ? 16.777  -41.506 28.380  1.00 20.27  ? 439  MET B CB  1 
ATOM   3901 C  CG  . MET B 1 235 ? 15.310  -41.197 28.082  1.00 21.33  ? 439  MET B CG  1 
ATOM   3902 S  SD  . MET B 1 235 ? 14.327  -40.867 29.560  1.00 23.90  ? 439  MET B SD  1 
ATOM   3903 C  CE  . MET B 1 235 ? 15.090  -39.371 30.184  1.00 27.04  ? 439  MET B CE  1 
ATOM   3904 N  N   . ALA B 1 236 ? 19.594  -43.007 28.188  1.00 20.06  ? 440  ALA B N   1 
ATOM   3905 C  CA  . ALA B 1 236 ? 21.036  -43.035 28.427  1.00 20.26  ? 440  ALA B CA  1 
ATOM   3906 C  C   . ALA B 1 236 ? 21.756  -43.442 27.142  1.00 19.88  ? 440  ALA B C   1 
ATOM   3907 O  O   . ALA B 1 236 ? 22.863  -42.990 26.883  1.00 19.61  ? 440  ALA B O   1 
ATOM   3908 C  CB  . ALA B 1 236 ? 21.382  -43.991 29.567  1.00 20.36  ? 440  ALA B CB  1 
ATOM   3909 N  N   . ASP B 1 237 ? 21.121  -44.294 26.335  1.00 19.98  ? 441  ASP B N   1 
ATOM   3910 C  CA  . ASP B 1 237 ? 21.726  -44.711 25.068  1.00 19.88  ? 441  ASP B CA  1 
ATOM   3911 C  C   . ASP B 1 237 ? 21.729  -43.523 24.094  1.00 19.08  ? 441  ASP B C   1 
ATOM   3912 O  O   . ASP B 1 237 ? 22.717  -43.282 23.398  1.00 18.85  ? 441  ASP B O   1 
ATOM   3913 C  CB  . ASP B 1 237 ? 21.020  -45.933 24.436  1.00 19.04  ? 441  ASP B CB  1 
ATOM   3914 C  CG  . ASP B 1 237 ? 21.066  -47.208 25.312  1.00 20.64  ? 441  ASP B CG  1 
ATOM   3915 O  OD1 . ASP B 1 237 ? 21.900  -47.345 26.248  1.00 20.39  ? 441  ASP B OD1 1 
ATOM   3916 O  OD2 . ASP B 1 237 ? 20.232  -48.106 25.036  1.00 19.05  ? 441  ASP B OD2 1 
ATOM   3917 N  N   . LEU B 1 238 ? 20.619  -42.789 24.050  1.00 18.69  ? 442  LEU B N   1 
ATOM   3918 C  CA  . LEU B 1 238 ? 20.511  -41.588 23.198  1.00 18.41  ? 442  LEU B CA  1 
ATOM   3919 C  C   . LEU B 1 238 ? 21.530  -40.500 23.535  1.00 18.62  ? 442  LEU B C   1 
ATOM   3920 O  O   . LEU B 1 238 ? 22.055  -39.842 22.643  1.00 18.89  ? 442  LEU B O   1 
ATOM   3921 C  CB  . LEU B 1 238 ? 19.093  -41.016 23.241  1.00 18.16  ? 442  LEU B CB  1 
ATOM   3922 C  CG  . LEU B 1 238 ? 18.027  -41.773 22.452  1.00 17.04  ? 442  LEU B CG  1 
ATOM   3923 C  CD1 . LEU B 1 238 ? 16.622  -41.400 22.922  1.00 16.57  ? 442  LEU B CD1 1 
ATOM   3924 C  CD2 . LEU B 1 238 ? 18.208  -41.547 20.950  1.00 16.81  ? 442  LEU B CD2 1 
ATOM   3925 N  N   . ARG B 1 239 ? 21.781  -40.291 24.822  1.00 18.51  ? 443  ARG B N   1 
ATOM   3926 C  CA  . ARG B 1 239 ? 22.842  -39.385 25.254  1.00 19.73  ? 443  ARG B CA  1 
ATOM   3927 C  C   . ARG B 1 239 ? 24.197  -39.803 24.664  1.00 19.02  ? 443  ARG B C   1 
ATOM   3928 O  O   . ARG B 1 239 ? 24.921  -38.951 24.145  1.00 18.74  ? 443  ARG B O   1 
ATOM   3929 C  CB  . ARG B 1 239 ? 22.927  -39.305 26.781  1.00 19.68  ? 443  ARG B CB  1 
ATOM   3930 C  CG  . ARG B 1 239 ? 23.720  -38.118 27.270  1.00 23.44  ? 443  ARG B CG  1 
ATOM   3931 C  CD  . ARG B 1 239 ? 23.547  -37.917 28.765  1.00 28.37  ? 443  ARG B CD  1 
ATOM   3932 N  NE  . ARG B 1 239 ? 22.190  -37.501 29.142  1.00 29.69  ? 443  ARG B NE  1 
ATOM   3933 C  CZ  . ARG B 1 239 ? 21.941  -36.582 30.074  1.00 28.72  ? 443  ARG B CZ  1 
ATOM   3934 N  NH1 . ARG B 1 239 ? 22.943  -35.991 30.702  1.00 28.29  ? 443  ARG B NH1 1 
ATOM   3935 N  NH2 . ARG B 1 239 ? 20.703  -36.252 30.383  1.00 29.78  ? 443  ARG B NH2 1 
ATOM   3936 N  N   . GLN B 1 240 ? 24.526  -41.097 24.733  1.00 18.63  ? 444  GLN B N   1 
ATOM   3937 C  CA  . GLN B 1 240 ? 25.783  -41.603 24.163  1.00 18.42  ? 444  GLN B CA  1 
ATOM   3938 C  C   . GLN B 1 240 ? 25.793  -41.533 22.625  1.00 17.72  ? 444  GLN B C   1 
ATOM   3939 O  O   . GLN B 1 240 ? 26.813  -41.212 22.013  1.00 17.04  ? 444  GLN B O   1 
ATOM   3940 C  CB  . GLN B 1 240 ? 26.077  -43.037 24.661  1.00 19.24  ? 444  GLN B CB  1 
ATOM   3941 C  CG  . GLN B 1 240 ? 27.426  -43.669 24.199  1.00 21.66  ? 444  GLN B CG  1 
ATOM   3942 C  CD  . GLN B 1 240 ? 28.683  -42.799 24.471  1.00 29.63  ? 444  GLN B CD  1 
ATOM   3943 O  OE1 . GLN B 1 240 ? 29.698  -42.932 23.766  1.00 33.88  ? 444  GLN B OE1 1 
ATOM   3944 N  NE2 . GLN B 1 240 ? 28.621  -41.919 25.484  1.00 29.76  ? 444  GLN B NE2 1 
ATOM   3945 N  N   . LEU B 1 241 ? 24.653  -41.812 22.003  1.00 17.25  ? 445  LEU B N   1 
ATOM   3946 C  CA  . LEU B 1 241 ? 24.556  -41.720 20.552  1.00 16.76  ? 445  LEU B CA  1 
ATOM   3947 C  C   . LEU B 1 241 ? 24.817  -40.289 20.060  1.00 17.08  ? 445  LEU B C   1 
ATOM   3948 O  O   . LEU B 1 241 ? 25.459  -40.105 19.030  1.00 18.24  ? 445  LEU B O   1 
ATOM   3949 C  CB  . LEU B 1 241 ? 23.189  -42.231 20.071  1.00 16.52  ? 445  LEU B CB  1 
ATOM   3950 C  CG  . LEU B 1 241 ? 22.889  -42.437 18.572  1.00 17.80  ? 445  LEU B CG  1 
ATOM   3951 C  CD1 . LEU B 1 241 ? 23.693  -43.594 17.977  1.00 17.90  ? 445  LEU B CD1 1 
ATOM   3952 C  CD2 . LEU B 1 241 ? 21.391  -42.675 18.363  1.00 16.34  ? 445  LEU B CD2 1 
ATOM   3953 N  N   . VAL B 1 242 ? 24.333  -39.286 20.793  1.00 16.71  ? 446  VAL B N   1 
ATOM   3954 C  CA  . VAL B 1 242 ? 24.528  -37.870 20.401  1.00 16.56  ? 446  VAL B CA  1 
ATOM   3955 C  C   . VAL B 1 242 ? 25.984  -37.414 20.617  1.00 17.40  ? 446  VAL B C   1 
ATOM   3956 O  O   . VAL B 1 242 ? 26.528  -36.656 19.807  1.00 17.40  ? 446  VAL B O   1 
ATOM   3957 C  CB  . VAL B 1 242 ? 23.502  -36.926 21.095  1.00 16.18  ? 446  VAL B CB  1 
ATOM   3958 C  CG1 . VAL B 1 242 ? 23.850  -35.435 20.887  1.00 13.52  ? 446  VAL B CG1 1 
ATOM   3959 C  CG2 . VAL B 1 242 ? 22.069  -37.236 20.595  1.00 16.03  ? 446  VAL B CG2 1 
ATOM   3960 N  N   . THR B 1 243 ? 26.611  -37.886 21.698  1.00 18.01  ? 447  THR B N   1 
ATOM   3961 C  CA  . THR B 1 243 ? 28.024  -37.585 21.965  1.00 18.59  ? 447  THR B CA  1 
ATOM   3962 C  C   . THR B 1 243 ? 28.898  -38.092 20.827  1.00 18.63  ? 447  THR B C   1 
ATOM   3963 O  O   . THR B 1 243 ? 29.721  -37.349 20.290  1.00 19.14  ? 447  THR B O   1 
ATOM   3964 C  CB  . THR B 1 243 ? 28.490  -38.160 23.316  1.00 18.64  ? 447  THR B CB  1 
ATOM   3965 O  OG1 . THR B 1 243 ? 27.750  -37.522 24.358  1.00 19.79  ? 447  THR B OG1 1 
ATOM   3966 C  CG2 . THR B 1 243 ? 29.989  -37.901 23.540  1.00 20.45  ? 447  THR B CG2 1 
ATOM   3967 N  N   . GLU B 1 244 ? 28.698  -39.349 20.451  1.00 18.85  ? 448  GLU B N   1 
ATOM   3968 C  CA  . GLU B 1 244 ? 29.311  -39.905 19.258  1.00 19.85  ? 448  GLU B CA  1 
ATOM   3969 C  C   . GLU B 1 244 ? 28.974  -39.150 17.968  1.00 18.79  ? 448  GLU B C   1 
ATOM   3970 O  O   . GLU B 1 244 ? 29.835  -38.996 17.137  1.00 19.18  ? 448  GLU B O   1 
ATOM   3971 C  CB  . GLU B 1 244 ? 28.971  -41.389 19.119  1.00 19.82  ? 448  GLU B CB  1 
ATOM   3972 C  CG  . GLU B 1 244 ? 29.587  -42.221 20.235  1.00 23.36  ? 448  GLU B CG  1 
ATOM   3973 C  CD  . GLU B 1 244 ? 29.021  -43.615 20.320  1.00 27.95  ? 448  GLU B CD  1 
ATOM   3974 O  OE1 . GLU B 1 244 ? 28.088  -43.933 19.551  1.00 31.06  ? 448  GLU B OE1 1 
ATOM   3975 O  OE2 . GLU B 1 244 ? 29.492  -44.393 21.172  1.00 30.35  ? 448  GLU B OE2 1 
ATOM   3976 N  N   . HIS B 1 245 ? 27.729  -38.692 17.802  1.00 18.41  ? 449  HIS B N   1 
ATOM   3977 C  CA  . HIS B 1 245 ? 27.335  -37.984 16.591  1.00 17.40  ? 449  HIS B CA  1 
ATOM   3978 C  C   . HIS B 1 245 ? 28.027  -36.621 16.557  1.00 17.58  ? 449  HIS B C   1 
ATOM   3979 O  O   . HIS B 1 245 ? 28.479  -36.181 15.505  1.00 16.70  ? 449  HIS B O   1 
ATOM   3980 C  CB  . HIS B 1 245 ? 25.796  -37.848 16.488  1.00 17.37  ? 449  HIS B CB  1 
ATOM   3981 C  CG  . HIS B 1 245 ? 25.330  -36.978 15.355  1.00 16.06  ? 449  HIS B CG  1 
ATOM   3982 N  ND1 . HIS B 1 245 ? 25.174  -37.448 14.069  1.00 14.01  ? 449  HIS B ND1 1 
ATOM   3983 C  CD2 . HIS B 1 245 ? 24.965  -35.670 15.321  1.00 13.70  ? 449  HIS B CD2 1 
ATOM   3984 C  CE1 . HIS B 1 245 ? 24.756  -36.469 13.286  1.00 15.32  ? 449  HIS B CE1 1 
ATOM   3985 N  NE2 . HIS B 1 245 ? 24.620  -35.378 14.020  1.00 14.67  ? 449  HIS B NE2 1 
ATOM   3986 N  N   . ALA B 1 246 ? 28.142  -35.985 17.724  1.00 17.77  ? 450  ALA B N   1 
ATOM   3987 C  CA  . ALA B 1 246 ? 28.742  -34.659 17.824  1.00 17.92  ? 450  ALA B CA  1 
ATOM   3988 C  C   . ALA B 1 246 ? 30.246  -34.743 17.534  1.00 18.33  ? 450  ALA B C   1 
ATOM   3989 O  O   . ALA B 1 246 ? 30.831  -33.782 17.022  1.00 18.59  ? 450  ALA B O   1 
ATOM   3990 C  CB  . ALA B 1 246 ? 28.489  -34.057 19.188  1.00 18.11  ? 450  ALA B CB  1 
ATOM   3991 N  N   . GLN B 1 247 ? 30.854  -35.893 17.840  1.00 18.44  ? 451  GLN B N   1 
ATOM   3992 C  CA  . GLN B 1 247 ? 32.285  -36.123 17.538  1.00 19.32  ? 451  GLN B CA  1 
ATOM   3993 C  C   . GLN B 1 247 ? 32.459  -36.327 16.026  1.00 19.81  ? 451  GLN B C   1 
ATOM   3994 O  O   . GLN B 1 247 ? 33.398  -35.801 15.418  1.00 19.39  ? 451  GLN B O   1 
ATOM   3995 C  CB  . GLN B 1 247 ? 32.862  -37.325 18.316  1.00 18.66  ? 451  GLN B CB  1 
ATOM   3996 C  CG  . GLN B 1 247 ? 32.926  -37.171 19.853  1.00 19.27  ? 451  GLN B CG  1 
ATOM   3997 C  CD  . GLN B 1 247 ? 33.136  -38.500 20.577  1.00 19.86  ? 451  GLN B CD  1 
ATOM   3998 O  OE1 . GLN B 1 247 ? 33.097  -39.563 19.969  1.00 21.69  ? 451  GLN B OE1 1 
ATOM   3999 N  NE2 . GLN B 1 247 ? 33.392  -38.434 21.872  1.00 21.62  ? 451  GLN B NE2 1 
ATOM   4000 N  N   . MET B 1 248 ? 31.541  -37.076 15.420  1.00 20.32  ? 452  MET B N   1 
ATOM   4001 C  CA  . MET B 1 248 ? 31.551  -37.254 13.974  1.00 20.66  ? 452  MET B CA  1 
ATOM   4002 C  C   . MET B 1 248 ? 31.377  -35.953 13.216  1.00 20.21  ? 452  MET B C   1 
ATOM   4003 O  O   . MET B 1 248 ? 31.998  -35.757 12.165  1.00 20.09  ? 452  MET B O   1 
ATOM   4004 C  CB  . MET B 1 248 ? 30.527  -38.303 13.548  1.00 20.69  ? 452  MET B CB  1 
ATOM   4005 C  CG  . MET B 1 248 ? 31.000  -39.723 13.867  1.00 21.21  ? 452  MET B CG  1 
ATOM   4006 S  SD  . MET B 1 248 ? 29.848  -41.024 13.355  1.00 24.97  ? 452  MET B SD  1 
ATOM   4007 C  CE  . MET B 1 248 ? 28.584  -40.897 14.590  1.00 22.76  ? 452  MET B CE  1 
ATOM   4008 N  N   . MET B 1 249 ? 30.555  -35.058 13.755  1.00 20.33  ? 453  MET B N   1 
ATOM   4009 C  CA  . MET B 1 249 ? 30.295  -33.767 13.133  1.00 20.12  ? 453  MET B CA  1 
ATOM   4010 C  C   . MET B 1 249 ? 31.497  -32.834 13.221  1.00 20.55  ? 453  MET B C   1 
ATOM   4011 O  O   . MET B 1 249 ? 31.769  -32.096 12.271  1.00 20.80  ? 453  MET B O   1 
ATOM   4012 C  CB  . MET B 1 249 ? 29.065  -33.097 13.736  1.00 20.28  ? 453  MET B CB  1 
ATOM   4013 C  CG  . MET B 1 249 ? 27.744  -33.776 13.432  1.00 18.55  ? 453  MET B CG  1 
ATOM   4014 S  SD  . MET B 1 249 ? 27.325  -33.769 11.683  1.00 20.16  ? 453  MET B SD  1 
ATOM   4015 C  CE  . MET B 1 249 ? 27.121  -32.010 11.437  1.00 15.87  ? 453  MET B CE  1 
ATOM   4016 N  N   . GLN B 1 250 ? 32.184  -32.840 14.364  1.00 20.91  ? 454  GLN B N   1 
ATOM   4017 C  CA  . GLN B 1 250 ? 33.495  -32.196 14.490  1.00 21.66  ? 454  GLN B CA  1 
ATOM   4018 C  C   . GLN B 1 250 ? 34.513  -32.705 13.463  1.00 21.18  ? 454  GLN B C   1 
ATOM   4019 O  O   . GLN B 1 250 ? 35.227  -31.906 12.869  1.00 21.45  ? 454  GLN B O   1 
ATOM   4020 C  CB  . GLN B 1 250 ? 34.062  -32.323 15.919  1.00 22.26  ? 454  GLN B CB  1 
ATOM   4021 C  CG  . GLN B 1 250 ? 35.461  -31.715 16.096  1.00 24.41  ? 454  GLN B CG  1 
ATOM   4022 C  CD  . GLN B 1 250 ? 35.477  -30.212 15.867  1.00 27.98  ? 454  GLN B CD  1 
ATOM   4023 O  OE1 . GLN B 1 250 ? 34.981  -29.465 16.694  1.00 30.00  ? 454  GLN B OE1 1 
ATOM   4024 N  NE2 . GLN B 1 250 ? 36.046  -29.769 14.743  1.00 27.62  ? 454  GLN B NE2 1 
ATOM   4025 N  N   . ARG B 1 251 ? 34.595  -34.025 13.272  1.00 20.78  ? 455  ARG B N   1 
ATOM   4026 C  CA  . ARG B 1 251 ? 35.473  -34.598 12.260  1.00 20.64  ? 455  ARG B CA  1 
ATOM   4027 C  C   . ARG B 1 251 ? 35.111  -34.131 10.847  1.00 21.01  ? 455  ARG B C   1 
ATOM   4028 O  O   . ARG B 1 251 ? 36.003  -33.821 10.054  1.00 21.24  ? 455  ARG B O   1 
ATOM   4029 C  CB  . ARG B 1 251 ? 35.504  -36.127 12.340  1.00 20.77  ? 455  ARG B CB  1 
ATOM   4030 C  CG  . ARG B 1 251 ? 36.313  -36.678 13.499  1.00 20.58  ? 455  ARG B CG  1 
ATOM   4031 C  CD  . ARG B 1 251 ? 37.606  -35.865 13.728  1.00 20.66  ? 455  ARG B CD  1 
ATOM   4032 N  NE  . ARG B 1 251 ? 38.559  -36.047 12.642  1.00 20.19  ? 455  ARG B NE  1 
ATOM   4033 C  CZ  . ARG B 1 251 ? 39.745  -35.448 12.559  1.00 21.33  ? 455  ARG B CZ  1 
ATOM   4034 N  NH1 . ARG B 1 251 ? 40.144  -34.573 13.472  1.00 20.48  ? 455  ARG B NH1 1 
ATOM   4035 N  NH2 . ARG B 1 251 ? 40.521  -35.717 11.530  1.00 23.19  ? 455  ARG B NH2 1 
ATOM   4036 N  N   . ILE B 1 252 ? 33.814  -34.035 10.549  1.00 20.82  ? 456  ILE B N   1 
ATOM   4037 C  CA  . ILE B 1 252 ? 33.364  -33.461 9.286   1.00 21.36  ? 456  ILE B CA  1 
ATOM   4038 C  C   . ILE B 1 252 ? 33.796  -31.997 9.151   1.00 22.07  ? 456  ILE B C   1 
ATOM   4039 O  O   . ILE B 1 252 ? 34.303  -31.601 8.109   1.00 21.77  ? 456  ILE B O   1 
ATOM   4040 C  CB  . ILE B 1 252 ? 31.835  -33.647 9.041   1.00 21.36  ? 456  ILE B CB  1 
ATOM   4041 C  CG1 . ILE B 1 252 ? 31.527  -35.104 8.663   1.00 20.84  ? 456  ILE B CG1 1 
ATOM   4042 C  CG2 . ILE B 1 252 ? 31.331  -32.721 7.934   1.00 21.55  ? 456  ILE B CG2 1 
ATOM   4043 C  CD1 . ILE B 1 252 ? 30.048  -35.473 8.727   1.00 20.99  ? 456  ILE B CD1 1 
ATOM   4044 N  N   . LYS B 1 253 ? 33.613  -31.207 10.202  1.00 23.33  ? 457  LYS B N   1 
ATOM   4045 C  CA  . LYS B 1 253 ? 34.005  -29.789 10.204  1.00 24.43  ? 457  LYS B CA  1 
ATOM   4046 C  C   . LYS B 1 253 ? 35.510  -29.597 9.920   1.00 24.71  ? 457  LYS B C   1 
ATOM   4047 O  O   . LYS B 1 253 ? 35.917  -28.709 9.161   1.00 24.88  ? 457  LYS B O   1 
ATOM   4048 C  CB  . LYS B 1 253 ? 33.680  -29.166 11.557  1.00 24.55  ? 457  LYS B CB  1 
ATOM   4049 C  CG  . LYS B 1 253 ? 33.785  -27.664 11.557  1.00 26.80  ? 457  LYS B CG  1 
ATOM   4050 C  CD  . LYS B 1 253 ? 33.840  -27.090 12.959  1.00 29.75  ? 457  LYS B CD  1 
ATOM   4051 C  CE  . LYS B 1 253 ? 33.802  -25.560 12.906  1.00 32.74  ? 457  LYS B CE  1 
ATOM   4052 N  NZ  . LYS B 1 253 ? 34.804  -24.989 11.935  1.00 34.15  ? 457  LYS B NZ  1 
ATOM   4053 N  N   . LYS B 1 254 ? 36.318  -30.444 10.540  1.00 24.96  ? 458  LYS B N   1 
ATOM   4054 C  CA  . LYS B 1 254 ? 37.774  -30.428 10.371  1.00 25.26  ? 458  LYS B CA  1 
ATOM   4055 C  C   . LYS B 1 254 ? 38.236  -30.855 8.967   1.00 25.34  ? 458  LYS B C   1 
ATOM   4056 O  O   . LYS B 1 254 ? 39.069  -30.181 8.351   1.00 25.30  ? 458  LYS B O   1 
ATOM   4057 C  CB  . LYS B 1 254 ? 38.406  -31.353 11.410  1.00 25.03  ? 458  LYS B CB  1 
ATOM   4058 C  CG  . LYS B 1 254 ? 39.909  -31.483 11.310  1.00 26.11  ? 458  LYS B CG  1 
ATOM   4059 C  CD  . LYS B 1 254 ? 40.552  -30.483 12.208  1.00 28.20  ? 458  LYS B CD  1 
ATOM   4060 C  CE  . LYS B 1 254 ? 41.086  -29.325 11.459  1.00 27.63  ? 458  LYS B CE  1 
ATOM   4061 N  NZ  . LYS B 1 254 ? 42.518  -29.591 11.184  1.00 28.57  ? 458  LYS B NZ  1 
ATOM   4062 N  N   . THR B 1 255 ? 37.701  -31.967 8.475   1.00 25.21  ? 459  THR B N   1 
ATOM   4063 C  CA  . THR B 1 255 ? 38.232  -32.629 7.276   1.00 26.08  ? 459  THR B CA  1 
ATOM   4064 C  C   . THR B 1 255 ? 37.447  -32.398 5.976   1.00 26.05  ? 459  THR B C   1 
ATOM   4065 O  O   . THR B 1 255 ? 37.999  -32.557 4.892   1.00 26.25  ? 459  THR B O   1 
ATOM   4066 C  CB  . THR B 1 255 ? 38.409  -34.148 7.497   1.00 26.14  ? 459  THR B CB  1 
ATOM   4067 O  OG1 . THR B 1 255 ? 37.122  -34.782 7.511   1.00 27.61  ? 459  THR B OG1 1 
ATOM   4068 C  CG2 . THR B 1 255 ? 39.124  -34.426 8.816   1.00 26.14  ? 459  THR B CG2 1 
ATOM   4069 N  N   . GLU B 1 256 ? 36.174  -32.036 6.075   1.00 26.02  ? 460  GLU B N   1 
ATOM   4070 C  CA  . GLU B 1 256 ? 35.360  -31.784 4.882   1.00 26.06  ? 460  GLU B CA  1 
ATOM   4071 C  C   . GLU B 1 256 ? 35.109  -30.288 4.751   1.00 27.04  ? 460  GLU B C   1 
ATOM   4072 O  O   . GLU B 1 256 ? 33.977  -29.807 4.891   1.00 25.78  ? 460  GLU B O   1 
ATOM   4073 C  CB  . GLU B 1 256 ? 34.045  -32.556 4.954   1.00 25.90  ? 460  GLU B CB  1 
ATOM   4074 C  CG  . GLU B 1 256 ? 34.226  -34.089 4.994   1.00 25.04  ? 460  GLU B CG  1 
ATOM   4075 C  CD  . GLU B 1 256 ? 34.730  -34.665 3.671   1.00 26.03  ? 460  GLU B CD  1 
ATOM   4076 O  OE1 . GLU B 1 256 ? 34.486  -34.056 2.597   1.00 23.75  ? 460  GLU B OE1 1 
ATOM   4077 O  OE2 . GLU B 1 256 ? 35.349  -35.747 3.704   1.00 26.88  ? 460  GLU B OE2 1 
ATOM   4078 N  N   . THR B 1 257 ? 36.192  -29.565 4.480   1.00 28.11  ? 461  THR B N   1 
ATOM   4079 C  CA  . THR B 1 257 ? 36.215  -28.099 4.592   1.00 29.87  ? 461  THR B CA  1 
ATOM   4080 C  C   . THR B 1 257 ? 35.447  -27.394 3.455   1.00 29.99  ? 461  THR B C   1 
ATOM   4081 O  O   . THR B 1 257 ? 35.167  -26.192 3.531   1.00 30.97  ? 461  THR B O   1 
ATOM   4082 C  CB  . THR B 1 257 ? 37.667  -27.573 4.724   1.00 30.22  ? 461  THR B CB  1 
ATOM   4083 O  OG1 . THR B 1 257 ? 37.676  -26.350 5.472   1.00 33.09  ? 461  THR B OG1 1 
ATOM   4084 C  CG2 . THR B 1 257 ? 38.303  -27.359 3.360   1.00 30.46  ? 461  THR B CG2 1 
ATOM   4085 N  N   . GLU B 1 258 ? 35.101  -28.157 2.423   1.00 29.55  ? 462  GLU B N   1 
ATOM   4086 C  CA  . GLU B 1 258 ? 34.221  -27.698 1.357   1.00 29.45  ? 462  GLU B CA  1 
ATOM   4087 C  C   . GLU B 1 258 ? 32.726  -28.024 1.576   1.00 29.42  ? 462  GLU B C   1 
ATOM   4088 O  O   . GLU B 1 258 ? 31.875  -27.521 0.825   1.00 29.58  ? 462  GLU B O   1 
ATOM   4089 C  CB  . GLU B 1 258 ? 34.693  -28.244 0.017   1.00 29.64  ? 462  GLU B CB  1 
ATOM   4090 N  N   . THR B 1 259 ? 32.382  -28.861 2.564   1.00 28.37  ? 463  THR B N   1 
ATOM   4091 C  CA  . THR B 1 259 ? 30.947  -29.019 2.869   1.00 27.83  ? 463  THR B CA  1 
ATOM   4092 C  C   . THR B 1 259 ? 30.393  -27.989 3.865   1.00 27.47  ? 463  THR B C   1 
ATOM   4093 O  O   . THR B 1 259 ? 30.976  -27.734 4.931   1.00 27.23  ? 463  THR B O   1 
ATOM   4094 C  CB  . THR B 1 259 ? 30.431  -30.501 3.080   1.00 27.64  ? 463  THR B CB  1 
ATOM   4095 O  OG1 . THR B 1 259 ? 29.689  -30.621 4.307   1.00 27.70  ? 463  THR B OG1 1 
ATOM   4096 C  CG2 . THR B 1 259 ? 31.531  -31.506 3.054   1.00 26.71  ? 463  THR B CG2 1 
ATOM   4097 N  N   . SER B 1 260 ? 29.295  -27.358 3.448   1.00 27.09  ? 464  SER B N   1 
ATOM   4098 C  CA  . SER B 1 260 ? 28.593  -26.337 4.241   1.00 26.63  ? 464  SER B CA  1 
ATOM   4099 C  C   . SER B 1 260 ? 27.813  -26.926 5.420   1.00 26.01  ? 464  SER B C   1 
ATOM   4100 O  O   . SER B 1 260 ? 27.264  -28.029 5.326   1.00 25.29  ? 464  SER B O   1 
ATOM   4101 C  CB  . SER B 1 260 ? 27.643  -25.531 3.347   1.00 26.55  ? 464  SER B CB  1 
ATOM   4102 O  OG  . SER B 1 260 ? 28.354  -24.533 2.639   1.00 27.59  ? 464  SER B OG  1 
ATOM   4103 N  N   . LEU B 1 261 ? 27.781  -26.182 6.520   1.00 25.94  ? 465  LEU B N   1 
ATOM   4104 C  CA  . LEU B 1 261 ? 26.968  -26.529 7.693   1.00 26.11  ? 465  LEU B CA  1 
ATOM   4105 C  C   . LEU B 1 261 ? 25.944  -25.421 7.963   1.00 25.54  ? 465  LEU B C   1 
ATOM   4106 O  O   . LEU B 1 261 ? 26.315  -24.255 8.068   1.00 25.55  ? 465  LEU B O   1 
ATOM   4107 C  CB  . LEU B 1 261 ? 27.860  -26.767 8.919   1.00 25.95  ? 465  LEU B CB  1 
ATOM   4108 C  CG  . LEU B 1 261 ? 27.198  -27.296 10.209  1.00 27.75  ? 465  LEU B CG  1 
ATOM   4109 C  CD1 . LEU B 1 261 ? 26.701  -28.750 10.065  1.00 28.24  ? 465  LEU B CD1 1 
ATOM   4110 C  CD2 . LEU B 1 261 ? 28.138  -27.177 11.424  1.00 27.14  ? 465  LEU B CD2 1 
ATOM   4111 N  N   . HIS B 1 262 ? 24.661  -25.785 8.044   1.00 25.29  ? 466  HIS B N   1 
ATOM   4112 C  CA  . HIS B 1 262 ? 23.573  -24.834 8.339   1.00 25.15  ? 466  HIS B CA  1 
ATOM   4113 C  C   . HIS B 1 262 ? 23.873  -23.973 9.584   1.00 25.15  ? 466  HIS B C   1 
ATOM   4114 O  O   . HIS B 1 262 ? 24.292  -24.502 10.613  1.00 24.54  ? 466  HIS B O   1 
ATOM   4115 C  CB  . HIS B 1 262 ? 22.267  -25.599 8.535   1.00 25.27  ? 466  HIS B CB  1 
ATOM   4116 C  CG  . HIS B 1 262 ? 21.033  -24.750 8.462   1.00 26.08  ? 466  HIS B CG  1 
ATOM   4117 N  ND1 . HIS B 1 262 ? 20.621  -23.940 9.499   1.00 24.87  ? 466  HIS B ND1 1 
ATOM   4118 C  CD2 . HIS B 1 262 ? 20.104  -24.614 7.486   1.00 25.89  ? 466  HIS B CD2 1 
ATOM   4119 C  CE1 . HIS B 1 262 ? 19.499  -23.334 9.160   1.00 25.87  ? 466  HIS B CE1 1 
ATOM   4120 N  NE2 . HIS B 1 262 ? 19.163  -23.725 7.944   1.00 25.66  ? 466  HIS B NE2 1 
ATOM   4121 N  N   . PRO B 1 263 ? 23.668  -22.638 9.486   1.00 25.12  ? 467  PRO B N   1 
ATOM   4122 C  CA  . PRO B 1 263 ? 23.926  -21.719 10.606  1.00 25.12  ? 467  PRO B CA  1 
ATOM   4123 C  C   . PRO B 1 263 ? 23.343  -22.164 11.966  1.00 24.88  ? 467  PRO B C   1 
ATOM   4124 O  O   . PRO B 1 263 ? 24.029  -22.060 12.987  1.00 24.80  ? 467  PRO B O   1 
ATOM   4125 C  CB  . PRO B 1 263 ? 23.270  -20.412 10.142  1.00 25.28  ? 467  PRO B CB  1 
ATOM   4126 C  CG  . PRO B 1 263 ? 23.365  -20.462 8.662   1.00 25.68  ? 467  PRO B CG  1 
ATOM   4127 C  CD  . PRO B 1 263 ? 23.169  -21.920 8.297   1.00 25.00  ? 467  PRO B CD  1 
ATOM   4128 N  N   . LEU B 1 264 ? 22.109  -22.667 11.981  1.00 24.82  ? 468  LEU B N   1 
ATOM   4129 C  CA  . LEU B 1 264 ? 21.501  -23.174 13.227  1.00 24.89  ? 468  LEU B CA  1 
ATOM   4130 C  C   . LEU B 1 264 ? 22.258  -24.360 13.825  1.00 25.03  ? 468  LEU B C   1 
ATOM   4131 O  O   . LEU B 1 264 ? 22.467  -24.424 15.042  1.00 24.54  ? 468  LEU B O   1 
ATOM   4132 C  CB  . LEU B 1 264 ? 20.025  -23.551 13.023  1.00 24.91  ? 468  LEU B CB  1 
ATOM   4133 C  CG  . LEU B 1 264 ? 19.249  -23.911 14.306  1.00 25.20  ? 468  LEU B CG  1 
ATOM   4134 C  CD1 . LEU B 1 264 ? 18.976  -22.678 15.183  1.00 25.35  ? 468  LEU B CD1 1 
ATOM   4135 C  CD2 . LEU B 1 264 ? 17.955  -24.615 13.967  1.00 26.04  ? 468  LEU B CD2 1 
ATOM   4136 N  N   . LEU B 1 265 ? 22.655  -25.301 12.974  1.00 25.13  ? 469  LEU B N   1 
ATOM   4137 C  CA  . LEU B 1 265 ? 23.443  -26.451 13.424  1.00 26.10  ? 469  LEU B CA  1 
ATOM   4138 C  C   . LEU B 1 265 ? 24.822  -26.039 13.939  1.00 26.54  ? 469  LEU B C   1 
ATOM   4139 O  O   . LEU B 1 265 ? 25.328  -26.608 14.910  1.00 26.14  ? 469  LEU B O   1 
ATOM   4140 C  CB  . LEU B 1 265 ? 23.570  -27.475 12.302  1.00 25.73  ? 469  LEU B CB  1 
ATOM   4141 C  CG  . LEU B 1 265 ? 22.548  -28.612 12.183  1.00 26.39  ? 469  LEU B CG  1 
ATOM   4142 C  CD1 . LEU B 1 265 ? 21.180  -28.364 12.821  1.00 24.90  ? 469  LEU B CD1 1 
ATOM   4143 C  CD2 . LEU B 1 265 ? 22.422  -29.033 10.717  1.00 24.63  ? 469  LEU B CD2 1 
ATOM   4144 N  N   . GLN B 1 266 ? 25.422  -25.044 13.287  1.00 27.50  ? 470  GLN B N   1 
ATOM   4145 C  CA  . GLN B 1 266 ? 26.655  -24.428 13.779  1.00 29.10  ? 470  GLN B CA  1 
ATOM   4146 C  C   . GLN B 1 266 ? 26.462  -23.921 15.212  1.00 28.89  ? 470  GLN B C   1 
ATOM   4147 O  O   . GLN B 1 266 ? 27.300  -24.165 16.073  1.00 29.03  ? 470  GLN B O   1 
ATOM   4148 C  CB  . GLN B 1 266 ? 27.087  -23.278 12.864  1.00 28.64  ? 470  GLN B CB  1 
ATOM   4149 C  CG  . GLN B 1 266 ? 27.459  -23.695 11.438  1.00 30.64  ? 470  GLN B CG  1 
ATOM   4150 C  CD  . GLN B 1 266 ? 28.078  -22.552 10.622  1.00 31.99  ? 470  GLN B CD  1 
ATOM   4151 O  OE1 . GLN B 1 266 ? 28.723  -21.655 11.218  1.00 34.48  ? 470  GLN B OE1 1 
ATOM   4152 N  NE2 . GLN B 1 266 ? 27.909  -22.546 9.380   1.00 35.68  ? 470  GLN B NE2 1 
ATOM   4153 N  N   . GLU B 1 267 ? 25.348  -23.227 15.456  1.00 29.50  ? 471  GLU B N   1 
ATOM   4154 C  CA  . GLU B 1 267 ? 24.999  -22.732 16.795  1.00 30.40  ? 471  GLU B CA  1 
ATOM   4155 C  C   . GLU B 1 267 ? 24.828  -23.850 17.831  1.00 30.58  ? 471  GLU B C   1 
ATOM   4156 O  O   . GLU B 1 267 ? 25.318  -23.732 18.961  1.00 30.86  ? 471  GLU B O   1 
ATOM   4157 C  CB  . GLU B 1 267 ? 23.744  -21.856 16.746  1.00 30.32  ? 471  GLU B CB  1 
ATOM   4158 C  CG  . GLU B 1 267 ? 23.929  -20.501 16.037  1.00 33.00  ? 471  GLU B CG  1 
ATOM   4159 C  CD  . GLU B 1 267 ? 25.140  -19.701 16.530  1.00 36.88  ? 471  GLU B CD  1 
ATOM   4160 O  OE1 . GLU B 1 267 ? 25.888  -19.195 15.673  1.00 39.01  ? 471  GLU B OE1 1 
ATOM   4161 O  OE2 . GLU B 1 267 ? 25.352  -19.574 17.760  1.00 37.56  ? 471  GLU B OE2 1 
ATOM   4162 N  N   . ILE B 1 268 ? 24.134  -24.924 17.445  1.00 30.70  ? 472  ILE B N   1 
ATOM   4163 C  CA  . ILE B 1 268 ? 23.967  -26.104 18.309  1.00 31.22  ? 472  ILE B CA  1 
ATOM   4164 C  C   . ILE B 1 268 ? 25.304  -26.761 18.682  1.00 32.17  ? 472  ILE B C   1 
ATOM   4165 O  O   . ILE B 1 268 ? 25.540  -27.041 19.851  1.00 32.21  ? 472  ILE B O   1 
ATOM   4166 C  CB  . ILE B 1 268 ? 22.995  -27.155 17.697  1.00 30.77  ? 472  ILE B CB  1 
ATOM   4167 C  CG1 . ILE B 1 268 ? 21.554  -26.636 17.730  1.00 30.97  ? 472  ILE B CG1 1 
ATOM   4168 C  CG2 . ILE B 1 268 ? 23.091  -28.508 18.430  1.00 29.63  ? 472  ILE B CG2 1 
ATOM   4169 C  CD1 . ILE B 1 268 ? 20.580  -27.430 16.876  1.00 30.38  ? 472  ILE B CD1 1 
ATOM   4170 N  N   . TYR B 1 269 ? 26.175  -26.984 17.699  1.00 33.42  ? 473  TYR B N   1 
ATOM   4171 C  CA  . TYR B 1 269 ? 27.430  -27.726 17.924  1.00 34.84  ? 473  TYR B CA  1 
ATOM   4172 C  C   . TYR B 1 269 ? 28.581  -26.893 18.491  1.00 37.01  ? 473  TYR B C   1 
ATOM   4173 O  O   . TYR B 1 269 ? 29.651  -27.426 18.783  1.00 37.43  ? 473  TYR B O   1 
ATOM   4174 C  CB  . TYR B 1 269 ? 27.873  -28.460 16.645  1.00 33.85  ? 473  TYR B CB  1 
ATOM   4175 C  CG  . TYR B 1 269 ? 26.962  -29.606 16.302  1.00 32.34  ? 473  TYR B CG  1 
ATOM   4176 C  CD1 . TYR B 1 269 ? 26.911  -30.734 17.110  1.00 31.12  ? 473  TYR B CD1 1 
ATOM   4177 C  CD2 . TYR B 1 269 ? 26.126  -29.553 15.187  1.00 30.50  ? 473  TYR B CD2 1 
ATOM   4178 C  CE1 . TYR B 1 269 ? 26.061  -31.786 16.817  1.00 30.62  ? 473  TYR B CE1 1 
ATOM   4179 C  CE2 . TYR B 1 269 ? 25.267  -30.603 14.890  1.00 29.84  ? 473  TYR B CE2 1 
ATOM   4180 C  CZ  . TYR B 1 269 ? 25.244  -31.712 15.710  1.00 30.67  ? 473  TYR B CZ  1 
ATOM   4181 O  OH  . TYR B 1 269 ? 24.408  -32.763 15.428  1.00 31.94  ? 473  TYR B OH  1 
ATOM   4182 N  N   . LYS B 1 270 ? 28.356  -25.591 18.650  1.00 39.41  ? 474  LYS B N   1 
ATOM   4183 C  CA  . LYS B 1 270 ? 29.361  -24.696 19.200  1.00 41.64  ? 474  LYS B CA  1 
ATOM   4184 C  C   . LYS B 1 270 ? 29.854  -25.191 20.570  1.00 42.83  ? 474  LYS B C   1 
ATOM   4185 O  O   . LYS B 1 270 ? 29.052  -25.473 21.470  1.00 43.11  ? 474  LYS B O   1 
ATOM   4186 C  CB  . LYS B 1 270 ? 28.802  -23.277 19.279  1.00 41.78  ? 474  LYS B CB  1 
ATOM   4187 C  CG  . LYS B 1 270 ? 29.808  -22.202 19.645  1.00 43.17  ? 474  LYS B CG  1 
ATOM   4188 C  CD  . LYS B 1 270 ? 29.402  -20.849 19.057  1.00 45.48  ? 474  LYS B CD  1 
ATOM   4189 C  CE  . LYS B 1 270 ? 28.054  -20.359 19.590  1.00 47.19  ? 474  LYS B CE  1 
ATOM   4190 N  NZ  . LYS B 1 270 ? 27.666  -19.015 19.047  1.00 47.67  ? 474  LYS B NZ  1 
ATOM   4191 N  N   . ASP B 1 271 ? 31.180  -25.302 20.683  1.00 44.30  ? 475  ASP B N   1 
ATOM   4192 C  CA  . ASP B 1 271 ? 31.907  -25.768 21.889  1.00 45.40  ? 475  ASP B CA  1 
ATOM   4193 C  C   . ASP B 1 271 ? 31.250  -26.887 22.687  1.00 45.71  ? 475  ASP B C   1 
ATOM   4194 O  O   . ASP B 1 271 ? 31.881  -27.916 22.952  1.00 46.31  ? 475  ASP B O   1 
ATOM   4195 C  CB  . ASP B 1 271 ? 32.312  -24.600 22.811  1.00 45.65  ? 475  ASP B CB  1 
ATOM   4196 C  CG  . ASP B 1 271 ? 31.194  -23.580 23.013  1.00 47.03  ? 475  ASP B CG  1 
ATOM   4197 O  OD1 . ASP B 1 271 ? 30.109  -23.958 23.519  1.00 48.21  ? 475  ASP B OD1 1 
ATOM   4198 O  OD2 . ASP B 1 271 ? 31.419  -22.393 22.676  1.00 47.91  ? 475  ASP B OD2 1 
HETATM 4199 CA CA  . CA  C 2 .   ? 18.624  -1.716  11.335  1.00 26.83  ? 1303 CA  A CA  1 
HETATM 4200 C  C5  . B7G D 3 .   ? 22.343  -18.550 22.146  1.00 39.64  ? 920  B7G A C5  1 
HETATM 4201 O  O5  . B7G D 3 .   ? 21.988  -19.546 21.170  1.00 40.38  ? 920  B7G A O5  1 
HETATM 4202 C  C1  . B7G D 3 .   ? 22.778  -20.748 21.114  1.00 39.97  ? 920  B7G A C1  1 
HETATM 4203 C  C2  . B7G D 3 .   ? 24.258  -20.401 20.939  1.00 40.75  ? 920  B7G A C2  1 
HETATM 4204 C  C3  . B7G D 3 .   ? 24.724  -19.481 22.071  1.00 41.22  ? 920  B7G A C3  1 
HETATM 4205 C  C4  . B7G D 3 .   ? 23.836  -18.252 22.224  1.00 40.70  ? 920  B7G A C4  1 
HETATM 4206 C  C6  . B7G D 3 .   ? 21.672  -17.240 21.772  1.00 38.44  ? 920  B7G A C6  1 
HETATM 4207 O  O1  . B7G D 3 .   ? 22.355  -21.531 19.996  1.00 38.51  ? 920  B7G A O1  1 
HETATM 4208 C  C7  . B7G D 3 .   ? 21.787  -22.779 20.375  1.00 38.13  ? 920  B7G A C7  1 
HETATM 4209 C  C8  . B7G D 3 .   ? 20.858  -23.277 19.275  1.00 38.08  ? 920  B7G A C8  1 
HETATM 4210 C  C9  . B7G D 3 .   ? 19.526  -23.655 19.901  1.00 36.95  ? 920  B7G A C9  1 
HETATM 4211 C  C10 . B7G D 3 .   ? 18.475  -24.007 18.863  1.00 35.96  ? 920  B7G A C10 1 
HETATM 4212 C  C11 . B7G D 3 .   ? 17.145  -23.367 19.223  1.00 35.53  ? 920  B7G A C11 1 
HETATM 4213 C  C12 . B7G D 3 .   ? 16.009  -24.025 18.459  1.00 35.83  ? 920  B7G A C12 1 
HETATM 4214 O  O2  . B7G D 3 .   ? 25.046  -21.602 20.928  1.00 41.90  ? 920  B7G A O2  1 
HETATM 4215 O  O3  . B7G D 3 .   ? 26.058  -19.017 21.819  1.00 42.24  ? 920  B7G A O3  1 
HETATM 4216 O  O4  . B7G D 3 .   ? 24.117  -17.630 23.487  1.00 41.29  ? 920  B7G A O4  1 
HETATM 4217 O  O6  . B7G D 3 .   ? 20.295  -17.346 22.093  1.00 37.97  ? 920  B7G A O6  1 
HETATM 4218 C  C13 . B7G D 3 .   ? 15.036  -23.004 17.905  1.00 35.62  ? 920  B7G A C13 1 
HETATM 4219 C  C5  . B7G E 3 .   ? 21.872  -18.208 26.324  1.00 38.10  ? 921  B7G A C5  1 
HETATM 4220 O  O5  . B7G E 3 .   ? 21.250  -17.199 27.143  1.00 38.60  ? 921  B7G A O5  1 
HETATM 4221 C  C1  . B7G E 3 .   ? 21.935  -15.934 27.283  1.00 38.51  ? 921  B7G A C1  1 
HETATM 4222 C  C2  . B7G E 3 .   ? 23.378  -16.141 27.764  1.00 38.51  ? 921  B7G A C2  1 
HETATM 4223 C  C3  . B7G E 3 .   ? 24.110  -17.109 26.839  1.00 38.49  ? 921  B7G A C3  1 
HETATM 4224 C  C4  . B7G E 3 .   ? 23.351  -18.418 26.653  1.00 39.00  ? 921  B7G A C4  1 
HETATM 4225 C  C6  . B7G E 3 .   ? 21.157  -19.531 26.561  1.00 37.15  ? 921  B7G A C6  1 
HETATM 4226 O  O1  . B7G E 3 .   ? 21.253  -15.113 28.233  1.00 37.17  ? 921  B7G A O1  1 
HETATM 4227 C  C7  . B7G E 3 .   ? 20.210  -14.321 27.677  1.00 35.08  ? 921  B7G A C7  1 
HETATM 4228 C  C8  . B7G E 3 .   ? 19.365  -13.766 28.822  1.00 34.37  ? 921  B7G A C8  1 
HETATM 4229 C  C9  . B7G E 3 .   ? 18.279  -12.816 28.326  1.00 33.97  ? 921  B7G A C9  1 
HETATM 4230 C  C10 . B7G E 3 .   ? 17.043  -13.581 27.882  1.00 34.56  ? 921  B7G A C10 1 
HETATM 4231 C  C11 . B7G E 3 .   ? 15.783  -12.745 28.016  1.00 34.69  ? 921  B7G A C11 1 
HETATM 4232 C  C12 . B7G E 3 .   ? 14.861  -13.391 29.040  1.00 35.73  ? 921  B7G A C12 1 
HETATM 4233 O  O2  . B7G E 3 .   ? 24.080  -14.888 27.766  1.00 38.36  ? 921  B7G A O2  1 
HETATM 4234 O  O3  . B7G E 3 .   ? 25.397  -17.429 27.366  1.00 39.75  ? 921  B7G A O3  1 
HETATM 4235 O  O4  . B7G E 3 .   ? 23.978  -19.178 25.605  1.00 38.95  ? 921  B7G A O4  1 
HETATM 4236 O  O6  . B7G E 3 .   ? 19.970  -19.528 25.775  1.00 37.07  ? 921  B7G A O6  1 
HETATM 4237 C  C13 . B7G E 3 .   ? 13.594  -13.921 28.400  1.00 35.51  ? 921  B7G A C13 1 
HETATM 4238 O  O2  . VCA F 4 .   ? 18.368  -5.010  35.660  1.00 26.19  ? 1001 VCA A O2  1 
HETATM 4239 C  C1  . VCA F 4 .   ? 19.212  -4.289  36.225  1.00 26.86  ? 1001 VCA A C1  1 
HETATM 4240 O  O1  . VCA F 4 .   ? 20.218  -3.830  35.674  1.00 26.94  ? 1001 VCA A O1  1 
HETATM 4241 C  C2  . VCA F 4 .   ? 18.996  -3.954  37.719  1.00 27.35  ? 1001 VCA A C2  1 
HETATM 4242 C  C3  . VCA F 4 .   ? 19.524  -2.566  38.119  1.00 28.00  ? 1001 VCA A C3  1 
HETATM 4243 C  C4  . VCA F 4 .   ? 18.649  -1.467  37.526  1.00 30.33  ? 1001 VCA A C4  1 
HETATM 4244 C  C5  . VCA F 4 .   ? 18.913  -0.112  38.174  1.00 30.60  ? 1001 VCA A C5  1 
HETATM 4245 C  C6  . VCA F 4 .   ? 18.210  0.972   37.366  1.00 33.27  ? 1001 VCA A C6  1 
HETATM 4246 C  C7  . VCA F 4 .   ? 16.722  0.996   37.695  1.00 36.29  ? 1001 VCA A C7  1 
HETATM 4247 C  C8  . VCA F 4 .   ? 15.863  0.945   36.428  1.00 39.09  ? 1001 VCA A C8  1 
HETATM 4248 C  C9  . VCA F 4 .   ? 14.409  0.547   36.738  1.00 41.02  ? 1001 VCA A C9  1 
HETATM 4249 C  C10 . VCA F 4 .   ? 13.711  1.558   37.657  1.00 42.31  ? 1001 VCA A C10 1 
HETATM 4250 C  C11 . VCA F 4 .   ? 12.668  0.955   38.363  1.00 43.73  ? 1001 VCA A C11 1 
HETATM 4251 C  C12 . VCA F 4 .   ? 12.605  0.906   39.760  1.00 43.49  ? 1001 VCA A C12 1 
HETATM 4252 C  C13 . VCA F 4 .   ? 13.589  1.452   40.585  1.00 43.40  ? 1001 VCA A C13 1 
HETATM 4253 C  C14 . VCA F 4 .   ? 13.043  1.828   41.964  1.00 42.72  ? 1001 VCA A C14 1 
HETATM 4254 C  C15 . VCA F 4 .   ? 12.828  0.582   42.826  1.00 43.36  ? 1001 VCA A C15 1 
HETATM 4255 C  C16 . VCA F 4 .   ? 11.998  0.901   44.071  1.00 42.62  ? 1001 VCA A C16 1 
HETATM 4256 C  C17 . VCA F 4 .   ? 12.865  1.135   45.309  1.00 41.98  ? 1001 VCA A C17 1 
HETATM 4257 C  C18 . VCA F 4 .   ? 12.003  1.177   46.567  1.00 41.15  ? 1001 VCA A C18 1 
HETATM 4258 CA CA  . CA  G 2 .   ? 16.091  -35.278 35.901  1.00 22.05  ? 2303 CA  B CA  1 
HETATM 4259 O  O2  . VCA H 4 .   ? 21.614  -32.069 12.443  1.00 24.23  ? 2001 VCA B O2  1 
HETATM 4260 C  C1  . VCA H 4 .   ? 22.688  -32.629 12.103  1.00 21.94  ? 2001 VCA B C1  1 
HETATM 4261 O  O1  . VCA H 4 .   ? 23.570  -33.039 12.888  1.00 20.12  ? 2001 VCA B O1  1 
HETATM 4262 C  C2  . VCA H 4 .   ? 22.925  -32.806 10.589  1.00 22.47  ? 2001 VCA B C2  1 
HETATM 4263 C  C3  . VCA H 4 .   ? 23.621  -34.132 10.240  1.00 23.46  ? 2001 VCA B C3  1 
HETATM 4264 C  C4  . VCA H 4 .   ? 22.694  -35.329 10.458  1.00 24.36  ? 2001 VCA B C4  1 
HETATM 4265 C  C5  . VCA H 4 .   ? 23.369  -36.600 9.949   1.00 27.52  ? 2001 VCA B C5  1 
HETATM 4266 C  C6  . VCA H 4 .   ? 22.356  -37.678 9.609   1.00 29.47  ? 2001 VCA B C6  1 
HETATM 4267 C  C7  . VCA H 4 .   ? 21.587  -38.156 10.825  1.00 31.89  ? 2001 VCA B C7  1 
HETATM 4268 C  C8  . VCA H 4 .   ? 20.749  -39.372 10.466  1.00 34.45  ? 2001 VCA B C8  1 
HETATM 4269 C  C9  . VCA H 4 .   ? 19.365  -38.934 9.988   1.00 37.50  ? 2001 VCA B C9  1 
HETATM 4270 C  C10 . VCA H 4 .   ? 19.141  -39.278 8.512   1.00 38.48  ? 2001 VCA B C10 1 
HETATM 4271 C  C11 . VCA H 4 .   ? 17.996  -38.614 8.066   1.00 39.72  ? 2001 VCA B C11 1 
HETATM 4272 C  C12 . VCA H 4 .   ? 17.669  -38.426 6.724   1.00 39.10  ? 2001 VCA B C12 1 
HETATM 4273 C  C13 . VCA H 4 .   ? 18.449  -38.883 5.668   1.00 38.96  ? 2001 VCA B C13 1 
HETATM 4274 C  C14 . VCA H 4 .   ? 18.052  -38.132 4.399   1.00 38.69  ? 2001 VCA B C14 1 
HETATM 4275 C  C15 . VCA H 4 .   ? 18.454  -38.924 3.159   1.00 38.99  ? 2001 VCA B C15 1 
HETATM 4276 C  C16 . VCA H 4 .   ? 18.265  -38.066 1.914   1.00 38.17  ? 2001 VCA B C16 1 
HETATM 4277 C  C17 . VCA H 4 .   ? 18.624  -38.851 0.661   1.00 39.17  ? 2001 VCA B C17 1 
HETATM 4278 C  C18 . VCA H 4 .   ? 18.355  -38.007 -0.575  1.00 39.16  ? 2001 VCA B C18 1 
HETATM 4279 O  O   . HOH I 5 .   ? 23.605  4.345   32.710  1.00 21.36  ? 1304 HOH A O   1 
HETATM 4280 O  O   . HOH I 5 .   ? 19.776  -5.669  27.821  1.00 21.93  ? 1305 HOH A O   1 
HETATM 4281 O  O   . HOH I 5 .   ? 8.407   11.337  25.304  1.00 20.94  ? 1306 HOH A O   1 
HETATM 4282 O  O   . HOH I 5 .   ? 12.733  14.521  44.554  1.00 20.78  ? 1307 HOH A O   1 
HETATM 4283 O  O   . HOH I 5 .   ? 5.670   13.363  27.783  1.00 18.92  ? 1308 HOH A O   1 
HETATM 4284 O  O   . HOH I 5 .   ? 16.629  11.724  26.292  1.00 23.33  ? 1309 HOH A O   1 
HETATM 4285 O  O   . HOH I 5 .   ? 4.246   9.055   52.558  1.00 23.40  ? 1310 HOH A O   1 
HETATM 4286 O  O   . HOH I 5 .   ? 8.030   9.282   27.494  1.00 19.57  ? 1311 HOH A O   1 
HETATM 4287 O  O   . HOH I 5 .   ? 19.650  -3.366  26.145  1.00 15.24  ? 1312 HOH A O   1 
HETATM 4288 O  O   . HOH I 5 .   ? 17.440  -6.228  20.371  1.00 18.98  ? 1313 HOH A O   1 
HETATM 4289 O  O   . HOH I 5 .   ? 17.744  15.683  32.168  1.00 26.74  ? 1314 HOH A O   1 
HETATM 4290 O  O   . HOH I 5 .   ? 25.229  6.493   32.556  1.00 23.66  ? 1315 HOH A O   1 
HETATM 4291 O  O   . HOH I 5 .   ? 24.293  -8.884  13.880  1.00 23.47  ? 1316 HOH A O   1 
HETATM 4292 O  O   . HOH I 5 .   ? 10.284  16.456  30.785  1.00 25.42  ? 1317 HOH A O   1 
HETATM 4293 O  O   . HOH I 5 .   ? 17.267  13.141  19.980  1.00 26.88  ? 1318 HOH A O   1 
HETATM 4294 O  O   . HOH I 5 .   ? -2.097  -1.997  29.525  1.00 31.34  ? 1319 HOH A O   1 
HETATM 4295 O  O   . HOH I 5 .   ? 21.429  -18.547 29.958  1.00 26.75  ? 1320 HOH A O   1 
HETATM 4296 O  O   . HOH I 5 .   ? 18.171  9.793   41.735  1.00 25.25  ? 1321 HOH A O   1 
HETATM 4297 O  O   . HOH I 5 .   ? 12.019  -21.281 16.313  1.00 45.30  ? 1322 HOH A O   1 
HETATM 4298 O  O   . HOH I 5 .   ? 24.932  -12.930 43.467  1.00 33.07  ? 1323 HOH A O   1 
HETATM 4299 O  O   . HOH I 5 .   ? 17.305  15.885  34.876  1.00 43.23  ? 1324 HOH A O   1 
HETATM 4300 O  O   . HOH I 5 .   ? 8.326   6.763   27.702  1.00 16.10  ? 1325 HOH A O   1 
HETATM 4301 O  O   . HOH I 5 .   ? 2.042   8.879   51.114  1.00 28.97  ? 1326 HOH A O   1 
HETATM 4302 O  O   . HOH I 5 .   ? 33.454  -5.654  26.134  1.00 37.24  ? 1327 HOH A O   1 
HETATM 4303 O  O   . HOH I 5 .   ? 17.955  -11.811 43.381  1.00 29.46  ? 1328 HOH A O   1 
HETATM 4304 O  O   . HOH I 5 .   ? 21.627  -15.641 17.841  1.00 25.64  ? 1329 HOH A O   1 
HETATM 4305 O  O   . HOH I 5 .   ? 2.438   18.120  16.364  1.00 34.01  ? 1330 HOH A O   1 
HETATM 4306 O  O   . HOH I 5 .   ? 23.900  -4.114  20.848  1.00 26.86  ? 1331 HOH A O   1 
HETATM 4307 O  O   . HOH I 5 .   ? 21.454  -10.437 50.628  1.00 30.23  ? 1332 HOH A O   1 
HETATM 4308 O  O   . HOH I 5 .   ? 16.339  15.608  23.880  1.00 36.39  ? 1333 HOH A O   1 
HETATM 4309 O  O   . HOH I 5 .   ? 2.003   3.212   10.521  1.00 34.00  ? 1334 HOH A O   1 
HETATM 4310 O  O   . HOH I 5 .   ? -0.515  2.058   47.968  1.00 33.06  ? 1335 HOH A O   1 
HETATM 4311 O  O   . HOH I 5 .   ? 6.401   13.718  13.118  1.00 35.83  ? 1336 HOH A O   1 
HETATM 4312 O  O   . HOH I 5 .   ? -0.671  7.442   25.916  1.00 23.22  ? 1337 HOH A O   1 
HETATM 4313 O  O   . HOH I 5 .   ? 10.457  13.547  11.129  1.00 26.50  ? 1338 HOH A O   1 
HETATM 4314 O  O   . HOH I 5 .   ? 15.927  15.645  20.958  1.00 25.63  ? 1339 HOH A O   1 
HETATM 4315 O  O   . HOH I 5 .   ? 14.589  13.672  52.287  1.00 34.84  ? 1340 HOH A O   1 
HETATM 4316 O  O   . HOH I 5 .   ? 12.680  12.671  49.656  1.00 27.00  ? 1341 HOH A O   1 
HETATM 4317 O  O   . HOH I 5 .   ? 22.510  -2.150  24.449  1.00 30.89  ? 1342 HOH A O   1 
HETATM 4318 O  O   . HOH I 5 .   ? 19.301  13.461  48.314  1.00 36.22  ? 1343 HOH A O   1 
HETATM 4319 O  O   . HOH I 5 .   ? 18.933  13.261  21.965  1.00 21.64  ? 1344 HOH A O   1 
HETATM 4320 O  O   . HOH I 5 .   ? 0.286   9.352   27.319  1.00 33.58  ? 1345 HOH A O   1 
HETATM 4321 O  O   . HOH I 5 .   ? 24.624  10.697  37.951  1.00 43.68  ? 1346 HOH A O   1 
HETATM 4322 O  O   . HOH I 5 .   ? -3.080  10.558  31.160  1.00 31.26  ? 1347 HOH A O   1 
HETATM 4323 O  O   . HOH I 5 .   ? 19.156  11.466  25.188  1.00 36.13  ? 1348 HOH A O   1 
HETATM 4324 O  O   . HOH I 5 .   ? 19.437  -5.706  51.593  1.00 23.57  ? 1349 HOH A O   1 
HETATM 4325 O  O   . HOH I 5 .   ? 16.294  -6.777  51.278  1.00 33.38  ? 1350 HOH A O   1 
HETATM 4326 O  O   . HOH I 5 .   ? 28.592  7.544   48.932  1.00 26.48  ? 1351 HOH A O   1 
HETATM 4327 O  O   . HOH I 5 .   ? 2.806   -9.109  29.999  1.00 28.84  ? 1352 HOH A O   1 
HETATM 4328 O  O   . HOH I 5 .   ? 2.738   -15.289 15.875  1.00 44.41  ? 1353 HOH A O   1 
HETATM 4329 O  O   . HOH I 5 .   ? 10.639  18.070  15.873  1.00 28.05  ? 1354 HOH A O   1 
HETATM 4330 O  O   . HOH I 5 .   ? 6.291   10.459  56.186  1.00 25.31  ? 1355 HOH A O   1 
HETATM 4331 O  O   . HOH I 5 .   ? 1.715   11.541  25.810  1.00 33.88  ? 1356 HOH A O   1 
HETATM 4332 O  O   . HOH I 5 .   ? 23.413  -5.510  10.573  1.00 35.44  ? 1357 HOH A O   1 
HETATM 4333 O  O   . HOH I 5 .   ? 6.232   3.144   28.599  1.00 32.95  ? 1358 HOH A O   1 
HETATM 4334 O  O   . HOH I 5 .   ? 16.251  -16.635 13.125  1.00 29.32  ? 1359 HOH A O   1 
HETATM 4335 O  O   . HOH I 5 .   ? 10.041  0.451   32.812  1.00 31.26  ? 1360 HOH A O   1 
HETATM 4336 O  O   . HOH I 5 .   ? 17.301  16.655  11.992  1.00 44.08  ? 1361 HOH A O   1 
HETATM 4337 O  O   . HOH I 5 .   ? -1.629  10.849  28.924  1.00 36.00  ? 1362 HOH A O   1 
HETATM 4338 O  O   . HOH I 5 .   ? 7.586   16.247  19.712  1.00 39.73  ? 1363 HOH A O   1 
HETATM 4339 O  O   . HOH I 5 .   ? 31.225  -0.749  45.066  1.00 33.80  ? 1364 HOH A O   1 
HETATM 4340 O  O   . HOH I 5 .   ? 22.627  -18.115 18.278  1.00 31.08  ? 1365 HOH A O   1 
HETATM 4341 O  O   . HOH I 5 .   ? 8.223   -4.987  62.449  1.00 33.57  ? 1366 HOH A O   1 
HETATM 4342 O  O   . HOH I 5 .   ? 1.092   2.140   17.104  1.00 24.59  ? 1367 HOH A O   1 
HETATM 4343 O  O   . HOH I 5 .   ? 11.712  13.590  52.762  1.00 25.97  ? 1368 HOH A O   1 
HETATM 4344 O  O   . HOH I 5 .   ? 25.181  4.550   20.625  1.00 24.64  ? 1369 HOH A O   1 
HETATM 4345 O  O   . HOH I 5 .   ? 24.984  9.988   48.021  1.00 29.02  ? 1370 HOH A O   1 
HETATM 4346 O  O   . HOH I 5 .   ? 3.192   -2.671  36.046  1.00 38.89  ? 1371 HOH A O   1 
HETATM 4347 O  O   . HOH I 5 .   ? 4.454   12.129  52.314  1.00 33.05  ? 1372 HOH A O   1 
HETATM 4348 O  O   . HOH I 5 .   ? 5.713   10.544  30.580  1.00 29.13  ? 1373 HOH A O   1 
HETATM 4349 O  O   . HOH I 5 .   ? -1.636  6.407   22.530  1.00 26.17  ? 1374 HOH A O   1 
HETATM 4350 O  O   . HOH I 5 .   ? -2.547  3.443   45.530  1.00 40.12  ? 1375 HOH A O   1 
HETATM 4351 O  O   . HOH I 5 .   ? 12.396  -14.753 39.250  1.00 43.62  ? 1376 HOH A O   1 
HETATM 4352 O  O   . HOH I 5 .   ? 32.057  -9.576  32.928  1.00 48.77  ? 1377 HOH A O   1 
HETATM 4353 O  O   . HOH I 5 .   ? 10.781  -4.050  60.922  1.00 36.11  ? 1378 HOH A O   1 
HETATM 4354 O  O   . HOH I 5 .   ? 4.802   -2.211  32.772  1.00 37.03  ? 1379 HOH A O   1 
HETATM 4355 O  O   . HOH I 5 .   ? 16.059  5.989   31.562  1.00 31.27  ? 1380 HOH A O   1 
HETATM 4356 O  O   . HOH I 5 .   ? 15.351  -17.535 10.285  1.00 30.29  ? 1381 HOH A O   1 
HETATM 4357 O  O   . HOH I 5 .   ? -3.738  2.817   28.673  1.00 46.64  ? 1382 HOH A O   1 
HETATM 4358 O  O   . HOH I 5 .   ? 26.406  7.959   37.357  1.00 48.36  ? 1383 HOH A O   1 
HETATM 4359 O  O   . HOH I 5 .   ? 24.848  8.851   22.546  1.00 33.57  ? 1384 HOH A O   1 
HETATM 4360 O  O   . HOH I 5 .   ? 16.329  17.867  31.011  1.00 39.62  ? 1385 HOH A O   1 
HETATM 4361 O  O   . HOH I 5 .   ? 0.690   -12.630 17.044  1.00 40.10  ? 1386 HOH A O   1 
HETATM 4362 O  O   . HOH I 5 .   ? 4.643   -9.106  12.453  1.00 32.87  ? 1387 HOH A O   1 
HETATM 4363 O  O   . HOH I 5 .   ? 19.969  4.750   15.801  1.00 38.01  ? 1388 HOH A O   1 
HETATM 4364 O  O   . HOH I 5 .   ? 30.403  6.864   36.058  1.00 48.11  ? 1389 HOH A O   1 
HETATM 4365 O  O   . HOH I 5 .   ? 6.814   -17.281 20.066  1.00 34.92  ? 1390 HOH A O   1 
HETATM 4366 O  O   . HOH I 5 .   ? 8.690   -0.979  40.977  1.00 31.40  ? 1391 HOH A O   1 
HETATM 4367 O  O   . HOH I 5 .   ? 17.670  -7.396  4.653   1.00 38.23  ? 1392 HOH A O   1 
HETATM 4368 O  O   . HOH I 5 .   ? -5.523  9.814   41.690  1.00 39.27  ? 1393 HOH A O   1 
HETATM 4369 O  O   . HOH I 5 .   ? 8.355   9.272   57.616  1.00 29.64  ? 1394 HOH A O   1 
HETATM 4370 O  O   . HOH I 5 .   ? 15.799  -2.885  4.264   1.00 35.79  ? 1395 HOH A O   1 
HETATM 4371 O  O   . HOH I 5 .   ? -0.367  4.468   12.295  1.00 42.89  ? 1396 HOH A O   1 
HETATM 4372 O  O   . HOH I 5 .   ? 5.461   13.170  30.671  1.00 28.06  ? 1397 HOH A O   1 
HETATM 4373 O  O   . HOH I 5 .   ? 18.082  1.651   21.132  1.00 32.05  ? 1398 HOH A O   1 
HETATM 4374 O  O   . HOH I 5 .   ? 15.316  17.361  36.030  1.00 30.38  ? 1399 HOH A O   1 
HETATM 4375 O  O   . HOH I 5 .   ? 7.310   -13.666 29.729  1.00 32.99  ? 1400 HOH A O   1 
HETATM 4376 O  O   . HOH I 5 .   ? 9.495   -11.684 37.859  1.00 39.14  ? 1401 HOH A O   1 
HETATM 4377 O  O   . HOH I 5 .   ? 21.772  10.161  31.213  1.00 24.70  ? 1402 HOH A O   1 
HETATM 4378 O  O   . HOH I 5 .   ? 9.041   -16.591 32.919  1.00 30.48  ? 1403 HOH A O   1 
HETATM 4379 O  O   . HOH I 5 .   ? 23.333  8.310   26.529  1.00 20.96  ? 1404 HOH A O   1 
HETATM 4380 O  O   . HOH I 5 .   ? -1.787  -7.577  18.670  1.00 40.17  ? 1405 HOH A O   1 
HETATM 4381 O  O   . HOH I 5 .   ? 22.725  12.598  22.118  1.00 35.81  ? 1406 HOH A O   1 
HETATM 4382 O  O   . HOH I 5 .   ? 26.855  -8.826  36.597  1.00 51.79  ? 1407 HOH A O   1 
HETATM 4383 O  O   . HOH I 5 .   ? 0.382   8.539   8.076   1.00 29.83  ? 1408 HOH A O   1 
HETATM 4384 O  O   . HOH I 5 .   ? 32.781  -8.144  36.514  1.00 55.54  ? 1409 HOH A O   1 
HETATM 4385 O  O   . HOH I 5 .   ? 3.994   14.801  37.084  1.00 34.49  ? 1410 HOH A O   1 
HETATM 4386 O  O   . HOH I 5 .   ? -2.624  3.980   26.086  1.00 34.24  ? 1411 HOH A O   1 
HETATM 4387 O  O   . HOH I 5 .   ? -8.801  3.821   42.487  1.00 36.00  ? 1412 HOH A O   1 
HETATM 4388 O  O   . HOH I 5 .   ? 9.885   17.123  18.242  1.00 39.11  ? 1413 HOH A O   1 
HETATM 4389 O  O   . HOH I 5 .   ? 0.856   -7.686  32.523  1.00 50.27  ? 1414 HOH A O   1 
HETATM 4390 O  O   . HOH I 5 .   ? 26.428  -3.367  27.097  1.00 42.53  ? 1415 HOH A O   1 
HETATM 4391 O  O   . HOH I 5 .   ? 27.173  -8.438  43.544  1.00 33.07  ? 1416 HOH A O   1 
HETATM 4392 O  O   . HOH I 5 .   ? 24.143  -13.717 20.770  1.00 37.38  ? 1417 HOH A O   1 
HETATM 4393 O  O   . HOH I 5 .   ? 8.874   -17.711 21.667  1.00 31.88  ? 1418 HOH A O   1 
HETATM 4394 O  O   . HOH I 5 .   ? 4.366   -11.205 31.757  1.00 42.04  ? 1419 HOH A O   1 
HETATM 4395 O  O   . HOH I 5 .   ? 23.812  -22.276 25.582  1.00 44.83  ? 1420 HOH A O   1 
HETATM 4396 O  O   . HOH I 5 .   ? 14.194  16.617  24.497  1.00 55.10  ? 1421 HOH A O   1 
HETATM 4397 O  O   . HOH I 5 .   ? 21.640  -15.031 42.605  1.00 45.53  ? 1422 HOH A O   1 
HETATM 4398 O  O   . HOH I 5 .   ? 8.575   1.092   38.894  1.00 32.36  ? 1423 HOH A O   1 
HETATM 4399 O  O   . HOH I 5 .   ? -3.149  8.627   24.878  1.00 50.96  ? 1424 HOH A O   1 
HETATM 4400 O  O   . HOH I 5 .   ? 29.097  -2.308  28.683  1.00 40.61  ? 1425 HOH A O   1 
HETATM 4401 O  O   . HOH I 5 .   ? 25.266  -11.210 13.709  1.00 34.24  ? 1426 HOH A O   1 
HETATM 4402 O  O   . HOH I 5 .   ? 27.605  6.723   33.606  1.00 51.40  ? 1427 HOH A O   1 
HETATM 4403 O  O   . HOH I 5 .   ? 32.130  -14.846 38.980  1.00 45.65  ? 1428 HOH A O   1 
HETATM 4404 O  O   . HOH I 5 .   ? 27.665  2.433   40.202  1.00 44.95  ? 1429 HOH A O   1 
HETATM 4405 O  O   . HOH I 5 .   ? 24.437  9.959   50.832  1.00 53.97  ? 1430 HOH A O   1 
HETATM 4406 O  O   . HOH I 5 .   ? 29.263  -8.897  35.321  1.00 68.37  ? 1431 HOH A O   1 
HETATM 4407 O  O   . HOH I 5 .   ? 29.779  3.356   34.012  1.00 51.76  ? 1432 HOH A O   1 
HETATM 4408 O  O   . HOH I 5 .   ? 1.634   -11.129 28.897  1.00 50.24  ? 1433 HOH A O   1 
HETATM 4409 O  O   . HOH I 5 .   ? 32.236  -8.045  30.707  1.00 43.04  ? 1434 HOH A O   1 
HETATM 4410 O  O   . HOH I 5 .   ? 3.427   7.065   56.856  1.00 34.82  ? 1435 HOH A O   1 
HETATM 4411 O  O   . HOH I 5 .   ? 17.199  11.561  52.695  1.00 29.67  ? 1436 HOH A O   1 
HETATM 4412 O  O   . HOH I 5 .   ? -0.199  10.849  46.826  1.00 44.11  ? 1437 HOH A O   1 
HETATM 4413 O  O   . HOH I 5 .   ? 12.009  18.136  20.843  1.00 50.03  ? 1438 HOH A O   1 
HETATM 4414 O  O   . HOH I 5 .   ? 15.339  -8.919  52.374  1.00 50.21  ? 1439 HOH A O   1 
HETATM 4415 O  O   . HOH I 5 .   ? 23.452  -16.919 35.596  1.00 31.74  ? 1440 HOH A O   1 
HETATM 4416 O  O   . HOH I 5 .   ? 11.212  -13.985 48.396  1.00 50.81  ? 1441 HOH A O   1 
HETATM 4417 O  O   . HOH I 5 .   ? 15.117  -10.136 43.115  1.00 37.14  ? 1442 HOH A O   1 
HETATM 4418 O  O   . HOH I 5 .   ? 10.600  -12.001 8.214   1.00 44.25  ? 1443 HOH A O   1 
HETATM 4419 O  O   . HOH I 5 .   ? 21.986  -12.529 49.027  1.00 82.30  ? 1444 HOH A O   1 
HETATM 4420 O  O   . HOH I 5 .   ? 31.548  6.291   25.578  1.00 63.58  ? 1445 HOH A O   1 
HETATM 4421 O  O   . HOH I 5 .   ? -2.848  9.938   42.173  1.00 33.13  ? 1446 HOH A O   1 
HETATM 4422 O  O   . HOH I 5 .   ? 29.325  0.572   40.190  1.00 35.30  ? 1447 HOH A O   1 
HETATM 4423 O  O   . HOH I 5 .   ? 27.438  -5.378  49.296  1.00 33.58  ? 1448 HOH A O   1 
HETATM 4424 O  O   . HOH I 5 .   ? -7.916  -3.348  17.578  1.00 49.55  ? 1449 HOH A O   1 
HETATM 4425 O  O   . HOH I 5 .   ? 4.193   9.013   55.411  1.00 37.28  ? 1450 HOH A O   1 
HETATM 4426 O  O   . HOH I 5 .   ? 23.394  -10.599 56.128  1.00 49.29  ? 1451 HOH A O   1 
HETATM 4427 O  O   . HOH I 5 .   ? 15.503  3.343   39.700  1.00 46.21  ? 1452 HOH A O   1 
HETATM 4428 O  O   . HOH I 5 .   ? 5.006   1.528   38.650  1.00 38.52  ? 1453 HOH A O   1 
HETATM 4429 O  O   . HOH I 5 .   ? 6.763   7.838   59.099  1.00 43.42  ? 1454 HOH A O   1 
HETATM 4430 O  O   . HOH I 5 .   ? 9.367   -5.181  43.255  1.00 54.32  ? 1455 HOH A O   1 
HETATM 4431 O  O   . HOH I 5 .   ? 6.832   -19.791 15.389  1.00 40.29  ? 1456 HOH A O   1 
HETATM 4432 O  O   . HOH I 5 .   ? 24.566  8.902   31.105  1.00 34.33  ? 1457 HOH A O   1 
HETATM 4433 O  O   . HOH I 5 .   ? 22.692  -13.318 51.499  1.00 33.34  ? 1458 HOH A O   1 
HETATM 4434 O  O   . HOH I 5 .   ? -4.062  3.323   39.997  1.00 38.30  ? 1459 HOH A O   1 
HETATM 4435 O  O   . HOH I 5 .   ? 16.351  -8.027  2.381   1.00 40.19  ? 1460 HOH A O   1 
HETATM 4436 O  O   . HOH I 5 .   ? 4.308   -6.726  35.521  1.00 51.96  ? 1461 HOH A O   1 
HETATM 4437 O  O   . HOH I 5 .   ? -1.448  2.623   16.368  1.00 36.48  ? 1462 HOH A O   1 
HETATM 4438 O  O   . HOH I 5 .   ? -4.330  0.021   28.634  1.00 42.92  ? 1463 HOH A O   1 
HETATM 4439 O  O   . HOH I 5 .   ? 30.529  2.896   40.028  1.00 46.69  ? 1464 HOH A O   1 
HETATM 4440 O  O   . HOH I 5 .   ? 27.106  -11.946 40.510  1.00 50.88  ? 1465 HOH A O   1 
HETATM 4441 O  O   . HOH I 5 .   ? 10.494  9.177   62.766  1.00 40.64  ? 1466 HOH A O   1 
HETATM 4442 O  O   . HOH I 5 .   ? 2.926   -7.620  13.609  1.00 49.45  ? 1467 HOH A O   1 
HETATM 4443 O  O   . HOH I 5 .   ? 10.582  -10.063 39.467  1.00 35.87  ? 1468 HOH A O   1 
HETATM 4444 O  O   . HOH I 5 .   ? 19.183  0.253   18.893  1.00 44.64  ? 1469 HOH A O   1 
HETATM 4445 O  O   . HOH I 5 .   ? 27.645  -16.161 26.414  1.00 52.85  ? 1470 HOH A O   1 
HETATM 4446 O  O   . HOH I 5 .   ? 5.424   -0.748  37.640  1.00 56.16  ? 1471 HOH A O   1 
HETATM 4447 O  O   . HOH I 5 .   ? 3.005   -13.349 24.234  1.00 46.80  ? 1472 HOH A O   1 
HETATM 4448 O  O   . HOH I 5 .   ? 29.951  -6.621  50.191  1.00 38.91  ? 1473 HOH A O   1 
HETATM 4449 O  O   . HOH I 5 .   ? 29.234  -10.600 43.271  1.00 43.71  ? 1474 HOH A O   1 
HETATM 4450 O  O   . HOH I 5 .   ? 22.583  -4.423  27.805  1.00 43.96  ? 1475 HOH A O   1 
HETATM 4451 O  O   . HOH I 5 .   ? 9.176   9.271   65.877  1.00 39.82  ? 1476 HOH A O   1 
HETATM 4452 O  O   . HOH I 5 .   ? 11.562  9.176   65.102  1.00 43.33  ? 1477 HOH A O   1 
HETATM 4453 O  O   . HOH I 5 .   ? -7.425  1.778   45.652  1.00 30.31  ? 1478 HOH A O   1 
HETATM 4454 O  O   . HOH I 5 .   ? 12.269  -3.724  5.040   1.00 29.74  ? 1479 HOH A O   1 
HETATM 4455 O  O   . HOH I 5 .   ? 25.038  8.220   28.521  1.00 42.51  ? 1480 HOH A O   1 
HETATM 4456 O  O   . HOH I 5 .   ? 0.680   -15.217 13.969  1.00 39.92  ? 1481 HOH A O   1 
HETATM 4457 O  O   . HOH I 5 .   ? 11.168  -0.783  34.916  1.00 32.94  ? 1482 HOH A O   1 
HETATM 4458 O  O   . HOH I 5 .   ? -3.373  4.752   17.478  1.00 32.81  ? 1483 HOH A O   1 
HETATM 4459 O  O   . HOH I 5 .   ? -1.938  -9.217  20.552  1.00 48.29  ? 1484 HOH A O   1 
HETATM 4460 O  O   . HOH I 5 .   ? -3.734  -1.431  32.789  1.00 46.26  ? 1485 HOH A O   1 
HETATM 4461 O  O   . HOH I 5 .   ? -5.145  -0.646  6.678   1.00 47.39  ? 1486 HOH A O   1 
HETATM 4462 O  O   . HOH I 5 .   ? 25.140  9.387   18.677  1.00 36.82  ? 1487 HOH A O   1 
HETATM 4463 O  O   . HOH I 5 .   ? 11.496  -12.420 40.126  1.00 47.19  ? 1488 HOH A O   1 
HETATM 4464 O  O   . HOH I 5 .   ? -2.581  -0.634  6.171   1.00 34.98  ? 1489 HOH A O   1 
HETATM 4465 O  O   . HOH I 5 .   ? 20.058  8.153   41.748  1.00 39.98  ? 1490 HOH A O   1 
HETATM 4466 O  O   . HOH I 5 .   ? 6.658   -1.200  4.436   1.00 47.42  ? 1491 HOH A O   1 
HETATM 4467 O  O   . HOH I 5 .   ? 11.117  14.871  49.307  1.00 39.36  ? 1492 HOH A O   1 
HETATM 4468 O  O   . HOH I 5 .   ? 17.499  -9.636  43.742  1.00 40.56  ? 1493 HOH A O   1 
HETATM 4469 O  O   . HOH I 5 .   ? 23.095  -0.563  38.196  1.00 71.19  ? 1494 HOH A O   1 
HETATM 4470 O  O   . HOH I 5 .   ? 4.115   -6.501  45.683  1.00 49.97  ? 1495 HOH A O   1 
HETATM 4471 O  O   . HOH I 5 .   ? 17.069  3.949   37.084  1.00 78.29  ? 1496 HOH A O   1 
HETATM 4472 O  O   . HOH I 5 .   ? 27.357  3.117   22.205  1.00 43.76  ? 1497 HOH A O   1 
HETATM 4473 O  O   . HOH I 5 .   ? 10.244  -0.435  50.170  1.00 56.28  ? 1498 HOH A O   1 
HETATM 4474 O  O   . HOH I 5 .   ? -3.981  2.221   17.154  1.00 74.51  ? 1499 HOH A O   1 
HETATM 4475 O  O   . HOH I 5 .   ? 31.028  -0.332  42.398  1.00 42.51  ? 1500 HOH A O   1 
HETATM 4476 O  O   . HOH I 5 .   ? 26.197  -15.762 34.445  1.00 48.70  ? 1501 HOH A O   1 
HETATM 4477 O  O   . HOH I 5 .   ? -5.612  -0.855  34.845  1.00 36.28  ? 1502 HOH A O   1 
HETATM 4478 O  O   . HOH I 5 .   ? 13.318  -10.999 41.459  1.00 52.30  ? 1503 HOH A O   1 
HETATM 4479 O  O   . HOH I 5 .   ? 28.752  -9.060  23.675  1.00 49.32  ? 1504 HOH A O   1 
HETATM 4480 O  O   . HOH I 5 .   ? 26.455  -15.893 14.128  1.00 45.61  ? 1505 HOH A O   1 
HETATM 4481 O  O   . HOH I 5 .   ? 29.879  -16.606 38.848  1.00 50.55  ? 1506 HOH A O   1 
HETATM 4482 O  O   . HOH I 5 .   ? -1.075  -6.559  31.019  1.00 46.57  ? 1507 HOH A O   1 
HETATM 4483 O  O   . HOH I 5 .   ? 4.226   -10.972 34.199  1.00 52.47  ? 1508 HOH A O   1 
HETATM 4484 O  O   . HOH I 5 .   ? 8.186   -7.847  8.192   1.00 45.84  ? 1509 HOH A O   1 
HETATM 4485 O  O   . HOH I 5 .   ? 19.311  -0.255  15.717  1.00 38.97  ? 1510 HOH A O   1 
HETATM 4486 O  O   . HOH I 5 .   ? 0.192   -10.957 23.589  1.00 43.72  ? 1511 HOH A O   1 
HETATM 4487 O  O   . HOH I 5 .   ? 12.164  2.850   3.138   1.00 116.11 ? 1512 HOH A O   1 
HETATM 4488 O  O   . HOH I 5 .   ? 21.191  -10.942 57.136  1.00 64.50  ? 1513 HOH A O   1 
HETATM 4489 O  O   . HOH J 5 .   ? 16.639  -50.596 27.087  1.00 19.46  ? 2304 HOH B O   1 
HETATM 4490 O  O   . HOH J 5 .   ? 21.246  -31.300 20.416  1.00 18.06  ? 2305 HOH B O   1 
HETATM 4491 O  O   . HOH J 5 .   ? 25.853  -41.346 16.358  1.00 19.12  ? 2306 HOH B O   1 
HETATM 4492 O  O   . HOH J 5 .   ? 12.236  -51.560 12.616  1.00 13.91  ? 2307 HOH B O   1 
HETATM 4493 O  O   . HOH J 5 .   ? 23.599  -32.889 27.890  1.00 22.18  ? 2308 HOH B O   1 
HETATM 4494 O  O   . HOH J 5 .   ? 7.142   -25.152 36.777  1.00 50.11  ? 2309 HOH B O   1 
HETATM 4495 O  O   . HOH J 5 .   ? 0.866   -44.780 17.124  1.00 20.49  ? 2310 HOH B O   1 
HETATM 4496 O  O   . HOH J 5 .   ? 16.988  -30.830 26.860  1.00 12.04  ? 2311 HOH B O   1 
HETATM 4497 O  O   . HOH J 5 .   ? 24.163  -45.694 22.222  1.00 17.98  ? 2312 HOH B O   1 
HETATM 4498 O  O   . HOH J 5 .   ? 20.722  -33.509 21.836  1.00 17.06  ? 2313 HOH B O   1 
HETATM 4499 O  O   . HOH J 5 .   ? 7.537   -50.342 16.777  1.00 22.50  ? 2314 HOH B O   1 
HETATM 4500 O  O   . HOH J 5 .   ? 17.867  -48.880 20.714  1.00 23.93  ? 2315 HOH B O   1 
HETATM 4501 O  O   . HOH J 5 .   ? 30.235  -38.920 -3.333  1.00 23.56  ? 2316 HOH B O   1 
HETATM 4502 O  O   . HOH J 5 .   ? 20.062  -21.272 30.272  1.00 31.79  ? 2317 HOH B O   1 
HETATM 4503 O  O   . HOH J 5 .   ? 0.307   -39.239 26.287  1.00 17.97  ? 2318 HOH B O   1 
HETATM 4504 O  O   . HOH J 5 .   ? 27.461  -43.624 16.993  1.00 21.54  ? 2319 HOH B O   1 
HETATM 4505 O  O   . HOH J 5 .   ? 19.004  -50.410 25.492  1.00 25.31  ? 2320 HOH B O   1 
HETATM 4506 O  O   . HOH J 5 .   ? 8.592   -33.873 40.553  1.00 25.70  ? 2321 HOH B O   1 
HETATM 4507 O  O   . HOH J 5 .   ? -2.598  -39.523 26.552  1.00 29.48  ? 2322 HOH B O   1 
HETATM 4508 O  O   . HOH J 5 .   ? 9.659   -46.232 17.699  1.00 15.75  ? 2323 HOH B O   1 
HETATM 4509 O  O   . HOH J 5 .   ? -1.964  -40.471 12.772  1.00 27.35  ? 2324 HOH B O   1 
HETATM 4510 O  O   . HOH J 5 .   ? 7.571   -40.248 16.139  1.00 19.41  ? 2325 HOH B O   1 
HETATM 4511 O  O   . HOH J 5 .   ? 20.762  -53.213 12.904  1.00 30.06  ? 2326 HOH B O   1 
HETATM 4512 O  O   . HOH J 5 .   ? 33.865  -31.850 1.465   1.00 28.40  ? 2327 HOH B O   1 
HETATM 4513 O  O   . HOH J 5 .   ? 19.679  -49.848 -2.554  1.00 20.90  ? 2328 HOH B O   1 
HETATM 4514 O  O   . HOH J 5 .   ? 10.350  -30.342 -0.932  1.00 47.02  ? 2329 HOH B O   1 
HETATM 4515 O  O   . HOH J 5 .   ? 10.038  -43.673 17.450  1.00 15.33  ? 2330 HOH B O   1 
HETATM 4516 O  O   . HOH J 5 .   ? 26.559  -31.172 -3.046  1.00 22.39  ? 2331 HOH B O   1 
HETATM 4517 O  O   . HOH J 5 .   ? 21.933  -27.966 34.686  1.00 19.28  ? 2332 HOH B O   1 
HETATM 4518 O  O   . HOH J 5 .   ? -1.577  -46.674 34.863  1.00 35.47  ? 2333 HOH B O   1 
HETATM 4519 O  O   . HOH J 5 .   ? 29.682  -30.369 20.058  1.00 43.30  ? 2334 HOH B O   1 
HETATM 4520 O  O   . HOH J 5 .   ? 24.006  -47.184 17.472  1.00 23.43  ? 2335 HOH B O   1 
HETATM 4521 O  O   . HOH J 5 .   ? -0.941  -43.457 20.262  1.00 23.27  ? 2336 HOH B O   1 
HETATM 4522 O  O   . HOH J 5 .   ? 18.390  -51.433 2.083   1.00 19.88  ? 2337 HOH B O   1 
HETATM 4523 O  O   . HOH J 5 .   ? 5.403   -44.437 41.466  1.00 18.09  ? 2338 HOH B O   1 
HETATM 4524 O  O   . HOH J 5 .   ? -0.064  -40.753 32.777  1.00 28.59  ? 2339 HOH B O   1 
HETATM 4525 O  O   . HOH J 5 .   ? 23.074  -35.295 24.471  1.00 27.09  ? 2340 HOH B O   1 
HETATM 4526 O  O   . HOH J 5 .   ? 3.845   -23.956 19.687  1.00 27.50  ? 2341 HOH B O   1 
HETATM 4527 O  O   . HOH J 5 .   ? -0.249  -47.399 11.374  1.00 26.30  ? 2342 HOH B O   1 
HETATM 4528 O  O   . HOH J 5 .   ? 12.243  -34.221 43.064  1.00 40.17  ? 2343 HOH B O   1 
HETATM 4529 O  O   . HOH J 5 .   ? 8.958   -54.304 26.671  1.00 33.51  ? 2344 HOH B O   1 
HETATM 4530 O  O   . HOH J 5 .   ? 8.067   -47.741 -0.985  1.00 67.02  ? 2345 HOH B O   1 
HETATM 4531 O  O   . HOH J 5 .   ? -1.125  -29.513 31.502  1.00 45.85  ? 2346 HOH B O   1 
HETATM 4532 O  O   . HOH J 5 .   ? 9.705   -45.860 -6.674  1.00 23.37  ? 2347 HOH B O   1 
HETATM 4533 O  O   . HOH J 5 .   ? 12.603  -44.155 -11.512 1.00 42.88  ? 2348 HOH B O   1 
HETATM 4534 O  O   . HOH J 5 .   ? 25.647  -50.632 -0.119  1.00 35.84  ? 2349 HOH B O   1 
HETATM 4535 O  O   . HOH J 5 .   ? 29.231  -48.379 4.781   1.00 25.40  ? 2350 HOH B O   1 
HETATM 4536 O  O   . HOH J 5 .   ? 1.459   -55.059 26.889  1.00 38.26  ? 2351 HOH B O   1 
HETATM 4537 O  O   . HOH J 5 .   ? 6.348   -19.801 24.277  1.00 21.06  ? 2352 HOH B O   1 
HETATM 4538 O  O   . HOH J 5 .   ? 20.321  -52.713 15.831  1.00 26.08  ? 2353 HOH B O   1 
HETATM 4539 O  O   . HOH J 5 .   ? 23.254  -26.925 4.169   1.00 43.80  ? 2354 HOH B O   1 
HETATM 4540 O  O   . HOH J 5 .   ? 10.642  -21.522 40.088  1.00 31.65  ? 2355 HOH B O   1 
HETATM 4541 O  O   . HOH J 5 .   ? 23.098  -46.972 6.460   1.00 25.91  ? 2356 HOH B O   1 
HETATM 4542 O  O   . HOH J 5 .   ? 18.901  -54.157 11.201  1.00 30.94  ? 2357 HOH B O   1 
HETATM 4543 O  O   . HOH J 5 .   ? 32.965  -37.895 10.748  1.00 26.05  ? 2358 HOH B O   1 
HETATM 4544 O  O   . HOH J 5 .   ? 9.882   -38.638 6.179   1.00 25.49  ? 2359 HOH B O   1 
HETATM 4545 O  O   . HOH J 5 .   ? 18.322  -43.113 15.531  1.00 19.84  ? 2360 HOH B O   1 
HETATM 4546 O  O   . HOH J 5 .   ? -2.987  -40.523 2.567   1.00 38.61  ? 2361 HOH B O   1 
HETATM 4547 O  O   . HOH J 5 .   ? 38.798  -30.344 3.070   1.00 57.99  ? 2362 HOH B O   1 
HETATM 4548 O  O   . HOH J 5 .   ? 12.563  -53.600 15.016  1.00 24.75  ? 2363 HOH B O   1 
HETATM 4549 O  O   . HOH J 5 .   ? 18.073  -29.343 41.805  1.00 44.24  ? 2364 HOH B O   1 
HETATM 4550 O  O   . HOH J 5 .   ? 8.806   -19.606 23.563  1.00 29.25  ? 2365 HOH B O   1 
HETATM 4551 O  O   . HOH J 5 .   ? -1.983  -27.745 13.905  1.00 46.87  ? 2366 HOH B O   1 
HETATM 4552 O  O   . HOH J 5 .   ? 11.335  -15.123 29.196  1.00 27.08  ? 2367 HOH B O   1 
HETATM 4553 O  O   . HOH J 5 .   ? -5.652  -40.202 3.010   1.00 27.18  ? 2368 HOH B O   1 
HETATM 4554 O  O   . HOH J 5 .   ? 5.694   -43.676 38.783  1.00 24.13  ? 2369 HOH B O   1 
HETATM 4555 O  O   . HOH J 5 .   ? 11.836  -19.557 35.564  1.00 25.88  ? 2370 HOH B O   1 
HETATM 4556 O  O   . HOH J 5 .   ? 13.195  -38.216 6.875   1.00 26.32  ? 2371 HOH B O   1 
HETATM 4557 O  O   . HOH J 5 .   ? 14.998  -27.283 6.758   1.00 35.35  ? 2372 HOH B O   1 
HETATM 4558 O  O   . HOH J 5 .   ? 0.992   -48.268 13.776  1.00 32.91  ? 2373 HOH B O   1 
HETATM 4559 O  O   . HOH J 5 .   ? 5.782   -52.691 36.367  1.00 33.12  ? 2374 HOH B O   1 
HETATM 4560 O  O   . HOH J 5 .   ? 30.917  -31.044 17.538  1.00 33.89  ? 2375 HOH B O   1 
HETATM 4561 O  O   . HOH J 5 .   ? 35.296  -34.864 15.913  1.00 42.84  ? 2376 HOH B O   1 
HETATM 4562 O  O   . HOH J 5 .   ? 5.337   -28.008 13.900  1.00 26.12  ? 2377 HOH B O   1 
HETATM 4563 O  O   . HOH J 5 .   ? 3.513   -48.441 17.560  1.00 29.53  ? 2378 HOH B O   1 
HETATM 4564 O  O   . HOH J 5 .   ? 20.103  -48.519 22.362  1.00 26.30  ? 2379 HOH B O   1 
HETATM 4565 O  O   . HOH J 5 .   ? 26.216  -45.828 18.196  1.00 33.57  ? 2380 HOH B O   1 
HETATM 4566 O  O   . HOH J 5 .   ? 1.943   -46.804 15.833  1.00 32.06  ? 2381 HOH B O   1 
HETATM 4567 O  O   . HOH J 5 .   ? 29.085  -47.608 9.031   1.00 24.65  ? 2382 HOH B O   1 
HETATM 4568 O  O   . HOH J 5 .   ? 23.145  -23.182 27.956  1.00 35.03  ? 2383 HOH B O   1 
HETATM 4569 O  O   . HOH J 5 .   ? 31.087  -46.899 1.599   1.00 27.00  ? 2384 HOH B O   1 
HETATM 4570 O  O   . HOH J 5 .   ? 7.823   -23.683 34.129  1.00 31.60  ? 2385 HOH B O   1 
HETATM 4571 O  O   . HOH J 5 .   ? 22.666  -50.078 26.322  1.00 19.48  ? 2386 HOH B O   1 
HETATM 4572 O  O   . HOH J 5 .   ? 16.491  -22.509 6.880   1.00 33.61  ? 2387 HOH B O   1 
HETATM 4573 O  O   . HOH J 5 .   ? 7.402   -34.864 11.518  1.00 25.71  ? 2388 HOH B O   1 
HETATM 4574 O  O   . HOH J 5 .   ? 12.995  -37.176 9.382   1.00 35.52  ? 2389 HOH B O   1 
HETATM 4575 O  O   . HOH J 5 .   ? 9.255   -48.403 19.915  1.00 26.24  ? 2390 HOH B O   1 
HETATM 4576 O  O   . HOH J 5 .   ? 22.788  -25.466 35.325  1.00 24.80  ? 2391 HOH B O   1 
HETATM 4577 O  O   . HOH J 5 .   ? 20.503  -31.442 38.028  1.00 25.42  ? 2392 HOH B O   1 
HETATM 4578 O  O   . HOH J 5 .   ? 22.316  -50.003 -5.220  1.00 34.77  ? 2393 HOH B O   1 
HETATM 4579 O  O   . HOH J 5 .   ? 34.513  -26.842 7.785   1.00 30.49  ? 2394 HOH B O   1 
HETATM 4580 O  O   . HOH J 5 .   ? 29.701  -45.237 12.379  1.00 26.94  ? 2395 HOH B O   1 
HETATM 4581 O  O   . HOH J 5 .   ? 0.725   -38.072 10.506  1.00 43.00  ? 2396 HOH B O   1 
HETATM 4582 O  O   . HOH J 5 .   ? 12.627  -46.532 -7.495  1.00 31.63  ? 2397 HOH B O   1 
HETATM 4583 O  O   . HOH J 5 .   ? 20.532  -27.231 4.458   1.00 35.30  ? 2398 HOH B O   1 
HETATM 4584 O  O   . HOH J 5 .   ? 27.859  -47.804 6.803   1.00 34.52  ? 2399 HOH B O   1 
HETATM 4585 O  O   . HOH J 5 .   ? -4.629  -29.556 25.241  1.00 35.48  ? 2400 HOH B O   1 
HETATM 4586 O  O   . HOH J 5 .   ? 14.810  -53.667 21.753  1.00 34.18  ? 2401 HOH B O   1 
HETATM 4587 O  O   . HOH J 5 .   ? 23.874  -30.525 -3.310  1.00 35.37  ? 2402 HOH B O   1 
HETATM 4588 O  O   . HOH J 5 .   ? 17.771  -52.189 29.663  1.00 30.90  ? 2403 HOH B O   1 
HETATM 4589 O  O   . HOH J 5 .   ? 7.566   -38.195 13.808  1.00 21.64  ? 2404 HOH B O   1 
HETATM 4590 O  O   . HOH J 5 .   ? -3.554  -50.204 24.988  1.00 50.22  ? 2405 HOH B O   1 
HETATM 4591 O  O   . HOH J 5 .   ? -4.971  -39.536 12.751  1.00 32.43  ? 2406 HOH B O   1 
HETATM 4592 O  O   . HOH J 5 .   ? 9.630   -23.597 15.398  1.00 36.42  ? 2407 HOH B O   1 
HETATM 4593 O  O   . HOH J 5 .   ? 7.337   -50.400 33.521  1.00 45.65  ? 2408 HOH B O   1 
HETATM 4594 O  O   . HOH J 5 .   ? 28.191  -50.372 0.508   1.00 51.03  ? 2409 HOH B O   1 
HETATM 4595 O  O   . HOH J 5 .   ? 22.654  -29.726 36.665  1.00 26.41  ? 2410 HOH B O   1 
HETATM 4596 O  O   . HOH J 5 .   ? 24.097  -46.579 30.512  1.00 37.80  ? 2411 HOH B O   1 
HETATM 4597 O  O   . HOH J 5 .   ? 0.144   -49.479 21.851  1.00 30.10  ? 2412 HOH B O   1 
HETATM 4598 O  O   . HOH J 5 .   ? 8.876   -26.432 10.164  1.00 63.29  ? 2413 HOH B O   1 
HETATM 4599 O  O   . HOH J 5 .   ? 32.484  -30.100 -1.087  1.00 99.12  ? 2414 HOH B O   1 
HETATM 4600 O  O   . HOH J 5 .   ? 8.327   -18.833 18.592  1.00 38.84  ? 2415 HOH B O   1 
HETATM 4601 O  O   . HOH J 5 .   ? 7.350   -33.897 0.484   1.00 32.33  ? 2416 HOH B O   1 
HETATM 4602 O  O   . HOH J 5 .   ? 2.721   -45.661 27.619  1.00 52.91  ? 2417 HOH B O   1 
HETATM 4603 O  O   . HOH J 5 .   ? 30.839  -33.509 -9.004  1.00 42.58  ? 2418 HOH B O   1 
HETATM 4604 O  O   . HOH J 5 .   ? -4.633  -44.446 1.419   1.00 36.19  ? 2419 HOH B O   1 
HETATM 4605 O  O   . HOH J 5 .   ? 36.527  -30.692 1.357   1.00 57.09  ? 2420 HOH B O   1 
HETATM 4606 O  O   . HOH J 5 .   ? 13.012  -25.845 7.915   1.00 37.75  ? 2421 HOH B O   1 
HETATM 4607 O  O   . HOH J 5 .   ? -3.086  -44.026 31.430  1.00 38.67  ? 2422 HOH B O   1 
HETATM 4608 O  O   . HOH J 5 .   ? 4.370   -51.045 31.271  1.00 34.74  ? 2423 HOH B O   1 
HETATM 4609 O  O   . HOH J 5 .   ? 0.403   -50.012 9.475   1.00 29.12  ? 2424 HOH B O   1 
HETATM 4610 O  O   . HOH J 5 .   ? 1.880   -23.792 25.885  1.00 35.70  ? 2425 HOH B O   1 
HETATM 4611 O  O   . HOH J 5 .   ? 25.411  -26.059 34.496  1.00 37.09  ? 2426 HOH B O   1 
HETATM 4612 O  O   . HOH J 5 .   ? 23.552  -32.878 24.469  1.00 24.60  ? 2427 HOH B O   1 
HETATM 4613 O  O   . HOH J 5 .   ? 18.453  -34.471 35.200  1.00 17.32  ? 2428 HOH B O   1 
HETATM 4614 O  O   . HOH J 5 .   ? 9.203   -55.574 29.757  1.00 25.44  ? 2429 HOH B O   1 
HETATM 4615 O  O   . HOH J 5 .   ? 22.987  -48.095 -10.097 1.00 22.87  ? 2430 HOH B O   1 
HETATM 4616 O  O   . HOH J 5 .   ? 18.402  -41.796 32.391  1.00 39.25  ? 2431 HOH B O   1 
HETATM 4617 O  O   . HOH J 5 .   ? -5.221  -39.704 15.383  1.00 25.03  ? 2432 HOH B O   1 
HETATM 4618 O  O   . HOH J 5 .   ? -1.765  -41.611 34.865  1.00 30.75  ? 2433 HOH B O   1 
HETATM 4619 O  O   . HOH J 5 .   ? 13.525  -30.043 42.213  1.00 23.34  ? 2434 HOH B O   1 
HETATM 4620 O  O   . HOH J 5 .   ? 22.520  -33.183 37.788  1.00 28.33  ? 2435 HOH B O   1 
HETATM 4621 O  O   . HOH J 5 .   ? 26.394  -45.240 -4.449  1.00 35.41  ? 2436 HOH B O   1 
HETATM 4622 O  O   . HOH J 5 .   ? 31.242  -39.672 10.150  1.00 27.68  ? 2437 HOH B O   1 
HETATM 4623 O  O   . HOH J 5 .   ? 14.985  -47.732 -10.584 1.00 23.77  ? 2438 HOH B O   1 
HETATM 4624 O  O   . HOH J 5 .   ? 9.956   -32.220 1.925   1.00 35.59  ? 2439 HOH B O   1 
HETATM 4625 O  O   . HOH J 5 .   ? 2.649   -28.366 31.422  1.00 28.77  ? 2440 HOH B O   1 
HETATM 4626 O  O   . HOH J 5 .   ? 28.323  -26.449 -1.432  1.00 31.86  ? 2441 HOH B O   1 
HETATM 4627 O  O   . HOH J 5 .   ? 17.526  -46.269 -11.357 1.00 23.95  ? 2442 HOH B O   1 
HETATM 4628 O  O   . HOH J 5 .   ? 25.656  -46.141 6.430   1.00 37.26  ? 2443 HOH B O   1 
HETATM 4629 O  O   . HOH J 5 .   ? 22.581  -48.963 19.504  1.00 41.81  ? 2444 HOH B O   1 
HETATM 4630 O  O   . HOH J 5 .   ? 8.633   -48.268 -5.913  1.00 35.89  ? 2445 HOH B O   1 
HETATM 4631 O  O   . HOH J 5 .   ? 12.547  -53.610 10.680  1.00 30.48  ? 2446 HOH B O   1 
HETATM 4632 O  O   . HOH J 5 .   ? 1.305   -29.771 29.592  1.00 44.42  ? 2447 HOH B O   1 
HETATM 4633 O  O   . HOH J 5 .   ? 18.319  -38.662 29.647  1.00 42.62  ? 2448 HOH B O   1 
HETATM 4634 O  O   . HOH J 5 .   ? 7.246   -25.848 12.243  1.00 37.52  ? 2449 HOH B O   1 
HETATM 4635 O  O   . HOH J 5 .   ? 24.706  -42.282 28.541  1.00 30.49  ? 2450 HOH B O   1 
HETATM 4636 O  O   . HOH J 5 .   ? 0.171   -53.008 34.373  1.00 39.74  ? 2451 HOH B O   1 
HETATM 4637 O  O   . HOH J 5 .   ? 32.193  -29.102 7.025   1.00 35.01  ? 2452 HOH B O   1 
HETATM 4638 O  O   . HOH J 5 .   ? -3.509  -47.815 22.859  1.00 52.04  ? 2453 HOH B O   1 
HETATM 4639 O  O   . HOH J 5 .   ? 17.242  -36.397 -3.567  1.00 38.26  ? 2454 HOH B O   1 
HETATM 4640 O  O   . HOH J 5 .   ? 46.628  -30.469 8.697   1.00 63.56  ? 2455 HOH B O   1 
HETATM 4641 O  O   . HOH J 5 .   ? 15.610  -52.921 26.116  1.00 30.35  ? 2456 HOH B O   1 
HETATM 4642 O  O   . HOH J 5 .   ? -3.448  -40.009 29.181  1.00 37.08  ? 2457 HOH B O   1 
HETATM 4643 O  O   . HOH J 5 .   ? 12.514  -56.571 39.011  1.00 34.96  ? 2458 HOH B O   1 
HETATM 4644 O  O   . HOH J 5 .   ? -2.165  -38.743 44.987  1.00 33.88  ? 2459 HOH B O   1 
HETATM 4645 O  O   . HOH J 5 .   ? 30.693  -28.270 9.370   1.00 43.68  ? 2460 HOH B O   1 
HETATM 4646 O  O   . HOH J 5 .   ? -1.907  -38.111 10.599  1.00 30.33  ? 2461 HOH B O   1 
HETATM 4647 O  O   . HOH J 5 .   ? 29.592  -45.003 15.564  1.00 37.24  ? 2462 HOH B O   1 
HETATM 4648 O  O   . HOH J 5 .   ? 6.083   -50.909 10.116  1.00 46.85  ? 2463 HOH B O   1 
HETATM 4649 O  O   . HOH J 5 .   ? 7.845   -35.235 8.594   1.00 34.15  ? 2464 HOH B O   1 
HETATM 4650 O  O   . HOH J 5 .   ? 19.791  -50.741 -5.997  1.00 44.57  ? 2465 HOH B O   1 
HETATM 4651 O  O   . HOH J 5 .   ? 9.408   -37.954 41.393  1.00 28.73  ? 2466 HOH B O   1 
HETATM 4652 O  O   . HOH J 5 .   ? 34.098  -41.921 9.507   1.00 42.40  ? 2467 HOH B O   1 
HETATM 4653 O  O   . HOH J 5 .   ? 14.662  -36.224 11.361  1.00 36.80  ? 2468 HOH B O   1 
HETATM 4654 O  O   . HOH J 5 .   ? 5.138   -48.824 33.734  1.00 48.03  ? 2469 HOH B O   1 
HETATM 4655 O  O   . HOH J 5 .   ? -1.328  -41.066 16.106  1.00 34.04  ? 2470 HOH B O   1 
HETATM 4656 O  O   . HOH J 5 .   ? 17.726  -38.865 26.347  1.00 29.30  ? 2471 HOH B O   1 
HETATM 4657 O  O   . HOH J 5 .   ? 9.475   -39.408 12.848  1.00 34.50  ? 2472 HOH B O   1 
HETATM 4658 O  O   . HOH J 5 .   ? 6.683   -49.584 35.691  1.00 30.24  ? 2473 HOH B O   1 
HETATM 4659 O  O   . HOH J 5 .   ? 14.132  -30.616 -5.407  1.00 56.83  ? 2474 HOH B O   1 
HETATM 4660 O  O   . HOH J 5 .   ? 22.875  -55.094 9.344   1.00 48.54  ? 2475 HOH B O   1 
HETATM 4661 O  O   . HOH J 5 .   ? 24.131  -34.080 18.038  1.00 51.77  ? 2476 HOH B O   1 
HETATM 4662 O  O   . HOH J 5 .   ? 27.113  -50.755 7.524   1.00 43.33  ? 2477 HOH B O   1 
HETATM 4663 O  O   . HOH J 5 .   ? 1.730   -25.098 17.879  1.00 42.52  ? 2478 HOH B O   1 
HETATM 4664 O  O   . HOH J 5 .   ? 25.801  -20.070 13.107  1.00 37.76  ? 2479 HOH B O   1 
HETATM 4665 O  O   . HOH J 5 .   ? -6.558  -39.950 28.724  1.00 47.10  ? 2480 HOH B O   1 
HETATM 4666 O  O   . HOH J 5 .   ? -0.247  -42.914 46.672  1.00 24.25  ? 2481 HOH B O   1 
HETATM 4667 O  O   . HOH J 5 .   ? 8.082   -48.029 1.509   1.00 33.99  ? 2482 HOH B O   1 
HETATM 4668 O  O   . HOH J 5 .   ? 19.021  -48.597 -12.527 1.00 29.13  ? 2483 HOH B O   1 
HETATM 4669 O  O   . HOH J 5 .   ? 7.105   -53.537 24.817  1.00 33.85  ? 2484 HOH B O   1 
HETATM 4670 O  O   . HOH J 5 .   ? 23.892  -24.510 4.669   1.00 42.06  ? 2485 HOH B O   1 
HETATM 4671 O  O   . HOH J 5 .   ? -2.407  -42.577 10.079  1.00 36.81  ? 2486 HOH B O   1 
HETATM 4672 O  O   . HOH J 5 .   ? -6.734  -36.185 23.104  1.00 48.39  ? 2487 HOH B O   1 
HETATM 4673 O  O   . HOH J 5 .   ? 7.988   -51.861 7.834   1.00 34.40  ? 2488 HOH B O   1 
HETATM 4674 O  O   . HOH J 5 .   ? 30.854  -35.138 21.704  1.00 34.96  ? 2489 HOH B O   1 
HETATM 4675 O  O   . HOH J 5 .   ? 3.482   -52.412 34.937  1.00 44.73  ? 2490 HOH B O   1 
HETATM 4676 O  O   . HOH J 5 .   ? 25.298  -17.743 12.341  1.00 48.73  ? 2491 HOH B O   1 
HETATM 4677 O  O   . HOH J 5 .   ? 3.000   -23.777 33.941  1.00 44.61  ? 2492 HOH B O   1 
HETATM 4678 O  O   . HOH J 5 .   ? 13.638  -37.681 13.554  1.00 31.90  ? 2493 HOH B O   1 
HETATM 4679 O  O   . HOH J 5 .   ? 29.884  -23.923 6.812   1.00 40.71  ? 2494 HOH B O   1 
HETATM 4680 O  O   . HOH J 5 .   ? -3.816  -56.873 30.628  1.00 45.59  ? 2495 HOH B O   1 
HETATM 4681 O  O   . HOH J 5 .   ? 1.260   -36.028 4.960   1.00 69.95  ? 2496 HOH B O   1 
HETATM 4682 O  O   . HOH J 5 .   ? -1.885  -41.454 30.702  1.00 34.93  ? 2497 HOH B O   1 
HETATM 4683 O  O   . HOH J 5 .   ? 19.162  -55.141 16.317  1.00 47.13  ? 2498 HOH B O   1 
HETATM 4684 O  O   . HOH J 5 .   ? 14.191  -55.885 12.081  1.00 39.38  ? 2499 HOH B O   1 
HETATM 4685 O  O   . HOH J 5 .   ? -8.691  -32.196 24.306  1.00 42.70  ? 2500 HOH B O   1 
HETATM 4686 O  O   . HOH J 5 .   ? 21.261  -51.323 22.634  1.00 39.65  ? 2501 HOH B O   1 
HETATM 4687 O  O   . HOH J 5 .   ? -3.028  -48.503 3.580   1.00 50.59  ? 2502 HOH B O   1 
HETATM 4688 O  O   . HOH J 5 .   ? -2.879  -44.059 34.146  1.00 37.81  ? 2503 HOH B O   1 
HETATM 4689 O  O   . HOH J 5 .   ? 42.304  -26.715 11.309  1.00 53.92  ? 2504 HOH B O   1 
HETATM 4690 O  O   . HOH J 5 .   ? -4.389  -30.701 19.288  1.00 39.94  ? 2505 HOH B O   1 
HETATM 4691 O  O   . HOH J 5 .   ? 36.065  -40.777 8.270   1.00 49.44  ? 2506 HOH B O   1 
HETATM 4692 O  O   . HOH J 5 .   ? 10.284  -35.585 12.095  1.00 33.98  ? 2507 HOH B O   1 
HETATM 4693 O  O   . HOH J 5 .   ? 2.785   -21.805 20.989  1.00 40.87  ? 2508 HOH B O   1 
HETATM 4694 O  O   . HOH J 5 .   ? 16.915  -52.980 23.200  1.00 48.17  ? 2509 HOH B O   1 
HETATM 4695 O  O   . HOH J 5 .   ? 22.840  -28.272 -4.663  1.00 38.95  ? 2510 HOH B O   1 
HETATM 4696 O  O   . HOH J 5 .   ? -0.647  -40.864 44.676  1.00 161.25 ? 2511 HOH B O   1 
HETATM 4697 O  O   . HOH J 5 .   ? 33.483  -46.069 1.802   1.00 50.69  ? 2512 HOH B O   1 
HETATM 4698 O  O   . HOH J 5 .   ? -5.166  -33.326 19.240  1.00 34.31  ? 2513 HOH B O   1 
HETATM 4699 O  O   . HOH J 5 .   ? 30.533  -29.162 14.600  1.00 40.40  ? 2514 HOH B O   1 
HETATM 4700 O  O   . HOH J 5 .   ? 6.627   -38.683 -4.212  1.00 46.37  ? 2515 HOH B O   1 
HETATM 4701 O  O   . HOH J 5 .   ? 4.675   -41.257 42.253  1.00 59.70  ? 2516 HOH B O   1 
HETATM 4702 O  O   . HOH J 5 .   ? 26.427  -45.263 20.777  1.00 43.69  ? 2517 HOH B O   1 
HETATM 4703 O  O   . HOH J 5 .   ? 7.055   -47.297 -3.929  1.00 56.56  ? 2518 HOH B O   1 
HETATM 4704 O  O   . HOH J 5 .   ? 24.379  -45.934 26.927  1.00 41.32  ? 2519 HOH B O   1 
HETATM 4705 O  O   . HOH J 5 .   ? 12.486  -37.033 -11.948 1.00 42.64  ? 2520 HOH B O   1 
HETATM 4706 O  O   . HOH J 5 .   ? 8.070   -41.283 41.538  1.00 50.20  ? 2521 HOH B O   1 
HETATM 4707 O  O   . HOH J 5 .   ? -0.790  -24.875 21.338  1.00 47.47  ? 2522 HOH B O   1 
HETATM 4708 O  O   . HOH J 5 .   ? 32.056  -33.061 20.077  1.00 47.02  ? 2523 HOH B O   1 
HETATM 4709 O  O   . HOH J 5 .   ? 30.114  -25.254 14.883  1.00 38.16  ? 2524 HOH B O   1 
HETATM 4710 O  O   . HOH J 5 .   ? 3.243   -21.001 30.099  1.00 40.20  ? 2525 HOH B O   1 
HETATM 4711 O  O   . HOH J 5 .   ? -2.658  -27.702 30.530  1.00 45.92  ? 2526 HOH B O   1 
HETATM 4712 O  O   . HOH J 5 .   ? 1.497   -48.763 -5.394  1.00 37.79  ? 2527 HOH B O   1 
HETATM 4713 O  O   . HOH J 5 .   ? 1.828   -21.625 27.984  1.00 40.80  ? 2528 HOH B O   1 
HETATM 4714 O  O   . HOH J 5 .   ? 3.154   -47.273 0.991   1.00 39.42  ? 2529 HOH B O   1 
HETATM 4715 O  O   . HOH J 5 .   ? 26.784  -21.372 23.798  1.00 74.25  ? 2530 HOH B O   1 
HETATM 4716 O  O   . HOH J 5 .   ? 8.190   -32.945 -5.260  1.00 53.46  ? 2531 HOH B O   1 
HETATM 4717 O  O   . HOH J 5 .   ? 28.194  -39.301 26.419  1.00 36.90  ? 2532 HOH B O   1 
HETATM 4718 O  O   . HOH J 5 .   ? 9.242   -16.645 28.821  1.00 45.78  ? 2533 HOH B O   1 
HETATM 4719 O  O   . HOH J 5 .   ? 18.102  -53.392 -6.100  1.00 38.87  ? 2534 HOH B O   1 
HETATM 4720 O  O   . HOH J 5 .   ? 17.583  -56.975 5.092   1.00 51.78  ? 2535 HOH B O   1 
HETATM 4721 O  O   . HOH J 5 .   ? 31.122  -46.776 5.839   1.00 46.74  ? 2536 HOH B O   1 
HETATM 4722 O  O   . HOH J 5 .   ? 0.791   -36.679 44.432  1.00 41.76  ? 2537 HOH B O   1 
HETATM 4723 O  O   . HOH J 5 .   ? 2.384   -50.558 13.512  1.00 39.45  ? 2538 HOH B O   1 
HETATM 4724 O  O   . HOH J 5 .   ? 26.296  -24.244 28.191  1.00 54.58  ? 2539 HOH B O   1 
HETATM 4725 O  O   . HOH J 5 .   ? 14.496  -56.534 40.719  1.00 49.16  ? 2540 HOH B O   1 
HETATM 4726 O  O   . HOH J 5 .   ? -4.951  -36.556 48.207  1.00 30.14  ? 2541 HOH B O   1 
HETATM 4727 O  O   . HOH J 5 .   ? -5.723  -44.280 35.046  1.00 37.91  ? 2542 HOH B O   1 
HETATM 4728 O  O   . HOH J 5 .   ? 9.024   -50.304 1.539   1.00 47.29  ? 2543 HOH B O   1 
HETATM 4729 O  O   . HOH J 5 .   ? 32.237  -25.202 5.402   1.00 43.65  ? 2544 HOH B O   1 
HETATM 4730 O  O   . HOH J 5 .   ? 27.751  -36.430 11.519  1.00 30.62  ? 2545 HOH B O   1 
HETATM 4731 O  O   . HOH J 5 .   ? 10.161  -54.303 15.572  1.00 35.36  ? 2546 HOH B O   1 
HETATM 4732 O  O   . HOH J 5 .   ? 40.813  -27.129 8.829   1.00 44.07  ? 2547 HOH B O   1 
HETATM 4733 O  O   . HOH J 5 .   ? 13.711  -36.160 4.914   1.00 37.34  ? 2548 HOH B O   1 
HETATM 4734 O  O   . HOH J 5 .   ? -2.888  -42.522 1.254   1.00 46.28  ? 2549 HOH B O   1 
HETATM 4735 O  O   . HOH J 5 .   ? -4.191  -41.865 24.871  1.00 40.59  ? 2550 HOH B O   1 
HETATM 4736 O  O   . HOH J 5 .   ? 9.905   -29.261 -7.546  1.00 70.14  ? 2551 HOH B O   1 
HETATM 4737 O  O   . HOH J 5 .   ? -7.231  -42.742 39.531  1.00 41.69  ? 2552 HOH B O   1 
HETATM 4738 O  O   . HOH J 5 .   ? -3.226  -32.447 35.837  1.00 48.14  ? 2553 HOH B O   1 
HETATM 4739 O  O   . HOH J 5 .   ? -1.642  -50.203 5.171   1.00 41.51  ? 2554 HOH B O   1 
HETATM 4740 O  O   . HOH J 5 .   ? 33.310  -32.511 -1.120  1.00 44.56  ? 2555 HOH B O   1 
HETATM 4741 O  O   . HOH J 5 .   ? -7.261  -42.309 -3.356  1.00 45.16  ? 2556 HOH B O   1 
HETATM 4742 O  O   . HOH J 5 .   ? 1.159   -51.285 -3.205  1.00 43.87  ? 2557 HOH B O   1 
HETATM 4743 O  O   . HOH J 5 .   ? -0.335  -46.718 40.182  1.00 44.67  ? 2558 HOH B O   1 
HETATM 4744 O  O   . HOH J 5 .   ? 10.899  -18.933 39.961  1.00 40.20  ? 2559 HOH B O   1 
HETATM 4745 O  O   . HOH J 5 .   ? 20.475  -34.630 36.348  1.00 49.14  ? 2560 HOH B O   1 
HETATM 4746 O  O   . HOH J 5 .   ? 36.890  -36.824 5.791   1.00 38.89  ? 2561 HOH B O   1 
HETATM 4747 O  O   . HOH J 5 .   ? 31.264  -30.194 -8.306  1.00 39.34  ? 2562 HOH B O   1 
HETATM 4748 O  O   . HOH J 5 .   ? 10.945  -27.858 -1.311  1.00 62.94  ? 2563 HOH B O   1 
HETATM 4749 O  O   . HOH J 5 .   ? 7.761   -18.186 26.646  1.00 45.20  ? 2564 HOH B O   1 
HETATM 4750 O  O   . HOH J 5 .   ? -3.145  -48.557 8.211   1.00 50.79  ? 2565 HOH B O   1 
HETATM 4751 O  O   . HOH J 5 .   ? -4.992  -44.375 45.890  1.00 29.26  ? 2566 HOH B O   1 
HETATM 4752 O  O   . HOH J 5 .   ? 32.944  -26.742 18.823  1.00 45.31  ? 2567 HOH B O   1 
HETATM 4753 O  O   . HOH J 5 .   ? 9.283   -56.882 19.994  1.00 40.64  ? 2568 HOH B O   1 
HETATM 4754 O  O   . HOH J 5 .   ? -1.760  -27.901 22.135  1.00 53.70  ? 2569 HOH B O   1 
HETATM 4755 O  O   . HOH J 5 .   ? -3.326  -53.275 26.449  1.00 50.95  ? 2570 HOH B O   1 
HETATM 4756 O  O   . HOH J 5 .   ? 19.862  -56.527 18.677  1.00 39.87  ? 2571 HOH B O   1 
HETATM 4757 O  O   . HOH J 5 .   ? 16.885  -55.848 11.603  1.00 47.93  ? 2572 HOH B O   1 
HETATM 4758 O  O   . HOH J 5 .   ? 7.205   -31.949 2.151   1.00 51.89  ? 2573 HOH B O   1 
HETATM 4759 O  O   . HOH J 5 .   ? -6.020  -54.482 30.540  1.00 46.74  ? 2574 HOH B O   1 
HETATM 4760 O  O   . HOH J 5 .   ? 3.111   -50.238 -1.504  1.00 57.88  ? 2575 HOH B O   1 
HETATM 4761 O  O   . HOH J 5 .   ? 0.227   -48.462 -7.655  1.00 37.15  ? 2576 HOH B O   1 
HETATM 4762 O  O   . HOH J 5 .   ? 10.784  -33.711 10.741  1.00 46.37  ? 2577 HOH B O   1 
HETATM 4763 O  O   . HOH J 5 .   ? 14.219  -35.114 36.804  1.00 21.97  ? 2578 HOH B O   1 
HETATM 4764 O  O   . HOH J 5 .   ? -4.723  -30.902 29.903  1.00 48.64  ? 2579 HOH B O   1 
HETATM 4765 O  O   . HOH J 5 .   ? 14.757  -34.599 3.036   1.00 47.65  ? 2580 HOH B O   1 
HETATM 4766 O  O   . HOH J 5 .   ? 29.377  -29.986 -10.094 1.00 41.64  ? 2581 HOH B O   1 
HETATM 4767 O  O   . HOH J 5 .   ? 30.253  -26.466 -7.048  1.00 40.47  ? 2582 HOH B O   1 
HETATM 4768 O  O   . HOH J 5 .   ? 14.583  -50.868 -5.984  1.00 37.85  ? 2583 HOH B O   1 
HETATM 4769 O  O   . HOH J 5 .   ? 17.698  -52.518 -0.038  1.00 35.80  ? 2584 HOH B O   1 
HETATM 4770 O  O   . HOH J 5 .   ? -6.656  -34.577 46.437  1.00 50.58  ? 2585 HOH B O   1 
HETATM 4771 O  O   . HOH J 5 .   ? 12.649  -46.415 -10.209 1.00 51.19  ? 2586 HOH B O   1 
HETATM 4772 O  O   . HOH J 5 .   ? 11.605  -37.634 12.325  1.00 50.10  ? 2587 HOH B O   1 
HETATM 4773 O  O   . HOH J 5 .   ? 10.200  -20.384 18.034  1.00 51.28  ? 2588 HOH B O   1 
HETATM 4774 O  O   . HOH J 5 .   ? -4.107  -37.452 9.295   1.00 42.04  ? 2589 HOH B O   1 
HETATM 4775 O  O   . HOH J 5 .   ? 41.597  -27.976 4.911   1.00 44.53  ? 2590 HOH B O   1 
HETATM 4776 O  O   . HOH J 5 .   ? 24.608  -55.839 6.307   1.00 48.22  ? 2591 HOH B O   1 
HETATM 4777 O  O   . HOH J 5 .   ? 10.566  -51.614 3.404   1.00 34.96  ? 2592 HOH B O   1 
HETATM 4778 O  O   . HOH J 5 .   ? 32.606  -46.658 11.796  1.00 53.12  ? 2593 HOH B O   1 
HETATM 4779 O  O   . HOH J 5 .   ? 13.244  -22.579 41.264  1.00 37.74  ? 2594 HOH B O   1 
HETATM 4780 O  O   . HOH J 5 .   ? 12.950  -57.774 30.521  1.00 48.53  ? 2595 HOH B O   1 
HETATM 4781 O  O   . HOH J 5 .   ? 22.384  -46.588 20.714  1.00 40.35  ? 2596 HOH B O   1 
HETATM 4782 O  O   . HOH J 5 .   ? -5.011  -40.479 -4.387  1.00 48.03  ? 2597 HOH B O   1 
HETATM 4783 O  O   . HOH J 5 .   ? 17.418  -26.226 5.711   1.00 40.63  ? 2598 HOH B O   1 
HETATM 4784 O  O   . HOH J 5 .   ? 13.387  -34.085 40.966  1.00 40.87  ? 2599 HOH B O   1 
HETATM 4785 O  O   . HOH J 5 .   ? 8.375   -26.493 40.625  1.00 41.76  ? 2600 HOH B O   1 
HETATM 4786 O  O   . HOH J 5 .   ? 32.202  -43.473 16.014  1.00 51.99  ? 2601 HOH B O   1 
HETATM 4787 O  O   . HOH J 5 .   ? 28.893  -47.579 16.611  1.00 50.65  ? 2602 HOH B O   1 
HETATM 4788 O  O   . HOH J 5 .   ? 3.199   -26.653 14.241  1.00 35.71  ? 2603 HOH B O   1 
HETATM 4789 O  O   . HOH J 5 .   ? 20.474  -30.705 40.372  1.00 31.85  ? 2604 HOH B O   1 
HETATM 4790 O  O   . HOH J 5 .   ? 8.174   -57.481 27.131  1.00 41.78  ? 2605 HOH B O   1 
HETATM 4791 O  O   . HOH J 5 .   ? 30.810  -25.114 0.757   1.00 56.14  ? 2606 HOH B O   1 
HETATM 4792 O  O   . HOH J 5 .   ? 20.804  -53.114 4.905   1.00 38.33  ? 2607 HOH B O   1 
HETATM 4793 O  O   . HOH J 5 .   ? -3.159  -35.086 43.023  1.00 43.61  ? 2608 HOH B O   1 
HETATM 4794 O  O   . HOH J 5 .   ? 12.314  -44.650 -8.382  1.00 55.65  ? 2609 HOH B O   1 
HETATM 4795 O  O   . HOH J 5 .   ? -7.422  -40.349 -6.343  1.00 41.39  ? 2610 HOH B O   1 
HETATM 4796 O  O   . HOH J 5 .   ? -7.750  -37.775 34.596  1.00 37.03  ? 2611 HOH B O   1 
HETATM 4797 O  O   . HOH J 5 .   ? -8.167  -34.704 25.738  1.00 60.35  ? 2612 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   205 ?   ?   ?   A . n 
A 1 2   PRO 2   206 ?   ?   ?   A . n 
A 1 3   GLN 3   207 ?   ?   ?   A . n 
A 1 4   VAL 4   208 ?   ?   ?   A . n 
A 1 5   ALA 5   209 ?   ?   ?   A . n 
A 1 6   ASP 6   210 ?   ?   ?   A . n 
A 1 7   LEU 7   211 211 LEU LEU A . n 
A 1 8   LYS 8   212 212 LYS LYS A . n 
A 1 9   ALA 9   213 213 ALA ALA A . n 
A 1 10  PHE 10  214 214 PHE PHE A . n 
A 1 11  SER 11  215 215 SER SER A . n 
A 1 12  LYS 12  216 216 LYS LYS A . n 
A 1 13  HIS 13  217 217 HIS HIS A . n 
A 1 14  ILE 14  218 218 ILE ILE A . n 
A 1 15  TYR 15  219 219 TYR TYR A . n 
A 1 16  ASN 16  220 220 ASN ASN A . n 
A 1 17  ALA 17  221 221 ALA ALA A . n 
A 1 18  TYR 18  222 222 TYR TYR A . n 
A 1 19  LEU 19  223 223 LEU LEU A . n 
A 1 20  LYS 20  224 224 LYS LYS A . n 
A 1 21  ASN 21  225 225 ASN ASN A . n 
A 1 22  PHE 22  226 226 PHE PHE A . n 
A 1 23  ASN 23  227 227 ASN ASN A . n 
A 1 24  MET 24  228 228 MET MET A . n 
A 1 25  THR 25  229 229 THR THR A . n 
A 1 26  LYS 26  230 230 LYS LYS A . n 
A 1 27  LYS 27  231 231 LYS LYS A . n 
A 1 28  LYS 28  232 232 LYS LYS A . n 
A 1 29  ALA 29  233 233 ALA ALA A . n 
A 1 30  ARG 30  234 234 ARG ARG A . n 
A 1 31  SER 31  235 235 SER SER A . n 
A 1 32  ILE 32  236 236 ILE ILE A . n 
A 1 33  LEU 33  237 237 LEU LEU A . n 
A 1 34  THR 34  238 238 THR THR A . n 
A 1 35  GLY 35  239 239 GLY GLY A . n 
A 1 36  LYS 36  240 240 LYS GLY A . n 
A 1 37  ALA 37  241 241 ALA GLY A . n 
A 1 38  SER 38  242 242 SER GLY A . n 
A 1 39  HIS 39  243 243 HIS HIS A . n 
A 1 40  THR 40  244 244 THR THR A . n 
A 1 41  ALA 41  245 245 ALA ALA A . n 
A 1 42  PRO 42  246 246 PRO PRO A . n 
A 1 43  PHE 43  247 247 PHE PHE A . n 
A 1 44  VAL 44  248 248 VAL VAL A . n 
A 1 45  ILE 45  249 249 ILE ILE A . n 
A 1 46  HIS 46  250 250 HIS HIS A . n 
A 1 47  ASP 47  251 251 ASP ASP A . n 
A 1 48  ILE 48  252 252 ILE ILE A . n 
A 1 49  GLU 49  253 253 GLU GLU A . n 
A 1 50  THR 50  254 254 THR THR A . n 
A 1 51  LEU 51  255 255 LEU LEU A . n 
A 1 52  TRP 52  256 256 TRP TRP A . n 
A 1 53  GLN 53  257 257 GLN GLN A . n 
A 1 54  ALA 54  258 258 ALA ALA A . n 
A 1 55  GLU 55  259 259 GLU GLU A . n 
A 1 56  LYS 56  260 260 LYS LYS A . n 
A 1 57  GLY 57  261 261 GLY GLY A . n 
A 1 58  LEU 58  262 262 LEU LEU A . n 
A 1 59  VAL 59  263 263 VAL VAL A . n 
A 1 60  TRP 60  264 264 TRP TRP A . n 
A 1 61  LYS 61  265 265 LYS LYS A . n 
A 1 62  GLN 62  266 ?   ?   ?   A . n 
A 1 63  LEU 63  267 ?   ?   ?   A . n 
A 1 64  VAL 64  268 ?   ?   ?   A . n 
A 1 65  ASN 65  269 ?   ?   ?   A . n 
A 1 66  GLY 66  270 ?   ?   ?   A . n 
A 1 67  LEU 67  271 271 LEU LEU A . n 
A 1 68  PRO 68  272 272 PRO PRO A . n 
A 1 69  PRO 69  273 273 PRO PRO A . n 
A 1 70  TYR 70  274 274 TYR TYR A . n 
A 1 71  LYS 71  275 275 LYS LYS A . n 
A 1 72  GLU 72  276 276 GLU GLU A . n 
A 1 73  ILE 73  277 277 ILE ILE A . n 
A 1 74  SER 74  278 278 SER SER A . n 
A 1 75  VAL 75  279 279 VAL VAL A . n 
A 1 76  HIS 76  280 280 HIS HIS A . n 
A 1 77  VAL 77  281 281 VAL VAL A . n 
A 1 78  PHE 78  282 282 PHE PHE A . n 
A 1 79  TYR 79  283 283 TYR TYR A . n 
A 1 80  ARG 80  284 284 ARG ARG A . n 
A 1 81  CYS 81  285 285 CYS CYS A . n 
A 1 82  GLN 82  286 286 GLN GLN A . n 
A 1 83  CYS 83  287 287 CYS CYS A . n 
A 1 84  THR 84  288 288 THR THR A . n 
A 1 85  THR 85  289 289 THR THR A . n 
A 1 86  VAL 86  290 290 VAL VAL A . n 
A 1 87  GLU 87  291 291 GLU GLU A . n 
A 1 88  THR 88  292 292 THR THR A . n 
A 1 89  VAL 89  293 293 VAL VAL A . n 
A 1 90  ARG 90  294 294 ARG ARG A . n 
A 1 91  GLU 91  295 295 GLU GLU A . n 
A 1 92  LEU 92  296 296 LEU LEU A . n 
A 1 93  THR 93  297 297 THR THR A . n 
A 1 94  GLU 94  298 298 GLU GLU A . n 
A 1 95  PHE 95  299 299 PHE PHE A . n 
A 1 96  ALA 96  300 300 ALA ALA A . n 
A 1 97  LYS 97  301 301 LYS LYS A . n 
A 1 98  SER 98  302 302 SER SER A . n 
A 1 99  ILE 99  303 303 ILE ILE A . n 
A 1 100 PRO 100 304 304 PRO PRO A . n 
A 1 101 SER 101 305 305 SER SER A . n 
A 1 102 PHE 102 306 306 PHE PHE A . n 
A 1 103 SER 103 307 307 SER SER A . n 
A 1 104 SER 104 308 308 SER SER A . n 
A 1 105 LEU 105 309 309 LEU LEU A . n 
A 1 106 PHE 106 310 310 PHE PHE A . n 
A 1 107 LEU 107 311 311 LEU LEU A . n 
A 1 108 ASN 108 312 312 ASN ASN A . n 
A 1 109 ASP 109 313 313 ASP ASP A . n 
A 1 110 GLN 110 314 314 GLN GLN A . n 
A 1 111 VAL 111 315 315 VAL VAL A . n 
A 1 112 THR 112 316 316 THR THR A . n 
A 1 113 LEU 113 317 317 LEU LEU A . n 
A 1 114 LEU 114 318 318 LEU LEU A . n 
A 1 115 LYS 115 319 319 LYS LYS A . n 
A 1 116 TYR 116 320 320 TYR TYR A . n 
A 1 117 GLY 117 321 321 GLY GLY A . n 
A 1 118 VAL 118 322 322 VAL VAL A . n 
A 1 119 HIS 119 323 323 HIS HIS A . n 
A 1 120 GLU 120 324 324 GLU GLU A . n 
A 1 121 ALA 121 325 325 ALA ALA A . n 
A 1 122 ILE 122 326 326 ILE ILE A . n 
A 1 123 PHE 123 327 327 PHE PHE A . n 
A 1 124 ALA 124 328 328 ALA ALA A . n 
A 1 125 MET 125 329 329 MET MET A . n 
A 1 126 LEU 126 330 330 LEU LEU A . n 
A 1 127 ALA 127 331 331 ALA ALA A . n 
A 1 128 SER 128 332 332 SER SER A . n 
A 1 129 ILE 129 333 333 ILE ILE A . n 
A 1 130 VAL 130 334 334 VAL VAL A . n 
A 1 131 ASN 131 335 335 ASN ASN A . n 
A 1 132 LYS 132 336 336 LYS LYS A . n 
A 1 133 ASP 133 337 337 ASP ASP A . n 
A 1 134 GLY 134 338 338 GLY GLY A . n 
A 1 135 LEU 135 339 339 LEU LEU A . n 
A 1 136 LEU 136 340 340 LEU LEU A . n 
A 1 137 VAL 137 341 341 VAL VAL A . n 
A 1 138 ALA 138 342 342 ALA ALA A . n 
A 1 139 ASN 139 343 343 ASN ASN A . n 
A 1 140 GLY 140 344 344 GLY GLY A . n 
A 1 141 SER 141 345 345 SER SER A . n 
A 1 142 GLY 142 346 346 GLY GLY A . n 
A 1 143 PHE 143 347 347 PHE PHE A . n 
A 1 144 VAL 144 348 348 VAL VAL A . n 
A 1 145 THR 145 349 349 THR THR A . n 
A 1 146 ARG 146 350 350 ARG ARG A . n 
A 1 147 GLU 147 351 351 GLU GLU A . n 
A 1 148 PHE 148 352 352 PHE PHE A . n 
A 1 149 LEU 149 353 353 LEU LEU A . n 
A 1 150 ARG 150 354 354 ARG ARG A . n 
A 1 151 SER 151 355 355 SER SER A . n 
A 1 152 LEU 152 356 356 LEU LEU A . n 
A 1 153 ARG 153 357 357 ARG ARG A . n 
A 1 154 LYS 154 358 358 LYS LYS A . n 
A 1 155 PRO 155 359 359 PRO PRO A . n 
A 1 156 PHE 156 360 360 PHE PHE A . n 
A 1 157 SER 157 361 361 SER SER A . n 
A 1 158 ASP 158 362 362 ASP ASP A . n 
A 1 159 ILE 159 363 363 ILE ILE A . n 
A 1 160 ILE 160 364 364 ILE ILE A . n 
A 1 161 GLU 161 365 365 GLU GLU A . n 
A 1 162 PRO 162 366 366 PRO PRO A . n 
A 1 163 LYS 163 367 367 LYS LYS A . n 
A 1 164 PHE 164 368 368 PHE PHE A . n 
A 1 165 GLU 165 369 369 GLU GLU A . n 
A 1 166 PHE 166 370 370 PHE PHE A . n 
A 1 167 ALA 167 371 371 ALA ALA A . n 
A 1 168 VAL 168 372 372 VAL VAL A . n 
A 1 169 LYS 169 373 373 LYS LYS A . n 
A 1 170 PHE 170 374 374 PHE PHE A . n 
A 1 171 ASN 171 375 375 ASN ASN A . n 
A 1 172 ALA 172 376 376 ALA ALA A . n 
A 1 173 LEU 173 377 377 LEU LEU A . n 
A 1 174 GLU 174 378 378 GLU GLU A . n 
A 1 175 LEU 175 379 379 LEU LEU A . n 
A 1 176 ASP 176 380 380 ASP ASP A . n 
A 1 177 ASP 177 381 381 ASP ASP A . n 
A 1 178 SER 178 382 382 SER SER A . n 
A 1 179 ASP 179 383 383 ASP ASP A . n 
A 1 180 LEU 180 384 384 LEU LEU A . n 
A 1 181 ALA 181 385 385 ALA ALA A . n 
A 1 182 LEU 182 386 386 LEU LEU A . n 
A 1 183 PHE 183 387 387 PHE PHE A . n 
A 1 184 ILE 184 388 388 ILE ILE A . n 
A 1 185 ALA 185 389 389 ALA ALA A . n 
A 1 186 ALA 186 390 390 ALA ALA A . n 
A 1 187 ILE 187 391 391 ILE ILE A . n 
A 1 188 ILE 188 392 392 ILE ILE A . n 
A 1 189 LEU 189 393 393 LEU LEU A . n 
A 1 190 CYS 190 394 394 CYS CYS A . n 
A 1 191 GLY 191 395 395 GLY GLY A . n 
A 1 192 ASP 192 396 396 ASP ASP A . n 
A 1 193 ARG 193 397 397 ARG ARG A . n 
A 1 194 PRO 194 398 398 PRO PRO A . n 
A 1 195 GLY 195 399 399 GLY GLY A . n 
A 1 196 LEU 196 400 400 LEU LEU A . n 
A 1 197 MET 197 401 401 MET MET A . n 
A 1 198 ASN 198 402 402 ASN ASN A . n 
A 1 199 VAL 199 403 403 VAL VAL A . n 
A 1 200 PRO 200 404 404 PRO PRO A . n 
A 1 201 ARG 201 405 405 ARG ARG A . n 
A 1 202 VAL 202 406 406 VAL VAL A . n 
A 1 203 GLU 203 407 407 GLU GLU A . n 
A 1 204 ALA 204 408 408 ALA ALA A . n 
A 1 205 ILE 205 409 409 ILE ILE A . n 
A 1 206 GLN 206 410 410 GLN GLN A . n 
A 1 207 ASP 207 411 411 ASP ASP A . n 
A 1 208 THR 208 412 412 THR THR A . n 
A 1 209 ILE 209 413 413 ILE ILE A . n 
A 1 210 LEU 210 414 414 LEU LEU A . n 
A 1 211 ARG 211 415 415 ARG ARG A . n 
A 1 212 ALA 212 416 416 ALA ALA A . n 
A 1 213 LEU 213 417 417 LEU LEU A . n 
A 1 214 GLU 214 418 418 GLU GLU A . n 
A 1 215 PHE 215 419 419 PHE PHE A . n 
A 1 216 HIS 216 420 420 HIS HIS A . n 
A 1 217 LEU 217 421 421 LEU LEU A . n 
A 1 218 GLN 218 422 422 GLN GLN A . n 
A 1 219 ALA 219 423 423 ALA ALA A . n 
A 1 220 ASN 220 424 424 ASN ASN A . n 
A 1 221 HIS 221 425 425 HIS HIS A . n 
A 1 222 PRO 222 426 426 PRO PRO A . n 
A 1 223 ASP 223 427 427 ASP ASP A . n 
A 1 224 ALA 224 428 428 ALA ALA A . n 
A 1 225 GLN 225 429 429 GLN ALA A . n 
A 1 226 GLN 226 430 430 GLN GLN A . n 
A 1 227 LEU 227 431 431 LEU LEU A . n 
A 1 228 PHE 228 432 432 PHE PHE A . n 
A 1 229 PRO 229 433 433 PRO PRO A . n 
A 1 230 LYS 230 434 434 LYS LYS A . n 
A 1 231 LEU 231 435 435 LEU LEU A . n 
A 1 232 LEU 232 436 436 LEU LEU A . n 
A 1 233 GLN 233 437 437 GLN GLN A . n 
A 1 234 LYS 234 438 438 LYS LYS A . n 
A 1 235 MET 235 439 439 MET MET A . n 
A 1 236 ALA 236 440 440 ALA ALA A . n 
A 1 237 ASP 237 441 441 ASP ASP A . n 
A 1 238 LEU 238 442 442 LEU LEU A . n 
A 1 239 ARG 239 443 443 ARG ARG A . n 
A 1 240 GLN 240 444 444 GLN GLN A . n 
A 1 241 LEU 241 445 445 LEU LEU A . n 
A 1 242 VAL 242 446 446 VAL VAL A . n 
A 1 243 THR 243 447 447 THR THR A . n 
A 1 244 GLU 244 448 448 GLU GLU A . n 
A 1 245 HIS 245 449 449 HIS HIS A . n 
A 1 246 ALA 246 450 450 ALA ALA A . n 
A 1 247 GLN 247 451 451 GLN GLN A . n 
A 1 248 MET 248 452 452 MET MET A . n 
A 1 249 MET 249 453 453 MET MET A . n 
A 1 250 GLN 250 454 454 GLN GLN A . n 
A 1 251 ARG 251 455 455 ARG ARG A . n 
A 1 252 ILE 252 456 456 ILE ILE A . n 
A 1 253 LYS 253 457 457 LYS LYS A . n 
A 1 254 LYS 254 458 458 LYS LYS A . n 
A 1 255 THR 255 459 459 THR THR A . n 
A 1 256 GLU 256 460 460 GLU GLU A . n 
A 1 257 THR 257 461 461 THR THR A . n 
A 1 258 GLU 258 462 462 GLU ALA A . n 
A 1 259 THR 259 463 463 THR THR A . n 
A 1 260 SER 260 464 464 SER SER A . n 
A 1 261 LEU 261 465 465 LEU LEU A . n 
A 1 262 HIS 262 466 466 HIS HIS A . n 
A 1 263 PRO 263 467 467 PRO PRO A . n 
A 1 264 LEU 264 468 468 LEU LEU A . n 
A 1 265 LEU 265 469 469 LEU LEU A . n 
A 1 266 GLN 266 470 470 GLN GLN A . n 
A 1 267 GLU 267 471 471 GLU GLU A . n 
A 1 268 ILE 268 472 472 ILE ILE A . n 
A 1 269 TYR 269 473 473 TYR TYR A . n 
A 1 270 LYS 270 474 474 LYS LYS A . n 
A 1 271 ASP 271 475 475 ASP ASP A . n 
A 1 272 MET 272 476 476 MET MET A . n 
B 1 1   ASN 1   205 205 ASN ASN B . n 
B 1 2   PRO 2   206 206 PRO PRO B . n 
B 1 3   GLN 3   207 207 GLN GLN B . n 
B 1 4   VAL 4   208 208 VAL VAL B . n 
B 1 5   ALA 5   209 209 ALA ALA B . n 
B 1 6   ASP 6   210 210 ASP ASP B . n 
B 1 7   LEU 7   211 211 LEU LEU B . n 
B 1 8   LYS 8   212 212 LYS LYS B . n 
B 1 9   ALA 9   213 213 ALA ALA B . n 
B 1 10  PHE 10  214 214 PHE PHE B . n 
B 1 11  SER 11  215 215 SER SER B . n 
B 1 12  LYS 12  216 216 LYS LYS B . n 
B 1 13  HIS 13  217 217 HIS HIS B . n 
B 1 14  ILE 14  218 218 ILE ILE B . n 
B 1 15  TYR 15  219 219 TYR TYR B . n 
B 1 16  ASN 16  220 220 ASN ASN B . n 
B 1 17  ALA 17  221 221 ALA ALA B . n 
B 1 18  TYR 18  222 222 TYR TYR B . n 
B 1 19  LEU 19  223 223 LEU LEU B . n 
B 1 20  LYS 20  224 224 LYS LYS B . n 
B 1 21  ASN 21  225 225 ASN ASN B . n 
B 1 22  PHE 22  226 226 PHE PHE B . n 
B 1 23  ASN 23  227 227 ASN ASN B . n 
B 1 24  MET 24  228 228 MET MET B . n 
B 1 25  THR 25  229 229 THR THR B . n 
B 1 26  LYS 26  230 230 LYS LYS B . n 
B 1 27  LYS 27  231 231 LYS LYS B . n 
B 1 28  LYS 28  232 232 LYS LYS B . n 
B 1 29  ALA 29  233 233 ALA ALA B . n 
B 1 30  ARG 30  234 234 ARG ARG B . n 
B 1 31  SER 31  235 235 SER SER B . n 
B 1 32  ILE 32  236 236 ILE ILE B . n 
B 1 33  LEU 33  237 237 LEU LEU B . n 
B 1 34  THR 34  238 238 THR THR B . n 
B 1 35  GLY 35  239 239 GLY GLY B . n 
B 1 36  LYS 36  240 ?   ?   ?   B . n 
B 1 37  ALA 37  241 ?   ?   ?   B . n 
B 1 38  SER 38  242 ?   ?   ?   B . n 
B 1 39  HIS 39  243 243 HIS HIS B . n 
B 1 40  THR 40  244 244 THR THR B . n 
B 1 41  ALA 41  245 245 ALA ALA B . n 
B 1 42  PRO 42  246 246 PRO PRO B . n 
B 1 43  PHE 43  247 247 PHE PHE B . n 
B 1 44  VAL 44  248 248 VAL VAL B . n 
B 1 45  ILE 45  249 249 ILE ILE B . n 
B 1 46  HIS 46  250 250 HIS HIS B . n 
B 1 47  ASP 47  251 251 ASP ASP B . n 
B 1 48  ILE 48  252 252 ILE ILE B . n 
B 1 49  GLU 49  253 253 GLU GLU B . n 
B 1 50  THR 50  254 254 THR THR B . n 
B 1 51  LEU 51  255 255 LEU LEU B . n 
B 1 52  TRP 52  256 256 TRP TRP B . n 
B 1 53  GLN 53  257 257 GLN GLN B . n 
B 1 54  ALA 54  258 258 ALA ALA B . n 
B 1 55  GLU 55  259 259 GLU GLU B . n 
B 1 56  LYS 56  260 260 LYS LYS B . n 
B 1 57  GLY 57  261 261 GLY GLY B . n 
B 1 58  LEU 58  262 262 LEU LEU B . n 
B 1 59  VAL 59  263 263 VAL VAL B . n 
B 1 60  TRP 60  264 264 TRP TRP B . n 
B 1 61  LYS 61  265 265 LYS LYS B . n 
B 1 62  GLN 62  266 ?   ?   ?   B . n 
B 1 63  LEU 63  267 ?   ?   ?   B . n 
B 1 64  VAL 64  268 ?   ?   ?   B . n 
B 1 65  ASN 65  269 ?   ?   ?   B . n 
B 1 66  GLY 66  270 ?   ?   ?   B . n 
B 1 67  LEU 67  271 271 LEU LEU B . n 
B 1 68  PRO 68  272 272 PRO PRO B . n 
B 1 69  PRO 69  273 273 PRO PRO B . n 
B 1 70  TYR 70  274 274 TYR TYR B . n 
B 1 71  LYS 71  275 275 LYS LYS B . n 
B 1 72  GLU 72  276 276 GLU GLU B . n 
B 1 73  ILE 73  277 277 ILE ILE B . n 
B 1 74  SER 74  278 278 SER SER B . n 
B 1 75  VAL 75  279 279 VAL VAL B . n 
B 1 76  HIS 76  280 280 HIS HIS B . n 
B 1 77  VAL 77  281 281 VAL VAL B . n 
B 1 78  PHE 78  282 282 PHE PHE B . n 
B 1 79  TYR 79  283 283 TYR TYR B . n 
B 1 80  ARG 80  284 284 ARG ARG B . n 
B 1 81  CYS 81  285 285 CYS CYS B . n 
B 1 82  GLN 82  286 286 GLN GLN B . n 
B 1 83  CYS 83  287 287 CYS CYS B . n 
B 1 84  THR 84  288 288 THR THR B . n 
B 1 85  THR 85  289 289 THR THR B . n 
B 1 86  VAL 86  290 290 VAL VAL B . n 
B 1 87  GLU 87  291 291 GLU GLU B . n 
B 1 88  THR 88  292 292 THR THR B . n 
B 1 89  VAL 89  293 293 VAL VAL B . n 
B 1 90  ARG 90  294 294 ARG ARG B . n 
B 1 91  GLU 91  295 295 GLU GLU B . n 
B 1 92  LEU 92  296 296 LEU LEU B . n 
B 1 93  THR 93  297 297 THR THR B . n 
B 1 94  GLU 94  298 298 GLU GLU B . n 
B 1 95  PHE 95  299 299 PHE PHE B . n 
B 1 96  ALA 96  300 300 ALA ALA B . n 
B 1 97  LYS 97  301 301 LYS LYS B . n 
B 1 98  SER 98  302 302 SER SER B . n 
B 1 99  ILE 99  303 303 ILE ILE B . n 
B 1 100 PRO 100 304 304 PRO PRO B . n 
B 1 101 SER 101 305 305 SER SER B . n 
B 1 102 PHE 102 306 306 PHE PHE B . n 
B 1 103 SER 103 307 307 SER SER B . n 
B 1 104 SER 104 308 308 SER SER B . n 
B 1 105 LEU 105 309 309 LEU LEU B . n 
B 1 106 PHE 106 310 310 PHE PHE B . n 
B 1 107 LEU 107 311 311 LEU LEU B . n 
B 1 108 ASN 108 312 312 ASN ASN B . n 
B 1 109 ASP 109 313 313 ASP ASP B . n 
B 1 110 GLN 110 314 314 GLN GLN B . n 
B 1 111 VAL 111 315 315 VAL VAL B . n 
B 1 112 THR 112 316 316 THR THR B . n 
B 1 113 LEU 113 317 317 LEU LEU B . n 
B 1 114 LEU 114 318 318 LEU LEU B . n 
B 1 115 LYS 115 319 319 LYS LYS B . n 
B 1 116 TYR 116 320 320 TYR TYR B . n 
B 1 117 GLY 117 321 321 GLY GLY B . n 
B 1 118 VAL 118 322 322 VAL VAL B . n 
B 1 119 HIS 119 323 323 HIS HIS B . n 
B 1 120 GLU 120 324 324 GLU GLU B . n 
B 1 121 ALA 121 325 325 ALA ALA B . n 
B 1 122 ILE 122 326 326 ILE ILE B . n 
B 1 123 PHE 123 327 327 PHE PHE B . n 
B 1 124 ALA 124 328 328 ALA ALA B . n 
B 1 125 MET 125 329 329 MET MET B . n 
B 1 126 LEU 126 330 330 LEU LEU B . n 
B 1 127 ALA 127 331 331 ALA ALA B . n 
B 1 128 SER 128 332 332 SER SER B . n 
B 1 129 ILE 129 333 333 ILE ILE B . n 
B 1 130 VAL 130 334 334 VAL VAL B . n 
B 1 131 ASN 131 335 335 ASN ASN B . n 
B 1 132 LYS 132 336 336 LYS LYS B . n 
B 1 133 ASP 133 337 337 ASP ASP B . n 
B 1 134 GLY 134 338 338 GLY GLY B . n 
B 1 135 LEU 135 339 339 LEU LEU B . n 
B 1 136 LEU 136 340 340 LEU LEU B . n 
B 1 137 VAL 137 341 341 VAL VAL B . n 
B 1 138 ALA 138 342 342 ALA ALA B . n 
B 1 139 ASN 139 343 343 ASN ASN B . n 
B 1 140 GLY 140 344 344 GLY GLY B . n 
B 1 141 SER 141 345 345 SER SER B . n 
B 1 142 GLY 142 346 346 GLY GLY B . n 
B 1 143 PHE 143 347 347 PHE PHE B . n 
B 1 144 VAL 144 348 348 VAL VAL B . n 
B 1 145 THR 145 349 349 THR THR B . n 
B 1 146 ARG 146 350 350 ARG ARG B . n 
B 1 147 GLU 147 351 351 GLU GLU B . n 
B 1 148 PHE 148 352 352 PHE PHE B . n 
B 1 149 LEU 149 353 353 LEU LEU B . n 
B 1 150 ARG 150 354 354 ARG ARG B . n 
B 1 151 SER 151 355 355 SER SER B . n 
B 1 152 LEU 152 356 356 LEU LEU B . n 
B 1 153 ARG 153 357 357 ARG ARG B . n 
B 1 154 LYS 154 358 358 LYS LYS B . n 
B 1 155 PRO 155 359 359 PRO PRO B . n 
B 1 156 PHE 156 360 360 PHE PHE B . n 
B 1 157 SER 157 361 361 SER SER B . n 
B 1 158 ASP 158 362 362 ASP ASP B . n 
B 1 159 ILE 159 363 363 ILE ILE B . n 
B 1 160 ILE 160 364 364 ILE ILE B . n 
B 1 161 GLU 161 365 365 GLU GLU B . n 
B 1 162 PRO 162 366 366 PRO PRO B . n 
B 1 163 LYS 163 367 367 LYS LYS B . n 
B 1 164 PHE 164 368 368 PHE PHE B . n 
B 1 165 GLU 165 369 369 GLU GLU B . n 
B 1 166 PHE 166 370 370 PHE PHE B . n 
B 1 167 ALA 167 371 371 ALA ALA B . n 
B 1 168 VAL 168 372 372 VAL VAL B . n 
B 1 169 LYS 169 373 373 LYS LYS B . n 
B 1 170 PHE 170 374 374 PHE PHE B . n 
B 1 171 ASN 171 375 375 ASN ASN B . n 
B 1 172 ALA 172 376 376 ALA ALA B . n 
B 1 173 LEU 173 377 377 LEU LEU B . n 
B 1 174 GLU 174 378 378 GLU GLU B . n 
B 1 175 LEU 175 379 379 LEU LEU B . n 
B 1 176 ASP 176 380 380 ASP ASP B . n 
B 1 177 ASP 177 381 381 ASP ASP B . n 
B 1 178 SER 178 382 382 SER SER B . n 
B 1 179 ASP 179 383 383 ASP ASP B . n 
B 1 180 LEU 180 384 384 LEU LEU B . n 
B 1 181 ALA 181 385 385 ALA ALA B . n 
B 1 182 LEU 182 386 386 LEU LEU B . n 
B 1 183 PHE 183 387 387 PHE PHE B . n 
B 1 184 ILE 184 388 388 ILE ILE B . n 
B 1 185 ALA 185 389 389 ALA ALA B . n 
B 1 186 ALA 186 390 390 ALA ALA B . n 
B 1 187 ILE 187 391 391 ILE ILE B . n 
B 1 188 ILE 188 392 392 ILE ILE B . n 
B 1 189 LEU 189 393 393 LEU LEU B . n 
B 1 190 CYS 190 394 394 CYS CYS B . n 
B 1 191 GLY 191 395 395 GLY GLY B . n 
B 1 192 ASP 192 396 396 ASP ASP B . n 
B 1 193 ARG 193 397 397 ARG ARG B . n 
B 1 194 PRO 194 398 398 PRO PRO B . n 
B 1 195 GLY 195 399 399 GLY GLY B . n 
B 1 196 LEU 196 400 400 LEU LEU B . n 
B 1 197 MET 197 401 401 MET MET B . n 
B 1 198 ASN 198 402 402 ASN ASN B . n 
B 1 199 VAL 199 403 403 VAL VAL B . n 
B 1 200 PRO 200 404 404 PRO PRO B . n 
B 1 201 ARG 201 405 405 ARG ARG B . n 
B 1 202 VAL 202 406 406 VAL VAL B . n 
B 1 203 GLU 203 407 407 GLU GLU B . n 
B 1 204 ALA 204 408 408 ALA ALA B . n 
B 1 205 ILE 205 409 409 ILE ILE B . n 
B 1 206 GLN 206 410 410 GLN GLN B . n 
B 1 207 ASP 207 411 411 ASP ASP B . n 
B 1 208 THR 208 412 412 THR THR B . n 
B 1 209 ILE 209 413 413 ILE ILE B . n 
B 1 210 LEU 210 414 414 LEU LEU B . n 
B 1 211 ARG 211 415 415 ARG ARG B . n 
B 1 212 ALA 212 416 416 ALA ALA B . n 
B 1 213 LEU 213 417 417 LEU LEU B . n 
B 1 214 GLU 214 418 418 GLU GLU B . n 
B 1 215 PHE 215 419 419 PHE PHE B . n 
B 1 216 HIS 216 420 420 HIS HIS B . n 
B 1 217 LEU 217 421 421 LEU LEU B . n 
B 1 218 GLN 218 422 422 GLN GLN B . n 
B 1 219 ALA 219 423 423 ALA ALA B . n 
B 1 220 ASN 220 424 424 ASN ASN B . n 
B 1 221 HIS 221 425 425 HIS HIS B . n 
B 1 222 PRO 222 426 426 PRO PRO B . n 
B 1 223 ASP 223 427 427 ASP ASP B . n 
B 1 224 ALA 224 428 428 ALA ALA B . n 
B 1 225 GLN 225 429 429 GLN ALA B . n 
B 1 226 GLN 226 430 430 GLN GLN B . n 
B 1 227 LEU 227 431 431 LEU LEU B . n 
B 1 228 PHE 228 432 432 PHE PHE B . n 
B 1 229 PRO 229 433 433 PRO PRO B . n 
B 1 230 LYS 230 434 434 LYS LYS B . n 
B 1 231 LEU 231 435 435 LEU LEU B . n 
B 1 232 LEU 232 436 436 LEU LEU B . n 
B 1 233 GLN 233 437 437 GLN GLN B . n 
B 1 234 LYS 234 438 438 LYS LYS B . n 
B 1 235 MET 235 439 439 MET MET B . n 
B 1 236 ALA 236 440 440 ALA ALA B . n 
B 1 237 ASP 237 441 441 ASP ASP B . n 
B 1 238 LEU 238 442 442 LEU LEU B . n 
B 1 239 ARG 239 443 443 ARG ARG B . n 
B 1 240 GLN 240 444 444 GLN GLN B . n 
B 1 241 LEU 241 445 445 LEU LEU B . n 
B 1 242 VAL 242 446 446 VAL VAL B . n 
B 1 243 THR 243 447 447 THR THR B . n 
B 1 244 GLU 244 448 448 GLU GLU B . n 
B 1 245 HIS 245 449 449 HIS HIS B . n 
B 1 246 ALA 246 450 450 ALA ALA B . n 
B 1 247 GLN 247 451 451 GLN GLN B . n 
B 1 248 MET 248 452 452 MET MET B . n 
B 1 249 MET 249 453 453 MET MET B . n 
B 1 250 GLN 250 454 454 GLN GLN B . n 
B 1 251 ARG 251 455 455 ARG ARG B . n 
B 1 252 ILE 252 456 456 ILE ILE B . n 
B 1 253 LYS 253 457 457 LYS LYS B . n 
B 1 254 LYS 254 458 458 LYS LYS B . n 
B 1 255 THR 255 459 459 THR THR B . n 
B 1 256 GLU 256 460 460 GLU GLU B . n 
B 1 257 THR 257 461 461 THR THR B . n 
B 1 258 GLU 258 462 462 GLU ALA B . n 
B 1 259 THR 259 463 463 THR THR B . n 
B 1 260 SER 260 464 464 SER SER B . n 
B 1 261 LEU 261 465 465 LEU LEU B . n 
B 1 262 HIS 262 466 466 HIS HIS B . n 
B 1 263 PRO 263 467 467 PRO PRO B . n 
B 1 264 LEU 264 468 468 LEU LEU B . n 
B 1 265 LEU 265 469 469 LEU LEU B . n 
B 1 266 GLN 266 470 470 GLN GLU B . n 
B 1 267 GLU 267 471 471 GLU GLU B . n 
B 1 268 ILE 268 472 472 ILE ILE B . n 
B 1 269 TYR 269 473 473 TYR TYR B . n 
B 1 270 LYS 270 474 474 LYS LYS B . n 
B 1 271 ASP 271 475 475 ASP ASP B . n 
B 1 272 MET 272 476 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,I 
2 1 B,G,H,J     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OE2 ? A GLU 203 ? A GLU 407  ? 1_555 CA ? C CA . ? A CA 1303 ? 1_555 OE1 ? A GLN 206 ? A GLN 410  ? 1_555 90.0  ? 
2 O   ? J HOH .   ? B HOH 2428 ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 O   ? J HOH .   ? B HOH 2578 ? 1_555 155.6 ? 
3 O   ? J HOH .   ? B HOH 2428 ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 OE2 ? B GLU 203 ? B GLU 407  ? 1_555 76.2  ? 
4 O   ? J HOH .   ? B HOH 2578 ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 OE2 ? B GLU 203 ? B GLU 407  ? 1_555 79.6  ? 
5 O   ? J HOH .   ? B HOH 2428 ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 OE1 ? B GLN 206 ? B GLN 410  ? 1_555 90.6  ? 
6 O   ? J HOH .   ? B HOH 2578 ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 OE1 ? B GLN 206 ? B GLN 410  ? 1_555 91.4  ? 
7 OE2 ? B GLU 203 ? B GLU 407  ? 1_555 CA ? G CA . ? B CA 2303 ? 1_555 OE1 ? B GLN 206 ? B GLN 410  ? 1_555 87.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-14 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0005  ?               program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran ? 1 
PDB_EXTRACT 1.700     'May. 30, 2005' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++     ? 2 
CCP4        '(SCALA)' ?               ?       ?                 ?                        'data scaling'    ? ?       ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 2397 ? ? O B HOH 2609 ? ? 2.10 
2 1 CG2 B ILE 363  ? ? O B HOH 2545 ? ? 2.11 
3 1 OD1 B ASP 383  ? ? O B HOH 2417 ? ? 2.15 
4 1 O   B GLN 451  ? ? O B HOH 2376 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CD A PRO 359  ? ? 1_555 O B HOH 2481 ? ? 2_656 1.83 
2 1 O  A HOH 1351 ? ? 1_555 O B HOH 2459 ? ? 2_656 1.83 
3 1 CD B PRO 359  ? ? 1_555 O B HOH 2368 ? ? 1_655 1.84 
4 1 O  A HOH 1436 ? ? 1_555 O B HOH 2343 ? ? 2_656 1.93 
5 1 O  A HOH 1340 ? ? 1_555 O B HOH 2599 ? ? 2_656 2.03 
6 1 N  A LEU 211  ? ? 1_555 O B HOH 2576 ? ? 2_555 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 263 ? ? -131.27 -54.36 
2 1 MET A 401 ? ? -91.01  -61.70 
3 1 GLN A 430 ? ? 85.28   1.65   
4 1 GLU A 460 ? ? -104.96 73.22  
5 1 ASP A 475 ? ? 83.99   -5.48  
6 1 LYS B 260 ? ? -72.28  27.57  
7 1 GLU B 460 ? ? -107.92 67.31  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 240 ? CB  ? A LYS 36  CB  
2  1 Y 1 A LYS 240 ? CG  ? A LYS 36  CG  
3  1 Y 1 A LYS 240 ? CD  ? A LYS 36  CD  
4  1 Y 1 A LYS 240 ? CE  ? A LYS 36  CE  
5  1 Y 1 A LYS 240 ? NZ  ? A LYS 36  NZ  
6  1 Y 1 A ALA 241 ? CB  ? A ALA 37  CB  
7  1 Y 1 A SER 242 ? CB  ? A SER 38  CB  
8  1 Y 1 A SER 242 ? OG  ? A SER 38  OG  
9  1 Y 1 A GLN 429 ? CG  ? A GLN 225 CG  
10 1 Y 1 A GLN 429 ? CD  ? A GLN 225 CD  
11 1 Y 1 A GLN 429 ? OE1 ? A GLN 225 OE1 
12 1 Y 1 A GLN 429 ? NE2 ? A GLN 225 NE2 
13 1 Y 1 A GLU 462 ? CG  ? A GLU 258 CG  
14 1 Y 1 A GLU 462 ? CD  ? A GLU 258 CD  
15 1 Y 1 A GLU 462 ? OE1 ? A GLU 258 OE1 
16 1 Y 1 A GLU 462 ? OE2 ? A GLU 258 OE2 
17 1 Y 1 B GLN 429 ? CG  ? B GLN 225 CG  
18 1 Y 1 B GLN 429 ? CD  ? B GLN 225 CD  
19 1 Y 1 B GLN 429 ? OE1 ? B GLN 225 OE1 
20 1 Y 1 B GLN 429 ? NE2 ? B GLN 225 NE2 
21 1 Y 1 B GLU 462 ? CG  ? B GLU 258 CG  
22 1 Y 1 B GLU 462 ? CD  ? B GLU 258 CD  
23 1 Y 1 B GLU 462 ? OE1 ? B GLU 258 OE1 
24 1 Y 1 B GLU 462 ? OE2 ? B GLU 258 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASN 205 ? A ASN 1   
2  1 Y 1 A PRO 206 ? A PRO 2   
3  1 Y 1 A GLN 207 ? A GLN 3   
4  1 Y 1 A VAL 208 ? A VAL 4   
5  1 Y 1 A ALA 209 ? A ALA 5   
6  1 Y 1 A ASP 210 ? A ASP 6   
7  1 Y 1 A GLN 266 ? A GLN 62  
8  1 Y 1 A LEU 267 ? A LEU 63  
9  1 Y 1 A VAL 268 ? A VAL 64  
10 1 Y 1 A ASN 269 ? A ASN 65  
11 1 Y 1 A GLY 270 ? A GLY 66  
12 1 Y 1 B LYS 240 ? B LYS 36  
13 1 Y 1 B ALA 241 ? B ALA 37  
14 1 Y 1 B SER 242 ? B SER 38  
15 1 Y 1 B GLN 266 ? B GLN 62  
16 1 Y 1 B LEU 267 ? B LEU 63  
17 1 Y 1 B VAL 268 ? B VAL 64  
18 1 Y 1 B ASN 269 ? B ASN 65  
19 1 Y 1 B GLY 270 ? B GLY 66  
20 1 Y 1 B MET 476 ? B MET 272 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                 CA  
3 HEPTYL-BETA-D-GLUCOPYRANOSIDE B7G 
4 'VACCENIC ACID'               VCA 
5 water                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1   1303 303 CA  CA  A . 
D 3 B7G 1   920  920 B7G B7G A . 
E 3 B7G 1   921  921 B7G B7G A . 
F 4 VCA 1   1001 1   VCA DRG A . 
G 2 CA  1   2303 303 CA  CA  B . 
H 4 VCA 1   2001 1   VCA DRG B . 
I 5 HOH 1   1304 5   HOH HOH A . 
I 5 HOH 2   1305 7   HOH HOH A . 
I 5 HOH 3   1306 11  HOH HOH A . 
I 5 HOH 4   1307 13  HOH HOH A . 
I 5 HOH 5   1308 14  HOH HOH A . 
I 5 HOH 6   1309 16  HOH HOH A . 
I 5 HOH 7   1310 17  HOH HOH A . 
I 5 HOH 8   1311 18  HOH HOH A . 
I 5 HOH 9   1312 19  HOH HOH A . 
I 5 HOH 10  1313 22  HOH HOH A . 
I 5 HOH 11  1314 27  HOH HOH A . 
I 5 HOH 12  1315 28  HOH HOH A . 
I 5 HOH 13  1316 30  HOH HOH A . 
I 5 HOH 14  1317 31  HOH HOH A . 
I 5 HOH 15  1318 32  HOH HOH A . 
I 5 HOH 16  1319 33  HOH HOH A . 
I 5 HOH 17  1320 35  HOH HOH A . 
I 5 HOH 18  1321 38  HOH HOH A . 
I 5 HOH 19  1322 39  HOH HOH A . 
I 5 HOH 20  1323 43  HOH HOH A . 
I 5 HOH 21  1324 47  HOH HOH A . 
I 5 HOH 22  1325 48  HOH HOH A . 
I 5 HOH 23  1326 52  HOH HOH A . 
I 5 HOH 24  1327 57  HOH HOH A . 
I 5 HOH 25  1328 59  HOH HOH A . 
I 5 HOH 26  1329 61  HOH HOH A . 
I 5 HOH 27  1330 62  HOH HOH A . 
I 5 HOH 28  1331 64  HOH HOH A . 
I 5 HOH 29  1332 67  HOH HOH A . 
I 5 HOH 30  1333 69  HOH HOH A . 
I 5 HOH 31  1334 71  HOH HOH A . 
I 5 HOH 32  1335 73  HOH HOH A . 
I 5 HOH 33  1336 74  HOH HOH A . 
I 5 HOH 34  1337 75  HOH HOH A . 
I 5 HOH 35  1338 78  HOH HOH A . 
I 5 HOH 36  1339 87  HOH HOH A . 
I 5 HOH 37  1340 88  HOH HOH A . 
I 5 HOH 38  1341 91  HOH HOH A . 
I 5 HOH 39  1342 92  HOH HOH A . 
I 5 HOH 40  1343 94  HOH HOH A . 
I 5 HOH 41  1344 95  HOH HOH A . 
I 5 HOH 42  1345 96  HOH HOH A . 
I 5 HOH 43  1346 97  HOH HOH A . 
I 5 HOH 44  1347 98  HOH HOH A . 
I 5 HOH 45  1348 101 HOH HOH A . 
I 5 HOH 46  1349 110 HOH HOH A . 
I 5 HOH 47  1350 114 HOH HOH A . 
I 5 HOH 48  1351 115 HOH HOH A . 
I 5 HOH 49  1352 116 HOH HOH A . 
I 5 HOH 50  1353 120 HOH HOH A . 
I 5 HOH 51  1354 122 HOH HOH A . 
I 5 HOH 52  1355 130 HOH HOH A . 
I 5 HOH 53  1356 135 HOH HOH A . 
I 5 HOH 54  1357 139 HOH HOH A . 
I 5 HOH 55  1358 144 HOH HOH A . 
I 5 HOH 56  1359 145 HOH HOH A . 
I 5 HOH 57  1360 147 HOH HOH A . 
I 5 HOH 58  1361 148 HOH HOH A . 
I 5 HOH 59  1362 150 HOH HOH A . 
I 5 HOH 60  1363 151 HOH HOH A . 
I 5 HOH 61  1364 153 HOH HOH A . 
I 5 HOH 62  1365 154 HOH HOH A . 
I 5 HOH 63  1366 157 HOH HOH A . 
I 5 HOH 64  1367 159 HOH HOH A . 
I 5 HOH 65  1368 166 HOH HOH A . 
I 5 HOH 66  1369 167 HOH HOH A . 
I 5 HOH 67  1370 168 HOH HOH A . 
I 5 HOH 68  1371 169 HOH HOH A . 
I 5 HOH 69  1372 171 HOH HOH A . 
I 5 HOH 70  1373 173 HOH HOH A . 
I 5 HOH 71  1374 176 HOH HOH A . 
I 5 HOH 72  1375 178 HOH HOH A . 
I 5 HOH 73  1376 179 HOH HOH A . 
I 5 HOH 74  1377 182 HOH HOH A . 
I 5 HOH 75  1378 183 HOH HOH A . 
I 5 HOH 76  1379 185 HOH HOH A . 
I 5 HOH 77  1380 188 HOH HOH A . 
I 5 HOH 78  1381 189 HOH HOH A . 
I 5 HOH 79  1382 194 HOH HOH A . 
I 5 HOH 80  1383 199 HOH HOH A . 
I 5 HOH 81  1384 200 HOH HOH A . 
I 5 HOH 82  1385 201 HOH HOH A . 
I 5 HOH 83  1386 202 HOH HOH A . 
I 5 HOH 84  1387 214 HOH HOH A . 
I 5 HOH 85  1388 216 HOH HOH A . 
I 5 HOH 86  1389 221 HOH HOH A . 
I 5 HOH 87  1390 222 HOH HOH A . 
I 5 HOH 88  1391 225 HOH HOH A . 
I 5 HOH 89  1392 226 HOH HOH A . 
I 5 HOH 90  1393 227 HOH HOH A . 
I 5 HOH 91  1394 229 HOH HOH A . 
I 5 HOH 92  1395 231 HOH HOH A . 
I 5 HOH 93  1396 233 HOH HOH A . 
I 5 HOH 94  1397 235 HOH HOH A . 
I 5 HOH 95  1398 237 HOH HOH A . 
I 5 HOH 96  1399 238 HOH HOH A . 
I 5 HOH 97  1400 239 HOH HOH A . 
I 5 HOH 98  1401 243 HOH HOH A . 
I 5 HOH 99  1402 245 HOH HOH A . 
I 5 HOH 100 1403 246 HOH HOH A . 
I 5 HOH 101 1404 248 HOH HOH A . 
I 5 HOH 102 1405 250 HOH HOH A . 
I 5 HOH 103 1406 253 HOH HOH A . 
I 5 HOH 104 1407 257 HOH HOH A . 
I 5 HOH 105 1408 258 HOH HOH A . 
I 5 HOH 106 1409 259 HOH HOH A . 
I 5 HOH 107 1410 260 HOH HOH A . 
I 5 HOH 108 1411 261 HOH HOH A . 
I 5 HOH 109 1412 266 HOH HOH A . 
I 5 HOH 110 1413 267 HOH HOH A . 
I 5 HOH 111 1414 270 HOH HOH A . 
I 5 HOH 112 1415 271 HOH HOH A . 
I 5 HOH 113 1416 273 HOH HOH A . 
I 5 HOH 114 1417 275 HOH HOH A . 
I 5 HOH 115 1418 276 HOH HOH A . 
I 5 HOH 116 1419 277 HOH HOH A . 
I 5 HOH 117 1420 279 HOH HOH A . 
I 5 HOH 118 1421 280 HOH HOH A . 
I 5 HOH 119 1422 283 HOH HOH A . 
I 5 HOH 120 1423 284 HOH HOH A . 
I 5 HOH 121 1424 287 HOH HOH A . 
I 5 HOH 122 1425 289 HOH HOH A . 
I 5 HOH 123 1426 291 HOH HOH A . 
I 5 HOH 124 1427 294 HOH HOH A . 
I 5 HOH 125 1428 295 HOH HOH A . 
I 5 HOH 126 1429 297 HOH HOH A . 
I 5 HOH 127 1430 298 HOH HOH A . 
I 5 HOH 128 1431 299 HOH HOH A . 
I 5 HOH 129 1432 300 HOH HOH A . 
I 5 HOH 130 1433 301 HOH HOH A . 
I 5 HOH 131 1434 302 HOH HOH A . 
I 5 HOH 132 1435 303 HOH HOH A . 
I 5 HOH 133 1436 307 HOH HOH A . 
I 5 HOH 134 1437 308 HOH HOH A . 
I 5 HOH 135 1438 311 HOH HOH A . 
I 5 HOH 136 1439 312 HOH HOH A . 
I 5 HOH 137 1440 313 HOH HOH A . 
I 5 HOH 138 1441 315 HOH HOH A . 
I 5 HOH 139 1442 319 HOH HOH A . 
I 5 HOH 140 1443 327 HOH HOH A . 
I 5 HOH 141 1444 331 HOH HOH A . 
I 5 HOH 142 1445 332 HOH HOH A . 
I 5 HOH 143 1446 335 HOH HOH A . 
I 5 HOH 144 1447 341 HOH HOH A . 
I 5 HOH 145 1448 343 HOH HOH A . 
I 5 HOH 146 1449 345 HOH HOH A . 
I 5 HOH 147 1450 351 HOH HOH A . 
I 5 HOH 148 1451 352 HOH HOH A . 
I 5 HOH 149 1452 356 HOH HOH A . 
I 5 HOH 150 1453 365 HOH HOH A . 
I 5 HOH 151 1454 366 HOH HOH A . 
I 5 HOH 152 1455 367 HOH HOH A . 
I 5 HOH 153 1456 368 HOH HOH A . 
I 5 HOH 154 1457 370 HOH HOH A . 
I 5 HOH 155 1458 371 HOH HOH A . 
I 5 HOH 156 1459 373 HOH HOH A . 
I 5 HOH 157 1460 374 HOH HOH A . 
I 5 HOH 158 1461 375 HOH HOH A . 
I 5 HOH 159 1462 383 HOH HOH A . 
I 5 HOH 160 1463 385 HOH HOH A . 
I 5 HOH 161 1464 387 HOH HOH A . 
I 5 HOH 162 1465 390 HOH HOH A . 
I 5 HOH 163 1466 391 HOH HOH A . 
I 5 HOH 164 1467 393 HOH HOH A . 
I 5 HOH 165 1468 395 HOH HOH A . 
I 5 HOH 166 1469 396 HOH HOH A . 
I 5 HOH 167 1470 401 HOH HOH A . 
I 5 HOH 168 1471 402 HOH HOH A . 
I 5 HOH 169 1472 404 HOH HOH A . 
I 5 HOH 170 1473 406 HOH HOH A . 
I 5 HOH 171 1474 408 HOH HOH A . 
I 5 HOH 172 1475 413 HOH HOH A . 
I 5 HOH 173 1476 417 HOH HOH A . 
I 5 HOH 174 1477 418 HOH HOH A . 
I 5 HOH 175 1478 419 HOH HOH A . 
I 5 HOH 176 1479 421 HOH HOH A . 
I 5 HOH 177 1480 423 HOH HOH A . 
I 5 HOH 178 1481 425 HOH HOH A . 
I 5 HOH 179 1482 429 HOH HOH A . 
I 5 HOH 180 1483 431 HOH HOH A . 
I 5 HOH 181 1484 434 HOH HOH A . 
I 5 HOH 182 1485 438 HOH HOH A . 
I 5 HOH 183 1486 439 HOH HOH A . 
I 5 HOH 184 1487 444 HOH HOH A . 
I 5 HOH 185 1488 446 HOH HOH A . 
I 5 HOH 186 1489 452 HOH HOH A . 
I 5 HOH 187 1490 455 HOH HOH A . 
I 5 HOH 188 1491 457 HOH HOH A . 
I 5 HOH 189 1492 458 HOH HOH A . 
I 5 HOH 190 1493 466 HOH HOH A . 
I 5 HOH 191 1494 470 HOH HOH A . 
I 5 HOH 192 1495 471 HOH HOH A . 
I 5 HOH 193 1496 472 HOH HOH A . 
I 5 HOH 194 1497 474 HOH HOH A . 
I 5 HOH 195 1498 476 HOH HOH A . 
I 5 HOH 196 1499 478 HOH HOH A . 
I 5 HOH 197 1500 483 HOH HOH A . 
I 5 HOH 198 1501 484 HOH HOH A . 
I 5 HOH 199 1502 485 HOH HOH A . 
I 5 HOH 200 1503 486 HOH HOH A . 
I 5 HOH 201 1504 487 HOH HOH A . 
I 5 HOH 202 1505 488 HOH HOH A . 
I 5 HOH 203 1506 491 HOH HOH A . 
I 5 HOH 204 1507 497 HOH HOH A . 
I 5 HOH 205 1508 500 HOH HOH A . 
I 5 HOH 206 1509 502 HOH HOH A . 
I 5 HOH 207 1510 503 HOH HOH A . 
I 5 HOH 208 1511 504 HOH HOH A . 
I 5 HOH 209 1512 509 HOH HOH A . 
I 5 HOH 210 1513 513 HOH HOH A . 
J 5 HOH 1   2304 1   HOH HOH B . 
J 5 HOH 2   2305 2   HOH HOH B . 
J 5 HOH 3   2306 3   HOH HOH B . 
J 5 HOH 4   2307 4   HOH HOH B . 
J 5 HOH 5   2308 6   HOH HOH B . 
J 5 HOH 6   2309 8   HOH HOH B . 
J 5 HOH 7   2310 9   HOH HOH B . 
J 5 HOH 8   2311 10  HOH HOH B . 
J 5 HOH 9   2312 12  HOH HOH B . 
J 5 HOH 10  2313 15  HOH HOH B . 
J 5 HOH 11  2314 20  HOH HOH B . 
J 5 HOH 12  2315 21  HOH HOH B . 
J 5 HOH 13  2316 23  HOH HOH B . 
J 5 HOH 14  2317 24  HOH HOH B . 
J 5 HOH 15  2318 25  HOH HOH B . 
J 5 HOH 16  2319 26  HOH HOH B . 
J 5 HOH 17  2320 29  HOH HOH B . 
J 5 HOH 18  2321 34  HOH HOH B . 
J 5 HOH 19  2322 36  HOH HOH B . 
J 5 HOH 20  2323 37  HOH HOH B . 
J 5 HOH 21  2324 40  HOH HOH B . 
J 5 HOH 22  2325 41  HOH HOH B . 
J 5 HOH 23  2326 42  HOH HOH B . 
J 5 HOH 24  2327 44  HOH HOH B . 
J 5 HOH 25  2328 45  HOH HOH B . 
J 5 HOH 26  2329 46  HOH HOH B . 
J 5 HOH 27  2330 49  HOH HOH B . 
J 5 HOH 28  2331 50  HOH HOH B . 
J 5 HOH 29  2332 51  HOH HOH B . 
J 5 HOH 30  2333 53  HOH HOH B . 
J 5 HOH 31  2334 54  HOH HOH B . 
J 5 HOH 32  2335 55  HOH HOH B . 
J 5 HOH 33  2336 56  HOH HOH B . 
J 5 HOH 34  2337 58  HOH HOH B . 
J 5 HOH 35  2338 60  HOH HOH B . 
J 5 HOH 36  2339 63  HOH HOH B . 
J 5 HOH 37  2340 65  HOH HOH B . 
J 5 HOH 38  2341 66  HOH HOH B . 
J 5 HOH 39  2342 68  HOH HOH B . 
J 5 HOH 40  2343 70  HOH HOH B . 
J 5 HOH 41  2344 72  HOH HOH B . 
J 5 HOH 42  2345 76  HOH HOH B . 
J 5 HOH 43  2346 77  HOH HOH B . 
J 5 HOH 44  2347 79  HOH HOH B . 
J 5 HOH 45  2348 80  HOH HOH B . 
J 5 HOH 46  2349 81  HOH HOH B . 
J 5 HOH 47  2350 82  HOH HOH B . 
J 5 HOH 48  2351 83  HOH HOH B . 
J 5 HOH 49  2352 84  HOH HOH B . 
J 5 HOH 50  2353 85  HOH HOH B . 
J 5 HOH 51  2354 86  HOH HOH B . 
J 5 HOH 52  2355 89  HOH HOH B . 
J 5 HOH 53  2356 90  HOH HOH B . 
J 5 HOH 54  2357 93  HOH HOH B . 
J 5 HOH 55  2358 99  HOH HOH B . 
J 5 HOH 56  2359 100 HOH HOH B . 
J 5 HOH 57  2360 102 HOH HOH B . 
J 5 HOH 58  2361 103 HOH HOH B . 
J 5 HOH 59  2362 104 HOH HOH B . 
J 5 HOH 60  2363 105 HOH HOH B . 
J 5 HOH 61  2364 106 HOH HOH B . 
J 5 HOH 62  2365 107 HOH HOH B . 
J 5 HOH 63  2366 108 HOH HOH B . 
J 5 HOH 64  2367 109 HOH HOH B . 
J 5 HOH 65  2368 111 HOH HOH B . 
J 5 HOH 66  2369 112 HOH HOH B . 
J 5 HOH 67  2370 113 HOH HOH B . 
J 5 HOH 68  2371 117 HOH HOH B . 
J 5 HOH 69  2372 118 HOH HOH B . 
J 5 HOH 70  2373 119 HOH HOH B . 
J 5 HOH 71  2374 121 HOH HOH B . 
J 5 HOH 72  2375 123 HOH HOH B . 
J 5 HOH 73  2376 124 HOH HOH B . 
J 5 HOH 74  2377 125 HOH HOH B . 
J 5 HOH 75  2378 126 HOH HOH B . 
J 5 HOH 76  2379 127 HOH HOH B . 
J 5 HOH 77  2380 128 HOH HOH B . 
J 5 HOH 78  2381 129 HOH HOH B . 
J 5 HOH 79  2382 131 HOH HOH B . 
J 5 HOH 80  2383 132 HOH HOH B . 
J 5 HOH 81  2384 133 HOH HOH B . 
J 5 HOH 82  2385 134 HOH HOH B . 
J 5 HOH 83  2386 136 HOH HOH B . 
J 5 HOH 84  2387 137 HOH HOH B . 
J 5 HOH 85  2388 138 HOH HOH B . 
J 5 HOH 86  2389 140 HOH HOH B . 
J 5 HOH 87  2390 141 HOH HOH B . 
J 5 HOH 88  2391 142 HOH HOH B . 
J 5 HOH 89  2392 143 HOH HOH B . 
J 5 HOH 90  2393 146 HOH HOH B . 
J 5 HOH 91  2394 149 HOH HOH B . 
J 5 HOH 92  2395 152 HOH HOH B . 
J 5 HOH 93  2396 155 HOH HOH B . 
J 5 HOH 94  2397 156 HOH HOH B . 
J 5 HOH 95  2398 158 HOH HOH B . 
J 5 HOH 96  2399 160 HOH HOH B . 
J 5 HOH 97  2400 161 HOH HOH B . 
J 5 HOH 98  2401 162 HOH HOH B . 
J 5 HOH 99  2402 163 HOH HOH B . 
J 5 HOH 100 2403 164 HOH HOH B . 
J 5 HOH 101 2404 165 HOH HOH B . 
J 5 HOH 102 2405 170 HOH HOH B . 
J 5 HOH 103 2406 172 HOH HOH B . 
J 5 HOH 104 2407 174 HOH HOH B . 
J 5 HOH 105 2408 175 HOH HOH B . 
J 5 HOH 106 2409 177 HOH HOH B . 
J 5 HOH 107 2410 180 HOH HOH B . 
J 5 HOH 108 2411 181 HOH HOH B . 
J 5 HOH 109 2412 184 HOH HOH B . 
J 5 HOH 110 2413 186 HOH HOH B . 
J 5 HOH 111 2414 187 HOH HOH B . 
J 5 HOH 112 2415 190 HOH HOH B . 
J 5 HOH 113 2416 191 HOH HOH B . 
J 5 HOH 114 2417 192 HOH HOH B . 
J 5 HOH 115 2418 193 HOH HOH B . 
J 5 HOH 116 2419 195 HOH HOH B . 
J 5 HOH 117 2420 196 HOH HOH B . 
J 5 HOH 118 2421 197 HOH HOH B . 
J 5 HOH 119 2422 198 HOH HOH B . 
J 5 HOH 120 2423 203 HOH HOH B . 
J 5 HOH 121 2424 204 HOH HOH B . 
J 5 HOH 122 2425 205 HOH HOH B . 
J 5 HOH 123 2426 206 HOH HOH B . 
J 5 HOH 124 2427 207 HOH HOH B . 
J 5 HOH 125 2428 208 HOH HOH B . 
J 5 HOH 126 2429 209 HOH HOH B . 
J 5 HOH 127 2430 210 HOH HOH B . 
J 5 HOH 128 2431 211 HOH HOH B . 
J 5 HOH 129 2432 212 HOH HOH B . 
J 5 HOH 130 2433 213 HOH HOH B . 
J 5 HOH 131 2434 215 HOH HOH B . 
J 5 HOH 132 2435 217 HOH HOH B . 
J 5 HOH 133 2436 218 HOH HOH B . 
J 5 HOH 134 2437 219 HOH HOH B . 
J 5 HOH 135 2438 220 HOH HOH B . 
J 5 HOH 136 2439 223 HOH HOH B . 
J 5 HOH 137 2440 224 HOH HOH B . 
J 5 HOH 138 2441 228 HOH HOH B . 
J 5 HOH 139 2442 230 HOH HOH B . 
J 5 HOH 140 2443 232 HOH HOH B . 
J 5 HOH 141 2444 234 HOH HOH B . 
J 5 HOH 142 2445 236 HOH HOH B . 
J 5 HOH 143 2446 240 HOH HOH B . 
J 5 HOH 144 2447 241 HOH HOH B . 
J 5 HOH 145 2448 242 HOH HOH B . 
J 5 HOH 146 2449 244 HOH HOH B . 
J 5 HOH 147 2450 247 HOH HOH B . 
J 5 HOH 148 2451 249 HOH HOH B . 
J 5 HOH 149 2452 251 HOH HOH B . 
J 5 HOH 150 2453 252 HOH HOH B . 
J 5 HOH 151 2454 254 HOH HOH B . 
J 5 HOH 152 2455 255 HOH HOH B . 
J 5 HOH 153 2456 256 HOH HOH B . 
J 5 HOH 154 2457 262 HOH HOH B . 
J 5 HOH 155 2458 263 HOH HOH B . 
J 5 HOH 156 2459 264 HOH HOH B . 
J 5 HOH 157 2460 265 HOH HOH B . 
J 5 HOH 158 2461 268 HOH HOH B . 
J 5 HOH 159 2462 269 HOH HOH B . 
J 5 HOH 160 2463 272 HOH HOH B . 
J 5 HOH 161 2464 274 HOH HOH B . 
J 5 HOH 162 2465 278 HOH HOH B . 
J 5 HOH 163 2466 281 HOH HOH B . 
J 5 HOH 164 2467 282 HOH HOH B . 
J 5 HOH 165 2468 285 HOH HOH B . 
J 5 HOH 166 2469 286 HOH HOH B . 
J 5 HOH 167 2470 288 HOH HOH B . 
J 5 HOH 168 2471 290 HOH HOH B . 
J 5 HOH 169 2472 292 HOH HOH B . 
J 5 HOH 170 2473 293 HOH HOH B . 
J 5 HOH 171 2474 296 HOH HOH B . 
J 5 HOH 172 2475 304 HOH HOH B . 
J 5 HOH 173 2476 305 HOH HOH B . 
J 5 HOH 174 2477 306 HOH HOH B . 
J 5 HOH 175 2478 309 HOH HOH B . 
J 5 HOH 176 2479 310 HOH HOH B . 
J 5 HOH 177 2480 314 HOH HOH B . 
J 5 HOH 178 2481 316 HOH HOH B . 
J 5 HOH 179 2482 317 HOH HOH B . 
J 5 HOH 180 2483 318 HOH HOH B . 
J 5 HOH 181 2484 320 HOH HOH B . 
J 5 HOH 182 2485 321 HOH HOH B . 
J 5 HOH 183 2486 322 HOH HOH B . 
J 5 HOH 184 2487 323 HOH HOH B . 
J 5 HOH 185 2488 324 HOH HOH B . 
J 5 HOH 186 2489 325 HOH HOH B . 
J 5 HOH 187 2490 326 HOH HOH B . 
J 5 HOH 188 2491 328 HOH HOH B . 
J 5 HOH 189 2492 329 HOH HOH B . 
J 5 HOH 190 2493 330 HOH HOH B . 
J 5 HOH 191 2494 333 HOH HOH B . 
J 5 HOH 192 2495 334 HOH HOH B . 
J 5 HOH 193 2496 336 HOH HOH B . 
J 5 HOH 194 2497 337 HOH HOH B . 
J 5 HOH 195 2498 338 HOH HOH B . 
J 5 HOH 196 2499 339 HOH HOH B . 
J 5 HOH 197 2500 340 HOH HOH B . 
J 5 HOH 198 2501 342 HOH HOH B . 
J 5 HOH 199 2502 344 HOH HOH B . 
J 5 HOH 200 2503 346 HOH HOH B . 
J 5 HOH 201 2504 347 HOH HOH B . 
J 5 HOH 202 2505 348 HOH HOH B . 
J 5 HOH 203 2506 349 HOH HOH B . 
J 5 HOH 204 2507 350 HOH HOH B . 
J 5 HOH 205 2508 353 HOH HOH B . 
J 5 HOH 206 2509 354 HOH HOH B . 
J 5 HOH 207 2510 355 HOH HOH B . 
J 5 HOH 208 2511 357 HOH HOH B . 
J 5 HOH 209 2512 358 HOH HOH B . 
J 5 HOH 210 2513 359 HOH HOH B . 
J 5 HOH 211 2514 360 HOH HOH B . 
J 5 HOH 212 2515 361 HOH HOH B . 
J 5 HOH 213 2516 362 HOH HOH B . 
J 5 HOH 214 2517 363 HOH HOH B . 
J 5 HOH 215 2518 364 HOH HOH B . 
J 5 HOH 216 2519 369 HOH HOH B . 
J 5 HOH 217 2520 372 HOH HOH B . 
J 5 HOH 218 2521 376 HOH HOH B . 
J 5 HOH 219 2522 377 HOH HOH B . 
J 5 HOH 220 2523 378 HOH HOH B . 
J 5 HOH 221 2524 379 HOH HOH B . 
J 5 HOH 222 2525 380 HOH HOH B . 
J 5 HOH 223 2526 381 HOH HOH B . 
J 5 HOH 224 2527 382 HOH HOH B . 
J 5 HOH 225 2528 384 HOH HOH B . 
J 5 HOH 226 2529 386 HOH HOH B . 
J 5 HOH 227 2530 388 HOH HOH B . 
J 5 HOH 228 2531 389 HOH HOH B . 
J 5 HOH 229 2532 392 HOH HOH B . 
J 5 HOH 230 2533 394 HOH HOH B . 
J 5 HOH 231 2534 397 HOH HOH B . 
J 5 HOH 232 2535 398 HOH HOH B . 
J 5 HOH 233 2536 399 HOH HOH B . 
J 5 HOH 234 2537 400 HOH HOH B . 
J 5 HOH 235 2538 403 HOH HOH B . 
J 5 HOH 236 2539 405 HOH HOH B . 
J 5 HOH 237 2540 407 HOH HOH B . 
J 5 HOH 238 2541 409 HOH HOH B . 
J 5 HOH 239 2542 410 HOH HOH B . 
J 5 HOH 240 2543 411 HOH HOH B . 
J 5 HOH 241 2544 412 HOH HOH B . 
J 5 HOH 242 2545 414 HOH HOH B . 
J 5 HOH 243 2546 415 HOH HOH B . 
J 5 HOH 244 2547 416 HOH HOH B . 
J 5 HOH 245 2548 420 HOH HOH B . 
J 5 HOH 246 2549 422 HOH HOH B . 
J 5 HOH 247 2550 424 HOH HOH B . 
J 5 HOH 248 2551 426 HOH HOH B . 
J 5 HOH 249 2552 427 HOH HOH B . 
J 5 HOH 250 2553 428 HOH HOH B . 
J 5 HOH 251 2554 430 HOH HOH B . 
J 5 HOH 252 2555 432 HOH HOH B . 
J 5 HOH 253 2556 433 HOH HOH B . 
J 5 HOH 254 2557 435 HOH HOH B . 
J 5 HOH 255 2558 436 HOH HOH B . 
J 5 HOH 256 2559 437 HOH HOH B . 
J 5 HOH 257 2560 440 HOH HOH B . 
J 5 HOH 258 2561 441 HOH HOH B . 
J 5 HOH 259 2562 442 HOH HOH B . 
J 5 HOH 260 2563 443 HOH HOH B . 
J 5 HOH 261 2564 445 HOH HOH B . 
J 5 HOH 262 2565 447 HOH HOH B . 
J 5 HOH 263 2566 448 HOH HOH B . 
J 5 HOH 264 2567 449 HOH HOH B . 
J 5 HOH 265 2568 450 HOH HOH B . 
J 5 HOH 266 2569 451 HOH HOH B . 
J 5 HOH 267 2570 453 HOH HOH B . 
J 5 HOH 268 2571 454 HOH HOH B . 
J 5 HOH 269 2572 456 HOH HOH B . 
J 5 HOH 270 2573 459 HOH HOH B . 
J 5 HOH 271 2574 460 HOH HOH B . 
J 5 HOH 272 2575 461 HOH HOH B . 
J 5 HOH 273 2576 462 HOH HOH B . 
J 5 HOH 274 2577 463 HOH HOH B . 
J 5 HOH 275 2578 464 HOH HOH B . 
J 5 HOH 276 2579 465 HOH HOH B . 
J 5 HOH 277 2580 467 HOH HOH B . 
J 5 HOH 278 2581 468 HOH HOH B . 
J 5 HOH 279 2582 469 HOH HOH B . 
J 5 HOH 280 2583 473 HOH HOH B . 
J 5 HOH 281 2584 475 HOH HOH B . 
J 5 HOH 282 2585 477 HOH HOH B . 
J 5 HOH 283 2586 479 HOH HOH B . 
J 5 HOH 284 2587 480 HOH HOH B . 
J 5 HOH 285 2588 481 HOH HOH B . 
J 5 HOH 286 2589 482 HOH HOH B . 
J 5 HOH 287 2590 489 HOH HOH B . 
J 5 HOH 288 2591 490 HOH HOH B . 
J 5 HOH 289 2592 492 HOH HOH B . 
J 5 HOH 290 2593 493 HOH HOH B . 
J 5 HOH 291 2594 494 HOH HOH B . 
J 5 HOH 292 2595 495 HOH HOH B . 
J 5 HOH 293 2596 496 HOH HOH B . 
J 5 HOH 294 2597 498 HOH HOH B . 
J 5 HOH 295 2598 499 HOH HOH B . 
J 5 HOH 296 2599 501 HOH HOH B . 
J 5 HOH 297 2600 505 HOH HOH B . 
J 5 HOH 298 2601 506 HOH HOH B . 
J 5 HOH 299 2602 507 HOH HOH B . 
J 5 HOH 300 2603 508 HOH HOH B . 
J 5 HOH 301 2604 510 HOH HOH B . 
J 5 HOH 302 2605 511 HOH HOH B . 
J 5 HOH 303 2606 512 HOH HOH B . 
J 5 HOH 304 2607 514 HOH HOH B . 
J 5 HOH 305 2608 515 HOH HOH B . 
J 5 HOH 306 2609 516 HOH HOH B . 
J 5 HOH 307 2610 517 HOH HOH B . 
J 5 HOH 308 2611 518 HOH HOH B . 
J 5 HOH 309 2612 519 HOH HOH B . 
#