data_2BAW
# 
_entry.id   2BAW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BAW         
RCSB  RCSB034890   
WWPDB D_1000034890 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AWH 'Similar structure with different crystal form deposited by ourselves.' unspecified   
PDB 2B50 'Similar structure with different crystal form deposited by ourselves.' unspecified   
PDB 2GWX 
;THIS ENTRY 2BAW REFLECTS AN ALTERNATIVE MODELING OF X-RAY
DATA 2GWX.
;
re-refinement 
# 
_pdbx_database_status.entry_id                        2BAW 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fyffe, S.A.'      1 
'Alphey, M.S.'     2 
'Buetow, L.'       3 
'Smith, T.K.'      4 
'Ferguson, M.A.J.' 5 
'Sorensen, M.D.'   6 
'Bjorkling, F.'    7 
'Hunter, W.N.'     8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary         'Reevaluation of the PPAR-beta/delta Ligand Binding Domain Model Reveals Why It Exhibits the Activated Form' 
Mol.Cell 21 1   2   2006 MOCEFL US 1097-2765 2168 ? 16387648 10.1016/j.molcel.2005.12.001 
original_data_1 'Molecular recognition of fatty acids by peroxisome proliferator-activated receptors.'                       
Mol.Cell 3  397 403 1999 MOCEFL US 1097-2765 2168 ? 10198642 ?                            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary         'Fyffe, S.A.'      1  
primary         'Alphey, M.S.'     2  
primary         'Buetow, L.'       3  
primary         'Smith, T.K.'      4  
primary         'Ferguson, M.A.J.' 5  
primary         'Sorensen, M.D.'   6  
primary         'Bjorkling, F.'    7  
primary         'Hunter, W.N.'     8  
original_data_1 'Xu, H.E.'         9  
original_data_1 'Lambert, M.H.'    10 
original_data_1 'Montana, V.G.'    11 
original_data_1 'Parks, D.J.'      12 
original_data_1 'Blanchard, S.G.'  13 
original_data_1 'Brown, P.J.'      14 
original_data_1 'Sternbach, D.D.'  15 
original_data_1 'Lehmann, J.M.'    16 
original_data_1 'Wisely, G.B.'     17 
original_data_1 'Willson, T.M.'    18 
original_data_1 'Kliewer, S.A.'    19 
original_data_1 'Milburn, M.V.'    20 
# 
_cell.length_a           39.770 
_cell.length_b           94.220 
_cell.length_c           96.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.77 
_cell.angle_gamma        90.00 
_cell.entry_id           2BAW 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         2BAW 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peroxisome proliferator activated receptor delta' 30568.590 2   ? ? ? ? 
2 non-polymer syn HEPTYL-BETA-D-GLUCOPYRANOSIDE                      278.342   2   ? ? ? ? 
3 non-polymer syn 'VACCENIC ACID'                                    282.461   2   ? ? ? ? 
4 water       nat water                                              18.015    161 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPAR-delta, PPAR-beta, Nuclear hormone receptor 1, NUC1, NUCI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTV
ETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEF
AVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHA
QMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTV
ETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEF
AVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHA
QMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   LYS n 
1 3   ALA n 
1 4   PHE n 
1 5   SER n 
1 6   LYS n 
1 7   HIS n 
1 8   ILE n 
1 9   TYR n 
1 10  ASN n 
1 11  ALA n 
1 12  TYR n 
1 13  LEU n 
1 14  LYS n 
1 15  ASN n 
1 16  PHE n 
1 17  ASN n 
1 18  MET n 
1 19  THR n 
1 20  LYS n 
1 21  LYS n 
1 22  LYS n 
1 23  ALA n 
1 24  ARG n 
1 25  SER n 
1 26  ILE n 
1 27  LEU n 
1 28  THR n 
1 29  GLY n 
1 30  LYS n 
1 31  ALA n 
1 32  SER n 
1 33  HIS n 
1 34  THR n 
1 35  ALA n 
1 36  PRO n 
1 37  PHE n 
1 38  VAL n 
1 39  ILE n 
1 40  HIS n 
1 41  ASP n 
1 42  ILE n 
1 43  GLU n 
1 44  THR n 
1 45  LEU n 
1 46  TRP n 
1 47  GLN n 
1 48  ALA n 
1 49  GLU n 
1 50  LYS n 
1 51  GLY n 
1 52  LEU n 
1 53  VAL n 
1 54  TRP n 
1 55  LYS n 
1 56  GLN n 
1 57  LEU n 
1 58  VAL n 
1 59  ASN n 
1 60  GLY n 
1 61  LEU n 
1 62  PRO n 
1 63  PRO n 
1 64  TYR n 
1 65  LYS n 
1 66  GLU n 
1 67  ILE n 
1 68  SER n 
1 69  VAL n 
1 70  HIS n 
1 71  VAL n 
1 72  PHE n 
1 73  TYR n 
1 74  ARG n 
1 75  CYS n 
1 76  GLN n 
1 77  CYS n 
1 78  THR n 
1 79  THR n 
1 80  VAL n 
1 81  GLU n 
1 82  THR n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  LEU n 
1 87  THR n 
1 88  GLU n 
1 89  PHE n 
1 90  ALA n 
1 91  LYS n 
1 92  SER n 
1 93  ILE n 
1 94  PRO n 
1 95  SER n 
1 96  PHE n 
1 97  SER n 
1 98  SER n 
1 99  LEU n 
1 100 PHE n 
1 101 LEU n 
1 102 ASN n 
1 103 ASP n 
1 104 GLN n 
1 105 VAL n 
1 106 THR n 
1 107 LEU n 
1 108 LEU n 
1 109 LYS n 
1 110 TYR n 
1 111 GLY n 
1 112 VAL n 
1 113 HIS n 
1 114 GLU n 
1 115 ALA n 
1 116 ILE n 
1 117 PHE n 
1 118 ALA n 
1 119 MET n 
1 120 LEU n 
1 121 ALA n 
1 122 SER n 
1 123 ILE n 
1 124 VAL n 
1 125 ASN n 
1 126 LYS n 
1 127 ASP n 
1 128 GLY n 
1 129 LEU n 
1 130 LEU n 
1 131 VAL n 
1 132 ALA n 
1 133 ASN n 
1 134 GLY n 
1 135 SER n 
1 136 GLY n 
1 137 PHE n 
1 138 VAL n 
1 139 THR n 
1 140 ARG n 
1 141 GLU n 
1 142 PHE n 
1 143 LEU n 
1 144 ARG n 
1 145 SER n 
1 146 LEU n 
1 147 ARG n 
1 148 LYS n 
1 149 PRO n 
1 150 PHE n 
1 151 SER n 
1 152 ASP n 
1 153 ILE n 
1 154 ILE n 
1 155 GLU n 
1 156 PRO n 
1 157 LYS n 
1 158 PHE n 
1 159 GLU n 
1 160 PHE n 
1 161 ALA n 
1 162 VAL n 
1 163 LYS n 
1 164 PHE n 
1 165 ASN n 
1 166 ALA n 
1 167 LEU n 
1 168 GLU n 
1 169 LEU n 
1 170 ASP n 
1 171 ASP n 
1 172 SER n 
1 173 ASP n 
1 174 LEU n 
1 175 ALA n 
1 176 LEU n 
1 177 PHE n 
1 178 ILE n 
1 179 ALA n 
1 180 ALA n 
1 181 ILE n 
1 182 ILE n 
1 183 LEU n 
1 184 CYS n 
1 185 GLY n 
1 186 ASP n 
1 187 ARG n 
1 188 PRO n 
1 189 GLY n 
1 190 LEU n 
1 191 MET n 
1 192 ASN n 
1 193 VAL n 
1 194 PRO n 
1 195 ARG n 
1 196 VAL n 
1 197 GLU n 
1 198 ALA n 
1 199 ILE n 
1 200 GLN n 
1 201 ASP n 
1 202 THR n 
1 203 ILE n 
1 204 LEU n 
1 205 ARG n 
1 206 ALA n 
1 207 LEU n 
1 208 GLU n 
1 209 PHE n 
1 210 HIS n 
1 211 LEU n 
1 212 GLN n 
1 213 ALA n 
1 214 ASN n 
1 215 HIS n 
1 216 PRO n 
1 217 ASP n 
1 218 ALA n 
1 219 GLN n 
1 220 GLN n 
1 221 LEU n 
1 222 PHE n 
1 223 PRO n 
1 224 LYS n 
1 225 LEU n 
1 226 LEU n 
1 227 GLN n 
1 228 LYS n 
1 229 MET n 
1 230 ALA n 
1 231 ASP n 
1 232 LEU n 
1 233 ARG n 
1 234 GLN n 
1 235 LEU n 
1 236 VAL n 
1 237 THR n 
1 238 GLU n 
1 239 HIS n 
1 240 ALA n 
1 241 GLN n 
1 242 MET n 
1 243 MET n 
1 244 GLN n 
1 245 ARG n 
1 246 ILE n 
1 247 LYS n 
1 248 LYS n 
1 249 THR n 
1 250 GLU n 
1 251 THR n 
1 252 GLU n 
1 253 THR n 
1 254 SER n 
1 255 LEU n 
1 256 HIS n 
1 257 PRO n 
1 258 LEU n 
1 259 LEU n 
1 260 GLN n 
1 261 GLU n 
1 262 ILE n 
1 263 TYR n 
1 264 LYS n 
1 265 ASP n 
1 266 MET n 
1 267 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PSETA WITH T7 PROMOTER' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPAS_HUMAN 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTV
ETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEF
AVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHA
QMMQRIKKTETETSLHPLLQEIYKDMY
;
_struct_ref.pdbx_align_begin           175 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BAW A 1 ? 267 ? Q03181 175 ? 441 ? 211 477 
2 1 2BAW B 1 ? 267 ? Q03181 175 ? 441 ? 211 477 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2BAW GLN A 220 ? UNP Q03181 TYR 394 CONFLICT 430 1 
2 2BAW GLN B 220 ? UNP Q03181 TYR 394 CONFLICT 430 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ?                             'C4 H7 N O4'     133.103 
B7G non-polymer         . HEPTYL-BETA-D-GLUCOPYRANOSIDE ?                             'C13 H26 O6'     278.342 
CYS 'L-peptide linking' y CYSTEINE                      ?                             'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ?                             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ?                             'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                    ?                             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ?                             'C5 H11 N O2'    117.146 
VCA non-polymer         . 'VACCENIC ACID'               '(11E)-OCTADEC-11-ENOIC ACID' 'C18 H34 O2'     282.461 
# 
_exptl.crystals_number   ? 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2BAW 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   58.11 
_exptl_crystal.density_Matthews      2.94 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           'AUTHOR USED THE SF DATA FROM ENTRY 2GWX' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             95.780 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    85.400 
_refine.ls_number_reflns_obs                     25545 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;THIS ENTRY REFLECTS AN ALTERNATIVE MODELING OF X-RAY DATA R2GWXSF.
HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
;
_refine.ls_R_factor_all                          0.247 
_refine.ls_R_factor_R_work                       0.245 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1336 
_refine.B_iso_mean                               36.706 
_refine.aniso_B[1][1]                            0.000 
_refine.aniso_B[2][2]                            -0.030 
_refine.aniso_B[3][3]                            0.030 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.030 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.887 
_refine.correlation_coeff_Fo_to_Fc_free          0.871 
_refine.pdbx_overall_ESU_R                       0.422 
_refine.pdbx_overall_ESU_R_Free                  0.277 
_refine.overall_SU_ML                            0.195 
_refine.overall_SU_B                             7.822 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2BAW 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     26881 
_refine.ls_R_factor_obs                          0.245 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3985 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             161 
_refine_hist.number_atoms_total               4224 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        95.780 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4139 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5570 1.227  1.978  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   491  5.525  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   181  36.331 24.033 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   739  17.393 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22   14.615 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           647  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2990 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2073 0.209  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2857 0.302  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    192  0.156  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   34   0.174  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 11   0.216  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2562 0.504  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4011 0.888  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1743 1.163  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1559 1.901  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               68.110 
_refine_ls_shell.number_reflns_R_work             1503 
_refine_ls_shell.R_factor_R_work                  0.222 
_refine_ls_shell.R_factor_R_free                  0.287 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1585 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2BAW 
_struct.title                     'Human Nuclear Receptor-Ligand Complex 1' 
_struct.pdbx_descriptor           'Peroxisome proliferator activated receptor delta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            'Nuclear Receptor, Protein-Ligand Complex, PPAR, TRANSCRIPTION' 
_struct_keywords.entry_id        2BAW 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 1   ? PHE A 16  ? LEU A 211 PHE A 226 1 ? 16 
HELX_P HELX_P2  2  THR A 19  ? LEU A 27  ? THR A 229 LEU A 237 1 ? 9  
HELX_P HELX_P3  3  ASP A 41  ? LEU A 52  ? ASP A 251 LEU A 262 1 ? 12 
HELX_P HELX_P4  4  GLU A 66  ? SER A 92  ? GLU A 276 SER A 302 1 ? 27 
HELX_P HELX_P5  5  ILE A 93  ? LEU A 99  ? ILE A 303 LEU A 309 1 ? 7  
HELX_P HELX_P6  6  PHE A 100 ? ALA A 121 ? PHE A 310 ALA A 331 1 ? 22 
HELX_P HELX_P7  7  ARG A 140 ? SER A 145 ? ARG A 350 SER A 355 1 ? 6  
HELX_P HELX_P8  8  ARG A 147 ? ALA A 166 ? ARG A 357 ALA A 376 1 ? 20 
HELX_P HELX_P9  9  ASP A 170 ? LEU A 183 ? ASP A 380 LEU A 393 1 ? 14 
HELX_P HELX_P10 10 ASN A 192 ? HIS A 215 ? ASN A 402 HIS A 425 1 ? 24 
HELX_P HELX_P11 11 GLN A 220 ? GLU A 250 ? GLN A 430 GLU A 460 1 ? 31 
HELX_P HELX_P12 12 HIS A 256 ? LYS A 264 ? HIS A 466 LYS A 474 1 ? 9  
HELX_P HELX_P13 13 LEU B 1   ? LYS B 14  ? LEU B 211 LYS B 224 1 ? 14 
HELX_P HELX_P14 14 THR B 19  ? ARG B 24  ? THR B 229 ARG B 234 1 ? 6  
HELX_P HELX_P15 15 ASP B 41  ? GLU B 49  ? ASP B 251 GLU B 259 1 ? 9  
HELX_P HELX_P16 16 GLU B 66  ? ILE B 93  ? GLU B 276 ILE B 303 1 ? 28 
HELX_P HELX_P17 17 PHE B 100 ? LEU B 120 ? PHE B 310 LEU B 330 1 ? 21 
HELX_P HELX_P18 18 ARG B 140 ? SER B 145 ? ARG B 350 SER B 355 1 ? 6  
HELX_P HELX_P19 19 PRO B 149 ? ILE B 153 ? PRO B 359 ILE B 363 5 ? 5  
HELX_P HELX_P20 20 ILE B 154 ? ALA B 166 ? ILE B 364 ALA B 376 1 ? 13 
HELX_P HELX_P21 21 ASP B 170 ? LEU B 183 ? ASP B 380 LEU B 393 1 ? 14 
HELX_P HELX_P22 22 ASN B 192 ? HIS B 215 ? ASN B 402 HIS B 425 1 ? 24 
HELX_P HELX_P23 23 GLN B 220 ? GLU B 250 ? GLN B 430 GLU B 460 1 ? 31 
HELX_P HELX_P24 24 HIS B 256 ? LYS B 264 ? HIS B 466 LYS B 474 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 37  ? ILE A 39  ? PHE A 247 ILE A 249 
A 2 GLY A 136 ? THR A 139 ? GLY A 346 THR A 349 
A 3 GLY A 128 ? VAL A 131 ? GLY A 338 VAL A 341 
A 4 VAL A 124 ? ASN A 125 ? VAL A 334 ASN A 335 
B 1 PHE B 37  ? ILE B 39  ? PHE B 247 ILE B 249 
B 2 GLY B 136 ? THR B 139 ? GLY B 346 THR B 349 
B 3 GLY B 128 ? VAL B 131 ? GLY B 338 VAL B 341 
B 4 VAL B 124 ? ASN B 125 ? VAL B 334 ASN B 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 39  ? N ILE A 249 O PHE A 137 ? O PHE A 347 
A 2 3 O VAL A 138 ? O VAL A 348 N LEU A 129 ? N LEU A 339 
A 3 4 O GLY A 128 ? O GLY A 338 N ASN A 125 ? N ASN A 335 
B 1 2 N ILE B 39  ? N ILE B 249 O THR B 139 ? O THR B 349 
B 2 3 O GLY B 136 ? O GLY B 346 N VAL B 131 ? N VAL B 341 
B 3 4 O GLY B 128 ? O GLY B 338 N ASN B 125 ? N ASN B 335 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE B7G A 920' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE B7G A 921' 
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE VCA A 201' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE VCA B 478' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  LEU A 101 ? LEU A 311 . ? 1_555 ? 
2  AC1 9  ASN A 102 ? ASN A 312 . ? 1_555 ? 
3  AC1 9  VAL A 105 ? VAL A 315 . ? 1_555 ? 
4  AC1 9  B7G D .   ? B7G A 921 . ? 1_555 ? 
5  AC1 9  LYS B 109 ? LYS B 319 . ? 1_555 ? 
6  AC1 9  LEU B 258 ? LEU B 468 . ? 1_555 ? 
7  AC1 9  GLU B 261 ? GLU B 471 . ? 1_555 ? 
8  AC1 9  LYS B 264 ? LYS B 474 . ? 1_555 ? 
9  AC1 9  ASP B 265 ? ASP B 475 . ? 1_555 ? 
10 AC2 10 THR A 87  ? THR A 297 . ? 1_555 ? 
11 AC2 10 LYS A 109 ? LYS A 319 . ? 1_555 ? 
12 AC2 10 GLU A 261 ? GLU A 471 . ? 1_555 ? 
13 AC2 10 LYS A 264 ? LYS A 474 . ? 1_555 ? 
14 AC2 10 B7G C .   ? B7G A 920 . ? 1_555 ? 
15 AC2 10 HOH G .   ? HOH A 994 . ? 1_555 ? 
16 AC2 10 PHE B 100 ? PHE B 310 . ? 1_555 ? 
17 AC2 10 LEU B 101 ? LEU B 311 . ? 1_555 ? 
18 AC2 10 ASN B 102 ? ASN B 312 . ? 1_555 ? 
19 AC2 10 THR B 106 ? THR B 316 . ? 1_555 ? 
20 AC3 11 LEU A 45  ? LEU A 255 . ? 1_555 ? 
21 AC3 11 CYS A 75  ? CYS A 285 . ? 1_555 ? 
22 AC3 11 THR A 79  ? THR A 289 . ? 1_555 ? 
23 AC3 11 HIS A 113 ? HIS A 323 . ? 1_555 ? 
24 AC3 11 LEU A 129 ? LEU A 339 . ? 1_555 ? 
25 AC3 11 VAL A 131 ? VAL A 341 . ? 1_555 ? 
26 AC3 11 VAL A 138 ? VAL A 348 . ? 1_555 ? 
27 AC3 11 HIS A 239 ? HIS A 449 . ? 1_555 ? 
28 AC3 11 MET A 243 ? MET A 453 . ? 1_555 ? 
29 AC3 11 LEU A 259 ? LEU A 469 . ? 1_555 ? 
30 AC3 11 TYR A 263 ? TYR A 473 . ? 1_555 ? 
31 AC4 8  CYS B 75  ? CYS B 285 . ? 1_555 ? 
32 AC4 8  THR B 79  ? THR B 289 . ? 1_555 ? 
33 AC4 8  HIS B 113 ? HIS B 323 . ? 1_555 ? 
34 AC4 8  ILE B 154 ? ILE B 364 . ? 1_555 ? 
35 AC4 8  HIS B 239 ? HIS B 449 . ? 1_555 ? 
36 AC4 8  MET B 243 ? MET B 453 . ? 1_555 ? 
37 AC4 8  LEU B 259 ? LEU B 469 . ? 1_555 ? 
38 AC4 8  TYR B 263 ? TYR B 473 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2BAW 
_atom_sites.fract_transf_matrix[1][1]   0.02514 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00343 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01061 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01044 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 1   ? 15.471  -36.299 9.796   1.00 41.75 ? 211  LEU A N   1 
ATOM   2    C CA  . LEU A 1 1   ? 14.352  -37.056 10.433  1.00 41.91 ? 211  LEU A CA  1 
ATOM   3    C C   . LEU A 1 1   ? 14.770  -37.620 11.789  1.00 41.96 ? 211  LEU A C   1 
ATOM   4    O O   . LEU A 1 1   ? 14.137  -37.307 12.802  1.00 41.66 ? 211  LEU A O   1 
ATOM   5    C CB  . LEU A 1 1   ? 13.820  -38.159 9.509   1.00 41.55 ? 211  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 1   ? 12.456  -38.046 8.792   1.00 41.78 ? 211  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 1   ? 11.781  -36.657 8.795   1.00 39.33 ? 211  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 1   ? 12.571  -38.604 7.364   1.00 41.88 ? 211  LEU A CD2 1 
ATOM   9    N N   . LYS A 1 2   ? 15.843  -38.418 11.810  1.00 41.86 ? 212  LYS A N   1 
ATOM   10   C CA  . LYS A 1 2   ? 16.341  -38.987 13.068  1.00 42.04 ? 212  LYS A CA  1 
ATOM   11   C C   . LYS A 1 2   ? 16.912  -37.929 14.011  1.00 41.63 ? 212  LYS A C   1 
ATOM   12   O O   . LYS A 1 2   ? 16.837  -38.079 15.231  1.00 41.88 ? 212  LYS A O   1 
ATOM   13   C CB  . LYS A 1 2   ? 17.330  -40.145 12.836  1.00 42.01 ? 212  LYS A CB  1 
ATOM   14   C CG  . LYS A 1 2   ? 18.744  -39.752 12.405  1.00 42.92 ? 212  LYS A CG  1 
ATOM   15   C CD  . LYS A 1 2   ? 19.767  -40.847 12.726  1.00 43.09 ? 212  LYS A CD  1 
ATOM   16   C CE  . LYS A 1 2   ? 19.543  -42.111 11.889  1.00 45.55 ? 212  LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 2   ? 20.594  -43.142 12.131  1.00 46.70 ? 212  LYS A NZ  1 
ATOM   18   N N   . ALA A 1 3   ? 17.460  -36.855 13.441  1.00 41.14 ? 213  ALA A N   1 
ATOM   19   C CA  . ALA A 1 3   ? 17.912  -35.699 14.223  1.00 40.57 ? 213  ALA A CA  1 
ATOM   20   C C   . ALA A 1 3   ? 16.719  -34.978 14.855  1.00 40.13 ? 213  ALA A C   1 
ATOM   21   O O   . ALA A 1 3   ? 16.781  -34.558 16.008  1.00 39.72 ? 213  ALA A O   1 
ATOM   22   C CB  . ALA A 1 3   ? 18.723  -34.737 13.344  1.00 40.25 ? 213  ALA A CB  1 
ATOM   23   N N   . PHE A 1 4   ? 15.649  -34.834 14.068  1.00 40.00 ? 214  PHE A N   1 
ATOM   24   C CA  . PHE A 1 4   ? 14.375  -34.233 14.486  1.00 39.61 ? 214  PHE A CA  1 
ATOM   25   C C   . PHE A 1 4   ? 13.739  -35.076 15.585  1.00 39.44 ? 214  PHE A C   1 
ATOM   26   O O   . PHE A 1 4   ? 13.108  -34.550 16.514  1.00 39.46 ? 214  PHE A O   1 
ATOM   27   C CB  . PHE A 1 4   ? 13.445  -34.151 13.268  1.00 39.49 ? 214  PHE A CB  1 
ATOM   28   C CG  . PHE A 1 4   ? 12.052  -33.667 13.568  1.00 39.39 ? 214  PHE A CG  1 
ATOM   29   C CD1 . PHE A 1 4   ? 10.978  -34.549 13.532  1.00 39.52 ? 214  PHE A CD1 1 
ATOM   30   C CD2 . PHE A 1 4   ? 11.804  -32.323 13.844  1.00 40.05 ? 214  PHE A CD2 1 
ATOM   31   C CE1 . PHE A 1 4   ? 9.676   -34.105 13.779  1.00 39.45 ? 214  PHE A CE1 1 
ATOM   32   C CE2 . PHE A 1 4   ? 10.505  -31.869 14.101  1.00 39.67 ? 214  PHE A CE2 1 
ATOM   33   C CZ  . PHE A 1 4   ? 9.444   -32.760 14.068  1.00 39.54 ? 214  PHE A CZ  1 
ATOM   34   N N   . SER A 1 5   ? 13.932  -36.385 15.472  1.00 38.98 ? 215  SER A N   1 
ATOM   35   C CA  . SER A 1 5   ? 13.385  -37.342 16.415  1.00 38.89 ? 215  SER A CA  1 
ATOM   36   C C   . SER A 1 5   ? 14.132  -37.332 17.748  1.00 38.45 ? 215  SER A C   1 
ATOM   37   O O   . SER A 1 5   ? 13.522  -37.492 18.806  1.00 38.48 ? 215  SER A O   1 
ATOM   38   C CB  . SER A 1 5   ? 13.410  -38.734 15.802  1.00 38.60 ? 215  SER A CB  1 
ATOM   39   O OG  . SER A 1 5   ? 13.286  -39.700 16.816  1.00 40.18 ? 215  SER A OG  1 
ATOM   40   N N   . LYS A 1 6   ? 15.451  -37.147 17.692  1.00 38.19 ? 216  LYS A N   1 
ATOM   41   C CA  . LYS A 1 6   ? 16.274  -37.026 18.906  1.00 37.58 ? 216  LYS A CA  1 
ATOM   42   C C   . LYS A 1 6   ? 15.963  -35.726 19.654  1.00 36.54 ? 216  LYS A C   1 
ATOM   43   O O   . LYS A 1 6   ? 16.018  -35.683 20.881  1.00 36.75 ? 216  LYS A O   1 
ATOM   44   C CB  . LYS A 1 6   ? 17.772  -37.096 18.571  1.00 37.54 ? 216  LYS A CB  1 
ATOM   45   C CG  . LYS A 1 6   ? 18.692  -37.233 19.802  1.00 38.01 ? 216  LYS A CG  1 
ATOM   46   C CD  . LYS A 1 6   ? 20.155  -36.971 19.464  1.00 38.81 ? 216  LYS A CD  1 
ATOM   47   C CE  . LYS A 1 6   ? 20.512  -35.473 19.494  1.00 41.19 ? 216  LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 6   ? 20.896  -34.989 20.863  1.00 41.72 ? 216  LYS A NZ  1 
ATOM   49   N N   . HIS A 1 7   ? 15.636  -34.676 18.911  1.00 35.17 ? 217  HIS A N   1 
ATOM   50   C CA  . HIS A 1 7   ? 15.274  -33.392 19.503  1.00 34.35 ? 217  HIS A CA  1 
ATOM   51   C C   . HIS A 1 7   ? 13.918  -33.432 20.229  1.00 33.08 ? 217  HIS A C   1 
ATOM   52   O O   . HIS A 1 7   ? 13.725  -32.741 21.228  1.00 32.97 ? 217  HIS A O   1 
ATOM   53   C CB  . HIS A 1 7   ? 15.269  -32.312 18.424  1.00 34.64 ? 217  HIS A CB  1 
ATOM   54   C CG  . HIS A 1 7   ? 15.357  -30.920 18.959  1.00 36.57 ? 217  HIS A CG  1 
ATOM   55   N ND1 . HIS A 1 7   ? 16.423  -30.479 19.717  1.00 39.27 ? 217  HIS A ND1 1 
ATOM   56   C CD2 . HIS A 1 7   ? 14.526  -29.859 18.826  1.00 37.94 ? 217  HIS A CD2 1 
ATOM   57   C CE1 . HIS A 1 7   ? 16.237  -29.210 20.039  1.00 38.89 ? 217  HIS A CE1 1 
ATOM   58   N NE2 . HIS A 1 7   ? 15.094  -28.810 19.509  1.00 38.57 ? 217  HIS A NE2 1 
ATOM   59   N N   . ILE A 1 8   ? 12.985  -34.228 19.714  1.00 31.63 ? 218  ILE A N   1 
ATOM   60   C CA  . ILE A 1 8   ? 11.689  -34.451 20.359  1.00 30.54 ? 218  ILE A CA  1 
ATOM   61   C C   . ILE A 1 8   ? 11.859  -35.287 21.639  1.00 30.06 ? 218  ILE A C   1 
ATOM   62   O O   . ILE A 1 8   ? 11.322  -34.945 22.694  1.00 29.03 ? 218  ILE A O   1 
ATOM   63   C CB  . ILE A 1 8   ? 10.695  -35.107 19.357  1.00 30.78 ? 218  ILE A CB  1 
ATOM   64   C CG1 . ILE A 1 8   ? 10.193  -34.056 18.359  1.00 30.18 ? 218  ILE A CG1 1 
ATOM   65   C CG2 . ILE A 1 8   ? 9.521   -35.811 20.073  1.00 30.15 ? 218  ILE A CG2 1 
ATOM   66   C CD1 . ILE A 1 8   ? 9.522   -34.653 17.129  1.00 30.11 ? 218  ILE A CD1 1 
ATOM   67   N N   . TYR A 1 9   ? 12.628  -36.370 21.523  1.00 29.63 ? 219  TYR A N   1 
ATOM   68   C CA  . TYR A 1 9   ? 13.027  -37.211 22.655  1.00 29.32 ? 219  TYR A CA  1 
ATOM   69   C C   . TYR A 1 9   ? 13.706  -36.430 23.777  1.00 29.24 ? 219  TYR A C   1 
ATOM   70   O O   . TYR A 1 9   ? 13.451  -36.707 24.951  1.00 29.01 ? 219  TYR A O   1 
ATOM   71   C CB  . TYR A 1 9   ? 13.929  -38.356 22.166  1.00 29.25 ? 219  TYR A CB  1 
ATOM   72   C CG  . TYR A 1 9   ? 14.326  -39.411 23.194  1.00 29.22 ? 219  TYR A CG  1 
ATOM   73   C CD1 . TYR A 1 9   ? 13.497  -39.742 24.261  1.00 28.97 ? 219  TYR A CD1 1 
ATOM   74   C CD2 . TYR A 1 9   ? 15.513  -40.124 23.052  1.00 29.23 ? 219  TYR A CD2 1 
ATOM   75   C CE1 . TYR A 1 9   ? 13.864  -40.711 25.175  1.00 28.92 ? 219  TYR A CE1 1 
ATOM   76   C CE2 . TYR A 1 9   ? 15.882  -41.099 23.961  1.00 29.46 ? 219  TYR A CE2 1 
ATOM   77   C CZ  . TYR A 1 9   ? 15.059  -41.385 25.020  1.00 29.22 ? 219  TYR A CZ  1 
ATOM   78   O OH  . TYR A 1 9   ? 15.421  -42.358 25.929  1.00 29.29 ? 219  TYR A OH  1 
ATOM   79   N N   . ASN A 1 10  ? 14.549  -35.451 23.427  1.00 29.05 ? 220  ASN A N   1 
ATOM   80   C CA  . ASN A 1 10  ? 15.220  -34.637 24.453  1.00 28.62 ? 220  ASN A CA  1 
ATOM   81   C C   . ASN A 1 10  ? 14.290  -33.650 25.149  1.00 27.90 ? 220  ASN A C   1 
ATOM   82   O O   . ASN A 1 10  ? 14.434  -33.396 26.345  1.00 27.83 ? 220  ASN A O   1 
ATOM   83   C CB  . ASN A 1 10  ? 16.506  -33.978 23.928  1.00 28.62 ? 220  ASN A CB  1 
ATOM   84   C CG  . ASN A 1 10  ? 17.699  -34.953 23.922  1.00 30.32 ? 220  ASN A CG  1 
ATOM   85   O OD1 . ASN A 1 10  ? 18.644  -34.812 24.713  1.00 33.73 ? 220  ASN A OD1 1 
ATOM   86   N ND2 . ASN A 1 10  ? 17.645  -35.955 23.052  1.00 29.75 ? 220  ASN A ND2 1 
ATOM   87   N N   . ALA A 1 11  ? 13.319  -33.126 24.409  1.00 27.37 ? 221  ALA A N   1 
ATOM   88   C CA  . ALA A 1 11  ? 12.285  -32.252 24.977  1.00 26.90 ? 221  ALA A CA  1 
ATOM   89   C C   . ALA A 1 11  ? 11.411  -33.036 25.972  1.00 26.72 ? 221  ALA A C   1 
ATOM   90   O O   . ALA A 1 11  ? 11.008  -32.511 27.011  1.00 26.56 ? 221  ALA A O   1 
ATOM   91   C CB  . ALA A 1 11  ? 11.424  -31.655 23.860  1.00 26.70 ? 221  ALA A CB  1 
ATOM   92   N N   . TYR A 1 12  ? 11.125  -34.288 25.622  1.00 26.29 ? 222  TYR A N   1 
ATOM   93   C CA  . TYR A 1 12  ? 10.448  -35.260 26.489  1.00 26.75 ? 222  TYR A CA  1 
ATOM   94   C C   . TYR A 1 12  ? 11.250  -35.466 27.773  1.00 27.27 ? 222  TYR A C   1 
ATOM   95   O O   . TYR A 1 12  ? 10.744  -35.242 28.868  1.00 27.21 ? 222  TYR A O   1 
ATOM   96   C CB  . TYR A 1 12  ? 10.316  -36.570 25.709  1.00 26.24 ? 222  TYR A CB  1 
ATOM   97   C CG  . TYR A 1 12  ? 9.666   -37.753 26.381  1.00 25.60 ? 222  TYR A CG  1 
ATOM   98   C CD1 . TYR A 1 12  ? 10.398  -38.598 27.219  1.00 24.76 ? 222  TYR A CD1 1 
ATOM   99   C CD2 . TYR A 1 12  ? 8.339   -38.078 26.110  1.00 24.72 ? 222  TYR A CD2 1 
ATOM   100  C CE1 . TYR A 1 12  ? 9.815   -39.715 27.797  1.00 25.88 ? 222  TYR A CE1 1 
ATOM   101  C CE2 . TYR A 1 12  ? 7.739   -39.191 26.683  1.00 25.15 ? 222  TYR A CE2 1 
ATOM   102  C CZ  . TYR A 1 12  ? 8.478   -40.008 27.523  1.00 25.83 ? 222  TYR A CZ  1 
ATOM   103  O OH  . TYR A 1 12  ? 7.879   -41.107 28.087  1.00 25.31 ? 222  TYR A OH  1 
ATOM   104  N N   . LEU A 1 13  ? 12.513  -35.869 27.623  1.00 27.77 ? 223  LEU A N   1 
ATOM   105  C CA  . LEU A 1 13  ? 13.417  -36.079 28.754  1.00 28.37 ? 223  LEU A CA  1 
ATOM   106  C C   . LEU A 1 13  ? 13.554  -34.873 29.679  1.00 28.67 ? 223  LEU A C   1 
ATOM   107  O O   . LEU A 1 13  ? 13.827  -35.024 30.863  1.00 28.57 ? 223  LEU A O   1 
ATOM   108  C CB  . LEU A 1 13  ? 14.796  -36.482 28.236  1.00 28.44 ? 223  LEU A CB  1 
ATOM   109  C CG  . LEU A 1 13  ? 15.137  -37.972 28.126  1.00 28.85 ? 223  LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 13  ? 13.915  -38.854 27.935  1.00 29.37 ? 223  LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 13  ? 16.159  -38.193 27.021  1.00 28.74 ? 223  LEU A CD2 1 
ATOM   112  N N   . LYS A 1 14  ? 13.364  -33.679 29.129  1.00 29.46 ? 224  LYS A N   1 
ATOM   113  C CA  . LYS A 1 14  ? 13.562  -32.432 29.875  1.00 30.36 ? 224  LYS A CA  1 
ATOM   114  C C   . LYS A 1 14  ? 12.289  -31.968 30.602  1.00 30.59 ? 224  LYS A C   1 
ATOM   115  O O   . LYS A 1 14  ? 12.356  -31.194 31.563  1.00 30.86 ? 224  LYS A O   1 
ATOM   116  C CB  . LYS A 1 14  ? 14.051  -31.350 28.913  1.00 30.36 ? 224  LYS A CB  1 
ATOM   117  C CG  . LYS A 1 14  ? 14.389  -30.010 29.538  1.00 32.70 ? 224  LYS A CG  1 
ATOM   118  C CD  . LYS A 1 14  ? 14.397  -28.920 28.460  1.00 35.81 ? 224  LYS A CD  1 
ATOM   119  C CE  . LYS A 1 14  ? 14.540  -27.524 29.056  1.00 37.07 ? 224  LYS A CE  1 
ATOM   120  N NZ  . LYS A 1 14  ? 14.695  -26.514 27.967  1.00 39.11 ? 224  LYS A NZ  1 
ATOM   121  N N   . ASN A 1 15  ? 11.130  -32.447 30.152  1.00 30.46 ? 225  ASN A N   1 
ATOM   122  C CA  . ASN A 1 15  ? 9.869   -31.868 30.596  1.00 30.13 ? 225  ASN A CA  1 
ATOM   123  C C   . ASN A 1 15  ? 8.968   -32.780 31.427  1.00 30.47 ? 225  ASN A C   1 
ATOM   124  O O   . ASN A 1 15  ? 8.040   -32.301 32.089  1.00 30.34 ? 225  ASN A O   1 
ATOM   125  C CB  . ASN A 1 15  ? 9.113   -31.302 29.391  1.00 29.70 ? 225  ASN A CB  1 
ATOM   126  C CG  . ASN A 1 15  ? 9.647   -29.955 28.954  1.00 29.53 ? 225  ASN A CG  1 
ATOM   127  O OD1 . ASN A 1 15  ? 9.519   -28.968 29.675  1.00 30.32 ? 225  ASN A OD1 1 
ATOM   128  N ND2 . ASN A 1 15  ? 10.251  -29.904 27.774  1.00 28.67 ? 225  ASN A ND2 1 
ATOM   129  N N   . PHE A 1 16  ? 9.226   -34.084 31.387  1.00 30.58 ? 226  PHE A N   1 
ATOM   130  C CA  . PHE A 1 16  ? 8.408   -35.037 32.133  1.00 31.35 ? 226  PHE A CA  1 
ATOM   131  C C   . PHE A 1 16  ? 9.143   -35.592 33.335  1.00 31.96 ? 226  PHE A C   1 
ATOM   132  O O   . PHE A 1 16  ? 10.204  -36.197 33.187  1.00 32.08 ? 226  PHE A O   1 
ATOM   133  C CB  . PHE A 1 16  ? 7.954   -36.189 31.236  1.00 30.55 ? 226  PHE A CB  1 
ATOM   134  C CG  . PHE A 1 16  ? 6.993   -35.776 30.182  1.00 30.33 ? 226  PHE A CG  1 
ATOM   135  C CD1 . PHE A 1 16  ? 5.755   -35.231 30.531  1.00 28.50 ? 226  PHE A CD1 1 
ATOM   136  C CD2 . PHE A 1 16  ? 7.316   -35.922 28.835  1.00 28.48 ? 226  PHE A CD2 1 
ATOM   137  C CE1 . PHE A 1 16  ? 4.867   -34.835 29.563  1.00 27.48 ? 226  PHE A CE1 1 
ATOM   138  C CE2 . PHE A 1 16  ? 6.421   -35.539 27.856  1.00 28.13 ? 226  PHE A CE2 1 
ATOM   139  C CZ  . PHE A 1 16  ? 5.194   -34.986 28.224  1.00 28.94 ? 226  PHE A CZ  1 
ATOM   140  N N   . ASN A 1 17  ? 8.569   -35.408 34.521  1.00 32.93 ? 227  ASN A N   1 
ATOM   141  C CA  . ASN A 1 17  ? 9.212   -35.908 35.738  1.00 34.01 ? 227  ASN A CA  1 
ATOM   142  C C   . ASN A 1 17  ? 9.251   -37.427 35.858  1.00 33.79 ? 227  ASN A C   1 
ATOM   143  O O   . ASN A 1 17  ? 10.193  -37.975 36.422  1.00 33.66 ? 227  ASN A O   1 
ATOM   144  C CB  . ASN A 1 17  ? 8.628   -35.279 36.998  1.00 34.60 ? 227  ASN A CB  1 
ATOM   145  C CG  . ASN A 1 17  ? 9.703   -34.961 38.027  1.00 36.90 ? 227  ASN A CG  1 
ATOM   146  O OD1 . ASN A 1 17  ? 9.838   -33.813 38.469  1.00 40.20 ? 227  ASN A OD1 1 
ATOM   147  N ND2 . ASN A 1 17  ? 10.490  -35.970 38.396  1.00 37.79 ? 227  ASN A ND2 1 
ATOM   148  N N   . MET A 1 18  ? 8.246   -38.100 35.303  1.00 33.84 ? 228  MET A N   1 
ATOM   149  C CA  . MET A 1 18  ? 8.234   -39.559 35.257  1.00 33.84 ? 228  MET A CA  1 
ATOM   150  C C   . MET A 1 18  ? 8.308   -40.111 33.825  1.00 33.94 ? 228  MET A C   1 
ATOM   151  O O   . MET A 1 18  ? 7.489   -39.771 32.965  1.00 33.87 ? 228  MET A O   1 
ATOM   152  C CB  . MET A 1 18  ? 6.989   -40.100 35.972  1.00 33.99 ? 228  MET A CB  1 
ATOM   153  C CG  . MET A 1 18  ? 6.828   -41.620 35.944  1.00 33.48 ? 228  MET A CG  1 
ATOM   154  S SD  . MET A 1 18  ? 8.061   -42.560 36.866  1.00 34.10 ? 228  MET A SD  1 
ATOM   155  C CE  . MET A 1 18  ? 7.852   -41.991 38.550  1.00 33.89 ? 228  MET A CE  1 
ATOM   156  N N   . THR A 1 19  ? 9.286   -40.977 33.583  1.00 33.79 ? 229  THR A N   1 
ATOM   157  C CA  . THR A 1 19  ? 9.385   -41.691 32.305  1.00 33.46 ? 229  THR A CA  1 
ATOM   158  C C   . THR A 1 19  ? 9.050   -43.186 32.456  1.00 33.35 ? 229  THR A C   1 
ATOM   159  O O   . THR A 1 19  ? 8.999   -43.717 33.574  1.00 33.07 ? 229  THR A O   1 
ATOM   160  C CB  . THR A 1 19  ? 10.783  -41.540 31.690  1.00 33.81 ? 229  THR A CB  1 
ATOM   161  O OG1 . THR A 1 19  ? 11.746  -42.219 32.507  1.00 32.30 ? 229  THR A OG1 1 
ATOM   162  C CG2 . THR A 1 19  ? 11.148  -40.044 31.536  1.00 33.03 ? 229  THR A CG2 1 
ATOM   163  N N   . LYS A 1 20  ? 8.803   -43.850 31.332  1.00 32.99 ? 230  LYS A N   1 
ATOM   164  C CA  . LYS A 1 20  ? 8.487   -45.267 31.352  1.00 33.22 ? 230  LYS A CA  1 
ATOM   165  C C   . LYS A 1 20  ? 9.660   -46.077 31.893  1.00 33.97 ? 230  LYS A C   1 
ATOM   166  O O   . LYS A 1 20  ? 9.465   -46.962 32.740  1.00 33.88 ? 230  LYS A O   1 
ATOM   167  C CB  . LYS A 1 20  ? 8.075   -45.785 29.972  1.00 32.48 ? 230  LYS A CB  1 
ATOM   168  C CG  . LYS A 1 20  ? 7.614   -47.229 30.012  1.00 29.66 ? 230  LYS A CG  1 
ATOM   169  C CD  . LYS A 1 20  ? 6.949   -47.691 28.733  1.00 25.55 ? 230  LYS A CD  1 
ATOM   170  C CE  . LYS A 1 20  ? 6.596   -49.158 28.836  1.00 24.27 ? 230  LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 20  ? 6.018   -49.701 27.574  1.00 23.35 ? 230  LYS A NZ  1 
ATOM   172  N N   . LYS A 1 21  ? 10.863  -45.770 31.401  1.00 34.56 ? 231  LYS A N   1 
ATOM   173  C CA  . LYS A 1 21  ? 12.093  -46.365 31.913  1.00 35.56 ? 231  LYS A CA  1 
ATOM   174  C C   . LYS A 1 21  ? 12.036  -46.439 33.445  1.00 36.20 ? 231  LYS A C   1 
ATOM   175  O O   . LYS A 1 21  ? 12.014  -47.533 34.022  1.00 36.17 ? 231  LYS A O   1 
ATOM   176  C CB  . LYS A 1 21  ? 13.307  -45.548 31.464  1.00 35.54 ? 231  LYS A CB  1 
ATOM   177  C CG  . LYS A 1 21  ? 14.653  -46.074 31.963  1.00 35.76 ? 231  LYS A CG  1 
ATOM   178  C CD  . LYS A 1 21  ? 15.400  -46.832 30.876  1.00 37.36 ? 231  LYS A CD  1 
ATOM   179  C CE  . LYS A 1 21  ? 16.905  -46.629 31.034  1.00 38.03 ? 231  LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 21  ? 17.690  -47.331 29.981  1.00 38.33 ? 231  LYS A NZ  1 
ATOM   181  N N   . LYS A 1 22  ? 11.981  -45.272 34.086  1.00 36.86 ? 232  LYS A N   1 
ATOM   182  C CA  . LYS A 1 22  ? 11.917  -45.189 35.538  1.00 38.12 ? 232  LYS A CA  1 
ATOM   183  C C   . LYS A 1 22  ? 10.701  -45.919 36.111  1.00 38.58 ? 232  LYS A C   1 
ATOM   184  O O   . LYS A 1 22  ? 10.831  -46.612 37.119  1.00 38.72 ? 232  LYS A O   1 
ATOM   185  C CB  . LYS A 1 22  ? 11.937  -43.733 36.004  1.00 38.37 ? 232  LYS A CB  1 
ATOM   186  C CG  . LYS A 1 22  ? 12.151  -43.551 37.500  1.00 39.68 ? 232  LYS A CG  1 
ATOM   187  C CD  . LYS A 1 22  ? 12.058  -42.081 37.879  1.00 42.51 ? 232  LYS A CD  1 
ATOM   188  C CE  . LYS A 1 22  ? 11.859  -41.901 39.376  1.00 44.11 ? 232  LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 22  ? 11.791  -40.459 39.730  1.00 45.49 ? 232  LYS A NZ  1 
ATOM   190  N N   . ALA A 1 23  ? 9.537   -45.777 35.470  1.00 38.98 ? 233  ALA A N   1 
ATOM   191  C CA  . ALA A 1 23  ? 8.310   -46.440 35.936  1.00 39.48 ? 233  ALA A CA  1 
ATOM   192  C C   . ALA A 1 23  ? 8.430   -47.964 36.008  1.00 39.93 ? 233  ALA A C   1 
ATOM   193  O O   . ALA A 1 23  ? 7.970   -48.569 36.971  1.00 39.85 ? 233  ALA A O   1 
ATOM   194  C CB  . ALA A 1 23  ? 7.103   -46.036 35.084  1.00 39.36 ? 233  ALA A CB  1 
ATOM   195  N N   . ARG A 1 24  ? 9.060   -48.574 35.004  1.00 40.86 ? 234  ARG A N   1 
ATOM   196  C CA  . ARG A 1 24  ? 9.151   -50.044 34.935  1.00 41.69 ? 234  ARG A CA  1 
ATOM   197  C C   . ARG A 1 24  ? 10.141  -50.596 35.958  1.00 42.28 ? 234  ARG A C   1 
ATOM   198  O O   . ARG A 1 24  ? 9.964   -51.714 36.456  1.00 42.27 ? 234  ARG A O   1 
ATOM   199  C CB  . ARG A 1 24  ? 9.512   -50.562 33.529  1.00 41.52 ? 234  ARG A CB  1 
ATOM   200  C CG  . ARG A 1 24  ? 8.647   -50.083 32.349  1.00 41.97 ? 234  ARG A CG  1 
ATOM   201  C CD  . ARG A 1 24  ? 7.169   -49.866 32.696  1.00 43.70 ? 234  ARG A CD  1 
ATOM   202  N NE  . ARG A 1 24  ? 6.367   -51.089 32.773  1.00 43.59 ? 234  ARG A NE  1 
ATOM   203  C CZ  . ARG A 1 24  ? 5.051   -51.097 32.981  1.00 44.27 ? 234  ARG A CZ  1 
ATOM   204  N NH1 . ARG A 1 24  ? 4.396   -49.952 33.120  1.00 43.41 ? 234  ARG A NH1 1 
ATOM   205  N NH2 . ARG A 1 24  ? 4.377   -52.247 33.039  1.00 44.80 ? 234  ARG A NH2 1 
ATOM   206  N N   . SER A 1 25  ? 11.171  -49.806 36.265  1.00 42.83 ? 235  SER A N   1 
ATOM   207  C CA  . SER A 1 25  ? 12.181  -50.192 37.243  1.00 43.56 ? 235  SER A CA  1 
ATOM   208  C C   . SER A 1 25  ? 11.591  -50.197 38.645  1.00 43.93 ? 235  SER A C   1 
ATOM   209  O O   . SER A 1 25  ? 11.923  -51.058 39.464  1.00 44.37 ? 235  SER A O   1 
ATOM   210  C CB  . SER A 1 25  ? 13.387  -49.258 37.186  1.00 43.32 ? 235  SER A CB  1 
ATOM   211  O OG  . SER A 1 25  ? 13.038  -47.968 37.641  1.00 44.05 ? 235  SER A OG  1 
ATOM   212  N N   . ILE A 1 26  ? 10.718  -49.232 38.917  1.00 44.20 ? 236  ILE A N   1 
ATOM   213  C CA  . ILE A 1 26  ? 10.004  -49.186 40.190  1.00 44.41 ? 236  ILE A CA  1 
ATOM   214  C C   . ILE A 1 26  ? 9.027   -50.362 40.270  1.00 44.97 ? 236  ILE A C   1 
ATOM   215  O O   . ILE A 1 26  ? 9.024   -51.105 41.252  1.00 45.13 ? 236  ILE A O   1 
ATOM   216  C CB  . ILE A 1 26  ? 9.291   -47.840 40.391  1.00 44.14 ? 236  ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 26  ? 10.321  -46.722 40.572  1.00 43.01 ? 236  ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 26  ? 8.361   -47.914 41.583  1.00 43.78 ? 236  ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 26  ? 9.797   -45.336 40.245  1.00 42.30 ? 236  ILE A CD1 1 
ATOM   220  N N   . LEU A 1 27  ? 8.230   -50.550 39.221  1.00 45.51 ? 237  LEU A N   1 
ATOM   221  C CA  . LEU A 1 27  ? 7.367   -51.732 39.108  1.00 46.34 ? 237  LEU A CA  1 
ATOM   222  C C   . LEU A 1 27  ? 8.175   -53.044 38.991  1.00 47.04 ? 237  LEU A C   1 
ATOM   223  O O   . LEU A 1 27  ? 7.594   -54.136 38.953  1.00 47.05 ? 237  LEU A O   1 
ATOM   224  C CB  . LEU A 1 27  ? 6.401   -51.586 37.922  1.00 46.06 ? 237  LEU A CB  1 
ATOM   225  C CG  . LEU A 1 27  ? 5.427   -50.401 37.876  1.00 46.17 ? 237  LEU A CG  1 
ATOM   226  C CD1 . LEU A 1 27  ? 4.754   -50.324 36.516  1.00 46.06 ? 237  LEU A CD1 1 
ATOM   227  C CD2 . LEU A 1 27  ? 4.374   -50.447 38.986  1.00 45.70 ? 237  LEU A CD2 1 
ATOM   228  N N   . THR A 1 28  ? 9.509   -52.908 38.961  1.00 47.69 ? 238  THR A N   1 
ATOM   229  C CA  . THR A 1 28  ? 10.484  -54.013 38.813  1.00 48.21 ? 238  THR A CA  1 
ATOM   230  C C   . THR A 1 28  ? 10.520  -54.659 37.416  1.00 48.36 ? 238  THR A C   1 
ATOM   231  O O   . THR A 1 28  ? 9.494   -55.062 36.864  1.00 48.97 ? 238  THR A O   1 
ATOM   232  C CB  . THR A 1 28  ? 10.381  -55.074 39.946  1.00 48.13 ? 238  THR A CB  1 
ATOM   233  O OG1 . THR A 1 28  ? 10.955  -54.541 41.144  1.00 48.47 ? 238  THR A OG1 1 
ATOM   234  C CG2 . THR A 1 28  ? 11.136  -56.347 39.580  1.00 48.73 ? 238  THR A CG2 1 
ATOM   235  N N   . LYS A 1 30  ? 12.032  -57.779 35.701  1.00 92.44 ? 240  LYS A N   1 
ATOM   236  C CA  . LYS A 1 30  ? 13.329  -57.812 35.029  1.00 92.45 ? 240  LYS A CA  1 
ATOM   237  C C   . LYS A 1 30  ? 14.267  -56.743 35.599  1.00 92.50 ? 240  LYS A C   1 
ATOM   238  O O   . LYS A 1 30  ? 15.401  -57.045 35.985  1.00 92.51 ? 240  LYS A O   1 
ATOM   239  C CB  . LYS A 1 30  ? 13.152  -57.619 33.516  1.00 92.39 ? 240  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 30  ? 13.984  -58.549 32.628  1.00 92.13 ? 240  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 30  ? 15.440  -58.115 32.482  1.00 91.74 ? 240  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 30  ? 16.367  -58.965 33.338  1.00 91.66 ? 240  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 30  ? 17.795  -58.757 32.976  1.00 91.42 ? 240  LYS A NZ  1 
ATOM   244  N N   . ALA A 1 31  ? 13.783  -55.502 35.651  1.00 92.50 ? 241  ALA A N   1 
ATOM   245  C CA  . ALA A 1 31  ? 14.551  -54.373 36.172  1.00 92.49 ? 241  ALA A CA  1 
ATOM   246  C C   . ALA A 1 31  ? 13.867  -53.755 37.390  1.00 92.50 ? 241  ALA A C   1 
ATOM   247  O O   . ALA A 1 31  ? 13.868  -54.332 38.478  1.00 92.44 ? 241  ALA A O   1 
ATOM   248  C CB  . ALA A 1 31  ? 14.756  -53.324 35.086  1.00 92.48 ? 241  ALA A CB  1 
ATOM   249  N N   . PRO A 1 36  ? 7.120   -49.432 46.552  1.00 41.16 ? 246  PRO A N   1 
ATOM   250  C CA  . PRO A 1 36  ? 6.299   -48.300 46.965  1.00 41.06 ? 246  PRO A CA  1 
ATOM   251  C C   . PRO A 1 36  ? 5.162   -48.710 47.905  1.00 40.58 ? 246  PRO A C   1 
ATOM   252  O O   . PRO A 1 36  ? 4.729   -49.867 47.897  1.00 40.66 ? 246  PRO A O   1 
ATOM   253  C CB  . PRO A 1 36  ? 5.711   -47.793 45.644  1.00 41.03 ? 246  PRO A CB  1 
ATOM   254  C CG  . PRO A 1 36  ? 6.604   -48.307 44.612  1.00 41.51 ? 246  PRO A CG  1 
ATOM   255  C CD  . PRO A 1 36  ? 7.037   -49.648 45.104  1.00 41.36 ? 246  PRO A CD  1 
ATOM   256  N N   . PHE A 1 37  ? 4.689   -47.747 48.691  1.00 40.04 ? 247  PHE A N   1 
ATOM   257  C CA  . PHE A 1 37  ? 3.579   -47.933 49.618  1.00 39.63 ? 247  PHE A CA  1 
ATOM   258  C C   . PHE A 1 37  ? 2.257   -48.229 48.888  1.00 39.24 ? 247  PHE A C   1 
ATOM   259  O O   . PHE A 1 37  ? 1.815   -47.444 48.038  1.00 38.93 ? 247  PHE A O   1 
ATOM   260  C CB  . PHE A 1 37  ? 3.449   -46.686 50.493  1.00 39.93 ? 247  PHE A CB  1 
ATOM   261  C CG  . PHE A 1 37  ? 2.451   -46.821 51.598  1.00 40.61 ? 247  PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 37  ? 2.696   -47.678 52.678  1.00 41.25 ? 247  PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 37  ? 1.268   -46.091 51.572  1.00 40.65 ? 247  PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 37  ? 1.766   -47.807 53.712  1.00 41.43 ? 247  PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 37  ? 0.330   -46.215 52.609  1.00 41.26 ? 247  PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 37  ? 0.584   -47.071 53.678  1.00 41.19 ? 247  PHE A CZ  1 
ATOM   267  N N   . VAL A 1 38  ? 1.637   -49.360 49.229  1.00 38.41 ? 248  VAL A N   1 
ATOM   268  C CA  . VAL A 1 38  ? 0.405   -49.812 48.565  1.00 37.80 ? 248  VAL A CA  1 
ATOM   269  C C   . VAL A 1 38  ? -0.874  -49.259 49.211  1.00 37.68 ? 248  VAL A C   1 
ATOM   270  O O   . VAL A 1 38  ? -1.187  -49.559 50.373  1.00 37.92 ? 248  VAL A O   1 
ATOM   271  C CB  . VAL A 1 38  ? 0.331   -51.363 48.448  1.00 37.62 ? 248  VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 38  ? -1.042  -51.811 47.982  1.00 38.06 ? 248  VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 38  ? 1.390   -51.887 47.485  1.00 37.43 ? 248  VAL A CG2 1 
ATOM   274  N N   . ILE A 1 39  ? -1.605  -48.450 48.442  1.00 36.96 ? 249  ILE A N   1 
ATOM   275  C CA  . ILE A 1 39  ? -2.923  -47.977 48.833  1.00 36.00 ? 249  ILE A CA  1 
ATOM   276  C C   . ILE A 1 39  ? -3.940  -48.888 48.172  1.00 35.80 ? 249  ILE A C   1 
ATOM   277  O O   . ILE A 1 39  ? -3.972  -48.999 46.946  1.00 35.48 ? 249  ILE A O   1 
ATOM   278  C CB  . ILE A 1 39  ? -3.158  -46.535 48.379  1.00 36.28 ? 249  ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 39  ? -2.074  -45.615 48.951  1.00 35.97 ? 249  ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 39  ? -4.568  -46.072 48.756  1.00 35.38 ? 249  ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 39  ? -1.699  -44.464 48.020  1.00 36.37 ? 249  ILE A CD1 1 
ATOM   282  N N   . HIS A 1 40  ? -4.762  -49.539 48.993  1.00 35.38 ? 250  HIS A N   1 
ATOM   283  C CA  . HIS A 1 40  ? -5.701  -50.555 48.522  1.00 35.07 ? 250  HIS A CA  1 
ATOM   284  C C   . HIS A 1 40  ? -7.029  -50.503 49.278  1.00 34.77 ? 250  HIS A C   1 
ATOM   285  O O   . HIS A 1 40  ? -7.940  -51.277 48.987  1.00 34.40 ? 250  HIS A O   1 
ATOM   286  C CB  . HIS A 1 40  ? -5.080  -51.956 48.638  1.00 34.98 ? 250  HIS A CB  1 
ATOM   287  C CG  . HIS A 1 40  ? -4.759  -52.363 50.043  1.00 34.68 ? 250  HIS A CG  1 
ATOM   288  N ND1 . HIS A 1 40  ? -5.634  -53.079 50.829  1.00 34.94 ? 250  HIS A ND1 1 
ATOM   289  C CD2 . HIS A 1 40  ? -3.659  -52.152 50.804  1.00 35.87 ? 250  HIS A CD2 1 
ATOM   290  C CE1 . HIS A 1 40  ? -5.092  -53.291 52.013  1.00 34.74 ? 250  HIS A CE1 1 
ATOM   291  N NE2 . HIS A 1 40  ? -3.893  -52.736 52.026  1.00 35.72 ? 250  HIS A NE2 1 
ATOM   292  N N   . ASP A 1 41  ? -7.108  -49.596 50.253  1.00 35.03 ? 251  ASP A N   1 
ATOM   293  C CA  . ASP A 1 41  ? -8.292  -49.365 51.090  1.00 35.26 ? 251  ASP A CA  1 
ATOM   294  C C   . ASP A 1 41  ? -8.208  -48.005 51.784  1.00 35.79 ? 251  ASP A C   1 
ATOM   295  O O   . ASP A 1 41  ? -7.239  -47.270 51.597  1.00 35.96 ? 251  ASP A O   1 
ATOM   296  C CB  . ASP A 1 41  ? -8.471  -50.488 52.124  1.00 35.19 ? 251  ASP A CB  1 
ATOM   297  C CG  . ASP A 1 41  ? -7.262  -50.666 53.033  1.00 34.59 ? 251  ASP A CG  1 
ATOM   298  O OD1 . ASP A 1 41  ? -6.529  -49.691 53.320  1.00 33.57 ? 251  ASP A OD1 1 
ATOM   299  O OD2 . ASP A 1 41  ? -7.060  -51.803 53.488  1.00 35.76 ? 251  ASP A OD2 1 
ATOM   300  N N   . ILE A 1 42  ? -9.210  -47.683 52.599  1.00 36.43 ? 252  ILE A N   1 
ATOM   301  C CA  . ILE A 1 42  ? -9.305  -46.368 53.234  1.00 37.23 ? 252  ILE A CA  1 
ATOM   302  C C   . ILE A 1 42  ? -8.158  -46.093 54.226  1.00 37.89 ? 252  ILE A C   1 
ATOM   303  O O   . ILE A 1 42  ? -7.587  -45.001 54.228  1.00 37.96 ? 252  ILE A O   1 
ATOM   304  C CB  . ILE A 1 42  ? -10.707 -46.157 53.885  1.00 37.43 ? 252  ILE A CB  1 
ATOM   305  C CG1 . ILE A 1 42  ? -11.803 -46.235 52.816  1.00 37.29 ? 252  ILE A CG1 1 
ATOM   306  C CG2 . ILE A 1 42  ? -10.791 -44.812 54.642  1.00 36.31 ? 252  ILE A CG2 1 
ATOM   307  C CD1 . ILE A 1 42  ? -13.229 -46.227 53.368  1.00 37.59 ? 252  ILE A CD1 1 
ATOM   308  N N   . GLU A 1 43  ? -7.824  -47.084 55.052  1.00 38.78 ? 253  GLU A N   1 
ATOM   309  C CA  . GLU A 1 43  ? -6.710  -46.981 56.007  1.00 39.71 ? 253  GLU A CA  1 
ATOM   310  C C   . GLU A 1 43  ? -5.363  -46.690 55.321  1.00 39.83 ? 253  GLU A C   1 
ATOM   311  O O   . GLU A 1 43  ? -4.610  -45.827 55.776  1.00 39.84 ? 253  GLU A O   1 
ATOM   312  C CB  . GLU A 1 43  ? -6.618  -48.256 56.858  1.00 39.99 ? 253  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 43  ? -5.913  -48.087 58.218  1.00 41.68 ? 253  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 43  ? -4.452  -48.543 58.222  1.00 44.24 ? 253  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 43  ? -4.038  -49.295 57.309  1.00 45.24 ? 253  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 43  ? -3.714  -48.160 59.158  1.00 44.75 ? 253  GLU A OE2 1 
ATOM   317  N N   . THR A 1 44  ? -5.071  -47.402 54.230  1.00 40.08 ? 254  THR A N   1 
ATOM   318  C CA  . THR A 1 44  ? -3.822  -47.195 53.485  1.00 40.37 ? 254  THR A CA  1 
ATOM   319  C C   . THR A 1 44  ? -3.810  -45.845 52.769  1.00 40.79 ? 254  THR A C   1 
ATOM   320  O O   . THR A 1 44  ? -2.770  -45.187 52.692  1.00 40.95 ? 254  THR A O   1 
ATOM   321  C CB  . THR A 1 44  ? -3.521  -48.335 52.479  1.00 40.48 ? 254  THR A CB  1 
ATOM   322  O OG1 . THR A 1 44  ? -4.702  -48.656 51.731  1.00 40.11 ? 254  THR A OG1 1 
ATOM   323  C CG2 . THR A 1 44  ? -3.010  -49.596 53.212  1.00 40.18 ? 254  THR A CG2 1 
ATOM   324  N N   . LEU A 1 45  ? -4.968  -45.427 52.262  1.00 40.96 ? 255  LEU A N   1 
ATOM   325  C CA  . LEU A 1 45  ? -5.101  -44.085 51.717  1.00 41.49 ? 255  LEU A CA  1 
ATOM   326  C C   . LEU A 1 45  ? -4.770  -43.058 52.794  1.00 41.80 ? 255  LEU A C   1 
ATOM   327  O O   . LEU A 1 45  ? -3.980  -42.149 52.566  1.00 41.98 ? 255  LEU A O   1 
ATOM   328  C CB  . LEU A 1 45  ? -6.507  -43.853 51.145  1.00 41.51 ? 255  LEU A CB  1 
ATOM   329  C CG  . LEU A 1 45  ? -6.852  -42.439 50.642  1.00 41.42 ? 255  LEU A CG  1 
ATOM   330  C CD1 . LEU A 1 45  ? -5.909  -41.967 49.554  1.00 40.28 ? 255  LEU A CD1 1 
ATOM   331  C CD2 . LEU A 1 45  ? -8.272  -42.404 50.137  1.00 41.57 ? 255  LEU A CD2 1 
ATOM   332  N N   . TRP A 1 46  ? -5.372  -43.218 53.966  1.00 42.34 ? 256  TRP A N   1 
ATOM   333  C CA  . TRP A 1 46  ? -5.124  -42.321 55.094  1.00 43.21 ? 256  TRP A CA  1 
ATOM   334  C C   . TRP A 1 46  ? -3.643  -42.286 55.494  1.00 43.75 ? 256  TRP A C   1 
ATOM   335  O O   . TRP A 1 46  ? -3.081  -41.210 55.710  1.00 43.38 ? 256  TRP A O   1 
ATOM   336  C CB  . TRP A 1 46  ? -6.010  -42.699 56.291  1.00 43.15 ? 256  TRP A CB  1 
ATOM   337  C CG  . TRP A 1 46  ? -5.986  -41.685 57.390  1.00 42.97 ? 256  TRP A CG  1 
ATOM   338  C CD1 . TRP A 1 46  ? -6.614  -40.470 57.403  1.00 42.97 ? 256  TRP A CD1 1 
ATOM   339  C CD2 . TRP A 1 46  ? -5.299  -41.795 58.635  1.00 42.95 ? 256  TRP A CD2 1 
ATOM   340  N NE1 . TRP A 1 46  ? -6.359  -39.817 58.583  1.00 43.08 ? 256  TRP A NE1 1 
ATOM   341  C CE2 . TRP A 1 46  ? -5.553  -40.609 59.358  1.00 43.35 ? 256  TRP A CE2 1 
ATOM   342  C CE3 . TRP A 1 46  ? -4.496  -42.785 59.216  1.00 43.18 ? 256  TRP A CE3 1 
ATOM   343  C CZ2 . TRP A 1 46  ? -5.030  -40.383 60.632  1.00 43.12 ? 256  TRP A CZ2 1 
ATOM   344  C CZ3 . TRP A 1 46  ? -3.970  -42.559 60.479  1.00 43.00 ? 256  TRP A CZ3 1 
ATOM   345  C CH2 . TRP A 1 46  ? -4.246  -41.369 61.175  1.00 43.47 ? 256  TRP A CH2 1 
ATOM   346  N N   . GLN A 1 47  ? -3.021  -43.462 55.565  1.00 44.64 ? 257  GLN A N   1 
ATOM   347  C CA  . GLN A 1 47  ? -1.594  -43.563 55.855  1.00 46.06 ? 257  GLN A CA  1 
ATOM   348  C C   . GLN A 1 47  ? -0.688  -42.938 54.792  1.00 46.88 ? 257  GLN A C   1 
ATOM   349  O O   . GLN A 1 47  ? 0.389   -42.446 55.118  1.00 46.79 ? 257  GLN A O   1 
ATOM   350  C CB  . GLN A 1 47  ? -1.176  -45.009 56.136  1.00 45.90 ? 257  GLN A CB  1 
ATOM   351  C CG  . GLN A 1 47  ? -0.600  -45.195 57.528  1.00 46.90 ? 257  GLN A CG  1 
ATOM   352  C CD  . GLN A 1 47  ? -1.559  -45.862 58.480  1.00 48.50 ? 257  GLN A CD  1 
ATOM   353  O OE1 . GLN A 1 47  ? -1.668  -47.086 58.502  1.00 50.12 ? 257  GLN A OE1 1 
ATOM   354  N NE2 . GLN A 1 47  ? -2.243  -45.068 59.290  1.00 48.41 ? 257  GLN A NE2 1 
ATOM   355  N N   . ALA A 1 48  ? -1.121  -42.963 53.532  1.00 48.21 ? 258  ALA A N   1 
ATOM   356  C CA  . ALA A 1 48  ? -0.410  -42.264 52.455  1.00 49.49 ? 258  ALA A CA  1 
ATOM   357  C C   . ALA A 1 48  ? -0.542  -40.746 52.594  1.00 50.49 ? 258  ALA A C   1 
ATOM   358  O O   . ALA A 1 48  ? 0.451   -40.026 52.495  1.00 50.57 ? 258  ALA A O   1 
ATOM   359  C CB  . ALA A 1 48  ? -0.907  -42.726 51.091  1.00 49.32 ? 258  ALA A CB  1 
ATOM   360  N N   . GLU A 1 49  ? -1.763  -40.274 52.850  1.00 51.86 ? 259  GLU A N   1 
ATOM   361  C CA  . GLU A 1 49  ? -2.047  -38.837 53.000  1.00 53.54 ? 259  GLU A CA  1 
ATOM   362  C C   . GLU A 1 49  ? -1.260  -38.161 54.131  1.00 54.65 ? 259  GLU A C   1 
ATOM   363  O O   . GLU A 1 49  ? -1.284  -36.934 54.266  1.00 54.93 ? 259  GLU A O   1 
ATOM   364  C CB  . GLU A 1 49  ? -3.554  -38.590 53.190  1.00 53.40 ? 259  GLU A CB  1 
ATOM   365  C CG  . GLU A 1 49  ? -4.411  -38.831 51.942  1.00 53.70 ? 259  GLU A CG  1 
ATOM   366  C CD  . GLU A 1 49  ? -4.153  -37.833 50.817  1.00 53.43 ? 259  GLU A CD  1 
ATOM   367  O OE1 . GLU A 1 49  ? -3.642  -36.727 51.083  1.00 53.89 ? 259  GLU A OE1 1 
ATOM   368  O OE2 . GLU A 1 49  ? -4.469  -38.157 49.657  1.00 53.81 ? 259  GLU A OE2 1 
ATOM   369  N N   . LYS A 1 50  ? -0.587  -38.972 54.945  1.00 56.12 ? 260  LYS A N   1 
ATOM   370  C CA  . LYS A 1 50  ? 0.354   -38.479 55.948  1.00 57.46 ? 260  LYS A CA  1 
ATOM   371  C C   . LYS A 1 50  ? 1.767   -38.919 55.582  1.00 58.11 ? 260  LYS A C   1 
ATOM   372  O O   . LYS A 1 50  ? 2.646   -38.085 55.383  1.00 58.42 ? 260  LYS A O   1 
ATOM   373  C CB  . LYS A 1 50  ? -0.008  -38.996 57.342  1.00 57.42 ? 260  LYS A CB  1 
ATOM   374  C CG  . LYS A 1 50  ? -1.406  -38.616 57.828  1.00 57.87 ? 260  LYS A CG  1 
ATOM   375  C CD  . LYS A 1 50  ? -1.818  -39.455 59.037  1.00 57.67 ? 260  LYS A CD  1 
ATOM   376  C CE  . LYS A 1 50  ? -1.018  -39.077 60.283  1.00 58.29 ? 260  LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 50  ? -1.411  -39.881 61.467  1.00 58.13 ? 260  LYS A NZ  1 
ATOM   378  N N   . GLY A 1 51  ? 1.959   -40.234 55.465  1.00 59.00 ? 261  GLY A N   1 
ATOM   379  C CA  . GLY A 1 51  ? 3.275   -40.853 55.281  1.00 60.03 ? 261  GLY A CA  1 
ATOM   380  C C   . GLY A 1 51  ? 4.115   -40.314 54.144  1.00 60.76 ? 261  GLY A C   1 
ATOM   381  O O   . GLY A 1 51  ? 5.187   -39.756 54.375  1.00 60.80 ? 261  GLY A O   1 
ATOM   382  N N   . LEU A 1 52  ? 3.623   -40.483 52.918  1.00 61.62 ? 262  LEU A N   1 
ATOM   383  C CA  . LEU A 1 52  ? 4.335   -40.043 51.709  1.00 62.42 ? 262  LEU A CA  1 
ATOM   384  C C   . LEU A 1 52  ? 3.879   -38.662 51.203  1.00 62.95 ? 262  LEU A C   1 
ATOM   385  O O   . LEU A 1 52  ? 4.122   -38.312 50.040  1.00 62.82 ? 262  LEU A O   1 
ATOM   386  C CB  . LEU A 1 52  ? 4.227   -41.108 50.604  1.00 62.36 ? 262  LEU A CB  1 
ATOM   387  C CG  . LEU A 1 52  ? 2.842   -41.581 50.142  1.00 62.39 ? 262  LEU A CG  1 
ATOM   388  C CD1 . LEU A 1 52  ? 2.409   -40.866 48.879  1.00 62.41 ? 262  LEU A CD1 1 
ATOM   389  C CD2 . LEU A 1 52  ? 2.855   -43.072 49.902  1.00 62.62 ? 262  LEU A CD2 1 
ATOM   390  N N   . VAL A 1 53  ? 3.246   -37.892 52.101  1.00 63.80 ? 263  VAL A N   1 
ATOM   391  C CA  . VAL A 1 53  ? 2.639   -36.578 51.810  1.00 64.48 ? 263  VAL A CA  1 
ATOM   392  C C   . VAL A 1 53  ? 1.863   -36.606 50.493  1.00 65.09 ? 263  VAL A C   1 
ATOM   393  O O   . VAL A 1 53  ? 0.685   -36.980 50.469  1.00 65.17 ? 263  VAL A O   1 
ATOM   394  C CB  . VAL A 1 53  ? 3.682   -35.441 51.797  1.00 64.58 ? 263  VAL A CB  1 
ATOM   395  N N   . TRP A 1 54  ? 2.533   -36.199 49.412  1.00 65.54 ? 264  TRP A N   1 
ATOM   396  C CA  . TRP A 1 54  ? 2.088   -36.484 48.046  1.00 65.80 ? 264  TRP A CA  1 
ATOM   397  C C   . TRP A 1 54  ? 3.085   -36.007 46.992  1.00 65.91 ? 264  TRP A C   1 
ATOM   398  O O   . TRP A 1 54  ? 4.280   -35.878 47.263  1.00 65.98 ? 264  TRP A O   1 
ATOM   399  C CB  . TRP A 1 54  ? 0.693   -35.926 47.769  1.00 65.90 ? 264  TRP A CB  1 
ATOM   400  C CG  . TRP A 1 54  ? -0.122  -36.865 46.955  1.00 66.08 ? 264  TRP A CG  1 
ATOM   401  C CD1 . TRP A 1 54  ? -0.504  -36.702 45.658  1.00 66.52 ? 264  TRP A CD1 1 
ATOM   402  C CD2 . TRP A 1 54  ? -0.635  -38.139 47.367  1.00 66.35 ? 264  TRP A CD2 1 
ATOM   403  N NE1 . TRP A 1 54  ? -1.237  -37.785 45.238  1.00 66.95 ? 264  TRP A NE1 1 
ATOM   404  C CE2 . TRP A 1 54  ? -1.333  -38.682 46.268  1.00 66.32 ? 264  TRP A CE2 1 
ATOM   405  C CE3 . TRP A 1 54  ? -0.583  -38.868 48.562  1.00 66.42 ? 264  TRP A CE3 1 
ATOM   406  C CZ2 . TRP A 1 54  ? -1.974  -39.921 46.324  1.00 66.18 ? 264  TRP A CZ2 1 
ATOM   407  C CZ3 . TRP A 1 54  ? -1.220  -40.100 48.618  1.00 66.40 ? 264  TRP A CZ3 1 
ATOM   408  C CH2 . TRP A 1 54  ? -1.907  -40.614 47.504  1.00 66.29 ? 264  TRP A CH2 1 
ATOM   409  N N   . LYS A 1 65  ? -17.376 -33.779 51.111  1.00 38.58 ? 275  LYS A N   1 
ATOM   410  C CA  . LYS A 1 65  ? -16.218 -34.644 50.894  1.00 38.03 ? 275  LYS A CA  1 
ATOM   411  C C   . LYS A 1 65  ? -16.477 -36.057 51.405  1.00 37.79 ? 275  LYS A C   1 
ATOM   412  O O   . LYS A 1 65  ? -17.323 -36.261 52.278  1.00 37.77 ? 275  LYS A O   1 
ATOM   413  C CB  . LYS A 1 65  ? -14.965 -34.053 51.549  1.00 38.21 ? 275  LYS A CB  1 
ATOM   414  N N   . GLU A 1 66  ? -15.736 -37.013 50.832  1.00 37.30 ? 276  GLU A N   1 
ATOM   415  C CA  . GLU A 1 66  ? -15.880 -38.462 51.045  1.00 36.51 ? 276  GLU A CA  1 
ATOM   416  C C   . GLU A 1 66  ? -14.717 -39.132 50.298  1.00 36.21 ? 276  GLU A C   1 
ATOM   417  O O   . GLU A 1 66  ? -14.034 -38.460 49.521  1.00 36.35 ? 276  GLU A O   1 
ATOM   418  C CB  . GLU A 1 66  ? -17.223 -38.970 50.498  1.00 36.73 ? 276  GLU A CB  1 
ATOM   419  C CG  . GLU A 1 66  ? -17.470 -38.650 49.018  1.00 36.49 ? 276  GLU A CG  1 
ATOM   420  C CD  . GLU A 1 66  ? -18.753 -39.256 48.464  1.00 36.29 ? 276  GLU A CD  1 
ATOM   421  O OE1 . GLU A 1 66  ? -18.840 -40.500 48.359  1.00 33.63 ? 276  GLU A OE1 1 
ATOM   422  O OE2 . GLU A 1 66  ? -19.664 -38.478 48.099  1.00 36.35 ? 276  GLU A OE2 1 
ATOM   423  N N   . ILE A 1 67  ? -14.497 -40.435 50.492  1.00 35.34 ? 277  ILE A N   1 
ATOM   424  C CA  . ILE A 1 67  ? -13.328 -41.091 49.877  1.00 35.16 ? 277  ILE A CA  1 
ATOM   425  C C   . ILE A 1 67  ? -13.298 -41.066 48.336  1.00 34.47 ? 277  ILE A C   1 
ATOM   426  O O   . ILE A 1 67  ? -12.290 -40.649 47.745  1.00 34.70 ? 277  ILE A O   1 
ATOM   427  C CB  . ILE A 1 67  ? -13.011 -42.516 50.435  1.00 35.39 ? 277  ILE A CB  1 
ATOM   428  C CG1 . ILE A 1 67  ? -12.032 -43.236 49.495  1.00 35.69 ? 277  ILE A CG1 1 
ATOM   429  C CG2 . ILE A 1 67  ? -14.273 -43.348 50.590  1.00 36.32 ? 277  ILE A CG2 1 
ATOM   430  C CD1 . ILE A 1 67  ? -11.064 -44.151 50.172  1.00 37.01 ? 277  ILE A CD1 1 
ATOM   431  N N   . SER A 1 68  ? -14.391 -41.501 47.705  1.00 33.43 ? 278  SER A N   1 
ATOM   432  C CA  . SER A 1 68  ? -14.506 -41.545 46.241  1.00 32.25 ? 278  SER A CA  1 
ATOM   433  C C   . SER A 1 68  ? -14.270 -40.182 45.570  1.00 31.67 ? 278  SER A C   1 
ATOM   434  O O   . SER A 1 68  ? -13.702 -40.123 44.479  1.00 31.00 ? 278  SER A O   1 
ATOM   435  C CB  . SER A 1 68  ? -15.871 -42.103 45.824  1.00 32.43 ? 278  SER A CB  1 
ATOM   436  O OG  . SER A 1 68  ? -16.072 -43.428 46.297  1.00 32.55 ? 278  SER A OG  1 
ATOM   437  N N   . VAL A 1 69  ? -14.707 -39.102 46.230  1.00 31.08 ? 279  VAL A N   1 
ATOM   438  C CA  . VAL A 1 69  ? -14.525 -37.735 45.723  1.00 30.72 ? 279  VAL A CA  1 
ATOM   439  C C   . VAL A 1 69  ? -13.084 -37.276 45.919  1.00 30.14 ? 279  VAL A C   1 
ATOM   440  O O   . VAL A 1 69  ? -12.500 -36.627 45.040  1.00 30.11 ? 279  VAL A O   1 
ATOM   441  C CB  . VAL A 1 69  ? -15.516 -36.727 46.382  1.00 30.91 ? 279  VAL A CB  1 
ATOM   442  C CG1 . VAL A 1 69  ? -15.149 -35.289 46.046  1.00 30.95 ? 279  VAL A CG1 1 
ATOM   443  C CG2 . VAL A 1 69  ? -16.943 -37.018 45.942  1.00 31.02 ? 279  VAL A CG2 1 
ATOM   444  N N   . HIS A 1 70  ? -12.515 -37.630 47.068  1.00 29.42 ? 280  HIS A N   1 
ATOM   445  C CA  . HIS A 1 70  ? -11.120 -37.322 47.376  1.00 28.75 ? 280  HIS A CA  1 
ATOM   446  C C   . HIS A 1 70  ? -10.164 -37.978 46.374  1.00 28.45 ? 280  HIS A C   1 
ATOM   447  O O   . HIS A 1 70  ? -9.177  -37.358 45.967  1.00 28.62 ? 280  HIS A O   1 
ATOM   448  C CB  . HIS A 1 70  ? -10.774 -37.753 48.798  1.00 28.75 ? 280  HIS A CB  1 
ATOM   449  C CG  . HIS A 1 70  ? -9.333  -37.559 49.147  1.00 28.49 ? 280  HIS A CG  1 
ATOM   450  N ND1 . HIS A 1 70  ? -8.384  -38.540 48.956  1.00 27.33 ? 280  HIS A ND1 1 
ATOM   451  C CD2 . HIS A 1 70  ? -8.673  -36.487 49.649  1.00 27.93 ? 280  HIS A CD2 1 
ATOM   452  C CE1 . HIS A 1 70  ? -7.203  -38.084 49.329  1.00 27.01 ? 280  HIS A CE1 1 
ATOM   453  N NE2 . HIS A 1 70  ? -7.351  -36.844 49.758  1.00 28.22 ? 280  HIS A NE2 1 
ATOM   454  N N   . VAL A 1 71  ? -10.455 -39.214 45.966  1.00 27.72 ? 281  VAL A N   1 
ATOM   455  C CA  . VAL A 1 71  ? -9.644  -39.867 44.926  1.00 27.48 ? 281  VAL A CA  1 
ATOM   456  C C   . VAL A 1 71  ? -9.772  -39.149 43.568  1.00 27.51 ? 281  VAL A C   1 
ATOM   457  O O   . VAL A 1 71  ? -8.779  -38.990 42.844  1.00 27.57 ? 281  VAL A O   1 
ATOM   458  C CB  . VAL A 1 71  ? -9.956  -41.375 44.789  1.00 27.31 ? 281  VAL A CB  1 
ATOM   459  C CG1 . VAL A 1 71  ? -9.235  -41.968 43.581  1.00 26.64 ? 281  VAL A CG1 1 
ATOM   460  C CG2 . VAL A 1 71  ? -9.560  -42.123 46.068  1.00 26.74 ? 281  VAL A CG2 1 
ATOM   461  N N   . PHE A 1 72  ? -10.991 -38.716 43.242  1.00 27.43 ? 282  PHE A N   1 
ATOM   462  C CA  . PHE A 1 72  ? -11.270 -37.940 42.019  1.00 27.67 ? 282  PHE A CA  1 
ATOM   463  C C   . PHE A 1 72  ? -10.521 -36.604 42.034  1.00 27.77 ? 282  PHE A C   1 
ATOM   464  O O   . PHE A 1 72  ? -9.984  -36.197 41.011  1.00 28.14 ? 282  PHE A O   1 
ATOM   465  C CB  . PHE A 1 72  ? -12.784 -37.723 41.862  1.00 27.47 ? 282  PHE A CB  1 
ATOM   466  C CG  . PHE A 1 72  ? -13.191 -37.008 40.594  1.00 26.80 ? 282  PHE A CG  1 
ATOM   467  C CD1 . PHE A 1 72  ? -13.075 -37.627 39.350  1.00 27.57 ? 282  PHE A CD1 1 
ATOM   468  C CD2 . PHE A 1 72  ? -13.732 -35.734 40.647  1.00 26.05 ? 282  PHE A CD2 1 
ATOM   469  C CE1 . PHE A 1 72  ? -13.474 -36.965 38.178  1.00 26.61 ? 282  PHE A CE1 1 
ATOM   470  C CE2 . PHE A 1 72  ? -14.141 -35.076 39.487  1.00 26.13 ? 282  PHE A CE2 1 
ATOM   471  C CZ  . PHE A 1 72  ? -14.003 -35.692 38.253  1.00 26.08 ? 282  PHE A CZ  1 
ATOM   472  N N   . TYR A 1 73  ? -10.465 -35.940 43.191  1.00 27.91 ? 283  TYR A N   1 
ATOM   473  C CA  . TYR A 1 73  ? -9.654  -34.724 43.332  1.00 28.25 ? 283  TYR A CA  1 
ATOM   474  C C   . TYR A 1 73  ? -8.175  -34.966 43.068  1.00 28.26 ? 283  TYR A C   1 
ATOM   475  O O   . TYR A 1 73  ? -7.528  -34.166 42.414  1.00 27.73 ? 283  TYR A O   1 
ATOM   476  C CB  . TYR A 1 73  ? -9.811  -34.070 44.714  1.00 28.37 ? 283  TYR A CB  1 
ATOM   477  C CG  . TYR A 1 73  ? -11.144 -33.395 44.942  1.00 28.84 ? 283  TYR A CG  1 
ATOM   478  C CD1 . TYR A 1 73  ? -12.000 -33.107 43.876  1.00 27.94 ? 283  TYR A CD1 1 
ATOM   479  C CD2 . TYR A 1 73  ? -11.540 -33.020 46.231  1.00 29.09 ? 283  TYR A CD2 1 
ATOM   480  C CE1 . TYR A 1 73  ? -13.229 -32.484 44.089  1.00 28.55 ? 283  TYR A CE1 1 
ATOM   481  C CE2 . TYR A 1 73  ? -12.768 -32.399 46.454  1.00 29.35 ? 283  TYR A CE2 1 
ATOM   482  C CZ  . TYR A 1 73  ? -13.604 -32.138 45.375  1.00 29.22 ? 283  TYR A CZ  1 
ATOM   483  O OH  . TYR A 1 73  ? -14.809 -31.527 45.591  1.00 29.77 ? 283  TYR A OH  1 
ATOM   484  N N   . ARG A 1 74  ? -7.647  -36.062 43.611  1.00 28.97 ? 284  ARG A N   1 
ATOM   485  C CA  . ARG A 1 74  ? -6.270  -36.483 43.349  1.00 29.05 ? 284  ARG A CA  1 
ATOM   486  C C   . ARG A 1 74  ? -6.022  -36.777 41.866  1.00 28.96 ? 284  ARG A C   1 
ATOM   487  O O   . ARG A 1 74  ? -4.927  -36.499 41.346  1.00 28.56 ? 284  ARG A O   1 
ATOM   488  C CB  . ARG A 1 74  ? -5.907  -37.695 44.206  1.00 29.67 ? 284  ARG A CB  1 
ATOM   489  C CG  . ARG A 1 74  ? -5.646  -37.373 45.664  1.00 30.69 ? 284  ARG A CG  1 
ATOM   490  C CD  . ARG A 1 74  ? -4.391  -36.552 45.804  1.00 34.02 ? 284  ARG A CD  1 
ATOM   491  N NE  . ARG A 1 74  ? -4.060  -36.295 47.203  1.00 37.34 ? 284  ARG A NE  1 
ATOM   492  C CZ  . ARG A 1 74  ? -3.164  -35.401 47.599  1.00 37.47 ? 284  ARG A CZ  1 
ATOM   493  N NH1 . ARG A 1 74  ? -2.516  -34.678 46.696  1.00 39.23 ? 284  ARG A NH1 1 
ATOM   494  N NH2 . ARG A 1 74  ? -2.923  -35.226 48.891  1.00 36.99 ? 284  ARG A NH2 1 
ATOM   495  N N   . CYS A 1 75  ? -7.032  -37.332 41.188  1.00 28.77 ? 285  CYS A N   1 
ATOM   496  C CA  . CYS A 1 75  ? -6.950  -37.556 39.736  1.00 28.74 ? 285  CYS A CA  1 
ATOM   497  C C   . CYS A 1 75  ? -6.835  -36.209 39.026  1.00 28.52 ? 285  CYS A C   1 
ATOM   498  O O   . CYS A 1 75  ? -6.069  -36.066 38.090  1.00 28.30 ? 285  CYS A O   1 
ATOM   499  C CB  . CYS A 1 75  ? -8.164  -38.329 39.206  1.00 28.51 ? 285  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 75  ? -8.388  -40.049 39.818  1.00 30.19 ? 285  CYS A SG  1 
ATOM   501  N N   . GLN A 1 76  ? -7.594  -35.221 39.493  1.00 28.79 ? 286  GLN A N   1 
ATOM   502  C CA  . GLN A 1 76  ? -7.547  -33.875 38.923  1.00 28.94 ? 286  GLN A CA  1 
ATOM   503  C C   . GLN A 1 76  ? -6.193  -33.201 39.120  1.00 29.30 ? 286  GLN A C   1 
ATOM   504  O O   . GLN A 1 76  ? -5.647  -32.635 38.160  1.00 28.97 ? 286  GLN A O   1 
ATOM   505  C CB  . GLN A 1 76  ? -8.662  -33.001 39.482  1.00 28.80 ? 286  GLN A CB  1 
ATOM   506  C CG  . GLN A 1 76  ? -10.045 -33.362 38.978  1.00 28.80 ? 286  GLN A CG  1 
ATOM   507  C CD  . GLN A 1 76  ? -11.042 -32.305 39.340  1.00 29.48 ? 286  GLN A CD  1 
ATOM   508  O OE1 . GLN A 1 76  ? -10.802 -31.125 39.114  1.00 30.20 ? 286  GLN A OE1 1 
ATOM   509  N NE2 . GLN A 1 76  ? -12.169 -32.714 39.905  1.00 29.54 ? 286  GLN A NE2 1 
ATOM   510  N N   . CYS A 1 77  ? -5.651  -33.272 40.342  1.00 29.47 ? 287  CYS A N   1 
ATOM   511  C CA  . CYS A 1 77  ? -4.283  -32.786 40.615  1.00 30.42 ? 287  CYS A CA  1 
ATOM   512  C C   . CYS A 1 77  ? -3.308  -33.344 39.589  1.00 29.89 ? 287  CYS A C   1 
ATOM   513  O O   . CYS A 1 77  ? -2.517  -32.609 39.011  1.00 30.60 ? 287  CYS A O   1 
ATOM   514  C CB  . CYS A 1 77  ? -3.798  -33.212 42.005  1.00 30.62 ? 287  CYS A CB  1 
ATOM   515  S SG  . CYS A 1 77  ? -4.768  -32.590 43.366  1.00 34.23 ? 287  CYS A SG  1 
ATOM   516  N N   . THR A 1 78  ? -3.393  -34.652 39.369  1.00 29.43 ? 288  THR A N   1 
ATOM   517  C CA  . THR A 1 78  ? -2.496  -35.377 38.481  1.00 28.78 ? 288  THR A CA  1 
ATOM   518  C C   . THR A 1 78  ? -2.657  -34.983 37.017  1.00 28.10 ? 288  THR A C   1 
ATOM   519  O O   . THR A 1 78  ? -1.658  -34.840 36.324  1.00 28.02 ? 288  THR A O   1 
ATOM   520  C CB  . THR A 1 78  ? -2.659  -36.906 38.673  1.00 28.97 ? 288  THR A CB  1 
ATOM   521  O OG1 . THR A 1 78  ? -2.311  -37.234 40.031  1.00 31.09 ? 288  THR A OG1 1 
ATOM   522  C CG2 . THR A 1 78  ? -1.777  -37.695 37.713  1.00 27.50 ? 288  THR A CG2 1 
ATOM   523  N N   . THR A 1 79  ? -3.893  -34.805 36.539  1.00 27.09 ? 289  THR A N   1 
ATOM   524  C CA  . THR A 1 79  ? -4.088  -34.453 35.128  1.00 26.09 ? 289  THR A CA  1 
ATOM   525  C C   . THR A 1 79  ? -3.679  -33.011 34.832  1.00 26.45 ? 289  THR A C   1 
ATOM   526  O O   . THR A 1 79  ? -3.105  -32.739 33.770  1.00 26.65 ? 289  THR A O   1 
ATOM   527  C CB  . THR A 1 79  ? -5.522  -34.743 34.601  1.00 26.40 ? 289  THR A CB  1 
ATOM   528  O OG1 . THR A 1 79  ? -6.493  -33.969 35.314  1.00 23.95 ? 289  THR A OG1 1 
ATOM   529  C CG2 . THR A 1 79  ? -5.859  -36.249 34.690  1.00 25.44 ? 289  THR A CG2 1 
ATOM   530  N N   . VAL A 1 80  ? -3.962  -32.106 35.780  1.00 26.00 ? 290  VAL A N   1 
ATOM   531  C CA  . VAL A 1 80  ? -3.597  -30.684 35.688  1.00 25.81 ? 290  VAL A CA  1 
ATOM   532  C C   . VAL A 1 80  ? -2.073  -30.499 35.663  1.00 26.01 ? 290  VAL A C   1 
ATOM   533  O O   . VAL A 1 80  ? -1.560  -29.680 34.904  1.00 25.63 ? 290  VAL A O   1 
ATOM   534  C CB  . VAL A 1 80  ? -4.223  -29.841 36.856  1.00 25.76 ? 290  VAL A CB  1 
ATOM   535  C CG1 . VAL A 1 80  ? -3.614  -28.446 36.932  1.00 26.04 ? 290  VAL A CG1 1 
ATOM   536  C CG2 . VAL A 1 80  ? -5.749  -29.732 36.706  1.00 25.95 ? 290  VAL A CG2 1 
ATOM   537  N N   . GLU A 1 81  ? -1.368  -31.260 36.507  1.00 26.10 ? 291  GLU A N   1 
ATOM   538  C CA  . GLU A 1 81  ? 0.095   -31.257 36.556  1.00 26.39 ? 291  GLU A CA  1 
ATOM   539  C C   . GLU A 1 81  ? 0.703   -31.771 35.235  1.00 26.11 ? 291  GLU A C   1 
ATOM   540  O O   . GLU A 1 81  ? 1.673   -31.199 34.722  1.00 26.68 ? 291  GLU A O   1 
ATOM   541  C CB  . GLU A 1 81  ? 0.581   -32.075 37.774  1.00 26.63 ? 291  GLU A CB  1 
ATOM   542  C CG  . GLU A 1 81  ? 2.105   -32.205 37.944  1.00 29.45 ? 291  GLU A CG  1 
ATOM   543  C CD  . GLU A 1 81  ? 2.854   -30.873 37.867  1.00 33.30 ? 291  GLU A CD  1 
ATOM   544  O OE1 . GLU A 1 81  ? 2.345   -29.847 38.374  1.00 35.81 ? 291  GLU A OE1 1 
ATOM   545  O OE2 . GLU A 1 81  ? 3.965   -30.851 37.297  1.00 35.22 ? 291  GLU A OE2 1 
ATOM   546  N N   . THR A 1 82  ? 0.119   -32.834 34.685  1.00 25.25 ? 292  THR A N   1 
ATOM   547  C CA  . THR A 1 82  ? 0.564   -33.408 33.414  1.00 24.59 ? 292  THR A CA  1 
ATOM   548  C C   . THR A 1 82  ? 0.251   -32.502 32.218  1.00 24.78 ? 292  THR A C   1 
ATOM   549  O O   . THR A 1 82  ? 0.998   -32.499 31.247  1.00 24.72 ? 292  THR A O   1 
ATOM   550  C CB  . THR A 1 82  ? -0.020  -34.806 33.220  1.00 24.16 ? 292  THR A CB  1 
ATOM   551  O OG1 . THR A 1 82  ? 0.293   -35.596 34.372  1.00 24.74 ? 292  THR A OG1 1 
ATOM   552  C CG2 . THR A 1 82  ? 0.576   -35.494 32.002  1.00 23.60 ? 292  THR A CG2 1 
ATOM   553  N N   . VAL A 1 83  ? -0.842  -31.732 32.294  1.00 24.74 ? 293  VAL A N   1 
ATOM   554  C CA  . VAL A 1 83  ? -1.077  -30.637 31.345  1.00 24.60 ? 293  VAL A CA  1 
ATOM   555  C C   . VAL A 1 83  ? 0.082   -29.611 31.325  1.00 24.94 ? 293  VAL A C   1 
ATOM   556  O O   . VAL A 1 83  ? 0.564   -29.226 30.248  1.00 25.26 ? 293  VAL A O   1 
ATOM   557  C CB  . VAL A 1 83  ? -2.454  -29.948 31.567  1.00 24.46 ? 293  VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 83  ? -2.580  -28.704 30.693  1.00 23.53 ? 293  VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 83  ? -3.603  -30.933 31.255  1.00 24.42 ? 293  VAL A CG2 1 
ATOM   560  N N   . ARG A 1 84  ? 0.539   -29.170 32.494  1.00 25.15 ? 294  ARG A N   1 
ATOM   561  C CA  . ARG A 1 84  ? 1.699   -28.259 32.545  1.00 26.01 ? 294  ARG A CA  1 
ATOM   562  C C   . ARG A 1 84  ? 2.906   -28.849 31.813  1.00 25.57 ? 294  ARG A C   1 
ATOM   563  O O   . ARG A 1 84  ? 3.578   -28.142 31.060  1.00 25.38 ? 294  ARG A O   1 
ATOM   564  C CB  . ARG A 1 84  ? 2.138   -27.962 33.975  1.00 26.56 ? 294  ARG A CB  1 
ATOM   565  C CG  . ARG A 1 84  ? 1.212   -27.124 34.809  1.00 29.88 ? 294  ARG A CG  1 
ATOM   566  C CD  . ARG A 1 84  ? 1.931   -26.779 36.117  1.00 34.94 ? 294  ARG A CD  1 
ATOM   567  N NE  . ARG A 1 84  ? 1.004   -26.564 37.224  1.00 39.63 ? 294  ARG A NE  1 
ATOM   568  C CZ  . ARG A 1 84  ? 0.391   -25.413 37.491  1.00 42.76 ? 294  ARG A CZ  1 
ATOM   569  N NH1 . ARG A 1 84  ? 0.596   -24.343 36.726  1.00 43.53 ? 294  ARG A NH1 1 
ATOM   570  N NH2 . ARG A 1 84  ? -0.435  -25.335 38.534  1.00 44.60 ? 294  ARG A NH2 1 
ATOM   571  N N   . GLU A 1 85  ? 3.185   -30.134 32.054  1.00 24.91 ? 295  GLU A N   1 
ATOM   572  C CA  . GLU A 1 85  ? 4.378   -30.756 31.502  1.00 25.11 ? 295  GLU A CA  1 
ATOM   573  C C   . GLU A 1 85  ? 4.278   -30.910 29.994  1.00 25.26 ? 295  GLU A C   1 
ATOM   574  O O   . GLU A 1 85  ? 5.247   -30.651 29.275  1.00 25.00 ? 295  GLU A O   1 
ATOM   575  C CB  . GLU A 1 85  ? 4.691   -32.084 32.193  1.00 25.25 ? 295  GLU A CB  1 
ATOM   576  C CG  . GLU A 1 85  ? 5.058   -31.906 33.658  1.00 25.79 ? 295  GLU A CG  1 
ATOM   577  C CD  . GLU A 1 85  ? 5.744   -33.114 34.266  1.00 28.66 ? 295  GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 85  ? 5.254   -34.253 34.078  1.00 28.07 ? 295  GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 85  ? 6.783   -32.911 34.950  1.00 31.27 ? 295  GLU A OE2 1 
ATOM   580  N N   . LEU A 1 86  ? 3.089   -31.300 29.530  1.00 25.32 ? 296  LEU A N   1 
ATOM   581  C CA  . LEU A 1 86  ? 2.773   -31.397 28.105  1.00 25.02 ? 296  LEU A CA  1 
ATOM   582  C C   . LEU A 1 86  ? 2.849   -30.058 27.364  1.00 25.48 ? 296  LEU A C   1 
ATOM   583  O O   . LEU A 1 86  ? 3.237   -30.020 26.197  1.00 25.37 ? 296  LEU A O   1 
ATOM   584  C CB  . LEU A 1 86  ? 1.389   -32.037 27.914  1.00 24.71 ? 296  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 86  ? 1.338   -33.553 28.098  1.00 22.95 ? 296  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 86  ? -0.058  -34.023 28.446  1.00 22.47 ? 296  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 86  ? 1.807   -34.212 26.840  1.00 22.37 ? 296  LEU A CD2 1 
ATOM   588  N N   . THR A 1 87  ? 2.465   -28.974 28.037  1.00 26.09 ? 297  THR A N   1 
ATOM   589  C CA  . THR A 1 87  ? 2.612   -27.618 27.509  1.00 26.44 ? 297  THR A CA  1 
ATOM   590  C C   . THR A 1 87  ? 4.099   -27.266 27.306  1.00 27.07 ? 297  THR A C   1 
ATOM   591  O O   . THR A 1 87  ? 4.491   -26.803 26.217  1.00 26.99 ? 297  THR A O   1 
ATOM   592  C CB  . THR A 1 87  ? 1.919   -26.574 28.440  1.00 26.78 ? 297  THR A CB  1 
ATOM   593  O OG1 . THR A 1 87  ? 0.520   -26.877 28.548  1.00 26.31 ? 297  THR A OG1 1 
ATOM   594  C CG2 . THR A 1 87  ? 2.089   -25.139 27.909  1.00 25.50 ? 297  THR A CG2 1 
ATOM   595  N N   . GLU A 1 88  ? 4.918   -27.504 28.336  1.00 27.12 ? 298  GLU A N   1 
ATOM   596  C CA  . GLU A 1 88  ? 6.366   -27.262 28.238  1.00 27.98 ? 298  GLU A CA  1 
ATOM   597  C C   . GLU A 1 88  ? 7.038   -28.192 27.226  1.00 27.63 ? 298  GLU A C   1 
ATOM   598  O O   . GLU A 1 88  ? 7.973   -27.779 26.551  1.00 28.12 ? 298  GLU A O   1 
ATOM   599  C CB  . GLU A 1 88  ? 7.084   -27.345 29.599  1.00 28.08 ? 298  GLU A CB  1 
ATOM   600  C CG  . GLU A 1 88  ? 6.530   -26.462 30.729  1.00 29.98 ? 298  GLU A CG  1 
ATOM   601  C CD  . GLU A 1 88  ? 6.506   -24.965 30.414  1.00 32.83 ? 298  GLU A CD  1 
ATOM   602  O OE1 . GLU A 1 88  ? 7.372   -24.474 29.662  1.00 35.17 ? 298  GLU A OE1 1 
ATOM   603  O OE2 . GLU A 1 88  ? 5.611   -24.270 30.934  1.00 34.27 ? 298  GLU A OE2 1 
ATOM   604  N N   . PHE A 1 89  ? 6.563   -29.433 27.118  1.00 27.39 ? 299  PHE A N   1 
ATOM   605  C CA  . PHE A 1 89  ? 7.044   -30.365 26.078  1.00 27.41 ? 299  PHE A CA  1 
ATOM   606  C C   . PHE A 1 89  ? 6.732   -29.847 24.660  1.00 27.57 ? 299  PHE A C   1 
ATOM   607  O O   . PHE A 1 89  ? 7.599   -29.852 23.781  1.00 27.39 ? 299  PHE A O   1 
ATOM   608  C CB  . PHE A 1 89  ? 6.479   -31.782 26.302  1.00 27.04 ? 299  PHE A CB  1 
ATOM   609  C CG  . PHE A 1 89  ? 6.717   -32.739 25.149  1.00 27.04 ? 299  PHE A CG  1 
ATOM   610  C CD1 . PHE A 1 89  ? 8.002   -33.147 24.807  1.00 26.13 ? 299  PHE A CD1 1 
ATOM   611  C CD2 . PHE A 1 89  ? 5.648   -33.240 24.411  1.00 27.33 ? 299  PHE A CD2 1 
ATOM   612  C CE1 . PHE A 1 89  ? 8.214   -34.025 23.736  1.00 26.11 ? 299  PHE A CE1 1 
ATOM   613  C CE2 . PHE A 1 89  ? 5.857   -34.131 23.343  1.00 25.85 ? 299  PHE A CE2 1 
ATOM   614  C CZ  . PHE A 1 89  ? 7.138   -34.519 23.009  1.00 25.52 ? 299  PHE A CZ  1 
ATOM   615  N N   . ALA A 1 90  ? 5.501   -29.392 24.446  1.00 28.03 ? 300  ALA A N   1 
ATOM   616  C CA  . ALA A 1 90  ? 5.096   -28.866 23.149  1.00 28.62 ? 300  ALA A CA  1 
ATOM   617  C C   . ALA A 1 90  ? 5.881   -27.600 22.789  1.00 29.59 ? 300  ALA A C   1 
ATOM   618  O O   . ALA A 1 90  ? 6.412   -27.493 21.677  1.00 29.20 ? 300  ALA A O   1 
ATOM   619  C CB  . ALA A 1 90  ? 3.597   -28.602 23.123  1.00 28.58 ? 300  ALA A CB  1 
ATOM   620  N N   . LYS A 1 91  ? 5.955   -26.657 23.737  1.00 30.36 ? 301  LYS A N   1 
ATOM   621  C CA  . LYS A 1 91  ? 6.733   -25.425 23.581  1.00 31.67 ? 301  LYS A CA  1 
ATOM   622  C C   . LYS A 1 91  ? 8.208   -25.698 23.274  1.00 32.80 ? 301  LYS A C   1 
ATOM   623  O O   . LYS A 1 91  ? 8.838   -24.932 22.543  1.00 33.01 ? 301  LYS A O   1 
ATOM   624  C CB  . LYS A 1 91  ? 6.612   -24.537 24.828  1.00 31.46 ? 301  LYS A CB  1 
ATOM   625  C CG  . LYS A 1 91  ? 5.273   -23.785 24.957  1.00 31.15 ? 301  LYS A CG  1 
ATOM   626  C CD  . LYS A 1 91  ? 5.075   -23.223 26.360  1.00 31.94 ? 301  LYS A CD  1 
ATOM   627  C CE  . LYS A 1 91  ? 6.091   -22.126 26.693  1.00 33.35 ? 301  LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 91  ? 6.153   -21.822 28.153  1.00 35.40 ? 301  LYS A NZ  1 
ATOM   629  N N   . SER A 1 92  ? 8.741   -26.797 23.820  1.00 33.97 ? 302  SER A N   1 
ATOM   630  C CA  . SER A 1 92  ? 10.137  -27.187 23.606  1.00 35.03 ? 302  SER A CA  1 
ATOM   631  C C   . SER A 1 92  ? 10.381  -27.743 22.211  1.00 35.60 ? 302  SER A C   1 
ATOM   632  O O   . SER A 1 92  ? 11.510  -28.099 21.874  1.00 36.05 ? 302  SER A O   1 
ATOM   633  C CB  . SER A 1 92  ? 10.613  -28.177 24.673  1.00 35.00 ? 302  SER A CB  1 
ATOM   634  O OG  . SER A 1 92  ? 10.704  -27.547 25.942  1.00 36.22 ? 302  SER A OG  1 
ATOM   635  N N   . ILE A 1 93  ? 9.327   -27.825 21.404  1.00 36.22 ? 303  ILE A N   1 
ATOM   636  C CA  . ILE A 1 93  ? 9.494   -28.092 19.971  1.00 37.12 ? 303  ILE A CA  1 
ATOM   637  C C   . ILE A 1 93  ? 9.248   -26.812 19.107  1.00 37.66 ? 303  ILE A C   1 
ATOM   638  O O   . ILE A 1 93  ? 8.227   -26.131 19.264  1.00 37.90 ? 303  ILE A O   1 
ATOM   639  C CB  . ILE A 1 93  ? 8.762   -29.405 19.490  1.00 36.94 ? 303  ILE A CB  1 
ATOM   640  C CG1 . ILE A 1 93  ? 8.156   -29.246 18.099  1.00 36.75 ? 303  ILE A CG1 1 
ATOM   641  C CG2 . ILE A 1 93  ? 7.714   -29.867 20.480  1.00 37.39 ? 303  ILE A CG2 1 
ATOM   642  C CD1 . ILE A 1 93  ? 7.717   -30.555 17.472  1.00 36.90 ? 303  ILE A CD1 1 
ATOM   643  N N   . PRO A 1 94  ? 10.220  -26.463 18.232  1.00 38.00 ? 304  PRO A N   1 
ATOM   644  C CA  . PRO A 1 94  ? 10.239  -25.169 17.517  1.00 38.17 ? 304  PRO A CA  1 
ATOM   645  C C   . PRO A 1 94  ? 9.013   -24.896 16.624  1.00 38.25 ? 304  PRO A C   1 
ATOM   646  O O   . PRO A 1 94  ? 8.377   -23.836 16.751  1.00 38.37 ? 304  PRO A O   1 
ATOM   647  C CB  . PRO A 1 94  ? 11.532  -25.247 16.688  1.00 38.41 ? 304  PRO A CB  1 
ATOM   648  C CG  . PRO A 1 94  ? 12.377  -26.269 17.404  1.00 38.34 ? 304  PRO A CG  1 
ATOM   649  C CD  . PRO A 1 94  ? 11.399  -27.284 17.899  1.00 38.01 ? 304  PRO A CD  1 
ATOM   650  N N   . SER A 1 95  ? 8.692   -25.847 15.745  1.00 37.91 ? 305  SER A N   1 
ATOM   651  C CA  . SER A 1 95  ? 7.491   -25.798 14.914  1.00 37.51 ? 305  SER A CA  1 
ATOM   652  C C   . SER A 1 95  ? 6.226   -25.500 15.731  1.00 37.38 ? 305  SER A C   1 
ATOM   653  O O   . SER A 1 95  ? 5.413   -24.667 15.337  1.00 37.58 ? 305  SER A O   1 
ATOM   654  C CB  . SER A 1 95  ? 7.329   -27.104 14.127  1.00 37.77 ? 305  SER A CB  1 
ATOM   655  O OG  . SER A 1 95  ? 7.366   -28.238 14.988  1.00 37.86 ? 305  SER A OG  1 
ATOM   656  N N   . PHE A 1 96  ? 6.065   -26.153 16.879  1.00 37.13 ? 306  PHE A N   1 
ATOM   657  C CA  . PHE A 1 96  ? 4.934   -25.830 17.747  1.00 36.77 ? 306  PHE A CA  1 
ATOM   658  C C   . PHE A 1 96  ? 4.997   -24.362 18.184  1.00 36.98 ? 306  PHE A C   1 
ATOM   659  O O   . PHE A 1 96  ? 3.982   -23.658 18.148  1.00 36.94 ? 306  PHE A O   1 
ATOM   660  C CB  . PHE A 1 96  ? 4.872   -26.769 18.957  1.00 36.38 ? 306  PHE A CB  1 
ATOM   661  C CG  . PHE A 1 96  ? 3.685   -26.529 19.864  1.00 35.74 ? 306  PHE A CG  1 
ATOM   662  C CD1 . PHE A 1 96  ? 3.768   -25.619 20.927  1.00 35.00 ? 306  PHE A CD1 1 
ATOM   663  C CD2 . PHE A 1 96  ? 2.489   -27.224 19.668  1.00 34.69 ? 306  PHE A CD2 1 
ATOM   664  C CE1 . PHE A 1 96  ? 2.670   -25.403 21.778  1.00 35.25 ? 306  PHE A CE1 1 
ATOM   665  C CE2 . PHE A 1 96  ? 1.375   -27.017 20.509  1.00 34.00 ? 306  PHE A CE2 1 
ATOM   666  C CZ  . PHE A 1 96  ? 1.463   -26.111 21.560  1.00 34.95 ? 306  PHE A CZ  1 
ATOM   667  N N   . SER A 1 97  ? 6.186   -23.905 18.583  1.00 37.23 ? 307  SER A N   1 
ATOM   668  C CA  . SER A 1 97  ? 6.364   -22.528 19.084  1.00 37.56 ? 307  SER A CA  1 
ATOM   669  C C   . SER A 1 97  ? 6.231   -21.442 18.003  1.00 37.47 ? 307  SER A C   1 
ATOM   670  O O   . SER A 1 97  ? 5.893   -20.297 18.310  1.00 37.35 ? 307  SER A O   1 
ATOM   671  C CB  . SER A 1 97  ? 7.685   -22.382 19.860  1.00 37.81 ? 307  SER A CB  1 
ATOM   672  O OG  . SER A 1 97  ? 7.596   -23.007 21.137  1.00 37.75 ? 307  SER A OG  1 
ATOM   673  N N   . SER A 1 98  ? 6.473   -21.809 16.744  1.00 37.28 ? 308  SER A N   1 
ATOM   674  C CA  . SER A 1 98  ? 6.267   -20.890 15.613  1.00 37.03 ? 308  SER A CA  1 
ATOM   675  C C   . SER A 1 98  ? 4.800   -20.553 15.384  1.00 36.37 ? 308  SER A C   1 
ATOM   676  O O   . SER A 1 98  ? 4.497   -19.498 14.841  1.00 36.59 ? 308  SER A O   1 
ATOM   677  C CB  . SER A 1 98  ? 6.833   -21.470 14.313  1.00 37.00 ? 308  SER A CB  1 
ATOM   678  O OG  . SER A 1 98  ? 8.150   -21.961 14.496  1.00 39.06 ? 308  SER A OG  1 
ATOM   679  N N   . LEU A 1 99  ? 3.899   -21.464 15.762  1.00 35.55 ? 309  LEU A N   1 
ATOM   680  C CA  . LEU A 1 99  ? 2.461   -21.262 15.598  1.00 34.53 ? 309  LEU A CA  1 
ATOM   681  C C   . LEU A 1 99  ? 1.997   -20.143 16.508  1.00 34.42 ? 309  LEU A C   1 
ATOM   682  O O   . LEU A 1 99  ? 2.576   -19.927 17.579  1.00 34.42 ? 309  LEU A O   1 
ATOM   683  C CB  . LEU A 1 99  ? 1.689   -22.536 15.952  1.00 34.69 ? 309  LEU A CB  1 
ATOM   684  C CG  . LEU A 1 99  ? 1.933   -23.844 15.184  1.00 34.60 ? 309  LEU A CG  1 
ATOM   685  C CD1 . LEU A 1 99  ? 1.261   -25.018 15.904  1.00 33.56 ? 309  LEU A CD1 1 
ATOM   686  C CD2 . LEU A 1 99  ? 1.461   -23.745 13.742  1.00 32.85 ? 309  LEU A CD2 1 
ATOM   687  N N   . PHE A 1 100 ? 0.958   -19.428 16.088  1.00 33.90 ? 310  PHE A N   1 
ATOM   688  C CA  . PHE A 1 100 ? 0.397   -18.374 16.916  1.00 33.36 ? 310  PHE A CA  1 
ATOM   689  C C   . PHE A 1 100 ? -0.225  -18.994 18.152  1.00 33.04 ? 310  PHE A C   1 
ATOM   690  O O   . PHE A 1 100 ? -0.832  -20.062 18.080  1.00 33.13 ? 310  PHE A O   1 
ATOM   691  C CB  . PHE A 1 100 ? -0.637  -17.560 16.147  1.00 33.82 ? 310  PHE A CB  1 
ATOM   692  C CG  . PHE A 1 100 ? -0.042  -16.510 15.241  1.00 34.10 ? 310  PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 100 ? 0.551   -15.367 15.772  1.00 34.42 ? 310  PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 100 ? -0.091  -16.661 13.856  1.00 35.09 ? 310  PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 100 ? 1.102   -14.390 14.938  1.00 35.27 ? 310  PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 100 ? 0.453   -15.685 13.003  1.00 35.43 ? 310  PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 100 ? 1.046   -14.549 13.549  1.00 34.89 ? 310  PHE A CZ  1 
ATOM   698  N N   . LEU A 1 101 ? -0.072  -18.309 19.282  1.00 32.29 ? 311  LEU A N   1 
ATOM   699  C CA  . LEU A 1 101 ? -0.453  -18.829 20.600  1.00 31.20 ? 311  LEU A CA  1 
ATOM   700  C C   . LEU A 1 101 ? -1.896  -19.345 20.685  1.00 30.53 ? 311  LEU A C   1 
ATOM   701  O O   . LEU A 1 101 ? -2.176  -20.246 21.483  1.00 30.17 ? 311  LEU A O   1 
ATOM   702  C CB  . LEU A 1 101 ? -0.184  -17.759 21.672  1.00 31.38 ? 311  LEU A CB  1 
ATOM   703  C CG  . LEU A 1 101 ? 0.224   -18.176 23.090  1.00 31.49 ? 311  LEU A CG  1 
ATOM   704  C CD1 . LEU A 1 101 ? 1.551   -18.925 23.089  1.00 32.25 ? 311  LEU A CD1 1 
ATOM   705  C CD2 . LEU A 1 101 ? 0.309   -16.968 24.003  1.00 30.99 ? 311  LEU A CD2 1 
ATOM   706  N N   . ASN A 1 102 ? -2.801  -18.790 19.868  1.00 29.44 ? 312  ASN A N   1 
ATOM   707  C CA  . ASN A 1 102 ? -4.182  -19.296 19.815  1.00 28.66 ? 312  ASN A CA  1 
ATOM   708  C C   . ASN A 1 102 ? -4.285  -20.705 19.196  1.00 28.49 ? 312  ASN A C   1 
ATOM   709  O O   . ASN A 1 102 ? -5.061  -21.542 19.673  1.00 28.75 ? 312  ASN A O   1 
ATOM   710  C CB  . ASN A 1 102 ? -5.161  -18.309 19.148  1.00 28.28 ? 312  ASN A CB  1 
ATOM   711  C CG  . ASN A 1 102 ? -4.829  -18.025 17.691  1.00 27.26 ? 312  ASN A CG  1 
ATOM   712  O OD1 . ASN A 1 102 ? -3.712  -17.654 17.361  1.00 29.58 ? 312  ASN A OD1 1 
ATOM   713  N ND2 . ASN A 1 102 ? -5.807  -18.177 16.823  1.00 26.09 ? 312  ASN A ND2 1 
ATOM   714  N N   . ASP A 1 103 ? -3.501  -20.968 18.153  1.00 27.34 ? 313  ASP A N   1 
ATOM   715  C CA  . ASP A 1 103 ? -3.375  -22.330 17.657  1.00 26.87 ? 313  ASP A CA  1 
ATOM   716  C C   . ASP A 1 103 ? -2.741  -23.275 18.693  1.00 26.68 ? 313  ASP A C   1 
ATOM   717  O O   . ASP A 1 103 ? -3.177  -24.437 18.836  1.00 25.85 ? 313  ASP A O   1 
ATOM   718  C CB  . ASP A 1 103 ? -2.614  -22.355 16.334  1.00 26.99 ? 313  ASP A CB  1 
ATOM   719  C CG  . ASP A 1 103 ? -3.529  -22.201 15.143  1.00 27.44 ? 313  ASP A CG  1 
ATOM   720  O OD1 . ASP A 1 103 ? -4.766  -22.291 15.336  1.00 28.25 ? 313  ASP A OD1 1 
ATOM   721  O OD2 . ASP A 1 103 ? -3.023  -22.011 14.009  1.00 28.31 ? 313  ASP A OD2 1 
ATOM   722  N N   . GLN A 1 104 ? -1.747  -22.776 19.438  1.00 26.07 ? 314  GLN A N   1 
ATOM   723  C CA  . GLN A 1 104 ? -1.090  -23.596 20.468  1.00 26.18 ? 314  GLN A CA  1 
ATOM   724  C C   . GLN A 1 104 ? -2.101  -24.101 21.498  1.00 25.87 ? 314  GLN A C   1 
ATOM   725  O O   . GLN A 1 104 ? -2.131  -25.301 21.820  1.00 24.99 ? 314  GLN A O   1 
ATOM   726  C CB  . GLN A 1 104 ? 0.073   -22.851 21.133  1.00 25.95 ? 314  GLN A CB  1 
ATOM   727  C CG  . GLN A 1 104 ? 1.266   -22.637 20.197  1.00 26.66 ? 314  GLN A CG  1 
ATOM   728  C CD  . GLN A 1 104 ? 2.429   -21.844 20.821  1.00 27.62 ? 314  GLN A CD  1 
ATOM   729  O OE1 . GLN A 1 104 ? 3.147   -21.120 20.118  1.00 30.19 ? 314  GLN A OE1 1 
ATOM   730  N NE2 . GLN A 1 104 ? 2.626   -21.992 22.130  1.00 28.06 ? 314  GLN A NE2 1 
ATOM   731  N N   . VAL A 1 105 ? -2.941  -23.175 21.978  1.00 25.46 ? 315  VAL A N   1 
ATOM   732  C CA  . VAL A 1 105 ? -4.002  -23.471 22.944  1.00 25.23 ? 315  VAL A CA  1 
ATOM   733  C C   . VAL A 1 105 ? -5.054  -24.442 22.390  1.00 24.90 ? 315  VAL A C   1 
ATOM   734  O O   . VAL A 1 105 ? -5.479  -25.346 23.087  1.00 25.36 ? 315  VAL A O   1 
ATOM   735  C CB  . VAL A 1 105 ? -4.678  -22.157 23.481  1.00 24.77 ? 315  VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 105 ? -6.015  -22.434 24.102  1.00 24.46 ? 315  VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 105 ? -3.779  -21.473 24.478  1.00 25.35 ? 315  VAL A CG2 1 
ATOM   738  N N   . THR A 1 106 ? -5.484  -24.244 21.155  1.00 24.64 ? 316  THR A N   1 
ATOM   739  C CA  . THR A 1 106 ? -6.463  -25.146 20.541  1.00 24.63 ? 316  THR A CA  1 
ATOM   740  C C   . THR A 1 106 ? -5.953  -26.600 20.530  1.00 24.42 ? 316  THR A C   1 
ATOM   741  O O   . THR A 1 106 ? -6.679  -27.524 20.894  1.00 24.60 ? 316  THR A O   1 
ATOM   742  C CB  . THR A 1 106 ? -6.820  -24.674 19.103  1.00 24.50 ? 316  THR A CB  1 
ATOM   743  O OG1 . THR A 1 106 ? -7.482  -23.408 19.167  1.00 25.39 ? 316  THR A OG1 1 
ATOM   744  C CG2 . THR A 1 106 ? -7.741  -25.670 18.388  1.00 24.76 ? 316  THR A CG2 1 
ATOM   745  N N   . LEU A 1 107 ? -4.699  -26.771 20.121  1.00 24.09 ? 317  LEU A N   1 
ATOM   746  C CA  . LEU A 1 107 ? -4.044  -28.068 19.975  1.00 24.01 ? 317  LEU A CA  1 
ATOM   747  C C   . LEU A 1 107 ? -3.939  -28.819 21.292  1.00 24.21 ? 317  LEU A C   1 
ATOM   748  O O   . LEU A 1 107 ? -4.233  -30.017 21.361  1.00 23.66 ? 317  LEU A O   1 
ATOM   749  C CB  . LEU A 1 107 ? -2.648  -27.858 19.394  1.00 23.68 ? 317  LEU A CB  1 
ATOM   750  C CG  . LEU A 1 107 ? -2.395  -28.183 17.925  1.00 23.98 ? 317  LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 107 ? -3.661  -28.347 17.120  1.00 23.50 ? 317  LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 107 ? -1.464  -27.159 17.320  1.00 23.17 ? 317  LEU A CD2 1 
ATOM   753  N N   . LEU A 1 108 ? -3.501  -28.092 22.321  1.00 24.32 ? 318  LEU A N   1 
ATOM   754  C CA  . LEU A 1 108 ? -3.450  -28.593 23.678  1.00 24.74 ? 318  LEU A CA  1 
ATOM   755  C C   . LEU A 1 108 ? -4.846  -28.841 24.241  1.00 25.04 ? 318  LEU A C   1 
ATOM   756  O O   . LEU A 1 108 ? -5.060  -29.827 24.932  1.00 25.86 ? 318  LEU A O   1 
ATOM   757  C CB  . LEU A 1 108 ? -2.650  -27.644 24.586  1.00 24.19 ? 318  LEU A CB  1 
ATOM   758  C CG  . LEU A 1 108 ? -1.126  -27.661 24.386  1.00 24.56 ? 318  LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 108 ? -0.491  -26.500 25.108  1.00 23.22 ? 318  LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 108 ? -0.480  -28.989 24.831  1.00 24.41 ? 318  LEU A CD2 1 
ATOM   761  N N   . LYS A 1 109 ? -5.800  -27.970 23.939  1.00 25.06 ? 319  LYS A N   1 
ATOM   762  C CA  . LYS A 1 109 ? -7.157  -28.164 24.433  1.00 25.44 ? 319  LYS A CA  1 
ATOM   763  C C   . LYS A 1 109 ? -7.678  -29.555 24.082  1.00 25.14 ? 319  LYS A C   1 
ATOM   764  O O   . LYS A 1 109 ? -8.231  -30.235 24.926  1.00 25.00 ? 319  LYS A O   1 
ATOM   765  C CB  . LYS A 1 109 ? -8.106  -27.100 23.875  1.00 25.67 ? 319  LYS A CB  1 
ATOM   766  C CG  . LYS A 1 109 ? -9.537  -27.151 24.435  1.00 26.02 ? 319  LYS A CG  1 
ATOM   767  C CD  . LYS A 1 109 ? -10.459 -26.252 23.626  1.00 26.36 ? 319  LYS A CD  1 
ATOM   768  C CE  . LYS A 1 109 ? -11.726 -25.911 24.393  1.00 28.47 ? 319  LYS A CE  1 
ATOM   769  N NZ  . LYS A 1 109 ? -12.560 -27.107 24.706  1.00 29.59 ? 319  LYS A NZ  1 
ATOM   770  N N   . TYR A 1 110 ? -7.463  -29.972 22.842  1.00 25.39 ? 320  TYR A N   1 
ATOM   771  C CA  . TYR A 1 110 ? -8.068  -31.186 22.301  1.00 25.54 ? 320  TYR A CA  1 
ATOM   772  C C   . TYR A 1 110 ? -7.123  -32.411 22.249  1.00 25.08 ? 320  TYR A C   1 
ATOM   773  O O   . TYR A 1 110 ? -7.577  -33.532 21.977  1.00 24.64 ? 320  TYR A O   1 
ATOM   774  C CB  . TYR A 1 110 ? -8.638  -30.893 20.892  1.00 26.59 ? 320  TYR A CB  1 
ATOM   775  C CG  . TYR A 1 110 ? -9.847  -29.966 20.857  1.00 28.23 ? 320  TYR A CG  1 
ATOM   776  C CD1 . TYR A 1 110 ? -11.134 -30.453 21.074  1.00 30.07 ? 320  TYR A CD1 1 
ATOM   777  C CD2 . TYR A 1 110 ? -9.704  -28.611 20.584  1.00 29.79 ? 320  TYR A CD2 1 
ATOM   778  C CE1 . TYR A 1 110 ? -12.245 -29.610 21.034  1.00 30.00 ? 320  TYR A CE1 1 
ATOM   779  C CE2 . TYR A 1 110 ? -10.813 -27.758 20.543  1.00 30.40 ? 320  TYR A CE2 1 
ATOM   780  C CZ  . TYR A 1 110 ? -12.076 -28.267 20.775  1.00 29.60 ? 320  TYR A CZ  1 
ATOM   781  O OH  . TYR A 1 110 ? -13.172 -27.429 20.740  1.00 28.92 ? 320  TYR A OH  1 
ATOM   782  N N   . GLY A 1 111 ? -5.821  -32.210 22.496  1.00 24.31 ? 321  GLY A N   1 
ATOM   783  C CA  . GLY A 1 111 ? -4.854  -33.318 22.422  1.00 23.46 ? 321  GLY A CA  1 
ATOM   784  C C   . GLY A 1 111 ? -4.296  -33.806 23.752  1.00 23.24 ? 321  GLY A C   1 
ATOM   785  O O   . GLY A 1 111 ? -3.731  -34.906 23.866  1.00 23.16 ? 321  GLY A O   1 
ATOM   786  N N   . VAL A 1 112 ? -4.467  -32.984 24.774  1.00 22.79 ? 322  VAL A N   1 
ATOM   787  C CA  . VAL A 1 112 ? -3.796  -33.196 26.041  1.00 21.96 ? 322  VAL A CA  1 
ATOM   788  C C   . VAL A 1 112 ? -4.322  -34.445 26.787  1.00 21.44 ? 322  VAL A C   1 
ATOM   789  O O   . VAL A 1 112 ? -3.531  -35.206 27.343  1.00 20.89 ? 322  VAL A O   1 
ATOM   790  C CB  . VAL A 1 112 ? -3.799  -31.877 26.855  1.00 21.94 ? 322  VAL A CB  1 
ATOM   791  C CG1 . VAL A 1 112 ? -4.976  -31.785 27.858  1.00 21.49 ? 322  VAL A CG1 1 
ATOM   792  C CG2 . VAL A 1 112 ? -2.467  -31.636 27.486  1.00 22.93 ? 322  VAL A CG2 1 
ATOM   793  N N   . HIS A 1 113 ? -5.631  -34.694 26.752  1.00 20.69 ? 323  HIS A N   1 
ATOM   794  C CA  . HIS A 1 113 ? -6.161  -35.893 27.408  1.00 20.99 ? 323  HIS A CA  1 
ATOM   795  C C   . HIS A 1 113 ? -5.858  -37.177 26.616  1.00 20.83 ? 323  HIS A C   1 
ATOM   796  O O   . HIS A 1 113 ? -5.712  -38.249 27.208  1.00 20.56 ? 323  HIS A O   1 
ATOM   797  C CB  . HIS A 1 113 ? -7.655  -35.755 27.723  1.00 21.24 ? 323  HIS A CB  1 
ATOM   798  C CG  . HIS A 1 113 ? -7.942  -34.923 28.939  1.00 21.75 ? 323  HIS A CG  1 
ATOM   799  N ND1 . HIS A 1 113 ? -8.226  -33.575 28.871  1.00 22.96 ? 323  HIS A ND1 1 
ATOM   800  C CD2 . HIS A 1 113 ? -7.983  -35.251 30.254  1.00 21.79 ? 323  HIS A CD2 1 
ATOM   801  C CE1 . HIS A 1 113 ? -8.424  -33.106 30.092  1.00 21.84 ? 323  HIS A CE1 1 
ATOM   802  N NE2 . HIS A 1 113 ? -8.294  -34.105 30.948  1.00 22.41 ? 323  HIS A NE2 1 
ATOM   803  N N   . GLU A 1 114 ? -5.743  -37.062 25.291  1.00 20.28 ? 324  GLU A N   1 
ATOM   804  C CA  . GLU A 1 114 ? -5.255  -38.174 24.470  1.00 20.96 ? 324  GLU A CA  1 
ATOM   805  C C   . GLU A 1 114 ? -3.822  -38.546 24.905  1.00 20.43 ? 324  GLU A C   1 
ATOM   806  O O   . GLU A 1 114 ? -3.527  -39.716 25.153  1.00 20.33 ? 324  GLU A O   1 
ATOM   807  C CB  . GLU A 1 114 ? -5.319  -37.845 22.968  1.00 20.70 ? 324  GLU A CB  1 
ATOM   808  C CG  . GLU A 1 114 ? -6.726  -37.922 22.326  1.00 22.20 ? 324  GLU A CG  1 
ATOM   809  C CD  . GLU A 1 114 ? -6.762  -37.420 20.872  1.00 22.26 ? 324  GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 114 ? -5.685  -37.240 20.257  1.00 24.77 ? 324  GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 114 ? -7.867  -37.205 20.335  1.00 23.44 ? 324  GLU A OE2 1 
ATOM   812  N N   . ALA A 1 115 ? -2.960  -37.540 25.049  1.00 19.79 ? 325  ALA A N   1 
ATOM   813  C CA  . ALA A 1 115 ? -1.579  -37.764 25.483  1.00 19.95 ? 325  ALA A CA  1 
ATOM   814  C C   . ALA A 1 115 ? -1.491  -38.291 26.922  1.00 20.15 ? 325  ALA A C   1 
ATOM   815  O O   . ALA A 1 115 ? -0.683  -39.173 27.208  1.00 19.18 ? 325  ALA A O   1 
ATOM   816  C CB  . ALA A 1 115 ? -0.750  -36.502 25.328  1.00 19.27 ? 325  ALA A CB  1 
ATOM   817  N N   . ILE A 1 116 ? -2.322  -37.747 27.809  1.00 20.12 ? 326  ILE A N   1 
ATOM   818  C CA  . ILE A 1 116 ? -2.311  -38.154 29.200  1.00 21.12 ? 326  ILE A CA  1 
ATOM   819  C C   . ILE A 1 116 ? -2.618  -39.647 29.304  1.00 21.50 ? 326  ILE A C   1 
ATOM   820  O O   . ILE A 1 116 ? -1.914  -40.392 29.996  1.00 21.79 ? 326  ILE A O   1 
ATOM   821  C CB  . ILE A 1 116 ? -3.295  -37.315 30.083  1.00 21.07 ? 326  ILE A CB  1 
ATOM   822  C CG1 . ILE A 1 116 ? -2.884  -35.839 30.090  1.00 20.97 ? 326  ILE A CG1 1 
ATOM   823  C CG2 . ILE A 1 116 ? -3.323  -37.855 31.513  1.00 21.38 ? 326  ILE A CG2 1 
ATOM   824  C CD1 . ILE A 1 116 ? -3.959  -34.859 30.572  1.00 21.14 ? 326  ILE A CD1 1 
ATOM   825  N N   . PHE A 1 117 ? -3.650  -40.082 28.593  1.00 22.25 ? 327  PHE A N   1 
ATOM   826  C CA  . PHE A 1 117 ? -4.069  -41.483 28.644  1.00 22.81 ? 327  PHE A CA  1 
ATOM   827  C C   . PHE A 1 117 ? -3.066  -42.427 27.981  1.00 22.72 ? 327  PHE A C   1 
ATOM   828  O O   . PHE A 1 117 ? -2.841  -43.528 28.468  1.00 22.15 ? 327  PHE A O   1 
ATOM   829  C CB  . PHE A 1 117 ? -5.485  -41.645 28.090  1.00 23.01 ? 327  PHE A CB  1 
ATOM   830  C CG  . PHE A 1 117 ? -6.528  -40.893 28.891  1.00 23.87 ? 327  PHE A CG  1 
ATOM   831  C CD1 . PHE A 1 117 ? -6.332  -40.640 30.251  1.00 24.22 ? 327  PHE A CD1 1 
ATOM   832  C CD2 . PHE A 1 117 ? -7.708  -40.474 28.304  1.00 23.60 ? 327  PHE A CD2 1 
ATOM   833  C CE1 . PHE A 1 117 ? -7.282  -39.946 30.991  1.00 25.19 ? 327  PHE A CE1 1 
ATOM   834  C CE2 . PHE A 1 117 ? -8.672  -39.786 29.043  1.00 24.67 ? 327  PHE A CE2 1 
ATOM   835  C CZ  . PHE A 1 117 ? -8.460  -39.524 30.382  1.00 24.19 ? 327  PHE A CZ  1 
ATOM   836  N N   . ALA A 1 118 ? -2.445  -41.980 26.894  1.00 23.11 ? 328  ALA A N   1 
ATOM   837  C CA  . ALA A 1 118 ? -1.333  -42.730 26.302  1.00 23.58 ? 328  ALA A CA  1 
ATOM   838  C C   . ALA A 1 118 ? -0.181  -42.896 27.312  1.00 24.00 ? 328  ALA A C   1 
ATOM   839  O O   . ALA A 1 118 ? 0.326   -43.996 27.482  1.00 23.97 ? 328  ALA A O   1 
ATOM   840  C CB  . ALA A 1 118 ? -0.848  -42.059 25.031  1.00 23.53 ? 328  ALA A CB  1 
ATOM   841  N N   . MET A 1 119 ? 0.188   -41.818 28.004  1.00 24.38 ? 329  MET A N   1 
ATOM   842  C CA  . MET A 1 119 ? 1.290   -41.840 28.971  1.00 25.75 ? 329  MET A CA  1 
ATOM   843  C C   . MET A 1 119 ? 0.989   -42.624 30.248  1.00 25.66 ? 329  MET A C   1 
ATOM   844  O O   . MET A 1 119 ? 1.903   -43.221 30.828  1.00 25.59 ? 329  MET A O   1 
ATOM   845  C CB  . MET A 1 119 ? 1.761   -40.421 29.322  1.00 25.19 ? 329  MET A CB  1 
ATOM   846  C CG  . MET A 1 119 ? 2.653   -39.795 28.250  1.00 26.88 ? 329  MET A CG  1 
ATOM   847  S SD  . MET A 1 119 ? 3.150   -38.097 28.618  1.00 27.84 ? 329  MET A SD  1 
ATOM   848  C CE  . MET A 1 119 ? 1.542   -37.331 28.787  1.00 24.99 ? 329  MET A CE  1 
ATOM   849  N N   . LEU A 1 120 ? -0.276  -42.614 30.681  1.00 25.54 ? 330  LEU A N   1 
ATOM   850  C CA  . LEU A 1 120 ? -0.734  -43.417 31.827  1.00 25.75 ? 330  LEU A CA  1 
ATOM   851  C C   . LEU A 1 120 ? -0.210  -44.855 31.744  1.00 25.29 ? 330  LEU A C   1 
ATOM   852  O O   . LEU A 1 120 ? 0.268   -45.421 32.738  1.00 24.75 ? 330  LEU A O   1 
ATOM   853  C CB  . LEU A 1 120 ? -2.257  -43.481 31.847  1.00 25.94 ? 330  LEU A CB  1 
ATOM   854  C CG  . LEU A 1 120 ? -3.016  -43.221 33.146  1.00 27.52 ? 330  LEU A CG  1 
ATOM   855  C CD1 . LEU A 1 120 ? -4.493  -43.574 32.927  1.00 26.64 ? 330  LEU A CD1 1 
ATOM   856  C CD2 . LEU A 1 120 ? -2.446  -43.948 34.348  1.00 26.42 ? 330  LEU A CD2 1 
ATOM   857  N N   . ALA A 1 121 ? -0.291  -45.415 30.537  1.00 24.66 ? 331  ALA A N   1 
ATOM   858  C CA  . ALA A 1 121 ? 0.161   -46.772 30.252  1.00 24.40 ? 331  ALA A CA  1 
ATOM   859  C C   . ALA A 1 121 ? 1.551   -47.054 30.829  1.00 24.69 ? 331  ALA A C   1 
ATOM   860  O O   . ALA A 1 121 ? 1.765   -48.118 31.434  1.00 25.12 ? 331  ALA A O   1 
ATOM   861  C CB  . ALA A 1 121 ? 0.118   -47.039 28.758  1.00 23.30 ? 331  ALA A CB  1 
ATOM   862  N N   . SER A 1 122 ? 2.470   -46.095 30.667  1.00 24.73 ? 332  SER A N   1 
ATOM   863  C CA  . SER A 1 122 ? 3.825   -46.162 31.245  1.00 24.93 ? 332  SER A CA  1 
ATOM   864  C C   . SER A 1 122 ? 3.836   -46.531 32.721  1.00 25.89 ? 332  SER A C   1 
ATOM   865  O O   . SER A 1 122 ? 4.650   -47.340 33.149  1.00 26.23 ? 332  SER A O   1 
ATOM   866  C CB  . SER A 1 122 ? 4.557   -44.832 31.077  1.00 24.40 ? 332  SER A CB  1 
ATOM   867  O OG  . SER A 1 122 ? 4.702   -44.502 29.717  1.00 22.95 ? 332  SER A OG  1 
ATOM   868  N N   . ILE A 1 123 ? 2.923   -45.944 33.493  1.00 26.92 ? 333  ILE A N   1 
ATOM   869  C CA  . ILE A 1 123 ? 2.897   -46.123 34.951  1.00 28.08 ? 333  ILE A CA  1 
ATOM   870  C C   . ILE A 1 123 ? 1.940   -47.225 35.434  1.00 28.63 ? 333  ILE A C   1 
ATOM   871  O O   . ILE A 1 123 ? 1.733   -47.405 36.641  1.00 28.19 ? 333  ILE A O   1 
ATOM   872  C CB  . ILE A 1 123 ? 2.563   -44.781 35.633  1.00 28.07 ? 333  ILE A CB  1 
ATOM   873  C CG1 . ILE A 1 123 ? 3.838   -43.966 35.831  1.00 28.44 ? 333  ILE A CG1 1 
ATOM   874  C CG2 . ILE A 1 123 ? 1.875   -45.004 36.949  1.00 29.10 ? 333  ILE A CG2 1 
ATOM   875  C CD1 . ILE A 1 123 ? 3.590   -42.470 35.981  1.00 30.30 ? 333  ILE A CD1 1 
ATOM   876  N N   . VAL A 1 124 ? 1.376   -47.967 34.486  1.00 29.65 ? 334  VAL A N   1 
ATOM   877  C CA  . VAL A 1 124 ? 0.322   -48.941 34.778  1.00 30.62 ? 334  VAL A CA  1 
ATOM   878  C C   . VAL A 1 124 ? 0.822   -50.374 34.593  1.00 31.71 ? 334  VAL A C   1 
ATOM   879  O O   . VAL A 1 124 ? 1.603   -50.658 33.673  1.00 32.05 ? 334  VAL A O   1 
ATOM   880  C CB  . VAL A 1 124 ? -0.925  -48.690 33.855  1.00 30.59 ? 334  VAL A CB  1 
ATOM   881  C CG1 . VAL A 1 124 ? -1.913  -49.840 33.898  1.00 30.63 ? 334  VAL A CG1 1 
ATOM   882  C CG2 . VAL A 1 124 ? -1.627  -47.382 34.219  1.00 29.50 ? 334  VAL A CG2 1 
ATOM   883  N N   . ASN A 1 125 ? 0.395   -51.271 35.481  1.00 32.42 ? 335  ASN A N   1 
ATOM   884  C CA  . ASN A 1 125 ? 0.370   -52.697 35.152  1.00 33.00 ? 335  ASN A CA  1 
ATOM   885  C C   . ASN A 1 125 ? -1.031  -53.224 35.450  1.00 33.49 ? 335  ASN A C   1 
ATOM   886  O O   . ASN A 1 125 ? -1.878  -52.467 35.935  1.00 33.61 ? 335  ASN A O   1 
ATOM   887  C CB  . ASN A 1 125 ? 1.506   -53.494 35.832  1.00 33.13 ? 335  ASN A CB  1 
ATOM   888  C CG  . ASN A 1 125 ? 1.315   -53.668 37.335  1.00 33.30 ? 335  ASN A CG  1 
ATOM   889  O OD1 . ASN A 1 125 ? 0.200   -53.825 37.825  1.00 34.51 ? 335  ASN A OD1 1 
ATOM   890  N ND2 . ASN A 1 125 ? 2.418   -53.685 38.066  1.00 32.89 ? 335  ASN A ND2 1 
ATOM   891  N N   . LYS A 1 126 ? -1.288  -54.496 35.152  1.00 33.85 ? 336  LYS A N   1 
ATOM   892  C CA  . LYS A 1 126 ? -2.633  -55.070 35.316  1.00 34.10 ? 336  LYS A CA  1 
ATOM   893  C C   . LYS A 1 126 ? -3.253  -54.860 36.707  1.00 34.00 ? 336  LYS A C   1 
ATOM   894  O O   . LYS A 1 126 ? -4.477  -54.843 36.841  1.00 34.20 ? 336  LYS A O   1 
ATOM   895  C CB  . LYS A 1 126 ? -2.641  -56.558 34.941  1.00 34.23 ? 336  LYS A CB  1 
ATOM   896  C CG  . LYS A 1 126 ? -1.869  -57.474 35.889  1.00 34.52 ? 336  LYS A CG  1 
ATOM   897  C CD  . LYS A 1 126 ? -1.397  -58.738 35.164  1.00 34.84 ? 336  LYS A CD  1 
ATOM   898  C CE  . LYS A 1 126 ? -1.676  -60.011 35.954  1.00 35.42 ? 336  LYS A CE  1 
ATOM   899  N NZ  . LYS A 1 126 ? -1.310  -59.919 37.399  1.00 36.88 ? 336  LYS A NZ  1 
ATOM   900  N N   . ASP A 1 127 ? -2.410  -54.661 37.720  1.00 33.82 ? 337  ASP A N   1 
ATOM   901  C CA  . ASP A 1 127 ? -2.862  -54.618 39.103  1.00 33.64 ? 337  ASP A CA  1 
ATOM   902  C C   . ASP A 1 127 ? -3.006  -53.238 39.715  1.00 33.40 ? 337  ASP A C   1 
ATOM   903  O O   . ASP A 1 127 ? -3.594  -53.106 40.786  1.00 33.30 ? 337  ASP A O   1 
ATOM   904  C CB  . ASP A 1 127 ? -1.946  -55.468 39.982  1.00 34.02 ? 337  ASP A CB  1 
ATOM   905  C CG  . ASP A 1 127 ? -2.040  -56.943 39.658  1.00 35.29 ? 337  ASP A CG  1 
ATOM   906  O OD1 . ASP A 1 127 ? -3.155  -57.421 39.350  1.00 36.11 ? 337  ASP A OD1 1 
ATOM   907  O OD2 . ASP A 1 127 ? -0.995  -57.622 39.709  1.00 37.83 ? 337  ASP A OD2 1 
ATOM   908  N N   . GLY A 1 128 ? -2.476  -52.213 39.058  1.00 33.09 ? 338  GLY A N   1 
ATOM   909  C CA  . GLY A 1 128 ? -2.557  -50.847 39.600  1.00 33.04 ? 338  GLY A CA  1 
ATOM   910  C C   . GLY A 1 128 ? -1.618  -49.833 38.963  1.00 32.83 ? 338  GLY A C   1 
ATOM   911  O O   . GLY A 1 128 ? -1.082  -50.059 37.873  1.00 32.25 ? 338  GLY A O   1 
ATOM   912  N N   . LEU A 1 129 ? -1.415  -48.717 39.655  1.00 32.91 ? 339  LEU A N   1 
ATOM   913  C CA  . LEU A 1 129 ? -0.605  -47.627 39.120  1.00 33.20 ? 339  LEU A CA  1 
ATOM   914  C C   . LEU A 1 129 ? 0.163   -46.846 40.181  1.00 33.12 ? 339  LEU A C   1 
ATOM   915  O O   . LEU A 1 129 ? -0.301  -46.677 41.312  1.00 33.32 ? 339  LEU A O   1 
ATOM   916  C CB  . LEU A 1 129 ? -1.467  -46.672 38.288  1.00 33.37 ? 339  LEU A CB  1 
ATOM   917  C CG  . LEU A 1 129 ? -2.249  -45.561 39.005  1.00 33.58 ? 339  LEU A CG  1 
ATOM   918  C CD1 . LEU A 1 129 ? -2.226  -44.317 38.150  1.00 34.06 ? 339  LEU A CD1 1 
ATOM   919  C CD2 . LEU A 1 129 ? -3.670  -45.973 39.329  1.00 32.85 ? 339  LEU A CD2 1 
ATOM   920  N N   . LEU A 1 130 ? 1.347   -46.380 39.794  1.00 33.13 ? 340  LEU A N   1 
ATOM   921  C CA  . LEU A 1 130 ? 2.152   -45.479 40.612  1.00 33.24 ? 340  LEU A CA  1 
ATOM   922  C C   . LEU A 1 130 ? 1.498   -44.114 40.757  1.00 33.39 ? 340  LEU A C   1 
ATOM   923  O O   . LEU A 1 130 ? 0.843   -43.607 39.833  1.00 33.32 ? 340  LEU A O   1 
ATOM   924  C CB  . LEU A 1 130 ? 3.545   -45.291 40.008  1.00 32.97 ? 340  LEU A CB  1 
ATOM   925  C CG  . LEU A 1 130 ? 4.461   -46.509 39.910  1.00 33.43 ? 340  LEU A CG  1 
ATOM   926  C CD1 . LEU A 1 130 ? 5.684   -46.216 39.023  1.00 31.84 ? 340  LEU A CD1 1 
ATOM   927  C CD2 . LEU A 1 130 ? 4.870   -46.961 41.307  1.00 33.00 ? 340  LEU A CD2 1 
ATOM   928  N N   . VAL A 1 131 ? 1.675   -43.536 41.934  1.00 33.58 ? 341  VAL A N   1 
ATOM   929  C CA  . VAL A 1 131 ? 1.262   -42.172 42.200  1.00 34.46 ? 341  VAL A CA  1 
ATOM   930  C C   . VAL A 1 131 ? 2.396   -41.483 42.928  1.00 35.25 ? 341  VAL A C   1 
ATOM   931  O O   . VAL A 1 131 ? 3.363   -42.132 43.343  1.00 35.41 ? 341  VAL A O   1 
ATOM   932  C CB  . VAL A 1 131 ? -0.059  -42.081 43.041  1.00 34.05 ? 341  VAL A CB  1 
ATOM   933  C CG1 . VAL A 1 131 ? -1.250  -42.562 42.237  1.00 33.13 ? 341  VAL A CG1 1 
ATOM   934  C CG2 . VAL A 1 131 ? 0.052   -42.851 44.377  1.00 34.17 ? 341  VAL A CG2 1 
ATOM   935  N N   . ALA A 1 132 ? 2.273   -40.168 43.075  1.00 36.56 ? 342  ALA A N   1 
ATOM   936  C CA  . ALA A 1 132 ? 3.208   -39.371 43.862  1.00 37.44 ? 342  ALA A CA  1 
ATOM   937  C C   . ALA A 1 132 ? 4.655   -39.683 43.471  1.00 38.06 ? 342  ALA A C   1 
ATOM   938  O O   . ALA A 1 132 ? 5.449   -40.146 44.286  1.00 38.38 ? 342  ALA A O   1 
ATOM   939  C CB  . ALA A 1 132 ? 2.963   -39.605 45.357  1.00 37.47 ? 342  ALA A CB  1 
ATOM   940  N N   . ASN A 1 133 ? 4.972   -39.459 42.198  1.00 38.92 ? 343  ASN A N   1 
ATOM   941  C CA  . ASN A 1 133 ? 6.332   -39.629 41.675  1.00 39.54 ? 343  ASN A CA  1 
ATOM   942  C C   . ASN A 1 133 ? 6.967   -40.995 41.972  1.00 39.36 ? 343  ASN A C   1 
ATOM   943  O O   . ASN A 1 133 ? 8.163   -41.088 42.256  1.00 39.76 ? 343  ASN A O   1 
ATOM   944  C CB  . ASN A 1 133 ? 7.250   -38.483 42.147  1.00 39.93 ? 343  ASN A CB  1 
ATOM   945  C CG  . ASN A 1 133 ? 8.450   -38.280 41.226  1.00 41.07 ? 343  ASN A CG  1 
ATOM   946  O OD1 . ASN A 1 133 ? 8.290   -38.118 40.017  1.00 42.57 ? 343  ASN A OD1 1 
ATOM   947  N ND2 . ASN A 1 133 ? 9.655   -38.312 41.792  1.00 41.38 ? 343  ASN A ND2 1 
ATOM   948  N N   . GLY A 1 134 ? 6.161   -42.051 41.903  1.00 39.13 ? 344  GLY A N   1 
ATOM   949  C CA  . GLY A 1 134 ? 6.649   -43.418 42.100  1.00 38.37 ? 344  GLY A CA  1 
ATOM   950  C C   . GLY A 1 134 ? 6.653   -43.895 43.542  1.00 37.90 ? 344  GLY A C   1 
ATOM   951  O O   . GLY A 1 134 ? 6.898   -45.074 43.814  1.00 38.11 ? 344  GLY A O   1 
ATOM   952  N N   . SER A 1 135 ? 6.358   -42.990 44.467  1.00 37.05 ? 345  SER A N   1 
ATOM   953  C CA  . SER A 1 135 ? 6.402   -43.305 45.889  1.00 36.29 ? 345  SER A CA  1 
ATOM   954  C C   . SER A 1 135 ? 5.266   -44.234 46.377  1.00 35.67 ? 345  SER A C   1 
ATOM   955  O O   . SER A 1 135 ? 5.445   -44.995 47.335  1.00 35.84 ? 345  SER A O   1 
ATOM   956  C CB  . SER A 1 135 ? 6.425   -42.008 46.689  1.00 36.12 ? 345  SER A CB  1 
ATOM   957  O OG  . SER A 1 135 ? 6.090   -42.250 48.037  1.00 38.21 ? 345  SER A OG  1 
ATOM   958  N N   . GLY A 1 136 ? 4.111   -44.174 45.719  1.00 34.63 ? 346  GLY A N   1 
ATOM   959  C CA  . GLY A 1 136 ? 2.958   -44.998 46.089  1.00 32.88 ? 346  GLY A CA  1 
ATOM   960  C C   . GLY A 1 136 ? 2.440   -45.831 44.933  1.00 31.89 ? 346  GLY A C   1 
ATOM   961  O O   . GLY A 1 136 ? 2.714   -45.536 43.768  1.00 31.91 ? 346  GLY A O   1 
ATOM   962  N N   . PHE A 1 137 ? 1.699   -46.882 45.263  1.00 30.86 ? 347  PHE A N   1 
ATOM   963  C CA  . PHE A 1 137 ? 1.054   -47.736 44.284  1.00 29.88 ? 347  PHE A CA  1 
ATOM   964  C C   . PHE A 1 137 ? -0.404  -47.897 44.706  1.00 29.70 ? 347  PHE A C   1 
ATOM   965  O O   . PHE A 1 137 ? -0.675  -48.381 45.802  1.00 29.72 ? 347  PHE A O   1 
ATOM   966  C CB  . PHE A 1 137 ? 1.753   -49.103 44.233  1.00 29.59 ? 347  PHE A CB  1 
ATOM   967  C CG  . PHE A 1 137 ? 1.293   -49.999 43.094  1.00 28.88 ? 347  PHE A CG  1 
ATOM   968  C CD1 . PHE A 1 137 ? 1.617   -49.704 41.774  1.00 28.10 ? 347  PHE A CD1 1 
ATOM   969  C CD2 . PHE A 1 137 ? 0.550   -51.144 43.351  1.00 28.65 ? 347  PHE A CD2 1 
ATOM   970  C CE1 . PHE A 1 137 ? 1.203   -50.535 40.738  1.00 27.57 ? 347  PHE A CE1 1 
ATOM   971  C CE2 . PHE A 1 137 ? 0.137   -51.983 42.320  1.00 27.99 ? 347  PHE A CE2 1 
ATOM   972  C CZ  . PHE A 1 137 ? 0.464   -51.677 41.013  1.00 27.86 ? 347  PHE A CZ  1 
ATOM   973  N N   . VAL A 1 138 ? -1.331  -47.470 43.847  1.00 29.20 ? 348  VAL A N   1 
ATOM   974  C CA  . VAL A 1 138 ? -2.770  -47.584 44.123  1.00 28.31 ? 348  VAL A CA  1 
ATOM   975  C C   . VAL A 1 138 ? -3.323  -48.755 43.324  1.00 28.15 ? 348  VAL A C   1 
ATOM   976  O O   . VAL A 1 138 ? -3.111  -48.832 42.121  1.00 28.36 ? 348  VAL A O   1 
ATOM   977  C CB  . VAL A 1 138 ? -3.521  -46.263 43.797  1.00 28.53 ? 348  VAL A CB  1 
ATOM   978  C CG1 . VAL A 1 138 ? -5.019  -46.384 44.071  1.00 26.79 ? 348  VAL A CG1 1 
ATOM   979  C CG2 . VAL A 1 138 ? -2.931  -45.101 44.615  1.00 28.42 ? 348  VAL A CG2 1 
ATOM   980  N N   . THR A 1 139 ? -4.013  -49.681 43.982  1.00 27.82 ? 349  THR A N   1 
ATOM   981  C CA  . THR A 1 139 ? -4.388  -50.913 43.295  1.00 27.90 ? 349  THR A CA  1 
ATOM   982  C C   . THR A 1 139 ? -5.621  -50.680 42.470  1.00 28.02 ? 349  THR A C   1 
ATOM   983  O O   . THR A 1 139 ? -6.453  -49.829 42.812  1.00 27.86 ? 349  THR A O   1 
ATOM   984  C CB  . THR A 1 139 ? -4.654  -52.096 44.252  1.00 27.89 ? 349  THR A CB  1 
ATOM   985  O OG1 . THR A 1 139 ? -5.924  -51.923 44.885  1.00 28.22 ? 349  THR A OG1 1 
ATOM   986  C CG2 . THR A 1 139 ? -3.551  -52.232 45.301  1.00 27.51 ? 349  THR A CG2 1 
ATOM   987  N N   . ARG A 1 140 ? -5.730  -51.451 41.394  1.00 28.17 ? 350  ARG A N   1 
ATOM   988  C CA  . ARG A 1 140 ? -6.821  -51.330 40.445  1.00 29.14 ? 350  ARG A CA  1 
ATOM   989  C C   . ARG A 1 140 ? -8.131  -51.795 41.057  1.00 29.46 ? 350  ARG A C   1 
ATOM   990  O O   . ARG A 1 140 ? -9.187  -51.259 40.721  1.00 29.55 ? 350  ARG A O   1 
ATOM   991  C CB  . ARG A 1 140 ? -6.496  -52.132 39.181  1.00 29.53 ? 350  ARG A CB  1 
ATOM   992  C CG  . ARG A 1 140 ? -7.561  -52.132 38.088  1.00 29.30 ? 350  ARG A CG  1 
ATOM   993  C CD  . ARG A 1 140 ? -7.152  -53.135 37.031  1.00 30.06 ? 350  ARG A CD  1 
ATOM   994  N NE  . ARG A 1 140 ? -8.059  -53.193 35.891  1.00 29.63 ? 350  ARG A NE  1 
ATOM   995  C CZ  . ARG A 1 140 ? -7.787  -53.848 34.769  1.00 30.04 ? 350  ARG A CZ  1 
ATOM   996  N NH1 . ARG A 1 140 ? -6.635  -54.496 34.631  1.00 30.44 ? 350  ARG A NH1 1 
ATOM   997  N NH2 . ARG A 1 140 ? -8.661  -53.850 33.777  1.00 30.37 ? 350  ARG A NH2 1 
ATOM   998  N N   . GLU A 1 141 ? -8.052  -52.785 41.953  1.00 29.98 ? 351  GLU A N   1 
ATOM   999  C CA  . GLU A 1 141 ? -9.223  -53.265 42.705  1.00 30.67 ? 351  GLU A CA  1 
ATOM   1000 C C   . GLU A 1 141 ? -9.796  -52.215 43.645  1.00 30.36 ? 351  GLU A C   1 
ATOM   1001 O O   . GLU A 1 141 ? -11.011 -52.051 43.704  1.00 30.18 ? 351  GLU A O   1 
ATOM   1002 C CB  . GLU A 1 141 ? -8.928  -54.555 43.480  1.00 30.91 ? 351  GLU A CB  1 
ATOM   1003 C CG  . GLU A 1 141 ? -9.303  -55.834 42.728  1.00 34.11 ? 351  GLU A CG  1 
ATOM   1004 C CD  . GLU A 1 141 ? -10.786 -55.902 42.314  1.00 37.50 ? 351  GLU A CD  1 
ATOM   1005 O OE1 . GLU A 1 141 ? -11.659 -55.356 43.033  1.00 39.28 ? 351  GLU A OE1 1 
ATOM   1006 O OE2 . GLU A 1 141 ? -11.073 -56.511 41.262  1.00 37.80 ? 351  GLU A OE2 1 
ATOM   1007 N N   . PHE A 1 142 ? -8.932  -51.497 44.361  1.00 30.41 ? 352  PHE A N   1 
ATOM   1008 C CA  . PHE A 1 142 ? -9.399  -50.387 45.202  1.00 30.96 ? 352  PHE A CA  1 
ATOM   1009 C C   . PHE A 1 142 ? -10.171 -49.354 44.387  1.00 31.18 ? 352  PHE A C   1 
ATOM   1010 O O   . PHE A 1 142 ? -11.268 -48.988 44.762  1.00 31.51 ? 352  PHE A O   1 
ATOM   1011 C CB  . PHE A 1 142 ? -8.254  -49.726 45.980  1.00 30.72 ? 352  PHE A CB  1 
ATOM   1012 C CG  . PHE A 1 142 ? -8.661  -48.467 46.710  1.00 30.74 ? 352  PHE A CG  1 
ATOM   1013 C CD1 . PHE A 1 142 ? -9.497  -48.527 47.833  1.00 29.29 ? 352  PHE A CD1 1 
ATOM   1014 C CD2 . PHE A 1 142 ? -8.218  -47.212 46.264  1.00 30.86 ? 352  PHE A CD2 1 
ATOM   1015 C CE1 . PHE A 1 142 ? -9.883  -47.365 48.494  1.00 28.91 ? 352  PHE A CE1 1 
ATOM   1016 C CE2 . PHE A 1 142 ? -8.591  -46.041 46.922  1.00 28.93 ? 352  PHE A CE2 1 
ATOM   1017 C CZ  . PHE A 1 142 ? -9.424  -46.116 48.032  1.00 30.31 ? 352  PHE A CZ  1 
ATOM   1018 N N   . LEU A 1 143 ? -9.597  -48.906 43.272  1.00 31.80 ? 353  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 143 ? -10.233 -47.932 42.372  1.00 32.25 ? 353  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 143 ? -11.610 -48.390 41.902  1.00 32.95 ? 353  LEU A C   1 
ATOM   1021 O O   . LEU A 1 143 ? -12.531 -47.579 41.799  1.00 32.54 ? 353  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 143 ? -9.333  -47.660 41.159  1.00 31.96 ? 353  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 143 ? -8.426  -46.420 41.090  1.00 31.72 ? 353  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 143 ? -8.165  -45.741 42.426  1.00 30.71 ? 353  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 143 ? -7.128  -46.768 40.394  1.00 31.01 ? 353  LEU A CD2 1 
ATOM   1026 N N   . ARG A 1 144 ? -11.733 -49.694 41.629  1.00 33.95 ? 354  ARG A N   1 
ATOM   1027 C CA  . ARG A 1 144 ? -12.999 -50.327 41.231  1.00 35.05 ? 354  ARG A CA  1 
ATOM   1028 C C   . ARG A 1 144 ? -14.048 -50.294 42.328  1.00 34.89 ? 354  ARG A C   1 
ATOM   1029 O O   . ARG A 1 144 ? -15.239 -50.355 42.039  1.00 34.84 ? 354  ARG A O   1 
ATOM   1030 C CB  . ARG A 1 144 ? -12.776 -51.792 40.854  1.00 35.46 ? 354  ARG A CB  1 
ATOM   1031 C CG  . ARG A 1 144 ? -12.144 -52.021 39.496  1.00 37.76 ? 354  ARG A CG  1 
ATOM   1032 C CD  . ARG A 1 144 ? -11.975 -53.516 39.246  1.00 41.29 ? 354  ARG A CD  1 
ATOM   1033 N NE  . ARG A 1 144 ? -11.288 -53.795 37.989  1.00 44.46 ? 354  ARG A NE  1 
ATOM   1034 C CZ  . ARG A 1 144 ? -11.149 -55.009 37.466  1.00 45.73 ? 354  ARG A CZ  1 
ATOM   1035 N NH1 . ARG A 1 144 ? -11.651 -56.067 38.095  1.00 46.20 ? 354  ARG A NH1 1 
ATOM   1036 N NH2 . ARG A 1 144 ? -10.509 -55.166 36.312  1.00 46.40 ? 354  ARG A NH2 1 
ATOM   1037 N N   . SER A 1 145 ? -13.592 -50.210 43.576  1.00 35.47 ? 355  SER A N   1 
ATOM   1038 C CA  . SER A 1 145 ? -14.459 -50.308 44.759  1.00 36.28 ? 355  SER A CA  1 
ATOM   1039 C C   . SER A 1 145 ? -15.164 -48.991 45.106  1.00 36.69 ? 355  SER A C   1 
ATOM   1040 O O   . SER A 1 145 ? -16.040 -48.951 45.968  1.00 36.59 ? 355  SER A O   1 
ATOM   1041 C CB  . SER A 1 145 ? -13.652 -50.813 45.964  1.00 36.17 ? 355  SER A CB  1 
ATOM   1042 O OG  . SER A 1 145 ? -12.958 -49.751 46.615  1.00 35.77 ? 355  SER A OG  1 
ATOM   1043 N N   . LEU A 1 146 ? -14.768 -47.919 44.427  1.00 37.47 ? 356  LEU A N   1 
ATOM   1044 C CA  . LEU A 1 146 ? -15.288 -46.580 44.692  1.00 38.24 ? 356  LEU A CA  1 
ATOM   1045 C C   . LEU A 1 146 ? -16.754 -46.451 44.261  1.00 38.80 ? 356  LEU A C   1 
ATOM   1046 O O   . LEU A 1 146 ? -17.250 -47.289 43.502  1.00 39.10 ? 356  LEU A O   1 
ATOM   1047 C CB  . LEU A 1 146 ? -14.404 -45.529 43.988  1.00 38.23 ? 356  LEU A CB  1 
ATOM   1048 C CG  . LEU A 1 146 ? -12.887 -45.558 44.268  1.00 37.94 ? 356  LEU A CG  1 
ATOM   1049 C CD1 . LEU A 1 146 ? -12.152 -44.558 43.402  1.00 36.74 ? 356  LEU A CD1 1 
ATOM   1050 C CD2 . LEU A 1 146 ? -12.540 -45.354 45.775  1.00 38.25 ? 356  LEU A CD2 1 
ATOM   1051 N N   . ARG A 1 147 ? -17.443 -45.420 44.761  1.00 39.38 ? 357  ARG A N   1 
ATOM   1052 C CA  . ARG A 1 147 ? -18.802 -45.072 44.304  1.00 39.90 ? 357  ARG A CA  1 
ATOM   1053 C C   . ARG A 1 147 ? -18.853 -45.081 42.787  1.00 40.19 ? 357  ARG A C   1 
ATOM   1054 O O   . ARG A 1 147 ? -17.854 -44.779 42.132  1.00 40.63 ? 357  ARG A O   1 
ATOM   1055 C CB  . ARG A 1 147 ? -19.223 -43.677 44.790  1.00 40.00 ? 357  ARG A CB  1 
ATOM   1056 C CG  . ARG A 1 147 ? -19.821 -43.630 46.169  1.00 39.62 ? 357  ARG A CG  1 
ATOM   1057 C CD  . ARG A 1 147 ? -21.024 -42.685 46.225  1.00 38.68 ? 357  ARG A CD  1 
ATOM   1058 N NE  . ARG A 1 147 ? -20.659 -41.271 46.281  1.00 36.73 ? 357  ARG A NE  1 
ATOM   1059 C CZ  . ARG A 1 147 ? -20.922 -40.383 45.326  1.00 36.13 ? 357  ARG A CZ  1 
ATOM   1060 N NH1 . ARG A 1 147 ? -21.561 -40.751 44.221  1.00 35.38 ? 357  ARG A NH1 1 
ATOM   1061 N NH2 . ARG A 1 147 ? -20.554 -39.116 45.481  1.00 35.22 ? 357  ARG A NH2 1 
ATOM   1062 N N   . LYS A 1 148 ? -20.029 -45.372 42.238  1.00 40.48 ? 358  LYS A N   1 
ATOM   1063 C CA  . LYS A 1 148 ? -20.147 -45.785 40.839  1.00 40.81 ? 358  LYS A CA  1 
ATOM   1064 C C   . LYS A 1 148 ? -19.797 -44.742 39.772  1.00 40.97 ? 358  LYS A C   1 
ATOM   1065 O O   . LYS A 1 148 ? -19.248 -45.114 38.716  1.00 41.61 ? 358  LYS A O   1 
ATOM   1066 C CB  . LYS A 1 148 ? -21.498 -46.450 40.553  1.00 40.84 ? 358  LYS A CB  1 
ATOM   1067 C CG  . LYS A 1 148 ? -21.499 -47.221 39.247  1.00 42.08 ? 358  LYS A CG  1 
ATOM   1068 C CD  . LYS A 1 148 ? -22.190 -48.570 39.354  1.00 43.50 ? 358  LYS A CD  1 
ATOM   1069 C CE  . LYS A 1 148 ? -21.777 -49.475 38.194  1.00 44.52 ? 358  LYS A CE  1 
ATOM   1070 N NZ  . LYS A 1 148 ? -21.934 -48.816 36.851  1.00 45.48 ? 358  LYS A NZ  1 
ATOM   1071 N N   . PRO A 1 149 ? -20.081 -43.441 40.019  1.00 40.40 ? 359  PRO A N   1 
ATOM   1072 C CA  . PRO A 1 149 ? -19.580 -42.566 38.961  1.00 39.98 ? 359  PRO A CA  1 
ATOM   1073 C C   . PRO A 1 149 ? -18.045 -42.628 38.925  1.00 39.34 ? 359  PRO A C   1 
ATOM   1074 O O   . PRO A 1 149 ? -17.449 -42.830 37.862  1.00 39.06 ? 359  PRO A O   1 
ATOM   1075 C CB  . PRO A 1 149 ? -20.067 -41.165 39.373  1.00 39.98 ? 359  PRO A CB  1 
ATOM   1076 C CG  . PRO A 1 149 ? -21.035 -41.372 40.478  1.00 40.20 ? 359  PRO A CG  1 
ATOM   1077 C CD  . PRO A 1 149 ? -20.748 -42.696 41.101  1.00 40.39 ? 359  PRO A CD  1 
ATOM   1078 N N   . PHE A 1 150 ? -17.426 -42.517 40.096  1.00 38.69 ? 360  PHE A N   1 
ATOM   1079 C CA  . PHE A 1 150 ? -15.982 -42.329 40.176  1.00 38.01 ? 360  PHE A CA  1 
ATOM   1080 C C   . PHE A 1 150 ? -15.171 -43.600 39.881  1.00 38.08 ? 360  PHE A C   1 
ATOM   1081 O O   . PHE A 1 150 ? -14.014 -43.516 39.464  1.00 38.08 ? 360  PHE A O   1 
ATOM   1082 C CB  . PHE A 1 150 ? -15.613 -41.664 41.503  1.00 37.65 ? 360  PHE A CB  1 
ATOM   1083 C CG  . PHE A 1 150 ? -16.398 -40.401 41.775  1.00 36.45 ? 360  PHE A CG  1 
ATOM   1084 C CD1 . PHE A 1 150 ? -16.134 -39.236 41.059  1.00 35.27 ? 360  PHE A CD1 1 
ATOM   1085 C CD2 . PHE A 1 150 ? -17.424 -40.391 42.719  1.00 35.50 ? 360  PHE A CD2 1 
ATOM   1086 C CE1 . PHE A 1 150 ? -16.862 -38.067 41.294  1.00 35.08 ? 360  PHE A CE1 1 
ATOM   1087 C CE2 . PHE A 1 150 ? -18.165 -39.233 42.962  1.00 35.87 ? 360  PHE A CE2 1 
ATOM   1088 C CZ  . PHE A 1 150 ? -17.882 -38.063 42.245  1.00 35.83 ? 360  PHE A CZ  1 
ATOM   1089 N N   . SER A 1 151 ? -15.801 -44.762 40.047  1.00 37.73 ? 361  SER A N   1 
ATOM   1090 C CA  . SER A 1 151 ? -15.180 -46.041 39.725  1.00 37.43 ? 361  SER A CA  1 
ATOM   1091 C C   . SER A 1 151 ? -15.281 -46.408 38.246  1.00 37.48 ? 361  SER A C   1 
ATOM   1092 O O   . SER A 1 151 ? -14.492 -47.211 37.758  1.00 37.52 ? 361  SER A O   1 
ATOM   1093 C CB  . SER A 1 151 ? -15.772 -47.164 40.583  1.00 37.75 ? 361  SER A CB  1 
ATOM   1094 O OG  . SER A 1 151 ? -17.175 -47.255 40.418  1.00 36.87 ? 361  SER A OG  1 
ATOM   1095 N N   . ASP A 1 152 ? -16.242 -45.825 37.534  1.00 37.27 ? 362  ASP A N   1 
ATOM   1096 C CA  . ASP A 1 152 ? -16.408 -46.091 36.103  1.00 37.09 ? 362  ASP A CA  1 
ATOM   1097 C C   . ASP A 1 152 ? -15.390 -45.368 35.212  1.00 36.49 ? 362  ASP A C   1 
ATOM   1098 O O   . ASP A 1 152 ? -15.146 -45.782 34.071  1.00 36.09 ? 362  ASP A O   1 
ATOM   1099 C CB  . ASP A 1 152 ? -17.813 -45.691 35.647  1.00 37.77 ? 362  ASP A CB  1 
ATOM   1100 C CG  . ASP A 1 152 ? -18.906 -46.584 36.231  1.00 39.91 ? 362  ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1 152 ? -19.944 -46.028 36.655  1.00 41.47 ? 362  ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1 152 ? -18.733 -47.827 36.263  1.00 40.99 ? 362  ASP A OD2 1 
ATOM   1103 N N   . ILE A 1 153 ? -14.818 -44.280 35.715  1.00 35.66 ? 363  ILE A N   1 
ATOM   1104 C CA  . ILE A 1 153 ? -14.011 -43.407 34.864  1.00 35.22 ? 363  ILE A CA  1 
ATOM   1105 C C   . ILE A 1 153 ? -12.606 -43.939 34.630  1.00 34.52 ? 363  ILE A C   1 
ATOM   1106 O O   . ILE A 1 153 ? -12.071 -43.789 33.540  1.00 33.97 ? 363  ILE A O   1 
ATOM   1107 C CB  . ILE A 1 153 ? -13.969 -41.938 35.355  1.00 35.52 ? 363  ILE A CB  1 
ATOM   1108 C CG1 . ILE A 1 153 ? -13.746 -41.862 36.860  1.00 35.05 ? 363  ILE A CG1 1 
ATOM   1109 C CG2 . ILE A 1 153 ? -15.255 -41.207 34.964  1.00 36.41 ? 363  ILE A CG2 1 
ATOM   1110 C CD1 . ILE A 1 153 ? -14.124 -40.532 37.474  1.00 35.83 ? 363  ILE A CD1 1 
ATOM   1111 N N   . ILE A 1 154 ? -12.032 -44.584 35.639  1.00 33.99 ? 364  ILE A N   1 
ATOM   1112 C CA  . ILE A 1 154 ? -10.636 -45.002 35.566  1.00 33.83 ? 364  ILE A CA  1 
ATOM   1113 C C   . ILE A 1 154 ? -10.440 -46.408 34.970  1.00 33.36 ? 364  ILE A C   1 
ATOM   1114 O O   . ILE A 1 154 ? -9.427  -46.676 34.328  1.00 33.25 ? 364  ILE A O   1 
ATOM   1115 C CB  . ILE A 1 154 ? -9.853  -44.717 36.916  1.00 34.01 ? 364  ILE A CB  1 
ATOM   1116 C CG1 . ILE A 1 154 ? -8.642  -45.643 37.105  1.00 34.34 ? 364  ILE A CG1 1 
ATOM   1117 C CG2 . ILE A 1 154 ? -10.784 -44.736 38.144  1.00 34.71 ? 364  ILE A CG2 1 
ATOM   1118 C CD1 . ILE A 1 154 ? -7.432  -45.283 36.235  1.00 35.05 ? 364  ILE A CD1 1 
ATOM   1119 N N   . GLU A 1 155 ? -11.429 -47.278 35.135  1.00 32.84 ? 365  GLU A N   1 
ATOM   1120 C CA  . GLU A 1 155 ? -11.334 -48.658 34.652  1.00 32.78 ? 365  GLU A CA  1 
ATOM   1121 C C   . GLU A 1 155 ? -11.070 -48.840 33.129  1.00 32.00 ? 365  GLU A C   1 
ATOM   1122 O O   . GLU A 1 155 ? -10.264 -49.698 32.758  1.00 31.82 ? 365  GLU A O   1 
ATOM   1123 C CB  . GLU A 1 155 ? -12.537 -49.499 35.132  1.00 33.10 ? 365  GLU A CB  1 
ATOM   1124 C CG  . GLU A 1 155 ? -12.530 -50.968 34.678  1.00 34.41 ? 365  GLU A CG  1 
ATOM   1125 C CD  . GLU A 1 155 ? -11.292 -51.750 35.146  1.00 38.64 ? 365  GLU A CD  1 
ATOM   1126 O OE1 . GLU A 1 155 ? -10.578 -51.290 36.080  1.00 39.03 ? 365  GLU A OE1 1 
ATOM   1127 O OE2 . GLU A 1 155 ? -11.029 -52.833 34.565  1.00 39.33 ? 365  GLU A OE2 1 
ATOM   1128 N N   . PRO A 1 156 ? -11.740 -48.052 32.254  1.00 31.37 ? 366  PRO A N   1 
ATOM   1129 C CA  . PRO A 1 156 ? -11.427 -48.125 30.819  1.00 30.96 ? 366  PRO A CA  1 
ATOM   1130 C C   . PRO A 1 156 ? -9.982  -47.754 30.462  1.00 30.37 ? 366  PRO A C   1 
ATOM   1131 O O   . PRO A 1 156 ? -9.436  -48.264 29.483  1.00 30.41 ? 366  PRO A O   1 
ATOM   1132 C CB  . PRO A 1 156 ? -12.402 -47.123 30.191  1.00 30.89 ? 366  PRO A CB  1 
ATOM   1133 C CG  . PRO A 1 156 ? -13.487 -46.993 31.171  1.00 31.48 ? 366  PRO A CG  1 
ATOM   1134 C CD  . PRO A 1 156 ? -12.839 -47.107 32.504  1.00 31.20 ? 366  PRO A CD  1 
ATOM   1135 N N   . LYS A 1 157 ? -9.374  -46.879 31.244  1.00 29.85 ? 367  LYS A N   1 
ATOM   1136 C CA  . LYS A 1 157 ? -7.977  -46.521 31.035  1.00 30.06 ? 367  LYS A CA  1 
ATOM   1137 C C   . LYS A 1 157 ? -7.039  -47.714 31.256  1.00 29.97 ? 367  LYS A C   1 
ATOM   1138 O O   . LYS A 1 157 ? -6.087  -47.886 30.506  1.00 29.47 ? 367  LYS A O   1 
ATOM   1139 C CB  . LYS A 1 157 ? -7.582  -45.341 31.924  1.00 29.95 ? 367  LYS A CB  1 
ATOM   1140 C CG  . LYS A 1 157 ? -8.118  -43.975 31.450  1.00 30.51 ? 367  LYS A CG  1 
ATOM   1141 C CD  . LYS A 1 157 ? -9.651  -43.878 31.467  1.00 30.32 ? 367  LYS A CD  1 
ATOM   1142 C CE  . LYS A 1 157 ? -10.107 -42.418 31.374  1.00 30.27 ? 367  LYS A CE  1 
ATOM   1143 N NZ  . LYS A 1 157 ? -11.585 -42.256 31.397  1.00 28.85 ? 367  LYS A NZ  1 
ATOM   1144 N N   . PHE A 1 158 ? -7.321  -48.529 32.281  1.00 30.18 ? 368  PHE A N   1 
ATOM   1145 C CA  . PHE A 1 158 ? -6.587  -49.776 32.524  1.00 30.41 ? 368  PHE A CA  1 
ATOM   1146 C C   . PHE A 1 158 ? -6.705  -50.735 31.338  1.00 30.62 ? 368  PHE A C   1 
ATOM   1147 O O   . PHE A 1 158 ? -5.708  -51.274 30.848  1.00 30.50 ? 368  PHE A O   1 
ATOM   1148 C CB  . PHE A 1 158 ? -7.101  -50.479 33.780  1.00 30.46 ? 368  PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 158 ? -6.457  -50.012 35.051  1.00 30.93 ? 368  PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 158 ? -5.207  -50.499 35.431  1.00 30.71 ? 368  PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 158 ? -7.107  -49.103 35.886  1.00 31.24 ? 368  PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 158 ? -4.605  -50.087 36.609  1.00 29.37 ? 368  PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 158 ? -6.506  -48.683 37.073  1.00 31.47 ? 368  PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 158 ? -5.252  -49.176 37.431  1.00 30.71 ? 368  PHE A CZ  1 
ATOM   1155 N N   . GLU A 1 159 ? -7.935  -50.950 30.883  1.00 30.76 ? 369  GLU A N   1 
ATOM   1156 C CA  . GLU A 1 159 ? -8.171  -51.806 29.727  1.00 30.95 ? 369  GLU A CA  1 
ATOM   1157 C C   . GLU A 1 159 ? -7.353  -51.308 28.537  1.00 29.85 ? 369  GLU A C   1 
ATOM   1158 O O   . GLU A 1 159 ? -6.762  -52.114 27.813  1.00 30.39 ? 369  GLU A O   1 
ATOM   1159 C CB  . GLU A 1 159 ? -9.675  -51.913 29.419  1.00 30.94 ? 369  GLU A CB  1 
ATOM   1160 C CG  . GLU A 1 159 ? -10.415 -52.797 30.441  1.00 32.71 ? 369  GLU A CG  1 
ATOM   1161 C CD  . GLU A 1 159 ? -11.938 -52.653 30.428  1.00 33.39 ? 369  GLU A CD  1 
ATOM   1162 O OE1 . GLU A 1 159 ? -12.462 -51.530 30.655  1.00 36.21 ? 369  GLU A OE1 1 
ATOM   1163 O OE2 . GLU A 1 159 ? -12.616 -53.689 30.230  1.00 36.50 ? 369  GLU A OE2 1 
ATOM   1164 N N   . PHE A 1 160 ? -7.285  -49.984 28.359  1.00 28.26 ? 370  PHE A N   1 
ATOM   1165 C CA  . PHE A 1 160 ? -6.491  -49.419 27.273  1.00 26.91 ? 370  PHE A CA  1 
ATOM   1166 C C   . PHE A 1 160 ? -5.018  -49.680 27.503  1.00 26.45 ? 370  PHE A C   1 
ATOM   1167 O O   . PHE A 1 160 ? -4.330  -50.187 26.614  1.00 26.00 ? 370  PHE A O   1 
ATOM   1168 C CB  . PHE A 1 160 ? -6.696  -47.903 27.088  1.00 26.21 ? 370  PHE A CB  1 
ATOM   1169 C CG  . PHE A 1 160 ? -5.874  -47.339 25.958  1.00 25.47 ? 370  PHE A CG  1 
ATOM   1170 C CD1 . PHE A 1 160 ? -4.575  -46.885 26.175  1.00 25.62 ? 370  PHE A CD1 1 
ATOM   1171 C CD2 . PHE A 1 160 ? -6.374  -47.318 24.670  1.00 23.73 ? 370  PHE A CD2 1 
ATOM   1172 C CE1 . PHE A 1 160 ? -3.801  -46.399 25.128  1.00 24.68 ? 370  PHE A CE1 1 
ATOM   1173 C CE2 . PHE A 1 160 ? -5.614  -46.835 23.626  1.00 24.82 ? 370  PHE A CE2 1 
ATOM   1174 C CZ  . PHE A 1 160 ? -4.320  -46.379 23.853  1.00 25.08 ? 370  PHE A CZ  1 
ATOM   1175 N N   . ALA A 1 161 ? -4.550  -49.307 28.698  1.00 25.88 ? 371  ALA A N   1 
ATOM   1176 C CA  . ALA A 1 161 ? -3.143  -49.405 29.068  1.00 25.89 ? 371  ALA A CA  1 
ATOM   1177 C C   . ALA A 1 161 ? -2.538  -50.794 28.853  1.00 26.11 ? 371  ALA A C   1 
ATOM   1178 O O   . ALA A 1 161 ? -1.452  -50.908 28.302  1.00 26.32 ? 371  ALA A O   1 
ATOM   1179 C CB  . ALA A 1 161 ? -2.950  -48.965 30.490  1.00 25.48 ? 371  ALA A CB  1 
ATOM   1180 N N   . VAL A 1 162 ? -3.237  -51.839 29.288  1.00 26.72 ? 372  VAL A N   1 
ATOM   1181 C CA  . VAL A 1 162 ? -2.730  -53.220 29.184  1.00 27.29 ? 372  VAL A CA  1 
ATOM   1182 C C   . VAL A 1 162 ? -2.497  -53.597 27.716  1.00 27.41 ? 372  VAL A C   1 
ATOM   1183 O O   . VAL A 1 162 ? -1.398  -54.013 27.342  1.00 27.76 ? 372  VAL A O   1 
ATOM   1184 C CB  . VAL A 1 162 ? -3.673  -54.234 29.875  1.00 27.14 ? 372  VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 162 ? -3.235  -55.659 29.599  1.00 28.08 ? 372  VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 162 ? -3.730  -53.973 31.377  1.00 26.88 ? 372  VAL A CG2 1 
ATOM   1187 N N   . LYS A 1 163 ? -3.519  -53.405 26.888  1.00 27.55 ? 373  LYS A N   1 
ATOM   1188 C CA  . LYS A 1 163 ? -3.387  -53.582 25.450  1.00 27.74 ? 373  LYS A CA  1 
ATOM   1189 C C   . LYS A 1 163 ? -2.301  -52.681 24.854  1.00 28.08 ? 373  LYS A C   1 
ATOM   1190 O O   . LYS A 1 163 ? -1.557  -53.113 23.963  1.00 28.29 ? 373  LYS A O   1 
ATOM   1191 C CB  . LYS A 1 163 ? -4.735  -53.385 24.748  1.00 27.93 ? 373  LYS A CB  1 
ATOM   1192 C CG  . LYS A 1 163 ? -5.768  -54.447 25.150  1.00 28.55 ? 373  LYS A CG  1 
ATOM   1193 C CD  . LYS A 1 163 ? -6.970  -54.501 24.226  1.00 29.07 ? 373  LYS A CD  1 
ATOM   1194 C CE  . LYS A 1 163 ? -8.172  -53.837 24.839  1.00 30.95 ? 373  LYS A CE  1 
ATOM   1195 N NZ  . LYS A 1 163 ? -8.099  -52.358 24.662  1.00 33.39 ? 373  LYS A NZ  1 
ATOM   1196 N N   . PHE A 1 164 ? -2.184  -51.445 25.353  1.00 27.50 ? 374  PHE A N   1 
ATOM   1197 C CA  . PHE A 1 164 ? -1.150  -50.539 24.852  1.00 27.01 ? 374  PHE A CA  1 
ATOM   1198 C C   . PHE A 1 164 ? 0.257   -51.009 25.248  1.00 27.15 ? 374  PHE A C   1 
ATOM   1199 O O   . PHE A 1 164 ? 1.178   -50.965 24.440  1.00 26.82 ? 374  PHE A O   1 
ATOM   1200 C CB  . PHE A 1 164 ? -1.394  -49.102 25.317  1.00 26.42 ? 374  PHE A CB  1 
ATOM   1201 C CG  . PHE A 1 164 ? -0.598  -48.068 24.558  1.00 25.37 ? 374  PHE A CG  1 
ATOM   1202 C CD1 . PHE A 1 164 ? -0.858  -47.818 23.214  1.00 23.46 ? 374  PHE A CD1 1 
ATOM   1203 C CD2 . PHE A 1 164 ? 0.409   -47.345 25.191  1.00 24.95 ? 374  PHE A CD2 1 
ATOM   1204 C CE1 . PHE A 1 164 ? -0.142  -46.853 22.512  1.00 23.98 ? 374  PHE A CE1 1 
ATOM   1205 C CE2 . PHE A 1 164 ? 1.146   -46.371 24.492  1.00 24.91 ? 374  PHE A CE2 1 
ATOM   1206 C CZ  . PHE A 1 164 ? 0.865   -46.127 23.147  1.00 24.53 ? 374  PHE A CZ  1 
ATOM   1207 N N   . ASN A 1 165 ? 0.409   -51.472 26.485  1.00 27.48 ? 375  ASN A N   1 
ATOM   1208 C CA  . ASN A 1 165 ? 1.710   -51.925 26.978  1.00 28.17 ? 375  ASN A CA  1 
ATOM   1209 C C   . ASN A 1 165 ? 2.248   -53.163 26.251  1.00 28.49 ? 375  ASN A C   1 
ATOM   1210 O O   . ASN A 1 165 ? 3.457   -53.333 26.155  1.00 28.92 ? 375  ASN A O   1 
ATOM   1211 C CB  . ASN A 1 165 ? 1.686   -52.144 28.506  1.00 27.89 ? 375  ASN A CB  1 
ATOM   1212 C CG  . ASN A 1 165 ? 1.744   -50.832 29.292  1.00 28.28 ? 375  ASN A CG  1 
ATOM   1213 O OD1 . ASN A 1 165 ? 2.097   -49.768 28.754  1.00 27.82 ? 375  ASN A OD1 1 
ATOM   1214 N ND2 . ASN A 1 165 ? 1.402   -50.905 30.570  1.00 24.58 ? 375  ASN A ND2 1 
ATOM   1215 N N   . ALA A 1 166 ? 1.360   -54.003 25.722  1.00 29.07 ? 376  ALA A N   1 
ATOM   1216 C CA  . ALA A 1 166 ? 1.781   -55.179 24.939  1.00 30.14 ? 376  ALA A CA  1 
ATOM   1217 C C   . ALA A 1 166 ? 2.701   -54.838 23.769  1.00 30.65 ? 376  ALA A C   1 
ATOM   1218 O O   . ALA A 1 166 ? 3.476   -55.689 23.323  1.00 31.47 ? 376  ALA A O   1 
ATOM   1219 C CB  . ALA A 1 166 ? 0.570   -55.980 24.442  1.00 29.50 ? 376  ALA A CB  1 
ATOM   1220 N N   . LEU A 1 167 ? 2.623   -53.599 23.286  1.00 31.13 ? 377  LEU A N   1 
ATOM   1221 C CA  . LEU A 1 167 ? 3.374   -53.155 22.102  1.00 31.38 ? 377  LEU A CA  1 
ATOM   1222 C C   . LEU A 1 167 ? 4.851   -52.875 22.421  1.00 31.64 ? 377  LEU A C   1 
ATOM   1223 O O   . LEU A 1 167 ? 5.689   -52.760 21.515  1.00 31.36 ? 377  LEU A O   1 
ATOM   1224 C CB  . LEU A 1 167 ? 2.697   -51.921 21.484  1.00 31.70 ? 377  LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 167 ? 1.243   -52.061 20.989  1.00 31.83 ? 377  LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 167 ? 0.693   -50.722 20.528  1.00 31.88 ? 377  LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 167 ? 1.144   -53.079 19.840  1.00 32.22 ? 377  LEU A CD2 1 
ATOM   1228 N N   . GLU A 1 168 ? 5.148   -52.764 23.719  1.00 31.93 ? 378  GLU A N   1 
ATOM   1229 C CA  . GLU A 1 168 ? 6.517   -52.663 24.236  1.00 32.17 ? 378  GLU A CA  1 
ATOM   1230 C C   . GLU A 1 168 ? 7.247   -51.437 23.703  1.00 31.63 ? 378  GLU A C   1 
ATOM   1231 O O   . GLU A 1 168 ? 8.411   -51.517 23.267  1.00 32.26 ? 378  GLU A O   1 
ATOM   1232 C CB  . GLU A 1 168 ? 7.303   -53.948 23.919  1.00 32.69 ? 378  GLU A CB  1 
ATOM   1233 C CG  . GLU A 1 168 ? 6.688   -55.221 24.515  1.00 33.29 ? 378  GLU A CG  1 
ATOM   1234 C CD  . GLU A 1 168 ? 7.629   -56.397 24.448  1.00 33.56 ? 378  GLU A CD  1 
ATOM   1235 O OE1 . GLU A 1 168 ? 8.033   -56.890 25.527  1.00 36.06 ? 378  GLU A OE1 1 
ATOM   1236 O OE2 . GLU A 1 168 ? 7.979   -56.820 23.322  1.00 34.52 ? 378  GLU A OE2 1 
ATOM   1237 N N   . LEU A 1 169 ? 6.557   -50.305 23.714  1.00 30.36 ? 379  LEU A N   1 
ATOM   1238 C CA  . LEU A 1 169 ? 7.172   -49.050 23.322  1.00 29.47 ? 379  LEU A CA  1 
ATOM   1239 C C   . LEU A 1 169 ? 8.111   -48.573 24.422  1.00 29.12 ? 379  LEU A C   1 
ATOM   1240 O O   . LEU A 1 169 ? 7.919   -48.887 25.601  1.00 28.70 ? 379  LEU A O   1 
ATOM   1241 C CB  . LEU A 1 169 ? 6.112   -47.996 23.025  1.00 29.27 ? 379  LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 169 ? 5.029   -48.329 21.987  1.00 28.76 ? 379  LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 169 ? 4.217   -47.076 21.740  1.00 27.18 ? 379  LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 169 ? 5.618   -48.821 20.685  1.00 29.28 ? 379  LEU A CD2 1 
ATOM   1245 N N   . ASP A 1 170 ? 9.142   -47.836 24.031  1.00 28.61 ? 380  ASP A N   1 
ATOM   1246 C CA  . ASP A 1 170 ? 10.010  -47.201 25.003  1.00 28.62 ? 380  ASP A CA  1 
ATOM   1247 C C   . ASP A 1 170 ? 9.820   -45.684 24.958  1.00 27.85 ? 380  ASP A C   1 
ATOM   1248 O O   . ASP A 1 170 ? 9.041   -45.181 24.148  1.00 27.94 ? 380  ASP A O   1 
ATOM   1249 C CB  . ASP A 1 170 ? 11.478  -47.628 24.812  1.00 28.74 ? 380  ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 170 ? 12.080  -47.158 23.493  1.00 30.36 ? 380  ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 170 ? 11.661  -46.113 22.946  1.00 30.64 ? 380  ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 170 ? 13.014  -47.835 23.012  1.00 32.89 ? 380  ASP A OD2 1 
ATOM   1253 N N   . ASP A 1 171 ? 10.535  -44.968 25.819  1.00 27.15 ? 381  ASP A N   1 
ATOM   1254 C CA  . ASP A 1 171 ? 10.379  -43.523 25.958  1.00 26.69 ? 381  ASP A CA  1 
ATOM   1255 C C   . ASP A 1 171 ? 10.601  -42.768 24.645  1.00 26.85 ? 381  ASP A C   1 
ATOM   1256 O O   . ASP A 1 171 ? 9.859   -41.828 24.338  1.00 26.71 ? 381  ASP A O   1 
ATOM   1257 C CB  . ASP A 1 171 ? 11.294  -42.988 27.060  1.00 26.43 ? 381  ASP A CB  1 
ATOM   1258 C CG  . ASP A 1 171 ? 10.766  -43.299 28.468  1.00 26.09 ? 381  ASP A CG  1 
ATOM   1259 O OD1 . ASP A 1 171 ? 9.792   -42.663 28.929  1.00 24.27 ? 381  ASP A OD1 1 
ATOM   1260 O OD2 . ASP A 1 171 ? 11.338  -44.183 29.119  1.00 25.66 ? 381  ASP A OD2 1 
ATOM   1261 N N   . SER A 1 172 ? 11.600  -43.195 23.866  1.00 26.65 ? 382  SER A N   1 
ATOM   1262 C CA  . SER A 1 172 ? 11.912  -42.546 22.589  1.00 26.46 ? 382  SER A CA  1 
ATOM   1263 C C   . SER A 1 172 ? 10.771  -42.744 21.586  1.00 26.15 ? 382  SER A C   1 
ATOM   1264 O O   . SER A 1 172 ? 10.452  -41.838 20.825  1.00 26.76 ? 382  SER A O   1 
ATOM   1265 C CB  . SER A 1 172 ? 13.255  -43.035 22.023  1.00 26.45 ? 382  SER A CB  1 
ATOM   1266 O OG  . SER A 1 172 ? 13.177  -44.387 21.579  1.00 26.17 ? 382  SER A OG  1 
ATOM   1267 N N   . ASP A 1 173 ? 10.159  -43.923 21.599  1.00 25.96 ? 383  ASP A N   1 
ATOM   1268 C CA  . ASP A 1 173 ? 8.935   -44.186 20.830  1.00 25.85 ? 383  ASP A CA  1 
ATOM   1269 C C   . ASP A 1 173 ? 7.785   -43.274 21.292  1.00 25.54 ? 383  ASP A C   1 
ATOM   1270 O O   . ASP A 1 173 ? 7.035   -42.737 20.472  1.00 25.74 ? 383  ASP A O   1 
ATOM   1271 C CB  . ASP A 1 173 ? 8.504   -45.642 20.997  1.00 25.98 ? 383  ASP A CB  1 
ATOM   1272 C CG  . ASP A 1 173 ? 9.609   -46.636 20.638  1.00 27.18 ? 383  ASP A CG  1 
ATOM   1273 O OD1 . ASP A 1 173 ? 10.385  -46.356 19.693  1.00 29.80 ? 383  ASP A OD1 1 
ATOM   1274 O OD2 . ASP A 1 173 ? 9.699   -47.699 21.300  1.00 25.81 ? 383  ASP A OD2 1 
ATOM   1275 N N   . LEU A 1 174 ? 7.660   -43.105 22.609  1.00 24.68 ? 384  LEU A N   1 
ATOM   1276 C CA  . LEU A 1 174 ? 6.568   -42.324 23.196  1.00 23.87 ? 384  LEU A CA  1 
ATOM   1277 C C   . LEU A 1 174 ? 6.737   -40.852 22.892  1.00 23.58 ? 384  LEU A C   1 
ATOM   1278 O O   . LEU A 1 174 ? 5.763   -40.176 22.562  1.00 23.17 ? 384  LEU A O   1 
ATOM   1279 C CB  . LEU A 1 174 ? 6.455   -42.560 24.711  1.00 23.55 ? 384  LEU A CB  1 
ATOM   1280 C CG  . LEU A 1 174 ? 5.954   -43.949 25.124  1.00 22.61 ? 384  LEU A CG  1 
ATOM   1281 C CD1 . LEU A 1 174 ? 6.045   -44.144 26.637  1.00 22.52 ? 384  LEU A CD1 1 
ATOM   1282 C CD2 . LEU A 1 174 ? 4.534   -44.202 24.622  1.00 20.85 ? 384  LEU A CD2 1 
ATOM   1283 N N   . ALA A 1 175 ? 7.976   -40.363 22.968  1.00 23.19 ? 385  ALA A N   1 
ATOM   1284 C CA  . ALA A 1 175 ? 8.240   -38.951 22.683  1.00 22.98 ? 385  ALA A CA  1 
ATOM   1285 C C   . ALA A 1 175 ? 7.628   -38.528 21.338  1.00 22.82 ? 385  ALA A C   1 
ATOM   1286 O O   . ALA A 1 175 ? 6.970   -37.492 21.251  1.00 22.92 ? 385  ALA A O   1 
ATOM   1287 C CB  . ALA A 1 175 ? 9.735   -38.661 22.728  1.00 23.19 ? 385  ALA A CB  1 
ATOM   1288 N N   . LEU A 1 176 ? 7.831   -39.354 20.311  1.00 22.45 ? 386  LEU A N   1 
ATOM   1289 C CA  . LEU A 1 176 ? 7.296   -39.112 18.960  1.00 22.37 ? 386  LEU A CA  1 
ATOM   1290 C C   . LEU A 1 176 ? 5.773   -39.300 18.867  1.00 21.99 ? 386  LEU A C   1 
ATOM   1291 O O   . LEU A 1 176 ? 5.080   -38.487 18.267  1.00 22.08 ? 386  LEU A O   1 
ATOM   1292 C CB  . LEU A 1 176 ? 7.999   -40.028 17.942  1.00 22.08 ? 386  LEU A CB  1 
ATOM   1293 C CG  . LEU A 1 176 ? 9.424   -39.639 17.509  1.00 22.98 ? 386  LEU A CG  1 
ATOM   1294 C CD1 . LEU A 1 176 ? 10.016  -40.740 16.683  1.00 22.11 ? 386  LEU A CD1 1 
ATOM   1295 C CD2 . LEU A 1 176 ? 9.470   -38.311 16.724  1.00 22.75 ? 386  LEU A CD2 1 
ATOM   1296 N N   . PHE A 1 177 ? 5.272   -40.382 19.460  1.00 21.85 ? 387  PHE A N   1 
ATOM   1297 C CA  . PHE A 1 177 ? 3.845   -40.721 19.471  1.00 21.68 ? 387  PHE A CA  1 
ATOM   1298 C C   . PHE A 1 177 ? 3.031   -39.568 20.069  1.00 21.28 ? 387  PHE A C   1 
ATOM   1299 O O   . PHE A 1 177 ? 1.997   -39.161 19.532  1.00 20.66 ? 387  PHE A O   1 
ATOM   1300 C CB  . PHE A 1 177 ? 3.648   -42.005 20.302  1.00 21.49 ? 387  PHE A CB  1 
ATOM   1301 C CG  . PHE A 1 177 ? 2.251   -42.585 20.250  1.00 21.40 ? 387  PHE A CG  1 
ATOM   1302 C CD1 . PHE A 1 177 ? 1.855   -43.401 19.195  1.00 22.45 ? 387  PHE A CD1 1 
ATOM   1303 C CD2 . PHE A 1 177 ? 1.350   -42.361 21.291  1.00 21.57 ? 387  PHE A CD2 1 
ATOM   1304 C CE1 . PHE A 1 177 ? 0.558   -43.952 19.159  1.00 19.74 ? 387  PHE A CE1 1 
ATOM   1305 C CE2 . PHE A 1 177 ? 0.072   -42.915 21.263  1.00 20.08 ? 387  PHE A CE2 1 
ATOM   1306 C CZ  . PHE A 1 177 ? -0.319  -43.711 20.190  1.00 19.65 ? 387  PHE A CZ  1 
ATOM   1307 N N   . ILE A 1 178 ? 3.517   -39.046 21.182  1.00 21.79 ? 388  ILE A N   1 
ATOM   1308 C CA  . ILE A 1 178 ? 2.819   -37.990 21.903  1.00 22.79 ? 388  ILE A CA  1 
ATOM   1309 C C   . ILE A 1 178 ? 2.907   -36.651 21.138  1.00 22.52 ? 388  ILE A C   1 
ATOM   1310 O O   . ILE A 1 178 ? 1.922   -35.911 21.069  1.00 21.91 ? 388  ILE A O   1 
ATOM   1311 C CB  . ILE A 1 178 ? 3.245   -37.951 23.411  1.00 23.36 ? 388  ILE A CB  1 
ATOM   1312 C CG1 . ILE A 1 178 ? 2.341   -37.036 24.237  1.00 25.05 ? 388  ILE A CG1 1 
ATOM   1313 C CG2 . ILE A 1 178 ? 4.718   -37.559 23.594  1.00 25.77 ? 388  ILE A CG2 1 
ATOM   1314 C CD1 . ILE A 1 178 ? 2.655   -35.568 24.090  1.00 25.93 ? 388  ILE A CD1 1 
ATOM   1315 N N   . ALA A 1 179 ? 4.057   -36.387 20.505  1.00 22.43 ? 389  ALA A N   1 
ATOM   1316 C CA  . ALA A 1 179 ? 4.205   -35.224 19.631  1.00 22.58 ? 389  ALA A CA  1 
ATOM   1317 C C   . ALA A 1 179 ? 3.133   -35.262 18.546  1.00 22.88 ? 389  ALA A C   1 
ATOM   1318 O O   . ALA A 1 179 ? 2.521   -34.234 18.248  1.00 22.54 ? 389  ALA A O   1 
ATOM   1319 C CB  . ALA A 1 179 ? 5.608   -35.182 18.994  1.00 22.34 ? 389  ALA A CB  1 
ATOM   1320 N N   . ALA A 1 180 ? 2.910   -36.456 17.984  1.00 23.06 ? 390  ALA A N   1 
ATOM   1321 C CA  . ALA A 1 180 ? 1.949   -36.680 16.892  1.00 23.80 ? 390  ALA A CA  1 
ATOM   1322 C C   . ALA A 1 180 ? 0.492   -36.503 17.329  1.00 24.40 ? 390  ALA A C   1 
ATOM   1323 O O   . ALA A 1 180 ? -0.333  -35.995 16.567  1.00 25.21 ? 390  ALA A O   1 
ATOM   1324 C CB  . ALA A 1 180 ? 2.154   -38.056 16.273  1.00 22.99 ? 390  ALA A CB  1 
ATOM   1325 N N   . ILE A 1 181 ? 0.179   -36.952 18.539  1.00 24.70 ? 391  ILE A N   1 
ATOM   1326 C CA  . ILE A 1 181 ? -1.114  -36.684 19.148  1.00 25.61 ? 391  ILE A CA  1 
ATOM   1327 C C   . ILE A 1 181 ? -1.389  -35.168 19.301  1.00 25.95 ? 391  ILE A C   1 
ATOM   1328 O O   . ILE A 1 181 ? -2.469  -34.706 18.953  1.00 26.80 ? 391  ILE A O   1 
ATOM   1329 C CB  . ILE A 1 181 ? -1.248  -37.400 20.518  1.00 25.35 ? 391  ILE A CB  1 
ATOM   1330 C CG1 . ILE A 1 181 ? -1.356  -38.914 20.325  1.00 25.41 ? 391  ILE A CG1 1 
ATOM   1331 C CG2 . ILE A 1 181 ? -2.444  -36.866 21.301  1.00 25.86 ? 391  ILE A CG2 1 
ATOM   1332 C CD1 . ILE A 1 181 ? -1.167  -39.697 21.617  1.00 27.06 ? 391  ILE A CD1 1 
ATOM   1333 N N   . ILE A 1 182 ? -0.437  -34.401 19.814  1.00 26.21 ? 392  ILE A N   1 
ATOM   1334 C CA  . ILE A 1 182 ? -0.685  -32.969 20.037  1.00 27.35 ? 392  ILE A CA  1 
ATOM   1335 C C   . ILE A 1 182 ? -0.747  -32.205 18.715  1.00 28.09 ? 392  ILE A C   1 
ATOM   1336 O O   . ILE A 1 182 ? -1.672  -31.425 18.480  1.00 28.48 ? 392  ILE A O   1 
ATOM   1337 C CB  . ILE A 1 182 ? 0.345   -32.320 21.007  1.00 27.10 ? 392  ILE A CB  1 
ATOM   1338 C CG1 . ILE A 1 182 ? 0.297   -33.010 22.380  1.00 27.50 ? 392  ILE A CG1 1 
ATOM   1339 C CG2 . ILE A 1 182 ? 0.096   -30.801 21.135  1.00 26.21 ? 392  ILE A CG2 1 
ATOM   1340 C CD1 . ILE A 1 182 ? 1.265   -32.444 23.423  1.00 28.06 ? 392  ILE A CD1 1 
ATOM   1341 N N   . LEU A 1 183 ? 0.220   -32.445 17.841  1.00 29.18 ? 393  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 183 ? 0.239   -31.774 16.539  1.00 30.24 ? 393  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 183 ? -0.684  -32.452 15.527  1.00 30.76 ? 393  LEU A C   1 
ATOM   1344 O O   . LEU A 1 183 ? -0.242  -33.111 14.587  1.00 31.08 ? 393  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 183 ? 1.672   -31.598 16.044  1.00 29.74 ? 393  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 183 ? 2.208   -30.427 16.869  1.00 30.63 ? 393  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 183 ? 3.484   -30.782 17.617  1.00 31.73 ? 393  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 183 ? 2.348   -29.154 16.026  1.00 29.93 ? 393  LEU A CD2 1 
ATOM   1349 N N   . CYS A 1 184 ? -1.979  -32.270 15.759  1.00 31.84 ? 394  CYS A N   1 
ATOM   1350 C CA  . CYS A 1 184 ? -3.044  -32.921 15.009  1.00 32.52 ? 394  CYS A CA  1 
ATOM   1351 C C   . CYS A 1 184 ? -3.885  -31.878 14.278  1.00 32.92 ? 394  CYS A C   1 
ATOM   1352 O O   . CYS A 1 184 ? -4.528  -31.027 14.907  1.00 32.81 ? 394  CYS A O   1 
ATOM   1353 C CB  . CYS A 1 184 ? -3.895  -33.752 15.972  1.00 32.55 ? 394  CYS A CB  1 
ATOM   1354 S SG  . CYS A 1 184 ? -5.527  -34.206 15.396  1.00 33.17 ? 394  CYS A SG  1 
ATOM   1355 N N   . GLY A 1 185 ? -3.869  -31.945 12.950  1.00 33.52 ? 395  GLY A N   1 
ATOM   1356 C CA  . GLY A 1 185 ? -4.508  -30.925 12.112  1.00 34.37 ? 395  GLY A CA  1 
ATOM   1357 C C   . GLY A 1 185 ? -6.020  -31.005 12.060  1.00 35.01 ? 395  GLY A C   1 
ATOM   1358 O O   . GLY A 1 185 ? -6.661  -30.237 11.350  1.00 35.03 ? 395  GLY A O   1 
ATOM   1359 N N   . ASP A 1 186 ? -6.585  -31.926 12.834  1.00 35.66 ? 396  ASP A N   1 
ATOM   1360 C CA  . ASP A 1 186 ? -8.006  -32.243 12.791  1.00 36.39 ? 396  ASP A CA  1 
ATOM   1361 C C   . ASP A 1 186 ? -8.841  -31.506 13.864  1.00 36.15 ? 396  ASP A C   1 
ATOM   1362 O O   . ASP A 1 186 ? -10.066 -31.603 13.876  1.00 35.75 ? 396  ASP A O   1 
ATOM   1363 C CB  . ASP A 1 186 ? -8.152  -33.765 12.943  1.00 37.08 ? 396  ASP A CB  1 
ATOM   1364 C CG  . ASP A 1 186 ? -9.463  -34.293 12.415  1.00 39.34 ? 396  ASP A CG  1 
ATOM   1365 O OD1 . ASP A 1 186 ? -10.234 -33.533 11.787  1.00 42.64 ? 396  ASP A OD1 1 
ATOM   1366 O OD2 . ASP A 1 186 ? -9.723  -35.494 12.624  1.00 43.08 ? 396  ASP A OD2 1 
ATOM   1367 N N   . ARG A 1 187 ? -8.177  -30.771 14.759  1.00 35.93 ? 397  ARG A N   1 
ATOM   1368 C CA  . ARG A 1 187 ? -8.861  -30.122 15.892  1.00 35.62 ? 397  ARG A CA  1 
ATOM   1369 C C   . ARG A 1 187 ? -9.802  -28.965 15.471  1.00 35.95 ? 397  ARG A C   1 
ATOM   1370 O O   . ARG A 1 187 ? -9.487  -28.204 14.547  1.00 36.20 ? 397  ARG A O   1 
ATOM   1371 C CB  . ARG A 1 187 ? -7.853  -29.638 16.952  1.00 34.99 ? 397  ARG A CB  1 
ATOM   1372 C CG  . ARG A 1 187 ? -6.783  -30.656 17.378  1.00 33.78 ? 397  ARG A CG  1 
ATOM   1373 C CD  . ARG A 1 187 ? -7.371  -31.966 17.902  1.00 31.45 ? 397  ARG A CD  1 
ATOM   1374 N NE  . ARG A 1 187 ? -6.345  -32.845 18.453  1.00 29.42 ? 397  ARG A NE  1 
ATOM   1375 C CZ  . ARG A 1 187 ? -6.556  -34.087 18.897  1.00 29.07 ? 397  ARG A CZ  1 
ATOM   1376 N NH1 . ARG A 1 187 ? -7.769  -34.630 18.856  1.00 26.14 ? 397  ARG A NH1 1 
ATOM   1377 N NH2 . ARG A 1 187 ? -5.543  -34.800 19.377  1.00 26.22 ? 397  ARG A NH2 1 
ATOM   1378 N N   . PRO A 1 188 ? -10.970 -28.857 16.135  1.00 35.75 ? 398  PRO A N   1 
ATOM   1379 C CA  . PRO A 1 188 ? -11.954 -27.783 15.965  1.00 35.75 ? 398  PRO A CA  1 
ATOM   1380 C C   . PRO A 1 188 ? -11.420 -26.364 16.214  1.00 35.91 ? 398  PRO A C   1 
ATOM   1381 O O   . PRO A 1 188 ? -10.846 -26.085 17.273  1.00 35.56 ? 398  PRO A O   1 
ATOM   1382 C CB  . PRO A 1 188 ? -13.022 -28.127 17.013  1.00 35.71 ? 398  PRO A CB  1 
ATOM   1383 C CG  . PRO A 1 188 ? -12.910 -29.599 17.185  1.00 35.58 ? 398  PRO A CG  1 
ATOM   1384 C CD  . PRO A 1 188 ? -11.441 -29.872 17.097  1.00 35.70 ? 398  PRO A CD  1 
ATOM   1385 N N   . GLY A 1 189 ? -11.622 -25.479 15.238  1.00 35.82 ? 399  GLY A N   1 
ATOM   1386 C CA  . GLY A 1 189 ? -11.233 -24.079 15.381  1.00 35.80 ? 399  GLY A CA  1 
ATOM   1387 C C   . GLY A 1 189 ? -9.756  -23.795 15.168  1.00 35.90 ? 399  GLY A C   1 
ATOM   1388 O O   . GLY A 1 189 ? -9.277  -22.712 15.515  1.00 35.67 ? 399  GLY A O   1 
ATOM   1389 N N   . LEU A 1 190 ? -9.027  -24.762 14.607  1.00 35.89 ? 400  LEU A N   1 
ATOM   1390 C CA  . LEU A 1 190 ? -7.643  -24.530 14.204  1.00 35.90 ? 400  LEU A CA  1 
ATOM   1391 C C   . LEU A 1 190 ? -7.611  -23.466 13.125  1.00 35.91 ? 400  LEU A C   1 
ATOM   1392 O O   . LEU A 1 190 ? -8.396  -23.504 12.187  1.00 35.83 ? 400  LEU A O   1 
ATOM   1393 C CB  . LEU A 1 190 ? -6.985  -25.809 13.688  1.00 35.84 ? 400  LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 190 ? -6.032  -26.573 14.609  1.00 36.02 ? 400  LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 190 ? -5.387  -27.704 13.832  1.00 35.08 ? 400  LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 190 ? -4.956  -25.653 15.199  1.00 35.59 ? 400  LEU A CD2 1 
ATOM   1397 N N   . MET A 1 191 ? -6.706  -22.508 13.279  1.00 36.29 ? 401  MET A N   1 
ATOM   1398 C CA  . MET A 1 191 ? -6.618  -21.374 12.366  1.00 36.38 ? 401  MET A CA  1 
ATOM   1399 C C   . MET A 1 191 ? -5.802  -21.760 11.143  1.00 36.44 ? 401  MET A C   1 
ATOM   1400 O O   . MET A 1 191 ? -6.244  -21.575 10.004  1.00 36.59 ? 401  MET A O   1 
ATOM   1401 C CB  . MET A 1 191 ? -5.992  -20.173 13.081  1.00 36.52 ? 401  MET A CB  1 
ATOM   1402 C CG  . MET A 1 191 ? -5.839  -18.902 12.239  1.00 36.93 ? 401  MET A CG  1 
ATOM   1403 S SD  . MET A 1 191 ? -5.276  -17.513 13.256  1.00 36.60 ? 401  MET A SD  1 
ATOM   1404 C CE  . MET A 1 191 ? -3.524  -17.862 13.409  1.00 35.32 ? 401  MET A CE  1 
ATOM   1405 N N   . ASN A 1 192 ? -4.614  -22.301 11.389  1.00 36.11 ? 402  ASN A N   1 
ATOM   1406 C CA  . ASN A 1 192 ? -3.710  -22.672 10.316  1.00 35.94 ? 402  ASN A CA  1 
ATOM   1407 C C   . ASN A 1 192 ? -3.571  -24.201 10.182  1.00 35.58 ? 402  ASN A C   1 
ATOM   1408 O O   . ASN A 1 192 ? -2.533  -24.775 10.511  1.00 35.16 ? 402  ASN A O   1 
ATOM   1409 C CB  . ASN A 1 192 ? -2.360  -21.975 10.525  1.00 36.08 ? 402  ASN A CB  1 
ATOM   1410 C CG  . ASN A 1 192 ? -1.507  -21.964 9.276   1.00 36.78 ? 402  ASN A CG  1 
ATOM   1411 O OD1 . ASN A 1 192 ? -1.904  -22.481 8.233   1.00 37.61 ? 402  ASN A OD1 1 
ATOM   1412 N ND2 . ASN A 1 192 ? -0.314  -21.377 9.380   1.00 37.70 ? 402  ASN A ND2 1 
ATOM   1413 N N   . VAL A 1 193 ? -4.642  -24.834 9.695   1.00 35.46 ? 403  VAL A N   1 
ATOM   1414 C CA  . VAL A 1 193 ? -4.717  -26.284 9.482   1.00 35.67 ? 403  VAL A CA  1 
ATOM   1415 C C   . VAL A 1 193 ? -3.578  -26.874 8.619   1.00 35.83 ? 403  VAL A C   1 
ATOM   1416 O O   . VAL A 1 193 ? -2.986  -27.890 9.001   1.00 35.35 ? 403  VAL A O   1 
ATOM   1417 C CB  . VAL A 1 193 ? -6.096  -26.712 8.868   1.00 35.95 ? 403  VAL A CB  1 
ATOM   1418 C CG1 . VAL A 1 193 ? -6.054  -28.161 8.347   1.00 35.37 ? 403  VAL A CG1 1 
ATOM   1419 C CG2 . VAL A 1 193 ? -7.233  -26.532 9.867   1.00 35.28 ? 403  VAL A CG2 1 
ATOM   1420 N N   . PRO A 1 194 ? -3.281  -26.262 7.451   1.00 35.96 ? 404  PRO A N   1 
ATOM   1421 C CA  . PRO A 1 194 ? -2.285  -26.913 6.593   1.00 36.25 ? 404  PRO A CA  1 
ATOM   1422 C C   . PRO A 1 194 ? -0.905  -26.964 7.242   1.00 36.35 ? 404  PRO A C   1 
ATOM   1423 O O   . PRO A 1 194 ? -0.214  -27.988 7.132   1.00 36.95 ? 404  PRO A O   1 
ATOM   1424 C CB  . PRO A 1 194 ? -2.269  -26.040 5.328   1.00 36.33 ? 404  PRO A CB  1 
ATOM   1425 C CG  . PRO A 1 194 ? -3.561  -25.268 5.376   1.00 36.27 ? 404  PRO A CG  1 
ATOM   1426 C CD  . PRO A 1 194 ? -3.796  -25.026 6.833   1.00 35.93 ? 404  PRO A CD  1 
ATOM   1427 N N   . ARG A 1 195 ? -0.523  -25.888 7.929   1.00 35.97 ? 405  ARG A N   1 
ATOM   1428 C CA  . ARG A 1 195 ? 0.753   -25.847 8.648   1.00 35.84 ? 405  ARG A CA  1 
ATOM   1429 C C   . ARG A 1 195 ? 0.869   -26.954 9.707   1.00 35.34 ? 405  ARG A C   1 
ATOM   1430 O O   . ARG A 1 195 ? 1.920   -27.593 9.821   1.00 35.24 ? 405  ARG A O   1 
ATOM   1431 C CB  . ARG A 1 195 ? 0.981   -24.462 9.277   1.00 36.16 ? 405  ARG A CB  1 
ATOM   1432 C CG  . ARG A 1 195 ? 2.265   -24.315 10.108  1.00 36.55 ? 405  ARG A CG  1 
ATOM   1433 C CD  . ARG A 1 195 ? 3.499   -24.531 9.243   1.00 38.24 ? 405  ARG A CD  1 
ATOM   1434 N NE  . ARG A 1 195 ? 4.750   -24.527 10.000  1.00 37.96 ? 405  ARG A NE  1 
ATOM   1435 C CZ  . ARG A 1 195 ? 5.898   -25.022 9.538   1.00 39.04 ? 405  ARG A CZ  1 
ATOM   1436 N NH1 . ARG A 1 195 ? 5.958   -25.571 8.330   1.00 38.86 ? 405  ARG A NH1 1 
ATOM   1437 N NH2 . ARG A 1 195 ? 6.993   -24.976 10.285  1.00 39.46 ? 405  ARG A NH2 1 
ATOM   1438 N N   . VAL A 1 196 ? -0.205  -27.170 10.470  1.00 34.79 ? 406  VAL A N   1 
ATOM   1439 C CA  . VAL A 1 196 ? -0.240  -28.219 11.499  1.00 34.43 ? 406  VAL A CA  1 
ATOM   1440 C C   . VAL A 1 196 ? -0.149  -29.607 10.854  1.00 34.31 ? 406  VAL A C   1 
ATOM   1441 O O   . VAL A 1 196 ? 0.610   -30.458 11.310  1.00 34.28 ? 406  VAL A O   1 
ATOM   1442 C CB  . VAL A 1 196 ? -1.499  -28.127 12.421  1.00 34.42 ? 406  VAL A CB  1 
ATOM   1443 C CG1 . VAL A 1 196 ? -1.462  -29.209 13.497  1.00 33.28 ? 406  VAL A CG1 1 
ATOM   1444 C CG2 . VAL A 1 196 ? -1.594  -26.749 13.086  1.00 34.92 ? 406  VAL A CG2 1 
ATOM   1445 N N   . GLU A 1 197 ? -0.916  -29.816 9.785   1.00 34.24 ? 407  GLU A N   1 
ATOM   1446 C CA  . GLU A 1 197 ? -0.876  -31.060 9.014   1.00 34.08 ? 407  GLU A CA  1 
ATOM   1447 C C   . GLU A 1 197 ? 0.543   -31.343 8.559   1.00 33.11 ? 407  GLU A C   1 
ATOM   1448 O O   . GLU A 1 197 ? 1.005   -32.478 8.631   1.00 33.11 ? 407  GLU A O   1 
ATOM   1449 C CB  . GLU A 1 197 ? -1.803  -30.984 7.795   1.00 33.90 ? 407  GLU A CB  1 
ATOM   1450 C CG  . GLU A 1 197 ? -3.282  -31.166 8.092   1.00 34.55 ? 407  GLU A CG  1 
ATOM   1451 C CD  . GLU A 1 197 ? -4.141  -31.154 6.831   1.00 36.00 ? 407  GLU A CD  1 
ATOM   1452 O OE1 . GLU A 1 197 ? -3.756  -30.501 5.830   1.00 38.27 ? 407  GLU A OE1 1 
ATOM   1453 O OE2 . GLU A 1 197 ? -5.212  -31.804 6.837   1.00 39.49 ? 407  GLU A OE2 1 
ATOM   1454 N N   . ALA A 1 198 ? 1.230   -30.298 8.102   1.00 32.51 ? 408  ALA A N   1 
ATOM   1455 C CA  . ALA A 1 198 ? 2.615   -30.419 7.640   1.00 31.81 ? 408  ALA A CA  1 
ATOM   1456 C C   . ALA A 1 198 ? 3.562   -30.864 8.748   1.00 31.21 ? 408  ALA A C   1 
ATOM   1457 O O   . ALA A 1 198 ? 4.443   -31.678 8.507   1.00 30.98 ? 408  ALA A O   1 
ATOM   1458 C CB  . ALA A 1 198 ? 3.097   -29.118 7.012   1.00 31.51 ? 408  ALA A CB  1 
ATOM   1459 N N   . ILE A 1 199 ? 3.384   -30.333 9.958   1.00 31.26 ? 409  ILE A N   1 
ATOM   1460 C CA  . ILE A 1 199 ? 4.205   -30.765 11.098  1.00 30.96 ? 409  ILE A CA  1 
ATOM   1461 C C   . ILE A 1 199 ? 3.898   -32.221 11.489  1.00 30.63 ? 409  ILE A C   1 
ATOM   1462 O O   . ILE A 1 199 ? 4.813   -32.996 11.764  1.00 30.56 ? 409  ILE A O   1 
ATOM   1463 C CB  . ILE A 1 199 ? 4.073   -29.822 12.323  1.00 31.12 ? 409  ILE A CB  1 
ATOM   1464 C CG1 . ILE A 1 199 ? 4.464   -28.385 11.951  1.00 31.31 ? 409  ILE A CG1 1 
ATOM   1465 C CG2 . ILE A 1 199 ? 4.961   -30.305 13.480  1.00 31.17 ? 409  ILE A CG2 1 
ATOM   1466 C CD1 . ILE A 1 199 ? 3.883   -27.317 12.887  1.00 31.88 ? 409  ILE A CD1 1 
ATOM   1467 N N   . GLN A 1 200 ? 2.618   -32.590 11.487  1.00 30.29 ? 410  GLN A N   1 
ATOM   1468 C CA  . GLN A 1 200 ? 2.204   -33.942 11.866  1.00 30.17 ? 410  GLN A CA  1 
ATOM   1469 C C   . GLN A 1 200 ? 2.778   -34.982 10.909  1.00 29.90 ? 410  GLN A C   1 
ATOM   1470 O O   . GLN A 1 200 ? 3.317   -36.001 11.338  1.00 29.62 ? 410  GLN A O   1 
ATOM   1471 C CB  . GLN A 1 200 ? 0.676   -34.067 11.909  1.00 30.34 ? 410  GLN A CB  1 
ATOM   1472 C CG  . GLN A 1 200 ? 0.200   -35.454 12.378  1.00 30.98 ? 410  GLN A CG  1 
ATOM   1473 C CD  . GLN A 1 200 ? -1.295  -35.633 12.297  1.00 30.48 ? 410  GLN A CD  1 
ATOM   1474 O OE1 . GLN A 1 200 ? -1.859  -35.798 11.218  1.00 31.60 ? 410  GLN A OE1 1 
ATOM   1475 N NE2 . GLN A 1 200 ? -1.944  -35.630 13.449  1.00 32.67 ? 410  GLN A NE2 1 
ATOM   1476 N N   . ASP A 1 201 ? 2.666   -34.717 9.614   1.00 29.54 ? 411  ASP A N   1 
ATOM   1477 C CA  . ASP A 1 201 ? 3.206   -35.631 8.616   1.00 29.75 ? 411  ASP A CA  1 
ATOM   1478 C C   . ASP A 1 201 ? 4.684   -35.934 8.884   1.00 28.95 ? 411  ASP A C   1 
ATOM   1479 O O   . ASP A 1 201 ? 5.098   -37.087 8.867   1.00 28.87 ? 411  ASP A O   1 
ATOM   1480 C CB  . ASP A 1 201 ? 3.001   -35.087 7.195   1.00 30.04 ? 411  ASP A CB  1 
ATOM   1481 C CG  . ASP A 1 201 ? 3.207   -36.158 6.134   1.00 31.02 ? 411  ASP A CG  1 
ATOM   1482 O OD1 . ASP A 1 201 ? 2.459   -37.160 6.144   1.00 31.40 ? 411  ASP A OD1 1 
ATOM   1483 O OD2 . ASP A 1 201 ? 4.120   -35.998 5.300   1.00 31.94 ? 411  ASP A OD2 1 
ATOM   1484 N N   . THR A 1 202 ? 5.451   -34.885 9.166   1.00 28.40 ? 412  THR A N   1 
ATOM   1485 C CA  . THR A 1 202 ? 6.872   -34.977 9.485   1.00 27.57 ? 412  THR A CA  1 
ATOM   1486 C C   . THR A 1 202 ? 7.127   -35.786 10.757  1.00 27.11 ? 412  THR A C   1 
ATOM   1487 O O   . THR A 1 202 ? 8.021   -36.627 10.786  1.00 26.84 ? 412  THR A O   1 
ATOM   1488 C CB  . THR A 1 202 ? 7.492   -33.561 9.609   1.00 27.71 ? 412  THR A CB  1 
ATOM   1489 O OG1 . THR A 1 202 ? 7.282   -32.850 8.381   1.00 28.75 ? 412  THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 202 ? 8.992   -33.619 9.910   1.00 26.73 ? 412  THR A CG2 1 
ATOM   1491 N N   . ILE A 1 203 ? 6.346   -35.531 11.804  1.00 26.90 ? 413  ILE A N   1 
ATOM   1492 C CA  . ILE A 1 203 ? 6.431   -36.346 13.026  1.00 26.42 ? 413  ILE A CA  1 
ATOM   1493 C C   . ILE A 1 203 ? 6.157   -37.818 12.729  1.00 26.21 ? 413  ILE A C   1 
ATOM   1494 O O   . ILE A 1 203 ? 6.877   -38.684 13.216  1.00 26.34 ? 413  ILE A O   1 
ATOM   1495 C CB  . ILE A 1 203 ? 5.493   -35.827 14.164  1.00 26.53 ? 413  ILE A CB  1 
ATOM   1496 C CG1 . ILE A 1 203 ? 5.940   -34.425 14.620  1.00 26.67 ? 413  ILE A CG1 1 
ATOM   1497 C CG2 . ILE A 1 203 ? 5.504   -36.784 15.360  1.00 24.31 ? 413  ILE A CG2 1 
ATOM   1498 C CD1 . ILE A 1 203 ? 4.851   -33.620 15.331  1.00 26.63 ? 413  ILE A CD1 1 
ATOM   1499 N N   . LEU A 1 204 ? 5.127   -38.086 11.926  1.00 26.22 ? 414  LEU A N   1 
ATOM   1500 C CA  . LEU A 1 204 ? 4.724   -39.451 11.579  1.00 26.82 ? 414  LEU A CA  1 
ATOM   1501 C C   . LEU A 1 204 ? 5.726   -40.208 10.700  1.00 27.39 ? 414  LEU A C   1 
ATOM   1502 O O   . LEU A 1 204 ? 5.882   -41.415 10.855  1.00 27.15 ? 414  LEU A O   1 
ATOM   1503 C CB  . LEU A 1 204 ? 3.334   -39.468 10.940  1.00 26.18 ? 414  LEU A CB  1 
ATOM   1504 C CG  . LEU A 1 204 ? 2.167   -39.184 11.907  1.00 26.94 ? 414  LEU A CG  1 
ATOM   1505 C CD1 . LEU A 1 204 ? 0.870   -38.989 11.128  1.00 24.78 ? 414  LEU A CD1 1 
ATOM   1506 C CD2 . LEU A 1 204 ? 2.006   -40.255 13.009  1.00 24.92 ? 414  LEU A CD2 1 
ATOM   1507 N N   . ARG A 1 205 ? 6.386   -39.499 9.783   1.00 28.45 ? 415  ARG A N   1 
ATOM   1508 C CA  . ARG A 1 205 ? 7.455   -40.082 8.955   1.00 29.73 ? 415  ARG A CA  1 
ATOM   1509 C C   . ARG A 1 205 ? 8.702   -40.319 9.809   1.00 30.02 ? 415  ARG A C   1 
ATOM   1510 O O   . ARG A 1 205 ? 9.459   -41.270 9.587   1.00 30.13 ? 415  ARG A O   1 
ATOM   1511 C CB  . ARG A 1 205 ? 7.790   -39.179 7.758   1.00 29.51 ? 415  ARG A CB  1 
ATOM   1512 C CG  . ARG A 1 205 ? 6.594   -38.867 6.869   1.00 30.31 ? 415  ARG A CG  1 
ATOM   1513 C CD  . ARG A 1 205 ? 6.985   -38.274 5.511   1.00 30.98 ? 415  ARG A CD  1 
ATOM   1514 N NE  . ARG A 1 205 ? 5.800   -38.028 4.681   1.00 33.28 ? 415  ARG A NE  1 
ATOM   1515 C CZ  . ARG A 1 205 ? 5.809   -37.917 3.353   1.00 34.73 ? 415  ARG A CZ  1 
ATOM   1516 N NH1 . ARG A 1 205 ? 6.945   -38.051 2.667   1.00 36.26 ? 415  ARG A NH1 1 
ATOM   1517 N NH2 . ARG A 1 205 ? 4.677   -37.684 2.702   1.00 34.34 ? 415  ARG A NH2 1 
ATOM   1518 N N   . ALA A 1 206 ? 8.909   -39.449 10.792  1.00 30.35 ? 416  ALA A N   1 
ATOM   1519 C CA  . ALA A 1 206 ? 9.991   -39.645 11.740  1.00 30.94 ? 416  ALA A CA  1 
ATOM   1520 C C   . ALA A 1 206 ? 9.679   -40.852 12.639  1.00 31.44 ? 416  ALA A C   1 
ATOM   1521 O O   . ALA A 1 206 ? 10.583  -41.609 13.007  1.00 31.04 ? 416  ALA A O   1 
ATOM   1522 C CB  . ALA A 1 206 ? 10.223  -38.402 12.549  1.00 30.63 ? 416  ALA A CB  1 
ATOM   1523 N N   . LEU A 1 207 ? 8.397   -41.051 12.949  1.00 32.10 ? 417  LEU A N   1 
ATOM   1524 C CA  . LEU A 1 207 ? 7.995   -42.179 13.783  1.00 32.90 ? 417  LEU A CA  1 
ATOM   1525 C C   . LEU A 1 207 ? 8.204   -43.523 13.090  1.00 34.00 ? 417  LEU A C   1 
ATOM   1526 O O   . LEU A 1 207 ? 8.829   -44.396 13.676  1.00 34.38 ? 417  LEU A O   1 
ATOM   1527 C CB  . LEU A 1 207 ? 6.564   -42.038 14.319  1.00 32.33 ? 417  LEU A CB  1 
ATOM   1528 C CG  . LEU A 1 207 ? 6.070   -43.150 15.270  1.00 32.60 ? 417  LEU A CG  1 
ATOM   1529 C CD1 . LEU A 1 207 ? 7.031   -43.398 16.425  1.00 32.57 ? 417  LEU A CD1 1 
ATOM   1530 C CD2 . LEU A 1 207 ? 4.662   -42.881 15.822  1.00 32.44 ? 417  LEU A CD2 1 
ATOM   1531 N N   . GLU A 1 208 ? 7.700   -43.705 11.865  1.00 35.46 ? 418  GLU A N   1 
ATOM   1532 C CA  . GLU A 1 208 ? 7.884   -45.004 11.181  1.00 37.31 ? 418  GLU A CA  1 
ATOM   1533 C C   . GLU A 1 208 ? 9.352   -45.326 10.912  1.00 37.44 ? 418  GLU A C   1 
ATOM   1534 O O   . GLU A 1 208 ? 9.743   -46.493 10.975  1.00 38.06 ? 418  GLU A O   1 
ATOM   1535 C CB  . GLU A 1 208 ? 7.011   -45.179 9.914   1.00 37.12 ? 418  GLU A CB  1 
ATOM   1536 C CG  . GLU A 1 208 ? 7.442   -44.445 8.640   1.00 38.40 ? 418  GLU A CG  1 
ATOM   1537 C CD  . GLU A 1 208 ? 6.382   -44.518 7.525   1.00 39.22 ? 418  GLU A CD  1 
ATOM   1538 O OE1 . GLU A 1 208 ? 6.410   -43.683 6.591   1.00 40.32 ? 418  GLU A OE1 1 
ATOM   1539 O OE2 . GLU A 1 208 ? 5.506   -45.412 7.580   1.00 42.78 ? 418  GLU A OE2 1 
ATOM   1540 N N   . PHE A 1 209 ? 10.160  -44.300 10.638  1.00 37.76 ? 419  PHE A N   1 
ATOM   1541 C CA  . PHE A 1 209 ? 11.599  -44.508 10.443  1.00 38.20 ? 419  PHE A CA  1 
ATOM   1542 C C   . PHE A 1 209 ? 12.289  -44.908 11.740  1.00 37.89 ? 419  PHE A C   1 
ATOM   1543 O O   . PHE A 1 209 ? 13.103  -45.829 11.739  1.00 38.32 ? 419  PHE A O   1 
ATOM   1544 C CB  . PHE A 1 209 ? 12.279  -43.305 9.774   1.00 38.52 ? 419  PHE A CB  1 
ATOM   1545 C CG  . PHE A 1 209 ? 12.076  -43.246 8.272   1.00 39.68 ? 419  PHE A CG  1 
ATOM   1546 C CD1 . PHE A 1 209 ? 12.222  -44.392 7.483   1.00 40.27 ? 419  PHE A CD1 1 
ATOM   1547 C CD2 . PHE A 1 209 ? 11.750  -42.042 7.644   1.00 40.19 ? 419  PHE A CD2 1 
ATOM   1548 C CE1 . PHE A 1 209 ? 12.034  -44.342 6.090   1.00 40.59 ? 419  PHE A CE1 1 
ATOM   1549 C CE2 . PHE A 1 209 ? 11.565  -41.975 6.252   1.00 40.90 ? 419  PHE A CE2 1 
ATOM   1550 C CZ  . PHE A 1 209 ? 11.707  -43.128 5.474   1.00 40.34 ? 419  PHE A CZ  1 
ATOM   1551 N N   . HIS A 1 210 ? 11.932  -44.240 12.839  1.00 37.41 ? 420  HIS A N   1 
ATOM   1552 C CA  . HIS A 1 210 ? 12.415  -44.585 14.180  1.00 36.88 ? 420  HIS A CA  1 
ATOM   1553 C C   . HIS A 1 210 ? 12.068  -46.023 14.570  1.00 36.80 ? 420  HIS A C   1 
ATOM   1554 O O   . HIS A 1 210 ? 12.897  -46.726 15.139  1.00 36.69 ? 420  HIS A O   1 
ATOM   1555 C CB  . HIS A 1 210 ? 11.861  -43.600 15.223  1.00 36.83 ? 420  HIS A CB  1 
ATOM   1556 C CG  . HIS A 1 210 ? 12.454  -43.760 16.594  1.00 36.34 ? 420  HIS A CG  1 
ATOM   1557 N ND1 . HIS A 1 210 ? 11.791  -44.398 17.623  1.00 35.19 ? 420  HIS A ND1 1 
ATOM   1558 C CD2 . HIS A 1 210 ? 13.641  -43.353 17.106  1.00 34.95 ? 420  HIS A CD2 1 
ATOM   1559 C CE1 . HIS A 1 210 ? 12.546  -44.378 18.707  1.00 34.52 ? 420  HIS A CE1 1 
ATOM   1560 N NE2 . HIS A 1 210 ? 13.674  -43.752 18.420  1.00 34.37 ? 420  HIS A NE2 1 
ATOM   1561 N N   . LEU A 1 211 ? 10.854  -46.463 14.251  1.00 36.98 ? 421  LEU A N   1 
ATOM   1562 C CA  . LEU A 1 211 ? 10.423  -47.817 14.603  1.00 37.20 ? 421  LEU A CA  1 
ATOM   1563 C C   . LEU A 1 211 ? 11.143  -48.881 13.783  1.00 38.01 ? 421  LEU A C   1 
ATOM   1564 O O   . LEU A 1 211 ? 11.381  -49.980 14.276  1.00 38.30 ? 421  LEU A O   1 
ATOM   1565 C CB  . LEU A 1 211 ? 8.908   -47.968 14.454  1.00 36.92 ? 421  LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 211 ? 7.986   -47.034 15.247  1.00 35.83 ? 421  LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 211 ? 6.531   -47.365 14.953  1.00 34.07 ? 421  LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 211 ? 8.266   -47.070 16.749  1.00 34.47 ? 421  LEU A CD2 1 
ATOM   1569 N N   . GLN A 1 212 ? 11.484  -48.553 12.535  1.00 38.82 ? 422  GLN A N   1 
ATOM   1570 C CA  . GLN A 1 212 ? 12.304  -49.423 11.691  1.00 39.39 ? 422  GLN A CA  1 
ATOM   1571 C C   . GLN A 1 212 ? 13.658  -49.685 12.330  1.00 39.32 ? 422  GLN A C   1 
ATOM   1572 O O   . GLN A 1 212 ? 14.145  -50.817 12.320  1.00 39.70 ? 422  GLN A O   1 
ATOM   1573 C CB  . GLN A 1 212 ? 12.501  -48.813 10.307  1.00 39.44 ? 422  GLN A CB  1 
ATOM   1574 C CG  . GLN A 1 212 ? 11.483  -49.247 9.276   1.00 39.90 ? 422  GLN A CG  1 
ATOM   1575 C CD  . GLN A 1 212 ? 11.795  -48.696 7.892   1.00 40.67 ? 422  GLN A CD  1 
ATOM   1576 O OE1 . GLN A 1 212 ? 12.292  -47.571 7.746   1.00 41.69 ? 422  GLN A OE1 1 
ATOM   1577 N NE2 . GLN A 1 212 ? 11.507  -49.490 6.866   1.00 41.68 ? 422  GLN A NE2 1 
ATOM   1578 N N   . ALA A 1 213 ? 14.260  -48.639 12.891  1.00 39.29 ? 423  ALA A N   1 
ATOM   1579 C CA  . ALA A 1 213 ? 15.500  -48.786 13.644  1.00 39.52 ? 423  ALA A CA  1 
ATOM   1580 C C   . ALA A 1 213 ? 15.280  -49.484 14.989  1.00 39.86 ? 423  ALA A C   1 
ATOM   1581 O O   . ALA A 1 213 ? 15.841  -50.543 15.229  1.00 40.05 ? 423  ALA A O   1 
ATOM   1582 C CB  . ALA A 1 213 ? 16.166  -47.431 13.852  1.00 39.55 ? 423  ALA A CB  1 
ATOM   1583 N N   . ASN A 1 214 ? 14.447  -48.884 15.841  1.00 40.17 ? 424  ASN A N   1 
ATOM   1584 C CA  . ASN A 1 214 ? 14.284  -49.264 17.251  1.00 40.31 ? 424  ASN A CA  1 
ATOM   1585 C C   . ASN A 1 214 ? 13.619  -50.624 17.473  1.00 40.21 ? 424  ASN A C   1 
ATOM   1586 O O   . ASN A 1 214 ? 13.945  -51.324 18.426  1.00 40.08 ? 424  ASN A O   1 
ATOM   1587 C CB  . ASN A 1 214 ? 13.496  -48.161 17.986  1.00 40.45 ? 424  ASN A CB  1 
ATOM   1588 C CG  . ASN A 1 214 ? 13.848  -48.050 19.472  1.00 40.99 ? 424  ASN A CG  1 
ATOM   1589 O OD1 . ASN A 1 214 ? 12.990  -47.706 20.293  1.00 41.11 ? 424  ASN A OD1 1 
ATOM   1590 N ND2 . ASN A 1 214 ? 15.106  -48.317 19.819  1.00 40.50 ? 424  ASN A ND2 1 
ATOM   1591 N N   . HIS A 1 215 ? 12.686  -50.983 16.595  1.00 40.23 ? 425  HIS A N   1 
ATOM   1592 C CA  . HIS A 1 215 ? 11.979  -52.264 16.665  1.00 40.25 ? 425  HIS A CA  1 
ATOM   1593 C C   . HIS A 1 215 ? 12.084  -52.998 15.316  1.00 40.45 ? 425  HIS A C   1 
ATOM   1594 O O   . HIS A 1 215 ? 11.092  -53.074 14.572  1.00 40.18 ? 425  HIS A O   1 
ATOM   1595 C CB  . HIS A 1 215 ? 10.502  -52.041 17.003  1.00 40.21 ? 425  HIS A CB  1 
ATOM   1596 C CG  . HIS A 1 215 ? 10.272  -51.358 18.312  1.00 40.54 ? 425  HIS A CG  1 
ATOM   1597 N ND1 . HIS A 1 215 ? 9.838   -52.030 19.433  1.00 40.30 ? 425  HIS A ND1 1 
ATOM   1598 C CD2 . HIS A 1 215 ? 10.405  -50.061 18.677  1.00 40.28 ? 425  HIS A CD2 1 
ATOM   1599 C CE1 . HIS A 1 215 ? 9.728   -51.178 20.436  1.00 40.42 ? 425  HIS A CE1 1 
ATOM   1600 N NE2 . HIS A 1 215 ? 10.065  -49.978 20.004  1.00 40.10 ? 425  HIS A NE2 1 
ATOM   1601 N N   . PRO A 1 216 ? 13.279  -53.541 14.988  1.00 40.50 ? 426  PRO A N   1 
ATOM   1602 C CA  . PRO A 1 216 ? 13.474  -54.142 13.657  1.00 40.65 ? 426  PRO A CA  1 
ATOM   1603 C C   . PRO A 1 216 ? 12.569  -55.342 13.358  1.00 40.56 ? 426  PRO A C   1 
ATOM   1604 O O   . PRO A 1 216 ? 12.201  -55.559 12.203  1.00 40.53 ? 426  PRO A O   1 
ATOM   1605 C CB  . PRO A 1 216 ? 14.953  -54.576 13.673  1.00 40.60 ? 426  PRO A CB  1 
ATOM   1606 C CG  . PRO A 1 216 ? 15.585  -53.781 14.759  1.00 40.70 ? 426  PRO A CG  1 
ATOM   1607 C CD  . PRO A 1 216 ? 14.506  -53.621 15.799  1.00 40.64 ? 426  PRO A CD  1 
ATOM   1608 N N   . ASP A 1 217 ? 12.211  -56.105 14.388  1.00 40.65 ? 427  ASP A N   1 
ATOM   1609 C CA  . ASP A 1 217 ? 11.487  -57.356 14.190  1.00 40.84 ? 427  ASP A CA  1 
ATOM   1610 C C   . ASP A 1 217 ? 9.962   -57.195 14.164  1.00 40.64 ? 427  ASP A C   1 
ATOM   1611 O O   . ASP A 1 217 ? 9.266   -57.993 13.541  1.00 40.81 ? 427  ASP A O   1 
ATOM   1612 C CB  . ASP A 1 217 ? 11.896  -58.391 15.251  1.00 41.18 ? 427  ASP A CB  1 
ATOM   1613 C CG  . ASP A 1 217 ? 13.413  -58.609 15.323  1.00 42.18 ? 427  ASP A CG  1 
ATOM   1614 O OD1 . ASP A 1 217 ? 14.081  -58.681 14.264  1.00 42.60 ? 427  ASP A OD1 1 
ATOM   1615 O OD2 . ASP A 1 217 ? 13.933  -58.726 16.456  1.00 43.72 ? 427  ASP A OD2 1 
ATOM   1616 N N   . ALA A 1 218 ? 9.451   -56.163 14.834  1.00 40.18 ? 428  ALA A N   1 
ATOM   1617 C CA  . ALA A 1 218 ? 8.008   -55.993 15.022  1.00 39.62 ? 428  ALA A CA  1 
ATOM   1618 C C   . ALA A 1 218 ? 7.265   -55.582 13.741  1.00 39.35 ? 428  ALA A C   1 
ATOM   1619 O O   . ALA A 1 218 ? 7.447   -54.476 13.212  1.00 39.44 ? 428  ALA A O   1 
ATOM   1620 C CB  . ALA A 1 218 ? 7.717   -55.020 16.188  1.00 39.47 ? 428  ALA A CB  1 
ATOM   1621 N N   . GLN A 1 219 ? 6.428   -56.496 13.254  1.00 38.90 ? 429  GLN A N   1 
ATOM   1622 C CA  . GLN A 1 219 ? 5.653   -56.294 12.037  1.00 38.22 ? 429  GLN A CA  1 
ATOM   1623 C C   . GLN A 1 219 ? 4.339   -55.572 12.317  1.00 37.89 ? 429  GLN A C   1 
ATOM   1624 O O   . GLN A 1 219 ? 3.681   -55.822 13.334  1.00 38.55 ? 429  GLN A O   1 
ATOM   1625 C CB  . GLN A 1 219 ? 5.373   -57.635 11.362  1.00 38.46 ? 429  GLN A CB  1 
ATOM   1626 N N   . GLN A 1 220 ? 3.971   -54.676 11.403  1.00 36.71 ? 430  GLN A N   1 
ATOM   1627 C CA  . GLN A 1 220 ? 2.740   -53.877 11.473  1.00 35.69 ? 430  GLN A CA  1 
ATOM   1628 C C   . GLN A 1 220 ? 2.652   -52.946 12.704  1.00 34.19 ? 430  GLN A C   1 
ATOM   1629 O O   . GLN A 1 220 ? 1.565   -52.466 13.041  1.00 33.88 ? 430  GLN A O   1 
ATOM   1630 C CB  . GLN A 1 220 ? 1.477   -54.750 11.312  1.00 35.97 ? 430  GLN A CB  1 
ATOM   1631 C CG  . GLN A 1 220 ? 1.435   -55.626 10.028  1.00 38.41 ? 430  GLN A CG  1 
ATOM   1632 C CD  . GLN A 1 220 ? 0.550   -55.073 8.901   1.00 41.12 ? 430  GLN A CD  1 
ATOM   1633 O OE1 . GLN A 1 220 ? -0.206  -54.114 9.084   1.00 43.98 ? 430  GLN A OE1 1 
ATOM   1634 N NE2 . GLN A 1 220 ? 0.631   -55.701 7.729   1.00 42.47 ? 430  GLN A NE2 1 
ATOM   1635 N N   . LEU A 1 221 ? 3.792   -52.669 13.345  1.00 32.55 ? 431  LEU A N   1 
ATOM   1636 C CA  . LEU A 1 221 ? 3.811   -51.762 14.505  1.00 31.38 ? 431  LEU A CA  1 
ATOM   1637 C C   . LEU A 1 221 ? 3.312   -50.355 14.168  1.00 30.48 ? 431  LEU A C   1 
ATOM   1638 O O   . LEU A 1 221 ? 2.496   -49.804 14.905  1.00 30.45 ? 431  LEU A O   1 
ATOM   1639 C CB  . LEU A 1 221 ? 5.176   -51.711 15.216  1.00 30.98 ? 431  LEU A CB  1 
ATOM   1640 C CG  . LEU A 1 221 ? 5.220   -50.939 16.565  1.00 31.93 ? 431  LEU A CG  1 
ATOM   1641 C CD1 . LEU A 1 221 ? 4.182   -51.442 17.592  1.00 29.95 ? 431  LEU A CD1 1 
ATOM   1642 C CD2 . LEU A 1 221 ? 6.606   -50.901 17.208  1.00 30.72 ? 431  LEU A CD2 1 
ATOM   1643 N N   . PHE A 1 222 ? 3.773   -49.780 13.059  1.00 29.41 ? 432  PHE A N   1 
ATOM   1644 C CA  . PHE A 1 222 ? 3.354   -48.418 12.715  1.00 28.62 ? 432  PHE A CA  1 
ATOM   1645 C C   . PHE A 1 222 ? 1.837   -48.293 12.525  1.00 28.51 ? 432  PHE A C   1 
ATOM   1646 O O   . PHE A 1 222 ? 1.215   -47.470 13.193  1.00 28.46 ? 432  PHE A O   1 
ATOM   1647 C CB  . PHE A 1 222 ? 4.122   -47.855 11.517  1.00 28.45 ? 432  PHE A CB  1 
ATOM   1648 C CG  . PHE A 1 222 ? 3.817   -46.413 11.227  1.00 26.99 ? 432  PHE A CG  1 
ATOM   1649 C CD1 . PHE A 1 222 ? 4.297   -45.406 12.052  1.00 25.85 ? 432  PHE A CD1 1 
ATOM   1650 C CD2 . PHE A 1 222 ? 3.049   -46.063 10.127  1.00 26.07 ? 432  PHE A CD2 1 
ATOM   1651 C CE1 . PHE A 1 222 ? 4.022   -44.069 11.778  1.00 26.09 ? 432  PHE A CE1 1 
ATOM   1652 C CE2 . PHE A 1 222 ? 2.768   -44.728 9.848   1.00 26.01 ? 432  PHE A CE2 1 
ATOM   1653 C CZ  . PHE A 1 222 ? 3.254   -43.732 10.677  1.00 25.94 ? 432  PHE A CZ  1 
ATOM   1654 N N   . PRO A 1 223 ? 1.234   -49.116 11.635  1.00 28.66 ? 433  PRO A N   1 
ATOM   1655 C CA  . PRO A 1 223 ? -0.225  -49.058 11.509  1.00 28.49 ? 433  PRO A CA  1 
ATOM   1656 C C   . PRO A 1 223 ? -0.938  -49.288 12.835  1.00 28.39 ? 433  PRO A C   1 
ATOM   1657 O O   . PRO A 1 223 ? -2.038  -48.780 13.029  1.00 28.56 ? 433  PRO A O   1 
ATOM   1658 C CB  . PRO A 1 223 ? -0.559  -50.211 10.547  1.00 28.25 ? 433  PRO A CB  1 
ATOM   1659 C CG  . PRO A 1 223 ? 0.690   -50.518 9.826   1.00 28.96 ? 433  PRO A CG  1 
ATOM   1660 C CD  . PRO A 1 223 ? 1.835   -50.097 10.704  1.00 28.78 ? 433  PRO A CD  1 
ATOM   1661 N N   . LYS A 1 224 ? -0.333  -50.058 13.734  1.00 28.42 ? 434  LYS A N   1 
ATOM   1662 C CA  . LYS A 1 224 ? -0.989  -50.374 14.998  1.00 28.58 ? 434  LYS A CA  1 
ATOM   1663 C C   . LYS A 1 224 ? -1.042  -49.159 15.909  1.00 28.77 ? 434  LYS A C   1 
ATOM   1664 O O   . LYS A 1 224 ? -2.021  -48.977 16.626  1.00 28.55 ? 434  LYS A O   1 
ATOM   1665 C CB  . LYS A 1 224 ? -0.316  -51.553 15.701  1.00 28.71 ? 434  LYS A CB  1 
ATOM   1666 C CG  . LYS A 1 224 ? -0.808  -52.910 15.221  1.00 29.25 ? 434  LYS A CG  1 
ATOM   1667 C CD  . LYS A 1 224 ? -0.184  -54.048 16.006  1.00 31.34 ? 434  LYS A CD  1 
ATOM   1668 C CE  . LYS A 1 224 ? -0.679  -54.108 17.460  1.00 34.26 ? 434  LYS A CE  1 
ATOM   1669 N NZ  . LYS A 1 224 ? -2.143  -54.405 17.628  1.00 34.73 ? 434  LYS A NZ  1 
ATOM   1670 N N   . LEU A 1 225 ? 0.002   -48.328 15.865  1.00 28.93 ? 435  LEU A N   1 
ATOM   1671 C CA  . LEU A 1 225 ? 0.036   -47.092 16.652  1.00 29.45 ? 435  LEU A CA  1 
ATOM   1672 C C   . LEU A 1 225 ? -0.927  -46.042 16.115  1.00 29.28 ? 435  LEU A C   1 
ATOM   1673 O O   . LEU A 1 225 ? -1.429  -45.208 16.870  1.00 29.49 ? 435  LEU A O   1 
ATOM   1674 C CB  . LEU A 1 225 ? 1.451   -46.517 16.734  1.00 29.69 ? 435  LEU A CB  1 
ATOM   1675 C CG  . LEU A 1 225 ? 2.498   -47.228 17.593  1.00 30.30 ? 435  LEU A CG  1 
ATOM   1676 C CD1 . LEU A 1 225 ? 3.734   -46.349 17.720  1.00 31.71 ? 435  LEU A CD1 1 
ATOM   1677 C CD2 . LEU A 1 225 ? 1.965   -47.577 18.969  1.00 29.88 ? 435  LEU A CD2 1 
ATOM   1678 N N   . LEU A 1 226 ? -1.191  -46.090 14.813  1.00 29.01 ? 436  LEU A N   1 
ATOM   1679 C CA  . LEU A 1 226 ? -2.186  -45.210 14.201  1.00 28.55 ? 436  LEU A CA  1 
ATOM   1680 C C   . LEU A 1 226 ? -3.601  -45.588 14.657  1.00 28.42 ? 436  LEU A C   1 
ATOM   1681 O O   . LEU A 1 226 ? -4.407  -44.719 15.018  1.00 28.08 ? 436  LEU A O   1 
ATOM   1682 C CB  . LEU A 1 226 ? -2.064  -45.217 12.677  1.00 28.21 ? 436  LEU A CB  1 
ATOM   1683 C CG  . LEU A 1 226 ? -0.801  -44.542 12.128  1.00 27.53 ? 436  LEU A CG  1 
ATOM   1684 C CD1 . LEU A 1 226 ? -0.702  -44.775 10.635  1.00 27.22 ? 436  LEU A CD1 1 
ATOM   1685 C CD2 . LEU A 1 226 ? -0.811  -43.047 12.428  1.00 26.56 ? 436  LEU A CD2 1 
ATOM   1686 N N   . GLN A 1 227 ? -3.886  -46.888 14.666  1.00 28.18 ? 437  GLN A N   1 
ATOM   1687 C CA  . GLN A 1 227 ? -5.142  -47.372 15.228  1.00 27.73 ? 437  GLN A CA  1 
ATOM   1688 C C   . GLN A 1 227 ? -5.262  -46.940 16.688  1.00 27.46 ? 437  GLN A C   1 
ATOM   1689 O O   . GLN A 1 227 ? -6.337  -46.498 17.107  1.00 27.23 ? 437  GLN A O   1 
ATOM   1690 C CB  . GLN A 1 227 ? -5.282  -48.888 15.083  1.00 27.63 ? 437  GLN A CB  1 
ATOM   1691 C CG  . GLN A 1 227 ? -6.662  -49.437 15.473  1.00 27.81 ? 437  GLN A CG  1 
ATOM   1692 C CD  . GLN A 1 227 ? -7.808  -48.704 14.804  1.00 28.80 ? 437  GLN A CD  1 
ATOM   1693 O OE1 . GLN A 1 227 ? -8.568  -47.999 15.462  1.00 30.16 ? 437  GLN A OE1 1 
ATOM   1694 N NE2 . GLN A 1 227 ? -7.925  -48.846 13.491  1.00 29.27 ? 437  GLN A NE2 1 
ATOM   1695 N N   . LYS A 1 228 ? -4.162  -47.034 17.445  1.00 26.80 ? 438  LYS A N   1 
ATOM   1696 C CA  . LYS A 1 228 ? -4.165  -46.612 18.862  1.00 26.77 ? 438  LYS A CA  1 
ATOM   1697 C C   . LYS A 1 228 ? -4.550  -45.141 19.019  1.00 26.76 ? 438  LYS A C   1 
ATOM   1698 O O   . LYS A 1 228 ? -5.328  -44.806 19.916  1.00 26.63 ? 438  LYS A O   1 
ATOM   1699 C CB  . LYS A 1 228 ? -2.823  -46.883 19.551  1.00 26.24 ? 438  LYS A CB  1 
ATOM   1700 C CG  . LYS A 1 228 ? -2.471  -48.362 19.698  1.00 27.14 ? 438  LYS A CG  1 
ATOM   1701 C CD  . LYS A 1 228 ? -3.499  -49.108 20.516  1.00 26.39 ? 438  LYS A CD  1 
ATOM   1702 C CE  . LYS A 1 228 ? -3.145  -50.568 20.658  1.00 24.71 ? 438  LYS A CE  1 
ATOM   1703 N NZ  . LYS A 1 228 ? -4.390  -51.364 20.772  1.00 24.94 ? 438  LYS A NZ  1 
ATOM   1704 N N   . MET A 1 229 ? -4.018  -44.287 18.136  1.00 26.90 ? 439  MET A N   1 
ATOM   1705 C CA  . MET A 1 229 ? -4.339  -42.858 18.119  1.00 28.05 ? 439  MET A CA  1 
ATOM   1706 C C   . MET A 1 229 ? -5.828  -42.656 17.918  1.00 28.04 ? 439  MET A C   1 
ATOM   1707 O O   . MET A 1 229 ? -6.437  -41.785 18.570  1.00 28.22 ? 439  MET A O   1 
ATOM   1708 C CB  . MET A 1 229 ? -3.571  -42.113 17.022  1.00 27.37 ? 439  MET A CB  1 
ATOM   1709 C CG  . MET A 1 229 ? -2.109  -41.898 17.340  1.00 28.78 ? 439  MET A CG  1 
ATOM   1710 S SD  . MET A 1 229 ? -1.124  -41.250 15.969  1.00 29.81 ? 439  MET A SD  1 
ATOM   1711 C CE  . MET A 1 229 ? -2.011  -39.730 15.616  1.00 30.89 ? 439  MET A CE  1 
ATOM   1712 N N   . ALA A 1 230 ? -6.399  -43.455 17.013  1.00 27.58 ? 440  ALA A N   1 
ATOM   1713 C CA  . ALA A 1 230 ? -7.827  -43.436 16.762  1.00 27.55 ? 440  ALA A CA  1 
ATOM   1714 C C   . ALA A 1 230 ? -8.576  -43.924 18.004  1.00 27.45 ? 440  ALA A C   1 
ATOM   1715 O O   . ALA A 1 230 ? -9.573  -43.323 18.402  1.00 27.55 ? 440  ALA A O   1 
ATOM   1716 C CB  . ALA A 1 230 ? -8.165  -44.282 15.550  1.00 27.47 ? 440  ALA A CB  1 
ATOM   1717 N N   . ASP A 1 231 ? -8.080  -44.991 18.627  1.00 27.36 ? 441  ASP A N   1 
ATOM   1718 C CA  . ASP A 1 231 ? -8.676  -45.513 19.846  1.00 27.52 ? 441  ASP A CA  1 
ATOM   1719 C C   . ASP A 1 231 ? -8.597  -44.505 20.983  1.00 27.48 ? 441  ASP A C   1 
ATOM   1720 O O   . ASP A 1 231 ? -9.492  -44.441 21.813  1.00 27.38 ? 441  ASP A O   1 
ATOM   1721 C CB  . ASP A 1 231 ? -7.971  -46.787 20.289  1.00 28.08 ? 441  ASP A CB  1 
ATOM   1722 C CG  . ASP A 1 231 ? -8.055  -47.897 19.274  1.00 28.89 ? 441  ASP A CG  1 
ATOM   1723 O OD1 . ASP A 1 231 ? -8.656  -47.712 18.200  1.00 31.99 ? 441  ASP A OD1 1 
ATOM   1724 O OD2 . ASP A 1 231 ? -7.506  -48.972 19.561  1.00 29.96 ? 441  ASP A OD2 1 
ATOM   1725 N N   . LEU A 1 232 ? -7.508  -43.742 21.034  1.00 27.63 ? 442  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 232 ? -7.356  -42.705 22.053  1.00 28.24 ? 442  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 232 ? -8.400  -41.610 21.909  1.00 28.81 ? 442  LEU A C   1 
ATOM   1728 O O   . LEU A 1 232 ? -8.903  -41.095 22.923  1.00 28.42 ? 442  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 232 ? -5.951  -42.103 22.049  1.00 27.69 ? 442  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 232 ? -4.884  -42.929 22.775  1.00 27.64 ? 442  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 232 ? -3.516  -42.351 22.487  1.00 25.89 ? 442  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 232 ? -5.135  -43.037 24.292  1.00 25.30 ? 442  LEU A CD2 1 
ATOM   1733 N N   . ARG A 1 233 ? -8.713  -41.271 20.653  1.00 29.38 ? 443  ARG A N   1 
ATOM   1734 C CA  . ARG A 1 233 ? -9.738  -40.274 20.324  1.00 30.40 ? 443  ARG A CA  1 
ATOM   1735 C C   . ARG A 1 233 ? -11.080 -40.694 20.927  1.00 30.36 ? 443  ARG A C   1 
ATOM   1736 O O   . ARG A 1 233 ? -11.760 -39.892 21.570  1.00 30.31 ? 443  ARG A O   1 
ATOM   1737 C CB  . ARG A 1 233 ? -9.851  -40.106 18.800  1.00 30.46 ? 443  ARG A CB  1 
ATOM   1738 C CG  . ARG A 1 233 ? -10.846 -39.045 18.321  1.00 32.47 ? 443  ARG A CG  1 
ATOM   1739 C CD  . ARG A 1 233 ? -10.201 -37.670 18.058  1.00 35.55 ? 443  ARG A CD  1 
ATOM   1740 N NE  . ARG A 1 233 ? -9.139  -37.721 17.048  1.00 37.26 ? 443  ARG A NE  1 
ATOM   1741 C CZ  . ARG A 1 233 ? -9.232  -37.239 15.808  1.00 39.14 ? 443  ARG A CZ  1 
ATOM   1742 N NH1 . ARG A 1 233 ? -10.349 -36.649 15.383  1.00 38.97 ? 443  ARG A NH1 1 
ATOM   1743 N NH2 . ARG A 1 233 ? -8.191  -37.342 14.984  1.00 38.50 ? 443  ARG A NH2 1 
ATOM   1744 N N   . GLN A 1 234 ? -11.426 -41.969 20.729  1.00 30.43 ? 444  GLN A N   1 
ATOM   1745 C CA  . GLN A 1 234 ? -12.649 -42.573 21.280  1.00 30.25 ? 444  GLN A CA  1 
ATOM   1746 C C   . GLN A 1 234 ? -12.647 -42.680 22.823  1.00 29.42 ? 444  GLN A C   1 
ATOM   1747 O O   . GLN A 1 234 ? -13.672 -42.455 23.468  1.00 29.24 ? 444  GLN A O   1 
ATOM   1748 C CB  . GLN A 1 234 ? -12.907 -43.933 20.611  1.00 30.57 ? 444  GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 234 ? -14.260 -44.575 20.916  1.00 32.45 ? 444  GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 234 ? -15.441 -43.738 20.477  1.00 36.03 ? 444  GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 234 ? -16.435 -43.644 21.198  1.00 39.15 ? 444  GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 234 ? -15.345 -43.122 19.294  1.00 36.88 ? 444  GLN A NE2 1 
ATOM   1753 N N   . LEU A 1 235 ? -11.499 -42.995 23.412  1.00 28.38 ? 445  LEU A N   1 
ATOM   1754 C CA  . LEU A 1 235 ? -11.389 -43.013 24.871  1.00 27.52 ? 445  LEU A CA  1 
ATOM   1755 C C   . LEU A 1 235 ? -11.668 -41.642 25.498  1.00 27.13 ? 445  LEU A C   1 
ATOM   1756 O O   . LEU A 1 235 ? -12.314 -41.553 26.538  1.00 26.90 ? 445  LEU A O   1 
ATOM   1757 C CB  . LEU A 1 235 ? -10.030 -43.561 25.322  1.00 27.40 ? 445  LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 235 ? -9.828  -43.884 26.815  1.00 27.44 ? 445  LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 235 ? -10.733 -45.023 27.280  1.00 25.40 ? 445  LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 235 ? -8.358  -44.209 27.123  1.00 27.31 ? 445  LEU A CD2 1 
ATOM   1761 N N   . VAL A 1 236 ? -11.193 -40.577 24.861  1.00 27.11 ? 446  VAL A N   1 
ATOM   1762 C CA  . VAL A 1 236 ? -11.407 -39.220 25.372  1.00 26.72 ? 446  VAL A CA  1 
ATOM   1763 C C   . VAL A 1 236 ? -12.857 -38.804 25.153  1.00 26.95 ? 446  VAL A C   1 
ATOM   1764 O O   . VAL A 1 236 ? -13.432 -38.094 25.977  1.00 27.17 ? 446  VAL A O   1 
ATOM   1765 C CB  . VAL A 1 236 ? -10.424 -38.195 24.752  1.00 26.44 ? 446  VAL A CB  1 
ATOM   1766 C CG1 . VAL A 1 236 ? -10.790 -36.759 25.158  1.00 25.08 ? 446  VAL A CG1 1 
ATOM   1767 C CG2 . VAL A 1 236 ? -8.993  -38.509 25.174  1.00 26.53 ? 446  VAL A CG2 1 
ATOM   1768 N N   . THR A 1 237 ? -13.448 -39.258 24.049  1.00 27.05 ? 447  THR A N   1 
ATOM   1769 C CA  . THR A 1 237 ? -14.872 -39.049 23.799  1.00 27.25 ? 447  THR A CA  1 
ATOM   1770 C C   . THR A 1 237 ? -15.739 -39.624 24.921  1.00 27.34 ? 447  THR A C   1 
ATOM   1771 O O   . THR A 1 237 ? -16.632 -38.928 25.413  1.00 27.71 ? 447  THR A O   1 
ATOM   1772 C CB  . THR A 1 237 ? -15.294 -39.577 22.407  1.00 27.35 ? 447  THR A CB  1 
ATOM   1773 O OG1 . THR A 1 237 ? -14.850 -38.656 21.403  1.00 27.09 ? 447  THR A OG1 1 
ATOM   1774 C CG2 . THR A 1 237 ? -16.800 -39.711 22.296  1.00 28.08 ? 447  THR A CG2 1 
ATOM   1775 N N   . GLU A 1 238 ? -15.465 -40.864 25.340  1.00 27.45 ? 448  GLU A N   1 
ATOM   1776 C CA  . GLU A 1 238 ? -16.183 -41.477 26.472  1.00 27.65 ? 448  GLU A CA  1 
ATOM   1777 C C   . GLU A 1 238 ? -15.836 -40.818 27.798  1.00 27.13 ? 448  GLU A C   1 
ATOM   1778 O O   . GLU A 1 238 ? -16.729 -40.564 28.618  1.00 26.77 ? 448  GLU A O   1 
ATOM   1779 C CB  . GLU A 1 238 ? -16.003 -43.016 26.556  1.00 28.22 ? 448  GLU A CB  1 
ATOM   1780 C CG  . GLU A 1 238 ? -14.556 -43.550 26.586  1.00 30.28 ? 448  GLU A CG  1 
ATOM   1781 C CD  . GLU A 1 238 ? -14.113 -44.187 27.933  1.00 32.84 ? 448  GLU A CD  1 
ATOM   1782 O OE1 . GLU A 1 238 ? -14.468 -45.372 28.180  1.00 30.28 ? 448  GLU A OE1 1 
ATOM   1783 O OE2 . GLU A 1 238 ? -13.350 -43.523 28.702  1.00 32.38 ? 448  GLU A OE2 1 
ATOM   1784 N N   . HIS A 1 239 ? -14.547 -40.532 28.008  1.00 25.93 ? 449  HIS A N   1 
ATOM   1785 C CA  . HIS A 1 239 ? -14.132 -39.810 29.189  1.00 25.04 ? 449  HIS A CA  1 
ATOM   1786 C C   . HIS A 1 239 ? -14.891 -38.482 29.380  1.00 25.07 ? 449  HIS A C   1 
ATOM   1787 O O   . HIS A 1 239 ? -15.358 -38.188 30.483  1.00 24.30 ? 449  HIS A O   1 
ATOM   1788 C CB  . HIS A 1 239 ? -12.635 -39.544 29.178  1.00 25.06 ? 449  HIS A CB  1 
ATOM   1789 C CG  . HIS A 1 239 ? -12.160 -38.837 30.406  1.00 24.23 ? 449  HIS A CG  1 
ATOM   1790 N ND1 . HIS A 1 239 ? -12.029 -39.472 31.623  1.00 23.77 ? 449  HIS A ND1 1 
ATOM   1791 C CD2 . HIS A 1 239 ? -11.837 -37.542 30.620  1.00 23.73 ? 449  HIS A CD2 1 
ATOM   1792 C CE1 . HIS A 1 239 ? -11.610 -38.606 32.526  1.00 23.65 ? 449  HIS A CE1 1 
ATOM   1793 N NE2 . HIS A 1 239 ? -11.488 -37.427 31.944  1.00 24.48 ? 449  HIS A NE2 1 
ATOM   1794 N N   . ALA A 1 240 ? -14.991 -37.688 28.313  1.00 25.22 ? 450  ALA A N   1 
ATOM   1795 C CA  . ALA A 1 240 ? -15.743 -36.430 28.336  1.00 26.27 ? 450  ALA A CA  1 
ATOM   1796 C C   . ALA A 1 240 ? -17.224 -36.647 28.664  1.00 26.82 ? 450  ALA A C   1 
ATOM   1797 O O   . ALA A 1 240 ? -17.815 -35.847 29.381  1.00 26.61 ? 450  ALA A O   1 
ATOM   1798 C CB  . ALA A 1 240 ? -15.587 -35.662 27.012  1.00 25.89 ? 450  ALA A CB  1 
ATOM   1799 N N   . GLN A 1 241 ? -17.812 -37.723 28.141  1.00 28.05 ? 451  GLN A N   1 
ATOM   1800 C CA  . GLN A 1 241 ? -19.214 -38.055 28.427  1.00 29.59 ? 451  GLN A CA  1 
ATOM   1801 C C   . GLN A 1 241 ? -19.420 -38.347 29.910  1.00 30.34 ? 451  GLN A C   1 
ATOM   1802 O O   . GLN A 1 241 ? -20.405 -37.905 30.517  1.00 30.58 ? 451  GLN A O   1 
ATOM   1803 C CB  . GLN A 1 241 ? -19.698 -39.217 27.558  1.00 29.55 ? 451  GLN A CB  1 
ATOM   1804 C CG  . GLN A 1 241 ? -19.983 -38.802 26.101  1.00 30.10 ? 451  GLN A CG  1 
ATOM   1805 C CD  . GLN A 1 241 ? -20.161 -39.982 25.155  1.00 30.71 ? 451  GLN A CD  1 
ATOM   1806 O OE1 . GLN A 1 241 ? -20.255 -41.150 25.579  1.00 32.78 ? 451  GLN A OE1 1 
ATOM   1807 N NE2 . GLN A 1 241 ? -20.209 -39.685 23.865  1.00 31.28 ? 451  GLN A NE2 1 
ATOM   1808 N N   . MET A 1 242 ? -18.461 -39.052 30.501  1.00 31.27 ? 452  MET A N   1 
ATOM   1809 C CA  . MET A 1 242 ? -18.506 -39.370 31.928  1.00 32.14 ? 452  MET A CA  1 
ATOM   1810 C C   . MET A 1 242 ? -18.287 -38.136 32.773  1.00 31.42 ? 452  MET A C   1 
ATOM   1811 O O   . MET A 1 242 ? -18.871 -38.017 33.849  1.00 31.38 ? 452  MET A O   1 
ATOM   1812 C CB  . MET A 1 242 ? -17.478 -40.436 32.286  1.00 31.96 ? 452  MET A CB  1 
ATOM   1813 C CG  . MET A 1 242 ? -17.868 -41.837 31.843  1.00 33.48 ? 452  MET A CG  1 
ATOM   1814 S SD  . MET A 1 242 ? -16.613 -43.059 32.263  1.00 34.98 ? 452  MET A SD  1 
ATOM   1815 C CE  . MET A 1 242 ? -15.384 -42.711 31.024  1.00 34.35 ? 452  MET A CE  1 
ATOM   1816 N N   . MET A 1 243 ? -17.463 -37.216 32.273  1.00 31.21 ? 453  MET A N   1 
ATOM   1817 C CA  . MET A 1 243 ? -17.159 -35.973 32.978  1.00 30.90 ? 453  MET A CA  1 
ATOM   1818 C C   . MET A 1 243 ? -18.387 -35.072 32.998  1.00 30.94 ? 453  MET A C   1 
ATOM   1819 O O   . MET A 1 243 ? -18.629 -34.375 33.981  1.00 31.05 ? 453  MET A O   1 
ATOM   1820 C CB  . MET A 1 243 ? -15.958 -35.246 32.351  1.00 30.94 ? 453  MET A CB  1 
ATOM   1821 C CG  . MET A 1 243 ? -14.579 -35.879 32.594  1.00 30.46 ? 453  MET A CG  1 
ATOM   1822 S SD  . MET A 1 243 ? -14.087 -35.934 34.326  1.00 30.31 ? 453  MET A SD  1 
ATOM   1823 C CE  . MET A 1 243 ? -14.409 -37.652 34.700  1.00 31.36 ? 453  MET A CE  1 
ATOM   1824 N N   . GLN A 1 244 ? -19.155 -35.103 31.914  1.00 30.99 ? 454  GLN A N   1 
ATOM   1825 C CA  . GLN A 1 244 ? -20.424 -34.373 31.809  1.00 31.56 ? 454  GLN A CA  1 
ATOM   1826 C C   . GLN A 1 244 ? -21.460 -34.849 32.850  1.00 31.15 ? 454  GLN A C   1 
ATOM   1827 O O   . GLN A 1 244 ? -22.115 -34.029 33.503  1.00 31.02 ? 454  GLN A O   1 
ATOM   1828 C CB  . GLN A 1 244 ? -20.981 -34.498 30.386  1.00 31.70 ? 454  GLN A CB  1 
ATOM   1829 C CG  . GLN A 1 244 ? -22.096 -33.519 30.041  1.00 35.41 ? 454  GLN A CG  1 
ATOM   1830 C CD  . GLN A 1 244 ? -21.625 -32.063 29.918  1.00 39.07 ? 454  GLN A CD  1 
ATOM   1831 O OE1 . GLN A 1 244 ? -22.254 -31.146 30.461  1.00 40.30 ? 454  GLN A OE1 1 
ATOM   1832 N NE2 . GLN A 1 244 ? -20.523 -31.848 29.198  1.00 40.00 ? 454  GLN A NE2 1 
ATOM   1833 N N   . ARG A 1 245 ? -21.592 -36.166 33.005  1.00 30.48 ? 455  ARG A N   1 
ATOM   1834 C CA  . ARG A 1 245 ? -22.468 -36.757 34.015  1.00 30.42 ? 455  ARG A CA  1 
ATOM   1835 C C   . ARG A 1 245 ? -22.100 -36.374 35.454  1.00 30.38 ? 455  ARG A C   1 
ATOM   1836 O O   . ARG A 1 245 ? -22.981 -36.051 36.260  1.00 30.66 ? 455  ARG A O   1 
ATOM   1837 C CB  . ARG A 1 245 ? -22.528 -38.288 33.862  1.00 30.35 ? 455  ARG A CB  1 
ATOM   1838 C CG  . ARG A 1 245 ? -23.154 -38.784 32.530  1.00 30.72 ? 455  ARG A CG  1 
ATOM   1839 C CD  . ARG A 1 245 ? -24.514 -38.128 32.243  1.00 30.17 ? 455  ARG A CD  1 
ATOM   1840 N NE  . ARG A 1 245 ? -25.496 -38.390 33.299  1.00 31.39 ? 455  ARG A NE  1 
ATOM   1841 C CZ  . ARG A 1 245 ? -26.674 -37.775 33.412  1.00 31.66 ? 455  ARG A CZ  1 
ATOM   1842 N NH1 . ARG A 1 245 ? -27.043 -36.841 32.541  1.00 31.87 ? 455  ARG A NH1 1 
ATOM   1843 N NH2 . ARG A 1 245 ? -27.488 -38.093 34.403  1.00 29.86 ? 455  ARG A NH2 1 
ATOM   1844 N N   . ILE A 1 246 ? -20.809 -36.402 35.774  1.00 30.22 ? 456  ILE A N   1 
ATOM   1845 C CA  . ILE A 1 246 ? -20.329 -35.990 37.100  1.00 30.23 ? 456  ILE A CA  1 
ATOM   1846 C C   . ILE A 1 246 ? -20.704 -34.530 37.368  1.00 30.79 ? 456  ILE A C   1 
ATOM   1847 O O   . ILE A 1 246 ? -21.122 -34.186 38.476  1.00 31.16 ? 456  ILE A O   1 
ATOM   1848 C CB  . ILE A 1 246 ? -18.795 -36.227 37.258  1.00 29.86 ? 456  ILE A CB  1 
ATOM   1849 C CG1 . ILE A 1 246 ? -18.511 -37.724 37.363  1.00 29.15 ? 456  ILE A CG1 1 
ATOM   1850 C CG2 . ILE A 1 246 ? -18.253 -35.548 38.500  1.00 29.04 ? 456  ILE A CG2 1 
ATOM   1851 C CD1 . ILE A 1 246 ? -17.205 -38.156 36.774  1.00 28.50 ? 456  ILE A CD1 1 
ATOM   1852 N N   . LYS A 1 247 ? -20.556 -33.684 36.350  1.00 31.21 ? 457  LYS A N   1 
ATOM   1853 C CA  . LYS A 1 247 ? -20.931 -32.273 36.424  1.00 31.96 ? 457  LYS A CA  1 
ATOM   1854 C C   . LYS A 1 247 ? -22.440 -32.070 36.635  1.00 32.39 ? 457  LYS A C   1 
ATOM   1855 O O   . LYS A 1 247 ? -22.841 -31.197 37.395  1.00 32.82 ? 457  LYS A O   1 
ATOM   1856 C CB  . LYS A 1 247 ? -20.437 -31.534 35.177  1.00 31.86 ? 457  LYS A CB  1 
ATOM   1857 C CG  . LYS A 1 247 ? -20.901 -30.085 35.059  1.00 32.74 ? 457  LYS A CG  1 
ATOM   1858 C CD  . LYS A 1 247 ? -19.984 -29.304 34.132  1.00 33.96 ? 457  LYS A CD  1 
ATOM   1859 C CE  . LYS A 1 247 ? -20.760 -28.361 33.213  1.00 35.35 ? 457  LYS A CE  1 
ATOM   1860 N NZ  . LYS A 1 247 ? -21.566 -27.339 33.945  1.00 37.23 ? 457  LYS A NZ  1 
ATOM   1861 N N   . LYS A 1 248 ? -23.262 -32.885 35.978  1.00 33.08 ? 458  LYS A N   1 
ATOM   1862 C CA  . LYS A 1 248 ? -24.714 -32.820 36.125  1.00 33.71 ? 458  LYS A CA  1 
ATOM   1863 C C   . LYS A 1 248 ? -25.224 -33.415 37.441  1.00 34.40 ? 458  LYS A C   1 
ATOM   1864 O O   . LYS A 1 248 ? -26.068 -32.815 38.105  1.00 34.73 ? 458  LYS A O   1 
ATOM   1865 C CB  . LYS A 1 248 ? -25.413 -33.513 34.949  1.00 33.52 ? 458  LYS A CB  1 
ATOM   1866 C CG  . LYS A 1 248 ? -26.961 -33.453 35.009  1.00 33.74 ? 458  LYS A CG  1 
ATOM   1867 C CD  . LYS A 1 248 ? -27.500 -32.133 34.444  1.00 33.44 ? 458  LYS A CD  1 
ATOM   1868 C CE  . LYS A 1 248 ? -28.956 -31.874 34.811  1.00 33.25 ? 458  LYS A CE  1 
ATOM   1869 N NZ  . LYS A 1 248 ? -29.065 -30.787 35.829  1.00 33.23 ? 458  LYS A NZ  1 
ATOM   1870 N N   . THR A 1 249 ? -24.721 -34.595 37.805  1.00 35.17 ? 459  THR A N   1 
ATOM   1871 C CA  . THR A 1 249 ? -25.278 -35.368 38.918  1.00 35.71 ? 459  THR A CA  1 
ATOM   1872 C C   . THR A 1 249 ? -24.511 -35.248 40.228  1.00 35.98 ? 459  THR A C   1 
ATOM   1873 O O   . THR A 1 249 ? -25.095 -35.465 41.286  1.00 36.42 ? 459  THR A O   1 
ATOM   1874 C CB  . THR A 1 249 ? -25.404 -36.875 38.574  1.00 35.91 ? 459  THR A CB  1 
ATOM   1875 O OG1 . THR A 1 249 ? -24.099 -37.455 38.448  1.00 36.91 ? 459  THR A OG1 1 
ATOM   1876 C CG2 . THR A 1 249 ? -26.173 -37.083 37.272  1.00 36.26 ? 459  THR A CG2 1 
ATOM   1877 N N   . GLU A 1 250 ? -23.216 -34.926 40.172  1.00 36.15 ? 460  GLU A N   1 
ATOM   1878 C CA  . GLU A 1 250 ? -22.410 -34.800 41.403  1.00 36.47 ? 460  GLU A CA  1 
ATOM   1879 C C   . GLU A 1 250 ? -22.161 -33.337 41.782  1.00 36.88 ? 460  GLU A C   1 
ATOM   1880 O O   . GLU A 1 250 ? -21.066 -32.804 41.590  1.00 36.85 ? 460  GLU A O   1 
ATOM   1881 C CB  . GLU A 1 250 ? -21.093 -35.581 41.303  1.00 36.29 ? 460  GLU A CB  1 
ATOM   1882 C CG  . GLU A 1 250 ? -21.245 -37.097 41.163  1.00 36.06 ? 460  GLU A CG  1 
ATOM   1883 C CD  . GLU A 1 250 ? -21.630 -37.792 42.465  1.00 37.37 ? 460  GLU A CD  1 
ATOM   1884 O OE1 . GLU A 1 250 ? -21.198 -37.345 43.552  1.00 36.78 ? 460  GLU A OE1 1 
ATOM   1885 O OE2 . GLU A 1 250 ? -22.352 -38.809 42.396  1.00 38.05 ? 460  GLU A OE2 1 
ATOM   1886 N N   . THR A 1 251 ? -23.197 -32.720 42.355  1.00 37.17 ? 461  THR A N   1 
ATOM   1887 C CA  . THR A 1 251 ? -23.254 -31.277 42.649  1.00 37.24 ? 461  THR A CA  1 
ATOM   1888 C C   . THR A 1 251 ? -22.384 -30.798 43.828  1.00 36.89 ? 461  THR A C   1 
ATOM   1889 O O   . THR A 1 251 ? -22.291 -29.590 44.079  1.00 37.41 ? 461  THR A O   1 
ATOM   1890 C CB  . THR A 1 251 ? -24.742 -30.790 42.844  1.00 37.38 ? 461  THR A CB  1 
ATOM   1891 O OG1 . THR A 1 251 ? -24.765 -29.578 43.605  1.00 38.63 ? 461  THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 251 ? -25.588 -31.832 43.581  1.00 37.13 ? 461  THR A CG2 1 
ATOM   1893 N N   . GLU A 1 252 ? -21.745 -31.728 44.536  1.00 36.27 ? 462  GLU A N   1 
ATOM   1894 C CA  . GLU A 1 252 ? -20.846 -31.380 45.641  1.00 35.36 ? 462  GLU A CA  1 
ATOM   1895 C C   . GLU A 1 252 ? -19.367 -31.402 45.250  1.00 34.83 ? 462  GLU A C   1 
ATOM   1896 O O   . GLU A 1 252 ? -18.535 -30.782 45.910  1.00 34.81 ? 462  GLU A O   1 
ATOM   1897 C CB  . GLU A 1 252 ? -21.079 -32.310 46.838  1.00 35.59 ? 462  GLU A CB  1 
ATOM   1898 N N   . THR A 1 253 ? -19.029 -32.114 44.182  1.00 34.19 ? 463  THR A N   1 
ATOM   1899 C CA  . THR A 1 253 ? -17.617 -32.243 43.807  1.00 33.43 ? 463  THR A CA  1 
ATOM   1900 C C   . THR A 1 253 ? -17.139 -31.048 42.975  1.00 32.80 ? 463  THR A C   1 
ATOM   1901 O O   . THR A 1 253 ? -17.726 -30.723 41.936  1.00 32.09 ? 463  THR A O   1 
ATOM   1902 C CB  . THR A 1 253 ? -17.289 -33.608 43.120  1.00 33.36 ? 463  THR A CB  1 
ATOM   1903 O OG1 . THR A 1 253 ? -17.221 -33.451 41.703  1.00 34.23 ? 463  THR A OG1 1 
ATOM   1904 C CG2 . THR A 1 253 ? -18.321 -34.663 43.464  1.00 32.65 ? 463  THR A CG2 1 
ATOM   1905 N N   . SER A 1 254 ? -16.093 -30.385 43.467  1.00 32.25 ? 464  SER A N   1 
ATOM   1906 C CA  . SER A 1 254 ? -15.467 -29.277 42.752  1.00 32.41 ? 464  SER A CA  1 
ATOM   1907 C C   . SER A 1 254 ? -14.784 -29.753 41.471  1.00 32.09 ? 464  SER A C   1 
ATOM   1908 O O   . SER A 1 254 ? -14.370 -30.909 41.361  1.00 31.85 ? 464  SER A O   1 
ATOM   1909 C CB  . SER A 1 254 ? -14.456 -28.544 43.644  1.00 32.70 ? 464  SER A CB  1 
ATOM   1910 O OG  . SER A 1 254 ? -15.113 -27.818 44.672  1.00 34.49 ? 464  SER A OG  1 
ATOM   1911 N N   . LEU A 1 255 ? -14.680 -28.850 40.506  1.00 31.57 ? 465  LEU A N   1 
ATOM   1912 C CA  . LEU A 1 255 ? -14.042 -29.145 39.241  1.00 31.28 ? 465  LEU A CA  1 
ATOM   1913 C C   . LEU A 1 255 ? -13.043 -28.030 38.961  1.00 30.74 ? 465  LEU A C   1 
ATOM   1914 O O   . LEU A 1 255 ? -13.418 -26.854 38.918  1.00 30.69 ? 465  LEU A O   1 
ATOM   1915 C CB  . LEU A 1 255 ? -15.101 -29.252 38.133  1.00 31.54 ? 465  LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 255 ? -16.191 -30.344 38.243  1.00 32.39 ? 465  LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 255 ? -17.483 -29.978 37.471  1.00 32.46 ? 465  LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 255 ? -15.690 -31.730 37.800  1.00 32.61 ? 465  LEU A CD2 1 
ATOM   1919 N N   . HIS A 1 256 ? -11.769 -28.397 38.820  1.00 30.03 ? 466  HIS A N   1 
ATOM   1920 C CA  . HIS A 1 256 ? -10.690 -27.446 38.531  1.00 29.76 ? 466  HIS A CA  1 
ATOM   1921 C C   . HIS A 1 256 ? -11.047 -26.591 37.309  1.00 29.86 ? 466  HIS A C   1 
ATOM   1922 O O   . HIS A 1 256 ? -11.470 -27.131 36.284  1.00 29.90 ? 466  HIS A O   1 
ATOM   1923 C CB  . HIS A 1 256 ? -9.373  -28.195 38.293  1.00 29.67 ? 466  HIS A CB  1 
ATOM   1924 C CG  . HIS A 1 256 ? -8.170  -27.304 38.204  1.00 28.86 ? 466  HIS A CG  1 
ATOM   1925 N ND1 . HIS A 1 256 ? -7.232  -27.214 39.210  1.00 28.45 ? 466  HIS A ND1 1 
ATOM   1926 C CD2 . HIS A 1 256 ? -7.751  -26.468 37.227  1.00 27.86 ? 466  HIS A CD2 1 
ATOM   1927 C CE1 . HIS A 1 256 ? -6.285  -26.366 38.853  1.00 27.67 ? 466  HIS A CE1 1 
ATOM   1928 N NE2 . HIS A 1 256 ? -6.579  -25.894 37.656  1.00 27.82 ? 466  HIS A NE2 1 
ATOM   1929 N N   . PRO A 1 257 ? -10.909 -25.257 37.424  1.00 30.34 ? 467  PRO A N   1 
ATOM   1930 C CA  . PRO A 1 257 ? -11.286 -24.318 36.346  1.00 30.84 ? 467  PRO A CA  1 
ATOM   1931 C C   . PRO A 1 257 ? -10.611 -24.548 34.981  1.00 31.25 ? 467  PRO A C   1 
ATOM   1932 O O   . PRO A 1 257 ? -11.251 -24.331 33.954  1.00 31.23 ? 467  PRO A O   1 
ATOM   1933 C CB  . PRO A 1 257 ? -10.925 -22.941 36.923  1.00 30.75 ? 467  PRO A CB  1 
ATOM   1934 C CG  . PRO A 1 257 ? -9.999  -23.228 38.075  1.00 31.00 ? 467  PRO A CG  1 
ATOM   1935 C CD  . PRO A 1 257 ? -10.422 -24.546 38.619  1.00 30.20 ? 467  PRO A CD  1 
ATOM   1936 N N   . LEU A 1 258 ? -9.353  -24.997 34.971  1.00 32.11 ? 468  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 258 ? -8.618  -25.286 33.719  1.00 32.43 ? 468  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 258 ? -9.231  -26.470 32.972  1.00 33.17 ? 468  LEU A C   1 
ATOM   1939 O O   . LEU A 1 258 ? -9.407  -26.424 31.752  1.00 33.09 ? 468  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 258 ? -7.127  -25.548 33.993  1.00 32.29 ? 468  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 258 ? -6.206  -25.832 32.794  1.00 32.39 ? 468  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 258 ? -5.957  -24.582 31.937  1.00 31.52 ? 468  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 258 ? -4.884  -26.418 33.261  1.00 32.11 ? 468  LEU A CD2 1 
ATOM   1944 N N   . LEU A 1 259 ? -9.557  -27.524 33.719  1.00 33.65 ? 469  LEU A N   1 
ATOM   1945 C CA  . LEU A 1 259 ? -10.262 -28.683 33.172  1.00 33.92 ? 469  LEU A CA  1 
ATOM   1946 C C   . LEU A 1 259 ? -11.682 -28.297 32.759  1.00 34.54 ? 469  LEU A C   1 
ATOM   1947 O O   . LEU A 1 259 ? -12.225 -28.850 31.809  1.00 34.82 ? 469  LEU A O   1 
ATOM   1948 C CB  . LEU A 1 259 ? -10.280 -29.832 34.198  1.00 33.92 ? 469  LEU A CB  1 
ATOM   1949 C CG  . LEU A 1 259 ? -9.190  -30.923 34.180  1.00 33.43 ? 469  LEU A CG  1 
ATOM   1950 C CD1 . LEU A 1 259 ? -7.867  -30.473 33.604  1.00 31.24 ? 469  LEU A CD1 1 
ATOM   1951 C CD2 . LEU A 1 259 ? -9.000  -31.519 35.570  1.00 33.33 ? 469  LEU A CD2 1 
ATOM   1952 N N   . GLN A 1 260 ? -12.279 -27.339 33.464  1.00 34.99 ? 470  GLN A N   1 
ATOM   1953 C CA  . GLN A 1 260 ? -13.574 -26.794 33.046  1.00 35.93 ? 470  GLN A CA  1 
ATOM   1954 C C   . GLN A 1 260 ? -13.469 -26.042 31.707  1.00 36.24 ? 470  GLN A C   1 
ATOM   1955 O O   . GLN A 1 260 ? -14.382 -26.118 30.885  1.00 35.94 ? 470  GLN A O   1 
ATOM   1956 C CB  . GLN A 1 260 ? -14.182 -25.897 34.133  1.00 35.96 ? 470  GLN A CB  1 
ATOM   1957 N N   . GLU A 1 261 ? -12.356 -25.328 31.506  1.00 36.90 ? 471  GLU A N   1 
ATOM   1958 C CA  . GLU A 1 261 ? -12.030 -24.677 30.225  1.00 37.62 ? 471  GLU A CA  1 
ATOM   1959 C C   . GLU A 1 261 ? -11.836 -25.661 29.060  1.00 38.30 ? 471  GLU A C   1 
ATOM   1960 O O   . GLU A 1 261 ? -12.086 -25.311 27.911  1.00 38.31 ? 471  GLU A O   1 
ATOM   1961 C CB  . GLU A 1 261 ? -10.783 -23.788 30.355  1.00 37.46 ? 471  GLU A CB  1 
ATOM   1962 C CG  . GLU A 1 261 ? -10.991 -22.482 31.117  1.00 37.31 ? 471  GLU A CG  1 
ATOM   1963 C CD  . GLU A 1 261 ? -12.034 -21.576 30.473  1.00 38.72 ? 471  GLU A CD  1 
ATOM   1964 O OE1 . GLU A 1 261 ? -13.142 -21.470 31.030  1.00 39.36 ? 471  GLU A OE1 1 
ATOM   1965 O OE2 . GLU A 1 261 ? -11.759 -20.980 29.405  1.00 39.14 ? 471  GLU A OE2 1 
ATOM   1966 N N   . ILE A 1 262 ? -11.393 -26.885 29.358  1.00 39.39 ? 472  ILE A N   1 
ATOM   1967 C CA  . ILE A 1 262 ? -11.160 -27.909 28.323  1.00 40.04 ? 472  ILE A CA  1 
ATOM   1968 C C   . ILE A 1 262 ? -12.457 -28.588 27.852  1.00 41.07 ? 472  ILE A C   1 
ATOM   1969 O O   . ILE A 1 262 ? -12.586 -28.926 26.673  1.00 41.01 ? 472  ILE A O   1 
ATOM   1970 C CB  . ILE A 1 262 ? -10.122 -28.981 28.797  1.00 40.07 ? 472  ILE A CB  1 
ATOM   1971 C CG1 . ILE A 1 262 ? -8.737  -28.358 28.965  1.00 39.02 ? 472  ILE A CG1 1 
ATOM   1972 C CG2 . ILE A 1 262 ? -10.064 -30.207 27.851  1.00 39.58 ? 472  ILE A CG2 1 
ATOM   1973 C CD1 . ILE A 1 262 ? -7.696  -29.315 29.541  1.00 39.68 ? 472  ILE A CD1 1 
ATOM   1974 N N   . TYR A 1 263 ? -13.411 -28.779 28.764  1.00 42.09 ? 473  TYR A N   1 
ATOM   1975 C CA  . TYR A 1 263 ? -14.598 -29.602 28.470  1.00 43.11 ? 473  TYR A CA  1 
ATOM   1976 C C   . TYR A 1 263 ? -15.810 -28.837 27.931  1.00 44.16 ? 473  TYR A C   1 
ATOM   1977 O O   . TYR A 1 263 ? -16.730 -29.444 27.370  1.00 44.27 ? 473  TYR A O   1 
ATOM   1978 C CB  . TYR A 1 263 ? -14.982 -30.467 29.687  1.00 42.50 ? 473  TYR A CB  1 
ATOM   1979 C CG  . TYR A 1 263 ? -13.954 -31.539 29.985  1.00 41.93 ? 473  TYR A CG  1 
ATOM   1980 C CD1 . TYR A 1 263 ? -13.669 -32.535 29.046  1.00 40.98 ? 473  TYR A CD1 1 
ATOM   1981 C CD2 . TYR A 1 263 ? -13.251 -31.548 31.189  1.00 40.17 ? 473  TYR A CD2 1 
ATOM   1982 C CE1 . TYR A 1 263 ? -12.719 -33.509 29.298  1.00 39.83 ? 473  TYR A CE1 1 
ATOM   1983 C CE2 . TYR A 1 263 ? -12.298 -32.518 31.447  1.00 39.78 ? 473  TYR A CE2 1 
ATOM   1984 C CZ  . TYR A 1 263 ? -12.040 -33.495 30.496  1.00 40.56 ? 473  TYR A CZ  1 
ATOM   1985 O OH  . TYR A 1 263 ? -11.102 -34.465 30.741  1.00 41.16 ? 473  TYR A OH  1 
ATOM   1986 N N   . LYS A 1 264 ? -15.788 -27.513 28.084  1.00 45.39 ? 474  LYS A N   1 
ATOM   1987 C CA  . LYS A 1 264 ? -16.865 -26.608 27.629  1.00 46.65 ? 474  LYS A CA  1 
ATOM   1988 C C   . LYS A 1 264 ? -17.530 -26.985 26.288  1.00 47.38 ? 474  LYS A C   1 
ATOM   1989 O O   . LYS A 1 264 ? -18.740 -26.792 26.117  1.00 47.49 ? 474  LYS A O   1 
ATOM   1990 C CB  . LYS A 1 264 ? -16.321 -25.186 27.555  1.00 46.68 ? 474  LYS A CB  1 
ATOM   1991 C CG  . LYS A 1 264 ? -17.278 -24.107 28.025  1.00 47.75 ? 474  LYS A CG  1 
ATOM   1992 C CD  . LYS A 1 264 ? -16.521 -22.890 28.578  1.00 48.21 ? 474  LYS A CD  1 
ATOM   1993 C CE  . LYS A 1 264 ? -15.472 -22.358 27.593  1.00 49.05 ? 474  LYS A CE  1 
ATOM   1994 N NZ  . LYS A 1 264 ? -14.619 -21.291 28.196  1.00 49.10 ? 474  LYS A NZ  1 
ATOM   1995 N N   . ASP A 1 265 ? -16.736 -27.520 25.355  1.00 48.00 ? 475  ASP A N   1 
ATOM   1996 C CA  . ASP A 1 265 ? -17.216 -27.963 24.040  1.00 48.78 ? 475  ASP A CA  1 
ATOM   1997 C C   . ASP A 1 265 ? -16.159 -28.789 23.311  1.00 49.01 ? 475  ASP A C   1 
ATOM   1998 O O   . ASP A 1 265 ? -16.167 -30.022 23.362  1.00 49.37 ? 475  ASP A O   1 
ATOM   1999 C CB  . ASP A 1 265 ? -17.602 -26.760 23.174  1.00 49.07 ? 475  ASP A CB  1 
ATOM   2000 C CG  . ASP A 1 265 ? -16.612 -25.621 23.292  1.00 49.85 ? 475  ASP A CG  1 
ATOM   2001 O OD1 . ASP A 1 265 ? -17.008 -24.538 23.769  1.00 50.57 ? 475  ASP A OD1 1 
ATOM   2002 O OD2 . ASP A 1 265 ? -15.428 -25.818 22.937  1.00 51.60 ? 475  ASP A OD2 1 
ATOM   2003 N N   . LEU B 1 1   ? 12.373  -3.997  42.801  1.00 51.87 ? 211  LEU B N   1 
ATOM   2004 C CA  . LEU B 1 1   ? 11.457  -3.293  41.857  1.00 51.96 ? 211  LEU B CA  1 
ATOM   2005 C C   . LEU B 1 1   ? 12.268  -2.552  40.792  1.00 52.13 ? 211  LEU B C   1 
ATOM   2006 O O   . LEU B 1 1   ? 11.818  -2.390  39.647  1.00 52.19 ? 211  LEU B O   1 
ATOM   2007 C CB  . LEU B 1 1   ? 10.533  -2.329  42.615  1.00 51.88 ? 211  LEU B CB  1 
ATOM   2008 C CG  . LEU B 1 1   ? 9.070   -2.175  42.174  1.00 52.12 ? 211  LEU B CG  1 
ATOM   2009 C CD1 . LEU B 1 1   ? 8.418   -3.516  41.801  1.00 52.50 ? 211  LEU B CD1 1 
ATOM   2010 C CD2 . LEU B 1 1   ? 8.247   -1.474  43.252  1.00 51.64 ? 211  LEU B CD2 1 
ATOM   2011 N N   . LYS B 1 2   ? 13.462  -2.108  41.186  1.00 51.96 ? 212  LYS B N   1 
ATOM   2012 C CA  . LYS B 1 2   ? 14.437  -1.522  40.269  1.00 51.72 ? 212  LYS B CA  1 
ATOM   2013 C C   . LYS B 1 2   ? 14.847  -2.571  39.231  1.00 51.30 ? 212  LYS B C   1 
ATOM   2014 O O   . LYS B 1 2   ? 14.789  -2.315  38.025  1.00 51.16 ? 212  LYS B O   1 
ATOM   2015 C CB  . LYS B 1 2   ? 15.659  -1.008  41.056  1.00 51.85 ? 212  LYS B CB  1 
ATOM   2016 C CG  . LYS B 1 2   ? 16.657  -0.172  40.253  1.00 52.35 ? 212  LYS B CG  1 
ATOM   2017 C CD  . LYS B 1 2   ? 16.081  1.189   39.876  1.00 53.27 ? 212  LYS B CD  1 
ATOM   2018 C CE  . LYS B 1 2   ? 16.730  1.747   38.602  1.00 53.38 ? 212  LYS B CE  1 
ATOM   2019 N NZ  . LYS B 1 2   ? 17.959  2.559   38.854  1.00 52.85 ? 212  LYS B NZ  1 
ATOM   2020 N N   . ALA B 1 3   ? 15.226  -3.758  39.714  1.00 50.82 ? 213  ALA B N   1 
ATOM   2021 C CA  . ALA B 1 3   ? 15.627  -4.881  38.858  1.00 50.22 ? 213  ALA B CA  1 
ATOM   2022 C C   . ALA B 1 3   ? 14.470  -5.428  38.020  1.00 49.83 ? 213  ALA B C   1 
ATOM   2023 O O   . ALA B 1 3   ? 14.689  -6.064  36.984  1.00 49.68 ? 213  ALA B O   1 
ATOM   2024 C CB  . ALA B 1 3   ? 16.252  -5.992  39.694  1.00 50.24 ? 213  ALA B CB  1 
ATOM   2025 N N   . PHE B 1 4   ? 13.246  -5.193  38.488  1.00 49.46 ? 214  PHE B N   1 
ATOM   2026 C CA  . PHE B 1 4   ? 12.037  -5.577  37.764  1.00 48.95 ? 214  PHE B CA  1 
ATOM   2027 C C   . PHE B 1 4   ? 11.861  -4.683  36.539  1.00 48.55 ? 214  PHE B C   1 
ATOM   2028 O O   . PHE B 1 4   ? 11.601  -5.177  35.443  1.00 48.66 ? 214  PHE B O   1 
ATOM   2029 C CB  . PHE B 1 4   ? 10.817  -5.489  38.692  1.00 49.07 ? 214  PHE B CB  1 
ATOM   2030 C CG  . PHE B 1 4   ? 9.498   -5.818  38.027  1.00 48.98 ? 214  PHE B CG  1 
ATOM   2031 C CD1 . PHE B 1 4   ? 8.714   -4.813  37.466  1.00 49.12 ? 214  PHE B CD1 1 
ATOM   2032 C CD2 . PHE B 1 4   ? 9.026   -7.124  37.993  1.00 48.66 ? 214  PHE B CD2 1 
ATOM   2033 C CE1 . PHE B 1 4   ? 7.493   -5.109  36.870  1.00 48.76 ? 214  PHE B CE1 1 
ATOM   2034 C CE2 . PHE B 1 4   ? 7.809   -7.424  37.398  1.00 48.66 ? 214  PHE B CE2 1 
ATOM   2035 C CZ  . PHE B 1 4   ? 7.045   -6.418  36.837  1.00 48.65 ? 214  PHE B CZ  1 
ATOM   2036 N N   . SER B 1 5   ? 12.020  -3.374  36.723  1.00 48.08 ? 215  SER B N   1 
ATOM   2037 C CA  . SER B 1 5   ? 11.819  -2.415  35.632  1.00 47.97 ? 215  SER B CA  1 
ATOM   2038 C C   . SER B 1 5   ? 12.868  -2.570  34.533  1.00 47.72 ? 215  SER B C   1 
ATOM   2039 O O   . SER B 1 5   ? 12.581  -2.345  33.359  1.00 47.77 ? 215  SER B O   1 
ATOM   2040 C CB  . SER B 1 5   ? 11.797  -0.977  36.157  1.00 47.62 ? 215  SER B CB  1 
ATOM   2041 N N   . LYS B 1 6   ? 14.076  -2.963  34.928  1.00 47.64 ? 216  LYS B N   1 
ATOM   2042 C CA  . LYS B 1 6   ? 15.190  -3.141  34.002  1.00 47.37 ? 216  LYS B CA  1 
ATOM   2043 C C   . LYS B 1 6   ? 15.095  -4.439  33.205  1.00 47.06 ? 216  LYS B C   1 
ATOM   2044 O O   . LYS B 1 6   ? 15.474  -4.475  32.037  1.00 47.20 ? 216  LYS B O   1 
ATOM   2045 C CB  . LYS B 1 6   ? 16.521  -3.052  34.748  1.00 47.64 ? 216  LYS B CB  1 
ATOM   2046 C CG  . LYS B 1 6   ? 17.128  -1.643  34.759  1.00 48.20 ? 216  LYS B CG  1 
ATOM   2047 C CD  . LYS B 1 6   ? 17.986  -1.377  35.998  1.00 49.19 ? 216  LYS B CD  1 
ATOM   2048 C CE  . LYS B 1 6   ? 19.178  -2.318  36.098  1.00 49.68 ? 216  LYS B CE  1 
ATOM   2049 N NZ  . LYS B 1 6   ? 19.708  -2.340  37.486  1.00 50.73 ? 216  LYS B NZ  1 
ATOM   2050 N N   . HIS B 1 7   ? 14.587  -5.499  33.828  1.00 46.59 ? 217  HIS B N   1 
ATOM   2051 C CA  . HIS B 1 7   ? 14.332  -6.746  33.110  1.00 46.20 ? 217  HIS B CA  1 
ATOM   2052 C C   . HIS B 1 7   ? 13.261  -6.539  32.038  1.00 45.53 ? 217  HIS B C   1 
ATOM   2053 O O   . HIS B 1 7   ? 13.362  -7.089  30.939  1.00 45.41 ? 217  HIS B O   1 
ATOM   2054 C CB  . HIS B 1 7   ? 13.933  -7.868  34.071  1.00 46.49 ? 217  HIS B CB  1 
ATOM   2055 C CG  . HIS B 1 7   ? 13.574  -9.153  33.389  1.00 47.57 ? 217  HIS B CG  1 
ATOM   2056 N ND1 . HIS B 1 7   ? 14.519  -10.079 32.998  1.00 49.25 ? 217  HIS B ND1 1 
ATOM   2057 C CD2 . HIS B 1 7   ? 12.372  -9.663  33.024  1.00 48.28 ? 217  HIS B CD2 1 
ATOM   2058 C CE1 . HIS B 1 7   ? 13.915  -11.105 32.421  1.00 49.24 ? 217  HIS B CE1 1 
ATOM   2059 N NE2 . HIS B 1 7   ? 12.612  -10.877 32.424  1.00 49.27 ? 217  HIS B NE2 1 
ATOM   2060 N N   . ILE B 1 8   ? 12.250  -5.737  32.368  1.00 44.50 ? 218  ILE B N   1 
ATOM   2061 C CA  . ILE B 1 8   ? 11.184  -5.384  31.434  1.00 43.58 ? 218  ILE B CA  1 
ATOM   2062 C C   . ILE B 1 8   ? 11.683  -4.422  30.336  1.00 43.23 ? 218  ILE B C   1 
ATOM   2063 O O   . ILE B 1 8   ? 11.259  -4.510  29.180  1.00 42.40 ? 218  ILE B O   1 
ATOM   2064 C CB  . ILE B 1 8   ? 9.934   -4.835  32.193  1.00 43.66 ? 218  ILE B CB  1 
ATOM   2065 C CG1 . ILE B 1 8   ? 9.160   -6.003  32.825  1.00 43.71 ? 218  ILE B CG1 1 
ATOM   2066 C CG2 . ILE B 1 8   ? 9.034   -3.984  31.279  1.00 42.94 ? 218  ILE B CG2 1 
ATOM   2067 C CD1 . ILE B 1 8   ? 7.818   -5.635  33.441  1.00 43.32 ? 218  ILE B CD1 1 
ATOM   2068 N N   . TYR B 1 9   ? 12.585  -3.514  30.704  1.00 43.05 ? 219  TYR B N   1 
ATOM   2069 C CA  . TYR B 1 9   ? 13.225  -2.635  29.727  1.00 43.05 ? 219  TYR B CA  1 
ATOM   2070 C C   . TYR B 1 9   ? 14.027  -3.448  28.709  1.00 42.91 ? 219  TYR B C   1 
ATOM   2071 O O   . TYR B 1 9   ? 13.896  -3.234  27.493  1.00 42.92 ? 219  TYR B O   1 
ATOM   2072 C CB  . TYR B 1 9   ? 14.113  -1.607  30.417  1.00 43.60 ? 219  TYR B CB  1 
ATOM   2073 C CG  . TYR B 1 9   ? 14.732  -0.575  29.491  1.00 44.20 ? 219  TYR B CG  1 
ATOM   2074 C CD1 . TYR B 1 9   ? 14.007  -0.023  28.440  1.00 44.49 ? 219  TYR B CD1 1 
ATOM   2075 C CD2 . TYR B 1 9   ? 16.037  -0.130  29.691  1.00 44.81 ? 219  TYR B CD2 1 
ATOM   2076 C CE1 . TYR B 1 9   ? 14.566  0.927   27.600  1.00 44.73 ? 219  TYR B CE1 1 
ATOM   2077 C CE2 . TYR B 1 9   ? 16.610  0.826   28.850  1.00 45.31 ? 219  TYR B CE2 1 
ATOM   2078 C CZ  . TYR B 1 9   ? 15.862  1.350   27.813  1.00 45.24 ? 219  TYR B CZ  1 
ATOM   2079 O OH  . TYR B 1 9   ? 16.414  2.297   26.979  1.00 46.28 ? 219  TYR B OH  1 
ATOM   2080 N N   . ASN B 1 10  ? 14.833  -4.384  29.216  1.00 42.19 ? 220  ASN B N   1 
ATOM   2081 C CA  . ASN B 1 10  ? 15.633  -5.279  28.386  1.00 41.84 ? 220  ASN B CA  1 
ATOM   2082 C C   . ASN B 1 10  ? 14.785  -6.094  27.415  1.00 41.32 ? 220  ASN B C   1 
ATOM   2083 O O   . ASN B 1 10  ? 15.081  -6.153  26.216  1.00 40.99 ? 220  ASN B O   1 
ATOM   2084 C CB  . ASN B 1 10  ? 16.486  -6.207  29.256  1.00 41.90 ? 220  ASN B CB  1 
ATOM   2085 C CG  . ASN B 1 10  ? 17.806  -5.574  29.665  1.00 42.66 ? 220  ASN B CG  1 
ATOM   2086 O OD1 . ASN B 1 10  ? 17.879  -4.791  30.619  1.00 43.42 ? 220  ASN B OD1 1 
ATOM   2087 N ND2 . ASN B 1 10  ? 18.864  -5.918  28.941  1.00 42.61 ? 220  ASN B ND2 1 
ATOM   2088 N N   . ALA B 1 11  ? 13.726  -6.703  27.945  1.00 40.43 ? 221  ALA B N   1 
ATOM   2089 C CA  . ALA B 1 11  ? 12.774  -7.469  27.158  1.00 39.67 ? 221  ALA B CA  1 
ATOM   2090 C C   . ALA B 1 11  ? 12.171  -6.639  26.022  1.00 39.47 ? 221  ALA B C   1 
ATOM   2091 O O   . ALA B 1 11  ? 12.004  -7.133  24.902  1.00 39.21 ? 221  ALA B O   1 
ATOM   2092 C CB  . ALA B 1 11  ? 11.681  -8.017  28.060  1.00 39.75 ? 221  ALA B CB  1 
ATOM   2093 N N   . TYR B 1 12  ? 11.851  -5.382  26.323  1.00 38.90 ? 222  TYR B N   1 
ATOM   2094 C CA  . TYR B 1 12  ? 11.332  -4.435  25.336  1.00 38.96 ? 222  TYR B CA  1 
ATOM   2095 C C   . TYR B 1 12  ? 12.388  -4.074  24.273  1.00 39.40 ? 222  TYR B C   1 
ATOM   2096 O O   . TYR B 1 12  ? 12.056  -3.889  23.097  1.00 39.63 ? 222  TYR B O   1 
ATOM   2097 C CB  . TYR B 1 12  ? 10.810  -3.193  26.065  1.00 38.27 ? 222  TYR B CB  1 
ATOM   2098 C CG  . TYR B 1 12  ? 10.396  -2.010  25.218  1.00 37.86 ? 222  TYR B CG  1 
ATOM   2099 C CD1 . TYR B 1 12  ? 11.349  -1.122  24.704  1.00 36.65 ? 222  TYR B CD1 1 
ATOM   2100 C CD2 . TYR B 1 12  ? 9.046   -1.729  24.991  1.00 38.36 ? 222  TYR B CD2 1 
ATOM   2101 C CE1 . TYR B 1 12  ? 10.977  -0.023  23.955  1.00 36.42 ? 222  TYR B CE1 1 
ATOM   2102 C CE2 . TYR B 1 12  ? 8.658   -0.619  24.238  1.00 38.07 ? 222  TYR B CE2 1 
ATOM   2103 C CZ  . TYR B 1 12  ? 9.634   0.228   23.718  1.00 37.63 ? 222  TYR B CZ  1 
ATOM   2104 O OH  . TYR B 1 12  ? 9.266   1.330   22.973  1.00 37.34 ? 222  TYR B OH  1 
ATOM   2105 N N   . LEU B 1 13  ? 13.651  -3.993  24.692  1.00 39.73 ? 223  LEU B N   1 
ATOM   2106 C CA  . LEU B 1 13  ? 14.764  -3.675  23.794  1.00 39.81 ? 223  LEU B CA  1 
ATOM   2107 C C   . LEU B 1 13  ? 15.111  -4.793  22.821  1.00 40.27 ? 223  LEU B C   1 
ATOM   2108 O O   . LEU B 1 13  ? 15.609  -4.527  21.723  1.00 40.39 ? 223  LEU B O   1 
ATOM   2109 C CB  . LEU B 1 13  ? 16.013  -3.284  24.590  1.00 39.44 ? 223  LEU B CB  1 
ATOM   2110 C CG  . LEU B 1 13  ? 15.984  -1.914  25.262  1.00 38.65 ? 223  LEU B CG  1 
ATOM   2111 C CD1 . LEU B 1 13  ? 17.269  -1.680  26.050  1.00 38.63 ? 223  LEU B CD1 1 
ATOM   2112 C CD2 . LEU B 1 13  ? 15.747  -0.812  24.233  1.00 37.80 ? 223  LEU B CD2 1 
ATOM   2113 N N   . LYS B 1 14  ? 14.859  -6.036  23.217  1.00 40.71 ? 224  LYS B N   1 
ATOM   2114 C CA  . LYS B 1 14  ? 15.247  -7.163  22.378  1.00 41.78 ? 224  LYS B CA  1 
ATOM   2115 C C   . LYS B 1 14  ? 14.068  -7.791  21.634  1.00 41.87 ? 224  LYS B C   1 
ATOM   2116 O O   . LYS B 1 14  ? 14.223  -8.802  20.945  1.00 41.88 ? 224  LYS B O   1 
ATOM   2117 C CB  . LYS B 1 14  ? 16.045  -8.205  23.180  1.00 41.80 ? 224  LYS B CB  1 
ATOM   2118 C CG  . LYS B 1 14  ? 15.237  -9.123  24.077  1.00 42.04 ? 224  LYS B CG  1 
ATOM   2119 C CD  . LYS B 1 14  ? 16.082  -10.316 24.553  1.00 42.77 ? 224  LYS B CD  1 
ATOM   2120 C CE  . LYS B 1 14  ? 17.134  -9.921  25.607  1.00 44.17 ? 224  LYS B CE  1 
ATOM   2121 N NZ  . LYS B 1 14  ? 17.674  -11.121 26.336  1.00 43.98 ? 224  LYS B NZ  1 
ATOM   2122 N N   . ASN B 1 15  ? 12.890  -7.196  21.778  1.00 42.05 ? 225  ASN B N   1 
ATOM   2123 C CA  . ASN B 1 15  ? 11.719  -7.731  21.111  1.00 42.42 ? 225  ASN B CA  1 
ATOM   2124 C C   . ASN B 1 15  ? 11.121  -6.768  20.112  1.00 42.71 ? 225  ASN B C   1 
ATOM   2125 O O   . ASN B 1 15  ? 10.414  -7.184  19.198  1.00 42.65 ? 225  ASN B O   1 
ATOM   2126 C CB  . ASN B 1 15  ? 10.682  -8.219  22.121  1.00 42.14 ? 225  ASN B CB  1 
ATOM   2127 C CG  . ASN B 1 15  ? 11.026  -9.588  22.680  1.00 42.22 ? 225  ASN B CG  1 
ATOM   2128 O OD1 . ASN B 1 15  ? 11.415  -9.722  23.847  1.00 42.39 ? 225  ASN B OD1 1 
ATOM   2129 N ND2 . ASN B 1 15  ? 10.898  -10.611 21.847  1.00 40.62 ? 225  ASN B ND2 1 
ATOM   2130 N N   . PHE B 1 16  ? 11.434  -5.489  20.284  1.00 43.42 ? 226  PHE B N   1 
ATOM   2131 C CA  . PHE B 1 16  ? 10.949  -4.444  19.391  1.00 44.28 ? 226  PHE B CA  1 
ATOM   2132 C C   . PHE B 1 16  ? 12.080  -3.792  18.593  1.00 44.95 ? 226  PHE B C   1 
ATOM   2133 O O   . PHE B 1 16  ? 12.920  -3.078  19.150  1.00 44.98 ? 226  PHE B O   1 
ATOM   2134 C CB  . PHE B 1 16  ? 10.142  -3.401  20.169  1.00 43.76 ? 226  PHE B CB  1 
ATOM   2135 C CG  . PHE B 1 16  ? 8.963   -3.974  20.898  1.00 44.16 ? 226  PHE B CG  1 
ATOM   2136 C CD1 . PHE B 1 16  ? 7.962   -4.656  20.209  1.00 44.17 ? 226  PHE B CD1 1 
ATOM   2137 C CD2 . PHE B 1 16  ? 8.848   -3.834  22.278  1.00 44.45 ? 226  PHE B CD2 1 
ATOM   2138 C CE1 . PHE B 1 16  ? 6.865   -5.193  20.891  1.00 43.84 ? 226  PHE B CE1 1 
ATOM   2139 C CE2 . PHE B 1 16  ? 7.749   -4.363  22.970  1.00 43.83 ? 226  PHE B CE2 1 
ATOM   2140 C CZ  . PHE B 1 16  ? 6.762   -5.045  22.274  1.00 43.27 ? 226  PHE B CZ  1 
ATOM   2141 N N   . ASN B 1 17  ? 12.084  -4.054  17.287  1.00 46.09 ? 227  ASN B N   1 
ATOM   2142 C CA  . ASN B 1 17  ? 13.066  -3.489  16.350  1.00 47.34 ? 227  ASN B CA  1 
ATOM   2143 C C   . ASN B 1 17  ? 13.126  -1.958  16.363  1.00 47.66 ? 227  ASN B C   1 
ATOM   2144 O O   . ASN B 1 17  ? 14.181  -1.373  16.615  1.00 47.93 ? 227  ASN B O   1 
ATOM   2145 C CB  . ASN B 1 17  ? 12.799  -3.989  14.928  1.00 47.55 ? 227  ASN B CB  1 
ATOM   2146 C CG  . ASN B 1 17  ? 11.465  -3.494  14.364  1.00 48.83 ? 227  ASN B CG  1 
ATOM   2147 O OD1 . ASN B 1 17  ? 11.428  -2.864  13.298  1.00 50.00 ? 227  ASN B OD1 1 
ATOM   2148 N ND2 . ASN B 1 17  ? 10.365  -3.773  15.077  1.00 49.01 ? 227  ASN B ND2 1 
ATOM   2149 N N   . MET B 1 18  ? 11.986  -1.321  16.107  1.00 48.04 ? 228  MET B N   1 
ATOM   2150 C CA  . MET B 1 18  ? 11.905  0.133   16.071  1.00 48.15 ? 228  MET B CA  1 
ATOM   2151 C C   . MET B 1 18  ? 11.496  0.703   17.427  1.00 47.95 ? 228  MET B C   1 
ATOM   2152 O O   . MET B 1 18  ? 10.308  0.878   17.719  1.00 47.44 ? 228  MET B O   1 
ATOM   2153 C CB  . MET B 1 18  ? 10.943  0.594   14.970  1.00 48.25 ? 228  MET B CB  1 
ATOM   2154 C CG  . MET B 1 18  ? 10.874  2.106   14.779  1.00 49.51 ? 228  MET B CG  1 
ATOM   2155 S SD  . MET B 1 18  ? 12.476  2.884   14.466  1.00 53.32 ? 228  MET B SD  1 
ATOM   2156 C CE  . MET B 1 18  ? 12.927  2.114   12.906  1.00 51.23 ? 228  MET B CE  1 
ATOM   2157 N N   . THR B 1 19  ? 12.500  0.990   18.248  1.00 47.96 ? 229  THR B N   1 
ATOM   2158 C CA  . THR B 1 19  ? 12.291  1.717   19.500  1.00 47.99 ? 229  THR B CA  1 
ATOM   2159 C C   . THR B 1 19  ? 12.023  3.189   19.191  1.00 47.89 ? 229  THR B C   1 
ATOM   2160 O O   . THR B 1 19  ? 12.323  3.655   18.084  1.00 47.72 ? 229  THR B O   1 
ATOM   2161 C CB  . THR B 1 19  ? 13.522  1.613   20.423  1.00 48.03 ? 229  THR B CB  1 
ATOM   2162 O OG1 . THR B 1 19  ? 14.623  2.316   19.832  1.00 48.20 ? 229  THR B OG1 1 
ATOM   2163 C CG2 . THR B 1 19  ? 13.905  0.150   20.650  1.00 47.72 ? 229  THR B CG2 1 
ATOM   2164 N N   . LYS B 1 20  ? 11.455  3.911   20.158  1.00 47.65 ? 230  LYS B N   1 
ATOM   2165 C CA  . LYS B 1 20  ? 11.208  5.344   20.011  1.00 47.57 ? 230  LYS B CA  1 
ATOM   2166 C C   . LYS B 1 20  ? 12.514  6.135   19.877  1.00 47.97 ? 230  LYS B C   1 
ATOM   2167 O O   . LYS B 1 20  ? 12.571  7.135   19.154  1.00 47.64 ? 230  LYS B O   1 
ATOM   2168 C CB  . LYS B 1 20  ? 10.395  5.888   21.188  1.00 47.43 ? 230  LYS B CB  1 
ATOM   2169 C CG  . LYS B 1 20  ? 9.814   7.274   20.937  1.00 46.44 ? 230  LYS B CG  1 
ATOM   2170 C CD  . LYS B 1 20  ? 9.054   7.798   22.129  1.00 45.52 ? 230  LYS B CD  1 
ATOM   2171 C CE  . LYS B 1 20  ? 8.198   8.975   21.736  1.00 45.23 ? 230  LYS B CE  1 
ATOM   2172 N NZ  . LYS B 1 20  ? 7.475   9.533   22.907  1.00 46.51 ? 230  LYS B NZ  1 
ATOM   2173 N N   . LYS B 1 21  ? 13.554  5.684   20.576  1.00 48.47 ? 231  LYS B N   1 
ATOM   2174 C CA  . LYS B 1 21  ? 14.848  6.366   20.538  1.00 49.16 ? 231  LYS B CA  1 
ATOM   2175 C C   . LYS B 1 21  ? 15.721  5.747   19.448  1.00 49.96 ? 231  LYS B C   1 
ATOM   2176 O O   . LYS B 1 21  ? 16.758  5.120   19.707  1.00 50.52 ? 231  LYS B O   1 
ATOM   2177 C CB  . LYS B 1 21  ? 15.514  6.393   21.922  1.00 48.80 ? 231  LYS B CB  1 
ATOM   2178 C CG  . LYS B 1 21  ? 14.612  7.004   23.037  1.00 47.51 ? 231  LYS B CG  1 
ATOM   2179 C CD  . LYS B 1 21  ? 13.998  8.358   22.634  1.00 43.03 ? 231  LYS B CD  1 
ATOM   2180 C CE  . LYS B 1 21  ? 12.755  8.658   23.434  1.00 39.50 ? 231  LYS B CE  1 
ATOM   2181 N NZ  . LYS B 1 21  ? 12.219  10.015  23.180  1.00 36.53 ? 231  LYS B NZ  1 
ATOM   2182 N N   . LYS B 1 22  ? 15.259  5.965   18.220  1.00 50.36 ? 232  LYS B N   1 
ATOM   2183 C CA  . LYS B 1 22  ? 15.709  5.285   17.017  1.00 51.02 ? 232  LYS B CA  1 
ATOM   2184 C C   . LYS B 1 22  ? 14.785  5.810   15.927  1.00 51.40 ? 232  LYS B C   1 
ATOM   2185 O O   . LYS B 1 22  ? 15.245  6.309   14.900  1.00 51.17 ? 232  LYS B O   1 
ATOM   2186 C CB  . LYS B 1 22  ? 15.532  3.771   17.164  1.00 51.23 ? 232  LYS B CB  1 
ATOM   2187 C CG  . LYS B 1 22  ? 16.419  2.907   16.283  1.00 51.07 ? 232  LYS B CG  1 
ATOM   2188 C CD  . LYS B 1 22  ? 16.325  1.466   16.761  1.00 50.77 ? 232  LYS B CD  1 
ATOM   2189 C CE  . LYS B 1 22  ? 17.136  0.511   15.918  1.00 50.00 ? 232  LYS B CE  1 
ATOM   2190 N NZ  . LYS B 1 22  ? 16.717  -0.877  16.226  1.00 49.63 ? 232  LYS B NZ  1 
ATOM   2191 N N   . ALA B 1 23  ? 13.478  5.718   16.185  1.00 51.69 ? 233  ALA B N   1 
ATOM   2192 C CA  . ALA B 1 23  ? 12.457  6.375   15.374  1.00 52.23 ? 233  ALA B CA  1 
ATOM   2193 C C   . ALA B 1 23  ? 12.628  7.892   15.431  1.00 52.69 ? 233  ALA B C   1 
ATOM   2194 O O   . ALA B 1 23  ? 12.431  8.584   14.432  1.00 52.66 ? 233  ALA B O   1 
ATOM   2195 C CB  . ALA B 1 23  ? 11.069  5.980   15.843  1.00 52.05 ? 233  ALA B CB  1 
ATOM   2196 N N   . ARG B 1 24  ? 13.005  8.401   16.601  1.00 53.30 ? 234  ARG B N   1 
ATOM   2197 C CA  . ARG B 1 24  ? 13.293  9.825   16.762  1.00 53.89 ? 234  ARG B CA  1 
ATOM   2198 C C   . ARG B 1 24  ? 14.637  10.206  16.141  1.00 54.11 ? 234  ARG B C   1 
ATOM   2199 O O   . ARG B 1 24  ? 14.860  11.373  15.825  1.00 54.02 ? 234  ARG B O   1 
ATOM   2200 C CB  . ARG B 1 24  ? 13.245  10.239  18.235  1.00 53.85 ? 234  ARG B CB  1 
ATOM   2201 C CG  . ARG B 1 24  ? 11.844  10.267  18.848  1.00 54.71 ? 234  ARG B CG  1 
ATOM   2202 C CD  . ARG B 1 24  ? 10.950  11.351  18.236  1.00 55.47 ? 234  ARG B CD  1 
ATOM   2203 N NE  . ARG B 1 24  ? 9.866   11.721  19.144  1.00 56.32 ? 234  ARG B NE  1 
ATOM   2204 C CZ  . ARG B 1 24  ? 8.678   12.189  18.765  1.00 57.77 ? 234  ARG B CZ  1 
ATOM   2205 N NH1 . ARG B 1 24  ? 8.386   12.343  17.474  1.00 57.65 ? 234  ARG B NH1 1 
ATOM   2206 N NH2 . ARG B 1 24  ? 7.767   12.487  19.686  1.00 57.97 ? 234  ARG B NH2 1 
ATOM   2207 N N   . SER B 1 25  ? 15.512  9.212   15.962  1.00 54.54 ? 235  SER B N   1 
ATOM   2208 C CA  . SER B 1 25  ? 16.829  9.404   15.350  1.00 54.77 ? 235  SER B CA  1 
ATOM   2209 C C   . SER B 1 25  ? 16.758  9.493   13.825  1.00 55.02 ? 235  SER B C   1 
ATOM   2210 O O   . SER B 1 25  ? 17.494  10.270  13.217  1.00 55.22 ? 235  SER B O   1 
ATOM   2211 C CB  . SER B 1 25  ? 17.785  8.277   15.756  1.00 54.87 ? 235  SER B CB  1 
ATOM   2212 O OG  . SER B 1 25  ? 18.008  8.257   17.160  1.00 55.17 ? 235  SER B OG  1 
ATOM   2213 N N   . ILE B 1 26  ? 15.886  8.692   13.210  1.00 55.18 ? 236  ILE B N   1 
ATOM   2214 C CA  . ILE B 1 26  ? 15.689  8.734   11.756  1.00 55.29 ? 236  ILE B CA  1 
ATOM   2215 C C   . ILE B 1 26  ? 14.422  9.501   11.368  1.00 55.63 ? 236  ILE B C   1 
ATOM   2216 O O   . ILE B 1 26  ? 13.730  9.129   10.414  1.00 55.69 ? 236  ILE B O   1 
ATOM   2217 C CB  . ILE B 1 26  ? 15.716  7.322   11.094  1.00 55.23 ? 236  ILE B CB  1 
ATOM   2218 C CG1 . ILE B 1 26  ? 14.721  6.374   11.775  1.00 55.07 ? 236  ILE B CG1 1 
ATOM   2219 C CG2 . ILE B 1 26  ? 17.154  6.765   11.059  1.00 54.86 ? 236  ILE B CG2 1 
ATOM   2220 C CD1 . ILE B 1 26  ? 14.729  4.956   11.247  1.00 55.02 ? 236  ILE B CD1 1 
ATOM   2221 N N   . LEU B 1 27  ? 14.149  10.583  12.100  1.00 55.94 ? 237  LEU B N   1 
ATOM   2222 C CA  . LEU B 1 27  ? 12.932  11.382  11.924  1.00 56.09 ? 237  LEU B CA  1 
ATOM   2223 C C   . LEU B 1 27  ? 13.045  12.806  12.500  1.00 56.26 ? 237  LEU B C   1 
ATOM   2224 O O   . LEU B 1 27  ? 12.190  13.656  12.229  1.00 56.28 ? 237  LEU B O   1 
ATOM   2225 C CB  . LEU B 1 27  ? 11.740  10.633  12.536  1.00 56.19 ? 237  LEU B CB  1 
ATOM   2226 C CG  . LEU B 1 27  ? 10.315  11.183  12.585  1.00 56.24 ? 237  LEU B CG  1 
ATOM   2227 C CD1 . LEU B 1 27  ? 9.333   10.071  12.303  1.00 57.05 ? 237  LEU B CD1 1 
ATOM   2228 C CD2 . LEU B 1 27  ? 10.038  11.806  13.940  1.00 57.23 ? 237  LEU B CD2 1 
ATOM   2229 N N   . THR B 1 28  ? 14.098  13.065  13.278  1.00 56.31 ? 238  THR B N   1 
ATOM   2230 C CA  . THR B 1 28  ? 14.277  14.363  13.948  1.00 56.49 ? 238  THR B CA  1 
ATOM   2231 C C   . THR B 1 28  ? 14.457  15.513  12.957  1.00 56.75 ? 238  THR B C   1 
ATOM   2232 O O   . THR B 1 28  ? 13.535  16.301  12.727  1.00 56.91 ? 238  THR B O   1 
ATOM   2233 C CB  . THR B 1 28  ? 15.476  14.348  14.924  1.00 56.34 ? 238  THR B CB  1 
ATOM   2234 N N   . PRO B 1 36  ? 14.234  8.999   4.971   1.00 49.61 ? 246  PRO B N   1 
ATOM   2235 C CA  . PRO B 1 36  ? 13.048  8.210   4.640   1.00 49.61 ? 246  PRO B CA  1 
ATOM   2236 C C   . PRO B 1 36  ? 12.347  8.677   3.356   1.00 49.59 ? 246  PRO B C   1 
ATOM   2237 O O   . PRO B 1 36  ? 12.078  9.878   3.179   1.00 49.71 ? 246  PRO B O   1 
ATOM   2238 C CB  . PRO B 1 36  ? 12.132  8.435   5.849   1.00 49.47 ? 246  PRO B CB  1 
ATOM   2239 C CG  . PRO B 1 36  ? 12.521  9.767   6.362   1.00 49.65 ? 246  PRO B CG  1 
ATOM   2240 C CD  . PRO B 1 36  ? 14.013  9.852   6.150   1.00 49.58 ? 246  PRO B CD  1 
ATOM   2241 N N   . PHE B 1 37  ? 12.054  7.720   2.479   1.00 49.33 ? 247  PHE B N   1 
ATOM   2242 C CA  . PHE B 1 37  ? 11.256  7.962   1.275   1.00 48.81 ? 247  PHE B CA  1 
ATOM   2243 C C   . PHE B 1 37  ? 9.825   8.373   1.652   1.00 48.19 ? 247  PHE B C   1 
ATOM   2244 O O   . PHE B 1 37  ? 9.148   7.664   2.402   1.00 47.95 ? 247  PHE B O   1 
ATOM   2245 C CB  . PHE B 1 37  ? 11.248  6.696   0.414   1.00 48.94 ? 247  PHE B CB  1 
ATOM   2246 C CG  . PHE B 1 37  ? 10.773  6.910   -0.994  1.00 49.02 ? 247  PHE B CG  1 
ATOM   2247 C CD1 . PHE B 1 37  ? 11.623  7.445   -1.955  1.00 49.21 ? 247  PHE B CD1 1 
ATOM   2248 C CD2 . PHE B 1 37  ? 9.485   6.546   -1.368  1.00 49.52 ? 247  PHE B CD2 1 
ATOM   2249 C CE1 . PHE B 1 37  ? 11.193  7.628   -3.261  1.00 49.52 ? 247  PHE B CE1 1 
ATOM   2250 C CE2 . PHE B 1 37  ? 9.045   6.724   -2.674  1.00 49.50 ? 247  PHE B CE2 1 
ATOM   2251 C CZ  . PHE B 1 37  ? 9.901   7.267   -3.622  1.00 49.49 ? 247  PHE B CZ  1 
ATOM   2252 N N   . VAL B 1 38  ? 9.380   9.518   1.135   1.00 47.30 ? 248  VAL B N   1 
ATOM   2253 C CA  . VAL B 1 38  ? 8.067   10.073  1.470   1.00 46.67 ? 248  VAL B CA  1 
ATOM   2254 C C   . VAL B 1 38  ? 6.956   9.604   0.519   1.00 46.53 ? 248  VAL B C   1 
ATOM   2255 O O   . VAL B 1 38  ? 6.942   9.949   -0.669  1.00 46.87 ? 248  VAL B O   1 
ATOM   2256 C CB  . VAL B 1 38  ? 8.099   11.619  1.527   1.00 46.59 ? 248  VAL B CB  1 
ATOM   2257 C CG1 . VAL B 1 38  ? 6.701   12.186  1.749   1.00 46.25 ? 248  VAL B CG1 1 
ATOM   2258 C CG2 . VAL B 1 38  ? 9.042   12.091  2.626   1.00 46.59 ? 248  VAL B CG2 1 
ATOM   2259 N N   . ILE B 1 39  ? 6.025   8.823   1.064   1.00 45.74 ? 249  ILE B N   1 
ATOM   2260 C CA  . ILE B 1 39  ? 4.888   8.295   0.317   1.00 44.75 ? 249  ILE B CA  1 
ATOM   2261 C C   . ILE B 1 39  ? 3.677   9.185   0.557   1.00 44.16 ? 249  ILE B C   1 
ATOM   2262 O O   . ILE B 1 39  ? 3.173   9.263   1.680   1.00 44.05 ? 249  ILE B O   1 
ATOM   2263 C CB  . ILE B 1 39  ? 4.563   6.849   0.762   1.00 44.84 ? 249  ILE B CB  1 
ATOM   2264 C CG1 . ILE B 1 39  ? 5.798   5.951   0.618   1.00 44.41 ? 249  ILE B CG1 1 
ATOM   2265 C CG2 . ILE B 1 39  ? 3.359   6.308   -0.011  1.00 44.78 ? 249  ILE B CG2 1 
ATOM   2266 C CD1 . ILE B 1 39  ? 5.837   4.763   1.567   1.00 43.87 ? 249  ILE B CD1 1 
ATOM   2267 N N   . HIS B 1 40  ? 3.210   9.855   -0.492  1.00 43.54 ? 250  HIS B N   1 
ATOM   2268 C CA  . HIS B 1 40  ? 2.121   10.829  -0.348  1.00 43.27 ? 250  HIS B CA  1 
ATOM   2269 C C   . HIS B 1 40  ? 1.029   10.739  -1.425  1.00 43.06 ? 250  HIS B C   1 
ATOM   2270 O O   . HIS B 1 40  ? 0.023   11.453  -1.358  1.00 42.78 ? 250  HIS B O   1 
ATOM   2271 C CB  . HIS B 1 40  ? 2.682   12.256  -0.263  1.00 43.23 ? 250  HIS B CB  1 
ATOM   2272 C CG  . HIS B 1 40  ? 3.500   12.657  -1.448  1.00 42.69 ? 250  HIS B CG  1 
ATOM   2273 N ND1 . HIS B 1 40  ? 3.065   13.584  -2.369  1.00 42.36 ? 250  HIS B ND1 1 
ATOM   2274 C CD2 . HIS B 1 40  ? 4.725   12.256  -1.865  1.00 42.80 ? 250  HIS B CD2 1 
ATOM   2275 C CE1 . HIS B 1 40  ? 3.986   13.737  -3.304  1.00 42.82 ? 250  HIS B CE1 1 
ATOM   2276 N NE2 . HIS B 1 40  ? 5.004   12.943  -3.021  1.00 42.50 ? 250  HIS B NE2 1 
ATOM   2277 N N   . ASP B 1 41  ? 1.238   9.855   -2.404  1.00 42.90 ? 251  ASP B N   1 
ATOM   2278 C CA  . ASP B 1 41  ? 0.285   9.622   -3.501  1.00 42.52 ? 251  ASP B CA  1 
ATOM   2279 C C   . ASP B 1 41  ? 0.504   8.225   -4.096  1.00 42.32 ? 251  ASP B C   1 
ATOM   2280 O O   . ASP B 1 41  ? 1.323   7.462   -3.590  1.00 42.36 ? 251  ASP B O   1 
ATOM   2281 C CB  . ASP B 1 41  ? 0.409   10.720  -4.574  1.00 42.39 ? 251  ASP B CB  1 
ATOM   2282 C CG  . ASP B 1 41  ? 1.836   10.889  -5.097  1.00 42.43 ? 251  ASP B CG  1 
ATOM   2283 O OD1 . ASP B 1 41  ? 2.738   10.120  -4.711  1.00 42.35 ? 251  ASP B OD1 1 
ATOM   2284 O OD2 . ASP B 1 41  ? 2.061   11.803  -5.918  1.00 44.10 ? 251  ASP B OD2 1 
ATOM   2285 N N   . ILE B 1 42  ? -0.211  7.887   -5.168  1.00 42.29 ? 252  ILE B N   1 
ATOM   2286 C CA  . ILE B 1 42  ? -0.047  6.574   -5.810  1.00 42.04 ? 252  ILE B CA  1 
ATOM   2287 C C   . ILE B 1 42  ? 1.374   6.338   -6.341  1.00 42.22 ? 252  ILE B C   1 
ATOM   2288 O O   . ILE B 1 42  ? 1.947   5.265   -6.141  1.00 41.93 ? 252  ILE B O   1 
ATOM   2289 C CB  . ILE B 1 42  ? -1.103  6.343   -6.922  1.00 41.92 ? 252  ILE B CB  1 
ATOM   2290 C CG1 . ILE B 1 42  ? -2.459  6.012   -6.289  1.00 41.99 ? 252  ILE B CG1 1 
ATOM   2291 C CG2 . ILE B 1 42  ? -0.670  5.224   -7.871  1.00 41.67 ? 252  ILE B CG2 1 
ATOM   2292 C CD1 . ILE B 1 42  ? -3.653  6.351   -7.138  1.00 40.51 ? 252  ILE B CD1 1 
ATOM   2293 N N   . GLU B 1 43  ? 1.943   7.345   -6.998  1.00 42.55 ? 253  GLU B N   1 
ATOM   2294 C CA  . GLU B 1 43  ? 3.210   7.163   -7.693  1.00 43.06 ? 253  GLU B CA  1 
ATOM   2295 C C   . GLU B 1 43  ? 4.343   6.838   -6.729  1.00 42.99 ? 253  GLU B C   1 
ATOM   2296 O O   . GLU B 1 43  ? 5.070   5.868   -6.930  1.00 42.85 ? 253  GLU B O   1 
ATOM   2297 C CB  . GLU B 1 43  ? 3.559   8.384   -8.539  1.00 43.36 ? 253  GLU B CB  1 
ATOM   2298 C CG  . GLU B 1 43  ? 4.626   8.114   -9.585  1.00 44.24 ? 253  GLU B CG  1 
ATOM   2299 C CD  . GLU B 1 43  ? 5.618   9.247   -9.680  1.00 46.23 ? 253  GLU B CD  1 
ATOM   2300 O OE1 . GLU B 1 43  ? 5.430   10.142  -10.532 1.00 46.72 ? 253  GLU B OE1 1 
ATOM   2301 O OE2 . GLU B 1 43  ? 6.579   9.252   -8.882  1.00 47.81 ? 253  GLU B OE2 1 
ATOM   2302 N N   . THR B 1 44  ? 4.479   7.639   -5.674  1.00 43.25 ? 254  THR B N   1 
ATOM   2303 C CA  . THR B 1 44  ? 5.521   7.392   -4.675  1.00 43.33 ? 254  THR B CA  1 
ATOM   2304 C C   . THR B 1 44  ? 5.324   6.053   -3.974  1.00 43.56 ? 254  THR B C   1 
ATOM   2305 O O   . THR B 1 44  ? 6.303   5.356   -3.708  1.00 43.60 ? 254  THR B O   1 
ATOM   2306 C CB  . THR B 1 44  ? 5.636   8.521   -3.634  1.00 43.26 ? 254  THR B CB  1 
ATOM   2307 O OG1 . THR B 1 44  ? 4.347   8.783   -3.067  1.00 43.31 ? 254  THR B OG1 1 
ATOM   2308 C CG2 . THR B 1 44  ? 6.180   9.786   -4.284  1.00 43.06 ? 254  THR B CG2 1 
ATOM   2309 N N   . LEU B 1 45  ? 4.068   5.684   -3.701  1.00 43.56 ? 255  LEU B N   1 
ATOM   2310 C CA  . LEU B 1 45  ? 3.781   4.385   -3.097  1.00 43.79 ? 255  LEU B CA  1 
ATOM   2311 C C   . LEU B 1 45  ? 4.221   3.263   -4.022  1.00 44.36 ? 255  LEU B C   1 
ATOM   2312 O O   . LEU B 1 45  ? 4.835   2.287   -3.582  1.00 44.00 ? 255  LEU B O   1 
ATOM   2313 C CB  . LEU B 1 45  ? 2.298   4.224   -2.738  1.00 43.61 ? 255  LEU B CB  1 
ATOM   2314 C CG  . LEU B 1 45  ? 1.919   2.845   -2.165  1.00 43.19 ? 255  LEU B CG  1 
ATOM   2315 C CD1 . LEU B 1 45  ? 2.710   2.505   -0.907  1.00 42.11 ? 255  LEU B CD1 1 
ATOM   2316 C CD2 . LEU B 1 45  ? 0.444   2.750   -1.882  1.00 43.69 ? 255  LEU B CD2 1 
ATOM   2317 N N   . TRP B 1 46  ? 3.911   3.411   -5.306  1.00 45.23 ? 256  TRP B N   1 
ATOM   2318 C CA  . TRP B 1 46  ? 4.292   2.410   -6.291  1.00 46.06 ? 256  TRP B CA  1 
ATOM   2319 C C   . TRP B 1 46  ? 5.810   2.228   -6.300  1.00 46.76 ? 256  TRP B C   1 
ATOM   2320 O O   . TRP B 1 46  ? 6.295   1.097   -6.346  1.00 46.66 ? 256  TRP B O   1 
ATOM   2321 C CB  . TRP B 1 46  ? 3.745   2.761   -7.679  1.00 45.92 ? 256  TRP B CB  1 
ATOM   2322 C CG  . TRP B 1 46  ? 4.182   1.817   -8.737  1.00 45.46 ? 256  TRP B CG  1 
ATOM   2323 C CD1 . TRP B 1 46  ? 3.747   0.541   -8.926  1.00 45.77 ? 256  TRP B CD1 1 
ATOM   2324 C CD2 . TRP B 1 46  ? 5.148   2.071   -9.759  1.00 45.67 ? 256  TRP B CD2 1 
ATOM   2325 N NE1 . TRP B 1 46  ? 4.381   -0.021  -10.011 1.00 46.06 ? 256  TRP B NE1 1 
ATOM   2326 C CE2 . TRP B 1 46  ? 5.249   0.897   -10.538 1.00 45.69 ? 256  TRP B CE2 1 
ATOM   2327 C CE3 . TRP B 1 46  ? 5.935   3.178   -10.097 1.00 45.39 ? 256  TRP B CE3 1 
ATOM   2328 C CZ2 . TRP B 1 46  ? 6.107   0.797   -11.630 1.00 45.15 ? 256  TRP B CZ2 1 
ATOM   2329 C CZ3 . TRP B 1 46  ? 6.790   3.077   -11.182 1.00 45.69 ? 256  TRP B CZ3 1 
ATOM   2330 C CH2 . TRP B 1 46  ? 6.869   1.893   -11.935 1.00 45.68 ? 256  TRP B CH2 1 
ATOM   2331 N N   . GLN B 1 47  ? 6.553   3.331   -6.211  1.00 47.82 ? 257  GLN B N   1 
ATOM   2332 C CA  . GLN B 1 47  ? 8.017   3.240   -6.194  1.00 49.04 ? 257  GLN B CA  1 
ATOM   2333 C C   . GLN B 1 47  ? 8.612   2.960   -4.808  1.00 49.60 ? 257  GLN B C   1 
ATOM   2334 O O   . GLN B 1 47  ? 9.770   2.540   -4.701  1.00 49.74 ? 257  GLN B O   1 
ATOM   2335 C CB  . GLN B 1 47  ? 8.690   4.429   -6.890  1.00 48.99 ? 257  GLN B CB  1 
ATOM   2336 C CG  . GLN B 1 47  ? 8.288   5.815   -6.425  1.00 49.19 ? 257  GLN B CG  1 
ATOM   2337 C CD  . GLN B 1 47  ? 8.809   6.899   -7.364  1.00 49.83 ? 257  GLN B CD  1 
ATOM   2338 O OE1 . GLN B 1 47  ? 9.173   7.998   -6.931  1.00 51.30 ? 257  GLN B OE1 1 
ATOM   2339 N NE2 . GLN B 1 47  ? 8.862   6.586   -8.656  1.00 50.52 ? 257  GLN B NE2 1 
ATOM   2340 N N   . ALA B 1 48  ? 7.817   3.178   -3.758  1.00 50.08 ? 258  ALA B N   1 
ATOM   2341 C CA  . ALA B 1 48  ? 8.155   2.680   -2.428  1.00 50.59 ? 258  ALA B CA  1 
ATOM   2342 C C   . ALA B 1 48  ? 8.048   1.160   -2.459  1.00 51.03 ? 258  ALA B C   1 
ATOM   2343 O O   . ALA B 1 48  ? 8.933   0.465   -1.969  1.00 51.50 ? 258  ALA B O   1 
ATOM   2344 C CB  . ALA B 1 48  ? 7.224   3.254   -1.376  1.00 50.37 ? 258  ALA B CB  1 
ATOM   2345 N N   . GLU B 1 49  ? 6.974   0.658   -3.068  1.00 51.54 ? 259  GLU B N   1 
ATOM   2346 C CA  . GLU B 1 49  ? 6.748   -0.779  -3.229  1.00 52.15 ? 259  GLU B CA  1 
ATOM   2347 C C   . GLU B 1 49  ? 7.862   -1.451  -4.033  1.00 52.82 ? 259  GLU B C   1 
ATOM   2348 O O   . GLU B 1 49  ? 8.052   -2.666  -3.948  1.00 52.89 ? 259  GLU B O   1 
ATOM   2349 C CB  . GLU B 1 49  ? 5.389   -1.047  -3.892  1.00 52.07 ? 259  GLU B CB  1 
ATOM   2350 C CG  . GLU B 1 49  ? 4.163   -0.762  -3.014  1.00 51.87 ? 259  GLU B CG  1 
ATOM   2351 C CD  . GLU B 1 49  ? 4.010   -1.719  -1.838  1.00 52.48 ? 259  GLU B CD  1 
ATOM   2352 O OE1 . GLU B 1 49  ? 4.647   -2.794  -1.831  1.00 52.34 ? 259  GLU B OE1 1 
ATOM   2353 O OE2 . GLU B 1 49  ? 3.237   -1.395  -0.908  1.00 53.66 ? 259  GLU B OE2 1 
ATOM   2354 N N   . LYS B 1 50  ? 8.591   -0.652  -4.808  1.00 53.40 ? 260  LYS B N   1 
ATOM   2355 C CA  . LYS B 1 50  ? 9.719   -1.145  -5.580  1.00 54.23 ? 260  LYS B CA  1 
ATOM   2356 C C   . LYS B 1 50  ? 11.005  -1.139  -4.753  1.00 54.62 ? 260  LYS B C   1 
ATOM   2357 O O   . LYS B 1 50  ? 11.538  -2.205  -4.445  1.00 54.60 ? 260  LYS B O   1 
ATOM   2358 C CB  . LYS B 1 50  ? 9.898   -0.342  -6.880  1.00 54.11 ? 260  LYS B CB  1 
ATOM   2359 C CG  . LYS B 1 50  ? 8.909   -0.711  -7.992  1.00 54.34 ? 260  LYS B CG  1 
ATOM   2360 C CD  . LYS B 1 50  ? 9.172   0.068   -9.279  1.00 54.45 ? 260  LYS B CD  1 
ATOM   2361 C CE  . LYS B 1 50  ? 10.224  -0.612  -10.154 1.00 55.45 ? 260  LYS B CE  1 
ATOM   2362 N NZ  . LYS B 1 50  ? 9.694   -1.836  -10.834 1.00 55.72 ? 260  LYS B NZ  1 
ATOM   2363 N N   . GLY B 1 51  ? 11.473  0.058   -4.385  1.00 55.09 ? 261  GLY B N   1 
ATOM   2364 C CA  . GLY B 1 51  ? 12.797  0.243   -3.785  1.00 55.58 ? 261  GLY B CA  1 
ATOM   2365 C C   . GLY B 1 51  ? 12.833  0.587   -2.303  1.00 56.02 ? 261  GLY B C   1 
ATOM   2366 O O   . GLY B 1 51  ? 13.391  1.619   -1.914  1.00 56.02 ? 261  GLY B O   1 
ATOM   2367 N N   . LEU B 1 52  ? 12.233  -0.278  -1.481  1.00 56.29 ? 262  LEU B N   1 
ATOM   2368 C CA  . LEU B 1 52  ? 12.308  -0.179  -0.018  1.00 56.33 ? 262  LEU B CA  1 
ATOM   2369 C C   . LEU B 1 52  ? 12.436  -1.553  0.632   1.00 56.48 ? 262  LEU B C   1 
ATOM   2370 O O   . LEU B 1 52  ? 12.453  -2.581  -0.053  1.00 56.79 ? 262  LEU B O   1 
ATOM   2371 C CB  . LEU B 1 52  ? 11.096  0.563   0.559   1.00 56.29 ? 262  LEU B CB  1 
ATOM   2372 C CG  . LEU B 1 52  ? 11.022  2.089   0.410   1.00 56.37 ? 262  LEU B CG  1 
ATOM   2373 C CD1 . LEU B 1 52  ? 9.844   2.656   1.188   1.00 55.73 ? 262  LEU B CD1 1 
ATOM   2374 C CD2 . LEU B 1 52  ? 12.319  2.763   0.850   1.00 57.11 ? 262  LEU B CD2 1 
ATOM   2375 N N   . LYS B 1 65  ? -8.317  -4.695  -6.584  1.00 38.39 ? 275  LYS B N   1 
ATOM   2376 C CA  . LYS B 1 65  ? -7.323  -3.972  -5.813  1.00 38.25 ? 275  LYS B CA  1 
ATOM   2377 C C   . LYS B 1 65  ? -7.345  -2.500  -6.167  1.00 38.40 ? 275  LYS B C   1 
ATOM   2378 O O   . LYS B 1 65  ? -7.619  -2.107  -7.309  1.00 39.00 ? 275  LYS B O   1 
ATOM   2379 C CB  . LYS B 1 65  ? -5.922  -4.533  -6.043  1.00 38.40 ? 275  LYS B CB  1 
ATOM   2380 N N   . GLU B 1 66  ? -7.048  -1.691  -5.162  1.00 37.64 ? 276  GLU B N   1 
ATOM   2381 C CA  . GLU B 1 66  ? -7.154  -0.259  -5.247  1.00 37.04 ? 276  GLU B CA  1 
ATOM   2382 C C   . GLU B 1 66  ? -6.266  0.299   -4.155  1.00 36.65 ? 276  GLU B C   1 
ATOM   2383 O O   . GLU B 1 66  ? -5.902  -0.426  -3.216  1.00 36.49 ? 276  GLU B O   1 
ATOM   2384 C CB  . GLU B 1 66  ? -8.611  0.188   -5.049  1.00 37.20 ? 276  GLU B CB  1 
ATOM   2385 C CG  . GLU B 1 66  ? -9.428  -0.675  -4.085  1.00 36.65 ? 276  GLU B CG  1 
ATOM   2386 C CD  . GLU B 1 66  ? -10.725 -0.005  -3.659  1.00 36.60 ? 276  GLU B CD  1 
ATOM   2387 O OE1 . GLU B 1 66  ? -10.670 1.128   -3.143  1.00 35.72 ? 276  GLU B OE1 1 
ATOM   2388 O OE2 . GLU B 1 66  ? -11.803 -0.610  -3.829  1.00 36.49 ? 276  GLU B OE2 1 
ATOM   2389 N N   . ILE B 1 67  ? -5.921  1.579   -4.264  1.00 35.69 ? 277  ILE B N   1 
ATOM   2390 C CA  . ILE B 1 67  ? -4.976  2.167   -3.320  1.00 35.03 ? 277  ILE B CA  1 
ATOM   2391 C C   . ILE B 1 67  ? -5.416  1.959   -1.874  1.00 34.55 ? 277  ILE B C   1 
ATOM   2392 O O   . ILE B 1 67  ? -4.620  1.520   -1.047  1.00 34.67 ? 277  ILE B O   1 
ATOM   2393 C CB  . ILE B 1 67  ? -4.669  3.675   -3.596  1.00 35.00 ? 277  ILE B CB  1 
ATOM   2394 C CG1 . ILE B 1 67  ? -3.583  4.184   -2.647  1.00 34.68 ? 277  ILE B CG1 1 
ATOM   2395 C CG2 . ILE B 1 67  ? -5.910  4.553   -3.450  1.00 34.58 ? 277  ILE B CG2 1 
ATOM   2396 C CD1 . ILE B 1 67  ? -2.211  3.681   -2.962  1.00 34.62 ? 277  ILE B CD1 1 
ATOM   2397 N N   . SER B 1 68  ? -6.687  2.246   -1.598  1.00 33.90 ? 278  SER B N   1 
ATOM   2398 C CA  . SER B 1 68  ? -7.200  2.282   -0.234  1.00 33.39 ? 278  SER B CA  1 
ATOM   2399 C C   . SER B 1 68  ? -7.152  0.893   0.407   1.00 33.04 ? 278  SER B C   1 
ATOM   2400 O O   . SER B 1 68  ? -6.737  0.750   1.562   1.00 32.44 ? 278  SER B O   1 
ATOM   2401 C CB  . SER B 1 68  ? -8.613  2.885   -0.208  1.00 33.57 ? 278  SER B CB  1 
ATOM   2402 O OG  . SER B 1 68  ? -8.636  4.153   -0.869  1.00 32.71 ? 278  SER B OG  1 
ATOM   2403 N N   . VAL B 1 69  ? -7.537  -0.121  -0.371  1.00 32.44 ? 279  VAL B N   1 
ATOM   2404 C CA  . VAL B 1 69  ? -7.484  -1.506  0.076   1.00 31.98 ? 279  VAL B CA  1 
ATOM   2405 C C   . VAL B 1 69  ? -6.044  -2.003  0.232   1.00 32.07 ? 279  VAL B C   1 
ATOM   2406 O O   . VAL B 1 69  ? -5.739  -2.695  1.215   1.00 32.17 ? 279  VAL B O   1 
ATOM   2407 C CB  . VAL B 1 69  ? -8.313  -2.434  -0.816  1.00 31.64 ? 279  VAL B CB  1 
ATOM   2408 C CG1 . VAL B 1 69  ? -8.097  -3.893  -0.433  1.00 31.82 ? 279  VAL B CG1 1 
ATOM   2409 C CG2 . VAL B 1 69  ? -9.781  -2.070  -0.706  1.00 30.89 ? 279  VAL B CG2 1 
ATOM   2410 N N   . HIS B 1 70  ? -5.161  -1.624  -0.695  1.00 31.72 ? 280  HIS B N   1 
ATOM   2411 C CA  . HIS B 1 70  ? -3.743  -1.977  -0.568  1.00 31.76 ? 280  HIS B CA  1 
ATOM   2412 C C   . HIS B 1 70  ? -3.050  -1.428  0.696   1.00 31.73 ? 280  HIS B C   1 
ATOM   2413 O O   . HIS B 1 70  ? -2.211  -2.112  1.278   1.00 31.66 ? 280  HIS B O   1 
ATOM   2414 C CB  . HIS B 1 70  ? -2.917  -1.594  -1.795  1.00 31.28 ? 280  HIS B CB  1 
ATOM   2415 C CG  . HIS B 1 70  ? -1.517  -2.119  -1.731  1.00 32.03 ? 280  HIS B CG  1 
ATOM   2416 N ND1 . HIS B 1 70  ? -1.197  -3.420  -2.054  1.00 33.45 ? 280  HIS B ND1 1 
ATOM   2417 C CD2 . HIS B 1 70  ? -0.367  -1.544  -1.304  1.00 32.46 ? 280  HIS B CD2 1 
ATOM   2418 C CE1 . HIS B 1 70  ? 0.095   -3.616  -1.857  1.00 33.01 ? 280  HIS B CE1 1 
ATOM   2419 N NE2 . HIS B 1 70  ? 0.622   -2.490  -1.409  1.00 32.33 ? 280  HIS B NE2 1 
ATOM   2420 N N   . VAL B 1 71  ? -3.389  -0.200  1.089   1.00 31.66 ? 281  VAL B N   1 
ATOM   2421 C CA  . VAL B 1 71  ? -2.847  0.423   2.301   1.00 31.55 ? 281  VAL B CA  1 
ATOM   2422 C C   . VAL B 1 71  ? -3.397  -0.289  3.561   1.00 31.85 ? 281  VAL B C   1 
ATOM   2423 O O   . VAL B 1 71  ? -2.657  -0.574  4.512   1.00 31.59 ? 281  VAL B O   1 
ATOM   2424 C CB  . VAL B 1 71  ? -3.138  1.957   2.328   1.00 31.64 ? 281  VAL B CB  1 
ATOM   2425 C CG1 . VAL B 1 71  ? -2.626  2.613   3.624   1.00 31.09 ? 281  VAL B CG1 1 
ATOM   2426 C CG2 . VAL B 1 71  ? -2.515  2.652   1.108   1.00 31.09 ? 281  VAL B CG2 1 
ATOM   2427 N N   . PHE B 1 72  ? -4.694  -0.577  3.547   1.00 32.07 ? 282  PHE B N   1 
ATOM   2428 C CA  . PHE B 1 72  ? -5.332  -1.375  4.586   1.00 32.80 ? 282  PHE B CA  1 
ATOM   2429 C C   . PHE B 1 72  ? -4.590  -2.706  4.808   1.00 33.05 ? 282  PHE B C   1 
ATOM   2430 O O   . PHE B 1 72  ? -4.246  -3.036  5.946   1.00 32.97 ? 282  PHE B O   1 
ATOM   2431 C CB  . PHE B 1 72  ? -6.795  -1.612  4.210   1.00 33.09 ? 282  PHE B CB  1 
ATOM   2432 C CG  . PHE B 1 72  ? -7.578  -2.385  5.231   1.00 33.72 ? 282  PHE B CG  1 
ATOM   2433 C CD1 . PHE B 1 72  ? -7.949  -1.803  6.433   1.00 34.52 ? 282  PHE B CD1 1 
ATOM   2434 C CD2 . PHE B 1 72  ? -7.973  -3.692  4.973   1.00 34.86 ? 282  PHE B CD2 1 
ATOM   2435 C CE1 . PHE B 1 72  ? -8.688  -2.527  7.377   1.00 35.51 ? 282  PHE B CE1 1 
ATOM   2436 C CE2 . PHE B 1 72  ? -8.717  -4.418  5.910   1.00 34.61 ? 282  PHE B CE2 1 
ATOM   2437 C CZ  . PHE B 1 72  ? -9.071  -3.833  7.109   1.00 34.30 ? 282  PHE B CZ  1 
ATOM   2438 N N   . TYR B 1 73  ? -4.323  -3.443  3.721   1.00 33.34 ? 283  TYR B N   1 
ATOM   2439 C CA  . TYR B 1 73  ? -3.532  -4.683  3.773   1.00 33.68 ? 283  TYR B CA  1 
ATOM   2440 C C   . TYR B 1 73  ? -2.161  -4.473  4.397   1.00 33.66 ? 283  TYR B C   1 
ATOM   2441 O O   . TYR B 1 73  ? -1.706  -5.292  5.192   1.00 33.56 ? 283  TYR B O   1 
ATOM   2442 C CB  . TYR B 1 73  ? -3.355  -5.307  2.383   1.00 33.96 ? 283  TYR B CB  1 
ATOM   2443 C CG  . TYR B 1 73  ? -4.591  -5.950  1.812   1.00 34.13 ? 283  TYR B CG  1 
ATOM   2444 C CD1 . TYR B 1 73  ? -5.635  -6.358  2.637   1.00 34.85 ? 283  TYR B CD1 1 
ATOM   2445 C CD2 . TYR B 1 73  ? -4.702  -6.186  0.441   1.00 33.92 ? 283  TYR B CD2 1 
ATOM   2446 C CE1 . TYR B 1 73  ? -6.772  -6.960  2.113   1.00 34.78 ? 283  TYR B CE1 1 
ATOM   2447 C CE2 . TYR B 1 73  ? -5.836  -6.791  -0.091  1.00 34.48 ? 283  TYR B CE2 1 
ATOM   2448 C CZ  . TYR B 1 73  ? -6.864  -7.178  0.755   1.00 34.51 ? 283  TYR B CZ  1 
ATOM   2449 O OH  . TYR B 1 73  ? -7.997  -7.775  0.246   1.00 35.48 ? 283  TYR B OH  1 
ATOM   2450 N N   . ARG B 1 74  ? -1.501  -3.380  4.017   1.00 33.91 ? 284  ARG B N   1 
ATOM   2451 C CA  . ARG B 1 74  ? -0.236  -2.992  4.638   1.00 34.14 ? 284  ARG B CA  1 
ATOM   2452 C C   . ARG B 1 74  ? -0.352  -2.714  6.146   1.00 33.99 ? 284  ARG B C   1 
ATOM   2453 O O   . ARG B 1 74  ? 0.586   -3.000  6.889   1.00 33.63 ? 284  ARG B O   1 
ATOM   2454 C CB  . ARG B 1 74  ? 0.394   -1.806  3.901   1.00 34.64 ? 284  ARG B CB  1 
ATOM   2455 C CG  . ARG B 1 74  ? 1.211   -2.213  2.668   1.00 35.59 ? 284  ARG B CG  1 
ATOM   2456 C CD  . ARG B 1 74  ? 2.524   -2.851  3.087   1.00 38.55 ? 284  ARG B CD  1 
ATOM   2457 N NE  . ARG B 1 74  ? 2.984   -3.866  2.142   1.00 40.29 ? 284  ARG B NE  1 
ATOM   2458 C CZ  . ARG B 1 74  ? 3.971   -3.687  1.274   1.00 41.20 ? 284  ARG B CZ  1 
ATOM   2459 N NH1 . ARG B 1 74  ? 4.612   -2.527  1.222   1.00 41.46 ? 284  ARG B NH1 1 
ATOM   2460 N NH2 . ARG B 1 74  ? 4.319   -4.671  0.459   1.00 42.81 ? 284  ARG B NH2 1 
ATOM   2461 N N   . CYS B 1 75  ? -1.495  -2.176  6.587   1.00 34.05 ? 285  CYS B N   1 
ATOM   2462 C CA  . CYS B 1 75  ? -1.774  -2.003  8.024   1.00 34.30 ? 285  CYS B CA  1 
ATOM   2463 C C   . CYS B 1 75  ? -1.922  -3.354  8.752   1.00 34.56 ? 285  CYS B C   1 
ATOM   2464 O O   . CYS B 1 75  ? -1.421  -3.522  9.867   1.00 34.31 ? 285  CYS B O   1 
ATOM   2465 C CB  . CYS B 1 75  ? -3.023  -1.139  8.255   1.00 34.43 ? 285  CYS B CB  1 
ATOM   2466 S SG  . CYS B 1 75  ? -2.935  0.560   7.604   1.00 34.00 ? 285  CYS B SG  1 
ATOM   2467 N N   . GLN B 1 76  ? -2.598  -4.311  8.108   1.00 34.91 ? 286  GLN B N   1 
ATOM   2468 C CA  . GLN B 1 76  ? -2.740  -5.678  8.636   1.00 34.88 ? 286  GLN B CA  1 
ATOM   2469 C C   . GLN B 1 76  ? -1.398  -6.399  8.779   1.00 34.75 ? 286  GLN B C   1 
ATOM   2470 O O   . GLN B 1 76  ? -1.152  -7.058  9.795   1.00 34.49 ? 286  GLN B O   1 
ATOM   2471 C CB  . GLN B 1 76  ? -3.679  -6.518  7.765   1.00 34.90 ? 286  GLN B CB  1 
ATOM   2472 C CG  . GLN B 1 76  ? -5.088  -5.989  7.659   1.00 35.88 ? 286  GLN B CG  1 
ATOM   2473 C CD  . GLN B 1 76  ? -6.048  -7.028  7.119   1.00 37.86 ? 286  GLN B CD  1 
ATOM   2474 O OE1 . GLN B 1 76  ? -6.086  -8.167  7.597   1.00 36.91 ? 286  GLN B OE1 1 
ATOM   2475 N NE2 . GLN B 1 76  ? -6.837  -6.641  6.113   1.00 38.27 ? 286  GLN B NE2 1 
ATOM   2476 N N   . CYS B 1 77  ? -0.542  -6.280  7.765   1.00 34.72 ? 287  CYS B N   1 
ATOM   2477 C CA  . CYS B 1 77  ? 0.819   -6.841  7.823   1.00 35.35 ? 287  CYS B CA  1 
ATOM   2478 C C   . CYS B 1 77  ? 1.573   -6.421  9.074   1.00 34.70 ? 287  CYS B C   1 
ATOM   2479 O O   . CYS B 1 77  ? 2.063   -7.263  9.820   1.00 34.39 ? 287  CYS B O   1 
ATOM   2480 C CB  . CYS B 1 77  ? 1.635   -6.414  6.608   1.00 35.48 ? 287  CYS B CB  1 
ATOM   2481 S SG  . CYS B 1 77  ? 1.094   -7.197  5.118   1.00 39.75 ? 287  CYS B SG  1 
ATOM   2482 N N   . THR B 1 78  ? 1.652   -5.109  9.285   1.00 34.62 ? 288  THR B N   1 
ATOM   2483 C CA  . THR B 1 78  ? 2.336   -4.535  10.434  1.00 34.60 ? 288  THR B CA  1 
ATOM   2484 C C   . THR B 1 78  ? 1.705   -5.011  11.732  1.00 34.54 ? 288  THR B C   1 
ATOM   2485 O O   . THR B 1 78  ? 2.408   -5.509  12.619  1.00 34.65 ? 288  THR B O   1 
ATOM   2486 C CB  . THR B 1 78  ? 2.334   -2.994  10.377  1.00 34.58 ? 288  THR B CB  1 
ATOM   2487 O OG1 . THR B 1 78  ? 2.762   -2.573  9.078   1.00 35.46 ? 288  THR B OG1 1 
ATOM   2488 C CG2 . THR B 1 78  ? 3.269   -2.415  11.418  1.00 34.21 ? 288  THR B CG2 1 
ATOM   2489 N N   . THR B 1 79  ? 0.383   -4.891  11.823  1.00 34.44 ? 289  THR B N   1 
ATOM   2490 C CA  . THR B 1 79  ? -0.334  -5.206  13.058  1.00 34.73 ? 289  THR B CA  1 
ATOM   2491 C C   . THR B 1 79  ? -0.058  -6.628  13.508  1.00 34.15 ? 289  THR B C   1 
ATOM   2492 O O   . THR B 1 79  ? 0.179   -6.875  14.687  1.00 34.52 ? 289  THR B O   1 
ATOM   2493 C CB  . THR B 1 79  ? -1.860  -4.985  12.920  1.00 34.73 ? 289  THR B CB  1 
ATOM   2494 O OG1 . THR B 1 79  ? -2.122  -3.591  12.721  1.00 36.23 ? 289  THR B OG1 1 
ATOM   2495 C CG2 . THR B 1 79  ? -2.580  -5.428  14.187  1.00 35.86 ? 289  THR B CG2 1 
ATOM   2496 N N   . VAL B 1 80  ? -0.081  -7.553  12.556  1.00 33.76 ? 290  VAL B N   1 
ATOM   2497 C CA  . VAL B 1 80  ? 0.090   -8.974  12.849  1.00 33.04 ? 290  VAL B CA  1 
ATOM   2498 C C   . VAL B 1 80  ? 1.521   -9.269  13.305  1.00 32.91 ? 290  VAL B C   1 
ATOM   2499 O O   . VAL B 1 80  ? 1.729   -10.045 14.235  1.00 32.83 ? 290  VAL B O   1 
ATOM   2500 C CB  . VAL B 1 80  ? -0.355  -9.855  11.648  1.00 32.98 ? 290  VAL B CB  1 
ATOM   2501 C CG1 . VAL B 1 80  ? 0.048   -11.306 11.853  1.00 32.76 ? 290  VAL B CG1 1 
ATOM   2502 C CG2 . VAL B 1 80  ? -1.867  -9.764  11.470  1.00 31.45 ? 290  VAL B CG2 1 
ATOM   2503 N N   . GLU B 1 81  ? 2.490   -8.628  12.653  1.00 32.90 ? 291  GLU B N   1 
ATOM   2504 C CA  . GLU B 1 81  ? 3.903   -8.719  13.020  1.00 32.95 ? 291  GLU B CA  1 
ATOM   2505 C C   . GLU B 1 81  ? 4.176   -8.147  14.408  1.00 32.26 ? 291  GLU B C   1 
ATOM   2506 O O   . GLU B 1 81  ? 4.935   -8.733  15.158  1.00 32.58 ? 291  GLU B O   1 
ATOM   2507 C CB  . GLU B 1 81  ? 4.780   -8.026  11.963  1.00 33.42 ? 291  GLU B CB  1 
ATOM   2508 C CG  . GLU B 1 81  ? 6.301   -8.137  12.180  1.00 35.97 ? 291  GLU B CG  1 
ATOM   2509 C CD  . GLU B 1 81  ? 6.807   -9.575  12.184  1.00 39.03 ? 291  GLU B CD  1 
ATOM   2510 O OE1 . GLU B 1 81  ? 6.405   -10.363 11.293  1.00 40.56 ? 291  GLU B OE1 1 
ATOM   2511 O OE2 . GLU B 1 81  ? 7.606   -9.914  13.083  1.00 40.52 ? 291  GLU B OE2 1 
ATOM   2512 N N   . THR B 1 82  ? 3.562   -7.010  14.741  1.00 31.80 ? 292  THR B N   1 
ATOM   2513 C CA  . THR B 1 82  ? 3.681   -6.406  16.080  1.00 31.29 ? 292  THR B CA  1 
ATOM   2514 C C   . THR B 1 82  ? 3.076   -7.293  17.174  1.00 31.14 ? 292  THR B C   1 
ATOM   2515 O O   . THR B 1 82  ? 3.594   -7.335  18.287  1.00 31.29 ? 292  THR B O   1 
ATOM   2516 C CB  . THR B 1 82  ? 2.998   -5.032  16.143  1.00 31.28 ? 292  THR B CB  1 
ATOM   2517 O OG1 . THR B 1 82  ? 3.251   -4.330  14.934  1.00 31.22 ? 292  THR B OG1 1 
ATOM   2518 C CG2 . THR B 1 82  ? 3.514   -4.196  17.315  1.00 30.91 ? 292  THR B CG2 1 
ATOM   2519 N N   . VAL B 1 83  ? 1.983   -7.985  16.849  1.00 30.64 ? 293  VAL B N   1 
ATOM   2520 C CA  . VAL B 1 83  ? 1.380   -8.997  17.725  1.00 30.31 ? 293  VAL B CA  1 
ATOM   2521 C C   . VAL B 1 83  ? 2.404   -10.082 18.046  1.00 30.81 ? 293  VAL B C   1 
ATOM   2522 O O   . VAL B 1 83  ? 2.512   -10.537 19.192  1.00 30.46 ? 293  VAL B O   1 
ATOM   2523 C CB  . VAL B 1 83  ? 0.095   -9.617  17.084  1.00 30.12 ? 293  VAL B CB  1 
ATOM   2524 C CG1 . VAL B 1 83  ? -0.371  -10.855 17.832  1.00 29.62 ? 293  VAL B CG1 1 
ATOM   2525 C CG2 . VAL B 1 83  ? -1.027  -8.589  17.004  1.00 29.54 ? 293  VAL B CG2 1 
ATOM   2526 N N   . ARG B 1 84  ? 3.170   -10.479 17.033  1.00 31.59 ? 294  ARG B N   1 
ATOM   2527 C CA  . ARG B 1 84  ? 4.225   -11.481 17.201  1.00 32.48 ? 294  ARG B CA  1 
ATOM   2528 C C   . ARG B 1 84  ? 5.244   -11.033 18.222  1.00 32.24 ? 294  ARG B C   1 
ATOM   2529 O O   . ARG B 1 84  ? 5.576   -11.785 19.141  1.00 32.18 ? 294  ARG B O   1 
ATOM   2530 C CB  . ARG B 1 84  ? 4.906   -11.795 15.868  1.00 32.74 ? 294  ARG B CB  1 
ATOM   2531 C CG  . ARG B 1 84  ? 4.530   -13.153 15.314  1.00 35.12 ? 294  ARG B CG  1 
ATOM   2532 C CD  . ARG B 1 84  ? 5.614   -14.200 15.612  1.00 38.81 ? 294  ARG B CD  1 
ATOM   2533 N NE  . ARG B 1 84  ? 5.039   -15.431 16.157  1.00 40.94 ? 294  ARG B NE  1 
ATOM   2534 C CZ  . ARG B 1 84  ? 4.443   -16.389 15.446  1.00 42.33 ? 294  ARG B CZ  1 
ATOM   2535 N NH1 . ARG B 1 84  ? 4.328   -16.299 14.121  1.00 41.44 ? 294  ARG B NH1 1 
ATOM   2536 N NH2 . ARG B 1 84  ? 3.954   -17.452 16.080  1.00 42.88 ? 294  ARG B NH2 1 
ATOM   2537 N N   . GLU B 1 85  ? 5.714   -9.799  18.044  1.00 32.27 ? 295  GLU B N   1 
ATOM   2538 C CA  . GLU B 1 85  ? 6.658   -9.145  18.942  1.00 32.56 ? 295  GLU B CA  1 
ATOM   2539 C C   . GLU B 1 85  ? 6.062   -8.965  20.334  1.00 32.01 ? 295  GLU B C   1 
ATOM   2540 O O   . GLU B 1 85  ? 6.741   -9.165  21.331  1.00 32.30 ? 295  GLU B O   1 
ATOM   2541 C CB  . GLU B 1 85  ? 7.051   -7.775  18.384  1.00 32.45 ? 295  GLU B CB  1 
ATOM   2542 C CG  . GLU B 1 85  ? 7.565   -7.782  16.953  1.00 33.55 ? 295  GLU B CG  1 
ATOM   2543 C CD  . GLU B 1 85  ? 8.032   -6.410  16.500  1.00 34.26 ? 295  GLU B CD  1 
ATOM   2544 O OE1 . GLU B 1 85  ? 7.384   -5.392  16.856  1.00 37.42 ? 295  GLU B OE1 1 
ATOM   2545 O OE2 . GLU B 1 85  ? 9.047   -6.345  15.775  1.00 37.69 ? 295  GLU B OE2 1 
ATOM   2546 N N   . LEU B 1 86  ? 4.797   -8.565  20.397  1.00 31.53 ? 296  LEU B N   1 
ATOM   2547 C CA  . LEU B 1 86  ? 4.124   -8.392  21.680  1.00 31.43 ? 296  LEU B CA  1 
ATOM   2548 C C   . LEU B 1 86  ? 3.992   -9.706  22.442  1.00 31.45 ? 296  LEU B C   1 
ATOM   2549 O O   . LEU B 1 86  ? 4.173   -9.726  23.647  1.00 31.23 ? 296  LEU B O   1 
ATOM   2550 C CB  . LEU B 1 86  ? 2.765   -7.690  21.512  1.00 30.98 ? 296  LEU B CB  1 
ATOM   2551 C CG  . LEU B 1 86  ? 2.868   -6.178  21.318  1.00 28.95 ? 296  LEU B CG  1 
ATOM   2552 C CD1 . LEU B 1 86  ? 1.543   -5.578  20.868  1.00 27.67 ? 296  LEU B CD1 1 
ATOM   2553 C CD2 . LEU B 1 86  ? 3.348   -5.537  22.593  1.00 28.58 ? 296  LEU B CD2 1 
ATOM   2554 N N   . THR B 1 87  ? 3.702   -10.797 21.728  1.00 32.25 ? 297  THR B N   1 
ATOM   2555 C CA  . THR B 1 87  ? 3.682   -12.146 22.312  1.00 32.67 ? 297  THR B CA  1 
ATOM   2556 C C   . THR B 1 87  ? 5.035   -12.479 22.946  1.00 33.36 ? 297  THR B C   1 
ATOM   2557 O O   . THR B 1 87  ? 5.106   -12.808 24.134  1.00 33.34 ? 297  THR B O   1 
ATOM   2558 C CB  . THR B 1 87  ? 3.305   -13.244 21.271  1.00 32.40 ? 297  THR B CB  1 
ATOM   2559 O OG1 . THR B 1 87  ? 2.026   -12.959 20.701  1.00 31.56 ? 297  THR B OG1 1 
ATOM   2560 C CG2 . THR B 1 87  ? 3.237   -14.622 21.932  1.00 32.57 ? 297  THR B CG2 1 
ATOM   2561 N N   . GLU B 1 88  ? 6.101   -12.362 22.153  1.00 34.32 ? 298  GLU B N   1 
ATOM   2562 C CA  . GLU B 1 88  ? 7.458   -12.696 22.598  1.00 35.32 ? 298  GLU B CA  1 
ATOM   2563 C C   . GLU B 1 88  ? 7.901   -11.837 23.773  1.00 35.56 ? 298  GLU B C   1 
ATOM   2564 O O   . GLU B 1 88  ? 8.508   -12.344 24.716  1.00 35.92 ? 298  GLU B O   1 
ATOM   2565 C CB  . GLU B 1 88  ? 8.456   -12.581 21.439  1.00 35.58 ? 298  GLU B CB  1 
ATOM   2566 C CG  . GLU B 1 88  ? 8.256   -13.631 20.333  1.00 36.96 ? 298  GLU B CG  1 
ATOM   2567 C CD  . GLU B 1 88  ? 8.387   -15.065 20.850  1.00 38.59 ? 298  GLU B CD  1 
ATOM   2568 O OE1 . GLU B 1 88  ? 7.396   -15.825 20.754  1.00 38.67 ? 298  GLU B OE1 1 
ATOM   2569 O OE2 . GLU B 1 88  ? 9.476   -15.421 21.363  1.00 39.24 ? 298  GLU B OE2 1 
ATOM   2570 N N   . PHE B 1 89  ? 7.588   -10.545 23.710  1.00 35.61 ? 299  PHE B N   1 
ATOM   2571 C CA  . PHE B 1 89  ? 7.815   -9.621  24.821  1.00 35.96 ? 299  PHE B CA  1 
ATOM   2572 C C   . PHE B 1 89  ? 7.060   -10.042 26.094  1.00 36.41 ? 299  PHE B C   1 
ATOM   2573 O O   . PHE B 1 89  ? 7.628   -10.038 27.192  1.00 36.12 ? 299  PHE B O   1 
ATOM   2574 C CB  . PHE B 1 89  ? 7.449   -8.188  24.406  1.00 35.66 ? 299  PHE B CB  1 
ATOM   2575 C CG  . PHE B 1 89  ? 7.413   -7.209  25.547  1.00 35.65 ? 299  PHE B CG  1 
ATOM   2576 C CD1 . PHE B 1 89  ? 8.582   -6.847  26.218  1.00 36.06 ? 299  PHE B CD1 1 
ATOM   2577 C CD2 . PHE B 1 89  ? 6.207   -6.634  25.943  1.00 35.60 ? 299  PHE B CD2 1 
ATOM   2578 C CE1 . PHE B 1 89  ? 8.543   -5.943  27.281  1.00 35.41 ? 299  PHE B CE1 1 
ATOM   2579 C CE2 . PHE B 1 89  ? 6.157   -5.728  27.003  1.00 35.06 ? 299  PHE B CE2 1 
ATOM   2580 C CZ  . PHE B 1 89  ? 7.326   -5.382  27.672  1.00 35.84 ? 299  PHE B CZ  1 
ATOM   2581 N N   . ALA B 1 90  ? 5.791   -10.414 25.941  1.00 36.96 ? 300  ALA B N   1 
ATOM   2582 C CA  . ALA B 1 90  ? 4.979   -10.853 27.073  1.00 37.76 ? 300  ALA B CA  1 
ATOM   2583 C C   . ALA B 1 90  ? 5.594   -12.099 27.724  1.00 38.66 ? 300  ALA B C   1 
ATOM   2584 O O   . ALA B 1 90  ? 5.759   -12.151 28.950  1.00 38.61 ? 300  ALA B O   1 
ATOM   2585 C CB  . ALA B 1 90  ? 3.545   -11.109 26.633  1.00 37.26 ? 300  ALA B CB  1 
ATOM   2586 N N   . LYS B 1 91  ? 5.964   -13.080 26.897  1.00 39.62 ? 301  LYS B N   1 
ATOM   2587 C CA  . LYS B 1 91  ? 6.645   -14.291 27.373  1.00 40.77 ? 301  LYS B CA  1 
ATOM   2588 C C   . LYS B 1 91  ? 7.905   -14.023 28.211  1.00 41.42 ? 301  LYS B C   1 
ATOM   2589 O O   . LYS B 1 91  ? 8.310   -14.878 29.003  1.00 41.31 ? 301  LYS B O   1 
ATOM   2590 C CB  . LYS B 1 91  ? 6.940   -15.265 26.225  1.00 40.78 ? 301  LYS B CB  1 
ATOM   2591 C CG  . LYS B 1 91  ? 5.695   -15.962 25.703  1.00 41.85 ? 301  LYS B CG  1 
ATOM   2592 C CD  . LYS B 1 91  ? 6.020   -17.258 24.967  1.00 43.66 ? 301  LYS B CD  1 
ATOM   2593 C CE  . LYS B 1 91  ? 4.750   -18.085 24.717  1.00 44.42 ? 301  LYS B CE  1 
ATOM   2594 N NZ  . LYS B 1 91  ? 4.133   -18.658 25.964  1.00 43.34 ? 301  LYS B NZ  1 
ATOM   2595 N N   . SER B 1 92  ? 8.490   -12.830 28.061  1.00 41.92 ? 302  SER B N   1 
ATOM   2596 C CA  . SER B 1 92  ? 9.696   -12.458 28.806  1.00 42.62 ? 302  SER B CA  1 
ATOM   2597 C C   . SER B 1 92  ? 9.381   -11.737 30.112  1.00 42.81 ? 302  SER B C   1 
ATOM   2598 O O   . SER B 1 92  ? 10.272  -11.547 30.940  1.00 42.99 ? 302  SER B O   1 
ATOM   2599 C CB  . SER B 1 92  ? 10.624  -11.588 27.953  1.00 42.54 ? 302  SER B CB  1 
ATOM   2600 O OG  . SER B 1 92  ? 10.902  -12.200 26.706  1.00 43.27 ? 302  SER B OG  1 
ATOM   2601 N N   . ILE B 1 93  ? 8.126   -11.323 30.284  1.00 43.04 ? 303  ILE B N   1 
ATOM   2602 C CA  . ILE B 1 93  ? 7.684   -10.667 31.517  1.00 43.25 ? 303  ILE B CA  1 
ATOM   2603 C C   . ILE B 1 93  ? 7.578   -11.733 32.623  1.00 43.53 ? 303  ILE B C   1 
ATOM   2604 O O   . ILE B 1 93  ? 7.018   -12.815 32.381  1.00 43.77 ? 303  ILE B O   1 
ATOM   2605 C CB  . ILE B 1 93  ? 6.356   -9.878  31.304  1.00 43.44 ? 303  ILE B CB  1 
ATOM   2606 C CG1 . ILE B 1 93  ? 6.611   -8.662  30.408  1.00 43.27 ? 303  ILE B CG1 1 
ATOM   2607 C CG2 . ILE B 1 93  ? 5.741   -9.418  32.634  1.00 43.33 ? 303  ILE B CG2 1 
ATOM   2608 C CD1 . ILE B 1 93  ? 5.376   -8.120  29.739  1.00 44.71 ? 303  ILE B CD1 1 
ATOM   2609 N N   . PRO B 1 94  ? 8.145   -11.443 33.823  1.00 43.35 ? 304  PRO B N   1 
ATOM   2610 C CA  . PRO B 1 94  ? 8.371   -12.448 34.874  1.00 42.91 ? 304  PRO B CA  1 
ATOM   2611 C C   . PRO B 1 94  ? 7.270   -13.507 34.994  1.00 42.30 ? 304  PRO B C   1 
ATOM   2612 O O   . PRO B 1 94  ? 7.491   -14.694 34.691  1.00 42.48 ? 304  PRO B O   1 
ATOM   2613 C CB  . PRO B 1 94  ? 8.436   -11.599 36.157  1.00 42.93 ? 304  PRO B CB  1 
ATOM   2614 C CG  . PRO B 1 94  ? 9.010   -10.298 35.705  1.00 43.34 ? 304  PRO B CG  1 
ATOM   2615 C CD  . PRO B 1 94  ? 8.614   -10.104 34.250  1.00 43.41 ? 304  PRO B CD  1 
ATOM   2616 N N   . SER B 1 95  ? 6.090   -13.063 35.409  1.00 41.31 ? 305  SER B N   1 
ATOM   2617 C CA  . SER B 1 95  ? 5.035   -13.969 35.822  1.00 40.00 ? 305  SER B CA  1 
ATOM   2618 C C   . SER B 1 95  ? 4.051   -14.294 34.705  1.00 38.96 ? 305  SER B C   1 
ATOM   2619 O O   . SER B 1 95  ? 3.195   -15.157 34.879  1.00 38.98 ? 305  SER B O   1 
ATOM   2620 C CB  . SER B 1 95  ? 4.308   -13.396 37.043  1.00 40.21 ? 305  SER B CB  1 
ATOM   2621 O OG  . SER B 1 95  ? 5.195   -13.205 38.133  1.00 40.16 ? 305  SER B OG  1 
ATOM   2622 N N   . PHE B 1 96  ? 4.171   -13.614 33.565  1.00 37.81 ? 306  PHE B N   1 
ATOM   2623 C CA  . PHE B 1 96  ? 3.304   -13.893 32.417  1.00 36.63 ? 306  PHE B CA  1 
ATOM   2624 C C   . PHE B 1 96  ? 3.395   -15.370 32.041  1.00 36.58 ? 306  PHE B C   1 
ATOM   2625 O O   . PHE B 1 96  ? 2.377   -16.056 32.020  1.00 36.53 ? 306  PHE B O   1 
ATOM   2626 C CB  . PHE B 1 96  ? 3.644   -12.994 31.217  1.00 35.58 ? 306  PHE B CB  1 
ATOM   2627 C CG  . PHE B 1 96  ? 2.623   -13.035 30.100  1.00 34.29 ? 306  PHE B CG  1 
ATOM   2628 C CD1 . PHE B 1 96  ? 1.456   -12.263 30.167  1.00 32.67 ? 306  PHE B CD1 1 
ATOM   2629 C CD2 . PHE B 1 96  ? 2.831   -13.829 28.968  1.00 33.26 ? 306  PHE B CD2 1 
ATOM   2630 C CE1 . PHE B 1 96  ? 0.512   -12.282 29.132  1.00 31.45 ? 306  PHE B CE1 1 
ATOM   2631 C CE2 . PHE B 1 96  ? 1.889   -13.855 27.920  1.00 33.10 ? 306  PHE B CE2 1 
ATOM   2632 C CZ  . PHE B 1 96  ? 0.725   -13.079 28.006  1.00 31.95 ? 306  PHE B CZ  1 
ATOM   2633 N N   . SER B 1 97  ? 4.616   -15.850 31.787  1.00 36.50 ? 307  SER B N   1 
ATOM   2634 C CA  . SER B 1 97  ? 4.877   -17.232 31.342  1.00 36.78 ? 307  SER B CA  1 
ATOM   2635 C C   . SER B 1 97  ? 4.325   -18.312 32.253  1.00 36.60 ? 307  SER B C   1 
ATOM   2636 O O   . SER B 1 97  ? 4.026   -19.414 31.792  1.00 36.49 ? 307  SER B O   1 
ATOM   2637 C CB  . SER B 1 97  ? 6.382   -17.474 31.170  1.00 36.93 ? 307  SER B CB  1 
ATOM   2638 O OG  . SER B 1 97  ? 6.847   -16.933 29.945  1.00 38.15 ? 307  SER B OG  1 
ATOM   2639 N N   . SER B 1 98  ? 4.204   -17.998 33.541  1.00 36.41 ? 308  SER B N   1 
ATOM   2640 C CA  . SER B 1 98  ? 3.725   -18.966 34.520  1.00 36.54 ? 308  SER B CA  1 
ATOM   2641 C C   . SER B 1 98  ? 2.194   -19.023 34.604  1.00 36.37 ? 308  SER B C   1 
ATOM   2642 O O   . SER B 1 98  ? 1.635   -19.880 35.299  1.00 36.97 ? 308  SER B O   1 
ATOM   2643 C CB  . SER B 1 98  ? 4.352   -18.710 35.898  1.00 36.65 ? 308  SER B CB  1 
ATOM   2644 O OG  . SER B 1 98  ? 3.953   -17.459 36.422  1.00 38.04 ? 308  SER B OG  1 
ATOM   2645 N N   . LEU B 1 99  ? 1.516   -18.121 33.902  1.00 35.48 ? 309  LEU B N   1 
ATOM   2646 C CA  . LEU B 1 99  ? 0.085   -18.287 33.667  1.00 34.98 ? 309  LEU B CA  1 
ATOM   2647 C C   . LEU B 1 99  ? -0.111  -19.386 32.619  1.00 34.71 ? 309  LEU B C   1 
ATOM   2648 O O   . LEU B 1 99  ? 0.729   -19.566 31.728  1.00 34.41 ? 309  LEU B O   1 
ATOM   2649 C CB  . LEU B 1 99  ? -0.558  -16.978 33.188  1.00 34.83 ? 309  LEU B CB  1 
ATOM   2650 C CG  . LEU B 1 99  ? -0.391  -15.756 34.097  1.00 35.02 ? 309  LEU B CG  1 
ATOM   2651 C CD1 . LEU B 1 99  ? -0.780  -14.474 33.368  1.00 34.06 ? 309  LEU B CD1 1 
ATOM   2652 C CD2 . LEU B 1 99  ? -1.208  -15.925 35.369  1.00 33.63 ? 309  LEU B CD2 1 
ATOM   2653 N N   . PHE B 1 100 ? -1.211  -20.128 32.737  1.00 34.37 ? 310  PHE B N   1 
ATOM   2654 C CA  . PHE B 1 100 ? -1.552  -21.132 31.739  1.00 33.78 ? 310  PHE B CA  1 
ATOM   2655 C C   . PHE B 1 100 ? -1.784  -20.479 30.393  1.00 33.14 ? 310  PHE B C   1 
ATOM   2656 O O   . PHE B 1 100 ? -2.297  -19.354 30.308  1.00 32.74 ? 310  PHE B O   1 
ATOM   2657 C CB  . PHE B 1 100 ? -2.786  -21.920 32.152  1.00 34.51 ? 310  PHE B CB  1 
ATOM   2658 C CG  . PHE B 1 100 ? -2.498  -23.032 33.132  1.00 35.69 ? 310  PHE B CG  1 
ATOM   2659 C CD1 . PHE B 1 100 ? -1.847  -24.192 32.714  1.00 34.71 ? 310  PHE B CD1 1 
ATOM   2660 C CD2 . PHE B 1 100 ? -2.883  -22.915 34.472  1.00 36.22 ? 310  PHE B CD2 1 
ATOM   2661 C CE1 . PHE B 1 100 ? -1.580  -25.223 33.609  1.00 36.14 ? 310  PHE B CE1 1 
ATOM   2662 C CE2 . PHE B 1 100 ? -2.626  -23.954 35.386  1.00 37.15 ? 310  PHE B CE2 1 
ATOM   2663 C CZ  . PHE B 1 100 ? -1.974  -25.107 34.949  1.00 36.48 ? 310  PHE B CZ  1 
ATOM   2664 N N   . LEU B 1 101 ? -1.409  -21.206 29.347  1.00 32.14 ? 311  LEU B N   1 
ATOM   2665 C CA  . LEU B 1 101 ? -1.454  -20.708 27.982  1.00 31.19 ? 311  LEU B CA  1 
ATOM   2666 C C   . LEU B 1 101 ? -2.776  -20.012 27.620  1.00 30.29 ? 311  LEU B C   1 
ATOM   2667 O O   . LEU B 1 101 ? -2.756  -18.946 27.008  1.00 29.78 ? 311  LEU B O   1 
ATOM   2668 C CB  . LEU B 1 101 ? -1.122  -21.833 26.994  1.00 31.38 ? 311  LEU B CB  1 
ATOM   2669 C CG  . LEU B 1 101 ? -0.234  -21.420 25.823  1.00 31.92 ? 311  LEU B CG  1 
ATOM   2670 C CD1 . LEU B 1 101 ? 1.085   -20.851 26.343  1.00 33.12 ? 311  LEU B CD1 1 
ATOM   2671 C CD2 . LEU B 1 101 ? 0.012   -22.604 24.906  1.00 32.72 ? 311  LEU B CD2 1 
ATOM   2672 N N   . ASN B 1 102 ? -3.903  -20.606 28.023  1.00 29.28 ? 312  ASN B N   1 
ATOM   2673 C CA  . ASN B 1 102 ? -5.221  -20.029 27.765  1.00 28.58 ? 312  ASN B CA  1 
ATOM   2674 C C   . ASN B 1 102 ? -5.428  -18.619 28.339  1.00 28.26 ? 312  ASN B C   1 
ATOM   2675 O O   . ASN B 1 102 ? -6.060  -17.774 27.693  1.00 27.96 ? 312  ASN B O   1 
ATOM   2676 C CB  . ASN B 1 102 ? -6.353  -20.971 28.194  1.00 28.39 ? 312  ASN B CB  1 
ATOM   2677 C CG  . ASN B 1 102 ? -6.345  -21.277 29.672  1.00 28.38 ? 312  ASN B CG  1 
ATOM   2678 O OD1 . ASN B 1 102 ? -5.306  -21.616 30.251  1.00 28.19 ? 312  ASN B OD1 1 
ATOM   2679 N ND2 . ASN B 1 102 ? -7.513  -21.182 30.295  1.00 27.77 ? 312  ASN B ND2 1 
ATOM   2680 N N   . ASP B 1 103 ? -4.888  -18.369 29.531  1.00 27.60 ? 313  ASP B N   1 
ATOM   2681 C CA  . ASP B 1 103 ? -4.888  -17.015 30.104  1.00 27.46 ? 313  ASP B CA  1 
ATOM   2682 C C   . ASP B 1 103 ? -3.922  -16.074 29.387  1.00 26.96 ? 313  ASP B C   1 
ATOM   2683 O O   . ASP B 1 103 ? -4.233  -14.891 29.192  1.00 27.39 ? 313  ASP B O   1 
ATOM   2684 C CB  . ASP B 1 103 ? -4.616  -17.043 31.617  1.00 27.41 ? 313  ASP B CB  1 
ATOM   2685 C CG  . ASP B 1 103 ? -5.879  -17.266 32.426  1.00 27.76 ? 313  ASP B CG  1 
ATOM   2686 O OD1 . ASP B 1 103 ? -6.989  -17.114 31.862  1.00 28.38 ? 313  ASP B OD1 1 
ATOM   2687 O OD2 . ASP B 1 103 ? -5.771  -17.579 33.629  1.00 27.97 ? 313  ASP B OD2 1 
ATOM   2688 N N   . GLN B 1 104 ? -2.768  -16.591 28.978  1.00 26.02 ? 314  GLN B N   1 
ATOM   2689 C CA  . GLN B 1 104 ? -1.848  -15.800 28.163  1.00 25.93 ? 314  GLN B CA  1 
ATOM   2690 C C   . GLN B 1 104 ? -2.520  -15.304 26.871  1.00 25.29 ? 314  GLN B C   1 
ATOM   2691 O O   . GLN B 1 104 ? -2.276  -14.173 26.428  1.00 25.04 ? 314  GLN B O   1 
ATOM   2692 C CB  . GLN B 1 104 ? -0.601  -16.600 27.815  1.00 25.78 ? 314  GLN B CB  1 
ATOM   2693 C CG  . GLN B 1 104 ? 0.345   -16.828 28.996  1.00 26.76 ? 314  GLN B CG  1 
ATOM   2694 C CD  . GLN B 1 104 ? 1.535   -17.676 28.607  1.00 27.11 ? 314  GLN B CD  1 
ATOM   2695 O OE1 . GLN B 1 104 ? 2.028   -17.594 27.476  1.00 27.21 ? 314  GLN B OE1 1 
ATOM   2696 N NE2 . GLN B 1 104 ? 2.003   -18.505 29.540  1.00 26.98 ? 314  GLN B NE2 1 
ATOM   2697 N N   . VAL B 1 105 ? -3.370  -16.157 26.300  1.00 24.14 ? 315  VAL B N   1 
ATOM   2698 C CA  . VAL B 1 105 ? -4.013  -15.905 25.019  1.00 23.74 ? 315  VAL B CA  1 
ATOM   2699 C C   . VAL B 1 105 ? -5.119  -14.872 25.179  1.00 23.06 ? 315  VAL B C   1 
ATOM   2700 O O   . VAL B 1 105 ? -5.184  -13.919 24.422  1.00 23.01 ? 315  VAL B O   1 
ATOM   2701 C CB  . VAL B 1 105 ? -4.496  -17.238 24.363  1.00 23.48 ? 315  VAL B CB  1 
ATOM   2702 C CG1 . VAL B 1 105 ? -5.610  -17.013 23.357  1.00 24.51 ? 315  VAL B CG1 1 
ATOM   2703 C CG2 . VAL B 1 105 ? -3.334  -17.938 23.709  1.00 23.66 ? 315  VAL B CG2 1 
ATOM   2704 N N   . THR B 1 106 ? -5.964  -15.059 26.185  1.00 23.12 ? 316  THR B N   1 
ATOM   2705 C CA  . THR B 1 106 ? -6.972  -14.065 26.578  1.00 22.96 ? 316  THR B CA  1 
ATOM   2706 C C   . THR B 1 106 ? -6.375  -12.652 26.730  1.00 22.60 ? 316  THR B C   1 
ATOM   2707 O O   . THR B 1 106 ? -6.853  -11.697 26.121  1.00 22.56 ? 316  THR B O   1 
ATOM   2708 C CB  . THR B 1 106 ? -7.651  -14.511 27.874  1.00 23.03 ? 316  THR B CB  1 
ATOM   2709 O OG1 . THR B 1 106 ? -8.412  -15.692 27.601  1.00 24.08 ? 316  THR B OG1 1 
ATOM   2710 C CG2 . THR B 1 106 ? -8.573  -13.417 28.447  1.00 22.90 ? 316  THR B CG2 1 
ATOM   2711 N N   . LEU B 1 107 ? -5.306  -12.541 27.511  1.00 22.30 ? 317  LEU B N   1 
ATOM   2712 C CA  . LEU B 1 107 ? -4.628  -11.265 27.719  1.00 21.97 ? 317  LEU B CA  1 
ATOM   2713 C C   . LEU B 1 107 ? -4.121  -10.622 26.426  1.00 22.26 ? 317  LEU B C   1 
ATOM   2714 O O   . LEU B 1 107 ? -4.225  -9.406  26.255  1.00 21.61 ? 317  LEU B O   1 
ATOM   2715 C CB  . LEU B 1 107 ? -3.479  -11.426 28.710  1.00 21.42 ? 317  LEU B CB  1 
ATOM   2716 C CG  . LEU B 1 107 ? -3.910  -11.731 30.144  1.00 21.35 ? 317  LEU B CG  1 
ATOM   2717 C CD1 . LEU B 1 107 ? -2.674  -11.909 31.026  1.00 20.20 ? 317  LEU B CD1 1 
ATOM   2718 C CD2 . LEU B 1 107 ? -4.833  -10.631 30.675  1.00 20.78 ? 317  LEU B CD2 1 
ATOM   2719 N N   . LEU B 1 108 ? -3.554  -11.434 25.532  1.00 22.27 ? 318  LEU B N   1 
ATOM   2720 C CA  . LEU B 1 108 ? -3.041  -10.917 24.273  1.00 22.39 ? 318  LEU B CA  1 
ATOM   2721 C C   . LEU B 1 108 ? -4.215  -10.536 23.360  1.00 22.57 ? 318  LEU B C   1 
ATOM   2722 O O   . LEU B 1 108 ? -4.188  -9.483  22.704  1.00 22.51 ? 318  LEU B O   1 
ATOM   2723 C CB  . LEU B 1 108 ? -2.053  -11.909 23.615  1.00 22.24 ? 318  LEU B CB  1 
ATOM   2724 C CG  . LEU B 1 108 ? -0.675  -11.949 24.325  1.00 22.91 ? 318  LEU B CG  1 
ATOM   2725 C CD1 . LEU B 1 108 ? 0.058   -13.260 24.111  1.00 21.94 ? 318  LEU B CD1 1 
ATOM   2726 C CD2 . LEU B 1 108 ? 0.243   -10.758 23.968  1.00 22.13 ? 318  LEU B CD2 1 
ATOM   2727 N N   . LYS B 1 109 ? -5.258  -11.364 23.366  1.00 22.34 ? 319  LYS B N   1 
ATOM   2728 C CA  . LYS B 1 109 ? -6.430  -11.125 22.537  1.00 22.74 ? 319  LYS B CA  1 
ATOM   2729 C C   . LYS B 1 109 ? -6.986  -9.703  22.739  1.00 23.10 ? 319  LYS B C   1 
ATOM   2730 O O   . LYS B 1 109 ? -7.122  -8.940  21.781  1.00 22.87 ? 319  LYS B O   1 
ATOM   2731 C CB  . LYS B 1 109 ? -7.518  -12.174 22.819  1.00 22.51 ? 319  LYS B CB  1 
ATOM   2732 C CG  . LYS B 1 109 ? -8.728  -12.037 21.910  1.00 22.86 ? 319  LYS B CG  1 
ATOM   2733 C CD  . LYS B 1 109 ? -9.829  -12.985 22.288  1.00 24.73 ? 319  LYS B CD  1 
ATOM   2734 C CE  . LYS B 1 109 ? -11.141 -12.581 21.632  1.00 26.75 ? 319  LYS B CE  1 
ATOM   2735 N NZ  . LYS B 1 109 ? -12.198 -13.576 21.955  1.00 29.02 ? 319  LYS B NZ  1 
ATOM   2736 N N   . TYR B 1 110 ? -7.284  -9.364  23.991  1.00 23.18 ? 320  TYR B N   1 
ATOM   2737 C CA  . TYR B 1 110 ? -7.909  -8.097  24.340  1.00 23.72 ? 320  TYR B CA  1 
ATOM   2738 C C   . TYR B 1 110 ? -6.896  -6.989  24.581  1.00 23.38 ? 320  TYR B C   1 
ATOM   2739 O O   . TYR B 1 110 ? -7.275  -5.834  24.834  1.00 23.50 ? 320  TYR B O   1 
ATOM   2740 C CB  . TYR B 1 110 ? -8.786  -8.279  25.590  1.00 24.84 ? 320  TYR B CB  1 
ATOM   2741 C CG  . TYR B 1 110 ? -9.985  -9.174  25.340  1.00 25.94 ? 320  TYR B CG  1 
ATOM   2742 C CD1 . TYR B 1 110 ? -11.130 -8.670  24.723  1.00 26.21 ? 320  TYR B CD1 1 
ATOM   2743 C CD2 . TYR B 1 110 ? -9.962  -10.526 25.693  1.00 25.38 ? 320  TYR B CD2 1 
ATOM   2744 C CE1 . TYR B 1 110 ? -12.233 -9.478  24.484  1.00 27.96 ? 320  TYR B CE1 1 
ATOM   2745 C CE2 . TYR B 1 110 ? -11.063 -11.348 25.451  1.00 27.42 ? 320  TYR B CE2 1 
ATOM   2746 C CZ  . TYR B 1 110 ? -12.193 -10.810 24.843  1.00 27.60 ? 320  TYR B CZ  1 
ATOM   2747 O OH  . TYR B 1 110 ? -13.294 -11.592 24.592  1.00 29.26 ? 320  TYR B OH  1 
ATOM   2748 N N   . GLY B 1 111 ? -5.614  -7.335  24.494  1.00 22.72 ? 321  GLY B N   1 
ATOM   2749 C CA  . GLY B 1 111 ? -4.545  -6.415  24.868  1.00 22.52 ? 321  GLY B CA  1 
ATOM   2750 C C   . GLY B 1 111 ? -3.671  -5.855  23.756  1.00 22.14 ? 321  GLY B C   1 
ATOM   2751 O O   . GLY B 1 111 ? -3.212  -4.709  23.862  1.00 21.80 ? 321  GLY B O   1 
ATOM   2752 N N   . VAL B 1 112 ? -3.430  -6.645  22.704  1.00 21.45 ? 322  VAL B N   1 
ATOM   2753 C CA  . VAL B 1 112 ? -2.424  -6.264  21.696  1.00 21.61 ? 322  VAL B CA  1 
ATOM   2754 C C   . VAL B 1 112 ? -2.708  -4.935  20.963  1.00 22.32 ? 322  VAL B C   1 
ATOM   2755 O O   . VAL B 1 112 ? -1.798  -4.141  20.772  1.00 22.46 ? 322  VAL B O   1 
ATOM   2756 C CB  . VAL B 1 112 ? -2.102  -7.387  20.661  1.00 21.50 ? 322  VAL B CB  1 
ATOM   2757 C CG1 . VAL B 1 112 ? -1.315  -8.501  21.312  1.00 20.20 ? 322  VAL B CG1 1 
ATOM   2758 C CG2 . VAL B 1 112 ? -3.374  -7.898  19.948  1.00 20.16 ? 322  VAL B CG2 1 
ATOM   2759 N N   . HIS B 1 113 ? -3.956  -4.691  20.564  1.00 23.00 ? 323  HIS B N   1 
ATOM   2760 C CA  . HIS B 1 113 ? -4.277  -3.433  19.887  1.00 23.75 ? 323  HIS B CA  1 
ATOM   2761 C C   . HIS B 1 113 ? -4.115  -2.201  20.785  1.00 23.99 ? 323  HIS B C   1 
ATOM   2762 O O   . HIS B 1 113 ? -3.693  -1.158  20.292  1.00 23.67 ? 323  HIS B O   1 
ATOM   2763 C CB  . HIS B 1 113 ? -5.657  -3.475  19.210  1.00 23.84 ? 323  HIS B CB  1 
ATOM   2764 C CG  . HIS B 1 113 ? -5.720  -4.432  18.067  1.00 24.39 ? 323  HIS B CG  1 
ATOM   2765 N ND1 . HIS B 1 113 ? -6.311  -5.674  18.167  1.00 26.51 ? 323  HIS B ND1 1 
ATOM   2766 C CD2 . HIS B 1 113 ? -5.231  -4.348  16.809  1.00 26.15 ? 323  HIS B CD2 1 
ATOM   2767 C CE1 . HIS B 1 113 ? -6.188  -6.315  17.017  1.00 26.38 ? 323  HIS B CE1 1 
ATOM   2768 N NE2 . HIS B 1 113 ? -5.550  -5.525  16.170  1.00 28.26 ? 323  HIS B NE2 1 
ATOM   2769 N N   . GLU B 1 114 ? -4.427  -2.322  22.084  1.00 24.16 ? 324  GLU B N   1 
ATOM   2770 C CA  . GLU B 1 114 ? -4.200  -1.212  23.033  1.00 24.83 ? 324  GLU B CA  1 
ATOM   2771 C C   . GLU B 1 114 ? -2.702  -0.863  23.085  1.00 25.40 ? 324  GLU B C   1 
ATOM   2772 O O   . GLU B 1 114 ? -2.322  0.316   23.070  1.00 24.89 ? 324  GLU B O   1 
ATOM   2773 C CB  . GLU B 1 114 ? -4.718  -1.548  24.439  1.00 24.74 ? 324  GLU B CB  1 
ATOM   2774 C CG  . GLU B 1 114 ? -6.242  -1.417  24.644  1.00 24.74 ? 324  GLU B CG  1 
ATOM   2775 C CD  . GLU B 1 114 ? -6.717  -1.964  25.994  1.00 24.55 ? 324  GLU B CD  1 
ATOM   2776 O OE1 . GLU B 1 114 ? -5.887  -2.105  26.918  1.00 25.53 ? 324  GLU B OE1 1 
ATOM   2777 O OE2 . GLU B 1 114 ? -7.921  -2.270  26.134  1.00 24.16 ? 324  GLU B OE2 1 
ATOM   2778 N N   . ALA B 1 115 ? -1.872  -1.910  23.123  1.00 25.78 ? 325  ALA B N   1 
ATOM   2779 C CA  . ALA B 1 115 ? -0.421  -1.784  23.103  1.00 26.44 ? 325  ALA B CA  1 
ATOM   2780 C C   . ALA B 1 115 ? 0.104   -1.330  21.745  1.00 27.00 ? 325  ALA B C   1 
ATOM   2781 O O   . ALA B 1 115 ? 1.054   -0.548  21.683  1.00 27.25 ? 325  ALA B O   1 
ATOM   2782 C CB  . ALA B 1 115 ? 0.233   -3.099  23.510  1.00 26.60 ? 325  ALA B CB  1 
ATOM   2783 N N   . ILE B 1 116 ? -0.504  -1.813  20.662  1.00 27.20 ? 326  ILE B N   1 
ATOM   2784 C CA  . ILE B 1 116 ? -0.123  -1.355  19.329  1.00 27.62 ? 326  ILE B CA  1 
ATOM   2785 C C   . ILE B 1 116 ? -0.411  0.143   19.157  1.00 27.94 ? 326  ILE B C   1 
ATOM   2786 O O   . ILE B 1 116 ? 0.469   0.897   18.726  1.00 28.25 ? 326  ILE B O   1 
ATOM   2787 C CB  . ILE B 1 116 ? -0.768  -2.185  18.202  1.00 27.71 ? 326  ILE B CB  1 
ATOM   2788 C CG1 . ILE B 1 116 ? -0.172  -3.593  18.187  1.00 27.51 ? 326  ILE B CG1 1 
ATOM   2789 C CG2 . ILE B 1 116 ? -0.519  -1.520  16.842  1.00 28.26 ? 326  ILE B CG2 1 
ATOM   2790 C CD1 . ILE B 1 116 ? -1.032  -4.635  17.522  1.00 29.13 ? 326  ILE B CD1 1 
ATOM   2791 N N   . PHE B 1 117 ? -1.616  0.575   19.526  1.00 27.77 ? 327  PHE B N   1 
ATOM   2792 C CA  . PHE B 1 117 ? -1.988  1.976   19.394  1.00 28.15 ? 327  PHE B CA  1 
ATOM   2793 C C   . PHE B 1 117 ? -1.209  2.927   20.303  1.00 29.15 ? 327  PHE B C   1 
ATOM   2794 O O   . PHE B 1 117 ? -1.046  4.099   19.978  1.00 29.66 ? 327  PHE B O   1 
ATOM   2795 C CB  . PHE B 1 117 ? -3.492  2.159   19.536  1.00 27.78 ? 327  PHE B CB  1 
ATOM   2796 C CG  . PHE B 1 117 ? -4.288  1.430   18.487  1.00 27.32 ? 327  PHE B CG  1 
ATOM   2797 C CD1 . PHE B 1 117 ? -3.799  1.294   17.184  1.00 26.26 ? 327  PHE B CD1 1 
ATOM   2798 C CD2 . PHE B 1 117 ? -5.520  0.891   18.793  1.00 25.60 ? 327  PHE B CD2 1 
ATOM   2799 C CE1 . PHE B 1 117 ? -4.522  0.619   16.215  1.00 25.99 ? 327  PHE B CE1 1 
ATOM   2800 C CE2 . PHE B 1 117 ? -6.249  0.226   17.827  1.00 26.68 ? 327  PHE B CE2 1 
ATOM   2801 C CZ  . PHE B 1 117 ? -5.753  0.086   16.541  1.00 26.18 ? 327  PHE B CZ  1 
ATOM   2802 N N   . ALA B 1 118 ? -0.695  2.419   21.418  1.00 30.16 ? 328  ALA B N   1 
ATOM   2803 C CA  . ALA B 1 118 ? 0.209   3.198   22.258  1.00 30.39 ? 328  ALA B CA  1 
ATOM   2804 C C   . ALA B 1 118 ? 1.601   3.364   21.626  1.00 30.94 ? 328  ALA B C   1 
ATOM   2805 O O   . ALA B 1 118 ? 2.145   4.465   21.624  1.00 30.73 ? 328  ALA B O   1 
ATOM   2806 C CB  . ALA B 1 118 ? 0.313   2.581   23.634  1.00 30.36 ? 328  ALA B CB  1 
ATOM   2807 N N   . MET B 1 119 ? 2.167   2.279   21.096  1.00 31.26 ? 329  MET B N   1 
ATOM   2808 C CA  . MET B 1 119 ? 3.519   2.313   20.530  1.00 32.54 ? 329  MET B CA  1 
ATOM   2809 C C   . MET B 1 119 ? 3.568   3.049   19.191  1.00 32.74 ? 329  MET B C   1 
ATOM   2810 O O   . MET B 1 119 ? 4.630   3.466   18.744  1.00 32.67 ? 329  MET B O   1 
ATOM   2811 C CB  . MET B 1 119 ? 4.075   0.899   20.334  1.00 32.32 ? 329  MET B CB  1 
ATOM   2812 C CG  . MET B 1 119 ? 4.359   0.148   21.617  1.00 33.23 ? 329  MET B CG  1 
ATOM   2813 S SD  . MET B 1 119 ? 5.012   -1.489  21.295  1.00 34.16 ? 329  MET B SD  1 
ATOM   2814 C CE  . MET B 1 119 ? 3.582   -2.324  20.627  1.00 34.15 ? 329  MET B CE  1 
ATOM   2815 N N   . LEU B 1 120 ? 2.410   3.186   18.553  1.00 33.12 ? 330  LEU B N   1 
ATOM   2816 C CA  . LEU B 1 120 ? 2.303   3.883   17.281  1.00 33.53 ? 330  LEU B CA  1 
ATOM   2817 C C   . LEU B 1 120 ? 2.700   5.354   17.423  1.00 33.44 ? 330  LEU B C   1 
ATOM   2818 O O   . LEU B 1 120 ? 3.188   5.953   16.473  1.00 33.05 ? 330  LEU B O   1 
ATOM   2819 C CB  . LEU B 1 120 ? 0.890   3.734   16.703  1.00 33.30 ? 330  LEU B CB  1 
ATOM   2820 C CG  . LEU B 1 120 ? 0.679   4.003   15.213  1.00 33.96 ? 330  LEU B CG  1 
ATOM   2821 C CD1 . LEU B 1 120 ? 1.727   3.289   14.353  1.00 33.71 ? 330  LEU B CD1 1 
ATOM   2822 C CD2 . LEU B 1 120 ? -0.722  3.566   14.814  1.00 33.86 ? 330  LEU B CD2 1 
ATOM   2823 N N   . ALA B 1 121 ? 2.513   5.910   18.622  1.00 33.61 ? 331  ALA B N   1 
ATOM   2824 C CA  . ALA B 1 121 ? 2.939   7.284   18.928  1.00 34.14 ? 331  ALA B CA  1 
ATOM   2825 C C   . ALA B 1 121 ? 4.437   7.501   18.685  1.00 34.57 ? 331  ALA B C   1 
ATOM   2826 O O   . ALA B 1 121 ? 4.838   8.547   18.191  1.00 34.76 ? 331  ALA B O   1 
ATOM   2827 C CB  . ALA B 1 121 ? 2.561   7.658   20.351  1.00 33.68 ? 331  ALA B CB  1 
ATOM   2828 N N   . SER B 1 122 ? 5.244   6.490   19.005  1.00 35.12 ? 332  SER B N   1 
ATOM   2829 C CA  . SER B 1 122 ? 6.696   6.515   18.808  1.00 35.94 ? 332  SER B CA  1 
ATOM   2830 C C   . SER B 1 122 ? 7.173   6.734   17.368  1.00 35.95 ? 332  SER B C   1 
ATOM   2831 O O   . SER B 1 122 ? 8.274   7.236   17.165  1.00 36.00 ? 332  SER B O   1 
ATOM   2832 C CB  . SER B 1 122 ? 7.324   5.228   19.347  1.00 35.99 ? 332  SER B CB  1 
ATOM   2833 O OG  . SER B 1 122 ? 6.779   4.920   20.618  1.00 37.09 ? 332  SER B OG  1 
ATOM   2834 N N   . ILE B 1 123 ? 6.374   6.344   16.376  1.00 36.05 ? 333  ILE B N   1 
ATOM   2835 C CA  . ILE B 1 123 ? 6.807   6.495   14.982  1.00 35.89 ? 333  ILE B CA  1 
ATOM   2836 C C   . ILE B 1 123 ? 6.043   7.602   14.231  1.00 36.22 ? 333  ILE B C   1 
ATOM   2837 O O   . ILE B 1 123 ? 6.182   7.758   13.015  1.00 35.78 ? 333  ILE B O   1 
ATOM   2838 C CB  . ILE B 1 123 ? 6.831   5.134   14.208  1.00 36.04 ? 333  ILE B CB  1 
ATOM   2839 C CG1 . ILE B 1 123 ? 5.441   4.486   14.160  1.00 35.40 ? 333  ILE B CG1 1 
ATOM   2840 C CG2 . ILE B 1 123 ? 7.881   4.192   14.819  1.00 35.53 ? 333  ILE B CG2 1 
ATOM   2841 C CD1 . ILE B 1 123 ? 5.381   3.179   13.379  1.00 35.16 ? 333  ILE B CD1 1 
ATOM   2842 N N   . VAL B 1 124 ? 5.275   8.380   14.991  1.00 36.65 ? 334  VAL B N   1 
ATOM   2843 C CA  . VAL B 1 124 ? 4.372   9.391   14.456  1.00 37.49 ? 334  VAL B CA  1 
ATOM   2844 C C   . VAL B 1 124 ? 4.932   10.811  14.642  1.00 38.71 ? 334  VAL B C   1 
ATOM   2845 O O   . VAL B 1 124 ? 5.665   11.070  15.605  1.00 39.13 ? 334  VAL B O   1 
ATOM   2846 C CB  . VAL B 1 124 ? 2.958   9.242   15.116  1.00 37.11 ? 334  VAL B CB  1 
ATOM   2847 C CG1 . VAL B 1 124 ? 2.149   10.508  15.045  1.00 36.66 ? 334  VAL B CG1 1 
ATOM   2848 C CG2 . VAL B 1 124 ? 2.180   8.090   14.487  1.00 36.98 ? 334  VAL B CG2 1 
ATOM   2849 N N   . ASN B 1 125 ? 4.643   11.690  13.673  1.00 39.85 ? 335  ASN B N   1 
ATOM   2850 C CA  . ASN B 1 125 ? 4.604   13.149  13.866  1.00 40.91 ? 335  ASN B CA  1 
ATOM   2851 C C   . ASN B 1 125 ? 3.228   13.621  13.417  1.00 41.25 ? 335  ASN B C   1 
ATOM   2852 O O   . ASN B 1 125 ? 2.393   12.819  12.990  1.00 41.24 ? 335  ASN B O   1 
ATOM   2853 C CB  . ASN B 1 125 ? 5.638   13.913  13.021  1.00 41.22 ? 335  ASN B CB  1 
ATOM   2854 C CG  . ASN B 1 125 ? 6.869   13.106  12.705  1.00 43.40 ? 335  ASN B CG  1 
ATOM   2855 O OD1 . ASN B 1 125 ? 7.272   12.218  13.468  1.00 45.20 ? 335  ASN B OD1 1 
ATOM   2856 N ND2 . ASN B 1 125 ? 7.489   13.414  11.568  1.00 43.67 ? 335  ASN B ND2 1 
ATOM   2857 N N   . LYS B 1 126 ? 3.009   14.932  13.465  1.00 41.77 ? 336  LYS B N   1 
ATOM   2858 C CA  . LYS B 1 126 ? 1.766   15.528  12.972  1.00 42.15 ? 336  LYS B CA  1 
ATOM   2859 C C   . LYS B 1 126 ? 1.611   15.379  11.460  1.00 42.04 ? 336  LYS B C   1 
ATOM   2860 O O   . LYS B 1 126 ? 0.514   15.562  10.935  1.00 42.41 ? 336  LYS B O   1 
ATOM   2861 C CB  . LYS B 1 126 ? 1.685   17.010  13.367  1.00 42.16 ? 336  LYS B CB  1 
ATOM   2862 N N   . ASP B 1 127 ? 2.700   15.037  10.773  1.00 42.04 ? 337  ASP B N   1 
ATOM   2863 C CA  . ASP B 1 127 ? 2.705   14.945  9.300   1.00 42.27 ? 337  ASP B CA  1 
ATOM   2864 C C   . ASP B 1 127 ? 2.766   13.524  8.757   1.00 41.97 ? 337  ASP B C   1 
ATOM   2865 O O   . ASP B 1 127 ? 2.880   13.319  7.547   1.00 41.81 ? 337  ASP B O   1 
ATOM   2866 C CB  . ASP B 1 127 ? 3.881   15.730  8.715   1.00 42.28 ? 337  ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 127 ? 3.809   17.193  9.033   1.00 42.91 ? 337  ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 127 ? 2.713   17.775  8.900   1.00 43.60 ? 337  ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 127 ? 4.853   17.757  9.419   1.00 44.88 ? 337  ASP B OD2 1 
ATOM   2870 N N   . GLY B 1 128 ? 2.707   12.546  9.647   1.00 41.75 ? 338  GLY B N   1 
ATOM   2871 C CA  . GLY B 1 128 ? 2.770   11.159  9.223   1.00 41.63 ? 338  GLY B CA  1 
ATOM   2872 C C   . GLY B 1 128 ? 3.505   10.241  10.170  1.00 41.46 ? 338  GLY B C   1 
ATOM   2873 O O   . GLY B 1 128 ? 3.599   10.496  11.375  1.00 41.22 ? 338  GLY B O   1 
ATOM   2874 N N   . LEU B 1 129 ? 4.054   9.181   9.594   1.00 41.46 ? 339  LEU B N   1 
ATOM   2875 C CA  . LEU B 1 129 ? 4.420   7.995   10.338  1.00 41.61 ? 339  LEU B CA  1 
ATOM   2876 C C   . LEU B 1 129 ? 5.453   7.244   9.525   1.00 41.55 ? 339  LEU B C   1 
ATOM   2877 O O   . LEU B 1 129 ? 5.371   7.217   8.305   1.00 41.22 ? 339  LEU B O   1 
ATOM   2878 C CB  . LEU B 1 129 ? 3.146   7.159   10.545  1.00 41.83 ? 339  LEU B CB  1 
ATOM   2879 C CG  . LEU B 1 129 ? 3.003   5.700   10.989  1.00 41.48 ? 339  LEU B CG  1 
ATOM   2880 C CD1 . LEU B 1 129 ? 1.562   5.497   11.401  1.00 42.04 ? 339  LEU B CD1 1 
ATOM   2881 C CD2 . LEU B 1 129 ? 3.336   4.745   9.877   1.00 41.95 ? 339  LEU B CD2 1 
ATOM   2882 N N   . LEU B 1 130 ? 6.432   6.655   10.200  1.00 42.11 ? 340  LEU B N   1 
ATOM   2883 C CA  . LEU B 1 130 ? 7.458   5.852   9.526   1.00 42.72 ? 340  LEU B CA  1 
ATOM   2884 C C   . LEU B 1 130 ? 6.918   4.479   9.147   1.00 43.36 ? 340  LEU B C   1 
ATOM   2885 O O   . LEU B 1 130 ? 6.055   3.940   9.839   1.00 43.28 ? 340  LEU B O   1 
ATOM   2886 C CB  . LEU B 1 130 ? 8.688   5.675   10.421  1.00 42.56 ? 340  LEU B CB  1 
ATOM   2887 C CG  . LEU B 1 130 ? 9.557   6.865   10.832  1.00 42.43 ? 340  LEU B CG  1 
ATOM   2888 C CD1 . LEU B 1 130 ? 10.557  6.428   11.890  1.00 41.67 ? 340  LEU B CD1 1 
ATOM   2889 C CD2 . LEU B 1 130 ? 10.270  7.480   9.634   1.00 42.31 ? 340  LEU B CD2 1 
ATOM   2890 N N   . VAL B 1 131 ? 7.429   3.924   8.051   1.00 44.35 ? 341  VAL B N   1 
ATOM   2891 C CA  . VAL B 1 131 ? 7.126   2.544   7.661   1.00 45.56 ? 341  VAL B CA  1 
ATOM   2892 C C   . VAL B 1 131 ? 8.377   1.733   7.304   1.00 46.45 ? 341  VAL B C   1 
ATOM   2893 O O   . VAL B 1 131 ? 9.465   2.290   7.146   1.00 46.62 ? 341  VAL B O   1 
ATOM   2894 C CB  . VAL B 1 131 ? 6.095   2.450   6.499   1.00 45.57 ? 341  VAL B CB  1 
ATOM   2895 C CG1 . VAL B 1 131 ? 4.681   2.626   7.015   1.00 45.06 ? 341  VAL B CG1 1 
ATOM   2896 C CG2 . VAL B 1 131 ? 6.413   3.435   5.375   1.00 45.67 ? 341  VAL B CG2 1 
ATOM   2897 N N   . ALA B 1 132 ? 8.193   0.418   7.169   1.00 47.76 ? 342  ALA B N   1 
ATOM   2898 C CA  . ALA B 1 132 ? 9.268   -0.549  6.895   1.00 48.94 ? 342  ALA B CA  1 
ATOM   2899 C C   . ALA B 1 132 ? 10.179  -0.686  8.115   1.00 49.77 ? 342  ALA B C   1 
ATOM   2900 O O   . ALA B 1 132 ? 9.876   -1.467  9.028   1.00 50.17 ? 342  ALA B O   1 
ATOM   2901 C CB  . ALA B 1 132 ? 10.055  -0.184  5.625   1.00 49.03 ? 342  ALA B CB  1 
ATOM   2902 N N   . ASN B 1 133 ? 11.285  0.061   8.128   1.00 50.27 ? 343  ASN B N   1 
ATOM   2903 C CA  . ASN B 1 133 ? 12.057  0.267   9.354   1.00 50.54 ? 343  ASN B CA  1 
ATOM   2904 C C   . ASN B 1 133 ? 12.645  1.673   9.415   1.00 50.51 ? 343  ASN B C   1 
ATOM   2905 O O   . ASN B 1 133 ? 13.796  1.868   9.808   1.00 51.00 ? 343  ASN B O   1 
ATOM   2906 C CB  . ASN B 1 133 ? 13.119  -0.837  9.574   1.00 50.79 ? 343  ASN B CB  1 
ATOM   2907 C CG  . ASN B 1 133 ? 14.286  -0.781  8.579   1.00 51.29 ? 343  ASN B CG  1 
ATOM   2908 O OD1 . ASN B 1 133 ? 14.919  -1.802  8.309   1.00 52.26 ? 343  ASN B OD1 1 
ATOM   2909 N ND2 . ASN B 1 133 ? 14.588  0.405   8.056   1.00 51.69 ? 343  ASN B ND2 1 
ATOM   2910 N N   . GLY B 1 134 ? 11.839  2.656   9.033   1.00 50.25 ? 344  GLY B N   1 
ATOM   2911 C CA  . GLY B 1 134 ? 12.311  4.030   8.931   1.00 49.90 ? 344  GLY B CA  1 
ATOM   2912 C C   . GLY B 1 134 ? 12.673  4.437   7.513   1.00 49.77 ? 344  GLY B C   1 
ATOM   2913 O O   . GLY B 1 134 ? 12.806  5.627   7.222   1.00 49.65 ? 344  GLY B O   1 
ATOM   2914 N N   . SER B 1 135 ? 12.825  3.452   6.625   1.00 49.57 ? 345  SER B N   1 
ATOM   2915 C CA  . SER B 1 135 ? 13.078  3.727   5.205   1.00 49.30 ? 345  SER B CA  1 
ATOM   2916 C C   . SER B 1 135 ? 11.928  4.489   4.513   1.00 48.87 ? 345  SER B C   1 
ATOM   2917 O O   . SER B 1 135 ? 12.165  5.246   3.567   1.00 49.23 ? 345  SER B O   1 
ATOM   2918 C CB  . SER B 1 135 ? 13.457  2.452   4.442   1.00 49.40 ? 345  SER B CB  1 
ATOM   2919 O OG  . SER B 1 135 ? 12.889  1.291   5.024   1.00 50.17 ? 345  SER B OG  1 
ATOM   2920 N N   . GLY B 1 136 ? 10.698  4.307   4.996   1.00 48.15 ? 346  GLY B N   1 
ATOM   2921 C CA  . GLY B 1 136 ? 9.555   5.067   4.488   1.00 47.18 ? 346  GLY B CA  1 
ATOM   2922 C C   . GLY B 1 136 ? 8.929   6.043   5.481   1.00 46.79 ? 346  GLY B C   1 
ATOM   2923 O O   . GLY B 1 136 ? 9.120   5.925   6.701   1.00 46.82 ? 346  GLY B O   1 
ATOM   2924 N N   . PHE B 1 137 ? 8.176   7.004   4.946   1.00 45.82 ? 347  PHE B N   1 
ATOM   2925 C CA  . PHE B 1 137 ? 7.380   7.936   5.734   1.00 45.23 ? 347  PHE B CA  1 
ATOM   2926 C C   . PHE B 1 137 ? 6.102   8.269   4.963   1.00 45.17 ? 347  PHE B C   1 
ATOM   2927 O O   . PHE B 1 137 ? 6.127   9.035   3.992   1.00 45.31 ? 347  PHE B O   1 
ATOM   2928 C CB  . PHE B 1 137 ? 8.185   9.204   6.048   1.00 45.34 ? 347  PHE B CB  1 
ATOM   2929 C CG  . PHE B 1 137 ? 7.425   10.243  6.848   1.00 45.26 ? 347  PHE B CG  1 
ATOM   2930 C CD1 . PHE B 1 137 ? 6.745   11.277  6.209   1.00 44.68 ? 347  PHE B CD1 1 
ATOM   2931 C CD2 . PHE B 1 137 ? 7.413   10.200  8.239   1.00 45.49 ? 347  PHE B CD2 1 
ATOM   2932 C CE1 . PHE B 1 137 ? 6.052   12.242  6.939   1.00 45.00 ? 347  PHE B CE1 1 
ATOM   2933 C CE2 . PHE B 1 137 ? 6.721   11.162  8.976   1.00 46.03 ? 347  PHE B CE2 1 
ATOM   2934 C CZ  . PHE B 1 137 ? 6.041   12.187  8.322   1.00 45.23 ? 347  PHE B CZ  1 
ATOM   2935 N N   . VAL B 1 138 ? 4.987   7.678   5.388   1.00 44.82 ? 348  VAL B N   1 
ATOM   2936 C CA  . VAL B 1 138 ? 3.699   7.876   4.717   1.00 44.38 ? 348  VAL B CA  1 
ATOM   2937 C C   . VAL B 1 138 ? 2.980   9.051   5.362   1.00 44.14 ? 348  VAL B C   1 
ATOM   2938 O O   . VAL B 1 138 ? 2.857   9.106   6.595   1.00 44.15 ? 348  VAL B O   1 
ATOM   2939 C CB  . VAL B 1 138 ? 2.818   6.603   4.775   1.00 44.54 ? 348  VAL B CB  1 
ATOM   2940 C CG1 . VAL B 1 138 ? 1.514   6.810   4.022   1.00 44.50 ? 348  VAL B CG1 1 
ATOM   2941 C CG2 . VAL B 1 138 ? 3.566   5.416   4.192   1.00 44.41 ? 348  VAL B CG2 1 
ATOM   2942 N N   . THR B 1 139 ? 2.510   9.989   4.538   1.00 43.54 ? 349  THR B N   1 
ATOM   2943 C CA  . THR B 1 139 ? 1.924   11.216  5.065   1.00 43.05 ? 349  THR B CA  1 
ATOM   2944 C C   . THR B 1 139 ? 0.490   11.044  5.556   1.00 43.00 ? 349  THR B C   1 
ATOM   2945 O O   . THR B 1 139 ? -0.291  10.260  5.006   1.00 42.79 ? 349  THR B O   1 
ATOM   2946 C CB  . THR B 1 139 ? 2.006   12.414  4.076   1.00 43.10 ? 349  THR B CB  1 
ATOM   2947 O OG1 . THR B 1 139 ? 0.931   12.352  3.138   1.00 42.92 ? 349  THR B OG1 1 
ATOM   2948 C CG2 . THR B 1 139 ? 3.348   12.446  3.338   1.00 43.15 ? 349  THR B CG2 1 
ATOM   2949 N N   . ARG B 1 140 ? 0.162   11.806  6.596   1.00 43.02 ? 350  ARG B N   1 
ATOM   2950 C CA  . ARG B 1 140 ? -1.144  11.775  7.242   1.00 42.89 ? 350  ARG B CA  1 
ATOM   2951 C C   . ARG B 1 140 ? -2.217  12.274  6.281   1.00 42.74 ? 350  ARG B C   1 
ATOM   2952 O O   . ARG B 1 140 ? -3.347  11.784  6.291   1.00 42.27 ? 350  ARG B O   1 
ATOM   2953 C CB  . ARG B 1 140 ? -1.086  12.636  8.510   1.00 43.05 ? 350  ARG B CB  1 
ATOM   2954 C CG  . ARG B 1 140 ? -2.341  12.664  9.365   1.00 42.76 ? 350  ARG B CG  1 
ATOM   2955 C CD  . ARG B 1 140 ? -2.089  13.478  10.629  1.00 43.12 ? 350  ARG B CD  1 
ATOM   2956 N NE  . ARG B 1 140 ? -3.329  13.809  11.335  1.00 44.27 ? 350  ARG B NE  1 
ATOM   2957 C CZ  . ARG B 1 140 ? -3.387  14.412  12.521  1.00 44.23 ? 350  ARG B CZ  1 
ATOM   2958 N NH1 . ARG B 1 140 ? -2.276  14.756  13.160  1.00 43.69 ? 350  ARG B NH1 1 
ATOM   2959 N NH2 . ARG B 1 140 ? -4.565  14.664  13.074  1.00 44.39 ? 350  ARG B NH2 1 
ATOM   2960 N N   . GLU B 1 141 ? -1.850  13.249  5.447   1.00 42.81 ? 351  GLU B N   1 
ATOM   2961 C CA  . GLU B 1 141 ? -2.776  13.818  4.465   1.00 42.76 ? 351  GLU B CA  1 
ATOM   2962 C C   . GLU B 1 141 ? -3.151  12.793  3.391   1.00 42.30 ? 351  GLU B C   1 
ATOM   2963 O O   . GLU B 1 141 ? -4.330  12.683  3.026   1.00 42.01 ? 351  GLU B O   1 
ATOM   2964 C CB  . GLU B 1 141 ? -2.208  15.099  3.834   1.00 43.22 ? 351  GLU B CB  1 
ATOM   2965 C CG  . GLU B 1 141 ? -1.687  16.153  4.829   1.00 44.61 ? 351  GLU B CG  1 
ATOM   2966 C CD  . GLU B 1 141 ? -2.752  16.673  5.781   1.00 47.11 ? 351  GLU B CD  1 
ATOM   2967 O OE1 . GLU B 1 141 ? -3.935  16.750  5.375   1.00 47.96 ? 351  GLU B OE1 1 
ATOM   2968 O OE2 . GLU B 1 141 ? -2.397  17.011  6.939   1.00 47.82 ? 351  GLU B OE2 1 
ATOM   2969 N N   . PHE B 1 142 ? -2.152  12.049  2.898   1.00 42.08 ? 352  PHE B N   1 
ATOM   2970 C CA  . PHE B 1 142 ? -2.387  10.917  1.971   1.00 41.84 ? 352  PHE B CA  1 
ATOM   2971 C C   . PHE B 1 142 ? -3.308  9.854   2.570   1.00 42.15 ? 352  PHE B C   1 
ATOM   2972 O O   . PHE B 1 142 ? -4.239  9.394   1.907   1.00 42.24 ? 352  PHE B O   1 
ATOM   2973 C CB  . PHE B 1 142 ? -1.069  10.263  1.540   1.00 41.20 ? 352  PHE B CB  1 
ATOM   2974 C CG  . PHE B 1 142 ? -1.243  8.953   0.803   1.00 40.53 ? 352  PHE B CG  1 
ATOM   2975 C CD1 . PHE B 1 142 ? -1.720  8.926   -0.508  1.00 39.16 ? 352  PHE B CD1 1 
ATOM   2976 C CD2 . PHE B 1 142 ? -0.927  7.744   1.419   1.00 39.17 ? 352  PHE B CD2 1 
ATOM   2977 C CE1 . PHE B 1 142 ? -1.873  7.715   -1.195  1.00 38.27 ? 352  PHE B CE1 1 
ATOM   2978 C CE2 . PHE B 1 142 ? -1.081  6.535   0.744   1.00 38.06 ? 352  PHE B CE2 1 
ATOM   2979 C CZ  . PHE B 1 142 ? -1.553  6.522   -0.567  1.00 38.80 ? 352  PHE B CZ  1 
ATOM   2980 N N   . LEU B 1 143 ? -3.041  9.466   3.819   1.00 42.45 ? 353  LEU B N   1 
ATOM   2981 C CA  . LEU B 1 143 ? -3.891  8.503   4.521   1.00 42.93 ? 353  LEU B CA  1 
ATOM   2982 C C   . LEU B 1 143 ? -5.317  9.015   4.586   1.00 43.36 ? 353  LEU B C   1 
ATOM   2983 O O   . LEU B 1 143 ? -6.246  8.256   4.339   1.00 43.79 ? 353  LEU B O   1 
ATOM   2984 C CB  . LEU B 1 143 ? -3.367  8.197   5.934   1.00 42.70 ? 353  LEU B CB  1 
ATOM   2985 C CG  . LEU B 1 143 ? -2.064  7.402   6.028   1.00 42.62 ? 353  LEU B CG  1 
ATOM   2986 C CD1 . LEU B 1 143 ? -1.637  7.287   7.467   1.00 42.94 ? 353  LEU B CD1 1 
ATOM   2987 C CD2 . LEU B 1 143 ? -2.192  6.019   5.389   1.00 42.79 ? 353  LEU B CD2 1 
ATOM   2988 N N   . ARG B 1 144 ? -5.471  10.307  4.890   1.00 43.74 ? 354  ARG B N   1 
ATOM   2989 C CA  . ARG B 1 144 ? -6.782  10.959  4.975   1.00 44.39 ? 354  ARG B CA  1 
ATOM   2990 C C   . ARG B 1 144 ? -7.530  11.024  3.644   1.00 44.38 ? 354  ARG B C   1 
ATOM   2991 O O   . ARG B 1 144 ? -8.764  11.098  3.622   1.00 44.41 ? 354  ARG B O   1 
ATOM   2992 C CB  . ARG B 1 144 ? -6.653  12.363  5.583   1.00 44.42 ? 354  ARG B CB  1 
ATOM   2993 C CG  . ARG B 1 144 ? -7.101  12.450  7.040   1.00 44.83 ? 354  ARG B CG  1 
ATOM   2994 C CD  . ARG B 1 144 ? -7.241  13.898  7.516   1.00 45.33 ? 354  ARG B CD  1 
ATOM   2995 N NE  . ARG B 1 144 ? -5.949  14.488  7.874   1.00 47.82 ? 354  ARG B NE  1 
ATOM   2996 C CZ  . ARG B 1 144 ? -5.757  15.766  8.198   1.00 49.90 ? 354  ARG B CZ  1 
ATOM   2997 N NH1 . ARG B 1 144 ? -6.772  16.629  8.206   1.00 50.90 ? 354  ARG B NH1 1 
ATOM   2998 N NH2 . ARG B 1 144 ? -4.537  16.190  8.505   1.00 50.79 ? 354  ARG B NH2 1 
ATOM   2999 N N   . SER B 1 145 ? -6.781  10.978  2.544   1.00 44.54 ? 355  SER B N   1 
ATOM   3000 C CA  . SER B 1 145 ? -7.348  11.088  1.201   1.00 44.80 ? 355  SER B CA  1 
ATOM   3001 C C   . SER B 1 145 ? -7.879  9.752   0.679   1.00 45.28 ? 355  SER B C   1 
ATOM   3002 O O   . SER B 1 145 ? -8.456  9.685   -0.417  1.00 45.17 ? 355  SER B O   1 
ATOM   3003 C CB  . SER B 1 145 ? -6.301  11.645  0.233   1.00 44.62 ? 355  SER B CB  1 
ATOM   3004 O OG  . SER B 1 145 ? -5.416  10.631  -0.207  1.00 43.79 ? 355  SER B OG  1 
ATOM   3005 N N   . LEU B 1 146 ? -7.675  8.693   1.461   1.00 45.75 ? 356  LEU B N   1 
ATOM   3006 C CA  . LEU B 1 146 ? -8.112  7.353   1.080   1.00 46.00 ? 356  LEU B CA  1 
ATOM   3007 C C   . LEU B 1 146 ? -9.635  7.246   1.052   1.00 46.35 ? 356  LEU B C   1 
ATOM   3008 O O   . LEU B 1 146 ? -10.342 8.002   1.718   1.00 45.94 ? 356  LEU B O   1 
ATOM   3009 C CB  . LEU B 1 146 ? -7.511  6.285   2.008   1.00 45.88 ? 356  LEU B CB  1 
ATOM   3010 C CG  . LEU B 1 146 ? -5.998  6.033   1.997   1.00 45.70 ? 356  LEU B CG  1 
ATOM   3011 C CD1 . LEU B 1 146 ? -5.634  4.982   3.040   1.00 45.09 ? 356  LEU B CD1 1 
ATOM   3012 C CD2 . LEU B 1 146 ? -5.478  5.626   0.609   1.00 45.39 ? 356  LEU B CD2 1 
ATOM   3013 N N   . ARG B 1 147 ? -10.113 6.289   0.265   1.00 47.17 ? 357  ARG B N   1 
ATOM   3014 C CA  . ARG B 1 147 ? -11.533 6.054   0.014   1.00 47.98 ? 357  ARG B CA  1 
ATOM   3015 C C   . ARG B 1 147 ? -12.385 5.962   1.291   1.00 48.63 ? 357  ARG B C   1 
ATOM   3016 O O   . ARG B 1 147 ? -11.874 5.740   2.389   1.00 48.63 ? 357  ARG B O   1 
ATOM   3017 C CB  . ARG B 1 147 ? -11.668 4.771   -0.804  1.00 47.95 ? 357  ARG B CB  1 
ATOM   3018 C CG  . ARG B 1 147 ? -12.801 4.724   -1.782  1.00 47.74 ? 357  ARG B CG  1 
ATOM   3019 C CD  . ARG B 1 147 ? -13.014 3.289   -2.210  1.00 47.08 ? 357  ARG B CD  1 
ATOM   3020 N NE  . ARG B 1 147 ? -13.879 2.617   -1.255  1.00 47.56 ? 357  ARG B NE  1 
ATOM   3021 C CZ  . ARG B 1 147 ? -13.935 1.306   -1.061  1.00 47.13 ? 357  ARG B CZ  1 
ATOM   3022 N NH1 . ARG B 1 147 ? -13.160 0.473   -1.745  1.00 45.98 ? 357  ARG B NH1 1 
ATOM   3023 N NH2 . ARG B 1 147 ? -14.776 0.836   -0.160  1.00 47.90 ? 357  ARG B NH2 1 
ATOM   3024 N N   . LYS B 1 148 ? -13.695 6.076   1.097   1.00 49.36 ? 358  LYS B N   1 
ATOM   3025 C CA  . LYS B 1 148 ? -14.701 6.349   2.142   1.00 49.94 ? 358  LYS B CA  1 
ATOM   3026 C C   . LYS B 1 148 ? -14.665 5.668   3.522   1.00 50.05 ? 358  LYS B C   1 
ATOM   3027 O O   . LYS B 1 148 ? -14.901 6.351   4.524   1.00 50.51 ? 358  LYS B O   1 
ATOM   3028 C CB  . LYS B 1 148 ? -16.119 6.263   1.538   1.00 50.33 ? 358  LYS B CB  1 
ATOM   3029 C CG  . LYS B 1 148 ? -16.292 6.976   0.172   1.00 50.35 ? 358  LYS B CG  1 
ATOM   3030 C CD  . LYS B 1 148 ? -16.248 8.502   0.258   1.00 50.13 ? 358  LYS B CD  1 
ATOM   3031 C CE  . LYS B 1 148 ? -14.896 9.071   -0.148  1.00 49.92 ? 358  LYS B CE  1 
ATOM   3032 N NZ  . LYS B 1 148 ? -14.040 9.357   1.027   1.00 50.64 ? 358  LYS B NZ  1 
ATOM   3033 N N   . PRO B 1 149 ? -14.434 4.334   3.591   1.00 49.85 ? 359  PRO B N   1 
ATOM   3034 C CA  . PRO B 1 149 ? -14.353 3.687   4.913   1.00 49.71 ? 359  PRO B CA  1 
ATOM   3035 C C   . PRO B 1 149 ? -12.951 3.587   5.541   1.00 49.60 ? 359  PRO B C   1 
ATOM   3036 O O   . PRO B 1 149 ? -12.807 3.699   6.762   1.00 49.56 ? 359  PRO B O   1 
ATOM   3037 C CB  . PRO B 1 149 ? -14.898 2.283   4.644   1.00 49.69 ? 359  PRO B CB  1 
ATOM   3038 C CG  . PRO B 1 149 ? -14.601 2.019   3.201   1.00 50.08 ? 359  PRO B CG  1 
ATOM   3039 C CD  . PRO B 1 149 ? -14.313 3.346   2.505   1.00 49.93 ? 359  PRO B CD  1 
ATOM   3040 N N   . PHE B 1 150 ? -11.937 3.371   4.716   1.00 49.18 ? 360  PHE B N   1 
ATOM   3041 C CA  . PHE B 1 150 ? -10.584 3.139   5.197   1.00 49.16 ? 360  PHE B CA  1 
ATOM   3042 C C   . PHE B 1 150 ? -9.912  4.391   5.752   1.00 49.41 ? 360  PHE B C   1 
ATOM   3043 O O   . PHE B 1 150 ? -9.071  4.304   6.646   1.00 49.33 ? 360  PHE B O   1 
ATOM   3044 C CB  . PHE B 1 150 ? -9.745  2.510   4.083   1.00 48.92 ? 360  PHE B CB  1 
ATOM   3045 C CG  . PHE B 1 150 ? -10.293 1.198   3.597   1.00 48.65 ? 360  PHE B CG  1 
ATOM   3046 C CD1 . PHE B 1 150 ? -10.181 0.048   4.382   1.00 47.21 ? 360  PHE B CD1 1 
ATOM   3047 C CD2 . PHE B 1 150 ? -10.945 1.114   2.373   1.00 48.04 ? 360  PHE B CD2 1 
ATOM   3048 C CE1 . PHE B 1 150 ? -10.692 -1.159  3.947   1.00 46.98 ? 360  PHE B CE1 1 
ATOM   3049 C CE2 . PHE B 1 150 ? -11.459 -0.097  1.928   1.00 47.47 ? 360  PHE B CE2 1 
ATOM   3050 C CZ  . PHE B 1 150 ? -11.332 -1.236  2.720   1.00 47.45 ? 360  PHE B CZ  1 
ATOM   3051 N N   . SER B 1 151 ? -10.310 5.546   5.222   1.00 49.55 ? 361  SER B N   1 
ATOM   3052 C CA  . SER B 1 151 ? -9.761  6.851   5.595   1.00 49.58 ? 361  SER B CA  1 
ATOM   3053 C C   . SER B 1 151 ? -9.916  7.230   7.072   1.00 49.54 ? 361  SER B C   1 
ATOM   3054 O O   . SER B 1 151 ? -9.068  7.936   7.621   1.00 49.54 ? 361  SER B O   1 
ATOM   3055 C CB  . SER B 1 151 ? -10.393 7.944   4.724   1.00 49.74 ? 361  SER B CB  1 
ATOM   3056 O OG  . SER B 1 151 ? -11.808 7.830   4.696   1.00 49.50 ? 361  SER B OG  1 
ATOM   3057 N N   . ASP B 1 152 ? -10.993 6.773   7.709   1.00 49.48 ? 362  ASP B N   1 
ATOM   3058 C CA  . ASP B 1 152 ? -11.267 7.163   9.095   1.00 49.38 ? 362  ASP B CA  1 
ATOM   3059 C C   . ASP B 1 152 ? -10.936 6.107   10.149  1.00 49.07 ? 362  ASP B C   1 
ATOM   3060 O O   . ASP B 1 152 ? -11.268 6.268   11.331  1.00 48.88 ? 362  ASP B O   1 
ATOM   3061 C CB  . ASP B 1 152 ? -12.699 7.701   9.260   1.00 49.81 ? 362  ASP B CB  1 
ATOM   3062 C CG  . ASP B 1 152 ? -13.751 6.807   8.625   1.00 51.00 ? 362  ASP B CG  1 
ATOM   3063 O OD1 . ASP B 1 152 ? -13.733 5.582   8.883   1.00 52.90 ? 362  ASP B OD1 1 
ATOM   3064 O OD2 . ASP B 1 152 ? -14.610 7.339   7.878   1.00 51.32 ? 362  ASP B OD2 1 
ATOM   3065 N N   . ILE B 1 153 ? -10.273 5.033   9.722   1.00 48.36 ? 363  ILE B N   1 
ATOM   3066 C CA  . ILE B 1 153 ? -9.821  4.010   10.664  1.00 47.88 ? 363  ILE B CA  1 
ATOM   3067 C C   . ILE B 1 153 ? -8.395  4.289   11.150  1.00 47.12 ? 363  ILE B C   1 
ATOM   3068 O O   . ILE B 1 153 ? -7.957  3.723   12.149  1.00 47.02 ? 363  ILE B O   1 
ATOM   3069 C CB  . ILE B 1 153 ? -9.930  2.561   10.089  1.00 48.07 ? 363  ILE B CB  1 
ATOM   3070 C CG1 . ILE B 1 153 ? -8.883  2.322   8.994   1.00 47.60 ? 363  ILE B CG1 1 
ATOM   3071 C CG2 . ILE B 1 153 ? -11.364 2.265   9.604   1.00 48.46 ? 363  ILE B CG2 1 
ATOM   3072 C CD1 . ILE B 1 153 ? -8.787  0.892   8.542   1.00 48.08 ? 363  ILE B CD1 1 
ATOM   3073 N N   . ILE B 1 154 ? -7.681  5.162   10.438  1.00 46.10 ? 364  ILE B N   1 
ATOM   3074 C CA  . ILE B 1 154 ? -6.296  5.494   10.786  1.00 45.16 ? 364  ILE B CA  1 
ATOM   3075 C C   . ILE B 1 154 ? -6.162  6.843   11.499  1.00 44.47 ? 364  ILE B C   1 
ATOM   3076 O O   . ILE B 1 154 ? -5.289  7.010   12.356  1.00 44.37 ? 364  ILE B O   1 
ATOM   3077 C CB  . ILE B 1 154 ? -5.330  5.446   9.556   1.00 45.23 ? 364  ILE B CB  1 
ATOM   3078 C CG1 . ILE B 1 154 ? -5.937  6.134   8.321   1.00 45.09 ? 364  ILE B CG1 1 
ATOM   3079 C CG2 . ILE B 1 154 ? -4.900  4.016   9.251   1.00 45.38 ? 364  ILE B CG2 1 
ATOM   3080 C CD1 . ILE B 1 154 ? -6.627  5.208   7.344   1.00 44.69 ? 364  ILE B CD1 1 
ATOM   3081 N N   . GLU B 1 155 ? -7.038  7.787   11.148  1.00 43.43 ? 365  GLU B N   1 
ATOM   3082 C CA  . GLU B 1 155 ? -6.983  9.165   11.652  1.00 42.73 ? 365  GLU B CA  1 
ATOM   3083 C C   . GLU B 1 155 ? -7.169  9.334   13.180  1.00 42.20 ? 365  GLU B C   1 
ATOM   3084 O O   . GLU B 1 155 ? -6.454  10.134  13.784  1.00 42.23 ? 365  GLU B O   1 
ATOM   3085 C CB  . GLU B 1 155 ? -7.931  10.079  10.846  1.00 42.66 ? 365  GLU B CB  1 
ATOM   3086 C CG  . GLU B 1 155 ? -8.089  11.532  11.345  1.00 42.65 ? 365  GLU B CG  1 
ATOM   3087 C CD  . GLU B 1 155 ? -6.799  12.348  11.346  1.00 42.90 ? 365  GLU B CD  1 
ATOM   3088 O OE1 . GLU B 1 155 ? -5.833  12.002  10.639  1.00 43.60 ? 365  GLU B OE1 1 
ATOM   3089 O OE2 . GLU B 1 155 ? -6.748  13.360  12.070  1.00 43.90 ? 365  GLU B OE2 1 
ATOM   3090 N N   . PRO B 1 156 ? -8.114  8.588   13.808  1.00 41.63 ? 366  PRO B N   1 
ATOM   3091 C CA  . PRO B 1 156 ? -8.206  8.666   15.271  1.00 41.23 ? 366  PRO B CA  1 
ATOM   3092 C C   . PRO B 1 156 ? -6.925  8.257   16.002  1.00 40.72 ? 366  PRO B C   1 
ATOM   3093 O O   . PRO B 1 156 ? -6.671  8.749   17.099  1.00 40.80 ? 366  PRO B O   1 
ATOM   3094 C CB  . PRO B 1 156 ? -9.347  7.696   15.609  1.00 41.06 ? 366  PRO B CB  1 
ATOM   3095 C CG  . PRO B 1 156 ? -10.153 7.622   14.369  1.00 41.00 ? 366  PRO B CG  1 
ATOM   3096 C CD  . PRO B 1 156 ? -9.148  7.688   13.264  1.00 41.49 ? 366  PRO B CD  1 
ATOM   3097 N N   . LYS B 1 157 ? -6.128  7.377   15.398  1.00 40.36 ? 367  LYS B N   1 
ATOM   3098 C CA  . LYS B 1 157 ? -4.871  6.939   16.014  1.00 40.17 ? 367  LYS B CA  1 
ATOM   3099 C C   . LYS B 1 157 ? -3.832  8.044   16.032  1.00 39.90 ? 367  LYS B C   1 
ATOM   3100 O O   . LYS B 1 157 ? -3.072  8.155   16.994  1.00 39.87 ? 367  LYS B O   1 
ATOM   3101 C CB  . LYS B 1 157 ? -4.320  5.676   15.354  1.00 40.24 ? 367  LYS B CB  1 
ATOM   3102 C CG  . LYS B 1 157 ? -5.082  4.395   15.723  1.00 41.19 ? 367  LYS B CG  1 
ATOM   3103 C CD  . LYS B 1 157 ? -6.475  4.369   15.099  1.00 41.90 ? 367  LYS B CD  1 
ATOM   3104 C CE  . LYS B 1 157 ? -7.090  2.980   15.139  1.00 42.41 ? 367  LYS B CE  1 
ATOM   3105 N NZ  . LYS B 1 157 ? -8.532  3.029   14.772  1.00 40.68 ? 367  LYS B NZ  1 
ATOM   3106 N N   . PHE B 1 158 ? -3.818  8.863   14.980  1.00 39.74 ? 368  PHE B N   1 
ATOM   3107 C CA  . PHE B 1 158 ? -3.008  10.075  14.943  1.00 39.77 ? 368  PHE B CA  1 
ATOM   3108 C C   . PHE B 1 158 ? -3.480  11.049  16.009  1.00 40.25 ? 368  PHE B C   1 
ATOM   3109 O O   . PHE B 1 158 ? -2.663  11.590  16.760  1.00 40.38 ? 368  PHE B O   1 
ATOM   3110 C CB  . PHE B 1 158 ? -3.061  10.754  13.566  1.00 39.71 ? 368  PHE B CB  1 
ATOM   3111 C CG  . PHE B 1 158 ? -1.984  10.304  12.614  1.00 38.85 ? 368  PHE B CG  1 
ATOM   3112 C CD1 . PHE B 1 158 ? -0.700  10.827  12.699  1.00 38.51 ? 368  PHE B CD1 1 
ATOM   3113 C CD2 . PHE B 1 158 ? -2.260  9.375   11.624  1.00 38.43 ? 368  PHE B CD2 1 
ATOM   3114 C CE1 . PHE B 1 158 ? 0.294   10.421  11.823  1.00 37.71 ? 368  PHE B CE1 1 
ATOM   3115 C CE2 . PHE B 1 158 ? -1.272  8.965   10.738  1.00 38.27 ? 368  PHE B CE2 1 
ATOM   3116 C CZ  . PHE B 1 158 ? 0.009   9.485   10.844  1.00 38.78 ? 368  PHE B CZ  1 
ATOM   3117 N N   . GLU B 1 159 ? -4.795  11.261  16.092  1.00 40.59 ? 369  GLU B N   1 
ATOM   3118 C CA  . GLU B 1 159 ? -5.331  12.203  17.081  1.00 41.10 ? 369  GLU B CA  1 
ATOM   3119 C C   . GLU B 1 159 ? -5.321  11.683  18.520  1.00 40.90 ? 369  GLU B C   1 
ATOM   3120 O O   . GLU B 1 159 ? -5.753  12.388  19.432  1.00 41.35 ? 369  GLU B O   1 
ATOM   3121 C CB  . GLU B 1 159 ? -6.686  12.811  16.667  1.00 41.02 ? 369  GLU B CB  1 
ATOM   3122 C CG  . GLU B 1 159 ? -7.901  11.890  16.682  1.00 42.11 ? 369  GLU B CG  1 
ATOM   3123 C CD  . GLU B 1 159 ? -9.045  12.403  15.793  1.00 42.24 ? 369  GLU B CD  1 
ATOM   3124 O OE1 . GLU B 1 159 ? -9.148  13.632  15.582  1.00 44.01 ? 369  GLU B OE1 1 
ATOM   3125 O OE2 . GLU B 1 159 ? -9.845  11.576  15.301  1.00 44.75 ? 369  GLU B OE2 1 
ATOM   3126 N N   . PHE B 1 160 ? -4.823  10.454  18.708  1.00 40.22 ? 370  PHE B N   1 
ATOM   3127 C CA  . PHE B 1 160 ? -4.426  9.961   20.030  1.00 39.46 ? 370  PHE B CA  1 
ATOM   3128 C C   . PHE B 1 160 ? -2.919  10.094  20.194  1.00 39.69 ? 370  PHE B C   1 
ATOM   3129 O O   . PHE B 1 160 ? -2.435  10.442  21.273  1.00 39.72 ? 370  PHE B O   1 
ATOM   3130 C CB  . PHE B 1 160 ? -4.811  8.492   20.237  1.00 38.97 ? 370  PHE B CB  1 
ATOM   3131 C CG  . PHE B 1 160 ? -4.144  7.861   21.437  1.00 38.37 ? 370  PHE B CG  1 
ATOM   3132 C CD1 . PHE B 1 160 ? -2.884  7.268   21.326  1.00 38.22 ? 370  PHE B CD1 1 
ATOM   3133 C CD2 . PHE B 1 160 ? -4.756  7.887   22.681  1.00 37.02 ? 370  PHE B CD2 1 
ATOM   3134 C CE1 . PHE B 1 160 ? -2.260  6.711   22.431  1.00 37.08 ? 370  PHE B CE1 1 
ATOM   3135 C CE2 . PHE B 1 160 ? -4.134  7.332   23.786  1.00 36.36 ? 370  PHE B CE2 1 
ATOM   3136 C CZ  . PHE B 1 160 ? -2.888  6.743   23.659  1.00 37.40 ? 370  PHE B CZ  1 
ATOM   3137 N N   . ALA B 1 161 ? -2.191  9.791   19.116  1.00 39.73 ? 371  ALA B N   1 
ATOM   3138 C CA  . ALA B 1 161 ? -0.728  9.735   19.112  1.00 39.90 ? 371  ALA B CA  1 
ATOM   3139 C C   . ALA B 1 161 ? -0.049  11.058  19.439  1.00 39.99 ? 371  ALA B C   1 
ATOM   3140 O O   . ALA B 1 161 ? 1.020   11.068  20.055  1.00 40.20 ? 371  ALA B O   1 
ATOM   3141 C CB  . ALA B 1 161 ? -0.215  9.198   17.767  1.00 39.73 ? 371  ALA B CB  1 
ATOM   3142 N N   . VAL B 1 162 ? -0.664  12.157  19.004  1.00 40.14 ? 372  VAL B N   1 
ATOM   3143 C CA  . VAL B 1 162 ? -0.110  13.502  19.194  1.00 40.48 ? 372  VAL B CA  1 
ATOM   3144 C C   . VAL B 1 162 ? -0.266  13.935  20.649  1.00 40.42 ? 372  VAL B C   1 
ATOM   3145 O O   . VAL B 1 162 ? 0.712   14.350  21.278  1.00 40.99 ? 372  VAL B O   1 
ATOM   3146 C CB  . VAL B 1 162 ? -0.738  14.541  18.214  1.00 40.51 ? 372  VAL B CB  1 
ATOM   3147 C CG1 . VAL B 1 162 ? -0.473  15.972  18.676  1.00 40.75 ? 372  VAL B CG1 1 
ATOM   3148 C CG2 . VAL B 1 162 ? -0.200  14.327  16.801  1.00 40.50 ? 372  VAL B CG2 1 
ATOM   3149 N N   . LYS B 1 163 ? -1.480  13.817  21.184  1.00 40.04 ? 373  LYS B N   1 
ATOM   3150 C CA  . LYS B 1 163 ? -1.715  14.048  22.609  1.00 39.95 ? 373  LYS B CA  1 
ATOM   3151 C C   . LYS B 1 163 ? -0.796  13.173  23.478  1.00 39.68 ? 373  LYS B C   1 
ATOM   3152 O O   . LYS B 1 163 ? -0.206  13.659  24.441  1.00 39.71 ? 373  LYS B O   1 
ATOM   3153 C CB  . LYS B 1 163 ? -3.187  13.820  22.966  1.00 40.02 ? 373  LYS B CB  1 
ATOM   3154 C CG  . LYS B 1 163 ? -4.158  14.687  22.172  1.00 39.68 ? 373  LYS B CG  1 
ATOM   3155 C CD  . LYS B 1 163 ? -5.608  14.332  22.484  1.00 40.26 ? 373  LYS B CD  1 
ATOM   3156 C CE  . LYS B 1 163 ? -6.561  14.826  21.396  1.00 41.42 ? 373  LYS B CE  1 
ATOM   3157 N NZ  . LYS B 1 163 ? -6.285  16.229  20.945  1.00 41.42 ? 373  LYS B NZ  1 
ATOM   3158 N N   . PHE B 1 164 ? -0.661  11.896  23.116  1.00 39.30 ? 374  PHE B N   1 
ATOM   3159 C CA  . PHE B 1 164 ? 0.186   10.954  23.851  1.00 38.83 ? 374  PHE B CA  1 
ATOM   3160 C C   . PHE B 1 164 ? 1.673   11.320  23.815  1.00 39.10 ? 374  PHE B C   1 
ATOM   3161 O O   . PHE B 1 164 ? 2.394   11.090  24.790  1.00 39.15 ? 374  PHE B O   1 
ATOM   3162 C CB  . PHE B 1 164 ? -0.019  9.524   23.339  1.00 38.43 ? 374  PHE B CB  1 
ATOM   3163 C CG  . PHE B 1 164 ? 0.579   8.465   24.227  1.00 37.41 ? 374  PHE B CG  1 
ATOM   3164 C CD1 . PHE B 1 164 ? -0.122  7.987   25.333  1.00 36.36 ? 374  PHE B CD1 1 
ATOM   3165 C CD2 . PHE B 1 164 ? 1.844   7.947   23.959  1.00 36.17 ? 374  PHE B CD2 1 
ATOM   3166 C CE1 . PHE B 1 164 ? 0.428   7.005   26.161  1.00 36.68 ? 374  PHE B CE1 1 
ATOM   3167 C CE2 . PHE B 1 164 ? 2.407   6.963   24.779  1.00 36.79 ? 374  PHE B CE2 1 
ATOM   3168 C CZ  . PHE B 1 164 ? 1.698   6.493   25.884  1.00 37.15 ? 374  PHE B CZ  1 
ATOM   3169 N N   . ASN B 1 165 ? 2.130   11.882  22.696  1.00 39.37 ? 375  ASN B N   1 
ATOM   3170 C CA  . ASN B 1 165 ? 3.522   12.324  22.577  1.00 39.49 ? 375  ASN B CA  1 
ATOM   3171 C C   . ASN B 1 165 ? 3.829   13.596  23.382  1.00 39.61 ? 375  ASN B C   1 
ATOM   3172 O O   . ASN B 1 165 ? 4.994   13.901  23.648  1.00 39.54 ? 375  ASN B O   1 
ATOM   3173 C CB  . ASN B 1 165 ? 3.930   12.482  21.103  1.00 39.72 ? 375  ASN B CB  1 
ATOM   3174 C CG  . ASN B 1 165 ? 4.276   11.142  20.431  1.00 40.30 ? 375  ASN B CG  1 
ATOM   3175 O OD1 . ASN B 1 165 ? 4.774   10.210  21.073  1.00 39.35 ? 375  ASN B OD1 1 
ATOM   3176 N ND2 . ASN B 1 165 ? 4.021   11.056  19.131  1.00 39.11 ? 375  ASN B ND2 1 
ATOM   3177 N N   . ALA B 1 166 ? 2.779   14.319  23.774  1.00 39.65 ? 376  ALA B N   1 
ATOM   3178 C CA  . ALA B 1 166 ? 2.906   15.496  24.638  1.00 40.14 ? 376  ALA B CA  1 
ATOM   3179 C C   . ALA B 1 166 ? 3.385   15.189  26.066  1.00 40.41 ? 376  ALA B C   1 
ATOM   3180 O O   . ALA B 1 166 ? 3.869   16.081  26.773  1.00 40.95 ? 376  ALA B O   1 
ATOM   3181 C CB  . ALA B 1 166 ? 1.591   16.265  24.682  1.00 39.96 ? 376  ALA B CB  1 
ATOM   3182 N N   . LEU B 1 167 ? 3.253   13.939  26.491  1.00 40.42 ? 377  LEU B N   1 
ATOM   3183 C CA  . LEU B 1 167 ? 3.664   13.540  27.836  1.00 40.51 ? 377  LEU B CA  1 
ATOM   3184 C C   . LEU B 1 167 ? 5.148   13.187  27.881  1.00 40.59 ? 377  LEU B C   1 
ATOM   3185 O O   . LEU B 1 167 ? 5.714   13.041  28.960  1.00 40.54 ? 377  LEU B O   1 
ATOM   3186 C CB  . LEU B 1 167 ? 2.824   12.356  28.332  1.00 40.67 ? 377  LEU B CB  1 
ATOM   3187 C CG  . LEU B 1 167 ? 1.301   12.405  28.158  1.00 41.06 ? 377  LEU B CG  1 
ATOM   3188 C CD1 . LEU B 1 167 ? 0.719   11.007  28.276  1.00 42.73 ? 377  LEU B CD1 1 
ATOM   3189 C CD2 . LEU B 1 167 ? 0.629   13.355  29.148  1.00 42.20 ? 377  LEU B CD2 1 
ATOM   3190 N N   . GLU B 1 168 ? 5.761   13.025  26.705  1.00 40.66 ? 378  GLU B N   1 
ATOM   3191 C CA  . GLU B 1 168 ? 7.218   12.861  26.559  1.00 40.87 ? 378  GLU B CA  1 
ATOM   3192 C C   . GLU B 1 168 ? 7.812   11.724  27.382  1.00 40.59 ? 378  GLU B C   1 
ATOM   3193 O O   . GLU B 1 168 ? 8.575   11.951  28.324  1.00 41.21 ? 378  GLU B O   1 
ATOM   3194 C CB  . GLU B 1 168 ? 7.958   14.181  26.856  1.00 40.97 ? 378  GLU B CB  1 
ATOM   3195 C CG  . GLU B 1 168 ? 7.582   15.339  25.932  1.00 41.09 ? 378  GLU B CG  1 
ATOM   3196 C CD  . GLU B 1 168 ? 8.299   16.634  26.268  1.00 41.81 ? 378  GLU B CD  1 
ATOM   3197 O OE1 . GLU B 1 168 ? 8.322   17.040  27.459  1.00 43.29 ? 378  GLU B OE1 1 
ATOM   3198 O OE2 . GLU B 1 168 ? 8.825   17.264  25.329  1.00 43.63 ? 378  GLU B OE2 1 
ATOM   3199 N N   . LEU B 1 169 ? 7.463   10.497  27.020  1.00 40.05 ? 379  LEU B N   1 
ATOM   3200 C CA  . LEU B 1 169 ? 8.050   9.319   27.651  1.00 39.41 ? 379  LEU B CA  1 
ATOM   3201 C C   . LEU B 1 169 ? 9.229   8.810   26.814  1.00 38.99 ? 379  LEU B C   1 
ATOM   3202 O O   . LEU B 1 169 ? 9.334   9.134   25.632  1.00 39.27 ? 379  LEU B O   1 
ATOM   3203 C CB  . LEU B 1 169 ? 6.973   8.239   27.833  1.00 39.29 ? 379  LEU B CB  1 
ATOM   3204 C CG  . LEU B 1 169 ? 5.718   8.731   28.576  1.00 39.10 ? 379  LEU B CG  1 
ATOM   3205 C CD1 . LEU B 1 169 ? 4.506   7.889   28.262  1.00 38.77 ? 379  LEU B CD1 1 
ATOM   3206 C CD2 . LEU B 1 169 ? 5.953   8.801   30.074  1.00 38.53 ? 379  LEU B CD2 1 
ATOM   3207 N N   . ASP B 1 170 ? 10.130  8.046   27.422  1.00 38.57 ? 380  ASP B N   1 
ATOM   3208 C CA  . ASP B 1 170 ? 11.169  7.347   26.652  1.00 38.49 ? 380  ASP B CA  1 
ATOM   3209 C C   . ASP B 1 170 ? 10.875  5.852   26.600  1.00 37.88 ? 380  ASP B C   1 
ATOM   3210 O O   . ASP B 1 170 ? 9.854   5.410   27.120  1.00 38.37 ? 380  ASP B O   1 
ATOM   3211 C CB  . ASP B 1 170 ? 12.592  7.651   27.171  1.00 38.61 ? 380  ASP B CB  1 
ATOM   3212 C CG  . ASP B 1 170 ? 12.827  7.182   28.598  1.00 39.15 ? 380  ASP B CG  1 
ATOM   3213 O OD1 . ASP B 1 170 ? 12.112  6.278   29.077  1.00 40.44 ? 380  ASP B OD1 1 
ATOM   3214 O OD2 . ASP B 1 170 ? 13.748  7.719   29.246  1.00 39.03 ? 380  ASP B OD2 1 
ATOM   3215 N N   . ASP B 1 171 ? 11.761  5.080   25.979  1.00 37.34 ? 381  ASP B N   1 
ATOM   3216 C CA  . ASP B 1 171 ? 11.571  3.632   25.828  1.00 36.93 ? 381  ASP B CA  1 
ATOM   3217 C C   . ASP B 1 171 ? 11.410  2.877   27.150  1.00 36.52 ? 381  ASP B C   1 
ATOM   3218 O O   . ASP B 1 171 ? 10.631  1.918   27.228  1.00 36.64 ? 381  ASP B O   1 
ATOM   3219 C CB  . ASP B 1 171 ? 12.703  3.025   25.002  1.00 36.96 ? 381  ASP B CB  1 
ATOM   3220 C CG  . ASP B 1 171 ? 12.544  3.294   23.515  1.00 37.94 ? 381  ASP B CG  1 
ATOM   3221 O OD1 . ASP B 1 171 ? 11.608  2.748   22.897  1.00 37.29 ? 381  ASP B OD1 1 
ATOM   3222 O OD2 . ASP B 1 171 ? 13.361  4.054   22.961  1.00 39.74 ? 381  ASP B OD2 1 
ATOM   3223 N N   . SER B 1 172 ? 12.147  3.314   28.174  1.00 35.95 ? 382  SER B N   1 
ATOM   3224 C CA  . SER B 1 172 ? 12.081  2.728   29.515  1.00 35.17 ? 382  SER B CA  1 
ATOM   3225 C C   . SER B 1 172 ? 10.689  2.872   30.126  1.00 34.76 ? 382  SER B C   1 
ATOM   3226 O O   . SER B 1 172 ? 10.167  1.915   30.690  1.00 34.80 ? 382  SER B O   1 
ATOM   3227 C CB  . SER B 1 172 ? 13.139  3.348   30.435  1.00 35.31 ? 382  SER B CB  1 
ATOM   3228 O OG  . SER B 1 172 ? 12.841  4.708   30.727  1.00 35.30 ? 382  SER B OG  1 
ATOM   3229 N N   . ASP B 1 173 ? 10.101  4.062   29.994  1.00 34.18 ? 383  ASP B N   1 
ATOM   3230 C CA  . ASP B 1 173 ? 8.732   4.331   30.440  1.00 34.23 ? 383  ASP B CA  1 
ATOM   3231 C C   . ASP B 1 173 ? 7.730   3.447   29.704  1.00 33.67 ? 383  ASP B C   1 
ATOM   3232 O O   . ASP B 1 173 ? 6.996   2.669   30.325  1.00 33.92 ? 383  ASP B O   1 
ATOM   3233 C CB  . ASP B 1 173 ? 8.355   5.809   30.232  1.00 34.39 ? 383  ASP B CB  1 
ATOM   3234 C CG  . ASP B 1 173 ? 9.398   6.777   30.782  1.00 35.61 ? 383  ASP B CG  1 
ATOM   3235 O OD1 . ASP B 1 173 ? 9.975   6.506   31.865  1.00 36.34 ? 383  ASP B OD1 1 
ATOM   3236 O OD2 . ASP B 1 173 ? 9.636   7.822   30.130  1.00 36.26 ? 383  ASP B OD2 1 
ATOM   3237 N N   . LEU B 1 174 ? 7.721   3.573   28.378  1.00 33.06 ? 384  LEU B N   1 
ATOM   3238 C CA  . LEU B 1 174 ? 6.883   2.759   27.494  1.00 32.18 ? 384  LEU B CA  1 
ATOM   3239 C C   . LEU B 1 174 ? 6.895   1.273   27.809  1.00 31.22 ? 384  LEU B C   1 
ATOM   3240 O O   . LEU B 1 174 ? 5.869   0.623   27.681  1.00 31.37 ? 384  LEU B O   1 
ATOM   3241 C CB  . LEU B 1 174 ? 7.288   2.962   26.032  1.00 32.21 ? 384  LEU B CB  1 
ATOM   3242 C CG  . LEU B 1 174 ? 6.410   3.759   25.060  1.00 32.91 ? 384  LEU B CG  1 
ATOM   3243 C CD1 . LEU B 1 174 ? 5.641   4.901   25.727  1.00 31.54 ? 384  LEU B CD1 1 
ATOM   3244 C CD2 . LEU B 1 174 ? 7.275   4.257   23.899  1.00 31.61 ? 384  LEU B CD2 1 
ATOM   3245 N N   . ALA B 1 175 ? 8.045   0.750   28.230  1.00 30.20 ? 385  ALA B N   1 
ATOM   3246 C CA  . ALA B 1 175 ? 8.196   -0.687  28.456  1.00 29.52 ? 385  ALA B CA  1 
ATOM   3247 C C   . ALA B 1 175 ? 7.312   -1.169  29.596  1.00 28.89 ? 385  ALA B C   1 
ATOM   3248 O O   . ALA B 1 175 ? 6.689   -2.227  29.504  1.00 28.78 ? 385  ALA B O   1 
ATOM   3249 C CB  . ALA B 1 175 ? 9.684   -1.059  28.710  1.00 29.56 ? 385  ALA B CB  1 
ATOM   3250 N N   . LEU B 1 176 ? 7.268   -0.382  30.667  1.00 28.43 ? 386  LEU B N   1 
ATOM   3251 C CA  . LEU B 1 176 ? 6.372   -0.652  31.787  1.00 28.11 ? 386  LEU B CA  1 
ATOM   3252 C C   . LEU B 1 176 ? 4.910   -0.371  31.412  1.00 27.74 ? 386  LEU B C   1 
ATOM   3253 O O   . LEU B 1 176 ? 4.007   -1.074  31.867  1.00 27.89 ? 386  LEU B O   1 
ATOM   3254 C CB  . LEU B 1 176 ? 6.793   0.167   33.016  1.00 27.91 ? 386  LEU B CB  1 
ATOM   3255 C CG  . LEU B 1 176 ? 8.268   0.045   33.458  1.00 28.77 ? 386  LEU B CG  1 
ATOM   3256 C CD1 . LEU B 1 176 ? 8.625   1.111   34.486  1.00 27.25 ? 386  LEU B CD1 1 
ATOM   3257 C CD2 . LEU B 1 176 ? 8.623   -1.350  33.988  1.00 27.34 ? 386  LEU B CD2 1 
ATOM   3258 N N   . PHE B 1 177 ? 4.687   0.644   30.578  1.00 27.17 ? 387  PHE B N   1 
ATOM   3259 C CA  . PHE B 1 177 ? 3.334   1.068   30.192  1.00 26.92 ? 387  PHE B CA  1 
ATOM   3260 C C   . PHE B 1 177 ? 2.633   0.001   29.332  1.00 26.91 ? 387  PHE B C   1 
ATOM   3261 O O   . PHE B 1 177 ? 1.441   -0.303  29.538  1.00 26.99 ? 387  PHE B O   1 
ATOM   3262 C CB  . PHE B 1 177 ? 3.405   2.411   29.460  1.00 26.97 ? 387  PHE B CB  1 
ATOM   3263 C CG  . PHE B 1 177 ? 2.070   3.022   29.163  1.00 27.19 ? 387  PHE B CG  1 
ATOM   3264 C CD1 . PHE B 1 177 ? 1.284   3.555   30.187  1.00 28.29 ? 387  PHE B CD1 1 
ATOM   3265 C CD2 . PHE B 1 177 ? 1.599   3.089   27.856  1.00 26.94 ? 387  PHE B CD2 1 
ATOM   3266 C CE1 . PHE B 1 177 ? 0.037   4.132   29.904  1.00 27.14 ? 387  PHE B CE1 1 
ATOM   3267 C CE2 . PHE B 1 177 ? 0.359   3.669   27.564  1.00 26.43 ? 387  PHE B CE2 1 
ATOM   3268 C CZ  . PHE B 1 177 ? -0.418  4.194   28.589  1.00 26.98 ? 387  PHE B CZ  1 
ATOM   3269 N N   . ILE B 1 178 ? 3.393   -0.569  28.393  1.00 26.38 ? 388  ILE B N   1 
ATOM   3270 C CA  . ILE B 1 178 ? 2.947   -1.679  27.547  1.00 25.98 ? 388  ILE B CA  1 
ATOM   3271 C C   . ILE B 1 178 ? 2.709   -2.948  28.366  1.00 25.40 ? 388  ILE B C   1 
ATOM   3272 O O   . ILE B 1 178 ? 1.714   -3.640  28.154  1.00 25.45 ? 388  ILE B O   1 
ATOM   3273 C CB  . ILE B 1 178 ? 3.974   -1.972  26.386  1.00 26.36 ? 388  ILE B CB  1 
ATOM   3274 C CG1 . ILE B 1 178 ? 4.082   -0.786  25.402  1.00 26.87 ? 388  ILE B CG1 1 
ATOM   3275 C CG2 . ILE B 1 178 ? 3.641   -3.260  25.645  1.00 26.56 ? 388  ILE B CG2 1 
ATOM   3276 C CD1 . ILE B 1 178 ? 2.742   -0.133  25.008  1.00 27.84 ? 388  ILE B CD1 1 
ATOM   3277 N N   . ALA B 1 179 ? 3.621   -3.260  29.288  1.00 24.65 ? 389  ALA B N   1 
ATOM   3278 C CA  . ALA B 1 179 ? 3.482   -4.446  30.122  1.00 24.26 ? 389  ALA B CA  1 
ATOM   3279 C C   . ALA B 1 179 ? 2.230   -4.359  31.003  1.00 24.45 ? 389  ALA B C   1 
ATOM   3280 O O   . ALA B 1 179 ? 1.496   -5.346  31.157  1.00 24.06 ? 389  ALA B O   1 
ATOM   3281 C CB  . ALA B 1 179 ? 4.718   -4.648  30.961  1.00 24.55 ? 389  ALA B CB  1 
ATOM   3282 N N   . ALA B 1 180 ? 1.974   -3.173  31.557  1.00 24.37 ? 390  ALA B N   1 
ATOM   3283 C CA  . ALA B 1 180 ? 0.743   -2.923  32.324  1.00 24.79 ? 390  ALA B CA  1 
ATOM   3284 C C   . ALA B 1 180 ? -0.522  -3.152  31.496  1.00 25.08 ? 390  ALA B C   1 
ATOM   3285 O O   . ALA B 1 180 ? -1.474  -3.777  31.984  1.00 25.48 ? 390  ALA B O   1 
ATOM   3286 C CB  . ALA B 1 180 ? 0.747   -1.525  32.918  1.00 24.72 ? 390  ALA B CB  1 
ATOM   3287 N N   . ILE B 1 181 ? -0.522  -2.662  30.254  1.00 25.42 ? 391  ILE B N   1 
ATOM   3288 C CA  . ILE B 1 181 ? -1.623  -2.891  29.292  1.00 26.06 ? 391  ILE B CA  1 
ATOM   3289 C C   . ILE B 1 181 ? -1.990  -4.372  29.064  1.00 26.36 ? 391  ILE B C   1 
ATOM   3290 O O   . ILE B 1 181 ? -3.175  -4.722  28.967  1.00 25.72 ? 391  ILE B O   1 
ATOM   3291 C CB  . ILE B 1 181 ? -1.336  -2.206  27.921  1.00 25.72 ? 391  ILE B CB  1 
ATOM   3292 C CG1 . ILE B 1 181 ? -1.708  -0.720  27.975  1.00 25.89 ? 391  ILE B CG1 1 
ATOM   3293 C CG2 . ILE B 1 181 ? -2.087  -2.898  26.766  1.00 25.21 ? 391  ILE B CG2 1 
ATOM   3294 C CD1 . ILE B 1 181 ? -1.326  0.054   26.700  1.00 26.79 ? 391  ILE B CD1 1 
ATOM   3295 N N   . ILE B 1 182 ? -0.982  -5.233  28.962  1.00 27.11 ? 392  ILE B N   1 
ATOM   3296 C CA  . ILE B 1 182 ? -1.242  -6.637  28.670  1.00 28.15 ? 392  ILE B CA  1 
ATOM   3297 C C   . ILE B 1 182 ? -1.704  -7.392  29.923  1.00 29.08 ? 392  ILE B C   1 
ATOM   3298 O O   . ILE B 1 182 ? -2.637  -8.199  29.853  1.00 29.20 ? 392  ILE B O   1 
ATOM   3299 C CB  . ILE B 1 182 ? -0.054  -7.310  27.970  1.00 28.02 ? 392  ILE B CB  1 
ATOM   3300 C CG1 . ILE B 1 182 ? 0.234   -6.581  26.654  1.00 28.55 ? 392  ILE B CG1 1 
ATOM   3301 C CG2 . ILE B 1 182 ? -0.356  -8.791  27.703  1.00 27.60 ? 392  ILE B CG2 1 
ATOM   3302 C CD1 . ILE B 1 182 ? 1.575   -6.921  26.024  1.00 30.88 ? 392  ILE B CD1 1 
ATOM   3303 N N   . LEU B 1 183 ? -1.074  -7.101  31.061  1.00 30.37 ? 393  LEU B N   1 
ATOM   3304 C CA  . LEU B 1 183 ? -1.422  -7.728  32.339  1.00 31.56 ? 393  LEU B CA  1 
ATOM   3305 C C   . LEU B 1 183 ? -2.641  -7.043  32.933  1.00 32.46 ? 393  LEU B C   1 
ATOM   3306 O O   . LEU B 1 183 ? -2.545  -6.289  33.902  1.00 32.72 ? 393  LEU B O   1 
ATOM   3307 C CB  . LEU B 1 183 ? -0.245  -7.644  33.325  1.00 31.73 ? 393  LEU B CB  1 
ATOM   3308 C CG  . LEU B 1 183 ? 0.884   -8.667  33.197  1.00 31.58 ? 393  LEU B CG  1 
ATOM   3309 C CD1 . LEU B 1 183 ? 0.355   -10.102 33.366  1.00 32.37 ? 393  LEU B CD1 1 
ATOM   3310 C CD2 . LEU B 1 183 ? 1.634   -8.506  31.891  1.00 31.93 ? 393  LEU B CD2 1 
ATOM   3311 N N   . CYS B 1 184 ? -3.793  -7.304  32.343  1.00 33.50 ? 394  CYS B N   1 
ATOM   3312 C CA  . CYS B 1 184 ? -4.984  -6.588  32.719  1.00 33.98 ? 394  CYS B CA  1 
ATOM   3313 C C   . CYS B 1 184 ? -6.027  -7.565  33.240  1.00 34.05 ? 394  CYS B C   1 
ATOM   3314 O O   . CYS B 1 184 ? -6.576  -8.368  32.485  1.00 33.77 ? 394  CYS B O   1 
ATOM   3315 C CB  . CYS B 1 184 ? -5.491  -5.796  31.519  1.00 34.34 ? 394  CYS B CB  1 
ATOM   3316 S SG  . CYS B 1 184 ? -7.050  -5.015  31.796  1.00 35.28 ? 394  CYS B SG  1 
ATOM   3317 N N   . GLY B 1 185 ? -6.297  -7.478  34.540  1.00 34.33 ? 395  GLY B N   1 
ATOM   3318 C CA  . GLY B 1 185 ? -7.087  -8.481  35.252  1.00 34.59 ? 395  GLY B CA  1 
ATOM   3319 C C   . GLY B 1 185 ? -8.552  -8.508  34.890  1.00 34.87 ? 395  GLY B C   1 
ATOM   3320 O O   . GLY B 1 185 ? -9.291  -9.388  35.327  1.00 35.03 ? 395  GLY B O   1 
ATOM   3321 N N   . ASP B 1 186 ? -8.959  -7.560  34.060  1.00 35.14 ? 396  ASP B N   1 
ATOM   3322 C CA  . ASP B 1 186 ? -10.359 -7.324  33.776  1.00 35.80 ? 396  ASP B CA  1 
ATOM   3323 C C   . ASP B 1 186 ? -10.826 -7.797  32.392  1.00 35.15 ? 396  ASP B C   1 
ATOM   3324 O O   . ASP B 1 186 ? -11.926 -7.446  31.960  1.00 35.68 ? 396  ASP B O   1 
ATOM   3325 C CB  . ASP B 1 186 ? -10.642 -5.824  33.969  1.00 36.65 ? 396  ASP B CB  1 
ATOM   3326 C CG  . ASP B 1 186 ? -12.063 -5.446  33.637  1.00 38.70 ? 396  ASP B CG  1 
ATOM   3327 O OD1 . ASP B 1 186 ? -12.242 -4.356  33.047  1.00 41.40 ? 396  ASP B OD1 1 
ATOM   3328 O OD2 . ASP B 1 186 ? -12.989 -6.236  33.948  1.00 40.28 ? 396  ASP B OD2 1 
ATOM   3329 N N   . ARG B 1 187 ? -10.017 -8.593  31.699  1.00 34.13 ? 397  ARG B N   1 
ATOM   3330 C CA  . ARG B 1 187 ? -10.410 -9.080  30.366  1.00 33.21 ? 397  ARG B CA  1 
ATOM   3331 C C   . ARG B 1 187 ? -11.455 -10.204 30.470  1.00 33.20 ? 397  ARG B C   1 
ATOM   3332 O O   . ARG B 1 187 ? -11.388 -11.023 31.386  1.00 33.37 ? 397  ARG B O   1 
ATOM   3333 C CB  . ARG B 1 187 ? -9.195  -9.544  29.544  1.00 32.32 ? 397  ARG B CB  1 
ATOM   3334 C CG  . ARG B 1 187 ? -8.021  -8.577  29.508  1.00 31.04 ? 397  ARG B CG  1 
ATOM   3335 C CD  . ARG B 1 187 ? -8.318  -7.228  28.826  1.00 28.44 ? 397  ARG B CD  1 
ATOM   3336 N NE  . ARG B 1 187 ? -7.071  -6.498  28.569  1.00 26.97 ? 397  ARG B NE  1 
ATOM   3337 C CZ  . ARG B 1 187 ? -6.981  -5.271  28.053  1.00 27.02 ? 397  ARG B CZ  1 
ATOM   3338 N NH1 . ARG B 1 187 ? -8.074  -4.581  27.720  1.00 26.03 ? 397  ARG B NH1 1 
ATOM   3339 N NH2 . ARG B 1 187 ? -5.783  -4.726  27.869  1.00 24.87 ? 397  ARG B NH2 1 
ATOM   3340 N N   . PRO B 1 188 ? -12.429 -10.235 29.537  1.00 33.05 ? 398  PRO B N   1 
ATOM   3341 C CA  . PRO B 1 188 ? -13.475 -11.261 29.520  1.00 32.82 ? 398  PRO B CA  1 
ATOM   3342 C C   . PRO B 1 188 ? -12.916 -12.675 29.369  1.00 32.95 ? 398  PRO B C   1 
ATOM   3343 O O   . PRO B 1 188 ? -12.071 -12.923 28.508  1.00 32.80 ? 398  PRO B O   1 
ATOM   3344 C CB  . PRO B 1 188 ? -14.305 -10.886 28.289  1.00 32.75 ? 398  PRO B CB  1 
ATOM   3345 C CG  . PRO B 1 188 ? -14.060 -9.424  28.113  1.00 32.93 ? 398  PRO B CG  1 
ATOM   3346 C CD  . PRO B 1 188 ? -12.615 -9.266  28.441  1.00 32.92 ? 398  PRO B CD  1 
ATOM   3347 N N   . GLY B 1 189 ? -13.375 -13.589 30.220  1.00 32.80 ? 399  GLY B N   1 
ATOM   3348 C CA  . GLY B 1 189 ? -12.992 -14.985 30.108  1.00 32.48 ? 399  GLY B CA  1 
ATOM   3349 C C   . GLY B 1 189 ? -11.733 -15.368 30.851  1.00 32.67 ? 399  GLY B C   1 
ATOM   3350 O O   . GLY B 1 189 ? -11.302 -16.519 30.765  1.00 32.93 ? 399  GLY B O   1 
ATOM   3351 N N   . LEU B 1 190 ? -11.142 -14.426 31.587  1.00 32.64 ? 400  LEU B N   1 
ATOM   3352 C CA  . LEU B 1 190 ? -9.947  -14.720 32.389  1.00 33.06 ? 400  LEU B CA  1 
ATOM   3353 C C   . LEU B 1 190 ? -10.217 -15.788 33.426  1.00 33.36 ? 400  LEU B C   1 
ATOM   3354 O O   . LEU B 1 190 ? -11.152 -15.687 34.214  1.00 33.53 ? 400  LEU B O   1 
ATOM   3355 C CB  . LEU B 1 190 ? -9.394  -13.475 33.093  1.00 33.05 ? 400  LEU B CB  1 
ATOM   3356 C CG  . LEU B 1 190 ? -8.170  -12.752 32.535  1.00 33.10 ? 400  LEU B CG  1 
ATOM   3357 C CD1 . LEU B 1 190 ? -7.812  -11.624 33.473  1.00 32.25 ? 400  LEU B CD1 1 
ATOM   3358 C CD2 . LEU B 1 190 ? -6.965  -13.675 32.337  1.00 32.64 ? 400  LEU B CD2 1 
ATOM   3359 N N   . MET B 1 191 ? -9.379  -16.810 33.420  1.00 33.86 ? 401  MET B N   1 
ATOM   3360 C CA  . MET B 1 191 ? -9.495  -17.900 34.372  1.00 34.70 ? 401  MET B CA  1 
ATOM   3361 C C   . MET B 1 191 ? -8.931  -17.482 35.734  1.00 34.35 ? 401  MET B C   1 
ATOM   3362 O O   . MET B 1 191 ? -9.617  -17.569 36.755  1.00 34.51 ? 401  MET B O   1 
ATOM   3363 C CB  . MET B 1 191 ? -8.770  -19.132 33.828  1.00 34.41 ? 401  MET B CB  1 
ATOM   3364 C CG  . MET B 1 191 ? -9.100  -20.442 34.522  1.00 35.46 ? 401  MET B CG  1 
ATOM   3365 S SD  . MET B 1 191 ? -8.232  -21.837 33.752  1.00 36.66 ? 401  MET B SD  1 
ATOM   3366 C CE  . MET B 1 191 ? -6.510  -21.336 33.846  1.00 36.36 ? 401  MET B CE  1 
ATOM   3367 N N   . ASN B 1 192 ? -7.682  -17.027 35.740  1.00 33.76 ? 402  ASN B N   1 
ATOM   3368 C CA  . ASN B 1 192 ? -7.012  -16.685 36.979  1.00 33.44 ? 402  ASN B CA  1 
ATOM   3369 C C   . ASN B 1 192 ? -6.847  -15.166 37.164  1.00 32.89 ? 402  ASN B C   1 
ATOM   3370 O O   . ASN B 1 192 ? -5.738  -14.618 37.101  1.00 32.46 ? 402  ASN B O   1 
ATOM   3371 C CB  . ASN B 1 192 ? -5.673  -17.425 37.066  1.00 33.36 ? 402  ASN B CB  1 
ATOM   3372 C CG  . ASN B 1 192 ? -5.151  -17.532 38.484  1.00 33.76 ? 402  ASN B CG  1 
ATOM   3373 O OD1 . ASN B 1 192 ? -4.334  -18.402 38.777  1.00 35.89 ? 402  ASN B OD1 1 
ATOM   3374 N ND2 . ASN B 1 192 ? -5.606  -16.650 39.370  1.00 32.48 ? 402  ASN B ND2 1 
ATOM   3375 N N   . VAL B 1 193 ? -7.975  -14.508 37.401  1.00 32.47 ? 403  VAL B N   1 
ATOM   3376 C CA  . VAL B 1 193 ? -8.024  -13.071 37.641  1.00 32.63 ? 403  VAL B CA  1 
ATOM   3377 C C   . VAL B 1 193 ? -7.126  -12.597 38.800  1.00 32.79 ? 403  VAL B C   1 
ATOM   3378 O O   . VAL B 1 193 ? -6.344  -11.667 38.607  1.00 32.82 ? 403  VAL B O   1 
ATOM   3379 C CB  . VAL B 1 193 ? -9.485  -12.573 37.837  1.00 32.72 ? 403  VAL B CB  1 
ATOM   3380 C CG1 . VAL B 1 193 ? -9.508  -11.112 38.254  1.00 32.71 ? 403  VAL B CG1 1 
ATOM   3381 C CG2 . VAL B 1 193 ? -10.305 -12.779 36.560  1.00 31.62 ? 403  VAL B CG2 1 
ATOM   3382 N N   . PRO B 1 194 ? -7.215  -13.235 39.994  1.00 32.85 ? 404  PRO B N   1 
ATOM   3383 C CA  . PRO B 1 194 ? -6.444  -12.665 41.106  1.00 33.02 ? 404  PRO B CA  1 
ATOM   3384 C C   . PRO B 1 194 ? -4.941  -12.650 40.839  1.00 33.05 ? 404  PRO B C   1 
ATOM   3385 O O   . PRO B 1 194 ? -4.251  -11.714 41.273  1.00 33.10 ? 404  PRO B O   1 
ATOM   3386 C CB  . PRO B 1 194 ? -6.778  -13.587 42.294  1.00 33.09 ? 404  PRO B CB  1 
ATOM   3387 C CG  . PRO B 1 194 ? -8.081  -14.226 41.929  1.00 33.25 ? 404  PRO B CG  1 
ATOM   3388 C CD  . PRO B 1 194 ? -7.966  -14.429 40.426  1.00 32.95 ? 404  PRO B CD  1 
ATOM   3389 N N   . ARG B 1 195 ? -4.442  -13.659 40.121  1.00 32.46 ? 405  ARG B N   1 
ATOM   3390 C CA  . ARG B 1 195 ? -3.027  -13.701 39.773  1.00 32.32 ? 405  ARG B CA  1 
ATOM   3391 C C   . ARG B 1 195 ? -2.653  -12.583 38.785  1.00 31.41 ? 405  ARG B C   1 
ATOM   3392 O O   . ARG B 1 195 ? -1.617  -11.945 38.951  1.00 31.47 ? 405  ARG B O   1 
ATOM   3393 C CB  . ARG B 1 195 ? -2.628  -15.076 39.220  1.00 32.95 ? 405  ARG B CB  1 
ATOM   3394 C CG  . ARG B 1 195 ? -1.133  -15.225 38.962  1.00 35.42 ? 405  ARG B CG  1 
ATOM   3395 C CD  . ARG B 1 195 ? -0.398  -15.844 40.137  1.00 40.70 ? 405  ARG B CD  1 
ATOM   3396 N NE  . ARG B 1 195 ? -0.220  -17.289 39.958  1.00 45.15 ? 405  ARG B NE  1 
ATOM   3397 C CZ  . ARG B 1 195 ? 0.759   -17.844 39.239  1.00 47.08 ? 405  ARG B CZ  1 
ATOM   3398 N NH1 . ARG B 1 195 ? 1.658   -17.079 38.618  1.00 47.93 ? 405  ARG B NH1 1 
ATOM   3399 N NH2 . ARG B 1 195 ? 0.845   -19.166 39.138  1.00 47.40 ? 405  ARG B NH2 1 
ATOM   3400 N N   . VAL B 1 196 ? -3.493  -12.355 37.772  1.00 30.41 ? 406  VAL B N   1 
ATOM   3401 C CA  . VAL B 1 196 ? -3.270  -11.284 36.795  1.00 29.48 ? 406  VAL B CA  1 
ATOM   3402 C C   . VAL B 1 196 ? -3.270  -9.908  37.490  1.00 29.49 ? 406  VAL B C   1 
ATOM   3403 O O   . VAL B 1 196 ? -2.335  -9.135  37.317  1.00 28.62 ? 406  VAL B O   1 
ATOM   3404 C CB  . VAL B 1 196 ? -4.277  -11.325 35.584  1.00 29.44 ? 406  VAL B CB  1 
ATOM   3405 C CG1 . VAL B 1 196 ? -3.985  -10.214 34.579  1.00 28.54 ? 406  VAL B CG1 1 
ATOM   3406 C CG2 . VAL B 1 196 ? -4.222  -12.655 34.866  1.00 29.17 ? 406  VAL B CG2 1 
ATOM   3407 N N   . GLU B 1 197 ? -4.291  -9.616  38.294  1.00 29.58 ? 407  GLU B N   1 
ATOM   3408 C CA  . GLU B 1 197 ? -4.289  -8.377  39.084  1.00 30.60 ? 407  GLU B CA  1 
ATOM   3409 C C   . GLU B 1 197 ? -3.004  -8.209  39.900  1.00 30.44 ? 407  GLU B C   1 
ATOM   3410 O O   . GLU B 1 197 ? -2.443  -7.119  39.948  1.00 30.26 ? 407  GLU B O   1 
ATOM   3411 C CB  . GLU B 1 197 ? -5.473  -8.312  40.043  1.00 30.95 ? 407  GLU B CB  1 
ATOM   3412 C CG  . GLU B 1 197 ? -6.840  -8.298  39.403  1.00 32.66 ? 407  GLU B CG  1 
ATOM   3413 C CD  . GLU B 1 197 ? -7.913  -8.638  40.415  1.00 35.86 ? 407  GLU B CD  1 
ATOM   3414 O OE1 . GLU B 1 197 ? -7.660  -9.530  41.262  1.00 37.62 ? 407  GLU B OE1 1 
ATOM   3415 O OE2 . GLU B 1 197 ? -8.999  -8.023  40.368  1.00 36.64 ? 407  GLU B OE2 1 
ATOM   3416 N N   . ALA B 1 198 ? -2.551  -9.288  40.538  1.00 30.60 ? 408  ALA B N   1 
ATOM   3417 C CA  . ALA B 1 198 ? -1.333  -9.250  41.361  1.00 30.88 ? 408  ALA B CA  1 
ATOM   3418 C C   . ALA B 1 198 ? -0.099  -8.860  40.550  1.00 30.79 ? 408  ALA B C   1 
ATOM   3419 O O   . ALA B 1 198 ? 0.675   -8.002  40.969  1.00 30.62 ? 408  ALA B O   1 
ATOM   3420 C CB  . ALA B 1 198 ? -1.105  -10.596 42.076  1.00 30.66 ? 408  ALA B CB  1 
ATOM   3421 N N   . ILE B 1 199 ? 0.084   -9.500  39.396  1.00 30.94 ? 409  ILE B N   1 
ATOM   3422 C CA  . ILE B 1 199 ? 1.172   -9.126  38.494  1.00 31.02 ? 409  ILE B CA  1 
ATOM   3423 C C   . ILE B 1 199 ? 1.013   -7.666  38.029  1.00 31.17 ? 409  ILE B C   1 
ATOM   3424 O O   . ILE B 1 199 ? 1.989   -6.904  38.032  1.00 31.18 ? 409  ILE B O   1 
ATOM   3425 C CB  . ILE B 1 199 ? 1.273   -10.066 37.262  1.00 31.15 ? 409  ILE B CB  1 
ATOM   3426 C CG1 . ILE B 1 199 ? 1.330   -11.537 37.693  1.00 30.91 ? 409  ILE B CG1 1 
ATOM   3427 C CG2 . ILE B 1 199 ? 2.487   -9.679  36.399  1.00 30.90 ? 409  ILE B CG2 1 
ATOM   3428 C CD1 . ILE B 1 199 ? 1.023   -12.534 36.570  1.00 30.92 ? 409  ILE B CD1 1 
ATOM   3429 N N   . GLN B 1 200 ? -0.207  -7.282  37.640  1.00 30.89 ? 410  GLN B N   1 
ATOM   3430 C CA  . GLN B 1 200 ? -0.460  -5.921  37.187  1.00 31.31 ? 410  GLN B CA  1 
ATOM   3431 C C   . GLN B 1 200 ? -0.060  -4.889  38.242  1.00 31.28 ? 410  GLN B C   1 
ATOM   3432 O O   . GLN B 1 200 ? 0.567   -3.878  37.909  1.00 31.22 ? 410  GLN B O   1 
ATOM   3433 C CB  . GLN B 1 200 ? -1.917  -5.696  36.754  1.00 30.82 ? 410  GLN B CB  1 
ATOM   3434 C CG  . GLN B 1 200 ? -2.110  -4.289  36.169  1.00 31.87 ? 410  GLN B CG  1 
ATOM   3435 C CD  . GLN B 1 200 ? -3.547  -3.902  35.871  1.00 32.34 ? 410  GLN B CD  1 
ATOM   3436 O OE1 . GLN B 1 200 ? -4.440  -4.046  36.710  1.00 33.66 ? 410  GLN B OE1 1 
ATOM   3437 N NE2 . GLN B 1 200 ? -3.768  -3.358  34.673  1.00 34.02 ? 410  GLN B NE2 1 
ATOM   3438 N N   . ASP B 1 201 ? -0.405  -5.141  39.505  1.00 31.17 ? 411  ASP B N   1 
ATOM   3439 C CA  . ASP B 1 201 ? -0.108  -4.170  40.558  1.00 31.50 ? 411  ASP B CA  1 
ATOM   3440 C C   . ASP B 1 201 ? 1.397   -3.884  40.687  1.00 31.55 ? 411  ASP B C   1 
ATOM   3441 O O   . ASP B 1 201 ? 1.804   -2.725  40.784  1.00 31.27 ? 411  ASP B O   1 
ATOM   3442 C CB  . ASP B 1 201 ? -0.710  -4.578  41.910  1.00 31.56 ? 411  ASP B CB  1 
ATOM   3443 C CG  . ASP B 1 201 ? -0.946  -3.367  42.833  1.00 31.39 ? 411  ASP B CG  1 
ATOM   3444 O OD1 . ASP B 1 201 ? -1.809  -2.525  42.519  1.00 31.98 ? 411  ASP B OD1 1 
ATOM   3445 O OD2 . ASP B 1 201 ? -0.268  -3.252  43.865  1.00 30.64 ? 411  ASP B OD2 1 
ATOM   3446 N N   . THR B 1 202 ? 2.221   -4.929  40.655  1.00 31.90 ? 412  THR B N   1 
ATOM   3447 C CA  . THR B 1 202 ? 3.661   -4.724  40.780  1.00 32.31 ? 412  THR B CA  1 
ATOM   3448 C C   . THR B 1 202 ? 4.196   -3.973  39.570  1.00 32.01 ? 412  THR B C   1 
ATOM   3449 O O   . THR B 1 202 ? 4.974   -3.040  39.726  1.00 32.34 ? 412  THR B O   1 
ATOM   3450 C CB  . THR B 1 202 ? 4.465   -6.022  41.029  1.00 32.51 ? 412  THR B CB  1 
ATOM   3451 O OG1 . THR B 1 202 ? 4.858   -6.612  39.783  1.00 34.08 ? 412  THR B OG1 1 
ATOM   3452 C CG2 . THR B 1 202 ? 3.665   -7.012  41.843  1.00 32.57 ? 412  THR B CG2 1 
ATOM   3453 N N   . ILE B 1 203 ? 3.764   -4.349  38.369  1.00 31.88 ? 413  ILE B N   1 
ATOM   3454 C CA  . ILE B 1 203 ? 4.074   -3.532  37.191  1.00 31.49 ? 413  ILE B CA  1 
ATOM   3455 C C   . ILE B 1 203 ? 3.756   -2.055  37.459  1.00 31.06 ? 413  ILE B C   1 
ATOM   3456 O O   . ILE B 1 203 ? 4.610   -1.206  37.266  1.00 31.00 ? 413  ILE B O   1 
ATOM   3457 C CB  . ILE B 1 203 ? 3.356   -4.005  35.906  1.00 31.25 ? 413  ILE B CB  1 
ATOM   3458 C CG1 . ILE B 1 203 ? 3.808   -5.419  35.546  1.00 31.47 ? 413  ILE B CG1 1 
ATOM   3459 C CG2 . ILE B 1 203 ? 3.674   -3.047  34.753  1.00 31.32 ? 413  ILE B CG2 1 
ATOM   3460 C CD1 . ILE B 1 203 ? 2.998   -6.059  34.452  1.00 30.74 ? 413  ILE B CD1 1 
ATOM   3461 N N   . LEU B 1 204 ? 2.537   -1.766  37.915  1.00 31.20 ? 414  LEU B N   1 
ATOM   3462 C CA  . LEU B 1 204 ? 2.106   -0.391  38.202  1.00 31.43 ? 414  LEU B CA  1 
ATOM   3463 C C   . LEU B 1 204 ? 2.919   0.316   39.288  1.00 31.68 ? 414  LEU B C   1 
ATOM   3464 O O   . LEU B 1 204 ? 3.177   1.514   39.181  1.00 31.57 ? 414  LEU B O   1 
ATOM   3465 C CB  . LEU B 1 204 ? 0.620   -0.346  38.551  1.00 31.28 ? 414  LEU B CB  1 
ATOM   3466 C CG  . LEU B 1 204 ? -0.430  0.132   37.536  1.00 31.44 ? 414  LEU B CG  1 
ATOM   3467 C CD1 . LEU B 1 204 ? -0.003  0.086   36.058  1.00 30.80 ? 414  LEU B CD1 1 
ATOM   3468 C CD2 . LEU B 1 204 ? -1.727  -0.646  37.759  1.00 29.48 ? 414  LEU B CD2 1 
ATOM   3469 N N   . ARG B 1 205 ? 3.309   -0.415  40.326  1.00 32.14 ? 415  ARG B N   1 
ATOM   3470 C CA  . ARG B 1 205 ? 4.197   0.140   41.347  1.00 33.32 ? 415  ARG B CA  1 
ATOM   3471 C C   . ARG B 1 205 ? 5.580   0.371   40.753  1.00 33.70 ? 415  ARG B C   1 
ATOM   3472 O O   . ARG B 1 205 ? 6.230   1.387   41.034  1.00 33.37 ? 415  ARG B O   1 
ATOM   3473 C CB  . ARG B 1 205 ? 4.285   -0.772  42.578  1.00 33.33 ? 415  ARG B CB  1 
ATOM   3474 C CG  . ARG B 1 205 ? 3.086   -0.675  43.503  1.00 34.70 ? 415  ARG B CG  1 
ATOM   3475 C CD  . ARG B 1 205 ? 2.937   -1.892  44.398  1.00 36.61 ? 415  ARG B CD  1 
ATOM   3476 N NE  . ARG B 1 205 ? 1.646   -1.869  45.077  1.00 39.17 ? 415  ARG B NE  1 
ATOM   3477 C CZ  . ARG B 1 205 ? 1.451   -1.474  46.337  1.00 40.17 ? 415  ARG B CZ  1 
ATOM   3478 N NH1 . ARG B 1 205 ? 2.470   -1.072  47.094  1.00 40.25 ? 415  ARG B NH1 1 
ATOM   3479 N NH2 . ARG B 1 205 ? 0.226   -1.490  46.844  1.00 40.31 ? 415  ARG B NH2 1 
ATOM   3480 N N   . ALA B 1 206 ? 6.022   -0.563  39.914  1.00 34.52 ? 416  ALA B N   1 
ATOM   3481 C CA  . ALA B 1 206 ? 7.272   -0.384  39.191  1.00 35.51 ? 416  ALA B CA  1 
ATOM   3482 C C   . ALA B 1 206 ? 7.195   0.889   38.353  1.00 36.25 ? 416  ALA B C   1 
ATOM   3483 O O   . ALA B 1 206 ? 8.120   1.691   38.361  1.00 36.70 ? 416  ALA B O   1 
ATOM   3484 C CB  . ALA B 1 206 ? 7.581   -1.595  38.325  1.00 35.40 ? 416  ALA B CB  1 
ATOM   3485 N N   . LEU B 1 207 ? 6.070   1.088   37.674  1.00 37.25 ? 417  LEU B N   1 
ATOM   3486 C CA  . LEU B 1 207 ? 5.877   2.251   36.810  1.00 38.54 ? 417  LEU B CA  1 
ATOM   3487 C C   . LEU B 1 207 ? 5.918   3.587   37.566  1.00 39.60 ? 417  LEU B C   1 
ATOM   3488 O O   . LEU B 1 207 ? 6.586   4.516   37.129  1.00 39.77 ? 417  LEU B O   1 
ATOM   3489 C CB  . LEU B 1 207 ? 4.587   2.116   35.989  1.00 38.10 ? 417  LEU B CB  1 
ATOM   3490 C CG  . LEU B 1 207 ? 4.051   3.345   35.243  1.00 38.14 ? 417  LEU B CG  1 
ATOM   3491 C CD1 . LEU B 1 207 ? 5.003   3.821   34.145  1.00 38.65 ? 417  LEU B CD1 1 
ATOM   3492 C CD2 . LEU B 1 207 ? 2.682   3.052   34.666  1.00 38.36 ? 417  LEU B CD2 1 
ATOM   3493 N N   . GLU B 1 208 ? 5.209   3.693   38.684  1.00 41.09 ? 418  GLU B N   1 
ATOM   3494 C CA  . GLU B 1 208 ? 5.239   4.932   39.461  1.00 42.63 ? 418  GLU B CA  1 
ATOM   3495 C C   . GLU B 1 208 ? 6.643   5.201   39.982  1.00 43.51 ? 418  GLU B C   1 
ATOM   3496 O O   . GLU B 1 208 ? 7.145   6.313   39.871  1.00 43.83 ? 418  GLU B O   1 
ATOM   3497 C CB  . GLU B 1 208 ? 4.234   4.911   40.613  1.00 42.60 ? 418  GLU B CB  1 
ATOM   3498 C CG  . GLU B 1 208 ? 4.049   6.287   41.252  1.00 43.72 ? 418  GLU B CG  1 
ATOM   3499 C CD  . GLU B 1 208 ? 2.795   6.386   42.090  1.00 44.39 ? 418  GLU B CD  1 
ATOM   3500 O OE1 . GLU B 1 208 ? 1.929   7.233   41.768  1.00 44.60 ? 418  GLU B OE1 1 
ATOM   3501 O OE2 . GLU B 1 208 ? 2.676   5.609   43.060  1.00 44.24 ? 418  GLU B OE2 1 
ATOM   3502 N N   . PHE B 1 209 ? 7.277   4.164   40.521  1.00 45.00 ? 419  PHE B N   1 
ATOM   3503 C CA  . PHE B 1 209 ? 8.631   4.265   41.049  1.00 46.35 ? 419  PHE B CA  1 
ATOM   3504 C C   . PHE B 1 209 ? 9.583   4.822   40.000  1.00 46.89 ? 419  PHE B C   1 
ATOM   3505 O O   . PHE B 1 209 ? 10.128  5.909   40.170  1.00 47.12 ? 419  PHE B O   1 
ATOM   3506 C CB  . PHE B 1 209 ? 9.123   2.905   41.554  1.00 46.79 ? 419  PHE B CB  1 
ATOM   3507 C CG  . PHE B 1 209 ? 10.491  2.951   42.167  1.00 47.76 ? 419  PHE B CG  1 
ATOM   3508 C CD1 . PHE B 1 209 ? 10.683  3.500   43.434  1.00 48.76 ? 419  PHE B CD1 1 
ATOM   3509 C CD2 . PHE B 1 209 ? 11.592  2.455   41.477  1.00 48.75 ? 419  PHE B CD2 1 
ATOM   3510 C CE1 . PHE B 1 209 ? 11.954  3.548   44.008  1.00 49.24 ? 419  PHE B CE1 1 
ATOM   3511 C CE2 . PHE B 1 209 ? 12.866  2.494   42.043  1.00 49.28 ? 419  PHE B CE2 1 
ATOM   3512 C CZ  . PHE B 1 209 ? 13.047  3.043   43.307  1.00 48.91 ? 419  PHE B CZ  1 
ATOM   3513 N N   . HIS B 1 210 ? 9.756   4.068   38.916  1.00 47.50 ? 420  HIS B N   1 
ATOM   3514 C CA  . HIS B 1 210 ? 10.582  4.459   37.772  1.00 47.80 ? 420  HIS B CA  1 
ATOM   3515 C C   . HIS B 1 210 ? 10.286  5.875   37.276  1.00 48.09 ? 420  HIS B C   1 
ATOM   3516 O O   . HIS B 1 210 ? 11.193  6.583   36.833  1.00 48.07 ? 420  HIS B O   1 
ATOM   3517 C CB  . HIS B 1 210 ? 10.388  3.445   36.646  1.00 47.60 ? 420  HIS B CB  1 
ATOM   3518 C CG  . HIS B 1 210 ? 10.952  3.875   35.330  1.00 47.71 ? 420  HIS B CG  1 
ATOM   3519 N ND1 . HIS B 1 210 ? 12.226  3.542   34.924  1.00 47.65 ? 420  HIS B ND1 1 
ATOM   3520 C CD2 . HIS B 1 210 ? 10.410  4.596   34.319  1.00 47.46 ? 420  HIS B CD2 1 
ATOM   3521 C CE1 . HIS B 1 210 ? 12.447  4.051   33.724  1.00 47.89 ? 420  HIS B CE1 1 
ATOM   3522 N NE2 . HIS B 1 210 ? 11.360  4.691   33.334  1.00 47.25 ? 420  HIS B NE2 1 
ATOM   3523 N N   . LEU B 1 211 ? 9.024   6.286   37.370  1.00 48.69 ? 421  LEU B N   1 
ATOM   3524 C CA  . LEU B 1 211 ? 8.598   7.598   36.881  1.00 49.28 ? 421  LEU B CA  1 
ATOM   3525 C C   . LEU B 1 211 ? 9.065   8.740   37.780  1.00 49.76 ? 421  LEU B C   1 
ATOM   3526 O O   . LEU B 1 211 ? 9.326   9.842   37.295  1.00 49.62 ? 421  LEU B O   1 
ATOM   3527 C CB  . LEU B 1 211 ? 7.077   7.639   36.696  1.00 49.24 ? 421  LEU B CB  1 
ATOM   3528 C CG  . LEU B 1 211 ? 6.532   8.085   35.328  1.00 49.52 ? 421  LEU B CG  1 
ATOM   3529 C CD1 . LEU B 1 211 ? 7.097   7.251   34.157  1.00 48.50 ? 421  LEU B CD1 1 
ATOM   3530 C CD2 . LEU B 1 211 ? 5.007   8.046   35.320  1.00 49.28 ? 421  LEU B CD2 1 
ATOM   3531 N N   . GLN B 1 212 ? 9.171   8.478   39.084  1.00 50.31 ? 422  GLN B N   1 
ATOM   3532 C CA  . GLN B 1 212 ? 9.767   9.446   40.021  1.00 50.91 ? 422  GLN B CA  1 
ATOM   3533 C C   . GLN B 1 212 ? 11.222  9.756   39.645  1.00 51.10 ? 422  GLN B C   1 
ATOM   3534 O O   . GLN B 1 212 ? 11.654  10.904  39.713  1.00 51.42 ? 422  GLN B O   1 
ATOM   3535 C CB  . GLN B 1 212 ? 9.685   8.948   41.474  1.00 50.87 ? 422  GLN B CB  1 
ATOM   3536 C CG  . GLN B 1 212 ? 8.325   9.138   42.142  1.00 50.53 ? 422  GLN B CG  1 
ATOM   3537 C CD  . GLN B 1 212 ? 8.199   8.366   43.455  1.00 50.98 ? 422  GLN B CD  1 
ATOM   3538 O OE1 . GLN B 1 212 ? 8.375   7.146   43.495  1.00 51.41 ? 422  GLN B OE1 1 
ATOM   3539 N NE2 . GLN B 1 212 ? 7.885   9.074   44.529  1.00 50.25 ? 422  GLN B NE2 1 
ATOM   3540 N N   . ALA B 1 213 ? 11.965  8.728   39.247  1.00 51.38 ? 423  ALA B N   1 
ATOM   3541 C CA  . ALA B 1 213 ? 13.312  8.906   38.725  1.00 51.91 ? 423  ALA B CA  1 
ATOM   3542 C C   . ALA B 1 213 ? 13.294  9.706   37.412  1.00 52.42 ? 423  ALA B C   1 
ATOM   3543 O O   . ALA B 1 213 ? 13.412  10.936  37.440  1.00 52.46 ? 423  ALA B O   1 
ATOM   3544 C CB  . ALA B 1 213 ? 13.992  7.557   38.544  1.00 51.76 ? 423  ALA B CB  1 
ATOM   3545 N N   . ASN B 1 214 ? 13.110  9.012   36.282  1.00 52.83 ? 424  ASN B N   1 
ATOM   3546 C CA  . ASN B 1 214 ? 13.121  9.618   34.937  1.00 53.30 ? 424  ASN B CA  1 
ATOM   3547 C C   . ASN B 1 214 ? 12.410  10.965  34.737  1.00 53.36 ? 424  ASN B C   1 
ATOM   3548 O O   . ASN B 1 214 ? 12.795  11.726  33.854  1.00 53.66 ? 424  ASN B O   1 
ATOM   3549 C CB  . ASN B 1 214 ? 12.613  8.620   33.881  1.00 53.54 ? 424  ASN B CB  1 
ATOM   3550 C CG  . ASN B 1 214 ? 13.743  7.888   33.162  1.00 53.79 ? 424  ASN B CG  1 
ATOM   3551 O OD1 . ASN B 1 214 ? 14.855  7.776   33.673  1.00 54.57 ? 424  ASN B OD1 1 
ATOM   3552 N ND2 . ASN B 1 214 ? 13.451  7.383   31.968  1.00 54.19 ? 424  ASN B ND2 1 
ATOM   3553 N N   . HIS B 1 215 ? 11.374  11.249  35.525  1.00 53.43 ? 425  HIS B N   1 
ATOM   3554 C CA  . HIS B 1 215 ? 10.626  12.509  35.394  1.00 53.40 ? 425  HIS B CA  1 
ATOM   3555 C C   . HIS B 1 215 ? 10.417  13.216  36.735  1.00 53.28 ? 425  HIS B C   1 
ATOM   3556 O O   . HIS B 1 215 ? 9.497   12.879  37.477  1.00 52.99 ? 425  HIS B O   1 
ATOM   3557 C CB  . HIS B 1 215 ? 9.272   12.278  34.711  1.00 53.41 ? 425  HIS B CB  1 
ATOM   3558 C CG  . HIS B 1 215 ? 9.377   11.682  33.345  1.00 53.73 ? 425  HIS B CG  1 
ATOM   3559 N ND1 . HIS B 1 215 ? 9.649   10.348  33.135  1.00 53.49 ? 425  HIS B ND1 1 
ATOM   3560 C CD2 . HIS B 1 215 ? 9.237   12.235  32.117  1.00 53.86 ? 425  HIS B CD2 1 
ATOM   3561 C CE1 . HIS B 1 215 ? 9.687   10.108  31.837  1.00 53.54 ? 425  HIS B CE1 1 
ATOM   3562 N NE2 . HIS B 1 215 ? 9.436   11.235  31.197  1.00 53.53 ? 425  HIS B NE2 1 
ATOM   3563 N N   . PRO B 1 216 ? 11.259  14.218  37.042  1.00 53.47 ? 426  PRO B N   1 
ATOM   3564 C CA  . PRO B 1 216 ? 11.105  14.923  38.316  1.00 53.33 ? 426  PRO B CA  1 
ATOM   3565 C C   . PRO B 1 216 ? 10.030  16.000  38.231  1.00 53.09 ? 426  PRO B C   1 
ATOM   3566 O O   . PRO B 1 216 ? 9.255   16.195  39.174  1.00 53.20 ? 426  PRO B O   1 
ATOM   3567 C CB  . PRO B 1 216 ? 12.478  15.562  38.525  1.00 53.39 ? 426  PRO B CB  1 
ATOM   3568 C CG  . PRO B 1 216 ? 13.020  15.782  37.147  1.00 53.53 ? 426  PRO B CG  1 
ATOM   3569 C CD  . PRO B 1 216 ? 12.373  14.758  36.234  1.00 53.64 ? 426  PRO B CD  1 
ATOM   3570 N N   . ASP B 1 217 ? 9.988   16.660  37.080  1.00 52.82 ? 427  ASP B N   1 
ATOM   3571 C CA  . ASP B 1 217 ? 9.181   17.853  36.841  1.00 52.46 ? 427  ASP B CA  1 
ATOM   3572 C C   . ASP B 1 217 ? 7.699   17.546  36.647  1.00 52.14 ? 427  ASP B C   1 
ATOM   3573 O O   . ASP B 1 217 ? 6.830   18.337  37.041  1.00 52.05 ? 427  ASP B O   1 
ATOM   3574 C CB  . ASP B 1 217 ? 9.713   18.565  35.590  1.00 52.46 ? 427  ASP B CB  1 
ATOM   3575 C CG  . ASP B 1 217 ? 9.718   17.660  34.353  1.00 52.04 ? 427  ASP B CG  1 
ATOM   3576 O OD1 . ASP B 1 217 ? 10.540  16.714  34.291  1.00 50.43 ? 427  ASP B OD1 1 
ATOM   3577 O OD2 . ASP B 1 217 ? 8.889   17.901  33.448  1.00 52.09 ? 427  ASP B OD2 1 
ATOM   3578 N N   . ALA B 1 218 ? 7.422   16.399  36.029  1.00 51.60 ? 428  ALA B N   1 
ATOM   3579 C CA  . ALA B 1 218 ? 6.081   16.096  35.550  1.00 51.09 ? 428  ALA B CA  1 
ATOM   3580 C C   . ALA B 1 218 ? 5.090   16.019  36.702  1.00 50.48 ? 428  ALA B C   1 
ATOM   3581 O O   . ALA B 1 218 ? 5.243   15.208  37.614  1.00 50.68 ? 428  ALA B O   1 
ATOM   3582 C CB  . ALA B 1 218 ? 6.079   14.819  34.724  1.00 50.93 ? 428  ALA B CB  1 
ATOM   3583 N N   . GLN B 1 219 ? 4.099   16.904  36.657  1.00 49.72 ? 429  GLN B N   1 
ATOM   3584 C CA  . GLN B 1 219 ? 3.028   16.945  37.641  1.00 48.78 ? 429  GLN B CA  1 
ATOM   3585 C C   . GLN B 1 219 ? 1.921   15.972  37.249  1.00 48.14 ? 429  GLN B C   1 
ATOM   3586 O O   . GLN B 1 219 ? 1.193   16.193  36.273  1.00 48.21 ? 429  GLN B O   1 
ATOM   3587 C CB  . GLN B 1 219 ? 2.468   18.365  37.768  1.00 48.72 ? 429  GLN B CB  1 
ATOM   3588 N N   . GLN B 1 220 ? 1.820   14.882  38.004  1.00 46.95 ? 430  GLN B N   1 
ATOM   3589 C CA  . GLN B 1 220 ? 0.741   13.917  37.841  1.00 46.01 ? 430  GLN B CA  1 
ATOM   3590 C C   . GLN B 1 220 ? 0.865   13.090  36.552  1.00 45.29 ? 430  GLN B C   1 
ATOM   3591 O O   . GLN B 1 220 ? -0.143  12.756  35.932  1.00 45.29 ? 430  GLN B O   1 
ATOM   3592 C CB  . GLN B 1 220 ? -0.626  14.625  37.922  1.00 46.08 ? 430  GLN B CB  1 
ATOM   3593 N N   . LEU B 1 221 ? 2.100   12.756  36.165  1.00 44.17 ? 431  LEU B N   1 
ATOM   3594 C CA  . LEU B 1 221 ? 2.355   11.916  34.988  1.00 43.35 ? 431  LEU B CA  1 
ATOM   3595 C C   . LEU B 1 221 ? 1.688   10.541  35.126  1.00 42.52 ? 431  LEU B C   1 
ATOM   3596 O O   . LEU B 1 221 ? 1.163   9.994   34.153  1.00 42.34 ? 431  LEU B O   1 
ATOM   3597 C CB  . LEU B 1 221 ? 3.865   11.728  34.755  1.00 43.27 ? 431  LEU B CB  1 
ATOM   3598 C CG  . LEU B 1 221 ? 4.482   11.874  33.346  1.00 43.11 ? 431  LEU B CG  1 
ATOM   3599 C CD1 . LEU B 1 221 ? 5.869   11.221  33.292  1.00 43.19 ? 431  LEU B CD1 1 
ATOM   3600 C CD2 . LEU B 1 221 ? 3.609   11.357  32.210  1.00 42.21 ? 431  LEU B CD2 1 
ATOM   3601 N N   . PHE B 1 222 ? 1.710   10.006  36.345  1.00 41.52 ? 432  PHE B N   1 
ATOM   3602 C CA  . PHE B 1 222 ? 1.198   8.670   36.640  1.00 40.57 ? 432  PHE B CA  1 
ATOM   3603 C C   . PHE B 1 222 ? -0.311  8.521   36.436  1.00 39.81 ? 432  PHE B C   1 
ATOM   3604 O O   . PHE B 1 222 ? -0.716  7.685   35.647  1.00 39.66 ? 432  PHE B O   1 
ATOM   3605 C CB  . PHE B 1 222 ? 1.647   8.205   38.037  1.00 40.41 ? 432  PHE B CB  1 
ATOM   3606 C CG  . PHE B 1 222 ? 1.279   6.780   38.360  1.00 40.36 ? 432  PHE B CG  1 
ATOM   3607 C CD1 . PHE B 1 222 ? 1.929   5.715   37.733  1.00 39.95 ? 432  PHE B CD1 1 
ATOM   3608 C CD2 . PHE B 1 222 ? 0.287   6.502   39.304  1.00 40.05 ? 432  PHE B CD2 1 
ATOM   3609 C CE1 . PHE B 1 222 ? 1.591   4.391   38.036  1.00 40.34 ? 432  PHE B CE1 1 
ATOM   3610 C CE2 . PHE B 1 222 ? -0.054  5.183   39.619  1.00 39.65 ? 432  PHE B CE2 1 
ATOM   3611 C CZ  . PHE B 1 222 ? 0.597   4.126   38.982  1.00 40.06 ? 432  PHE B CZ  1 
ATOM   3612 N N   . PRO B 1 223 ? -1.147  9.310   37.151  1.00 39.71 ? 433  PRO B N   1 
ATOM   3613 C CA  . PRO B 1 223 ? -2.599  9.272   36.859  1.00 39.15 ? 433  PRO B CA  1 
ATOM   3614 C C   . PRO B 1 223 ? -2.957  9.724   35.449  1.00 38.75 ? 433  PRO B C   1 
ATOM   3615 O O   . PRO B 1 223 ? -4.034  9.392   34.950  1.00 38.87 ? 433  PRO B O   1 
ATOM   3616 C CB  . PRO B 1 223 ? -3.205  10.240  37.889  1.00 39.07 ? 433  PRO B CB  1 
ATOM   3617 C CG  . PRO B 1 223 ? -2.083  11.087  38.355  1.00 39.37 ? 433  PRO B CG  1 
ATOM   3618 C CD  . PRO B 1 223 ? -0.851  10.214  38.282  1.00 39.72 ? 433  PRO B CD  1 
ATOM   3619 N N   . LYS B 1 224 ? -2.067  10.483  34.820  1.00 38.29 ? 434  LYS B N   1 
ATOM   3620 C CA  . LYS B 1 224 ? -2.233  10.848  33.416  1.00 37.98 ? 434  LYS B CA  1 
ATOM   3621 C C   . LYS B 1 224 ? -2.170  9.609   32.519  1.00 37.60 ? 434  LYS B C   1 
ATOM   3622 O O   . LYS B 1 224 ? -2.970  9.481   31.580  1.00 37.71 ? 434  LYS B O   1 
ATOM   3623 C CB  . LYS B 1 224 ? -1.165  11.857  32.987  1.00 38.19 ? 434  LYS B CB  1 
ATOM   3624 N N   . LEU B 1 225 ? -1.240  8.698   32.821  1.00 36.74 ? 435  LEU B N   1 
ATOM   3625 C CA  . LEU B 1 225 ? -1.037  7.504   31.993  1.00 36.51 ? 435  LEU B CA  1 
ATOM   3626 C C   . LEU B 1 225 ? -2.131  6.458   32.186  1.00 36.28 ? 435  LEU B C   1 
ATOM   3627 O O   . LEU B 1 225 ? -2.512  5.767   31.237  1.00 35.98 ? 435  LEU B O   1 
ATOM   3628 C CB  . LEU B 1 225 ? 0.348   6.908   32.223  1.00 36.47 ? 435  LEU B CB  1 
ATOM   3629 C CG  . LEU B 1 225 ? 1.506   7.712   31.630  1.00 36.78 ? 435  LEU B CG  1 
ATOM   3630 C CD1 . LEU B 1 225 ? 2.853   7.095   31.997  1.00 36.52 ? 435  LEU B CD1 1 
ATOM   3631 C CD2 . LEU B 1 225 ? 1.348   7.819   30.121  1.00 36.86 ? 435  LEU B CD2 1 
ATOM   3632 N N   . LEU B 1 226 ? -2.646  6.367   33.414  1.00 36.03 ? 436  LEU B N   1 
ATOM   3633 C CA  . LEU B 1 226 ? -3.768  5.483   33.735  1.00 35.34 ? 436  LEU B CA  1 
ATOM   3634 C C   . LEU B 1 226 ? -5.023  5.900   32.984  1.00 34.80 ? 436  LEU B C   1 
ATOM   3635 O O   . LEU B 1 226 ? -5.787  5.050   32.515  1.00 34.88 ? 436  LEU B O   1 
ATOM   3636 C CB  . LEU B 1 226 ? -4.028  5.458   35.246  1.00 35.33 ? 436  LEU B CB  1 
ATOM   3637 C CG  . LEU B 1 226 ? -2.883  4.953   36.130  1.00 35.06 ? 436  LEU B CG  1 
ATOM   3638 C CD1 . LEU B 1 226 ? -3.212  5.161   37.607  1.00 34.91 ? 436  LEU B CD1 1 
ATOM   3639 C CD2 . LEU B 1 226 ? -2.564  3.488   35.847  1.00 33.68 ? 436  LEU B CD2 1 
ATOM   3640 N N   . GLN B 1 227 ? -5.235  7.208   32.868  1.00 34.01 ? 437  GLN B N   1 
ATOM   3641 C CA  . GLN B 1 227 ? -6.337  7.730   32.063  1.00 33.55 ? 437  GLN B CA  1 
ATOM   3642 C C   . GLN B 1 227 ? -6.147  7.389   30.570  1.00 33.27 ? 437  GLN B C   1 
ATOM   3643 O O   . GLN B 1 227 ? -7.124  7.107   29.873  1.00 33.62 ? 437  GLN B O   1 
ATOM   3644 C CB  . GLN B 1 227 ? -6.494  9.242   32.279  1.00 33.46 ? 437  GLN B CB  1 
ATOM   3645 C CG  . GLN B 1 227 ? -7.675  9.892   31.563  1.00 32.83 ? 437  GLN B CG  1 
ATOM   3646 C CD  . GLN B 1 227 ? -9.020  9.235   31.846  1.00 32.93 ? 437  GLN B CD  1 
ATOM   3647 O OE1 . GLN B 1 227 ? -9.753  8.911   30.922  1.00 35.01 ? 437  GLN B OE1 1 
ATOM   3648 N NE2 . GLN B 1 227 ? -9.356  9.053   33.119  1.00 33.18 ? 437  GLN B NE2 1 
ATOM   3649 N N   . LYS B 1 228 ? -4.897  7.400   30.102  1.00 32.66 ? 438  LYS B N   1 
ATOM   3650 C CA  . LYS B 1 228 ? -4.560  7.021   28.721  1.00 32.68 ? 438  LYS B CA  1 
ATOM   3651 C C   . LYS B 1 228 ? -4.821  5.535   28.442  1.00 32.65 ? 438  LYS B C   1 
ATOM   3652 O O   . LYS B 1 228 ? -5.180  5.164   27.325  1.00 32.20 ? 438  LYS B O   1 
ATOM   3653 C CB  . LYS B 1 228 ? -3.098  7.354   28.395  1.00 32.47 ? 438  LYS B CB  1 
ATOM   3654 C CG  . LYS B 1 228 ? -2.740  8.839   28.383  1.00 33.14 ? 438  LYS B CG  1 
ATOM   3655 C CD  . LYS B 1 228 ? -3.393  9.578   27.218  1.00 32.76 ? 438  LYS B CD  1 
ATOM   3656 C CE  . LYS B 1 228 ? -2.916  11.022  27.136  1.00 33.24 ? 438  LYS B CE  1 
ATOM   3657 N NZ  . LYS B 1 228 ? -3.977  11.906  26.571  1.00 33.05 ? 438  LYS B NZ  1 
ATOM   3658 N N   . MET B 1 229 ? -4.620  4.696   29.457  1.00 32.63 ? 439  MET B N   1 
ATOM   3659 C CA  . MET B 1 229 ? -4.968  3.282   29.370  1.00 33.13 ? 439  MET B CA  1 
ATOM   3660 C C   . MET B 1 229 ? -6.473  3.130   29.144  1.00 33.09 ? 439  MET B C   1 
ATOM   3661 O O   . MET B 1 229 ? -6.905  2.264   28.364  1.00 32.81 ? 439  MET B O   1 
ATOM   3662 C CB  . MET B 1 229 ? -4.544  2.526   30.636  1.00 32.96 ? 439  MET B CB  1 
ATOM   3663 C CG  . MET B 1 229 ? -3.036  2.402   30.816  1.00 33.37 ? 439  MET B CG  1 
ATOM   3664 S SD  . MET B 1 229 ? -2.566  1.683   32.404  1.00 33.96 ? 439  MET B SD  1 
ATOM   3665 C CE  . MET B 1 229 ? -3.131  -0.010  32.223  1.00 35.37 ? 439  MET B CE  1 
ATOM   3666 N N   . ALA B 1 230 ? -7.262  3.975   29.818  1.00 33.11 ? 440  ALA B N   1 
ATOM   3667 C CA  . ALA B 1 230 ? -8.725  3.983   29.640  1.00 33.23 ? 440  ALA B CA  1 
ATOM   3668 C C   . ALA B 1 230 ? -9.103  4.538   28.272  1.00 33.25 ? 440  ALA B C   1 
ATOM   3669 O O   . ALA B 1 230 ? -10.028 4.050   27.629  1.00 32.98 ? 440  ALA B O   1 
ATOM   3670 C CB  . ALA B 1 230 ? -9.403  4.776   30.741  1.00 33.16 ? 440  ALA B CB  1 
ATOM   3671 N N   . ASP B 1 231 ? -8.384  5.574   27.845  1.00 33.59 ? 441  ASP B N   1 
ATOM   3672 C CA  . ASP B 1 231 ? -8.543  6.143   26.511  1.00 33.98 ? 441  ASP B CA  1 
ATOM   3673 C C   . ASP B 1 231 ? -8.247  5.099   25.437  1.00 33.87 ? 441  ASP B C   1 
ATOM   3674 O O   . ASP B 1 231 ? -9.009  4.962   24.478  1.00 33.92 ? 441  ASP B O   1 
ATOM   3675 C CB  . ASP B 1 231 ? -7.627  7.362   26.332  1.00 34.16 ? 441  ASP B CB  1 
ATOM   3676 C CG  . ASP B 1 231 ? -8.055  8.553   27.177  1.00 34.81 ? 441  ASP B CG  1 
ATOM   3677 O OD1 . ASP B 1 231 ? -9.239  8.628   27.581  1.00 35.88 ? 441  ASP B OD1 1 
ATOM   3678 O OD2 . ASP B 1 231 ? -7.198  9.422   27.439  1.00 34.45 ? 441  ASP B OD2 1 
ATOM   3679 N N   . LEU B 1 232 ? -7.149  4.361   25.613  1.00 33.94 ? 442  LEU B N   1 
ATOM   3680 C CA  . LEU B 1 232 ? -6.783  3.269   24.700  1.00 34.16 ? 442  LEU B CA  1 
ATOM   3681 C C   . LEU B 1 232 ? -7.853  2.179   24.613  1.00 34.56 ? 442  LEU B C   1 
ATOM   3682 O O   . LEU B 1 232 ? -8.122  1.660   23.516  1.00 34.59 ? 442  LEU B O   1 
ATOM   3683 C CB  . LEU B 1 232 ? -5.423  2.670   25.069  1.00 33.98 ? 442  LEU B CB  1 
ATOM   3684 C CG  . LEU B 1 232 ? -4.187  3.478   24.630  1.00 33.85 ? 442  LEU B CG  1 
ATOM   3685 C CD1 . LEU B 1 232 ? -2.972  3.095   25.472  1.00 33.40 ? 442  LEU B CD1 1 
ATOM   3686 C CD2 . LEU B 1 232 ? -3.890  3.331   23.134  1.00 31.18 ? 442  LEU B CD2 1 
ATOM   3687 N N   . ARG B 1 233 ? -8.477  1.853   25.752  1.00 34.68 ? 443  ARG B N   1 
ATOM   3688 C CA  . ARG B 1 233 ? -9.522  0.837   25.776  1.00 35.16 ? 443  ARG B CA  1 
ATOM   3689 C C   . ARG B 1 233 ? -10.723 1.263   24.944  1.00 35.21 ? 443  ARG B C   1 
ATOM   3690 O O   . ARG B 1 233 ? -11.357 0.428   24.291  1.00 35.39 ? 443  ARG B O   1 
ATOM   3691 C CB  . ARG B 1 233 ? -9.957  0.481   27.199  1.00 35.17 ? 443  ARG B CB  1 
ATOM   3692 C CG  . ARG B 1 233 ? -10.931 -0.705  27.237  1.00 36.01 ? 443  ARG B CG  1 
ATOM   3693 C CD  . ARG B 1 233 ? -11.293 -1.147  28.642  1.00 36.04 ? 443  ARG B CD  1 
ATOM   3694 N NE  . ARG B 1 233 ? -10.128 -1.585  29.402  1.00 38.57 ? 443  ARG B NE  1 
ATOM   3695 C CZ  . ARG B 1 233 ? -10.176 -2.423  30.433  1.00 40.57 ? 443  ARG B CZ  1 
ATOM   3696 N NH1 . ARG B 1 233 ? -11.335 -2.943  30.820  1.00 41.88 ? 443  ARG B NH1 1 
ATOM   3697 N NH2 . ARG B 1 233 ? -9.063  -2.758  31.072  1.00 40.52 ? 443  ARG B NH2 1 
ATOM   3698 N N   . GLN B 1 234 ? -11.023 2.561   24.963  1.00 35.09 ? 444  GLN B N   1 
ATOM   3699 C CA  . GLN B 1 234 ? -12.119 3.111   24.158  1.00 34.73 ? 444  GLN B CA  1 
ATOM   3700 C C   . GLN B 1 234 ? -11.754 3.207   22.664  1.00 33.77 ? 444  GLN B C   1 
ATOM   3701 O O   . GLN B 1 234 ? -12.588 2.924   21.808  1.00 33.34 ? 444  GLN B O   1 
ATOM   3702 C CB  . GLN B 1 234 ? -12.605 4.451   24.730  1.00 34.90 ? 444  GLN B CB  1 
ATOM   3703 C CG  . GLN B 1 234 ? -13.830 5.066   24.035  1.00 37.04 ? 444  GLN B CG  1 
ATOM   3704 C CD  . GLN B 1 234 ? -15.027 4.129   23.966  1.00 40.15 ? 444  GLN B CD  1 
ATOM   3705 O OE1 . GLN B 1 234 ? -15.345 3.429   24.933  1.00 43.08 ? 444  GLN B OE1 1 
ATOM   3706 N NE2 . GLN B 1 234 ? -15.703 4.117   22.819  1.00 40.33 ? 444  GLN B NE2 1 
ATOM   3707 N N   . LEU B 1 235 ? -10.516 3.593   22.365  1.00 32.92 ? 445  LEU B N   1 
ATOM   3708 C CA  . LEU B 1 235 ? -10.020 3.611   20.984  1.00 32.62 ? 445  LEU B CA  1 
ATOM   3709 C C   . LEU B 1 235 ? -10.169 2.231   20.309  1.00 32.09 ? 445  LEU B C   1 
ATOM   3710 O O   . LEU B 1 235 ? -10.626 2.132   19.173  1.00 32.02 ? 445  LEU B O   1 
ATOM   3711 C CB  . LEU B 1 235 ? -8.552  4.055   20.959  1.00 32.61 ? 445  LEU B CB  1 
ATOM   3712 C CG  . LEU B 1 235 ? -7.859  4.629   19.711  1.00 32.88 ? 445  LEU B CG  1 
ATOM   3713 C CD1 . LEU B 1 235 ? -6.498  5.178   20.107  1.00 31.37 ? 445  LEU B CD1 1 
ATOM   3714 C CD2 . LEU B 1 235 ? -7.686  3.604   18.596  1.00 33.46 ? 445  LEU B CD2 1 
ATOM   3715 N N   . VAL B 1 236 ? -9.788  1.173   21.022  1.00 31.94 ? 446  VAL B N   1 
ATOM   3716 C CA  . VAL B 1 236 ? -9.884  -0.196  20.497  1.00 31.48 ? 446  VAL B CA  1 
ATOM   3717 C C   . VAL B 1 236 ? -11.336 -0.574  20.238  1.00 31.60 ? 446  VAL B C   1 
ATOM   3718 O O   . VAL B 1 236 ? -11.645 -1.163  19.202  1.00 31.73 ? 446  VAL B O   1 
ATOM   3719 C CB  . VAL B 1 236 ? -9.159  -1.225  21.407  1.00 31.23 ? 446  VAL B CB  1 
ATOM   3720 C CG1 . VAL B 1 236 ? -9.481  -2.652  21.000  1.00 31.11 ? 446  VAL B CG1 1 
ATOM   3721 C CG2 . VAL B 1 236 ? -7.652  -0.989  21.373  1.00 30.34 ? 446  VAL B CG2 1 
ATOM   3722 N N   . THR B 1 237 ? -12.220 -0.211  21.167  1.00 31.70 ? 447  THR B N   1 
ATOM   3723 C CA  . THR B 1 237 ? -13.661 -0.420  21.013  1.00 31.82 ? 447  THR B CA  1 
ATOM   3724 C C   . THR B 1 237 ? -14.163 0.154   19.686  1.00 31.98 ? 447  THR B C   1 
ATOM   3725 O O   . THR B 1 237 ? -14.799 -0.545  18.897  1.00 31.44 ? 447  THR B O   1 
ATOM   3726 C CB  . THR B 1 237 ? -14.445 0.218   22.179  1.00 31.62 ? 447  THR B CB  1 
ATOM   3727 O OG1 . THR B 1 237 ? -14.182 -0.510  23.382  1.00 32.86 ? 447  THR B OG1 1 
ATOM   3728 C CG2 . THR B 1 237 ? -15.955 0.219   21.904  1.00 31.33 ? 447  THR B CG2 1 
ATOM   3729 N N   . GLU B 1 238 ? -13.876 1.429   19.455  1.00 32.84 ? 448  GLU B N   1 
ATOM   3730 C CA  . GLU B 1 238 ? -14.274 2.087   18.215  1.00 34.16 ? 448  GLU B CA  1 
ATOM   3731 C C   . GLU B 1 238 ? -13.599 1.368   17.047  1.00 33.76 ? 448  GLU B C   1 
ATOM   3732 O O   . GLU B 1 238 ? -14.215 1.141   16.015  1.00 33.38 ? 448  GLU B O   1 
ATOM   3733 C CB  . GLU B 1 238 ? -13.887 3.576   18.208  1.00 34.20 ? 448  GLU B CB  1 
ATOM   3734 C CG  . GLU B 1 238 ? -13.975 4.304   19.555  1.00 37.76 ? 448  GLU B CG  1 
ATOM   3735 C CD  . GLU B 1 238 ? -15.301 5.029   19.809  1.00 42.09 ? 448  GLU B CD  1 
ATOM   3736 O OE1 . GLU B 1 238 ? -16.298 4.758   19.092  1.00 43.87 ? 448  GLU B OE1 1 
ATOM   3737 O OE2 . GLU B 1 238 ? -15.339 5.864   20.754  1.00 42.29 ? 448  GLU B OE2 1 
ATOM   3738 N N   . HIS B 1 239 ? -12.334 0.994   17.231  1.00 33.98 ? 449  HIS B N   1 
ATOM   3739 C CA  . HIS B 1 239 ? -11.580 0.342   16.167  1.00 34.39 ? 449  HIS B CA  1 
ATOM   3740 C C   . HIS B 1 239 ? -12.212 -0.987  15.772  1.00 34.54 ? 449  HIS B C   1 
ATOM   3741 O O   . HIS B 1 239 ? -12.375 -1.262  14.590  1.00 34.35 ? 449  HIS B O   1 
ATOM   3742 C CB  . HIS B 1 239 ? -10.110 0.156   16.544  1.00 34.13 ? 449  HIS B CB  1 
ATOM   3743 C CG  . HIS B 1 239 ? -9.316  -0.547  15.492  1.00 34.84 ? 449  HIS B CG  1 
ATOM   3744 N ND1 . HIS B 1 239 ? -8.859  0.088   14.355  1.00 34.84 ? 449  HIS B ND1 1 
ATOM   3745 C CD2 . HIS B 1 239 ? -8.934  -1.841  15.381  1.00 34.61 ? 449  HIS B CD2 1 
ATOM   3746 C CE1 . HIS B 1 239 ? -8.208  -0.780  13.603  1.00 34.74 ? 449  HIS B CE1 1 
ATOM   3747 N NE2 . HIS B 1 239 ? -8.243  -1.958  14.200  1.00 35.03 ? 449  HIS B NE2 1 
ATOM   3748 N N   . ALA B 1 240 ? -12.575 -1.792  16.769  1.00 35.14 ? 450  ALA B N   1 
ATOM   3749 C CA  . ALA B 1 240 ? -13.225 -3.080  16.541  1.00 35.87 ? 450  ALA B CA  1 
ATOM   3750 C C   . ALA B 1 240 ? -14.520 -2.910  15.745  1.00 36.60 ? 450  ALA B C   1 
ATOM   3751 O O   . ALA B 1 240 ? -14.781 -3.662  14.796  1.00 36.10 ? 450  ALA B O   1 
ATOM   3752 C CB  . ALA B 1 240 ? -13.483 -3.790  17.866  1.00 35.46 ? 450  ALA B CB  1 
ATOM   3753 N N   . GLN B 1 241 ? -15.308 -1.902  16.120  1.00 37.72 ? 451  GLN B N   1 
ATOM   3754 C CA  . GLN B 1 241 ? -16.563 -1.588  15.426  1.00 39.11 ? 451  GLN B CA  1 
ATOM   3755 C C   . GLN B 1 241 ? -16.352 -1.243  13.954  1.00 39.50 ? 451  GLN B C   1 
ATOM   3756 O O   . GLN B 1 241 ? -16.966 -1.852  13.082  1.00 39.30 ? 451  GLN B O   1 
ATOM   3757 C CB  . GLN B 1 241 ? -17.340 -0.497  16.168  1.00 38.96 ? 451  GLN B CB  1 
ATOM   3758 C CG  . GLN B 1 241 ? -18.078 -1.046  17.399  1.00 40.16 ? 451  GLN B CG  1 
ATOM   3759 C CD  . GLN B 1 241 ? -18.646 0.026   18.319  1.00 40.00 ? 451  GLN B CD  1 
ATOM   3760 O OE1 . GLN B 1 241 ? -18.574 1.225   18.038  1.00 42.29 ? 451  GLN B OE1 1 
ATOM   3761 N NE2 . GLN B 1 241 ? -19.217 -0.412  19.429  1.00 40.44 ? 451  GLN B NE2 1 
ATOM   3762 N N   . MET B 1 242 ? -15.466 -0.285  13.686  1.00 40.29 ? 452  MET B N   1 
ATOM   3763 C CA  . MET B 1 242 ? -15.054 0.033   12.318  1.00 41.51 ? 452  MET B CA  1 
ATOM   3764 C C   . MET B 1 242 ? -14.658 -1.229  11.533  1.00 41.26 ? 452  MET B C   1 
ATOM   3765 O O   . MET B 1 242 ? -15.032 -1.386  10.365  1.00 41.36 ? 452  MET B O   1 
ATOM   3766 C CB  . MET B 1 242 ? -13.903 1.047   12.321  1.00 41.27 ? 452  MET B CB  1 
ATOM   3767 C CG  . MET B 1 242 ? -14.298 2.440   12.803  1.00 42.42 ? 452  MET B CG  1 
ATOM   3768 S SD  . MET B 1 242 ? -12.932 3.628   12.746  1.00 43.91 ? 452  MET B SD  1 
ATOM   3769 C CE  . MET B 1 242 ? -12.207 3.413   14.363  1.00 42.60 ? 452  MET B CE  1 
ATOM   3770 N N   . MET B 1 243 ? -13.921 -2.125  12.191  1.00 41.26 ? 453  MET B N   1 
ATOM   3771 C CA  . MET B 1 243 ? -13.454 -3.377  11.592  1.00 41.10 ? 453  MET B CA  1 
ATOM   3772 C C   . MET B 1 243 ? -14.593 -4.357  11.287  1.00 41.69 ? 453  MET B C   1 
ATOM   3773 O O   . MET B 1 243 ? -14.573 -5.025  10.247  1.00 41.41 ? 453  MET B O   1 
ATOM   3774 C CB  . MET B 1 243 ? -12.393 -4.043  12.481  1.00 40.86 ? 453  MET B CB  1 
ATOM   3775 C CG  . MET B 1 243 ? -11.076 -3.260  12.624  1.00 39.79 ? 453  MET B CG  1 
ATOM   3776 S SD  . MET B 1 243 ? -10.203 -2.964  11.069  1.00 36.38 ? 453  MET B SD  1 
ATOM   3777 C CE  . MET B 1 243 ? -9.323  -4.510  10.863  1.00 37.38 ? 453  MET B CE  1 
ATOM   3778 N N   . GLN B 1 244 ? -15.570 -4.441  12.195  1.00 42.41 ? 454  GLN B N   1 
ATOM   3779 C CA  . GLN B 1 244 ? -16.762 -5.288  12.013  1.00 43.20 ? 454  GLN B CA  1 
ATOM   3780 C C   . GLN B 1 244 ? -17.537 -4.813  10.782  1.00 43.36 ? 454  GLN B C   1 
ATOM   3781 O O   . GLN B 1 244 ? -17.920 -5.621  9.933   1.00 43.05 ? 454  GLN B O   1 
ATOM   3782 C CB  . GLN B 1 244 ? -17.678 -5.270  13.260  1.00 43.00 ? 454  GLN B CB  1 
ATOM   3783 C CG  . GLN B 1 244 ? -17.123 -5.961  14.522  1.00 43.76 ? 454  GLN B CG  1 
ATOM   3784 C CD  . GLN B 1 244 ? -17.850 -5.552  15.821  1.00 44.01 ? 454  GLN B CD  1 
ATOM   3785 O OE1 . GLN B 1 244 ? -19.072 -5.678  15.939  1.00 46.15 ? 454  GLN B OE1 1 
ATOM   3786 N NE2 . GLN B 1 244 ? -17.089 -5.075  16.799  1.00 44.93 ? 454  GLN B NE2 1 
ATOM   3787 N N   . ARG B 1 245 ? -17.742 -3.500  10.687  1.00 43.76 ? 455  ARG B N   1 
ATOM   3788 C CA  . ARG B 1 245 ? -18.430 -2.893  9.551   1.00 44.69 ? 455  ARG B CA  1 
ATOM   3789 C C   . ARG B 1 245 ? -17.779 -3.246  8.211   1.00 44.96 ? 455  ARG B C   1 
ATOM   3790 O O   . ARG B 1 245 ? -18.478 -3.611  7.266   1.00 45.05 ? 455  ARG B O   1 
ATOM   3791 C CB  . ARG B 1 245 ? -18.522 -1.374  9.720   1.00 45.12 ? 455  ARG B CB  1 
ATOM   3792 C CG  . ARG B 1 245 ? -19.827 -0.882  10.339  1.00 46.60 ? 455  ARG B CG  1 
ATOM   3793 C CD  . ARG B 1 245 ? -20.926 -0.656  9.281   1.00 49.90 ? 455  ARG B CD  1 
ATOM   3794 N NE  . ARG B 1 245 ? -22.229 -0.499  9.926   1.00 52.21 ? 455  ARG B NE  1 
ATOM   3795 C CZ  . ARG B 1 245 ? -22.751 0.665   10.305  1.00 53.78 ? 455  ARG B CZ  1 
ATOM   3796 N NH1 . ARG B 1 245 ? -22.095 1.800   10.087  1.00 54.94 ? 455  ARG B NH1 1 
ATOM   3797 N NH2 . ARG B 1 245 ? -23.934 0.695   10.908  1.00 54.22 ? 455  ARG B NH2 1 
ATOM   3798 N N   . ILE B 1 246 ? -16.449 -3.148  8.141   1.00 45.12 ? 456  ILE B N   1 
ATOM   3799 C CA  . ILE B 1 246 ? -15.687 -3.501  6.938   1.00 45.31 ? 456  ILE B CA  1 
ATOM   3800 C C   . ILE B 1 246 ? -15.926 -4.956  6.500   1.00 45.76 ? 456  ILE B C   1 
ATOM   3801 O O   . ILE B 1 246 ? -16.061 -5.222  5.309   1.00 45.55 ? 456  ILE B O   1 
ATOM   3802 C CB  . ILE B 1 246 ? -14.159 -3.216  7.118   1.00 45.34 ? 456  ILE B CB  1 
ATOM   3803 C CG1 . ILE B 1 246 ? -13.904 -1.714  7.283   1.00 45.13 ? 456  ILE B CG1 1 
ATOM   3804 C CG2 . ILE B 1 246 ? -13.343 -3.765  5.946   1.00 44.75 ? 456  ILE B CG2 1 
ATOM   3805 C CD1 . ILE B 1 246 ? -12.517 -1.366  7.808   1.00 45.22 ? 456  ILE B CD1 1 
ATOM   3806 N N   . LYS B 1 247 ? -15.993 -5.880  7.464   1.00 46.35 ? 457  LYS B N   1 
ATOM   3807 C CA  . LYS B 1 247 ? -16.249 -7.300  7.185   1.00 47.15 ? 457  LYS B CA  1 
ATOM   3808 C C   . LYS B 1 247 ? -17.591 -7.518  6.486   1.00 47.75 ? 457  LYS B C   1 
ATOM   3809 O O   . LYS B 1 247 ? -17.702 -8.367  5.611   1.00 47.97 ? 457  LYS B O   1 
ATOM   3810 C CB  . LYS B 1 247 ? -16.190 -8.146  8.471   1.00 47.24 ? 457  LYS B CB  1 
ATOM   3811 C CG  . LYS B 1 247 ? -16.292 -9.661  8.223   1.00 47.36 ? 457  LYS B CG  1 
ATOM   3812 C CD  . LYS B 1 247 ? -16.637 -10.461 9.473   1.00 47.23 ? 457  LYS B CD  1 
ATOM   3813 C CE  . LYS B 1 247 ? -16.848 -11.942 9.128   1.00 48.02 ? 457  LYS B CE  1 
ATOM   3814 N NZ  . LYS B 1 247 ? -16.636 -12.876 10.290  1.00 47.88 ? 457  LYS B NZ  1 
ATOM   3815 N N   . LYS B 1 248 ? -18.595 -6.742  6.884   1.00 48.62 ? 458  LYS B N   1 
ATOM   3816 C CA  . LYS B 1 248 ? -19.956 -6.857  6.369   1.00 49.42 ? 458  LYS B CA  1 
ATOM   3817 C C   . LYS B 1 248 ? -20.123 -6.168  5.010   1.00 49.83 ? 458  LYS B C   1 
ATOM   3818 O O   . LYS B 1 248 ? -20.760 -6.714  4.106   1.00 49.87 ? 458  LYS B O   1 
ATOM   3819 C CB  . LYS B 1 248 ? -20.951 -6.278  7.394   1.00 49.49 ? 458  LYS B CB  1 
ATOM   3820 C CG  . LYS B 1 248 ? -22.439 -6.294  6.965   1.00 50.34 ? 458  LYS B CG  1 
ATOM   3821 C CD  . LYS B 1 248 ? -23.090 -7.680  7.088   1.00 51.17 ? 458  LYS B CD  1 
ATOM   3822 C CE  . LYS B 1 248 ? -23.670 -7.928  8.479   1.00 52.18 ? 458  LYS B CE  1 
ATOM   3823 N NZ  . LYS B 1 248 ? -22.675 -7.702  9.573   1.00 53.36 ? 458  LYS B NZ  1 
ATOM   3824 N N   . THR B 1 249 ? -19.542 -4.977  4.873   1.00 50.34 ? 459  THR B N   1 
ATOM   3825 C CA  . THR B 1 249 ? -19.758 -4.144  3.687   1.00 50.65 ? 459  THR B CA  1 
ATOM   3826 C C   . THR B 1 249 ? -18.716 -4.340  2.572   1.00 50.98 ? 459  THR B C   1 
ATOM   3827 O O   . THR B 1 249 ? -19.083 -4.453  1.398   1.00 51.29 ? 459  THR B O   1 
ATOM   3828 C CB  . THR B 1 249 ? -19.930 -2.645  4.061   1.00 50.55 ? 459  THR B CB  1 
ATOM   3829 O OG1 . THR B 1 249 ? -20.362 -1.913  2.914   1.00 50.82 ? 459  THR B OG1 1 
ATOM   3830 C CG2 . THR B 1 249 ? -18.634 -2.034  4.593   1.00 50.69 ? 459  THR B CG2 1 
ATOM   3831 N N   . GLU B 1 250 ? -17.434 -4.382  2.942   1.00 51.20 ? 460  GLU B N   1 
ATOM   3832 C CA  . GLU B 1 250 ? -16.320 -4.456  1.985   1.00 51.35 ? 460  GLU B CA  1 
ATOM   3833 C C   . GLU B 1 250 ? -15.925 -5.905  1.712   1.00 51.67 ? 460  GLU B C   1 
ATOM   3834 O O   . GLU B 1 250 ? -14.773 -6.292  1.927   1.00 51.91 ? 460  GLU B O   1 
ATOM   3835 C CB  . GLU B 1 250 ? -15.094 -3.708  2.525   1.00 51.19 ? 460  GLU B CB  1 
ATOM   3836 C CG  . GLU B 1 250 ? -15.299 -2.238  2.833   1.00 50.85 ? 460  GLU B CG  1 
ATOM   3837 C CD  . GLU B 1 250 ? -15.346 -1.379  1.589   1.00 50.31 ? 460  GLU B CD  1 
ATOM   3838 O OE1 . GLU B 1 250 ? -14.585 -1.648  0.633   1.00 49.12 ? 460  GLU B OE1 1 
ATOM   3839 O OE2 . GLU B 1 250 ? -16.144 -0.421  1.570   1.00 50.63 ? 460  GLU B OE2 1 
ATOM   3840 N N   . THR B 1 251 ? -16.873 -6.698  1.223   1.00 51.86 ? 461  THR B N   1 
ATOM   3841 C CA  . THR B 1 251 ? -16.695 -8.148  1.117   1.00 52.00 ? 461  THR B CA  1 
ATOM   3842 C C   . THR B 1 251 ? -15.525 -8.597  0.235   1.00 51.93 ? 461  THR B C   1 
ATOM   3843 O O   . THR B 1 251 ? -15.039 -9.731  0.369   1.00 52.24 ? 461  THR B O   1 
ATOM   3844 C CB  . THR B 1 251 ? -17.984 -8.828  0.644   1.00 52.25 ? 461  THR B CB  1 
ATOM   3845 O OG1 . THR B 1 251 ? -18.567 -8.049  -0.410  1.00 52.53 ? 461  THR B OG1 1 
ATOM   3846 C CG2 . THR B 1 251 ? -18.978 -8.944  1.805   1.00 52.15 ? 461  THR B CG2 1 
ATOM   3847 N N   . GLU B 1 252 ? -15.071 -7.715  -0.652  1.00 51.42 ? 462  GLU B N   1 
ATOM   3848 C CA  . GLU B 1 252 ? -13.929 -8.022  -1.521  1.00 51.06 ? 462  GLU B CA  1 
ATOM   3849 C C   . GLU B 1 252 ? -12.613 -8.031  -0.740  1.00 50.08 ? 462  GLU B C   1 
ATOM   3850 O O   . GLU B 1 252 ? -11.680 -8.741  -1.108  1.00 50.07 ? 462  GLU B O   1 
ATOM   3851 C CB  . GLU B 1 252 ? -13.823 -7.035  -2.698  1.00 51.50 ? 462  GLU B CB  1 
ATOM   3852 C CG  . GLU B 1 252 ? -15.138 -6.371  -3.151  1.00 52.86 ? 462  GLU B CG  1 
ATOM   3853 C CD  . GLU B 1 252 ? -16.202 -7.357  -3.611  1.00 54.43 ? 462  GLU B CD  1 
ATOM   3854 O OE1 . GLU B 1 252 ? -15.853 -8.376  -4.257  1.00 55.31 ? 462  GLU B OE1 1 
ATOM   3855 O OE2 . GLU B 1 252 ? -17.393 -7.096  -3.330  1.00 54.87 ? 462  GLU B OE2 1 
ATOM   3856 N N   . THR B 1 253 ? -12.556 -7.242  0.332   1.00 48.84 ? 463  THR B N   1 
ATOM   3857 C CA  . THR B 1 253 ? -11.350 -7.082  1.140   1.00 47.74 ? 463  THR B CA  1 
ATOM   3858 C C   . THR B 1 253 ? -11.087 -8.307  2.016   1.00 46.99 ? 463  THR B C   1 
ATOM   3859 O O   . THR B 1 253 ? -11.969 -8.762  2.749   1.00 46.92 ? 463  THR B O   1 
ATOM   3860 C CB  . THR B 1 253 ? -11.447 -5.834  2.049   1.00 47.83 ? 463  THR B CB  1 
ATOM   3861 O OG1 . THR B 1 253 ? -12.087 -4.765  1.341   1.00 47.65 ? 463  THR B OG1 1 
ATOM   3862 C CG2 . THR B 1 253 ? -10.070 -5.386  2.494   1.00 47.98 ? 463  THR B CG2 1 
ATOM   3863 N N   . SER B 1 254 ? -9.868  -8.832  1.943   1.00 45.74 ? 464  SER B N   1 
ATOM   3864 C CA  . SER B 1 254 ? -9.483  -9.953  2.790   1.00 44.80 ? 464  SER B CA  1 
ATOM   3865 C C   . SER B 1 254 ? -9.064  -9.512  4.198   1.00 43.98 ? 464  SER B C   1 
ATOM   3866 O O   . SER B 1 254 ? -8.309  -8.547  4.368   1.00 43.78 ? 464  SER B O   1 
ATOM   3867 C CB  . SER B 1 254 ? -8.386  -10.782 2.127   1.00 44.87 ? 464  SER B CB  1 
ATOM   3868 O OG  . SER B 1 254 ? -8.933  -11.623 1.122   1.00 45.54 ? 464  SER B OG  1 
ATOM   3869 N N   . LEU B 1 255 ? -9.576  -10.215 5.204   1.00 42.68 ? 465  LEU B N   1 
ATOM   3870 C CA  . LEU B 1 255 ? -9.155  -10.002 6.584   1.00 41.47 ? 465  LEU B CA  1 
ATOM   3871 C C   . LEU B 1 255 ? -8.300  -11.169 7.062   1.00 40.36 ? 465  LEU B C   1 
ATOM   3872 O O   . LEU B 1 255 ? -8.694  -12.329 6.939   1.00 40.40 ? 465  LEU B O   1 
ATOM   3873 C CB  . LEU B 1 255 ? -10.357 -9.823  7.517   1.00 41.60 ? 465  LEU B CB  1 
ATOM   3874 C CG  . LEU B 1 255 ? -11.548 -8.923  7.184   1.00 42.12 ? 465  LEU B CG  1 
ATOM   3875 C CD1 . LEU B 1 255 ? -11.125 -7.610  6.496   1.00 43.23 ? 465  LEU B CD1 1 
ATOM   3876 C CD2 . LEU B 1 255 ? -12.587 -9.681  6.355   1.00 43.30 ? 465  LEU B CD2 1 
ATOM   3877 N N   . HIS B 1 256 ? -7.128  -10.853 7.600   1.00 39.08 ? 466  HIS B N   1 
ATOM   3878 C CA  . HIS B 1 256 ? -6.235  -11.851 8.184   1.00 37.93 ? 466  HIS B CA  1 
ATOM   3879 C C   . HIS B 1 256 ? -6.986  -12.632 9.282   1.00 37.42 ? 466  HIS B C   1 
ATOM   3880 O O   . HIS B 1 256 ? -7.689  -12.026 10.103  1.00 37.03 ? 466  HIS B O   1 
ATOM   3881 C CB  . HIS B 1 256 ? -4.994  -11.153 8.754   1.00 37.71 ? 466  HIS B CB  1 
ATOM   3882 C CG  . HIS B 1 256 ? -3.852  -12.076 9.041   1.00 37.28 ? 466  HIS B CG  1 
ATOM   3883 N ND1 . HIS B 1 256 ? -3.829  -12.915 10.136  1.00 36.68 ? 466  HIS B ND1 1 
ATOM   3884 C CD2 . HIS B 1 256 ? -2.685  -12.280 8.383   1.00 35.75 ? 466  HIS B CD2 1 
ATOM   3885 C CE1 . HIS B 1 256 ? -2.700  -13.603 10.135  1.00 36.72 ? 466  HIS B CE1 1 
ATOM   3886 N NE2 . HIS B 1 256 ? -1.986  -13.231 9.085   1.00 36.51 ? 466  HIS B NE2 1 
ATOM   3887 N N   . PRO B 1 257 ? -6.865  -13.974 9.280   1.00 36.84 ? 467  PRO B N   1 
ATOM   3888 C CA  . PRO B 1 257 ? -7.603  -14.832 10.224  1.00 36.52 ? 467  PRO B CA  1 
ATOM   3889 C C   . PRO B 1 257 ? -7.286  -14.602 11.715  1.00 36.21 ? 467  PRO B C   1 
ATOM   3890 O O   . PRO B 1 257 ? -8.181  -14.734 12.543  1.00 36.05 ? 467  PRO B O   1 
ATOM   3891 C CB  . PRO B 1 257 ? -7.225  -16.248 9.789   1.00 36.58 ? 467  PRO B CB  1 
ATOM   3892 C CG  . PRO B 1 257 ? -5.928  -16.087 9.027   1.00 36.93 ? 467  PRO B CG  1 
ATOM   3893 C CD  . PRO B 1 257 ? -6.036  -14.763 8.347   1.00 37.01 ? 467  PRO B CD  1 
ATOM   3894 N N   . LEU B 1 258 ? -6.043  -14.237 12.042  1.00 35.81 ? 468  LEU B N   1 
ATOM   3895 C CA  . LEU B 1 258 ? -5.667  -13.858 13.408  1.00 35.66 ? 468  LEU B CA  1 
ATOM   3896 C C   . LEU B 1 258 ? -6.494  -12.665 13.932  1.00 35.91 ? 468  LEU B C   1 
ATOM   3897 O O   . LEU B 1 258 ? -7.016  -12.694 15.057  1.00 35.51 ? 468  LEU B O   1 
ATOM   3898 C CB  . LEU B 1 258 ? -4.182  -13.496 13.461  1.00 35.81 ? 468  LEU B CB  1 
ATOM   3899 C CG  . LEU B 1 258 ? -3.317  -13.792 14.690  1.00 35.19 ? 468  LEU B CG  1 
ATOM   3900 C CD1 . LEU B 1 258 ? -2.363  -12.648 14.903  1.00 33.60 ? 468  LEU B CD1 1 
ATOM   3901 C CD2 . LEU B 1 258 ? -4.141  -14.029 15.935  1.00 36.31 ? 468  LEU B CD2 1 
ATOM   3902 N N   . LEU B 1 259 ? -6.604  -11.629 13.102  1.00 35.72 ? 469  LEU B N   1 
ATOM   3903 C CA  . LEU B 1 259 ? -7.347  -10.413 13.440  1.00 35.99 ? 469  LEU B CA  1 
ATOM   3904 C C   . LEU B 1 259 ? -8.836  -10.692 13.602  1.00 36.42 ? 469  LEU B C   1 
ATOM   3905 O O   . LEU B 1 259 ? -9.496  -10.092 14.451  1.00 36.56 ? 469  LEU B O   1 
ATOM   3906 C CB  . LEU B 1 259 ? -7.122  -9.337  12.372  1.00 35.53 ? 469  LEU B CB  1 
ATOM   3907 C CG  . LEU B 1 259 ? -5.680  -8.886  12.118  1.00 34.90 ? 469  LEU B CG  1 
ATOM   3908 C CD1 . LEU B 1 259 ? -5.652  -7.829  11.014  1.00 34.60 ? 469  LEU B CD1 1 
ATOM   3909 C CD2 . LEU B 1 259 ? -4.998  -8.360  13.403  1.00 34.16 ? 469  LEU B CD2 1 
ATOM   3910 N N   . GLN B 1 260 ? -9.341  -11.605 12.776  1.00 37.05 ? 470  GLN B N   1 
ATOM   3911 C CA  . GLN B 1 260 ? -10.715 -12.103 12.844  1.00 38.06 ? 470  GLN B CA  1 
ATOM   3912 C C   . GLN B 1 260 ? -11.015 -12.761 14.198  1.00 38.23 ? 470  GLN B C   1 
ATOM   3913 O O   . GLN B 1 260 ? -12.070 -12.517 14.779  1.00 38.04 ? 470  GLN B O   1 
ATOM   3914 C CB  . GLN B 1 260 ? -10.953 -13.105 11.710  1.00 38.28 ? 470  GLN B CB  1 
ATOM   3915 C CG  . GLN B 1 260 ? -12.419 -13.431 11.436  1.00 40.19 ? 470  GLN B CG  1 
ATOM   3916 C CD  . GLN B 1 260 ? -12.931 -12.820 10.144  1.00 42.41 ? 470  GLN B CD  1 
ATOM   3917 O OE1 . GLN B 1 260 ? -13.728 -11.882 10.170  1.00 44.02 ? 470  GLN B OE1 1 
ATOM   3918 N NE2 . GLN B 1 260 ? -12.468 -13.344 9.004   1.00 42.09 ? 470  GLN B NE2 1 
ATOM   3919 N N   . GLU B 1 261 ? -10.087 -13.590 14.685  1.00 38.82 ? 471  GLU B N   1 
ATOM   3920 C CA  . GLU B 1 261 ? -10.202 -14.217 16.013  1.00 39.62 ? 471  GLU B CA  1 
ATOM   3921 C C   . GLU B 1 261 ? -10.343 -13.173 17.106  1.00 39.91 ? 471  GLU B C   1 
ATOM   3922 O O   . GLU B 1 261 ? -11.241 -13.273 17.944  1.00 40.18 ? 471  GLU B O   1 
ATOM   3923 C CB  . GLU B 1 261 ? -8.987  -15.098 16.346  1.00 39.72 ? 471  GLU B CB  1 
ATOM   3924 C CG  . GLU B 1 261 ? -8.755  -16.293 15.440  1.00 40.44 ? 471  GLU B CG  1 
ATOM   3925 C CD  . GLU B 1 261 ? -9.916  -17.273 15.418  1.00 41.66 ? 471  GLU B CD  1 
ATOM   3926 O OE1 . GLU B 1 261 ? -10.758 -17.262 16.352  1.00 42.71 ? 471  GLU B OE1 1 
ATOM   3927 O OE2 . GLU B 1 261 ? -9.976  -18.065 14.455  1.00 41.53 ? 471  GLU B OE2 1 
ATOM   3928 N N   . ILE B 1 262 ? -9.453  -12.178 17.081  1.00 40.22 ? 472  ILE B N   1 
ATOM   3929 C CA  . ILE B 1 262 ? -9.407  -11.107 18.084  1.00 40.40 ? 472  ILE B CA  1 
ATOM   3930 C C   . ILE B 1 262 ? -10.726 -10.328 18.146  1.00 41.20 ? 472  ILE B C   1 
ATOM   3931 O O   . ILE B 1 262 ? -11.278 -10.131 19.230  1.00 41.25 ? 472  ILE B O   1 
ATOM   3932 C CB  . ILE B 1 262 ? -8.185  -10.146 17.838  1.00 40.37 ? 472  ILE B CB  1 
ATOM   3933 C CG1 . ILE B 1 262 ? -6.864  -10.878 18.097  1.00 39.77 ? 472  ILE B CG1 1 
ATOM   3934 C CG2 . ILE B 1 262 ? -8.285  -8.871  18.684  1.00 39.70 ? 472  ILE B CG2 1 
ATOM   3935 C CD1 . ILE B 1 262 ? -5.616  -10.132 17.651  1.00 40.24 ? 472  ILE B CD1 1 
ATOM   3936 N N   . TYR B 1 263 ? -11.237 -9.913  16.987  1.00 42.07 ? 473  TYR B N   1 
ATOM   3937 C CA  . TYR B 1 263 ? -12.405 -9.027  16.932  1.00 43.09 ? 473  TYR B CA  1 
ATOM   3938 C C   . TYR B 1 263 ? -13.737 -9.748  17.082  1.00 43.95 ? 473  TYR B C   1 
ATOM   3939 O O   . TYR B 1 263 ? -14.730 -9.142  17.483  1.00 44.08 ? 473  TYR B O   1 
ATOM   3940 C CB  . TYR B 1 263 ? -12.400 -8.205  15.636  1.00 42.89 ? 473  TYR B CB  1 
ATOM   3941 C CG  . TYR B 1 263 ? -11.232 -7.262  15.546  1.00 42.91 ? 473  TYR B CG  1 
ATOM   3942 C CD1 . TYR B 1 263 ? -10.873 -6.475  16.640  1.00 42.45 ? 473  TYR B CD1 1 
ATOM   3943 C CD2 . TYR B 1 263 ? -10.481 -7.151  14.372  1.00 42.65 ? 473  TYR B CD2 1 
ATOM   3944 C CE1 . TYR B 1 263 ? -9.803  -5.612  16.576  1.00 42.15 ? 473  TYR B CE1 1 
ATOM   3945 C CE2 . TYR B 1 263 ? -9.399  -6.280  14.301  1.00 41.83 ? 473  TYR B CE2 1 
ATOM   3946 C CZ  . TYR B 1 263 ? -9.071  -5.517  15.411  1.00 41.77 ? 473  TYR B CZ  1 
ATOM   3947 O OH  . TYR B 1 263 ? -8.012  -4.646  15.381  1.00 42.41 ? 473  TYR B OH  1 
ATOM   3948 N N   . LYS B 1 264 ? -13.740 -11.038 16.759  1.00 45.03 ? 474  LYS B N   1 
ATOM   3949 C CA  . LYS B 1 264 ? -14.940 -11.879 16.744  1.00 46.25 ? 474  LYS B CA  1 
ATOM   3950 C C   . LYS B 1 264 ? -15.891 -11.659 17.932  1.00 46.87 ? 474  LYS B C   1 
ATOM   3951 O O   . LYS B 1 264 ? -17.115 -11.609 17.760  1.00 47.04 ? 474  LYS B O   1 
ATOM   3952 C CB  . LYS B 1 264 ? -14.516 -13.350 16.680  1.00 46.20 ? 474  LYS B CB  1 
ATOM   3953 C CG  . LYS B 1 264 ? -15.632 -14.334 16.412  1.00 47.09 ? 474  LYS B CG  1 
ATOM   3954 C CD  . LYS B 1 264 ? -15.070 -15.725 16.120  1.00 48.19 ? 474  LYS B CD  1 
ATOM   3955 C CE  . LYS B 1 264 ? -14.341 -16.309 17.318  1.00 47.73 ? 474  LYS B CE  1 
ATOM   3956 N NZ  . LYS B 1 264 ? -13.383 -17.357 16.888  1.00 48.61 ? 474  LYS B NZ  1 
ATOM   3957 N N   . ASP B 1 265 ? -15.323 -11.514 19.125  1.00 47.48 ? 475  ASP B N   1 
ATOM   3958 C CA  . ASP B 1 265 ? -16.115 -11.503 20.353  1.00 48.19 ? 475  ASP B CA  1 
ATOM   3959 C C   . ASP B 1 265 ? -16.369 -10.121 20.962  1.00 48.29 ? 475  ASP B C   1 
ATOM   3960 O O   . ASP B 1 265 ? -17.117 -9.993  21.929  1.00 48.46 ? 475  ASP B O   1 
ATOM   3961 C CB  . ASP B 1 265 ? -15.475 -12.451 21.364  1.00 48.27 ? 475  ASP B CB  1 
ATOM   3962 C CG  . ASP B 1 265 ? -15.400 -13.870 20.843  1.00 49.68 ? 475  ASP B CG  1 
ATOM   3963 O OD1 . ASP B 1 265 ? -16.434 -14.379 20.354  1.00 51.93 ? 475  ASP B OD1 1 
ATOM   3964 O OD2 . ASP B 1 265 ? -14.312 -14.479 20.904  1.00 51.35 ? 475  ASP B OD2 1 
ATOM   3965 N N   . MET B 1 266 ? -15.764 -9.088  20.383  1.00 48.51 ? 476  MET B N   1 
ATOM   3966 C CA  . MET B 1 266 ? -15.937 -7.730  20.878  1.00 48.83 ? 476  MET B CA  1 
ATOM   3967 C C   . MET B 1 266 ? -17.248 -7.129  20.368  1.00 49.13 ? 476  MET B C   1 
ATOM   3968 O O   . MET B 1 266 ? -17.696 -7.447  19.264  1.00 48.98 ? 476  MET B O   1 
ATOM   3969 C CB  . MET B 1 266 ? -14.745 -6.859  20.477  1.00 48.71 ? 476  MET B CB  1 
ATOM   3970 C CG  . MET B 1 266 ? -13.422 -7.306  21.086  1.00 48.65 ? 476  MET B CG  1 
ATOM   3971 S SD  . MET B 1 266 ? -12.003 -6.554  20.267  1.00 49.13 ? 476  MET B SD  1 
ATOM   3972 C CE  . MET B 1 266 ? -10.627 -7.228  21.206  1.00 48.45 ? 476  MET B CE  1 
ATOM   3973 N N   . TYR B 1 267 ? -17.867 -6.280  21.190  1.00 49.38 ? 477  TYR B N   1 
ATOM   3974 C CA  . TYR B 1 267 ? -19.089 -5.575  20.810  1.00 49.76 ? 477  TYR B CA  1 
ATOM   3975 C C   . TYR B 1 267 ? -18.929 -4.070  20.989  1.00 50.00 ? 477  TYR B C   1 
ATOM   3976 O O   . TYR B 1 267 ? -19.323 -3.302  20.109  1.00 50.14 ? 477  TYR B O   1 
ATOM   3977 C CB  . TYR B 1 267 ? -20.305 -6.088  21.595  1.00 49.75 ? 477  TYR B CB  1 
ATOM   3978 C CG  . TYR B 1 267 ? -20.100 -6.147  23.087  1.00 49.71 ? 477  TYR B CG  1 
ATOM   3979 C CD1 . TYR B 1 267 ? -20.386 -5.047  23.897  1.00 50.21 ? 477  TYR B CD1 1 
ATOM   3980 C CD2 . TYR B 1 267 ? -19.619 -7.308  23.694  1.00 49.79 ? 477  TYR B CD2 1 
ATOM   3981 C CE1 . TYR B 1 267 ? -20.190 -5.099  25.284  1.00 50.06 ? 477  TYR B CE1 1 
ATOM   3982 C CE2 . TYR B 1 267 ? -19.421 -7.374  25.076  1.00 49.82 ? 477  TYR B CE2 1 
ATOM   3983 C CZ  . TYR B 1 267 ? -19.710 -6.268  25.861  1.00 50.12 ? 477  TYR B CZ  1 
ATOM   3984 O OH  . TYR B 1 267 ? -19.512 -6.335  27.218  1.00 49.74 ? 477  TYR B OH  1 
ATOM   3985 O OXT . TYR B 1 267 ? -18.405 -3.591  22.004  1.00 50.28 ? 477  TYR B OXT 1 
HETATM 3986 C C5  . B7G C 2 .   ? -9.008  -19.141 21.414  1.00 39.15 ? 920  B7G A C5  1 
HETATM 3987 O O5  . B7G C 2 .   ? -8.386  -18.169 20.570  1.00 37.92 ? 920  B7G A O5  1 
HETATM 3988 C C1  . B7G C 2 .   ? -9.012  -16.892 20.486  1.00 37.84 ? 920  B7G A C1  1 
HETATM 3989 C C2  . B7G C 2 .   ? -10.479 -17.031 20.046  1.00 39.44 ? 920  B7G A C2  1 
HETATM 3990 C C3  . B7G C 2 .   ? -11.239 -18.064 20.893  1.00 39.65 ? 920  B7G A C3  1 
HETATM 3991 C C4  . B7G C 2 .   ? -10.457 -19.375 20.988  1.00 39.37 ? 920  B7G A C4  1 
HETATM 3992 C C6  . B7G C 2 .   ? -8.225  -20.445 21.287  1.00 38.77 ? 920  B7G A C6  1 
HETATM 3993 O O1  . B7G C 2 .   ? -8.245  -16.183 19.517  1.00 35.42 ? 920  B7G A O1  1 
HETATM 3994 C C7  . B7G C 2 .   ? -7.812  -14.907 19.961  1.00 35.36 ? 920  B7G A C7  1 
HETATM 3995 C C8  . B7G C 2 .   ? -6.338  -14.934 20.328  1.00 35.53 ? 920  B7G A C8  1 
HETATM 3996 C C9  . B7G C 2 .   ? -5.494  -14.153 19.327  1.00 34.72 ? 920  B7G A C9  1 
HETATM 3997 C C10 . B7G C 2 .   ? -4.407  -13.384 20.063  1.00 35.01 ? 920  B7G A C10 1 
HETATM 3998 C C11 . B7G C 2 .   ? -3.041  -13.576 19.417  1.00 35.14 ? 920  B7G A C11 1 
HETATM 3999 C C12 . B7G C 2 .   ? -2.128  -14.463 20.256  1.00 35.30 ? 920  B7G A C12 1 
HETATM 4000 O O2  . B7G C 2 .   ? -11.152 -15.763 20.125  1.00 40.91 ? 920  B7G A O2  1 
HETATM 4001 O O3  . B7G C 2 .   ? -12.535 -18.343 20.331  1.00 38.54 ? 920  B7G A O3  1 
HETATM 4002 O O4  . B7G C 2 .   ? -11.084 -20.249 21.928  1.00 38.67 ? 920  B7G A O4  1 
HETATM 4003 O O6  . B7G C 2 .   ? -6.865  -20.226 21.655  1.00 38.18 ? 920  B7G A O6  1 
HETATM 4004 C C13 . B7G C 2 .   ? -0.982  -14.972 19.399  1.00 36.03 ? 920  B7G A C13 1 
HETATM 4005 C C5  . B7G D 2 .   ? -9.289  -20.452 25.153  1.00 50.17 ? 921  B7G A C5  1 
HETATM 4006 O O5  . B7G D 2 .   ? -9.062  -21.376 26.222  1.00 49.30 ? 921  B7G A O5  1 
HETATM 4007 C C1  . B7G D 2 .   ? -9.816  -22.589 26.102  1.00 49.53 ? 921  B7G A C1  1 
HETATM 4008 C C2  . B7G D 2 .   ? -11.306 -22.245 26.177  1.00 50.40 ? 921  B7G A C2  1 
HETATM 4009 C C3  . B7G D 2 .   ? -11.650 -21.226 25.088  1.00 50.85 ? 921  B7G A C3  1 
HETATM 4010 C C4  . B7G D 2 .   ? -10.750 -20.000 25.229  1.00 50.63 ? 921  B7G A C4  1 
HETATM 4011 C C6  . B7G D 2 .   ? -8.250  -19.325 25.199  1.00 49.34 ? 921  B7G A C6  1 
HETATM 4012 O O1  . B7G D 2 .   ? -9.436  -23.502 27.141  1.00 48.25 ? 921  B7G A O1  1 
HETATM 4013 C C7  . B7G D 2 .   ? -8.318  -24.301 26.752  1.00 46.65 ? 921  B7G A C7  1 
HETATM 4014 C C8  . B7G D 2 .   ? -7.646  -24.906 27.976  1.00 44.98 ? 921  B7G A C8  1 
HETATM 4015 C C9  . B7G D 2 .   ? -6.368  -25.623 27.559  1.00 44.09 ? 921  B7G A C9  1 
HETATM 4016 C C10 . B7G D 2 .   ? -5.137  -24.947 28.148  1.00 43.45 ? 921  B7G A C10 1 
HETATM 4017 C C11 . B7G D 2 .   ? -4.008  -25.947 28.367  1.00 42.56 ? 921  B7G A C11 1 
HETATM 4018 C C12 . B7G D 2 .   ? -2.651  -25.346 28.002  1.00 42.87 ? 921  B7G A C12 1 
HETATM 4019 O O2  . B7G D 2 .   ? -12.119 -23.415 26.026  1.00 50.14 ? 921  B7G A O2  1 
HETATM 4020 O O3  . B7G D 2 .   ? -13.034 -20.858 25.157  1.00 51.28 ? 921  B7G A O3  1 
HETATM 4021 O O4  . B7G D 2 .   ? -11.023 -19.082 24.175  1.00 51.21 ? 921  B7G A O4  1 
HETATM 4022 O O6  . B7G D 2 .   ? -8.730  -18.175 25.909  1.00 48.59 ? 921  B7G A O6  1 
HETATM 4023 C C13 . B7G D 2 .   ? -1.928  -24.757 29.207  1.00 41.85 ? 921  B7G A C13 1 
HETATM 4024 O O2  . VCA E 3 .   ? -8.733  -34.427 33.791  1.00 31.22 ? 201  VCA A O2  1 
HETATM 4025 C C1  . VCA E 3 .   ? -9.810  -35.016 34.042  1.00 33.11 ? 201  VCA A C1  1 
HETATM 4026 O O1  . VCA E 3 .   ? -10.639 -35.401 33.197  1.00 31.71 ? 201  VCA A O1  1 
HETATM 4027 C C2  . VCA E 3 .   ? -10.163 -35.288 35.519  1.00 34.03 ? 201  VCA A C2  1 
HETATM 4028 C C3  . VCA E 3 .   ? -9.546  -36.583 36.045  1.00 34.93 ? 201  VCA A C3  1 
HETATM 4029 C C4  . VCA E 3 .   ? -10.190 -37.805 35.401  1.00 36.79 ? 201  VCA A C4  1 
HETATM 4030 C C5  . VCA E 3 .   ? -9.580  -39.103 35.930  1.00 40.04 ? 201  VCA A C5  1 
HETATM 4031 C C6  . VCA E 3 .   ? -8.518  -39.636 34.963  1.00 43.14 ? 201  VCA A C6  1 
HETATM 4032 C C7  . VCA E 3 .   ? -7.883  -40.936 35.464  1.00 45.04 ? 201  VCA A C7  1 
HETATM 4033 C C8  . VCA E 3 .   ? -6.833  -40.656 36.544  1.00 46.48 ? 201  VCA A C8  1 
HETATM 4034 C C9  . VCA E 3 .   ? -5.409  -40.869 36.015  1.00 47.53 ? 201  VCA A C9  1 
HETATM 4035 C C10 . VCA E 3 .   ? -4.392  -40.244 36.977  1.00 47.57 ? 201  VCA A C10 1 
HETATM 4036 C C11 . VCA E 3 .   ? -3.773  -41.224 37.746  1.00 49.14 ? 201  VCA A C11 1 
HETATM 4037 C C12 . VCA E 3 .   ? -3.780  -41.283 39.147  1.00 49.71 ? 201  VCA A C12 1 
HETATM 4038 C C13 . VCA E 3 .   ? -4.410  -40.373 39.997  1.00 49.34 ? 201  VCA A C13 1 
HETATM 4039 C C14 . VCA E 3 .   ? -5.291  -41.110 41.019  1.00 49.35 ? 201  VCA A C14 1 
HETATM 4040 C C15 . VCA E 3 .   ? -4.517  -41.381 42.319  1.00 48.25 ? 201  VCA A C15 1 
HETATM 4041 C C16 . VCA E 3 .   ? -5.461  -41.775 43.460  1.00 46.65 ? 201  VCA A C16 1 
HETATM 4042 C C17 . VCA E 3 .   ? -4.682  -41.945 44.764  1.00 45.23 ? 201  VCA A C17 1 
HETATM 4043 C C18 . VCA E 3 .   ? -5.587  -41.745 45.970  1.00 44.22 ? 201  VCA A C18 1 
HETATM 4044 O O2  . VCA F 3 .   ? -7.044  -3.853  13.214  1.00 40.88 ? 478  VCA B O2  1 
HETATM 4045 C C1  . VCA F 3 .   ? -5.981  -4.178  12.644  1.00 42.50 ? 478  VCA B C1  1 
HETATM 4046 O O1  . VCA F 3 .   ? -5.116  -4.954  13.096  1.00 41.80 ? 478  VCA B O1  1 
HETATM 4047 C C2  . VCA F 3 .   ? -5.711  -3.566  11.267  1.00 43.21 ? 478  VCA B C2  1 
HETATM 4048 C C3  . VCA F 3 .   ? -5.221  -2.138  11.418  1.00 44.07 ? 478  VCA B C3  1 
HETATM 4049 C C4  . VCA F 3 .   ? -6.118  -1.194  10.635  1.00 46.94 ? 478  VCA B C4  1 
HETATM 4050 C C5  . VCA F 3 .   ? -6.046  0.232   11.199  1.00 48.08 ? 478  VCA B C5  1 
HETATM 4051 C C6  . VCA F 3 .   ? -4.676  0.855   10.969  1.00 49.17 ? 478  VCA B C6  1 
HETATM 4052 C C7  . VCA F 3 .   ? -4.046  1.331   12.280  1.00 49.34 ? 478  VCA B C7  1 
HETATM 4053 C C8  . VCA F 3 .   ? -2.648  1.894   12.021  1.00 50.44 ? 478  VCA B C8  1 
HETATM 4054 C C9  . VCA F 3 .   ? -1.641  0.790   11.668  1.00 50.80 ? 478  VCA B C9  1 
HETATM 4055 C C10 . VCA F 3 .   ? -0.341  1.408   11.154  1.00 51.41 ? 478  VCA B C10 1 
HETATM 4056 C C11 . VCA F 3 .   ? 0.424   0.480   10.454  1.00 51.51 ? 478  VCA B C11 1 
HETATM 4057 C C12 . VCA F 3 .   ? 1.070   0.788   9.254   1.00 51.87 ? 478  VCA B C12 1 
HETATM 4058 C C13 . VCA F 3 .   ? 1.006   2.040   8.642   1.00 52.39 ? 478  VCA B C13 1 
HETATM 4059 C C14 . VCA F 3 .   ? 0.239   1.993   7.318   1.00 52.16 ? 478  VCA B C14 1 
HETATM 4060 C C15 . VCA F 3 .   ? 1.143   1.591   6.152   1.00 52.22 ? 478  VCA B C15 1 
HETATM 4061 C C16 . VCA F 3 .   ? 1.136   2.670   5.066   1.00 52.38 ? 478  VCA B C16 1 
HETATM 4062 C C17 . VCA F 3 .   ? 1.730   2.134   3.761   1.00 52.84 ? 478  VCA B C17 1 
HETATM 4063 C C18 . VCA F 3 .   ? 1.278   2.967   2.558   1.00 52.61 ? 478  VCA B C18 1 
HETATM 4064 O O   . HOH G 4 .   ? 12.053  -55.873 17.454  1.00 20.92 ? 922  HOH A O   1 
HETATM 4065 O O   . HOH G 4 .   ? 10.884  -28.328 14.680  1.00 20.47 ? 923  HOH A O   1 
HETATM 4066 O O   . HOH G 4 .   ? -7.136  -54.753 28.404  1.00 28.22 ? 924  HOH A O   1 
HETATM 4067 O O   . HOH G 4 .   ? -7.751  -34.885 24.183  1.00 24.23 ? 925  HOH A O   1 
HETATM 4068 O O   . HOH G 4 .   ? 5.124   -52.337 27.513  1.00 20.41 ? 926  HOH A O   1 
HETATM 4069 O O   . HOH G 4 .   ? -7.171  -49.584 21.768  1.00 20.25 ? 927  HOH A O   1 
HETATM 4070 O O   . HOH G 4 .   ? 15.680  -45.589 10.544  1.00 27.57 ? 928  HOH A O   1 
HETATM 4071 O O   . HOH G 4 .   ? -10.980 -49.043 27.193  1.00 31.79 ? 929  HOH A O   1 
HETATM 4072 O O   . HOH G 4 .   ? 9.913   -23.510 13.009  1.00 37.28 ? 930  HOH A O   1 
HETATM 4073 O O   . HOH G 4 .   ? -2.966  -53.198 11.667  1.00 33.88 ? 931  HOH A O   1 
HETATM 4074 O O   . HOH G 4 .   ? -7.840  -37.717 53.929  1.00 48.79 ? 932  HOH A O   1 
HETATM 4075 O O   . HOH G 4 .   ? -0.718  -38.873 42.302  1.00 37.21 ? 933  HOH A O   1 
HETATM 4076 O O   . HOH G 4 .   ? -23.663 -42.687 38.968  1.00 43.01 ? 934  HOH A O   1 
HETATM 4077 O O   . HOH G 4 .   ? 3.504   -55.678 15.985  1.00 35.34 ? 935  HOH A O   1 
HETATM 4078 O O   . HOH G 4 .   ? -6.423  -32.484 47.548  1.00 43.69 ? 936  HOH A O   1 
HETATM 4079 O O   . HOH G 4 .   ? 14.748  -42.425 32.840  1.00 24.73 ? 937  HOH A O   1 
HETATM 4080 O O   . HOH G 4 .   ? 0.173   -37.313 7.802   1.00 38.13 ? 938  HOH A O   1 
HETATM 4081 O O   . HOH G 4 .   ? 4.669   -55.383 36.159  1.00 30.87 ? 939  HOH A O   1 
HETATM 4082 O O   . HOH G 4 .   ? 5.482   -41.978 29.387  1.00 30.18 ? 940  HOH A O   1 
HETATM 4083 O O   . HOH G 4 .   ? -7.489  -55.759 31.107  1.00 46.18 ? 941  HOH A O   1 
HETATM 4084 O O   . HOH G 4 .   ? -22.750 -40.283 48.650  1.00 37.77 ? 942  HOH A O   1 
HETATM 4085 O O   . HOH G 4 .   ? -8.109  -32.912 26.126  1.00 17.54 ? 943  HOH A O   1 
HETATM 4086 O O   . HOH G 4 .   ? -11.847 -19.450 32.761  1.00 55.66 ? 944  HOH A O   1 
HETATM 4087 O O   . HOH G 4 .   ? 7.837   -29.241 9.292   1.00 50.21 ? 945  HOH A O   1 
HETATM 4088 O O   . HOH G 4 .   ? -11.115 -23.625 21.790  1.00 54.00 ? 946  HOH A O   1 
HETATM 4089 O O   . HOH G 4 .   ? -7.157  -21.980 16.912  1.00 32.66 ? 947  HOH A O   1 
HETATM 4090 O O   . HOH G 4 .   ? -10.972 -29.180 49.478  1.00 38.92 ? 948  HOH A O   1 
HETATM 4091 O O   . HOH G 4 .   ? 1.494   -22.948 34.052  1.00 43.41 ? 949  HOH A O   1 
HETATM 4092 O O   . HOH G 4 .   ? 4.776   -57.953 26.298  1.00 50.44 ? 950  HOH A O   1 
HETATM 4093 O O   . HOH G 4 .   ? -12.318 -47.779 38.400  1.00 25.88 ? 951  HOH A O   1 
HETATM 4094 O O   . HOH G 4 .   ? 0.120   -40.927 38.831  1.00 21.16 ? 952  HOH A O   1 
HETATM 4095 O O   . HOH G 4 .   ? 5.574   -32.369 6.009   1.00 36.77 ? 953  HOH A O   1 
HETATM 4096 O O   . HOH G 4 .   ? -11.102 -46.608 22.542  1.00 30.35 ? 954  HOH A O   1 
HETATM 4097 O O   . HOH G 4 .   ? 15.819  -26.067 19.956  1.00 48.78 ? 955  HOH A O   1 
HETATM 4098 O O   . HOH G 4 .   ? -4.502  -59.867 38.072  1.00 41.33 ? 956  HOH A O   1 
HETATM 4099 O O   . HOH G 4 .   ? -12.810 -30.111 51.111  1.00 42.97 ? 957  HOH A O   1 
HETATM 4100 O O   . HOH G 4 .   ? -19.794 -35.945 48.133  1.00 36.00 ? 958  HOH A O   1 
HETATM 4101 O O   . HOH G 4 .   ? 16.026  -40.952 16.053  1.00 45.75 ? 959  HOH A O   1 
HETATM 4102 O O   . HOH G 4 .   ? 11.361  -24.765 22.966  1.00 46.12 ? 960  HOH A O   1 
HETATM 4103 O O   . HOH G 4 .   ? -8.632  -53.684 52.895  1.00 25.77 ? 961  HOH A O   1 
HETATM 4104 O O   . HOH G 4 .   ? 9.129   -51.366 47.648  1.00 55.40 ? 962  HOH A O   1 
HETATM 4105 O O   . HOH G 4 .   ? 5.832   -36.897 34.462  1.00 44.26 ? 963  HOH A O   1 
HETATM 4106 O O   . HOH G 4 .   ? 18.676  -31.779 21.178  1.00 43.47 ? 964  HOH A O   1 
HETATM 4107 O O   . HOH G 4 .   ? -16.662 -26.764 40.077  1.00 42.34 ? 965  HOH A O   1 
HETATM 4108 O O   . HOH G 4 .   ? 0.376   -42.442 36.616  1.00 52.11 ? 966  HOH A O   1 
HETATM 4109 O O   . HOH G 4 .   ? -16.908 -28.017 33.635  1.00 61.51 ? 967  HOH A O   1 
HETATM 4110 O O   . HOH G 4 .   ? -9.821  -49.550 55.419  1.00 26.85 ? 968  HOH A O   1 
HETATM 4111 O O   . HOH G 4 .   ? -13.969 -56.893 39.161  1.00 59.86 ? 969  HOH A O   1 
HETATM 4112 O O   . HOH G 4 .   ? -5.247  -44.904 29.570  1.00 30.49 ? 970  HOH A O   1 
HETATM 4113 O O   . HOH G 4 .   ? -0.152  -34.814 43.307  1.00 28.75 ? 971  HOH A O   1 
HETATM 4114 O O   . HOH G 4 .   ? 9.419   -29.546 11.046  1.00 34.85 ? 972  HOH A O   1 
HETATM 4115 O O   . HOH G 4 .   ? 2.651   -25.253 5.508   1.00 30.01 ? 973  HOH A O   1 
HETATM 4116 O O   . HOH G 4 .   ? -4.107  -31.785 19.451  1.00 16.07 ? 974  HOH A O   1 
HETATM 4117 O O   . HOH G 4 .   ? 0.127   -39.538 32.743  1.00 26.62 ? 975  HOH A O   1 
HETATM 4118 O O   . HOH G 4 .   ? 21.071  -35.485 15.414  1.00 33.42 ? 976  HOH A O   1 
HETATM 4119 O O   . HOH G 4 .   ? 9.414   -25.701 27.484  1.00 54.02 ? 977  HOH A O   1 
HETATM 4120 O O   . HOH G 4 .   ? -0.713  -20.611 13.784  1.00 29.98 ? 978  HOH A O   1 
HETATM 4121 O O   . HOH G 4 .   ? 14.371  -29.143 24.023  1.00 40.36 ? 979  HOH A O   1 
HETATM 4122 O O   . HOH G 4 .   ? -14.790 -29.700 47.872  1.00 30.20 ? 980  HOH A O   1 
HETATM 4123 O O   . HOH G 4 .   ? -17.016 -42.600 48.641  1.00 26.62 ? 981  HOH A O   1 
HETATM 4124 O O   . HOH G 4 .   ? -10.173 -49.713 38.513  1.00 29.90 ? 982  HOH A O   1 
HETATM 4125 O O   . HOH G 4 .   ? -16.376 -38.005 19.217  1.00 46.89 ? 983  HOH A O   1 
HETATM 4126 O O   . HOH G 4 .   ? -3.931  -37.086 16.340  1.00 60.72 ? 984  HOH A O   1 
HETATM 4127 O O   . HOH G 4 .   ? 3.583   -48.033 26.971  1.00 22.28 ? 985  HOH A O   1 
HETATM 4128 O O   . HOH G 4 .   ? -22.724 -33.178 53.313  1.00 48.61 ? 986  HOH A O   1 
HETATM 4129 O O   . HOH G 4 .   ? 5.749   -36.950 45.267  1.00 41.70 ? 987  HOH A O   1 
HETATM 4130 O O   . HOH G 4 .   ? -25.496 -44.154 40.316  1.00 58.23 ? 988  HOH A O   1 
HETATM 4131 O O   . HOH G 4 .   ? 0.917   -56.415 16.206  1.00 41.35 ? 989  HOH A O   1 
HETATM 4132 O O   . HOH G 4 .   ? -5.889  -57.293 32.226  1.00 33.16 ? 990  HOH A O   1 
HETATM 4133 O O   . HOH G 4 .   ? 2.246   -20.970 7.429   1.00 42.36 ? 991  HOH A O   1 
HETATM 4134 O O   . HOH G 4 .   ? -6.677  -31.923 8.721   1.00 38.06 ? 992  HOH A O   1 
HETATM 4135 O O   . HOH G 4 .   ? -20.847 -34.934 44.754  1.00 41.61 ? 993  HOH A O   1 
HETATM 4136 O O   . HOH G 4 .   ? -9.507  -20.116 28.981  1.00 46.48 ? 994  HOH A O   1 
HETATM 4137 O O   . HOH G 4 .   ? 8.211   -52.107 13.300  1.00 35.76 ? 995  HOH A O   1 
HETATM 4138 O O   . HOH G 4 .   ? 12.157  -54.200 43.378  1.00 53.64 ? 996  HOH A O   1 
HETATM 4139 O O   . HOH G 4 .   ? -23.364 -33.726 44.891  1.00 36.65 ? 997  HOH A O   1 
HETATM 4140 O O   . HOH G 4 .   ? 5.662   -40.744 31.662  1.00 38.92 ? 998  HOH A O   1 
HETATM 4141 O O   . HOH G 4 .   ? 2.493   -41.119 33.425  1.00 41.63 ? 999  HOH A O   1 
HETATM 4142 O O   . HOH G 4 .   ? 3.578   -33.107 47.022  1.00 47.23 ? 1000 HOH A O   1 
HETATM 4143 O O   . HOH G 4 .   ? -0.792  -53.318 52.080  1.00 47.22 ? 1001 HOH A O   1 
HETATM 4144 O O   . HOH G 4 .   ? -9.238  -56.039 39.574  1.00 35.69 ? 1002 HOH A O   1 
HETATM 4145 O O   . HOH G 4 .   ? -8.792  -51.810 56.607  1.00 39.47 ? 1003 HOH A O   1 
HETATM 4146 O O   . HOH G 4 .   ? -6.388  -33.328 5.262   1.00 39.72 ? 1004 HOH A O   1 
HETATM 4147 O O   . HOH H 4 .   ? -11.622 -5.414  27.722  1.00 26.27 ? 479  HOH B O   1 
HETATM 4148 O O   . HOH H 4 .   ? -6.665  -6.479  20.771  1.00 18.75 ? 480  HOH B O   1 
HETATM 4149 O O   . HOH H 4 .   ? 3.198   -0.089  16.569  1.00 32.10 ? 481  HOH B O   1 
HETATM 4150 O O   . HOH H 4 .   ? 15.739  -2.443  20.212  1.00 39.47 ? 482  HOH B O   1 
HETATM 4151 O O   . HOH H 4 .   ? -4.119  -7.013  -5.467  1.00 38.60 ? 483  HOH B O   1 
HETATM 4152 O O   . HOH H 4 .   ? 12.229  6.138   42.187  1.00 50.17 ? 484  HOH B O   1 
HETATM 4153 O O   . HOH H 4 .   ? -5.934  11.707  28.250  1.00 29.23 ? 485  HOH B O   1 
HETATM 4154 O O   . HOH H 4 .   ? 11.644  -13.566 32.451  1.00 44.86 ? 486  HOH B O   1 
HETATM 4155 O O   . HOH H 4 .   ? 6.657   11.978  23.266  1.00 56.45 ? 487  HOH B O   1 
HETATM 4156 O O   . HOH H 4 .   ? -14.793 1.166   25.972  1.00 36.94 ? 488  HOH B O   1 
HETATM 4157 O O   . HOH H 4 .   ? 11.289  -6.662  14.439  1.00 42.17 ? 489  HOH B O   1 
HETATM 4158 O O   . HOH H 4 .   ? -17.311 5.241   26.554  1.00 60.03 ? 490  HOH B O   1 
HETATM 4159 O O   . HOH H 4 .   ? 2.937   16.310  34.165  1.00 55.59 ? 491  HOH B O   1 
HETATM 4160 O O   . HOH H 4 .   ? 5.388   -4.473  6.184   1.00 39.56 ? 492  HOH B O   1 
HETATM 4161 O O   . HOH H 4 .   ? -16.453 -4.988  22.884  1.00 57.30 ? 493  HOH B O   1 
HETATM 4162 O O   . HOH H 4 .   ? 16.026  2.456   23.673  1.00 60.20 ? 494  HOH B O   1 
HETATM 4163 O O   . HOH H 4 .   ? 0.584   18.475  7.937   1.00 44.86 ? 495  HOH B O   1 
HETATM 4164 O O   . HOH H 4 .   ? -12.783 -3.888  -3.254  1.00 51.65 ? 496  HOH B O   1 
HETATM 4165 O O   . HOH H 4 .   ? -10.489 3.764   16.660  1.00 24.25 ? 497  HOH B O   1 
HETATM 4166 O O   . HOH H 4 .   ? 17.415  -0.319  21.509  1.00 47.70 ? 498  HOH B O   1 
HETATM 4167 O O   . HOH H 4 .   ? 5.882   -10.346 38.793  1.00 53.65 ? 499  HOH B O   1 
HETATM 4168 O O   . HOH H 4 .   ? 8.010   -2.007  16.350  1.00 38.36 ? 500  HOH B O   1 
HETATM 4169 O O   . HOH H 4 .   ? 4.939   -9.484  4.477   1.00 39.47 ? 501  HOH B O   1 
HETATM 4170 O O   . HOH H 4 .   ? 5.048   -0.411  46.684  1.00 45.89 ? 502  HOH B O   1 
HETATM 4171 O O   . HOH H 4 .   ? -8.882  3.352   -3.217  1.00 43.69 ? 503  HOH B O   1 
HETATM 4172 O O   . HOH H 4 .   ? -14.246 0.801   -4.649  1.00 52.31 ? 504  HOH B O   1 
HETATM 4173 O O   . HOH H 4 .   ? -15.807 8.812   4.983   1.00 58.98 ? 505  HOH B O   1 
HETATM 4174 O O   . HOH H 4 .   ? 19.762  8.451   19.091  1.00 43.02 ? 506  HOH B O   1 
HETATM 4175 O O   . HOH H 4 .   ? -20.604 3.537   18.799  1.00 42.75 ? 507  HOH B O   1 
HETATM 4176 O O   . HOH H 4 .   ? -7.769  14.884  2.506   1.00 45.90 ? 508  HOH B O   1 
HETATM 4177 O O   . HOH H 4 .   ? 4.142   -14.155 12.316  1.00 69.72 ? 509  HOH B O   1 
HETATM 4178 O O   . HOH H 4 .   ? 10.094  -9.792  19.048  1.00 46.18 ? 510  HOH B O   1 
HETATM 4179 O O   . HOH H 4 .   ? 11.240  14.368  30.460  1.00 49.83 ? 511  HOH B O   1 
HETATM 4180 O O   . HOH H 4 .   ? -9.597  -19.639 12.615  1.00 48.51 ? 512  HOH B O   1 
HETATM 4181 O O   . HOH H 4 .   ? 14.347  -5.670  43.598  1.00 40.40 ? 513  HOH B O   1 
HETATM 4182 O O   . HOH H 4 .   ? 7.753   -16.326 38.126  1.00 42.36 ? 514  HOH B O   1 
HETATM 4183 O O   . HOH H 4 .   ? 23.035  5.859   7.830   1.00 53.75 ? 515  HOH B O   1 
HETATM 4184 O O   . HOH H 4 .   ? 0.999   -7.490  43.571  1.00 38.10 ? 516  HOH B O   1 
HETATM 4185 O O   . HOH H 4 .   ? -15.022 -12.757 33.105  1.00 39.76 ? 517  HOH B O   1 
HETATM 4186 O O   . HOH H 4 .   ? 8.334   14.971  20.403  1.00 56.71 ? 518  HOH B O   1 
HETATM 4187 O O   . HOH H 4 .   ? -3.836  11.459  30.318  1.00 40.86 ? 519  HOH B O   1 
HETATM 4188 O O   . HOH H 4 .   ? -6.664  9.065   7.755   1.00 53.55 ? 520  HOH B O   1 
HETATM 4189 O O   . HOH H 4 .   ? 4.649   5.702   22.227  1.00 32.43 ? 521  HOH B O   1 
HETATM 4190 O O   . HOH H 4 .   ? 5.722   14.856  30.806  1.00 46.82 ? 522  HOH B O   1 
HETATM 4191 O O   . HOH H 4 .   ? -10.995 -16.074 38.701  1.00 34.95 ? 523  HOH B O   1 
HETATM 4192 O O   . HOH H 4 .   ? 4.463   0.964   2.231   1.00 47.02 ? 524  HOH B O   1 
HETATM 4193 O O   . HOH H 4 .   ? -9.825  -16.822 12.072  1.00 37.41 ? 525  HOH B O   1 
HETATM 4194 O O   . HOH H 4 .   ? 0.628   13.960  -2.719  1.00 38.17 ? 526  HOH B O   1 
HETATM 4195 O O   . HOH H 4 .   ? -0.331  -9.950  -0.264  1.00 53.88 ? 527  HOH B O   1 
HETATM 4196 O O   . HOH H 4 .   ? -6.561  -4.391  22.700  1.00 20.07 ? 528  HOH B O   1 
HETATM 4197 O O   . HOH H 4 .   ? 8.224   9.734   17.282  1.00 33.67 ? 529  HOH B O   1 
HETATM 4198 O O   . HOH H 4 .   ? 5.366   -14.874 29.424  1.00 52.16 ? 530  HOH B O   1 
HETATM 4199 O O   . HOH H 4 .   ? -0.050  1.633   -6.116  1.00 45.21 ? 531  HOH B O   1 
HETATM 4200 O O   . HOH H 4 .   ? 5.129   8.305   22.676  1.00 30.46 ? 532  HOH B O   1 
HETATM 4201 O O   . HOH H 4 .   ? -0.446  14.991  32.780  1.00 50.31 ? 533  HOH B O   1 
HETATM 4202 O O   . HOH H 4 .   ? 13.503  2.048   36.902  1.00 45.48 ? 534  HOH B O   1 
HETATM 4203 O O   . HOH H 4 .   ? 3.660   -11.773 10.574  1.00 37.26 ? 535  HOH B O   1 
HETATM 4204 O O   . HOH H 4 .   ? -1.473  17.593  39.447  1.00 64.98 ? 536  HOH B O   1 
HETATM 4205 O O   . HOH H 4 .   ? 4.317   12.964  37.795  1.00 49.18 ? 537  HOH B O   1 
HETATM 4206 O O   . HOH H 4 .   ? 15.267  -3.101  2.086   1.00 48.97 ? 538  HOH B O   1 
HETATM 4207 O O   . HOH H 4 .   ? 4.458   -10.208 41.310  1.00 54.50 ? 539  HOH B O   1 
HETATM 4208 O O   . HOH H 4 .   ? -4.618  -7.485  28.135  1.00 21.20 ? 540  HOH B O   1 
HETATM 4209 O O   . HOH H 4 .   ? -17.399 4.337   -1.192  1.00 44.01 ? 541  HOH B O   1 
HETATM 4210 O O   . HOH H 4 .   ? -15.620 -19.566 17.174  1.00 44.89 ? 542  HOH B O   1 
HETATM 4211 O O   . HOH H 4 .   ? 8.014   -7.666  -8.351  1.00 49.94 ? 543  HOH B O   1 
HETATM 4212 O O   . HOH H 4 .   ? -2.007  -18.387 41.508  1.00 58.28 ? 544  HOH B O   1 
HETATM 4213 O O   . HOH H 4 .   ? 13.709  12.294  30.720  1.00 47.84 ? 545  HOH B O   1 
HETATM 4214 O O   . HOH H 4 .   ? -21.508 1.188   19.017  1.00 54.50 ? 546  HOH B O   1 
HETATM 4215 O O   . HOH H 4 .   ? -11.950 -10.593 34.073  1.00 37.89 ? 547  HOH B O   1 
HETATM 4216 O O   . HOH H 4 .   ? 5.098   10.347  24.913  1.00 31.12 ? 548  HOH B O   1 
HETATM 4217 O O   . HOH H 4 .   ? -3.220  -18.884 34.529  1.00 36.37 ? 549  HOH B O   1 
HETATM 4218 O O   . HOH H 4 .   ? 7.280   -2.768  7.347   1.00 40.16 ? 550  HOH B O   1 
HETATM 4219 O O   . HOH H 4 .   ? 3.390   -0.339  14.014  1.00 58.06 ? 551  HOH B O   1 
HETATM 4220 O O   . HOH H 4 .   ? 19.605  5.509   13.063  1.00 57.49 ? 552  HOH B O   1 
HETATM 4221 O O   . HOH H 4 .   ? -12.981 -11.542 0.999   1.00 86.80 ? 553  HOH B O   1 
HETATM 4222 O O   . HOH H 4 .   ? 5.608   8.652   39.616  1.00 49.28 ? 554  HOH B O   1 
HETATM 4223 O O   . HOH H 4 .   ? -2.643  5.335   18.204  1.00 30.01 ? 555  HOH B O   1 
HETATM 4224 O O   . HOH H 4 .   ? -18.811 -13.150 11.588  1.00 54.16 ? 556  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   211 211 LEU LEU A . n 
A 1 2   LYS 2   212 212 LYS LYS A . n 
A 1 3   ALA 3   213 213 ALA ALA A . n 
A 1 4   PHE 4   214 214 PHE PHE A . n 
A 1 5   SER 5   215 215 SER SER A . n 
A 1 6   LYS 6   216 216 LYS LYS A . n 
A 1 7   HIS 7   217 217 HIS HIS A . n 
A 1 8   ILE 8   218 218 ILE ILE A . n 
A 1 9   TYR 9   219 219 TYR TYR A . n 
A 1 10  ASN 10  220 220 ASN ASN A . n 
A 1 11  ALA 11  221 221 ALA ALA A . n 
A 1 12  TYR 12  222 222 TYR TYR A . n 
A 1 13  LEU 13  223 223 LEU LEU A . n 
A 1 14  LYS 14  224 224 LYS LYS A . n 
A 1 15  ASN 15  225 225 ASN ASN A . n 
A 1 16  PHE 16  226 226 PHE PHE A . n 
A 1 17  ASN 17  227 227 ASN ASN A . n 
A 1 18  MET 18  228 228 MET MET A . n 
A 1 19  THR 19  229 229 THR THR A . n 
A 1 20  LYS 20  230 230 LYS LYS A . n 
A 1 21  LYS 21  231 231 LYS LYS A . n 
A 1 22  LYS 22  232 232 LYS LYS A . n 
A 1 23  ALA 23  233 233 ALA ALA A . n 
A 1 24  ARG 24  234 234 ARG ARG A . n 
A 1 25  SER 25  235 235 SER SER A . n 
A 1 26  ILE 26  236 236 ILE ILE A . n 
A 1 27  LEU 27  237 237 LEU LEU A . n 
A 1 28  THR 28  238 238 THR THR A . n 
A 1 29  GLY 29  239 ?   ?   ?   A . n 
A 1 30  LYS 30  240 240 LYS LYS A . n 
A 1 31  ALA 31  241 241 ALA ALA A . n 
A 1 32  SER 32  242 ?   ?   ?   A . n 
A 1 33  HIS 33  243 ?   ?   ?   A . n 
A 1 34  THR 34  244 ?   ?   ?   A . n 
A 1 35  ALA 35  245 ?   ?   ?   A . n 
A 1 36  PRO 36  246 246 PRO PRO A . n 
A 1 37  PHE 37  247 247 PHE PHE A . n 
A 1 38  VAL 38  248 248 VAL VAL A . n 
A 1 39  ILE 39  249 249 ILE ILE A . n 
A 1 40  HIS 40  250 250 HIS HIS A . n 
A 1 41  ASP 41  251 251 ASP ASP A . n 
A 1 42  ILE 42  252 252 ILE ILE A . n 
A 1 43  GLU 43  253 253 GLU GLU A . n 
A 1 44  THR 44  254 254 THR THR A . n 
A 1 45  LEU 45  255 255 LEU LEU A . n 
A 1 46  TRP 46  256 256 TRP TRP A . n 
A 1 47  GLN 47  257 257 GLN GLN A . n 
A 1 48  ALA 48  258 258 ALA ALA A . n 
A 1 49  GLU 49  259 259 GLU GLU A . n 
A 1 50  LYS 50  260 260 LYS LYS A . n 
A 1 51  GLY 51  261 261 GLY GLY A . n 
A 1 52  LEU 52  262 262 LEU LEU A . n 
A 1 53  VAL 53  263 263 VAL VAL A . n 
A 1 54  TRP 54  264 264 TRP TRP A . n 
A 1 55  LYS 55  265 ?   ?   ?   A . n 
A 1 56  GLN 56  266 ?   ?   ?   A . n 
A 1 57  LEU 57  267 ?   ?   ?   A . n 
A 1 58  VAL 58  268 ?   ?   ?   A . n 
A 1 59  ASN 59  269 ?   ?   ?   A . n 
A 1 60  GLY 60  270 ?   ?   ?   A . n 
A 1 61  LEU 61  271 ?   ?   ?   A . n 
A 1 62  PRO 62  272 ?   ?   ?   A . n 
A 1 63  PRO 63  273 ?   ?   ?   A . n 
A 1 64  TYR 64  274 ?   ?   ?   A . n 
A 1 65  LYS 65  275 275 LYS LYS A . n 
A 1 66  GLU 66  276 276 GLU GLU A . n 
A 1 67  ILE 67  277 277 ILE ILE A . n 
A 1 68  SER 68  278 278 SER SER A . n 
A 1 69  VAL 69  279 279 VAL VAL A . n 
A 1 70  HIS 70  280 280 HIS HIS A . n 
A 1 71  VAL 71  281 281 VAL VAL A . n 
A 1 72  PHE 72  282 282 PHE PHE A . n 
A 1 73  TYR 73  283 283 TYR TYR A . n 
A 1 74  ARG 74  284 284 ARG ARG A . n 
A 1 75  CYS 75  285 285 CYS CYS A . n 
A 1 76  GLN 76  286 286 GLN GLN A . n 
A 1 77  CYS 77  287 287 CYS CYS A . n 
A 1 78  THR 78  288 288 THR THR A . n 
A 1 79  THR 79  289 289 THR THR A . n 
A 1 80  VAL 80  290 290 VAL VAL A . n 
A 1 81  GLU 81  291 291 GLU GLU A . n 
A 1 82  THR 82  292 292 THR THR A . n 
A 1 83  VAL 83  293 293 VAL VAL A . n 
A 1 84  ARG 84  294 294 ARG ARG A . n 
A 1 85  GLU 85  295 295 GLU GLU A . n 
A 1 86  LEU 86  296 296 LEU LEU A . n 
A 1 87  THR 87  297 297 THR THR A . n 
A 1 88  GLU 88  298 298 GLU GLU A . n 
A 1 89  PHE 89  299 299 PHE PHE A . n 
A 1 90  ALA 90  300 300 ALA ALA A . n 
A 1 91  LYS 91  301 301 LYS LYS A . n 
A 1 92  SER 92  302 302 SER SER A . n 
A 1 93  ILE 93  303 303 ILE ILE A . n 
A 1 94  PRO 94  304 304 PRO PRO A . n 
A 1 95  SER 95  305 305 SER SER A . n 
A 1 96  PHE 96  306 306 PHE PHE A . n 
A 1 97  SER 97  307 307 SER SER A . n 
A 1 98  SER 98  308 308 SER SER A . n 
A 1 99  LEU 99  309 309 LEU LEU A . n 
A 1 100 PHE 100 310 310 PHE PHE A . n 
A 1 101 LEU 101 311 311 LEU LEU A . n 
A 1 102 ASN 102 312 312 ASN ASN A . n 
A 1 103 ASP 103 313 313 ASP ASP A . n 
A 1 104 GLN 104 314 314 GLN GLN A . n 
A 1 105 VAL 105 315 315 VAL VAL A . n 
A 1 106 THR 106 316 316 THR THR A . n 
A 1 107 LEU 107 317 317 LEU LEU A . n 
A 1 108 LEU 108 318 318 LEU LEU A . n 
A 1 109 LYS 109 319 319 LYS LYS A . n 
A 1 110 TYR 110 320 320 TYR TYR A . n 
A 1 111 GLY 111 321 321 GLY GLY A . n 
A 1 112 VAL 112 322 322 VAL VAL A . n 
A 1 113 HIS 113 323 323 HIS HIS A . n 
A 1 114 GLU 114 324 324 GLU GLU A . n 
A 1 115 ALA 115 325 325 ALA ALA A . n 
A 1 116 ILE 116 326 326 ILE ILE A . n 
A 1 117 PHE 117 327 327 PHE PHE A . n 
A 1 118 ALA 118 328 328 ALA ALA A . n 
A 1 119 MET 119 329 329 MET MET A . n 
A 1 120 LEU 120 330 330 LEU LEU A . n 
A 1 121 ALA 121 331 331 ALA ALA A . n 
A 1 122 SER 122 332 332 SER SER A . n 
A 1 123 ILE 123 333 333 ILE ILE A . n 
A 1 124 VAL 124 334 334 VAL VAL A . n 
A 1 125 ASN 125 335 335 ASN ASN A . n 
A 1 126 LYS 126 336 336 LYS LYS A . n 
A 1 127 ASP 127 337 337 ASP ASP A . n 
A 1 128 GLY 128 338 338 GLY GLY A . n 
A 1 129 LEU 129 339 339 LEU LEU A . n 
A 1 130 LEU 130 340 340 LEU LEU A . n 
A 1 131 VAL 131 341 341 VAL VAL A . n 
A 1 132 ALA 132 342 342 ALA ALA A . n 
A 1 133 ASN 133 343 343 ASN ASN A . n 
A 1 134 GLY 134 344 344 GLY GLY A . n 
A 1 135 SER 135 345 345 SER SER A . n 
A 1 136 GLY 136 346 346 GLY GLY A . n 
A 1 137 PHE 137 347 347 PHE PHE A . n 
A 1 138 VAL 138 348 348 VAL VAL A . n 
A 1 139 THR 139 349 349 THR THR A . n 
A 1 140 ARG 140 350 350 ARG ARG A . n 
A 1 141 GLU 141 351 351 GLU GLU A . n 
A 1 142 PHE 142 352 352 PHE PHE A . n 
A 1 143 LEU 143 353 353 LEU LEU A . n 
A 1 144 ARG 144 354 354 ARG ARG A . n 
A 1 145 SER 145 355 355 SER SER A . n 
A 1 146 LEU 146 356 356 LEU LEU A . n 
A 1 147 ARG 147 357 357 ARG ARG A . n 
A 1 148 LYS 148 358 358 LYS LYS A . n 
A 1 149 PRO 149 359 359 PRO PRO A . n 
A 1 150 PHE 150 360 360 PHE PHE A . n 
A 1 151 SER 151 361 361 SER SER A . n 
A 1 152 ASP 152 362 362 ASP ASP A . n 
A 1 153 ILE 153 363 363 ILE ILE A . n 
A 1 154 ILE 154 364 364 ILE ILE A . n 
A 1 155 GLU 155 365 365 GLU GLU A . n 
A 1 156 PRO 156 366 366 PRO PRO A . n 
A 1 157 LYS 157 367 367 LYS LYS A . n 
A 1 158 PHE 158 368 368 PHE PHE A . n 
A 1 159 GLU 159 369 369 GLU GLU A . n 
A 1 160 PHE 160 370 370 PHE PHE A . n 
A 1 161 ALA 161 371 371 ALA ALA A . n 
A 1 162 VAL 162 372 372 VAL VAL A . n 
A 1 163 LYS 163 373 373 LYS LYS A . n 
A 1 164 PHE 164 374 374 PHE PHE A . n 
A 1 165 ASN 165 375 375 ASN ASN A . n 
A 1 166 ALA 166 376 376 ALA ALA A . n 
A 1 167 LEU 167 377 377 LEU LEU A . n 
A 1 168 GLU 168 378 378 GLU GLU A . n 
A 1 169 LEU 169 379 379 LEU LEU A . n 
A 1 170 ASP 170 380 380 ASP ASP A . n 
A 1 171 ASP 171 381 381 ASP ASP A . n 
A 1 172 SER 172 382 382 SER SER A . n 
A 1 173 ASP 173 383 383 ASP ASP A . n 
A 1 174 LEU 174 384 384 LEU LEU A . n 
A 1 175 ALA 175 385 385 ALA ALA A . n 
A 1 176 LEU 176 386 386 LEU LEU A . n 
A 1 177 PHE 177 387 387 PHE PHE A . n 
A 1 178 ILE 178 388 388 ILE ILE A . n 
A 1 179 ALA 179 389 389 ALA ALA A . n 
A 1 180 ALA 180 390 390 ALA ALA A . n 
A 1 181 ILE 181 391 391 ILE ILE A . n 
A 1 182 ILE 182 392 392 ILE ILE A . n 
A 1 183 LEU 183 393 393 LEU LEU A . n 
A 1 184 CYS 184 394 394 CYS CYS A . n 
A 1 185 GLY 185 395 395 GLY GLY A . n 
A 1 186 ASP 186 396 396 ASP ASP A . n 
A 1 187 ARG 187 397 397 ARG ARG A . n 
A 1 188 PRO 188 398 398 PRO PRO A . n 
A 1 189 GLY 189 399 399 GLY GLY A . n 
A 1 190 LEU 190 400 400 LEU LEU A . n 
A 1 191 MET 191 401 401 MET MET A . n 
A 1 192 ASN 192 402 402 ASN ASN A . n 
A 1 193 VAL 193 403 403 VAL VAL A . n 
A 1 194 PRO 194 404 404 PRO PRO A . n 
A 1 195 ARG 195 405 405 ARG ARG A . n 
A 1 196 VAL 196 406 406 VAL VAL A . n 
A 1 197 GLU 197 407 407 GLU GLU A . n 
A 1 198 ALA 198 408 408 ALA ALA A . n 
A 1 199 ILE 199 409 409 ILE ILE A . n 
A 1 200 GLN 200 410 410 GLN GLN A . n 
A 1 201 ASP 201 411 411 ASP ASP A . n 
A 1 202 THR 202 412 412 THR THR A . n 
A 1 203 ILE 203 413 413 ILE ILE A . n 
A 1 204 LEU 204 414 414 LEU LEU A . n 
A 1 205 ARG 205 415 415 ARG ARG A . n 
A 1 206 ALA 206 416 416 ALA ALA A . n 
A 1 207 LEU 207 417 417 LEU LEU A . n 
A 1 208 GLU 208 418 418 GLU GLU A . n 
A 1 209 PHE 209 419 419 PHE PHE A . n 
A 1 210 HIS 210 420 420 HIS HIS A . n 
A 1 211 LEU 211 421 421 LEU LEU A . n 
A 1 212 GLN 212 422 422 GLN GLN A . n 
A 1 213 ALA 213 423 423 ALA ALA A . n 
A 1 214 ASN 214 424 424 ASN ASN A . n 
A 1 215 HIS 215 425 425 HIS HIS A . n 
A 1 216 PRO 216 426 426 PRO PRO A . n 
A 1 217 ASP 217 427 427 ASP ASP A . n 
A 1 218 ALA 218 428 428 ALA ALA A . n 
A 1 219 GLN 219 429 429 GLN GLN A . n 
A 1 220 GLN 220 430 430 GLN GLN A . n 
A 1 221 LEU 221 431 431 LEU LEU A . n 
A 1 222 PHE 222 432 432 PHE PHE A . n 
A 1 223 PRO 223 433 433 PRO PRO A . n 
A 1 224 LYS 224 434 434 LYS LYS A . n 
A 1 225 LEU 225 435 435 LEU LEU A . n 
A 1 226 LEU 226 436 436 LEU LEU A . n 
A 1 227 GLN 227 437 437 GLN GLN A . n 
A 1 228 LYS 228 438 438 LYS LYS A . n 
A 1 229 MET 229 439 439 MET MET A . n 
A 1 230 ALA 230 440 440 ALA ALA A . n 
A 1 231 ASP 231 441 441 ASP ASP A . n 
A 1 232 LEU 232 442 442 LEU LEU A . n 
A 1 233 ARG 233 443 443 ARG ARG A . n 
A 1 234 GLN 234 444 444 GLN GLN A . n 
A 1 235 LEU 235 445 445 LEU LEU A . n 
A 1 236 VAL 236 446 446 VAL VAL A . n 
A 1 237 THR 237 447 447 THR THR A . n 
A 1 238 GLU 238 448 448 GLU GLU A . n 
A 1 239 HIS 239 449 449 HIS HIS A . n 
A 1 240 ALA 240 450 450 ALA ALA A . n 
A 1 241 GLN 241 451 451 GLN GLN A . n 
A 1 242 MET 242 452 452 MET MET A . n 
A 1 243 MET 243 453 453 MET MET A . n 
A 1 244 GLN 244 454 454 GLN GLN A . n 
A 1 245 ARG 245 455 455 ARG ARG A . n 
A 1 246 ILE 246 456 456 ILE ILE A . n 
A 1 247 LYS 247 457 457 LYS LYS A . n 
A 1 248 LYS 248 458 458 LYS LYS A . n 
A 1 249 THR 249 459 459 THR THR A . n 
A 1 250 GLU 250 460 460 GLU GLU A . n 
A 1 251 THR 251 461 461 THR THR A . n 
A 1 252 GLU 252 462 462 GLU GLU A . n 
A 1 253 THR 253 463 463 THR THR A . n 
A 1 254 SER 254 464 464 SER SER A . n 
A 1 255 LEU 255 465 465 LEU LEU A . n 
A 1 256 HIS 256 466 466 HIS HIS A . n 
A 1 257 PRO 257 467 467 PRO PRO A . n 
A 1 258 LEU 258 468 468 LEU LEU A . n 
A 1 259 LEU 259 469 469 LEU LEU A . n 
A 1 260 GLN 260 470 470 GLN GLN A . n 
A 1 261 GLU 261 471 471 GLU GLU A . n 
A 1 262 ILE 262 472 472 ILE ILE A . n 
A 1 263 TYR 263 473 473 TYR TYR A . n 
A 1 264 LYS 264 474 474 LYS LYS A . n 
A 1 265 ASP 265 475 475 ASP ASP A . n 
A 1 266 MET 266 476 ?   ?   ?   A . n 
A 1 267 TYR 267 477 ?   ?   ?   A . n 
B 1 1   LEU 1   211 211 LEU LEU B . n 
B 1 2   LYS 2   212 212 LYS LYS B . n 
B 1 3   ALA 3   213 213 ALA ALA B . n 
B 1 4   PHE 4   214 214 PHE PHE B . n 
B 1 5   SER 5   215 215 SER SER B . n 
B 1 6   LYS 6   216 216 LYS LYS B . n 
B 1 7   HIS 7   217 217 HIS HIS B . n 
B 1 8   ILE 8   218 218 ILE ILE B . n 
B 1 9   TYR 9   219 219 TYR TYR B . n 
B 1 10  ASN 10  220 220 ASN ASN B . n 
B 1 11  ALA 11  221 221 ALA ALA B . n 
B 1 12  TYR 12  222 222 TYR TYR B . n 
B 1 13  LEU 13  223 223 LEU LEU B . n 
B 1 14  LYS 14  224 224 LYS LYS B . n 
B 1 15  ASN 15  225 225 ASN ASN B . n 
B 1 16  PHE 16  226 226 PHE PHE B . n 
B 1 17  ASN 17  227 227 ASN ASN B . n 
B 1 18  MET 18  228 228 MET MET B . n 
B 1 19  THR 19  229 229 THR THR B . n 
B 1 20  LYS 20  230 230 LYS LYS B . n 
B 1 21  LYS 21  231 231 LYS LYS B . n 
B 1 22  LYS 22  232 232 LYS LYS B . n 
B 1 23  ALA 23  233 233 ALA ALA B . n 
B 1 24  ARG 24  234 234 ARG ARG B . n 
B 1 25  SER 25  235 235 SER SER B . n 
B 1 26  ILE 26  236 236 ILE ILE B . n 
B 1 27  LEU 27  237 237 LEU LEU B . n 
B 1 28  THR 28  238 238 THR THR B . n 
B 1 29  GLY 29  239 ?   ?   ?   B . n 
B 1 30  LYS 30  240 ?   ?   ?   B . n 
B 1 31  ALA 31  241 ?   ?   ?   B . n 
B 1 32  SER 32  242 ?   ?   ?   B . n 
B 1 33  HIS 33  243 ?   ?   ?   B . n 
B 1 34  THR 34  244 ?   ?   ?   B . n 
B 1 35  ALA 35  245 ?   ?   ?   B . n 
B 1 36  PRO 36  246 246 PRO PRO B . n 
B 1 37  PHE 37  247 247 PHE PHE B . n 
B 1 38  VAL 38  248 248 VAL VAL B . n 
B 1 39  ILE 39  249 249 ILE ILE B . n 
B 1 40  HIS 40  250 250 HIS HIS B . n 
B 1 41  ASP 41  251 251 ASP ASP B . n 
B 1 42  ILE 42  252 252 ILE ILE B . n 
B 1 43  GLU 43  253 253 GLU GLU B . n 
B 1 44  THR 44  254 254 THR THR B . n 
B 1 45  LEU 45  255 255 LEU LEU B . n 
B 1 46  TRP 46  256 256 TRP TRP B . n 
B 1 47  GLN 47  257 257 GLN GLN B . n 
B 1 48  ALA 48  258 258 ALA ALA B . n 
B 1 49  GLU 49  259 259 GLU GLU B . n 
B 1 50  LYS 50  260 260 LYS LYS B . n 
B 1 51  GLY 51  261 261 GLY GLY B . n 
B 1 52  LEU 52  262 262 LEU LEU B . n 
B 1 53  VAL 53  263 ?   ?   ?   B . n 
B 1 54  TRP 54  264 ?   ?   ?   B . n 
B 1 55  LYS 55  265 ?   ?   ?   B . n 
B 1 56  GLN 56  266 ?   ?   ?   B . n 
B 1 57  LEU 57  267 ?   ?   ?   B . n 
B 1 58  VAL 58  268 ?   ?   ?   B . n 
B 1 59  ASN 59  269 ?   ?   ?   B . n 
B 1 60  GLY 60  270 ?   ?   ?   B . n 
B 1 61  LEU 61  271 ?   ?   ?   B . n 
B 1 62  PRO 62  272 ?   ?   ?   B . n 
B 1 63  PRO 63  273 ?   ?   ?   B . n 
B 1 64  TYR 64  274 ?   ?   ?   B . n 
B 1 65  LYS 65  275 275 LYS LYS B . n 
B 1 66  GLU 66  276 276 GLU GLU B . n 
B 1 67  ILE 67  277 277 ILE ILE B . n 
B 1 68  SER 68  278 278 SER SER B . n 
B 1 69  VAL 69  279 279 VAL VAL B . n 
B 1 70  HIS 70  280 280 HIS HIS B . n 
B 1 71  VAL 71  281 281 VAL VAL B . n 
B 1 72  PHE 72  282 282 PHE PHE B . n 
B 1 73  TYR 73  283 283 TYR TYR B . n 
B 1 74  ARG 74  284 284 ARG ARG B . n 
B 1 75  CYS 75  285 285 CYS CYS B . n 
B 1 76  GLN 76  286 286 GLN GLN B . n 
B 1 77  CYS 77  287 287 CYS CYS B . n 
B 1 78  THR 78  288 288 THR THR B . n 
B 1 79  THR 79  289 289 THR THR B . n 
B 1 80  VAL 80  290 290 VAL VAL B . n 
B 1 81  GLU 81  291 291 GLU GLU B . n 
B 1 82  THR 82  292 292 THR THR B . n 
B 1 83  VAL 83  293 293 VAL VAL B . n 
B 1 84  ARG 84  294 294 ARG ARG B . n 
B 1 85  GLU 85  295 295 GLU GLU B . n 
B 1 86  LEU 86  296 296 LEU LEU B . n 
B 1 87  THR 87  297 297 THR THR B . n 
B 1 88  GLU 88  298 298 GLU GLU B . n 
B 1 89  PHE 89  299 299 PHE PHE B . n 
B 1 90  ALA 90  300 300 ALA ALA B . n 
B 1 91  LYS 91  301 301 LYS LYS B . n 
B 1 92  SER 92  302 302 SER SER B . n 
B 1 93  ILE 93  303 303 ILE ILE B . n 
B 1 94  PRO 94  304 304 PRO PRO B . n 
B 1 95  SER 95  305 305 SER SER B . n 
B 1 96  PHE 96  306 306 PHE PHE B . n 
B 1 97  SER 97  307 307 SER SER B . n 
B 1 98  SER 98  308 308 SER SER B . n 
B 1 99  LEU 99  309 309 LEU LEU B . n 
B 1 100 PHE 100 310 310 PHE PHE B . n 
B 1 101 LEU 101 311 311 LEU LEU B . n 
B 1 102 ASN 102 312 312 ASN ASN B . n 
B 1 103 ASP 103 313 313 ASP ASP B . n 
B 1 104 GLN 104 314 314 GLN GLN B . n 
B 1 105 VAL 105 315 315 VAL VAL B . n 
B 1 106 THR 106 316 316 THR THR B . n 
B 1 107 LEU 107 317 317 LEU LEU B . n 
B 1 108 LEU 108 318 318 LEU LEU B . n 
B 1 109 LYS 109 319 319 LYS LYS B . n 
B 1 110 TYR 110 320 320 TYR TYR B . n 
B 1 111 GLY 111 321 321 GLY GLY B . n 
B 1 112 VAL 112 322 322 VAL VAL B . n 
B 1 113 HIS 113 323 323 HIS HIS B . n 
B 1 114 GLU 114 324 324 GLU GLU B . n 
B 1 115 ALA 115 325 325 ALA ALA B . n 
B 1 116 ILE 116 326 326 ILE ILE B . n 
B 1 117 PHE 117 327 327 PHE PHE B . n 
B 1 118 ALA 118 328 328 ALA ALA B . n 
B 1 119 MET 119 329 329 MET MET B . n 
B 1 120 LEU 120 330 330 LEU LEU B . n 
B 1 121 ALA 121 331 331 ALA ALA B . n 
B 1 122 SER 122 332 332 SER SER B . n 
B 1 123 ILE 123 333 333 ILE ILE B . n 
B 1 124 VAL 124 334 334 VAL VAL B . n 
B 1 125 ASN 125 335 335 ASN ASN B . n 
B 1 126 LYS 126 336 336 LYS LYS B . n 
B 1 127 ASP 127 337 337 ASP ASP B . n 
B 1 128 GLY 128 338 338 GLY GLY B . n 
B 1 129 LEU 129 339 339 LEU LEU B . n 
B 1 130 LEU 130 340 340 LEU LEU B . n 
B 1 131 VAL 131 341 341 VAL VAL B . n 
B 1 132 ALA 132 342 342 ALA ALA B . n 
B 1 133 ASN 133 343 343 ASN ASN B . n 
B 1 134 GLY 134 344 344 GLY GLY B . n 
B 1 135 SER 135 345 345 SER SER B . n 
B 1 136 GLY 136 346 346 GLY GLY B . n 
B 1 137 PHE 137 347 347 PHE PHE B . n 
B 1 138 VAL 138 348 348 VAL VAL B . n 
B 1 139 THR 139 349 349 THR THR B . n 
B 1 140 ARG 140 350 350 ARG ARG B . n 
B 1 141 GLU 141 351 351 GLU GLU B . n 
B 1 142 PHE 142 352 352 PHE PHE B . n 
B 1 143 LEU 143 353 353 LEU LEU B . n 
B 1 144 ARG 144 354 354 ARG ARG B . n 
B 1 145 SER 145 355 355 SER SER B . n 
B 1 146 LEU 146 356 356 LEU LEU B . n 
B 1 147 ARG 147 357 357 ARG ARG B . n 
B 1 148 LYS 148 358 358 LYS LYS B . n 
B 1 149 PRO 149 359 359 PRO PRO B . n 
B 1 150 PHE 150 360 360 PHE PHE B . n 
B 1 151 SER 151 361 361 SER SER B . n 
B 1 152 ASP 152 362 362 ASP ASP B . n 
B 1 153 ILE 153 363 363 ILE ILE B . n 
B 1 154 ILE 154 364 364 ILE ILE B . n 
B 1 155 GLU 155 365 365 GLU GLU B . n 
B 1 156 PRO 156 366 366 PRO PRO B . n 
B 1 157 LYS 157 367 367 LYS LYS B . n 
B 1 158 PHE 158 368 368 PHE PHE B . n 
B 1 159 GLU 159 369 369 GLU GLU B . n 
B 1 160 PHE 160 370 370 PHE PHE B . n 
B 1 161 ALA 161 371 371 ALA ALA B . n 
B 1 162 VAL 162 372 372 VAL VAL B . n 
B 1 163 LYS 163 373 373 LYS LYS B . n 
B 1 164 PHE 164 374 374 PHE PHE B . n 
B 1 165 ASN 165 375 375 ASN ASN B . n 
B 1 166 ALA 166 376 376 ALA ALA B . n 
B 1 167 LEU 167 377 377 LEU LEU B . n 
B 1 168 GLU 168 378 378 GLU GLU B . n 
B 1 169 LEU 169 379 379 LEU LEU B . n 
B 1 170 ASP 170 380 380 ASP ASP B . n 
B 1 171 ASP 171 381 381 ASP ASP B . n 
B 1 172 SER 172 382 382 SER SER B . n 
B 1 173 ASP 173 383 383 ASP ASP B . n 
B 1 174 LEU 174 384 384 LEU LEU B . n 
B 1 175 ALA 175 385 385 ALA ALA B . n 
B 1 176 LEU 176 386 386 LEU LEU B . n 
B 1 177 PHE 177 387 387 PHE PHE B . n 
B 1 178 ILE 178 388 388 ILE ILE B . n 
B 1 179 ALA 179 389 389 ALA ALA B . n 
B 1 180 ALA 180 390 390 ALA ALA B . n 
B 1 181 ILE 181 391 391 ILE ILE B . n 
B 1 182 ILE 182 392 392 ILE ILE B . n 
B 1 183 LEU 183 393 393 LEU LEU B . n 
B 1 184 CYS 184 394 394 CYS CYS B . n 
B 1 185 GLY 185 395 395 GLY GLY B . n 
B 1 186 ASP 186 396 396 ASP ASP B . n 
B 1 187 ARG 187 397 397 ARG ARG B . n 
B 1 188 PRO 188 398 398 PRO PRO B . n 
B 1 189 GLY 189 399 399 GLY GLY B . n 
B 1 190 LEU 190 400 400 LEU LEU B . n 
B 1 191 MET 191 401 401 MET MET B . n 
B 1 192 ASN 192 402 402 ASN ASN B . n 
B 1 193 VAL 193 403 403 VAL VAL B . n 
B 1 194 PRO 194 404 404 PRO PRO B . n 
B 1 195 ARG 195 405 405 ARG ARG B . n 
B 1 196 VAL 196 406 406 VAL VAL B . n 
B 1 197 GLU 197 407 407 GLU GLU B . n 
B 1 198 ALA 198 408 408 ALA ALA B . n 
B 1 199 ILE 199 409 409 ILE ILE B . n 
B 1 200 GLN 200 410 410 GLN GLN B . n 
B 1 201 ASP 201 411 411 ASP ASP B . n 
B 1 202 THR 202 412 412 THR THR B . n 
B 1 203 ILE 203 413 413 ILE ILE B . n 
B 1 204 LEU 204 414 414 LEU LEU B . n 
B 1 205 ARG 205 415 415 ARG ARG B . n 
B 1 206 ALA 206 416 416 ALA ALA B . n 
B 1 207 LEU 207 417 417 LEU LEU B . n 
B 1 208 GLU 208 418 418 GLU GLU B . n 
B 1 209 PHE 209 419 419 PHE PHE B . n 
B 1 210 HIS 210 420 420 HIS HIS B . n 
B 1 211 LEU 211 421 421 LEU LEU B . n 
B 1 212 GLN 212 422 422 GLN GLN B . n 
B 1 213 ALA 213 423 423 ALA ALA B . n 
B 1 214 ASN 214 424 424 ASN ASN B . n 
B 1 215 HIS 215 425 425 HIS HIS B . n 
B 1 216 PRO 216 426 426 PRO PRO B . n 
B 1 217 ASP 217 427 427 ASP ASP B . n 
B 1 218 ALA 218 428 428 ALA ALA B . n 
B 1 219 GLN 219 429 429 GLN GLN B . n 
B 1 220 GLN 220 430 430 GLN GLN B . n 
B 1 221 LEU 221 431 431 LEU LEU B . n 
B 1 222 PHE 222 432 432 PHE PHE B . n 
B 1 223 PRO 223 433 433 PRO PRO B . n 
B 1 224 LYS 224 434 434 LYS LYS B . n 
B 1 225 LEU 225 435 435 LEU LEU B . n 
B 1 226 LEU 226 436 436 LEU LEU B . n 
B 1 227 GLN 227 437 437 GLN GLN B . n 
B 1 228 LYS 228 438 438 LYS LYS B . n 
B 1 229 MET 229 439 439 MET MET B . n 
B 1 230 ALA 230 440 440 ALA ALA B . n 
B 1 231 ASP 231 441 441 ASP ASP B . n 
B 1 232 LEU 232 442 442 LEU LEU B . n 
B 1 233 ARG 233 443 443 ARG ARG B . n 
B 1 234 GLN 234 444 444 GLN GLN B . n 
B 1 235 LEU 235 445 445 LEU LEU B . n 
B 1 236 VAL 236 446 446 VAL VAL B . n 
B 1 237 THR 237 447 447 THR THR B . n 
B 1 238 GLU 238 448 448 GLU GLU B . n 
B 1 239 HIS 239 449 449 HIS HIS B . n 
B 1 240 ALA 240 450 450 ALA ALA B . n 
B 1 241 GLN 241 451 451 GLN GLN B . n 
B 1 242 MET 242 452 452 MET MET B . n 
B 1 243 MET 243 453 453 MET MET B . n 
B 1 244 GLN 244 454 454 GLN GLN B . n 
B 1 245 ARG 245 455 455 ARG ARG B . n 
B 1 246 ILE 246 456 456 ILE ILE B . n 
B 1 247 LYS 247 457 457 LYS LYS B . n 
B 1 248 LYS 248 458 458 LYS LYS B . n 
B 1 249 THR 249 459 459 THR THR B . n 
B 1 250 GLU 250 460 460 GLU GLU B . n 
B 1 251 THR 251 461 461 THR THR B . n 
B 1 252 GLU 252 462 462 GLU GLU B . n 
B 1 253 THR 253 463 463 THR THR B . n 
B 1 254 SER 254 464 464 SER SER B . n 
B 1 255 LEU 255 465 465 LEU LEU B . n 
B 1 256 HIS 256 466 466 HIS HIS B . n 
B 1 257 PRO 257 467 467 PRO PRO B . n 
B 1 258 LEU 258 468 468 LEU LEU B . n 
B 1 259 LEU 259 469 469 LEU LEU B . n 
B 1 260 GLN 260 470 470 GLN GLN B . n 
B 1 261 GLU 261 471 471 GLU GLU B . n 
B 1 262 ILE 262 472 472 ILE ILE B . n 
B 1 263 TYR 263 473 473 TYR TYR B . n 
B 1 264 LYS 264 474 474 LYS LYS B . n 
B 1 265 ASP 265 475 475 ASP ASP B . n 
B 1 266 MET 266 476 476 MET MET B . n 
B 1 267 TYR 267 477 477 TYR TYR B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,G 
2 1 B,F,H     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-24 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-09-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0005 ?               program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran ? 1 
PDB_EXTRACT 1.700    'May. 30, 2005' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++     ? 2 
MOLREP      .        ?               ?       ?                 ?                        phasing           ? ?       ? 3 
# 
_pdbx_database_remark.id     0 
_pdbx_database_remark.text   
;THIS ENTRY 2BAW REFLECTS AN ALTERNATIVE MODELING OF THE 
STRUCTURAL DATA IN R2GWXSF, 
ORIGINAL DATA DETERMINED BY AUTHOR: H.E.XU,M.H.LAMBERT,V.G.MONTANA, 
D.J.PARK,S.BLANCHARD,P.BROWN,D.STERNBACH,J.LEHMANN,G.W.BRUCE, 
T.M.WILLSON,S.A.KLIEWER,M.V.MILBURN
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              339 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              339 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              339 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.36 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            14.06 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 250 ? ? -142.81 -2.15  
2  1 GLU A 259 ? ? -59.33  -9.51  
3  1 VAL A 263 ? ? 43.40   -94.53 
4  1 ARG A 357 ? ? -46.54  151.40 
5  1 ASN A 402 ? ? -110.18 71.24  
6  1 GLU A 460 ? ? -103.37 77.28  
7  1 LYS A 474 ? ? -37.65  -35.52 
8  1 LYS B 232 ? ? 175.15  -52.22 
9  1 LEU B 237 ? ? -160.02 -11.56 
10 1 ALA B 342 ? ? 69.58   -95.46 
11 1 ASN B 343 ? ? -144.32 42.45  
12 1 ASN B 402 ? ? -107.65 70.12  
13 1 ALA B 423 ? ? -64.28  -86.53 
14 1 GLN B 430 ? ? 71.20   36.16  
15 1 GLU B 460 ? ? -92.29  58.81  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A VAL 263 ? CG1 ? A VAL 53  CG1 
2  1 Y 1 A VAL 263 ? CG2 ? A VAL 53  CG2 
3  1 Y 1 A LYS 275 ? CG  ? A LYS 65  CG  
4  1 Y 1 A LYS 275 ? CD  ? A LYS 65  CD  
5  1 Y 1 A LYS 275 ? CE  ? A LYS 65  CE  
6  1 Y 1 A LYS 275 ? NZ  ? A LYS 65  NZ  
7  1 Y 1 A GLN 429 ? CG  ? A GLN 219 CG  
8  1 Y 1 A GLN 429 ? CD  ? A GLN 219 CD  
9  1 Y 1 A GLN 429 ? OE1 ? A GLN 219 OE1 
10 1 Y 1 A GLN 429 ? NE2 ? A GLN 219 NE2 
11 1 Y 1 A GLU 462 ? CG  ? A GLU 252 CG  
12 1 Y 1 A GLU 462 ? CD  ? A GLU 252 CD  
13 1 Y 1 A GLU 462 ? OE1 ? A GLU 252 OE1 
14 1 Y 1 A GLU 462 ? OE2 ? A GLU 252 OE2 
15 1 Y 1 A GLN 470 ? CG  ? A GLN 260 CG  
16 1 Y 1 A GLN 470 ? CD  ? A GLN 260 CD  
17 1 Y 1 A GLN 470 ? OE1 ? A GLN 260 OE1 
18 1 Y 1 A GLN 470 ? NE2 ? A GLN 260 NE2 
19 1 Y 1 B SER 215 ? OG  ? B SER 5   OG  
20 1 Y 1 B THR 238 ? OG1 ? B THR 28  OG1 
21 1 Y 1 B THR 238 ? CG2 ? B THR 28  CG2 
22 1 Y 1 B LYS 275 ? CG  ? B LYS 65  CG  
23 1 Y 1 B LYS 275 ? CD  ? B LYS 65  CD  
24 1 Y 1 B LYS 275 ? CE  ? B LYS 65  CE  
25 1 Y 1 B LYS 275 ? NZ  ? B LYS 65  NZ  
26 1 Y 1 B LYS 336 ? CG  ? B LYS 126 CG  
27 1 Y 1 B LYS 336 ? CD  ? B LYS 126 CD  
28 1 Y 1 B LYS 336 ? CE  ? B LYS 126 CE  
29 1 Y 1 B LYS 336 ? NZ  ? B LYS 126 NZ  
30 1 Y 1 B GLN 429 ? CG  ? B GLN 219 CG  
31 1 Y 1 B GLN 429 ? CD  ? B GLN 219 CD  
32 1 Y 1 B GLN 429 ? OE1 ? B GLN 219 OE1 
33 1 Y 1 B GLN 429 ? NE2 ? B GLN 219 NE2 
34 1 Y 1 B GLN 430 ? CG  ? B GLN 220 CG  
35 1 Y 1 B GLN 430 ? CD  ? B GLN 220 CD  
36 1 Y 1 B GLN 430 ? OE1 ? B GLN 220 OE1 
37 1 Y 1 B GLN 430 ? NE2 ? B GLN 220 NE2 
38 1 Y 1 B LYS 434 ? CG  ? B LYS 224 CG  
39 1 Y 1 B LYS 434 ? CD  ? B LYS 224 CD  
40 1 Y 1 B LYS 434 ? CE  ? B LYS 224 CE  
41 1 Y 1 B LYS 434 ? NZ  ? B LYS 224 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 239 ? A GLY 29  
2  1 Y 1 A SER 242 ? A SER 32  
3  1 Y 1 A HIS 243 ? A HIS 33  
4  1 Y 1 A THR 244 ? A THR 34  
5  1 Y 1 A ALA 245 ? A ALA 35  
6  1 Y 1 A LYS 265 ? A LYS 55  
7  1 Y 1 A GLN 266 ? A GLN 56  
8  1 Y 1 A LEU 267 ? A LEU 57  
9  1 Y 1 A VAL 268 ? A VAL 58  
10 1 Y 1 A ASN 269 ? A ASN 59  
11 1 Y 1 A GLY 270 ? A GLY 60  
12 1 Y 1 A LEU 271 ? A LEU 61  
13 1 Y 1 A PRO 272 ? A PRO 62  
14 1 Y 1 A PRO 273 ? A PRO 63  
15 1 Y 1 A TYR 274 ? A TYR 64  
16 1 Y 1 A MET 476 ? A MET 266 
17 1 Y 1 A TYR 477 ? A TYR 267 
18 1 Y 1 B GLY 239 ? B GLY 29  
19 1 Y 1 B LYS 240 ? B LYS 30  
20 1 Y 1 B ALA 241 ? B ALA 31  
21 1 Y 1 B SER 242 ? B SER 32  
22 1 Y 1 B HIS 243 ? B HIS 33  
23 1 Y 1 B THR 244 ? B THR 34  
24 1 Y 1 B ALA 245 ? B ALA 35  
25 1 Y 1 B VAL 263 ? B VAL 53  
26 1 Y 1 B TRP 264 ? B TRP 54  
27 1 Y 1 B LYS 265 ? B LYS 55  
28 1 Y 1 B GLN 266 ? B GLN 56  
29 1 Y 1 B LEU 267 ? B LEU 57  
30 1 Y 1 B VAL 268 ? B VAL 58  
31 1 Y 1 B ASN 269 ? B ASN 59  
32 1 Y 1 B GLY 270 ? B GLY 60  
33 1 Y 1 B LEU 271 ? B LEU 61  
34 1 Y 1 B PRO 272 ? B PRO 62  
35 1 Y 1 B PRO 273 ? B PRO 63  
36 1 Y 1 B TYR 274 ? B TYR 64  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 HEPTYL-BETA-D-GLUCOPYRANOSIDE B7G 
3 'VACCENIC ACID'               VCA 
4 water                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 B7G 1  920  920 B7G B7G A . 
D 2 B7G 1  921  921 B7G B7G A . 
E 3 VCA 1  201  201 VCA VCA A . 
F 3 VCA 1  478  301 VCA VCA B . 
G 4 HOH 1  922  1   HOH HOH A . 
G 4 HOH 2  923  2   HOH HOH A . 
G 4 HOH 3  924  4   HOH HOH A . 
G 4 HOH 4  925  6   HOH HOH A . 
G 4 HOH 5  926  7   HOH HOH A . 
G 4 HOH 6  927  8   HOH HOH A . 
G 4 HOH 7  928  9   HOH HOH A . 
G 4 HOH 8  929  10  HOH HOH A . 
G 4 HOH 9  930  12  HOH HOH A . 
G 4 HOH 10 931  15  HOH HOH A . 
G 4 HOH 11 932  16  HOH HOH A . 
G 4 HOH 12 933  17  HOH HOH A . 
G 4 HOH 13 934  18  HOH HOH A . 
G 4 HOH 14 935  19  HOH HOH A . 
G 4 HOH 15 936  21  HOH HOH A . 
G 4 HOH 16 937  22  HOH HOH A . 
G 4 HOH 17 938  23  HOH HOH A . 
G 4 HOH 18 939  24  HOH HOH A . 
G 4 HOH 19 940  28  HOH HOH A . 
G 4 HOH 20 941  32  HOH HOH A . 
G 4 HOH 21 942  35  HOH HOH A . 
G 4 HOH 22 943  36  HOH HOH A . 
G 4 HOH 23 944  40  HOH HOH A . 
G 4 HOH 24 945  41  HOH HOH A . 
G 4 HOH 25 946  46  HOH HOH A . 
G 4 HOH 26 947  47  HOH HOH A . 
G 4 HOH 27 948  49  HOH HOH A . 
G 4 HOH 28 949  50  HOH HOH A . 
G 4 HOH 29 950  53  HOH HOH A . 
G 4 HOH 30 951  54  HOH HOH A . 
G 4 HOH 31 952  55  HOH HOH A . 
G 4 HOH 32 953  56  HOH HOH A . 
G 4 HOH 33 954  58  HOH HOH A . 
G 4 HOH 34 955  60  HOH HOH A . 
G 4 HOH 35 956  63  HOH HOH A . 
G 4 HOH 36 957  65  HOH HOH A . 
G 4 HOH 37 958  66  HOH HOH A . 
G 4 HOH 38 959  70  HOH HOH A . 
G 4 HOH 39 960  71  HOH HOH A . 
G 4 HOH 40 961  73  HOH HOH A . 
G 4 HOH 41 962  74  HOH HOH A . 
G 4 HOH 42 963  76  HOH HOH A . 
G 4 HOH 43 964  77  HOH HOH A . 
G 4 HOH 44 965  81  HOH HOH A . 
G 4 HOH 45 966  82  HOH HOH A . 
G 4 HOH 46 967  85  HOH HOH A . 
G 4 HOH 47 968  88  HOH HOH A . 
G 4 HOH 48 969  92  HOH HOH A . 
G 4 HOH 49 970  96  HOH HOH A . 
G 4 HOH 50 971  98  HOH HOH A . 
G 4 HOH 51 972  100 HOH HOH A . 
G 4 HOH 52 973  101 HOH HOH A . 
G 4 HOH 53 974  103 HOH HOH A . 
G 4 HOH 54 975  105 HOH HOH A . 
G 4 HOH 55 976  107 HOH HOH A . 
G 4 HOH 56 977  108 HOH HOH A . 
G 4 HOH 57 978  109 HOH HOH A . 
G 4 HOH 58 979  110 HOH HOH A . 
G 4 HOH 59 980  112 HOH HOH A . 
G 4 HOH 60 981  116 HOH HOH A . 
G 4 HOH 61 982  117 HOH HOH A . 
G 4 HOH 62 983  118 HOH HOH A . 
G 4 HOH 63 984  119 HOH HOH A . 
G 4 HOH 64 985  120 HOH HOH A . 
G 4 HOH 65 986  127 HOH HOH A . 
G 4 HOH 66 987  128 HOH HOH A . 
G 4 HOH 67 988  130 HOH HOH A . 
G 4 HOH 68 989  131 HOH HOH A . 
G 4 HOH 69 990  132 HOH HOH A . 
G 4 HOH 70 991  134 HOH HOH A . 
G 4 HOH 71 992  137 HOH HOH A . 
G 4 HOH 72 993  138 HOH HOH A . 
G 4 HOH 73 994  143 HOH HOH A . 
G 4 HOH 74 995  146 HOH HOH A . 
G 4 HOH 75 996  147 HOH HOH A . 
G 4 HOH 76 997  149 HOH HOH A . 
G 4 HOH 77 998  151 HOH HOH A . 
G 4 HOH 78 999  152 HOH HOH A . 
G 4 HOH 79 1000 155 HOH HOH A . 
G 4 HOH 80 1001 156 HOH HOH A . 
G 4 HOH 81 1002 157 HOH HOH A . 
G 4 HOH 82 1003 159 HOH HOH A . 
G 4 HOH 83 1004 161 HOH HOH A . 
H 4 HOH 1  479  3   HOH HOH B . 
H 4 HOH 2  480  5   HOH HOH B . 
H 4 HOH 3  481  11  HOH HOH B . 
H 4 HOH 4  482  13  HOH HOH B . 
H 4 HOH 5  483  14  HOH HOH B . 
H 4 HOH 6  484  20  HOH HOH B . 
H 4 HOH 7  485  25  HOH HOH B . 
H 4 HOH 8  486  26  HOH HOH B . 
H 4 HOH 9  487  27  HOH HOH B . 
H 4 HOH 10 488  29  HOH HOH B . 
H 4 HOH 11 489  30  HOH HOH B . 
H 4 HOH 12 490  31  HOH HOH B . 
H 4 HOH 13 491  33  HOH HOH B . 
H 4 HOH 14 492  34  HOH HOH B . 
H 4 HOH 15 493  37  HOH HOH B . 
H 4 HOH 16 494  38  HOH HOH B . 
H 4 HOH 17 495  39  HOH HOH B . 
H 4 HOH 18 496  42  HOH HOH B . 
H 4 HOH 19 497  43  HOH HOH B . 
H 4 HOH 20 498  44  HOH HOH B . 
H 4 HOH 21 499  45  HOH HOH B . 
H 4 HOH 22 500  48  HOH HOH B . 
H 4 HOH 23 501  51  HOH HOH B . 
H 4 HOH 24 502  52  HOH HOH B . 
H 4 HOH 25 503  57  HOH HOH B . 
H 4 HOH 26 504  59  HOH HOH B . 
H 4 HOH 27 505  61  HOH HOH B . 
H 4 HOH 28 506  62  HOH HOH B . 
H 4 HOH 29 507  64  HOH HOH B . 
H 4 HOH 30 508  67  HOH HOH B . 
H 4 HOH 31 509  68  HOH HOH B . 
H 4 HOH 32 510  69  HOH HOH B . 
H 4 HOH 33 511  72  HOH HOH B . 
H 4 HOH 34 512  75  HOH HOH B . 
H 4 HOH 35 513  78  HOH HOH B . 
H 4 HOH 36 514  79  HOH HOH B . 
H 4 HOH 37 515  80  HOH HOH B . 
H 4 HOH 38 516  83  HOH HOH B . 
H 4 HOH 39 517  84  HOH HOH B . 
H 4 HOH 40 518  86  HOH HOH B . 
H 4 HOH 41 519  87  HOH HOH B . 
H 4 HOH 42 520  89  HOH HOH B . 
H 4 HOH 43 521  90  HOH HOH B . 
H 4 HOH 44 522  91  HOH HOH B . 
H 4 HOH 45 523  93  HOH HOH B . 
H 4 HOH 46 524  94  HOH HOH B . 
H 4 HOH 47 525  95  HOH HOH B . 
H 4 HOH 48 526  97  HOH HOH B . 
H 4 HOH 49 527  99  HOH HOH B . 
H 4 HOH 50 528  102 HOH HOH B . 
H 4 HOH 51 529  104 HOH HOH B . 
H 4 HOH 52 530  106 HOH HOH B . 
H 4 HOH 53 531  111 HOH HOH B . 
H 4 HOH 54 532  113 HOH HOH B . 
H 4 HOH 55 533  114 HOH HOH B . 
H 4 HOH 56 534  115 HOH HOH B . 
H 4 HOH 57 535  121 HOH HOH B . 
H 4 HOH 58 536  122 HOH HOH B . 
H 4 HOH 59 537  123 HOH HOH B . 
H 4 HOH 60 538  124 HOH HOH B . 
H 4 HOH 61 539  125 HOH HOH B . 
H 4 HOH 62 540  126 HOH HOH B . 
H 4 HOH 63 541  129 HOH HOH B . 
H 4 HOH 64 542  133 HOH HOH B . 
H 4 HOH 65 543  135 HOH HOH B . 
H 4 HOH 66 544  136 HOH HOH B . 
H 4 HOH 67 545  139 HOH HOH B . 
H 4 HOH 68 546  140 HOH HOH B . 
H 4 HOH 69 547  141 HOH HOH B . 
H 4 HOH 70 548  142 HOH HOH B . 
H 4 HOH 71 549  144 HOH HOH B . 
H 4 HOH 72 550  145 HOH HOH B . 
H 4 HOH 73 551  148 HOH HOH B . 
H 4 HOH 74 552  150 HOH HOH B . 
H 4 HOH 75 553  153 HOH HOH B . 
H 4 HOH 76 554  154 HOH HOH B . 
H 4 HOH 77 555  158 HOH HOH B . 
H 4 HOH 78 556  160 HOH HOH B . 
#