data_2BG9
# 
_entry.id   2BG9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BG9         
PDBE  EBI-22015    
WWPDB D_1290022015 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1L4W unspecified 
'NMR STRUCTURE OF AN ACHR-PEPTIDE (TORPEDO CALIFORNICA,ALPHA-SUBUNIT RESIDUES 182-202) IN COMPLEX WITH ALPHA-BUNGAROTOXIN' 
PDB 1LJZ unspecified 
'NMR STRUCTURE OF AN ACHR-PEPTIDE (TORPEDO CALIFORNICA,ALPHA-SUBUNIT RESIDUES 182-202) IN COMPLEX WITH ALPHA-BUNGAROTOXIN' 
PDB 1OED unspecified 'STRUCTURE OF ACETYLCHOLINE RECEPTOR PORE FROM ELECTRON IMAGES' 
PDB 1I9B unspecified 'X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP)' 
PDB 1UV6 unspecified 'X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH CARBAMYLCHOLINE' 
PDB 1F3R unspecified 'NMR STRUCTURE OF AN MIR PEPTIDE ANALOGUE IN COMPLEX WITH AN FV ANTIBODY FRAGMENT' 
PDB 1TOR unspecified 'NMR STRUCTURES OF AN MIR PEPTIDE ANALOGUE IN COMPLEX WITH AN ANTIBODY' 
PDB 1TOS unspecified 'NMR STRUCTURES OF AN MIR PEPTIDE ANALOGUE IN COMPLEX WITH AN ANTIBODY' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BG9 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Unwin, N.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution' J.Mol.Biol. 346 967 ? 2005 JMOBAK UK 
0022-2836 0070 ? 15701510 10.1016/J.JMB.2004.12.031 
1       'Structure and Gating Mechanism of the Acetylcholine Receptor Pore'          Nature      423 949 ? 2003 NATUAS UK 
0028-0836 0006 ? 12827192 10.1038/NATURE01748       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Unwin, N.'     1 ? 
1       'Miyazawa, A.'  2 ? 
1       'Fujiyoshi, Y.' 3 ? 
1       'Unwin, N.'     4 ? 
# 
_cell.entry_id           2BG9 
_cell.length_a           1.0 
_cell.length_b           1.0 
_cell.length_c           1.0 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BG9 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN' 42501.316 2 ? ? ? ? 
2 polymer nat 'ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN'  42167.359 1 ? ? ? ? 
3 polymer nat 'ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN' 42280.695 1 ? ? ? ? 
4 polymer nat 'ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN' 42299.496 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'NICOTINIC ACETYLCHOLINE RECEPTOR' 
2 'NICOTINIC ACETYLCHOLINE RECEPTOR' 
3 'NICOTINIC ACETYLCHOLINE RECEPTOR' 
4 'NICOTINIC ACETYLCHOLINE RECEPTOR' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRL
PSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISP
ESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHSAIEGVKYIAEHMK
SDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
;
;SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRL
PSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISP
ESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHSAIEGVKYIAEHMK
SDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
;
A,D ? 
2 'polypeptide(L)' no no 
;SVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSI
PSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQH
ALDAMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDAGEKM
SLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHEAVEAIKYIAEQLESAS
EFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFLDASHNVPPDNPFA
;
;SVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSI
PSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQH
ALDAMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDAGEKM
SLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHEAVEAIKYIAEQLESAS
EFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFLDASHNVPPDNPFA
;
B   ? 
3 'polypeptide(L)' no no 
;VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISIL
RLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISM
DLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGE
KMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKE
KNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
;
;VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISIL
RLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISM
DLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGE
KMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKE
KNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
;
C   ? 
4 'polypeptide(L)' no no 
;NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIP
SELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLS
AEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAG
GQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKST
KEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
;
;NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIP
SELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLS
AEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAG
GQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKST
KEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
;
E   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   HIS n 
1 4   GLU n 
1 5   THR n 
1 6   ARG n 
1 7   LEU n 
1 8   VAL n 
1 9   ALA n 
1 10  ASN n 
1 11  LEU n 
1 12  LEU n 
1 13  GLU n 
1 14  ASN n 
1 15  TYR n 
1 16  ASN n 
1 17  LYS n 
1 18  VAL n 
1 19  ILE n 
1 20  ARG n 
1 21  PRO n 
1 22  VAL n 
1 23  GLU n 
1 24  HIS n 
1 25  HIS n 
1 26  THR n 
1 27  HIS n 
1 28  PHE n 
1 29  VAL n 
1 30  ASP n 
1 31  ILE n 
1 32  THR n 
1 33  VAL n 
1 34  GLY n 
1 35  LEU n 
1 36  GLN n 
1 37  LEU n 
1 38  ILE n 
1 39  GLN n 
1 40  LEU n 
1 41  ILE n 
1 42  ASN n 
1 43  VAL n 
1 44  ASP n 
1 45  GLU n 
1 46  VAL n 
1 47  ASN n 
1 48  GLN n 
1 49  ILE n 
1 50  VAL n 
1 51  GLU n 
1 52  THR n 
1 53  ASN n 
1 54  VAL n 
1 55  ARG n 
1 56  LEU n 
1 57  ARG n 
1 58  GLN n 
1 59  GLN n 
1 60  TRP n 
1 61  ILE n 
1 62  ASP n 
1 63  VAL n 
1 64  ARG n 
1 65  LEU n 
1 66  ARG n 
1 67  TRP n 
1 68  ASN n 
1 69  PRO n 
1 70  ALA n 
1 71  ASP n 
1 72  TYR n 
1 73  GLY n 
1 74  GLY n 
1 75  ILE n 
1 76  LYS n 
1 77  LYS n 
1 78  ILE n 
1 79  ARG n 
1 80  LEU n 
1 81  PRO n 
1 82  SER n 
1 83  ASP n 
1 84  ASP n 
1 85  VAL n 
1 86  TRP n 
1 87  LEU n 
1 88  PRO n 
1 89  ASP n 
1 90  LEU n 
1 91  VAL n 
1 92  LEU n 
1 93  TYR n 
1 94  ASN n 
1 95  ASN n 
1 96  ALA n 
1 97  ASP n 
1 98  GLY n 
1 99  ASP n 
1 100 PHE n 
1 101 ALA n 
1 102 ILE n 
1 103 VAL n 
1 104 HIS n 
1 105 MET n 
1 106 THR n 
1 107 LYS n 
1 108 LEU n 
1 109 LEU n 
1 110 LEU n 
1 111 ASP n 
1 112 TYR n 
1 113 THR n 
1 114 GLY n 
1 115 LYS n 
1 116 ILE n 
1 117 MET n 
1 118 TRP n 
1 119 THR n 
1 120 PRO n 
1 121 PRO n 
1 122 ALA n 
1 123 ILE n 
1 124 PHE n 
1 125 LYS n 
1 126 SER n 
1 127 TYR n 
1 128 CYS n 
1 129 GLU n 
1 130 ILE n 
1 131 ILE n 
1 132 VAL n 
1 133 THR n 
1 134 HIS n 
1 135 PHE n 
1 136 PRO n 
1 137 PHE n 
1 138 ASP n 
1 139 GLN n 
1 140 GLN n 
1 141 ASN n 
1 142 CYS n 
1 143 THR n 
1 144 MET n 
1 145 LYS n 
1 146 LEU n 
1 147 GLY n 
1 148 ILE n 
1 149 TRP n 
1 150 THR n 
1 151 TYR n 
1 152 ASP n 
1 153 GLY n 
1 154 THR n 
1 155 LYS n 
1 156 VAL n 
1 157 SER n 
1 158 ILE n 
1 159 SER n 
1 160 PRO n 
1 161 GLU n 
1 162 SER n 
1 163 ASP n 
1 164 ARG n 
1 165 PRO n 
1 166 ASP n 
1 167 LEU n 
1 168 SER n 
1 169 THR n 
1 170 PHE n 
1 171 MET n 
1 172 GLU n 
1 173 SER n 
1 174 GLY n 
1 175 GLU n 
1 176 TRP n 
1 177 VAL n 
1 178 MET n 
1 179 LYS n 
1 180 ASP n 
1 181 TYR n 
1 182 ARG n 
1 183 GLY n 
1 184 TRP n 
1 185 LYS n 
1 186 HIS n 
1 187 TRP n 
1 188 VAL n 
1 189 TYR n 
1 190 TYR n 
1 191 THR n 
1 192 CYS n 
1 193 CYS n 
1 194 PRO n 
1 195 ASP n 
1 196 THR n 
1 197 PRO n 
1 198 TYR n 
1 199 LEU n 
1 200 ASP n 
1 201 ILE n 
1 202 THR n 
1 203 TYR n 
1 204 HIS n 
1 205 PHE n 
1 206 ILE n 
1 207 MET n 
1 208 GLN n 
1 209 ARG n 
1 210 ILE n 
1 211 PRO n 
1 212 LEU n 
1 213 TYR n 
1 214 PHE n 
1 215 VAL n 
1 216 VAL n 
1 217 ASN n 
1 218 VAL n 
1 219 ILE n 
1 220 ILE n 
1 221 PRO n 
1 222 CYS n 
1 223 LEU n 
1 224 LEU n 
1 225 PHE n 
1 226 SER n 
1 227 PHE n 
1 228 LEU n 
1 229 THR n 
1 230 VAL n 
1 231 LEU n 
1 232 VAL n 
1 233 PHE n 
1 234 TYR n 
1 235 LEU n 
1 236 PRO n 
1 237 THR n 
1 238 ASP n 
1 239 SER n 
1 240 GLY n 
1 241 GLU n 
1 242 LYS n 
1 243 MET n 
1 244 THR n 
1 245 LEU n 
1 246 SER n 
1 247 ILE n 
1 248 SER n 
1 249 VAL n 
1 250 LEU n 
1 251 LEU n 
1 252 SER n 
1 253 LEU n 
1 254 THR n 
1 255 VAL n 
1 256 PHE n 
1 257 LEU n 
1 258 LEU n 
1 259 VAL n 
1 260 ILE n 
1 261 VAL n 
1 262 GLU n 
1 263 LEU n 
1 264 ILE n 
1 265 PRO n 
1 266 SER n 
1 267 THR n 
1 268 SER n 
1 269 SER n 
1 270 ALA n 
1 271 VAL n 
1 272 PRO n 
1 273 LEU n 
1 274 ILE n 
1 275 GLY n 
1 276 LYS n 
1 277 TYR n 
1 278 MET n 
1 279 LEU n 
1 280 PHE n 
1 281 THR n 
1 282 MET n 
1 283 ILE n 
1 284 PHE n 
1 285 VAL n 
1 286 ILE n 
1 287 SER n 
1 288 SER n 
1 289 ILE n 
1 290 ILE n 
1 291 VAL n 
1 292 THR n 
1 293 VAL n 
1 294 VAL n 
1 295 VAL n 
1 296 ILE n 
1 297 ASN n 
1 298 THR n 
1 299 HIS n 
1 300 HIS n 
1 301 ARG n 
1 302 SER n 
1 303 PRO n 
1 304 SER n 
1 305 THR n 
1 306 HIS n 
1 307 SER n 
1 308 ALA n 
1 309 ILE n 
1 310 GLU n 
1 311 GLY n 
1 312 VAL n 
1 313 LYS n 
1 314 TYR n 
1 315 ILE n 
1 316 ALA n 
1 317 GLU n 
1 318 HIS n 
1 319 MET n 
1 320 LYS n 
1 321 SER n 
1 322 ASP n 
1 323 GLU n 
1 324 GLU n 
1 325 SER n 
1 326 SER n 
1 327 ASN n 
1 328 ALA n 
1 329 ALA n 
1 330 GLU n 
1 331 GLU n 
1 332 TRP n 
1 333 LYS n 
1 334 TYR n 
1 335 VAL n 
1 336 ALA n 
1 337 MET n 
1 338 VAL n 
1 339 ILE n 
1 340 ASP n 
1 341 HIS n 
1 342 ILE n 
1 343 LEU n 
1 344 LEU n 
1 345 CYS n 
1 346 VAL n 
1 347 PHE n 
1 348 MET n 
1 349 LEU n 
1 350 ILE n 
1 351 CYS n 
1 352 ILE n 
1 353 ILE n 
1 354 GLY n 
1 355 THR n 
1 356 VAL n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 ALA n 
1 361 GLY n 
1 362 ARG n 
1 363 LEU n 
1 364 ILE n 
1 365 GLU n 
1 366 LEU n 
1 367 SER n 
1 368 GLN n 
1 369 GLU n 
1 370 GLY n 
2 1   SER n 
2 2   VAL n 
2 3   MET n 
2 4   GLU n 
2 5   ASP n 
2 6   THR n 
2 7   LEU n 
2 8   LEU n 
2 9   SER n 
2 10  VAL n 
2 11  LEU n 
2 12  PHE n 
2 13  GLU n 
2 14  ASN n 
2 15  TYR n 
2 16  ASN n 
2 17  PRO n 
2 18  LYS n 
2 19  VAL n 
2 20  ARG n 
2 21  PRO n 
2 22  SER n 
2 23  GLN n 
2 24  THR n 
2 25  VAL n 
2 26  GLY n 
2 27  ASP n 
2 28  LYS n 
2 29  VAL n 
2 30  THR n 
2 31  VAL n 
2 32  ARG n 
2 33  VAL n 
2 34  GLY n 
2 35  LEU n 
2 36  THR n 
2 37  LEU n 
2 38  THR n 
2 39  SER n 
2 40  LEU n 
2 41  LEU n 
2 42  ILE n 
2 43  LEU n 
2 44  ASN n 
2 45  GLU n 
2 46  LYS n 
2 47  ASN n 
2 48  GLU n 
2 49  GLU n 
2 50  MET n 
2 51  THR n 
2 52  THR n 
2 53  SER n 
2 54  VAL n 
2 55  PHE n 
2 56  LEU n 
2 57  ASN n 
2 58  LEU n 
2 59  ALA n 
2 60  TRP n 
2 61  THR n 
2 62  ASP n 
2 63  TYR n 
2 64  ARG n 
2 65  LEU n 
2 66  GLN n 
2 67  TRP n 
2 68  ASP n 
2 69  PRO n 
2 70  ALA n 
2 71  ALA n 
2 72  TYR n 
2 73  GLU n 
2 74  GLY n 
2 75  ILE n 
2 76  LYS n 
2 77  ASP n 
2 78  LEU n 
2 79  SER n 
2 80  ILE n 
2 81  PRO n 
2 82  SER n 
2 83  ASP n 
2 84  ASP n 
2 85  VAL n 
2 86  TRP n 
2 87  GLN n 
2 88  PRO n 
2 89  ASP n 
2 90  ILE n 
2 91  VAL n 
2 92  LEU n 
2 93  MET n 
2 94  ASN n 
2 95  ASN n 
2 96  ASN n 
2 97  ASP n 
2 98  GLY n 
2 99  SER n 
2 100 PHE n 
2 101 GLU n 
2 102 ILE n 
2 103 THR n 
2 104 LEU n 
2 105 HIS n 
2 106 VAL n 
2 107 ASN n 
2 108 VAL n 
2 109 LEU n 
2 110 VAL n 
2 111 GLN n 
2 112 HIS n 
2 113 THR n 
2 114 GLY n 
2 115 ALA n 
2 116 VAL n 
2 117 SER n 
2 118 TRP n 
2 119 HIS n 
2 120 PRO n 
2 121 SER n 
2 122 ALA n 
2 123 ILE n 
2 124 TYR n 
2 125 ARG n 
2 126 SER n 
2 127 SER n 
2 128 CYS n 
2 129 THR n 
2 130 ILE n 
2 131 LYS n 
2 132 VAL n 
2 133 MET n 
2 134 TYR n 
2 135 PHE n 
2 136 PRO n 
2 137 PHE n 
2 138 ASP n 
2 139 TRP n 
2 140 GLN n 
2 141 ASN n 
2 142 CYS n 
2 143 THR n 
2 144 MET n 
2 145 VAL n 
2 146 PHE n 
2 147 LYS n 
2 148 SER n 
2 149 TYR n 
2 150 THR n 
2 151 TYR n 
2 152 ASP n 
2 153 THR n 
2 154 SER n 
2 155 GLU n 
2 156 VAL n 
2 157 ILE n 
2 158 LEU n 
2 159 GLN n 
2 160 HIS n 
2 161 ALA n 
2 162 LEU n 
2 163 ASP n 
2 164 ALA n 
2 165 MET n 
2 166 ILE n 
2 167 ASN n 
2 168 GLN n 
2 169 ASP n 
2 170 ALA n 
2 171 PHE n 
2 172 THR n 
2 173 GLU n 
2 174 ASN n 
2 175 GLY n 
2 176 GLN n 
2 177 TRP n 
2 178 SER n 
2 179 ILE n 
2 180 GLU n 
2 181 HIS n 
2 182 LYS n 
2 183 PRO n 
2 184 SER n 
2 185 ARG n 
2 186 LYS n 
2 187 ASN n 
2 188 TRP n 
2 189 ARG n 
2 190 SER n 
2 191 ASP n 
2 192 ASP n 
2 193 PRO n 
2 194 SER n 
2 195 TYR n 
2 196 GLU n 
2 197 ASP n 
2 198 VAL n 
2 199 THR n 
2 200 PHE n 
2 201 TYR n 
2 202 LEU n 
2 203 ILE n 
2 204 ILE n 
2 205 GLN n 
2 206 ARG n 
2 207 LYS n 
2 208 PRO n 
2 209 LEU n 
2 210 PHE n 
2 211 TYR n 
2 212 ILE n 
2 213 VAL n 
2 214 TYR n 
2 215 THR n 
2 216 ILE n 
2 217 VAL n 
2 218 PRO n 
2 219 CYS n 
2 220 ILE n 
2 221 LEU n 
2 222 ILE n 
2 223 SER n 
2 224 ILE n 
2 225 LEU n 
2 226 ALA n 
2 227 ILE n 
2 228 LEU n 
2 229 VAL n 
2 230 PHE n 
2 231 TYR n 
2 232 LEU n 
2 233 PRO n 
2 234 PRO n 
2 235 ASP n 
2 236 ALA n 
2 237 GLY n 
2 238 GLU n 
2 239 LYS n 
2 240 MET n 
2 241 SER n 
2 242 LEU n 
2 243 SER n 
2 244 ILE n 
2 245 SER n 
2 246 ALA n 
2 247 LEU n 
2 248 LEU n 
2 249 ALA n 
2 250 LEU n 
2 251 THR n 
2 252 VAL n 
2 253 PHE n 
2 254 LEU n 
2 255 LEU n 
2 256 LEU n 
2 257 LEU n 
2 258 ALA n 
2 259 ASP n 
2 260 LYS n 
2 261 VAL n 
2 262 PRO n 
2 263 GLU n 
2 264 THR n 
2 265 SER n 
2 266 LEU n 
2 267 SER n 
2 268 VAL n 
2 269 PRO n 
2 270 ILE n 
2 271 ILE n 
2 272 ILE n 
2 273 SER n 
2 274 TYR n 
2 275 LEU n 
2 276 MET n 
2 277 PHE n 
2 278 ILE n 
2 279 MET n 
2 280 ILE n 
2 281 LEU n 
2 282 VAL n 
2 283 ALA n 
2 284 PHE n 
2 285 SER n 
2 286 VAL n 
2 287 ILE n 
2 288 LEU n 
2 289 SER n 
2 290 VAL n 
2 291 VAL n 
2 292 VAL n 
2 293 LEU n 
2 294 ASN n 
2 295 LEU n 
2 296 HIS n 
2 297 HIS n 
2 298 ARG n 
2 299 SER n 
2 300 PRO n 
2 301 ASN n 
2 302 THR n 
2 303 HIS n 
2 304 GLU n 
2 305 ALA n 
2 306 VAL n 
2 307 GLU n 
2 308 ALA n 
2 309 ILE n 
2 310 LYS n 
2 311 TYR n 
2 312 ILE n 
2 313 ALA n 
2 314 GLU n 
2 315 GLN n 
2 316 LEU n 
2 317 GLU n 
2 318 SER n 
2 319 ALA n 
2 320 SER n 
2 321 GLU n 
2 322 PHE n 
2 323 ASP n 
2 324 ASP n 
2 325 LEU n 
2 326 LYS n 
2 327 LYS n 
2 328 ASP n 
2 329 TRP n 
2 330 GLN n 
2 331 TYR n 
2 332 VAL n 
2 333 ALA n 
2 334 MET n 
2 335 VAL n 
2 336 ALA n 
2 337 ASP n 
2 338 ARG n 
2 339 LEU n 
2 340 PHE n 
2 341 LEU n 
2 342 TYR n 
2 343 ILE n 
2 344 PHE n 
2 345 ILE n 
2 346 THR n 
2 347 MET n 
2 348 CYS n 
2 349 SER n 
2 350 ILE n 
2 351 GLY n 
2 352 THR n 
2 353 PHE n 
2 354 SER n 
2 355 ILE n 
2 356 PHE n 
2 357 LEU n 
2 358 ASP n 
2 359 ALA n 
2 360 SER n 
2 361 HIS n 
2 362 ASN n 
2 363 VAL n 
2 364 PRO n 
2 365 PRO n 
2 366 ASP n 
2 367 ASN n 
2 368 PRO n 
2 369 PHE n 
2 370 ALA n 
3 1   VAL n 
3 2   ASN n 
3 3   GLU n 
3 4   GLU n 
3 5   GLU n 
3 6   ARG n 
3 7   LEU n 
3 8   ILE n 
3 9   ASN n 
3 10  ASP n 
3 11  LEU n 
3 12  LEU n 
3 13  ILE n 
3 14  VAL n 
3 15  ASN n 
3 16  LYS n 
3 17  TYR n 
3 18  ASN n 
3 19  LYS n 
3 20  HIS n 
3 21  VAL n 
3 22  ARG n 
3 23  PRO n 
3 24  VAL n 
3 25  LYS n 
3 26  HIS n 
3 27  ASN n 
3 28  ASN n 
3 29  GLU n 
3 30  VAL n 
3 31  VAL n 
3 32  ASN n 
3 33  ILE n 
3 34  ALA n 
3 35  LEU n 
3 36  SER n 
3 37  LEU n 
3 38  THR n 
3 39  LEU n 
3 40  SER n 
3 41  ASN n 
3 42  LEU n 
3 43  ILE n 
3 44  SER n 
3 45  LEU n 
3 46  LYS n 
3 47  GLU n 
3 48  THR n 
3 49  ASP n 
3 50  GLU n 
3 51  THR n 
3 52  LEU n 
3 53  THR n 
3 54  THR n 
3 55  ASN n 
3 56  VAL n 
3 57  TRP n 
3 58  MET n 
3 59  ASP n 
3 60  HIS n 
3 61  ALA n 
3 62  TRP n 
3 63  TYR n 
3 64  ASP n 
3 65  HIS n 
3 66  ARG n 
3 67  LEU n 
3 68  THR n 
3 69  TRP n 
3 70  ASN n 
3 71  ALA n 
3 72  SER n 
3 73  GLU n 
3 74  TYR n 
3 75  SER n 
3 76  ASP n 
3 77  ILE n 
3 78  SER n 
3 79  ILE n 
3 80  LEU n 
3 81  ARG n 
3 82  LEU n 
3 83  ARG n 
3 84  PRO n 
3 85  GLU n 
3 86  LEU n 
3 87  ILE n 
3 88  TRP n 
3 89  ILE n 
3 90  PRO n 
3 91  ASP n 
3 92  ILE n 
3 93  VAL n 
3 94  LEU n 
3 95  GLN n 
3 96  ASN n 
3 97  ASN n 
3 98  ASN n 
3 99  ASP n 
3 100 GLY n 
3 101 GLN n 
3 102 TYR n 
3 103 ASN n 
3 104 VAL n 
3 105 ALA n 
3 106 TYR n 
3 107 PHE n 
3 108 CYS n 
3 109 ASN n 
3 110 VAL n 
3 111 LEU n 
3 112 VAL n 
3 113 ARG n 
3 114 PRO n 
3 115 ASN n 
3 116 GLY n 
3 117 TYR n 
3 118 VAL n 
3 119 THR n 
3 120 TRP n 
3 121 LEU n 
3 122 PRO n 
3 123 PRO n 
3 124 ALA n 
3 125 ILE n 
3 126 PHE n 
3 127 ARG n 
3 128 SER n 
3 129 SER n 
3 130 CYS n 
3 131 PRO n 
3 132 ILE n 
3 133 ASN n 
3 134 VAL n 
3 135 LEU n 
3 136 TYR n 
3 137 PHE n 
3 138 PRO n 
3 139 PHE n 
3 140 ASP n 
3 141 TRP n 
3 142 GLN n 
3 143 ASN n 
3 144 CYS n 
3 145 SER n 
3 146 LEU n 
3 147 LYS n 
3 148 PHE n 
3 149 THR n 
3 150 ALA n 
3 151 LEU n 
3 152 ASN n 
3 153 TYR n 
3 154 ASN n 
3 155 ALA n 
3 156 ASN n 
3 157 GLU n 
3 158 ILE n 
3 159 SER n 
3 160 MET n 
3 161 ASP n 
3 162 LEU n 
3 163 ILE n 
3 164 ILE n 
3 165 ASP n 
3 166 PRO n 
3 167 GLU n 
3 168 ALA n 
3 169 PHE n 
3 170 THR n 
3 171 GLU n 
3 172 ASN n 
3 173 GLY n 
3 174 GLU n 
3 175 TRP n 
3 176 GLU n 
3 177 ILE n 
3 178 ILE n 
3 179 HIS n 
3 180 LYS n 
3 181 PRO n 
3 182 ALA n 
3 183 LYS n 
3 184 LYS n 
3 185 ASN n 
3 186 ILE n 
3 187 TYR n 
3 188 GLY n 
3 189 ASP n 
3 190 LYS n 
3 191 PHE n 
3 192 PRO n 
3 193 ASN n 
3 194 GLY n 
3 195 THR n 
3 196 ASN n 
3 197 TYR n 
3 198 GLN n 
3 199 ASP n 
3 200 VAL n 
3 201 THR n 
3 202 PHE n 
3 203 TYR n 
3 204 LEU n 
3 205 ILE n 
3 206 ILE n 
3 207 ARG n 
3 208 ARG n 
3 209 LYS n 
3 210 PRO n 
3 211 LEU n 
3 212 PHE n 
3 213 TYR n 
3 214 VAL n 
3 215 ILE n 
3 216 ASN n 
3 217 PHE n 
3 218 ILE n 
3 219 THR n 
3 220 PRO n 
3 221 CYS n 
3 222 VAL n 
3 223 LEU n 
3 224 ILE n 
3 225 SER n 
3 226 PHE n 
3 227 LEU n 
3 228 ALA n 
3 229 ALA n 
3 230 LEU n 
3 231 ALA n 
3 232 PHE n 
3 233 TYR n 
3 234 LEU n 
3 235 PRO n 
3 236 ALA n 
3 237 GLU n 
3 238 SER n 
3 239 GLY n 
3 240 GLU n 
3 241 LYS n 
3 242 MET n 
3 243 SER n 
3 244 THR n 
3 245 ALA n 
3 246 ILE n 
3 247 CYS n 
3 248 VAL n 
3 249 LEU n 
3 250 LEU n 
3 251 ALA n 
3 252 GLN n 
3 253 ALA n 
3 254 VAL n 
3 255 PHE n 
3 256 LEU n 
3 257 LEU n 
3 258 LEU n 
3 259 THR n 
3 260 SER n 
3 261 GLN n 
3 262 ARG n 
3 263 LEU n 
3 264 PRO n 
3 265 GLU n 
3 266 THR n 
3 267 ALA n 
3 268 LEU n 
3 269 ALA n 
3 270 VAL n 
3 271 PRO n 
3 272 LEU n 
3 273 ILE n 
3 274 GLY n 
3 275 LYS n 
3 276 TYR n 
3 277 LEU n 
3 278 MET n 
3 279 PHE n 
3 280 ILE n 
3 281 MET n 
3 282 SER n 
3 283 LEU n 
3 284 VAL n 
3 285 THR n 
3 286 GLY n 
3 287 VAL n 
3 288 VAL n 
3 289 VAL n 
3 290 ASN n 
3 291 CYS n 
3 292 GLY n 
3 293 ILE n 
3 294 VAL n 
3 295 LEU n 
3 296 ASN n 
3 297 PHE n 
3 298 HIS n 
3 299 PHE n 
3 300 ARG n 
3 301 THR n 
3 302 PRO n 
3 303 SER n 
3 304 THR n 
3 305 HIS n 
3 306 SER n 
3 307 GLY n 
3 308 ILE n 
3 309 ASP n 
3 310 SER n 
3 311 THR n 
3 312 ASN n 
3 313 TYR n 
3 314 ILE n 
3 315 VAL n 
3 316 LYS n 
3 317 GLN n 
3 318 ILE n 
3 319 LYS n 
3 320 GLU n 
3 321 LYS n 
3 322 ASN n 
3 323 ALA n 
3 324 TYR n 
3 325 ASP n 
3 326 GLU n 
3 327 GLU n 
3 328 VAL n 
3 329 GLY n 
3 330 ASN n 
3 331 TRP n 
3 332 ASN n 
3 333 LEU n 
3 334 VAL n 
3 335 GLY n 
3 336 GLN n 
3 337 THR n 
3 338 ILE n 
3 339 ASP n 
3 340 ARG n 
3 341 LEU n 
3 342 SER n 
3 343 MET n 
3 344 PHE n 
3 345 ILE n 
3 346 ILE n 
3 347 THR n 
3 348 PRO n 
3 349 VAL n 
3 350 MET n 
3 351 VAL n 
3 352 LEU n 
3 353 GLY n 
3 354 THR n 
3 355 ILE n 
3 356 PHE n 
3 357 ILE n 
3 358 PHE n 
3 359 VAL n 
3 360 MET n 
3 361 GLY n 
3 362 ASN n 
3 363 PHE n 
3 364 ASN n 
3 365 ARG n 
3 366 PRO n 
3 367 PRO n 
3 368 ALA n 
3 369 LYS n 
4 1   ASN n 
4 2   GLU n 
4 3   GLU n 
4 4   GLY n 
4 5   ARG n 
4 6   LEU n 
4 7   ILE n 
4 8   GLU n 
4 9   LYS n 
4 10  LEU n 
4 11  LEU n 
4 12  GLY n 
4 13  ASP n 
4 14  TYR n 
4 15  ASP n 
4 16  LYS n 
4 17  ARG n 
4 18  ILE n 
4 19  LYS n 
4 20  PRO n 
4 21  ALA n 
4 22  LYS n 
4 23  THR n 
4 24  LEU n 
4 25  ASP n 
4 26  HIS n 
4 27  VAL n 
4 28  ILE n 
4 29  ASP n 
4 30  VAL n 
4 31  THR n 
4 32  LEU n 
4 33  LYS n 
4 34  LEU n 
4 35  THR n 
4 36  LEU n 
4 37  THR n 
4 38  ASN n 
4 39  LEU n 
4 40  ILE n 
4 41  SER n 
4 42  LEU n 
4 43  ASN n 
4 44  GLU n 
4 45  LYS n 
4 46  GLU n 
4 47  GLU n 
4 48  ALA n 
4 49  LEU n 
4 50  THR n 
4 51  THR n 
4 52  ASN n 
4 53  VAL n 
4 54  TRP n 
4 55  ILE n 
4 56  GLU n 
4 57  ILE n 
4 58  GLN n 
4 59  TRP n 
4 60  ASN n 
4 61  ASP n 
4 62  TYR n 
4 63  ARG n 
4 64  LEU n 
4 65  SER n 
4 66  TRP n 
4 67  ASN n 
4 68  THR n 
4 69  SER n 
4 70  GLU n 
4 71  TYR n 
4 72  GLU n 
4 73  GLY n 
4 74  ILE n 
4 75  ASP n 
4 76  LEU n 
4 77  VAL n 
4 78  ARG n 
4 79  ILE n 
4 80  PRO n 
4 81  SER n 
4 82  GLU n 
4 83  LEU n 
4 84  LEU n 
4 85  TRP n 
4 86  LEU n 
4 87  PRO n 
4 88  ASP n 
4 89  VAL n 
4 90  VAL n 
4 91  LEU n 
4 92  GLU n 
4 93  ASN n 
4 94  ASN n 
4 95  VAL n 
4 96  ASP n 
4 97  GLY n 
4 98  GLN n 
4 99  PHE n 
4 100 GLU n 
4 101 VAL n 
4 102 ALA n 
4 103 TYR n 
4 104 TYR n 
4 105 ALA n 
4 106 ASN n 
4 107 VAL n 
4 108 LEU n 
4 109 VAL n 
4 110 TYR n 
4 111 ASN n 
4 112 ASP n 
4 113 GLY n 
4 114 SER n 
4 115 MET n 
4 116 TYR n 
4 117 TRP n 
4 118 LEU n 
4 119 PRO n 
4 120 PRO n 
4 121 ALA n 
4 122 ILE n 
4 123 TYR n 
4 124 ARG n 
4 125 SER n 
4 126 THR n 
4 127 CYS n 
4 128 PRO n 
4 129 ILE n 
4 130 ALA n 
4 131 VAL n 
4 132 THR n 
4 133 TYR n 
4 134 PHE n 
4 135 PRO n 
4 136 PHE n 
4 137 ASP n 
4 138 TRP n 
4 139 GLN n 
4 140 ASN n 
4 141 CYS n 
4 142 SER n 
4 143 LEU n 
4 144 VAL n 
4 145 PHE n 
4 146 ARG n 
4 147 SER n 
4 148 GLN n 
4 149 THR n 
4 150 TYR n 
4 151 ASN n 
4 152 ALA n 
4 153 HIS n 
4 154 GLU n 
4 155 VAL n 
4 156 ASN n 
4 157 LEU n 
4 158 GLN n 
4 159 LEU n 
4 160 SER n 
4 161 ALA n 
4 162 GLU n 
4 163 GLU n 
4 164 GLY n 
4 165 ILE n 
4 166 ASP n 
4 167 PRO n 
4 168 GLU n 
4 169 ASP n 
4 170 PHE n 
4 171 THR n 
4 172 GLU n 
4 173 ASN n 
4 174 GLY n 
4 175 GLU n 
4 176 TRP n 
4 177 THR n 
4 178 ILE n 
4 179 ARG n 
4 180 HIS n 
4 181 ARG n 
4 182 PRO n 
4 183 ALA n 
4 184 LYS n 
4 185 LYS n 
4 186 ASN n 
4 187 TYR n 
4 188 ASN n 
4 189 TRP n 
4 190 GLN n 
4 191 LEU n 
4 192 THR n 
4 193 LYS n 
4 194 ASP n 
4 195 ASP n 
4 196 ILE n 
4 197 ASP n 
4 198 PHE n 
4 199 GLN n 
4 200 GLU n 
4 201 ILE n 
4 202 ILE n 
4 203 PHE n 
4 204 PHE n 
4 205 LEU n 
4 206 ILE n 
4 207 ILE n 
4 208 GLN n 
4 209 ARG n 
4 210 LYS n 
4 211 PRO n 
4 212 LEU n 
4 213 PHE n 
4 214 TYR n 
4 215 ILE n 
4 216 ILE n 
4 217 ASN n 
4 218 ILE n 
4 219 ILE n 
4 220 ALA n 
4 221 PRO n 
4 222 CYS n 
4 223 VAL n 
4 224 LEU n 
4 225 ILE n 
4 226 SER n 
4 227 SER n 
4 228 LEU n 
4 229 VAL n 
4 230 VAL n 
4 231 LEU n 
4 232 VAL n 
4 233 TYR n 
4 234 PHE n 
4 235 LEU n 
4 236 PRO n 
4 237 ALA n 
4 238 GLN n 
4 239 ALA n 
4 240 GLY n 
4 241 GLY n 
4 242 GLN n 
4 243 LYS n 
4 244 CYS n 
4 245 THR n 
4 246 LEU n 
4 247 SER n 
4 248 ILE n 
4 249 SER n 
4 250 VAL n 
4 251 LEU n 
4 252 LEU n 
4 253 ALA n 
4 254 GLN n 
4 255 THR n 
4 256 ILE n 
4 257 PHE n 
4 258 LEU n 
4 259 PHE n 
4 260 LEU n 
4 261 ILE n 
4 262 ALA n 
4 263 GLN n 
4 264 LYS n 
4 265 VAL n 
4 266 PRO n 
4 267 GLU n 
4 268 THR n 
4 269 SER n 
4 270 LEU n 
4 271 ASN n 
4 272 VAL n 
4 273 PRO n 
4 274 LEU n 
4 275 ILE n 
4 276 GLY n 
4 277 LYS n 
4 278 TYR n 
4 279 LEU n 
4 280 ILE n 
4 281 PHE n 
4 282 VAL n 
4 283 MET n 
4 284 PHE n 
4 285 VAL n 
4 286 SER n 
4 287 LEU n 
4 288 VAL n 
4 289 ILE n 
4 290 VAL n 
4 291 THR n 
4 292 ASN n 
4 293 CYS n 
4 294 VAL n 
4 295 ILE n 
4 296 VAL n 
4 297 LEU n 
4 298 ASN n 
4 299 VAL n 
4 300 SER n 
4 301 LEU n 
4 302 ARG n 
4 303 THR n 
4 304 PRO n 
4 305 ASN n 
4 306 THR n 
4 307 HIS n 
4 308 SER n 
4 309 CYS n 
4 310 VAL n 
4 311 GLU n 
4 312 ALA n 
4 313 CYS n 
4 314 ASN n 
4 315 PHE n 
4 316 ILE n 
4 317 ALA n 
4 318 LYS n 
4 319 SER n 
4 320 THR n 
4 321 LYS n 
4 322 GLU n 
4 323 GLN n 
4 324 ASN n 
4 325 ASP n 
4 326 SER n 
4 327 GLY n 
4 328 SER n 
4 329 GLU n 
4 330 ASN n 
4 331 GLU n 
4 332 ASN n 
4 333 TRP n 
4 334 VAL n 
4 335 LEU n 
4 336 ILE n 
4 337 GLY n 
4 338 LYS n 
4 339 VAL n 
4 340 ILE n 
4 341 ASP n 
4 342 LYS n 
4 343 ALA n 
4 344 CYS n 
4 345 PHE n 
4 346 TRP n 
4 347 ILE n 
4 348 ALA n 
4 349 LEU n 
4 350 LEU n 
4 351 LEU n 
4 352 PHE n 
4 353 SER n 
4 354 LEU n 
4 355 GLY n 
4 356 THR n 
4 357 LEU n 
4 358 ALA n 
4 359 ILE n 
4 360 PHE n 
4 361 LEU n 
4 362 THR n 
4 363 GLY n 
4 364 HIS n 
4 365 LEU n 
4 366 ASN n 
4 367 GLN n 
4 368 VAL n 
4 369 PRO n 
4 370 GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'MARBLED ELECTRIC RAY' 'TORPEDO MARMORATA' 7788 ? ? ? 'DERIVED FROM MUSCLE' ? ? ? ? ? ? ? 'ELECTRIC ORGAN' ? ? ? ? 
?                             
2 1 sample ? ? 'MARBLED ELECTRIC RAY' 'TORPEDO MARMORATA' 7788 ? ? ? 'DERIVED FROM MUSCLE' ? ? ? ? ? ? ? 'ELECTRIC ORGAN' ? ? ? ? 
?                             
3 1 sample ? ? 'MARBLED ELECTRIC RAY' 'TORPEDO MARMORATA' 7788 ? ? ? 'DERIVED FROM MUSCLE' ? ? ? ? ? ? ? 'ELECTRIC ORGAN' ? ? ? ? 
?                             
4 1 sample ? ? 'MARBLED ELECTRIC RAY' 'TORPEDO MARMORATA' 7788 ? ? ? 'DERIVED FROM MUSCLE' ? ? ? ? ? ? ? 'ELECTRIC ORGAN' ? ? ? ? 
'INHABITS THE EUROPEAN COAST' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACHA_TORMA 1 ? ? P02711 ? 
2 UNP Q6S3I0     2 ? ? Q6S3I0 ? 
3 UNP Q6S3H8     3 ? ? Q6S3H8 ? 
4 UNP Q6S3H9     4 ? ? Q6S3H9 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2BG9 A 1   ? 306 ? P02711 25  ? 330 ? 1   306 
2  1 2BG9 A 307 ? 370 ? P02711 398 ? 461 ? 374 437 
3  2 2BG9 B 1   ? 164 ? Q6S3I0 25  ? 188 ? 1   164 
4  2 2BG9 B 165 ? 303 ? Q6S3I0 198 ? 336 ? 174 312 
5  2 2BG9 B 304 ? 370 ? Q6S3I0 427 ? 493 ? 403 469 
6  3 2BG9 C 1   ? 162 ? Q6S3H8 22  ? 183 ? 1   162 
7  3 2BG9 C 163 ? 305 ? Q6S3H8 199 ? 341 ? 178 320 
8  3 2BG9 C 306 ? 369 ? Q6S3H8 442 ? 505 ? 421 484 
9  1 2BG9 D 1   ? 306 ? P02711 25  ? 330 ? 1   306 
10 1 2BG9 D 307 ? 370 ? P02711 398 ? 461 ? 374 437 
11 4 2BG9 E 1   ? 164 ? Q6S3H9 18  ? 181 ? 1   164 
12 4 2BG9 E 165 ? 307 ? Q6S3H9 189 ? 332 ? 172 314 
13 4 2BG9 E 308 ? 370 ? Q6S3H9 432 ? 493 ? 414 476 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BG9 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2BG9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14924 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14924 
_refine_hist.d_res_high                       4.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2BG9 
_struct.title                     'REFINED STRUCTURE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR AT 4A RESOLUTION.' 
_struct.pdbx_descriptor           
;ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN, ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN, ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN, ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BG9 
_struct_keywords.pdbx_keywords   'ION CHANNEL/RECEPTOR' 
_struct_keywords.text            
'ION CHANNEL/RECEPTOR, ACETYLCHOLINE RECEPTOR, ION CHANNEL, ION TRANSPORT, POSTSYNAPTIC MEMBRANE, ION CHANNEL-RECEPTOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 3   ? ASN A 14  ? HIS A 3   ASN A 14  1 ? 12 
HELX_P HELX_P2  2  LEU A 212 ? SER A 239 ? LEU A 212 SER A 239 1 ? 28 
HELX_P HELX_P3  3  LYS A 242 ? VAL A 271 ? LYS A 242 VAL A 271 1 ? 30 
HELX_P HELX_P4  4  TYR A 277 ? ARG A 301 ? TYR A 277 ARG A 301 1 ? 25 
HELX_P HELX_P5  5  SER A 307 ? TRP A 332 ? SER A 374 TRP A 399 1 ? 26 
HELX_P HELX_P6  6  VAL A 338 ? GLU A 369 ? VAL A 405 GLU A 436 1 ? 32 
HELX_P HELX_P7  7  MET B 3   ? TYR B 15  ? MET B 3   TYR B 15  1 ? 13 
HELX_P HELX_P8  8  TYR B 211 ? LEU B 232 ? TYR B 220 LEU B 241 1 ? 22 
HELX_P HELX_P9  9  GLU B 238 ? LEU B 266 ? GLU B 247 LEU B 275 1 ? 29 
HELX_P HELX_P10 10 ILE B 272 ? ARG B 298 ? ILE B 281 ARG B 307 1 ? 27 
HELX_P HELX_P11 11 GLU B 304 ? TYR B 331 ? GLU B 403 TYR B 430 1 ? 28 
HELX_P HELX_P12 12 ALA B 333 ? VAL B 363 ? ALA B 432 VAL B 462 1 ? 31 
HELX_P HELX_P13 13 GLU C 3   ? LEU C 12  ? GLU C 3   LEU C 12  1 ? 10 
HELX_P HELX_P14 14 PHE C 212 ? GLY C 239 ? PHE C 227 GLY C 254 1 ? 28 
HELX_P HELX_P15 15 LYS C 241 ? ALA C 269 ? LYS C 256 ALA C 284 1 ? 29 
HELX_P HELX_P16 16 ILE C 273 ? ARG C 300 ? ILE C 288 ARG C 315 1 ? 28 
HELX_P HELX_P17 17 SER C 306 ? VAL C 334 ? SER C 421 VAL C 449 1 ? 29 
HELX_P HELX_P18 18 THR C 337 ? ARG C 365 ? THR C 452 ARG C 480 1 ? 29 
HELX_P HELX_P19 19 HIS D 3   ? ASN D 14  ? HIS D 3   ASN D 14  1 ? 12 
HELX_P HELX_P20 20 LEU D 212 ? GLY D 240 ? LEU D 212 GLY D 240 1 ? 29 
HELX_P HELX_P21 21 LYS D 242 ? VAL D 271 ? LYS D 242 VAL D 271 1 ? 30 
HELX_P HELX_P22 22 TYR D 277 ? ARG D 301 ? TYR D 277 ARG D 301 1 ? 25 
HELX_P HELX_P23 23 SER D 307 ? TYR D 334 ? SER D 374 TYR D 401 1 ? 28 
HELX_P HELX_P24 24 MET D 337 ? GLU D 369 ? MET D 404 GLU D 436 1 ? 33 
HELX_P HELX_P25 25 GLU E 2   ? TYR E 14  ? GLU E 2   TYR E 14  1 ? 13 
HELX_P HELX_P26 26 TYR E 214 ? ALA E 239 ? TYR E 221 ALA E 246 1 ? 26 
HELX_P HELX_P27 27 LYS E 243 ? VAL E 272 ? LYS E 250 VAL E 279 1 ? 30 
HELX_P HELX_P28 28 GLY E 276 ? SER E 300 ? GLY E 283 SER E 307 1 ? 25 
HELX_P HELX_P29 29 SER E 308 ? ILE E 336 ? SER E 414 ILE E 442 1 ? 29 
HELX_P HELX_P30 30 GLY E 337 ? VAL E 368 ? GLY E 443 VAL E 474 1 ? 32 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 128 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 128 A CYS 142 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf2 disulf ? ? A CYS 192 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 192 A CYS 193 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf3 disulf ? ? B CYS 128 SG ? ? ? 1_555 B CYS 142 SG ? ? B CYS 128 B CYS 142 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf4 disulf ? ? C CYS 130 SG ? ? ? 1_555 C CYS 144 SG ? ? C CYS 130 C CYS 144 1_555 ? ? ? ? ? ? ? 1.968 ? 
disulf5 disulf ? ? D CYS 128 SG ? ? ? 1_555 D CYS 142 SG ? ? D CYS 128 D CYS 142 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf6 disulf ? ? D CYS 192 SG ? ? ? 1_555 D CYS 193 SG ? ? D CYS 192 D CYS 193 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf7 disulf ? ? E CYS 127 SG ? ? ? 1_555 E CYS 141 SG ? ? E CYS 127 E CYS 141 1_555 ? ? ? ? ? ? ? 2.065 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 6 ? 
AC ? 4 ? 
BA ? 6 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 2 ? 
CA ? 6 ? 
CB ? 5 ? 
CC ? 4 ? 
CD ? 4 ? 
DA ? 2 ? 
DB ? 3 ? 
DC ? 2 ? 
DD ? 2 ? 
DE ? 4 ? 
EA ? 8 ? 
EB ? 4 ? 
EC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CA 5 6 ? parallel      
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
DA 1 2 ? parallel      
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DC 1 2 ? anti-parallel 
DD 1 2 ? anti-parallel 
DE 1 2 ? anti-parallel 
DE 2 3 ? anti-parallel 
DE 3 4 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EA 6 7 ? parallel      
EA 7 8 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? anti-parallel 
EB 3 4 ? anti-parallel 
EC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 78  ? PRO A 81  ? ILE A 78  PRO A 81  
AA 2 LYS A 107 ? LEU A 110 ? LYS A 107 LEU A 110 
AA 3 ILE A 116 ? TRP A 118 ? ILE A 116 TRP A 118 
AA 4 ILE A 49  ? TRP A 60  ? ILE A 49  TRP A 60  
AA 5 VAL A 29  ? ASP A 44  ? VAL A 29  ASP A 44  
AA 6 VAL A 156 ? SER A 159 ? VAL A 156 SER A 159 
AB 1 ILE A 78  ? PRO A 81  ? ILE A 78  PRO A 81  
AB 2 LYS A 107 ? LEU A 110 ? LYS A 107 LEU A 110 
AB 3 ILE A 116 ? TRP A 118 ? ILE A 116 TRP A 118 
AB 4 ILE A 49  ? TRP A 60  ? ILE A 49  TRP A 60  
AB 5 PRO A 121 ? TYR A 127 ? PRO A 121 TYR A 127 
AB 6 PHE A 100 ? ALA A 101 ? PHE A 100 ALA A 101 
AC 1 LEU A 90  ? LEU A 92  ? LEU A 90  LEU A 92  
AC 2 GLN A 140 ? ILE A 148 ? GLN A 140 ILE A 148 
AC 3 LEU A 199 ? GLN A 208 ? LEU A 199 GLN A 208 
AC 4 VAL A 177 ? TRP A 187 ? VAL A 177 TRP A 187 
BA 1 ASP B 77  ? PRO B 81  ? ASP B 77  PRO B 81  
BA 2 ASN B 107 ? GLN B 111 ? ASN B 107 GLN B 111 
BA 3 ALA B 115 ? TRP B 118 ? ALA B 115 TRP B 118 
BA 4 ASN B 57  ? THR B 61  ? ASN B 57  THR B 61  
BA 5 THR B 30  ? GLY B 34  ? THR B 30  GLY B 34  
BA 6 ILE B 157 ? GLN B 159 ? ILE B 157 GLN B 159 
BB 1 LEU B 37  ? ASN B 44  ? LEU B 37  ASN B 44  
BB 2 GLU B 49  ? PHE B 55  ? GLU B 49  PHE B 55  
BB 3 SER B 121 ? SER B 126 ? SER B 121 SER B 126 
BB 4 PHE B 100 ? GLU B 101 ? PHE B 100 GLU B 101 
BC 1 ILE B 90  ? LEU B 92  ? ILE B 90  LEU B 92  
BC 2 THR B 143 ? SER B 148 ? THR B 143 SER B 148 
BC 3 VAL B 198 ? TYR B 201 ? VAL B 207 TYR B 210 
BC 4 SER B 184 ? LYS B 186 ? SER B 193 LYS B 195 
BD 1 SER B 178 ? ILE B 179 ? SER B 187 ILE B 188 
BD 2 ILE B 204 ? GLN B 205 ? ILE B 213 GLN B 214 
CA 1 LEU C 80  ? LEU C 82  ? LEU C 80  LEU C 82  
CA 2 VAL C 110 ? VAL C 112 ? VAL C 110 VAL C 112 
CA 3 TYR C 117 ? TRP C 120 ? TYR C 117 TRP C 120 
CA 4 THR C 51  ? TYR C 63  ? THR C 51  TYR C 63  
CA 5 ASN C 32  ? LYS C 46  ? ASN C 32  LYS C 46  
CA 6 SER C 159 ? ASP C 161 ? SER C 159 ASP C 161 
CB 1 LEU C 80  ? LEU C 82  ? LEU C 80  LEU C 82  
CB 2 VAL C 110 ? VAL C 112 ? VAL C 110 VAL C 112 
CB 3 TYR C 117 ? TRP C 120 ? TYR C 117 TRP C 120 
CB 4 THR C 51  ? TYR C 63  ? THR C 51  TYR C 63  
CB 5 PRO C 123 ? SER C 128 ? PRO C 123 SER C 128 
CC 1 ILE C 92  ? LEU C 94  ? ILE C 92  LEU C 94  
CC 2 ASN C 143 ? ALA C 150 ? ASN C 143 ALA C 150 
CC 3 GLN C 198 ? ARG C 208 ? GLN C 213 ARG C 223 
CC 4 TRP C 175 ? HIS C 179 ? TRP C 190 HIS C 194 
CD 1 ILE C 92  ? LEU C 94  ? ILE C 92  LEU C 94  
CD 2 ASN C 143 ? ALA C 150 ? ASN C 143 ALA C 150 
CD 3 GLN C 198 ? ARG C 208 ? GLN C 213 ARG C 223 
CD 4 ALA C 182 ? ILE C 186 ? ALA C 197 ILE C 201 
DA 1 ASP D 30  ? THR D 32  ? ASP D 30  THR D 32  
DA 2 SER D 157 ? SER D 159 ? SER D 157 SER D 159 
DB 1 LEU D 37  ? ASP D 44  ? LEU D 37  ASP D 44  
DB 2 ILE D 49  ? ARG D 55  ? ILE D 49  ARG D 55  
DB 3 PRO D 121 ? TYR D 127 ? PRO D 121 TYR D 127 
DC 1 GLN D 58  ? TRP D 60  ? GLN D 58  TRP D 60  
DC 2 ILE D 116 ? TRP D 118 ? ILE D 116 TRP D 118 
DD 1 ILE D 78  ? PRO D 81  ? ILE D 78  PRO D 81  
DD 2 LYS D 107 ? LEU D 110 ? LYS D 107 LEU D 110 
DE 1 LEU D 90  ? LEU D 92  ? LEU D 90  LEU D 92  
DE 2 ASN D 141 ? ILE D 148 ? ASN D 141 ILE D 148 
DE 3 LEU D 199 ? GLN D 208 ? LEU D 199 GLN D 208 
DE 4 VAL D 177 ? TRP D 187 ? VAL D 177 TRP D 187 
EA 1 LEU E 108 ? VAL E 109 ? LEU E 108 VAL E 109 
EA 2 SER E 114 ? TRP E 117 ? SER E 114 TRP E 117 
EA 3 ALA E 48  ? ASN E 60  ? ALA E 48  ASN E 60  
EA 4 PRO E 120 ? SER E 125 ? PRO E 120 SER E 125 
EA 5 ALA E 48  ? ASN E 60  ? ALA E 48  ASN E 60  
EA 6 LEU E 157 ? GLN E 158 ? LEU E 157 GLN E 158 
EA 7 VAL E 30  ? ASN E 43  ? VAL E 30  ASN E 43  
EA 8 ALA E 48  ? ASN E 60  ? ALA E 48  ASN E 60  
EB 1 VAL E 89  ? LEU E 91  ? VAL E 89  LEU E 91  
EB 2 LEU E 143 ? SER E 147 ? LEU E 143 SER E 147 
EB 3 GLU E 200 ? PHE E 203 ? GLU E 207 PHE E 210 
EB 4 LYS E 185 ? ASN E 186 ? LYS E 192 ASN E 193 
EC 1 TRP E 176 ? HIS E 180 ? TRP E 183 HIS E 187 
EC 2 ILE E 206 ? ARG E 209 ? ILE E 213 ARG E 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 80  ? N LEU A 80  O LEU A 108 ? O LEU A 108 
AA 2 3 N LEU A 109 ? N LEU A 109 O MET A 117 ? O MET A 117 
AA 3 4 N TRP A 118 ? N TRP A 118 O GLN A 58  ? O GLN A 58  
AA 4 5 N GLN A 59  ? N GLN A 59  O THR A 32  ? O THR A 32  
AA 5 6 N ILE A 31  ? N ILE A 31  O SER A 157 ? O SER A 157 
AB 1 2 N LEU A 80  ? N LEU A 80  O LEU A 108 ? O LEU A 108 
AB 2 3 N LEU A 109 ? N LEU A 109 O MET A 117 ? O MET A 117 
AB 3 4 N TRP A 118 ? N TRP A 118 O GLN A 58  ? O GLN A 58  
AB 4 5 N VAL A 54  ? N VAL A 54  O ALA A 122 ? O ALA A 122 
AB 5 6 N ILE A 123 ? N ILE A 123 O ALA A 101 ? O ALA A 101 
AC 1 2 N VAL A 91  ? N VAL A 91  O GLY A 147 ? O GLY A 147 
AC 2 3 N LEU A 146 ? N LEU A 146 O ILE A 201 ? O ILE A 201 
AC 3 4 N GLN A 208 ? N GLN A 208 O VAL A 177 ? O VAL A 177 
BA 1 2 N ILE B 80  ? N ILE B 80  O VAL B 108 ? O VAL B 108 
BA 2 3 N GLN B 111 ? N GLN B 111 O ALA B 115 ? O ALA B 115 
BA 3 4 N TRP B 118 ? N TRP B 118 O LEU B 58  ? O LEU B 58  
BA 4 5 N ALA B 59  ? N ALA B 59  O ARG B 32  ? O ARG B 32  
BA 5 6 N VAL B 31  ? N VAL B 31  O ILE B 157 ? O ILE B 157 
BB 1 2 N ASN B 44  ? N ASN B 44  O GLU B 49  ? O GLU B 49  
BB 2 3 N VAL B 54  ? N VAL B 54  O ALA B 122 ? O ALA B 122 
BB 3 4 N ILE B 123 ? N ILE B 123 O GLU B 101 ? O GLU B 101 
BC 1 2 N VAL B 91  ? N VAL B 91  O LYS B 147 ? O LYS B 147 
BC 2 3 N PHE B 146 ? N PHE B 146 O VAL B 198 ? O VAL B 207 
BC 3 4 N THR B 199 ? N THR B 208 O ARG B 185 ? O ARG B 194 
BD 1 2 N SER B 178 ? N SER B 187 O GLN B 205 ? O GLN B 214 
CA 1 2 N LEU C 82  ? N LEU C 82  O VAL C 110 ? O VAL C 110 
CA 2 3 N LEU C 111 ? N LEU C 111 O THR C 119 ? O THR C 119 
CA 3 4 N TRP C 120 ? N TRP C 120 O HIS C 60  ? O HIS C 60  
CA 4 5 N ALA C 61  ? N ALA C 61  O ALA C 34  ? O ALA C 34  
CA 5 6 N ILE C 33  ? N ILE C 33  O SER C 159 ? O SER C 159 
CB 1 2 N LEU C 82  ? N LEU C 82  O VAL C 110 ? O VAL C 110 
CB 2 3 N LEU C 111 ? N LEU C 111 O THR C 119 ? O THR C 119 
CB 3 4 N TRP C 120 ? N TRP C 120 O HIS C 60  ? O HIS C 60  
CB 4 5 N VAL C 56  ? N VAL C 56  O ALA C 124 ? O ALA C 124 
CC 1 2 N VAL C 93  ? N VAL C 93  O THR C 149 ? O THR C 149 
CC 2 3 N PHE C 148 ? N PHE C 148 O VAL C 200 ? O VAL C 215 
CC 3 4 N ARG C 207 ? N ARG C 222 O GLU C 176 ? O GLU C 191 
CD 1 2 N VAL C 93  ? N VAL C 93  O THR C 149 ? O THR C 149 
CD 2 3 N PHE C 148 ? N PHE C 148 O VAL C 200 ? O VAL C 215 
CD 3 4 N THR C 201 ? N THR C 216 O LYS C 183 ? O LYS C 198 
DA 1 2 N ILE D 31  ? N ILE D 31  O SER D 157 ? O SER D 157 
DB 1 2 N ASP D 44  ? N ASP D 44  O ILE D 49  ? O ILE D 49  
DB 2 3 N VAL D 54  ? N VAL D 54  O ALA D 122 ? O ALA D 122 
DC 1 2 N TRP D 60  ? N TRP D 60  O ILE D 116 ? O ILE D 116 
DD 1 2 N LEU D 80  ? N LEU D 80  O LEU D 108 ? O LEU D 108 
DE 1 2 N VAL D 91  ? N VAL D 91  O GLY D 147 ? O GLY D 147 
DE 2 3 N LEU D 146 ? N LEU D 146 O ILE D 201 ? O ILE D 201 
DE 3 4 N GLN D 208 ? N GLN D 208 O VAL D 177 ? O VAL D 177 
EA 1 2 N LEU E 108 ? N LEU E 108 O TYR E 116 ? O TYR E 116 
EA 2 3 N TRP E 117 ? N TRP E 117 O ILE E 57  ? O ILE E 57  
EA 3 4 N VAL E 53  ? N VAL E 53  O ALA E 121 ? O ALA E 121 
EA 4 5 N SER E 125 ? N SER E 125 O LEU E 49  ? O LEU E 49  
EA 6 7 N GLN E 158 ? N GLN E 158 O VAL E 30  ? O VAL E 30  
EA 7 8 N ASN E 43  ? N ASN E 43  O ALA E 48  ? O ALA E 48  
EB 1 2 N VAL E 90  ? N VAL E 90  O ARG E 146 ? O ARG E 146 
EB 2 3 N PHE E 145 ? N PHE E 145 O ILE E 201 ? O ILE E 208 
EB 3 4 N GLU E 200 ? N GLU E 207 O ASN E 186 ? O ASN E 193 
EC 1 2 N ARG E 179 ? N ARG E 186 O ILE E 206 ? O ILE E 213 
# 
_database_PDB_matrix.entry_id          2BG9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BG9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . SER A 1 1   ? 72.521  89.542  165.969 1.00 10.00 ? 1   SER A N   1 
ATOM 2     C CA  . SER A 1 1   ? 72.301  90.315  167.214 1.00 10.00 ? 1   SER A CA  1 
ATOM 3     C C   . SER A 1 1   ? 70.841  90.715  167.421 1.00 10.00 ? 1   SER A C   1 
ATOM 4     O O   . SER A 1 1   ? 70.055  89.959  168.009 1.00 10.00 ? 1   SER A O   1 
ATOM 5     C CB  . SER A 1 1   ? 73.196  91.561  167.209 1.00 10.00 ? 1   SER A CB  1 
ATOM 6     O OG  . SER A 1 1   ? 73.104  92.249  165.974 1.00 10.00 ? 1   SER A OG  1 
ATOM 7     N N   . GLU A 1 2   ? 70.461  91.902  166.943 1.00 10.00 ? 2   GLU A N   1 
ATOM 8     C CA  . GLU A 1 2   ? 69.098  92.387  167.123 1.00 10.00 ? 2   GLU A CA  1 
ATOM 9     C C   . GLU A 1 2   ? 68.085  91.270  166.903 1.00 10.00 ? 2   GLU A C   1 
ATOM 10    O O   . GLU A 1 2   ? 67.566  91.079  165.802 1.00 10.00 ? 2   GLU A O   1 
ATOM 11    C CB  . GLU A 1 2   ? 68.817  93.556  166.178 1.00 10.00 ? 2   GLU A CB  1 
ATOM 12    C CG  . GLU A 1 2   ? 68.709  93.159  164.714 1.00 10.00 ? 2   GLU A CG  1 
ATOM 13    C CD  . GLU A 1 2   ? 68.652  94.358  163.789 1.00 10.00 ? 2   GLU A CD  1 
ATOM 14    O OE1 . GLU A 1 2   ? 68.680  95.500  164.293 1.00 10.00 ? 2   GLU A OE1 1 
ATOM 15    O OE2 . GLU A 1 2   ? 68.576  94.155  162.558 1.00 10.00 ? 2   GLU A OE2 1 
ATOM 16    N N   . HIS A 1 3   ? 67.802  90.584  167.994 1.00 10.00 ? 3   HIS A N   1 
ATOM 17    C CA  . HIS A 1 3   ? 66.909  89.445  168.025 1.00 10.00 ? 3   HIS A CA  1 
ATOM 18    C C   . HIS A 1 3   ? 67.189  88.518  166.822 1.00 10.00 ? 3   HIS A C   1 
ATOM 19    O O   . HIS A 1 3   ? 66.332  87.745  166.395 1.00 10.00 ? 3   HIS A O   1 
ATOM 20    C CB  . HIS A 1 3   ? 65.457  89.953  168.127 1.00 10.00 ? 3   HIS A CB  1 
ATOM 21    C CG  . HIS A 1 3   ? 65.105  90.493  169.494 1.00 10.00 ? 3   HIS A CG  1 
ATOM 22    N ND1 . HIS A 1 3   ? 65.979  91.250  170.252 1.00 10.00 ? 3   HIS A ND1 1 
ATOM 23    C CD2 . HIS A 1 3   ? 63.970  90.386  170.238 1.00 10.00 ? 3   HIS A CD2 1 
ATOM 24    C CE1 . HIS A 1 3   ? 65.401  91.580  171.398 1.00 10.00 ? 3   HIS A CE1 1 
ATOM 25    N NE2 . HIS A 1 3   ? 64.181  91.070  171.415 1.00 10.00 ? 3   HIS A NE2 1 
ATOM 26    N N   . GLU A 1 4   ? 68.424  88.624  166.314 1.00 10.00 ? 4   GLU A N   1 
ATOM 27    C CA  . GLU A 1 4   ? 69.004  87.861  165.207 1.00 10.00 ? 4   GLU A CA  1 
ATOM 28    C C   . GLU A 1 4   ? 68.351  86.523  164.871 1.00 10.00 ? 4   GLU A C   1 
ATOM 29    O O   . GLU A 1 4   ? 67.663  86.382  163.857 1.00 10.00 ? 4   GLU A O   1 
ATOM 30    C CB  . GLU A 1 4   ? 70.488  87.619  165.516 1.00 10.00 ? 4   GLU A CB  1 
ATOM 31    C CG  . GLU A 1 4   ? 71.212  86.651  164.588 1.00 10.00 ? 4   GLU A CG  1 
ATOM 32    C CD  . GLU A 1 4   ? 71.712  87.308  163.318 1.00 10.00 ? 4   GLU A CD  1 
ATOM 33    O OE1 . GLU A 1 4   ? 72.556  88.223  163.416 1.00 10.00 ? 4   GLU A OE1 1 
ATOM 34    O OE2 . GLU A 1 4   ? 71.265  86.908  162.222 1.00 10.00 ? 4   GLU A OE2 1 
ATOM 35    N N   . THR A 1 5   ? 68.630  85.532  165.709 1.00 10.00 ? 5   THR A N   1 
ATOM 36    C CA  . THR A 1 5   ? 68.106  84.183  165.547 1.00 10.00 ? 5   THR A CA  1 
ATOM 37    C C   . THR A 1 5   ? 66.611  84.191  165.872 1.00 10.00 ? 5   THR A C   1 
ATOM 38    O O   . THR A 1 5   ? 65.797  83.495  165.239 1.00 10.00 ? 5   THR A O   1 
ATOM 39    C CB  . THR A 1 5   ? 68.897  83.204  166.474 1.00 10.00 ? 5   THR A CB  1 
ATOM 40    O OG1 . THR A 1 5   ? 70.245  83.090  166.007 1.00 10.00 ? 5   THR A OG1 1 
ATOM 41    C CG2 . THR A 1 5   ? 68.258  81.827  166.519 1.00 10.00 ? 5   THR A CG2 1 
ATOM 42    N N   . ARG A 1 6   ? 66.220  84.994  166.848 1.00 10.00 ? 6   ARG A N   1 
ATOM 43    C CA  . ARG A 1 6   ? 64.802  85.010  167.167 1.00 10.00 ? 6   ARG A CA  1 
ATOM 44    C C   . ARG A 1 6   ? 64.019  85.580  165.979 1.00 10.00 ? 6   ARG A C   1 
ATOM 45    O O   . ARG A 1 6   ? 62.893  85.154  165.731 1.00 10.00 ? 6   ARG A O   1 
ATOM 46    C CB  . ARG A 1 6   ? 64.532  85.799  168.460 1.00 10.00 ? 6   ARG A CB  1 
ATOM 47    C CG  . ARG A 1 6   ? 63.512  85.130  169.406 1.00 10.00 ? 6   ARG A CG  1 
ATOM 48    C CD  . ARG A 1 6   ? 63.375  85.830  170.766 1.00 10.00 ? 6   ARG A CD  1 
ATOM 49    N NE  . ARG A 1 6   ? 64.494  85.582  171.666 1.00 10.00 ? 6   ARG A NE  1 
ATOM 50    C CZ  . ARG A 1 6   ? 65.704  86.111  171.528 1.00 10.00 ? 6   ARG A CZ  1 
ATOM 51    N NH1 . ARG A 1 6   ? 65.972  86.931  170.521 1.00 10.00 ? 6   ARG A NH1 1 
ATOM 52    N NH2 . ARG A 1 6   ? 66.659  85.813  172.398 1.00 10.00 ? 6   ARG A NH2 1 
ATOM 53    N N   . LEU A 1 7   ? 64.613  86.546  165.268 1.00 10.00 ? 7   LEU A N   1 
ATOM 54    C CA  . LEU A 1 7   ? 64.050  87.163  164.074 1.00 10.00 ? 7   LEU A CA  1 
ATOM 55    C C   . LEU A 1 7   ? 63.717  86.078  163.055 1.00 10.00 ? 7   LEU A C   1 
ATOM 56    O O   . LEU A 1 7   ? 62.565  85.735  162.795 1.00 10.00 ? 7   LEU A O   1 
ATOM 57    C CB  . LEU A 1 7   ? 65.103  88.048  163.410 1.00 10.00 ? 7   LEU A CB  1 
ATOM 58    C CG  . LEU A 1 7   ? 65.990  89.002  164.193 1.00 10.00 ? 7   LEU A CG  1 
ATOM 59    C CD1 . LEU A 1 7   ? 67.207  89.469  163.380 1.00 10.00 ? 7   LEU A CD1 1 
ATOM 60    C CD2 . LEU A 1 7   ? 65.105  90.131  164.672 1.00 10.00 ? 7   LEU A CD2 1 
ATOM 61    N N   . VAL A 1 8   ? 64.790  85.562  162.479 1.00 10.00 ? 8   VAL A N   1 
ATOM 62    C CA  . VAL A 1 8   ? 64.765  84.548  161.438 1.00 10.00 ? 8   VAL A CA  1 
ATOM 63    C C   . VAL A 1 8   ? 63.933  83.285  161.659 1.00 10.00 ? 8   VAL A C   1 
ATOM 64    O O   . VAL A 1 8   ? 63.182  82.885  160.770 1.00 10.00 ? 8   VAL A O   1 
ATOM 65    C CB  . VAL A 1 8   ? 66.203  84.139  161.078 1.00 10.00 ? 8   VAL A CB  1 
ATOM 66    C CG1 . VAL A 1 8   ? 66.968  85.351  160.559 1.00 10.00 ? 8   VAL A CG1 1 
ATOM 67    C CG2 . VAL A 1 8   ? 66.896  83.536  162.294 1.00 10.00 ? 8   VAL A CG2 1 
ATOM 68    N N   . ALA A 1 9   ? 64.079  82.653  162.819 1.00 10.00 ? 9   ALA A N   1 
ATOM 69    C CA  . ALA A 1 9   ? 63.342  81.436  163.149 1.00 10.00 ? 9   ALA A CA  1 
ATOM 70    C C   . ALA A 1 9   ? 61.844  81.666  163.275 1.00 10.00 ? 9   ALA A C   1 
ATOM 71    O O   . ALA A 1 9   ? 61.047  80.932  162.691 1.00 10.00 ? 9   ALA A O   1 
ATOM 72    C CB  . ALA A 1 9   ? 63.891  80.824  164.435 1.00 10.00 ? 9   ALA A CB  1 
ATOM 73    N N   . ASN A 1 10  ? 61.450  82.673  164.043 1.00 10.00 ? 10  ASN A N   1 
ATOM 74    C CA  . ASN A 1 10  ? 60.040  82.964  164.194 1.00 10.00 ? 10  ASN A CA  1 
ATOM 75    C C   . ASN A 1 10  ? 59.362  82.963  162.838 1.00 10.00 ? 10  ASN A C   1 
ATOM 76    O O   . ASN A 1 10  ? 58.358  82.289  162.643 1.00 10.00 ? 10  ASN A O   1 
ATOM 77    C CB  . ASN A 1 10  ? 59.838  84.324  164.864 1.00 10.00 ? 10  ASN A CB  1 
ATOM 78    C CG  . ASN A 1 10  ? 58.376  84.730  164.926 1.00 10.00 ? 10  ASN A CG  1 
ATOM 79    O OD1 . ASN A 1 10  ? 57.540  84.003  165.462 1.00 10.00 ? 10  ASN A OD1 1 
ATOM 80    N ND2 . ASN A 1 10  ? 58.062  85.896  164.375 1.00 10.00 ? 10  ASN A ND2 1 
ATOM 81    N N   . LEU A 1 11  ? 59.935  83.712  161.912 1.00 10.00 ? 11  LEU A N   1 
ATOM 82    C CA  . LEU A 1 11  ? 59.429  83.850  160.543 1.00 10.00 ? 11  LEU A CA  1 
ATOM 83    C C   . LEU A 1 11  ? 59.161  82.488  159.899 1.00 10.00 ? 11  LEU A C   1 
ATOM 84    O O   . LEU A 1 11  ? 58.105  82.304  159.288 1.00 10.00 ? 11  LEU A O   1 
ATOM 85    C CB  . LEU A 1 11  ? 60.415  84.646  159.681 1.00 10.00 ? 11  LEU A CB  1 
ATOM 86    C CG  . LEU A 1 11  ? 60.945  85.952  160.277 1.00 10.00 ? 11  LEU A CG  1 
ATOM 87    C CD1 . LEU A 1 11  ? 61.613  86.801  159.206 1.00 10.00 ? 11  LEU A CD1 1 
ATOM 88    C CD2 . LEU A 1 11  ? 59.824  86.729  160.951 1.00 10.00 ? 11  LEU A CD2 1 
ATOM 89    N N   . LEU A 1 12  ? 60.109  81.558  159.969 1.00 10.00 ? 12  LEU A N   1 
ATOM 90    C CA  . LEU A 1 12  ? 59.941  80.206  159.384 1.00 10.00 ? 12  LEU A CA  1 
ATOM 91    C C   . LEU A 1 12  ? 58.762  79.452  159.960 1.00 10.00 ? 12  LEU A C   1 
ATOM 92    O O   . LEU A 1 12  ? 57.908  78.952  159.243 1.00 10.00 ? 12  LEU A O   1 
ATOM 93    C CB  . LEU A 1 12  ? 61.170  79.322  159.653 1.00 10.00 ? 12  LEU A CB  1 
ATOM 94    C CG  . LEU A 1 12  ? 60.815  77.834  159.896 1.00 10.00 ? 12  LEU A CG  1 
ATOM 95    C CD1 . LEU A 1 12  ? 60.588  77.136  158.552 1.00 10.00 ? 12  LEU A CD1 1 
ATOM 96    C CD2 . LEU A 1 12  ? 61.907  77.128  160.701 1.00 10.00 ? 12  LEU A CD2 1 
ATOM 97    N N   . GLU A 1 13  ? 58.782  79.360  161.281 1.00 10.00 ? 13  GLU A N   1 
ATOM 98    C CA  . GLU A 1 13  ? 57.763  78.615  162.004 1.00 10.00 ? 13  GLU A CA  1 
ATOM 99    C C   . GLU A 1 13  ? 56.334  78.978  161.598 1.00 10.00 ? 13  GLU A C   1 
ATOM 100   O O   . GLU A 1 13  ? 55.710  78.258  160.817 1.00 10.00 ? 13  GLU A O   1 
ATOM 101   C CB  . GLU A 1 13  ? 57.950  78.769  163.523 1.00 10.00 ? 13  GLU A CB  1 
ATOM 102   C CG  . GLU A 1 13  ? 59.408  78.619  164.004 1.00 10.00 ? 13  GLU A CG  1 
ATOM 103   C CD  . GLU A 1 13  ? 59.590  78.825  165.526 1.00 10.00 ? 13  GLU A CD  1 
ATOM 104   O OE1 . GLU A 1 13  ? 58.861  79.664  166.114 1.00 10.00 ? 13  GLU A OE1 1 
ATOM 105   O OE2 . GLU A 1 13  ? 60.484  78.157  166.107 1.00 10.00 ? 13  GLU A OE2 1 
ATOM 106   N N   . ASN A 1 14  ? 55.794  80.095  162.081 1.00 10.00 ? 14  ASN A N   1 
ATOM 107   C CA  . ASN A 1 14  ? 54.423  80.377  161.686 1.00 10.00 ? 14  ASN A CA  1 
ATOM 108   C C   . ASN A 1 14  ? 54.265  81.108  160.365 1.00 10.00 ? 14  ASN A C   1 
ATOM 109   O O   . ASN A 1 14  ? 54.134  82.332  160.288 1.00 10.00 ? 14  ASN A O   1 
ATOM 110   C CB  . ASN A 1 14  ? 53.653  81.074  162.806 1.00 10.00 ? 14  ASN A CB  1 
ATOM 111   C CG  . ASN A 1 14  ? 52.951  80.094  163.709 1.00 10.00 ? 14  ASN A CG  1 
ATOM 112   O OD1 . ASN A 1 14  ? 52.216  79.212  163.250 1.00 10.00 ? 14  ASN A OD1 1 
ATOM 113   N ND2 . ASN A 1 14  ? 53.167  80.243  165.004 1.00 10.00 ? 14  ASN A ND2 1 
ATOM 114   N N   . TYR A 1 15  ? 54.293  80.293  159.321 1.00 10.00 ? 15  TYR A N   1 
ATOM 115   C CA  . TYR A 1 15  ? 54.141  80.713  157.941 1.00 10.00 ? 15  TYR A CA  1 
ATOM 116   C C   . TYR A 1 15  ? 53.982  79.506  157.048 1.00 10.00 ? 15  TYR A C   1 
ATOM 117   O O   . TYR A 1 15  ? 54.917  78.726  156.879 1.00 10.00 ? 15  TYR A O   1 
ATOM 118   C CB  . TYR A 1 15  ? 55.358  81.471  157.456 1.00 10.00 ? 15  TYR A CB  1 
ATOM 119   C CG  . TYR A 1 15  ? 55.414  81.573  155.957 1.00 10.00 ? 15  TYR A CG  1 
ATOM 120   C CD1 . TYR A 1 15  ? 54.286  81.948  155.228 1.00 10.00 ? 15  TYR A CD1 1 
ATOM 121   C CD2 . TYR A 1 15  ? 56.590  81.273  155.270 1.00 10.00 ? 15  TYR A CD2 1 
ATOM 122   C CE1 . TYR A 1 15  ? 54.322  82.016  153.860 1.00 10.00 ? 15  TYR A CE1 1 
ATOM 123   C CE2 . TYR A 1 15  ? 56.644  81.339  153.900 1.00 10.00 ? 15  TYR A CE2 1 
ATOM 124   C CZ  . TYR A 1 15  ? 55.509  81.711  153.194 1.00 10.00 ? 15  TYR A CZ  1 
ATOM 125   O OH  . TYR A 1 15  ? 55.573  81.810  151.824 1.00 10.00 ? 15  TYR A OH  1 
ATOM 126   N N   . ASN A 1 16  ? 52.812  79.376  156.445 1.00 10.00 ? 16  ASN A N   1 
ATOM 127   C CA  . ASN A 1 16  ? 52.561  78.260  155.558 1.00 10.00 ? 16  ASN A CA  1 
ATOM 128   C C   . ASN A 1 16  ? 52.637  78.761  154.116 1.00 10.00 ? 16  ASN A C   1 
ATOM 129   O O   . ASN A 1 16  ? 51.824  79.584  153.685 1.00 10.00 ? 16  ASN A O   1 
ATOM 130   C CB  . ASN A 1 16  ? 51.199  77.622  155.878 1.00 10.00 ? 16  ASN A CB  1 
ATOM 131   C CG  . ASN A 1 16  ? 51.208  76.861  157.213 1.00 10.00 ? 16  ASN A CG  1 
ATOM 132   O OD1 . ASN A 1 16  ? 52.266  76.401  157.663 1.00 10.00 ? 16  ASN A OD1 1 
ATOM 133   N ND2 . ASN A 1 16  ? 50.029  76.706  157.832 1.00 10.00 ? 16  ASN A ND2 1 
ATOM 134   N N   . LYS A 1 17  ? 53.666  78.282  153.414 1.00 10.00 ? 17  LYS A N   1 
ATOM 135   C CA  . LYS A 1 17  ? 53.970  78.599  152.024 1.00 10.00 ? 17  LYS A CA  1 
ATOM 136   C C   . LYS A 1 17  ? 52.731  78.508  151.130 1.00 10.00 ? 17  LYS A C   1 
ATOM 137   O O   . LYS A 1 17  ? 52.368  79.447  150.407 1.00 10.00 ? 17  LYS A O   1 
ATOM 138   C CB  . LYS A 1 17  ? 55.015  77.612  151.479 1.00 10.00 ? 17  LYS A CB  1 
ATOM 139   C CG  . LYS A 1 17  ? 56.240  77.365  152.365 1.00 10.00 ? 17  LYS A CG  1 
ATOM 140   C CD  . LYS A 1 17  ? 57.266  76.424  151.674 1.00 10.00 ? 17  LYS A CD  1 
ATOM 141   C CE  . LYS A 1 17  ? 57.417  76.759  150.177 1.00 10.00 ? 17  LYS A CE  1 
ATOM 142   N NZ  . LYS A 1 17  ? 58.612  76.213  149.480 1.00 10.00 ? 17  LYS A NZ  1 
ATOM 143   N N   . VAL A 1 18  ? 52.117  77.335  151.176 1.00 10.00 ? 18  VAL A N   1 
ATOM 144   C CA  . VAL A 1 18  ? 50.928  77.002  150.391 1.00 10.00 ? 18  VAL A CA  1 
ATOM 145   C C   . VAL A 1 18  ? 49.728  77.897  150.638 1.00 10.00 ? 18  VAL A C   1 
ATOM 146   O O   . VAL A 1 18  ? 48.792  77.928  149.837 1.00 10.00 ? 18  VAL A O   1 
ATOM 147   C CB  . VAL A 1 18  ? 50.476  75.559  150.669 1.00 10.00 ? 18  VAL A CB  1 
ATOM 148   C CG1 . VAL A 1 18  ? 49.425  75.132  149.639 1.00 10.00 ? 18  VAL A CG1 1 
ATOM 149   C CG2 . VAL A 1 18  ? 51.679  74.661  150.688 1.00 10.00 ? 18  VAL A CG2 1 
ATOM 150   N N   . ILE A 1 19  ? 49.733  78.620  151.748 1.00 10.00 ? 19  ILE A N   1 
ATOM 151   C CA  . ILE A 1 19  ? 48.589  79.474  152.024 1.00 10.00 ? 19  ILE A CA  1 
ATOM 152   C C   . ILE A 1 19  ? 48.521  80.628  151.042 1.00 10.00 ? 19  ILE A C   1 
ATOM 153   O O   . ILE A 1 19  ? 49.538  81.217  150.681 1.00 10.00 ? 19  ILE A O   1 
ATOM 154   C CB  . ILE A 1 19  ? 48.597  79.986  153.483 1.00 10.00 ? 19  ILE A CB  1 
ATOM 155   C CG1 . ILE A 1 19  ? 48.284  78.808  154.422 1.00 10.00 ? 19  ILE A CG1 1 
ATOM 156   C CG2 . ILE A 1 19  ? 47.581  81.135  153.645 1.00 10.00 ? 19  ILE A CG2 1 
ATOM 157   C CD1 . ILE A 1 19  ? 48.436  79.108  155.880 1.00 10.00 ? 19  ILE A CD1 1 
ATOM 158   N N   . ARG A 1 20  ? 47.319  80.900  150.565 1.00 10.00 ? 20  ARG A N   1 
ATOM 159   C CA  . ARG A 1 20  ? 47.118  82.015  149.658 1.00 10.00 ? 20  ARG A CA  1 
ATOM 160   C C   . ARG A 1 20  ? 46.639  83.245  150.412 1.00 10.00 ? 20  ARG A C   1 
ATOM 161   O O   . ARG A 1 20  ? 45.668  83.129  151.174 1.00 10.00 ? 20  ARG A O   1 
ATOM 162   C CB  . ARG A 1 20  ? 46.122  81.644  148.560 1.00 10.00 ? 20  ARG A CB  1 
ATOM 163   C CG  . ARG A 1 20  ? 44.756  81.222  149.077 1.00 10.00 ? 20  ARG A CG  1 
ATOM 164   C CD  . ARG A 1 20  ? 43.906  80.638  147.961 1.00 10.00 ? 20  ARG A CD  1 
ATOM 165   N NE  . ARG A 1 20  ? 42.870  79.747  148.472 1.00 10.00 ? 20  ARG A NE  1 
ATOM 166   C CZ  . ARG A 1 20  ? 42.760  79.387  149.746 1.00 10.00 ? 20  ARG A CZ  1 
ATOM 167   N NH1 . ARG A 1 20  ? 43.626  79.844  150.640 1.00 10.00 ? 20  ARG A NH1 1 
ATOM 168   N NH2 . ARG A 1 20  ? 41.785  78.572  150.123 1.00 10.00 ? 20  ARG A NH2 1 
ATOM 169   N N   . PRO A 1 21  ? 47.364  84.364  150.322 1.00 10.00 ? 21  PRO A N   1 
ATOM 170   C CA  . PRO A 1 21  ? 47.044  85.603  151.033 1.00 10.00 ? 21  PRO A CA  1 
ATOM 171   C C   . PRO A 1 21  ? 45.598  86.110  150.897 1.00 10.00 ? 21  PRO A C   1 
ATOM 172   O O   . PRO A 1 21  ? 45.342  87.264  150.570 1.00 10.00 ? 21  PRO A O   1 
ATOM 173   C CB  . PRO A 1 21  ? 48.121  86.574  150.542 1.00 10.00 ? 21  PRO A CB  1 
ATOM 174   C CG  . PRO A 1 21  ? 48.852  85.819  149.349 1.00 10.00 ? 21  PRO A CG  1 
ATOM 175   C CD  . PRO A 1 21  ? 48.682  84.411  149.644 1.00 10.00 ? 21  PRO A CD  1 
ATOM 176   N N   . VAL A 1 22  ? 44.662  85.212  151.205 1.00 10.00 ? 22  VAL A N   1 
ATOM 177   C CA  . VAL A 1 22  ? 43.212  85.507  151.167 1.00 10.00 ? 22  VAL A CA  1 
ATOM 178   C C   . VAL A 1 22  ? 42.947  86.562  152.250 1.00 10.00 ? 22  VAL A C   1 
ATOM 179   O O   . VAL A 1 22  ? 43.448  86.445  153.372 1.00 10.00 ? 22  VAL A O   1 
ATOM 180   C CB  . VAL A 1 22  ? 42.289  84.230  151.499 1.00 10.00 ? 22  VAL A CB  1 
ATOM 181   C CG1 . VAL A 1 22  ? 40.831  84.479  151.083 1.00 10.00 ? 22  VAL A CG1 1 
ATOM 182   C CG2 . VAL A 1 22  ? 42.820  82.983  150.816 1.00 10.00 ? 22  VAL A CG2 1 
ATOM 183   N N   . GLU A 1 23  ? 42.181  87.594  151.901 1.00 10.00 ? 23  GLU A N   1 
ATOM 184   C CA  . GLU A 1 23  ? 41.821  88.664  152.824 1.00 10.00 ? 23  GLU A CA  1 
ATOM 185   C C   . GLU A 1 23  ? 40.300  88.813  152.857 1.00 10.00 ? 23  GLU A C   1 
ATOM 186   O O   . GLU A 1 23  ? 39.725  89.537  152.041 1.00 10.00 ? 23  GLU A O   1 
ATOM 187   C CB  . GLU A 1 23  ? 42.451  89.994  152.383 1.00 10.00 ? 23  GLU A CB  1 
ATOM 188   C CG  . GLU A 1 23  ? 43.918  90.186  152.762 1.00 10.00 ? 23  GLU A CG  1 
ATOM 189   C CD  . GLU A 1 23  ? 44.105  91.105  153.962 1.00 10.00 ? 23  GLU A CD  1 
ATOM 190   O OE1 . GLU A 1 23  ? 43.655  92.268  153.898 1.00 10.00 ? 23  GLU A OE1 1 
ATOM 191   O OE2 . GLU A 1 23  ? 44.705  90.668  154.966 1.00 10.00 ? 23  GLU A OE2 1 
ATOM 192   N N   . HIS A 1 24  ? 39.651  88.125  153.795 1.00 10.00 ? 24  HIS A N   1 
ATOM 193   C CA  . HIS A 1 24  ? 38.200  88.202  153.943 1.00 10.00 ? 24  HIS A CA  1 
ATOM 194   C C   . HIS A 1 24  ? 37.552  87.673  152.658 1.00 10.00 ? 24  HIS A C   1 
ATOM 195   O O   . HIS A 1 24  ? 38.251  87.307  151.705 1.00 10.00 ? 24  HIS A O   1 
ATOM 196   C CB  . HIS A 1 24  ? 37.768  89.664  154.175 1.00 10.00 ? 24  HIS A CB  1 
ATOM 197   C CG  . HIS A 1 24  ? 38.832  90.539  154.780 1.00 10.00 ? 24  HIS A CG  1 
ATOM 198   N ND1 . HIS A 1 24  ? 38.857  91.906  154.600 1.00 10.00 ? 24  HIS A ND1 1 
ATOM 199   C CD2 . HIS A 1 24  ? 39.911  90.245  155.546 1.00 10.00 ? 24  HIS A CD2 1 
ATOM 200   C CE1 . HIS A 1 24  ? 39.905  92.415  155.223 1.00 10.00 ? 24  HIS A CE1 1 
ATOM 201   N NE2 . HIS A 1 24  ? 40.562  91.428  155.805 1.00 10.00 ? 24  HIS A NE2 1 
ATOM 202   N N   . HIS A 1 25  ? 36.224  87.603  152.621 1.00 10.00 ? 25  HIS A N   1 
ATOM 203   C CA  . HIS A 1 25  ? 35.587  87.144  151.398 1.00 10.00 ? 25  HIS A CA  1 
ATOM 204   C C   . HIS A 1 25  ? 35.274  88.315  150.488 1.00 10.00 ? 25  HIS A C   1 
ATOM 205   O O   . HIS A 1 25  ? 34.185  88.898  150.524 1.00 10.00 ? 25  HIS A O   1 
ATOM 206   C CB  . HIS A 1 25  ? 34.307  86.370  151.680 1.00 10.00 ? 25  HIS A CB  1 
ATOM 207   C CG  . HIS A 1 25  ? 33.306  86.440  150.565 1.00 10.00 ? 25  HIS A CG  1 
ATOM 208   N ND1 . HIS A 1 25  ? 33.662  86.312  149.239 1.00 10.00 ? 25  HIS A ND1 1 
ATOM 209   C CD2 . HIS A 1 25  ? 31.965  86.639  150.578 1.00 10.00 ? 25  HIS A CD2 1 
ATOM 210   C CE1 . HIS A 1 25  ? 32.584  86.428  148.482 1.00 10.00 ? 25  HIS A CE1 1 
ATOM 211   N NE2 . HIS A 1 25  ? 31.542  86.627  149.271 1.00 10.00 ? 25  HIS A NE2 1 
ATOM 212   N N   . THR A 1 26  ? 36.241  88.687  149.669 1.00 10.00 ? 26  THR A N   1 
ATOM 213   C CA  . THR A 1 26  ? 35.974  89.787  148.756 1.00 10.00 ? 26  THR A CA  1 
ATOM 214   C C   . THR A 1 26  ? 36.893  89.844  147.544 1.00 10.00 ? 26  THR A C   1 
ATOM 215   O O   . THR A 1 26  ? 36.963  88.884  146.799 1.00 10.00 ? 26  THR A O   1 
ATOM 216   C CB  . THR A 1 26  ? 36.005  91.136  149.483 1.00 10.00 ? 26  THR A CB  1 
ATOM 217   O OG1 . THR A 1 26  ? 35.477  90.988  150.811 1.00 10.00 ? 26  THR A OG1 1 
ATOM 218   C CG2 . THR A 1 26  ? 35.148  92.142  148.712 1.00 10.00 ? 26  THR A CG2 1 
ATOM 219   N N   . HIS A 1 27  ? 37.572  90.974  147.356 1.00 10.00 ? 27  HIS A N   1 
ATOM 220   C CA  . HIS A 1 27  ? 38.489  91.238  146.254 1.00 10.00 ? 27  HIS A CA  1 
ATOM 221   C C   . HIS A 1 27  ? 39.297  90.107  145.662 1.00 10.00 ? 27  HIS A C   1 
ATOM 222   O O   . HIS A 1 27  ? 39.948  90.308  144.634 1.00 10.00 ? 27  HIS A O   1 
ATOM 223   C CB  . HIS A 1 27  ? 39.426  92.412  146.605 1.00 10.00 ? 27  HIS A CB  1 
ATOM 224   C CG  . HIS A 1 27  ? 40.716  92.040  147.296 1.00 10.00 ? 27  HIS A CG  1 
ATOM 225   N ND1 . HIS A 1 27  ? 40.773  91.281  148.450 1.00 10.00 ? 27  HIS A ND1 1 
ATOM 226   C CD2 . HIS A 1 27  ? 41.991  92.451  147.067 1.00 10.00 ? 27  HIS A CD2 1 
ATOM 227   C CE1 . HIS A 1 27  ? 42.018  91.249  148.901 1.00 10.00 ? 27  HIS A CE1 1 
ATOM 228   N NE2 . HIS A 1 27  ? 42.776  91.953  148.080 1.00 10.00 ? 27  HIS A NE2 1 
ATOM 229   N N   . PHE A 1 28  ? 39.270  88.919  146.264 1.00 10.00 ? 28  PHE A N   1 
ATOM 230   C CA  . PHE A 1 28  ? 40.020  87.838  145.649 1.00 10.00 ? 28  PHE A CA  1 
ATOM 231   C C   . PHE A 1 28  ? 41.503  88.250  145.865 1.00 10.00 ? 28  PHE A C   1 
ATOM 232   O O   . PHE A 1 28  ? 41.779  89.292  146.473 1.00 10.00 ? 28  PHE A O   1 
ATOM 233   C CB  . PHE A 1 28  ? 39.629  87.771  144.131 1.00 10.00 ? 28  PHE A CB  1 
ATOM 234   C CG  . PHE A 1 28  ? 38.171  88.215  143.824 1.00 10.00 ? 28  PHE A CG  1 
ATOM 235   C CD1 . PHE A 1 28  ? 37.915  89.245  142.931 1.00 10.00 ? 28  PHE A CD1 1 
ATOM 236   C CD2 . PHE A 1 28  ? 37.066  87.638  144.476 1.00 10.00 ? 28  PHE A CD2 1 
ATOM 237   C CE1 . PHE A 1 28  ? 36.587  89.693  142.700 1.00 10.00 ? 28  PHE A CE1 1 
ATOM 238   C CE2 . PHE A 1 28  ? 35.726  88.090  144.243 1.00 10.00 ? 28  PHE A CE2 1 
ATOM 239   C CZ  . PHE A 1 28  ? 35.492  89.111  143.361 1.00 10.00 ? 28  PHE A CZ  1 
ATOM 240   N N   . VAL A 1 29  ? 42.468  87.436  145.448 1.00 10.00 ? 29  VAL A N   1 
ATOM 241   C CA  . VAL A 1 29  ? 43.840  87.868  145.596 1.00 10.00 ? 29  VAL A CA  1 
ATOM 242   C C   . VAL A 1 29  ? 44.057  88.696  144.328 1.00 10.00 ? 29  VAL A C   1 
ATOM 243   O O   . VAL A 1 29  ? 43.925  88.177  143.209 1.00 10.00 ? 29  VAL A O   1 
ATOM 244   C CB  . VAL A 1 29  ? 44.805  86.670  145.638 1.00 10.00 ? 29  VAL A CB  1 
ATOM 245   C CG1 . VAL A 1 29  ? 45.978  86.992  146.557 1.00 10.00 ? 29  VAL A CG1 1 
ATOM 246   C CG2 . VAL A 1 29  ? 44.067  85.419  146.107 1.00 10.00 ? 29  VAL A CG2 1 
ATOM 247   N N   . ASP A 1 30  ? 44.341  89.987  144.487 1.00 10.00 ? 30  ASP A N   1 
ATOM 248   C CA  . ASP A 1 30  ? 44.546  90.826  143.308 1.00 10.00 ? 30  ASP A CA  1 
ATOM 249   C C   . ASP A 1 30  ? 45.936  90.601  142.789 1.00 10.00 ? 30  ASP A C   1 
ATOM 250   O O   . ASP A 1 30  ? 46.925  90.982  143.423 1.00 10.00 ? 30  ASP A O   1 
ATOM 251   C CB  . ASP A 1 30  ? 44.413  92.300  143.606 1.00 10.00 ? 30  ASP A CB  1 
ATOM 252   C CG  . ASP A 1 30  ? 45.043  93.140  142.533 1.00 10.00 ? 30  ASP A CG  1 
ATOM 253   O OD1 . ASP A 1 30  ? 44.305  93.580  141.631 1.00 10.00 ? 30  ASP A OD1 1 
ATOM 254   O OD2 . ASP A 1 30  ? 46.281  93.334  142.580 1.00 10.00 ? 30  ASP A OD2 1 
ATOM 255   N N   . ILE A 1 31  ? 45.995  90.019  141.604 1.00 10.00 ? 31  ILE A N   1 
ATOM 256   C CA  . ILE A 1 31  ? 47.263  89.664  140.979 1.00 10.00 ? 31  ILE A CA  1 
ATOM 257   C C   . ILE A 1 31  ? 47.252  90.101  139.504 1.00 10.00 ? 31  ILE A C   1 
ATOM 258   O O   . ILE A 1 31  ? 46.322  89.787  138.763 1.00 10.00 ? 31  ILE A O   1 
ATOM 259   C CB  . ILE A 1 31  ? 47.475  88.111  141.179 1.00 10.00 ? 31  ILE A CB  1 
ATOM 260   C CG1 . ILE A 1 31  ? 47.842  87.847  142.642 1.00 10.00 ? 31  ILE A CG1 1 
ATOM 261   C CG2 . ILE A 1 31  ? 48.518  87.528  140.207 1.00 10.00 ? 31  ILE A CG2 1 
ATOM 262   C CD1 . ILE A 1 31  ? 46.938  86.864  143.295 1.00 10.00 ? 31  ILE A CD1 1 
ATOM 263   N N   . THR A 1 32  ? 48.264  90.862  139.087 1.00 10.00 ? 32  THR A N   1 
ATOM 264   C CA  . THR A 1 32  ? 48.322  91.330  137.705 1.00 10.00 ? 32  THR A CA  1 
ATOM 265   C C   . THR A 1 32  ? 49.426  90.703  136.869 1.00 10.00 ? 32  THR A C   1 
ATOM 266   O O   . THR A 1 32  ? 50.506  90.398  137.369 1.00 10.00 ? 32  THR A O   1 
ATOM 267   C CB  . THR A 1 32  ? 48.505  92.858  137.662 1.00 10.00 ? 32  THR A CB  1 
ATOM 268   O OG1 . THR A 1 32  ? 47.425  93.493  138.360 1.00 10.00 ? 32  THR A OG1 1 
ATOM 269   C CG2 . THR A 1 32  ? 48.543  93.351  136.226 1.00 10.00 ? 32  THR A CG2 1 
ATOM 270   N N   . VAL A 1 33  ? 49.127  90.526  135.586 1.00 10.00 ? 33  VAL A N   1 
ATOM 271   C CA  . VAL A 1 33  ? 50.051  89.942  134.619 1.00 10.00 ? 33  VAL A CA  1 
ATOM 272   C C   . VAL A 1 33  ? 50.599  91.070  133.756 1.00 10.00 ? 33  VAL A C   1 
ATOM 273   O O   . VAL A 1 33  ? 49.939  92.095  133.568 1.00 10.00 ? 33  VAL A O   1 
ATOM 274   C CB  . VAL A 1 33  ? 49.349  88.942  133.651 1.00 10.00 ? 33  VAL A CB  1 
ATOM 275   C CG1 . VAL A 1 33  ? 50.352  87.985  133.097 1.00 10.00 ? 33  VAL A CG1 1 
ATOM 276   C CG2 . VAL A 1 33  ? 48.240  88.235  134.327 1.00 10.00 ? 33  VAL A CG2 1 
ATOM 277   N N   . GLY A 1 34  ? 51.801  90.868  133.229 1.00 10.00 ? 34  GLY A N   1 
ATOM 278   C CA  . GLY A 1 34  ? 52.430  91.853  132.364 1.00 10.00 ? 34  GLY A CA  1 
ATOM 279   C C   . GLY A 1 34  ? 53.530  91.158  131.596 1.00 10.00 ? 34  GLY A C   1 
ATOM 280   O O   . GLY A 1 34  ? 54.605  90.932  132.145 1.00 10.00 ? 34  GLY A O   1 
ATOM 281   N N   . LEU A 1 35  ? 53.248  90.796  130.349 1.00 10.00 ? 35  LEU A N   1 
ATOM 282   C CA  . LEU A 1 35  ? 54.191  90.093  129.482 1.00 10.00 ? 35  LEU A CA  1 
ATOM 283   C C   . LEU A 1 35  ? 55.009  90.976  128.560 1.00 10.00 ? 35  LEU A C   1 
ATOM 284   O O   . LEU A 1 35  ? 54.449  91.742  127.782 1.00 10.00 ? 35  LEU A O   1 
ATOM 285   C CB  . LEU A 1 35  ? 53.441  89.097  128.596 1.00 10.00 ? 35  LEU A CB  1 
ATOM 286   C CG  . LEU A 1 35  ? 54.241  88.233  127.599 1.00 10.00 ? 35  LEU A CG  1 
ATOM 287   C CD1 . LEU A 1 35  ? 53.275  87.287  126.899 1.00 10.00 ? 35  LEU A CD1 1 
ATOM 288   C CD2 . LEU A 1 35  ? 54.997  89.076  126.567 1.00 10.00 ? 35  LEU A CD2 1 
ATOM 289   N N   . GLN A 1 36  ? 56.329  90.830  128.610 1.00 10.00 ? 36  GLN A N   1 
ATOM 290   C CA  . GLN A 1 36  ? 57.192  91.592  127.711 1.00 10.00 ? 36  GLN A CA  1 
ATOM 291   C C   . GLN A 1 36  ? 58.048  90.605  126.928 1.00 10.00 ? 36  GLN A C   1 
ATOM 292   O O   . GLN A 1 36  ? 59.086  90.132  127.408 1.00 10.00 ? 36  GLN A O   1 
ATOM 293   C CB  . GLN A 1 36  ? 58.089  92.572  128.478 1.00 10.00 ? 36  GLN A CB  1 
ATOM 294   C CG  . GLN A 1 36  ? 58.949  93.448  127.603 1.00 10.00 ? 36  GLN A CG  1 
ATOM 295   C CD  . GLN A 1 36  ? 60.096  92.704  126.952 1.00 10.00 ? 36  GLN A CD  1 
ATOM 296   O OE1 . GLN A 1 36  ? 59.893  91.916  126.053 1.00 10.00 ? 36  GLN A OE1 1 
ATOM 297   N NE2 . GLN A 1 36  ? 61.315  92.975  127.402 1.00 10.00 ? 36  GLN A NE2 1 
ATOM 298   N N   . LEU A 1 37  ? 57.615  90.286  125.715 1.00 10.00 ? 37  LEU A N   1 
ATOM 299   C CA  . LEU A 1 37  ? 58.386  89.350  124.887 1.00 10.00 ? 37  LEU A CA  1 
ATOM 300   C C   . LEU A 1 37  ? 59.707  90.045  124.567 1.00 10.00 ? 37  LEU A C   1 
ATOM 301   O O   . LEU A 1 37  ? 59.716  91.033  123.841 1.00 10.00 ? 37  LEU A O   1 
ATOM 302   C CB  . LEU A 1 37  ? 57.655  88.995  123.568 1.00 10.00 ? 37  LEU A CB  1 
ATOM 303   C CG  . LEU A 1 37  ? 56.244  88.398  123.594 1.00 10.00 ? 37  LEU A CG  1 
ATOM 304   C CD1 . LEU A 1 37  ? 55.831  88.047  122.181 1.00 10.00 ? 37  LEU A CD1 1 
ATOM 305   C CD2 . LEU A 1 37  ? 56.213  87.168  124.473 1.00 10.00 ? 37  LEU A CD2 1 
ATOM 306   N N   . ILE A 1 38  ? 60.810  89.566  125.142 1.00 10.00 ? 38  ILE A N   1 
ATOM 307   C CA  . ILE A 1 38  ? 62.119  90.180  124.889 1.00 10.00 ? 38  ILE A CA  1 
ATOM 308   C C   . ILE A 1 38  ? 62.467  89.897  123.430 1.00 10.00 ? 38  ILE A C   1 
ATOM 309   O O   . ILE A 1 38  ? 63.080  90.718  122.743 1.00 10.00 ? 38  ILE A O   1 
ATOM 310   C CB  . ILE A 1 38  ? 63.259  89.576  125.775 1.00 10.00 ? 38  ILE A CB  1 
ATOM 311   C CG1 . ILE A 1 38  ? 62.985  89.805  127.259 1.00 10.00 ? 38  ILE A CG1 1 
ATOM 312   C CG2 . ILE A 1 38  ? 64.595  90.240  125.430 1.00 10.00 ? 38  ILE A CG2 1 
ATOM 313   C CD1 . ILE A 1 38  ? 61.796  89.044  127.850 1.00 10.00 ? 38  ILE A CD1 1 
ATOM 314   N N   . GLN A 1 39  ? 62.097  88.700  122.975 1.00 10.00 ? 39  GLN A N   1 
ATOM 315   C CA  . GLN A 1 39  ? 62.348  88.288  121.594 1.00 10.00 ? 39  GLN A CA  1 
ATOM 316   C C   . GLN A 1 39  ? 61.798  86.899  121.268 1.00 10.00 ? 39  GLN A C   1 
ATOM 317   O O   . GLN A 1 39  ? 61.434  86.135  122.157 1.00 10.00 ? 39  GLN A O   1 
ATOM 318   C CB  . GLN A 1 39  ? 63.849  88.364  121.274 1.00 10.00 ? 39  GLN A CB  1 
ATOM 319   C CG  . GLN A 1 39  ? 64.479  89.735  121.447 1.00 10.00 ? 39  GLN A CG  1 
ATOM 320   C CD  . GLN A 1 39  ? 65.960  89.736  121.106 1.00 10.00 ? 39  GLN A CD  1 
ATOM 321   O OE1 . GLN A 1 39  ? 66.529  88.701  120.757 1.00 10.00 ? 39  GLN A OE1 1 
ATOM 322   N NE2 . GLN A 1 39  ? 66.589  90.903  121.205 1.00 10.00 ? 39  GLN A NE2 1 
ATOM 323   N N   . LEU A 1 40  ? 61.725  86.594  119.978 1.00 10.00 ? 40  LEU A N   1 
ATOM 324   C CA  . LEU A 1 40  ? 61.214  85.334  119.497 1.00 10.00 ? 40  LEU A CA  1 
ATOM 325   C C   . LEU A 1 40  ? 62.324  84.528  118.811 1.00 10.00 ? 40  LEU A C   1 
ATOM 326   O O   . LEU A 1 40  ? 63.092  85.075  118.038 1.00 10.00 ? 40  LEU A O   1 
ATOM 327   C CB  . LEU A 1 40  ? 60.094  85.602  118.511 1.00 10.00 ? 40  LEU A CB  1 
ATOM 328   C CG  . LEU A 1 40  ? 59.276  86.850  118.756 1.00 10.00 ? 40  LEU A CG  1 
ATOM 329   C CD1 . LEU A 1 40  ? 58.138  86.851  117.765 1.00 10.00 ? 40  LEU A CD1 1 
ATOM 330   C CD2 . LEU A 1 40  ? 58.723  86.862  120.151 1.00 10.00 ? 40  LEU A CD2 1 
ATOM 331   N N   . ILE A 1 41  ? 62.355  83.210  119.060 1.00 10.00 ? 41  ILE A N   1 
ATOM 332   C CA  . ILE A 1 41  ? 63.369  82.287  118.559 1.00 10.00 ? 41  ILE A CA  1 
ATOM 333   C C   . ILE A 1 41  ? 62.919  81.611  117.266 1.00 10.00 ? 41  ILE A C   1 
ATOM 334   O O   . ILE A 1 41  ? 63.717  81.458  116.306 1.00 10.00 ? 41  ILE A O   1 
ATOM 335   C CB  . ILE A 1 41  ? 63.705  81.201  119.596 1.00 10.00 ? 41  ILE A CB  1 
ATOM 336   C CG1 . ILE A 1 41  ? 62.536  80.225  119.745 1.00 10.00 ? 41  ILE A CG1 1 
ATOM 337   C CG2 . ILE A 1 41  ? 64.055  81.833  120.934 1.00 10.00 ? 41  ILE A CG2 1 
ATOM 338   C CD1 . ILE A 1 41  ? 62.962  78.790  119.963 1.00 10.00 ? 41  ILE A CD1 1 
ATOM 339   N N   . ASN A 1 42  ? 61.687  81.131  117.205 1.00 10.00 ? 42  ASN A N   1 
ATOM 340   C CA  . ASN A 1 42  ? 61.227  80.439  116.003 1.00 10.00 ? 42  ASN A CA  1 
ATOM 341   C C   . ASN A 1 42  ? 59.703  80.187  115.946 1.00 10.00 ? 42  ASN A C   1 
ATOM 342   O O   . ASN A 1 42  ? 59.000  80.036  116.967 1.00 10.00 ? 42  ASN A O   1 
ATOM 343   C CB  . ASN A 1 42  ? 62.047  79.129  115.798 1.00 10.00 ? 42  ASN A CB  1 
ATOM 344   C CG  . ASN A 1 42  ? 63.529  79.402  115.442 1.00 10.00 ? 42  ASN A CG  1 
ATOM 345   O OD1 . ASN A 1 42  ? 63.835  79.997  114.396 1.00 10.00 ? 42  ASN A OD1 1 
ATOM 346   N ND2 . ASN A 1 42  ? 64.438  79.002  116.326 1.00 10.00 ? 42  ASN A ND2 1 
ATOM 347   N N   . VAL A 1 43  ? 59.189  80.176  114.724 1.00 10.00 ? 43  VAL A N   1 
ATOM 348   C CA  . VAL A 1 43  ? 57.769  79.989  114.497 1.00 10.00 ? 43  VAL A CA  1 
ATOM 349   C C   . VAL A 1 43  ? 57.486  79.136  113.265 1.00 10.00 ? 43  VAL A C   1 
ATOM 350   O O   . VAL A 1 43  ? 58.278  79.084  112.325 1.00 10.00 ? 43  VAL A O   1 
ATOM 351   C CB  . VAL A 1 43  ? 57.049  81.344  114.301 1.00 10.00 ? 43  VAL A CB  1 
ATOM 352   C CG1 . VAL A 1 43  ? 55.533  81.127  114.181 1.00 10.00 ? 43  VAL A CG1 1 
ATOM 353   C CG2 . VAL A 1 43  ? 57.417  82.301  115.431 1.00 10.00 ? 43  VAL A CG2 1 
ATOM 354   N N   . ASP A 1 44  ? 56.321  78.489  113.281 1.00 10.00 ? 44  ASP A N   1 
ATOM 355   C CA  . ASP A 1 44  ? 55.879  77.619  112.176 1.00 10.00 ? 44  ASP A CA  1 
ATOM 356   C C   . ASP A 1 44  ? 54.414  77.937  111.921 1.00 10.00 ? 44  ASP A C   1 
ATOM 357   O O   . ASP A 1 44  ? 53.522  77.414  112.586 1.00 10.00 ? 44  ASP A O   1 
ATOM 358   C CB  . ASP A 1 44  ? 56.016  76.139  112.559 1.00 10.00 ? 44  ASP A CB  1 
ATOM 359   C CG  . ASP A 1 44  ? 56.192  75.231  111.355 1.00 10.00 ? 44  ASP A CG  1 
ATOM 360   O OD1 . ASP A 1 44  ? 56.213  73.997  111.534 1.00 10.00 ? 44  ASP A OD1 1 
ATOM 361   O OD2 . ASP A 1 44  ? 56.301  75.757  110.227 1.00 10.00 ? 44  ASP A OD2 1 
ATOM 362   N N   . GLU A 1 45  ? 54.180  78.847  110.985 1.00 10.00 ? 45  GLU A N   1 
ATOM 363   C CA  . GLU A 1 45  ? 52.834  79.272  110.624 1.00 10.00 ? 45  GLU A CA  1 
ATOM 364   C C   . GLU A 1 45  ? 51.971  78.062  110.260 1.00 10.00 ? 45  GLU A C   1 
ATOM 365   O O   . GLU A 1 45  ? 50.777  78.013  110.568 1.00 10.00 ? 45  GLU A O   1 
ATOM 366   C CB  . GLU A 1 45  ? 52.909  80.242  109.443 1.00 10.00 ? 45  GLU A CB  1 
ATOM 367   C CG  . GLU A 1 45  ? 51.602  80.887  109.088 1.00 10.00 ? 45  GLU A CG  1 
ATOM 368   C CD  . GLU A 1 45  ? 51.618  81.446  107.694 1.00 10.00 ? 45  GLU A CD  1 
ATOM 369   O OE1 . GLU A 1 45  ? 50.546  81.868  107.223 1.00 10.00 ? 45  GLU A OE1 1 
ATOM 370   O OE2 . GLU A 1 45  ? 52.699  81.462  107.071 1.00 10.00 ? 45  GLU A OE2 1 
ATOM 371   N N   . VAL A 1 46  ? 52.590  77.087  109.604 1.00 10.00 ? 46  VAL A N   1 
ATOM 372   C CA  . VAL A 1 46  ? 51.907  75.866  109.195 1.00 10.00 ? 46  VAL A CA  1 
ATOM 373   C C   . VAL A 1 46  ? 51.290  75.159  110.398 1.00 10.00 ? 46  VAL A C   1 
ATOM 374   O O   . VAL A 1 46  ? 50.146  74.706  110.353 1.00 10.00 ? 46  VAL A O   1 
ATOM 375   C CB  . VAL A 1 46  ? 52.857  74.912  108.448 1.00 10.00 ? 46  VAL A CB  1 
ATOM 376   C CG1 . VAL A 1 46  ? 52.615  73.475  108.878 1.00 10.00 ? 46  VAL A CG1 1 
ATOM 377   C CG2 . VAL A 1 46  ? 52.687  75.062  106.943 1.00 10.00 ? 46  VAL A CG2 1 
ATOM 378   N N   . ASN A 1 47  ? 52.137  74.962  111.408 1.00 10.00 ? 47  ASN A N   1 
ATOM 379   C CA  . ASN A 1 47  ? 51.730  74.261  112.632 1.00 10.00 ? 47  ASN A CA  1 
ATOM 380   C C   . ASN A 1 47  ? 51.364  75.254  113.731 1.00 10.00 ? 47  ASN A C   1 
ATOM 381   O O   . ASN A 1 47  ? 51.082  74.859  114.859 1.00 10.00 ? 47  ASN A O   1 
ATOM 382   C CB  . ASN A 1 47  ? 52.873  73.344  113.130 1.00 10.00 ? 47  ASN A CB  1 
ATOM 383   C CG  . ASN A 1 47  ? 53.076  72.104  112.254 1.00 10.00 ? 47  ASN A CG  1 
ATOM 384   O OD1 . ASN A 1 47  ? 52.113  71.410  111.911 1.00 10.00 ? 47  ASN A OD1 1 
ATOM 385   N ND2 . ASN A 1 47  ? 54.330  71.820  111.901 1.00 10.00 ? 47  ASN A ND2 1 
ATOM 386   N N   . GLN A 1 48  ? 51.361  76.548  113.421 1.00 10.00 ? 48  GLN A N   1 
ATOM 387   C CA  . GLN A 1 48  ? 51.032  77.670  114.290 1.00 10.00 ? 48  GLN A CA  1 
ATOM 388   C C   . GLN A 1 48  ? 51.693  77.523  115.653 1.00 10.00 ? 48  GLN A C   1 
ATOM 389   O O   . GLN A 1 48  ? 51.045  77.823  116.696 1.00 10.00 ? 48  GLN A O   1 
ATOM 390   C CB  . GLN A 1 48  ? 49.516  77.808  114.439 1.00 10.00 ? 48  GLN A CB  1 
ATOM 391   C CG  . GLN A 1 48  ? 48.869  76.705  115.259 1.00 10.00 ? 48  GLN A CG  1 
ATOM 392   C CD  . GLN A 1 48  ? 47.356  76.741  115.189 1.00 10.00 ? 48  GLN A CD  1 
ATOM 393   O OE1 . GLN A 1 48  ? 46.777  77.598  114.521 1.00 10.00 ? 48  GLN A OE1 1 
ATOM 394   N NE2 . GLN A 1 48  ? 46.518  75.909  115.795 1.00 10.00 ? 48  GLN A NE2 1 
ATOM 395   N N   . ILE A 1 49  ? 52.963  77.194  115.698 1.00 10.00 ? 49  ILE A N   1 
ATOM 396   C CA  . ILE A 1 49  ? 53.747  77.018  116.935 1.00 10.00 ? 49  ILE A CA  1 
ATOM 397   C C   . ILE A 1 49  ? 54.892  78.041  117.031 1.00 10.00 ? 49  ILE A C   1 
ATOM 398   O O   . ILE A 1 49  ? 55.604  78.224  116.055 1.00 10.00 ? 49  ILE A O   1 
ATOM 399   C CB  . ILE A 1 49  ? 54.403  75.587  116.980 1.00 10.00 ? 49  ILE A CB  1 
ATOM 400   C CG1 . ILE A 1 49  ? 53.324  74.491  117.034 1.00 10.00 ? 49  ILE A CG1 1 
ATOM 401   C CG2 . ILE A 1 49  ? 55.343  75.479  118.169 1.00 10.00 ? 49  ILE A CG2 1 
ATOM 402   C CD1 . ILE A 1 49  ? 53.861  73.061  116.998 1.00 10.00 ? 49  ILE A CD1 1 
ATOM 403   N N   . VAL A 1 50  ? 55.072  78.701  118.183 1.00 10.00 ? 50  VAL A N   1 
ATOM 404   C CA  . VAL A 1 50  ? 56.186  79.657  118.348 1.00 10.00 ? 50  VAL A CA  1 
ATOM 405   C C   . VAL A 1 50  ? 56.919  79.457  119.667 1.00 10.00 ? 50  VAL A C   1 
ATOM 406   O O   . VAL A 1 50  ? 56.309  79.140  120.688 1.00 10.00 ? 50  VAL A O   1 
ATOM 407   C CB  . VAL A 1 50  ? 55.770  81.165  118.336 1.00 10.00 ? 50  VAL A CB  1 
ATOM 408   C CG1 . VAL A 1 50  ? 56.979  81.996  118.550 1.00 10.00 ? 50  VAL A CG1 1 
ATOM 409   C CG2 . VAL A 1 50  ? 55.137  81.551  117.025 1.00 10.00 ? 50  VAL A CG2 1 
ATOM 410   N N   . GLU A 1 51  ? 58.231  79.663  119.633 1.00 10.00 ? 51  GLU A N   1 
ATOM 411   C CA  . GLU A 1 51  ? 59.062  79.538  120.802 1.00 10.00 ? 51  GLU A CA  1 
ATOM 412   C C   . GLU A 1 51  ? 59.500  81.013  121.050 1.00 10.00 ? 51  GLU A C   1 
ATOM 413   O O   . GLU A 1 51  ? 60.239  81.600  120.255 1.00 10.00 ? 51  GLU A O   1 
ATOM 414   C CB  . GLU A 1 51  ? 60.203  78.568  120.452 1.00 10.00 ? 51  GLU A CB  1 
ATOM 415   C CG  . GLU A 1 51  ? 60.708  77.736  121.618 1.00 10.00 ? 51  GLU A CG  1 
ATOM 416   C CD  . GLU A 1 51  ? 61.939  76.923  121.275 1.00 10.00 ? 51  GLU A CD  1 
ATOM 417   O OE1 . GLU A 1 51  ? 62.595  76.400  122.200 1.00 10.00 ? 51  GLU A OE1 1 
ATOM 418   O OE2 . GLU A 1 51  ? 62.255  76.804  120.078 1.00 10.00 ? 51  GLU A OE2 1 
ATOM 419   N N   . THR A 1 52  ? 59.006  81.615  122.138 1.00 10.00 ? 52  THR A N   1 
ATOM 420   C CA  . THR A 1 52  ? 59.277  83.025  122.426 1.00 10.00 ? 52  THR A CA  1 
ATOM 421   C C   . THR A 1 52  ? 59.869  83.398  123.784 1.00 10.00 ? 52  THR A C   1 
ATOM 422   O O   . THR A 1 52  ? 59.738  82.658  124.754 1.00 10.00 ? 52  THR A O   1 
ATOM 423   C CB  . THR A 1 52  ? 57.991  83.810  122.324 1.00 10.00 ? 52  THR A CB  1 
ATOM 424   O OG1 . THR A 1 52  ? 57.163  83.481  123.450 1.00 10.00 ? 52  THR A OG1 1 
ATOM 425   C CG2 . THR A 1 52  ? 57.244  83.447  121.060 1.00 10.00 ? 52  THR A CG2 1 
ATOM 426   N N   . ASN A 1 53  ? 60.473  84.589  123.841 1.00 10.00 ? 53  ASN A N   1 
ATOM 427   C CA  . ASN A 1 53  ? 61.072  85.122  125.073 1.00 10.00 ? 53  ASN A CA  1 
ATOM 428   C C   . ASN A 1 53  ? 60.075  85.956  125.863 1.00 10.00 ? 53  ASN A C   1 
ATOM 429   O O   . ASN A 1 53  ? 59.571  86.947  125.375 1.00 10.00 ? 53  ASN A O   1 
ATOM 430   C CB  . ASN A 1 53  ? 62.293  85.981  124.756 1.00 10.00 ? 53  ASN A CB  1 
ATOM 431   C CG  . ASN A 1 53  ? 63.572  85.375  125.274 1.00 10.00 ? 53  ASN A CG  1 
ATOM 432   O OD1 . ASN A 1 53  ? 63.611  84.871  126.388 1.00 10.00 ? 53  ASN A OD1 1 
ATOM 433   N ND2 . ASN A 1 53  ? 64.629  85.429  124.476 1.00 10.00 ? 53  ASN A ND2 1 
ATOM 434   N N   . VAL A 1 54  ? 59.810  85.575  127.108 1.00 10.00 ? 54  VAL A N   1 
ATOM 435   C CA  . VAL A 1 54  ? 58.841  86.332  127.896 1.00 10.00 ? 54  VAL A CA  1 
ATOM 436   C C   . VAL A 1 54  ? 59.346  86.587  129.321 1.00 10.00 ? 54  VAL A C   1 
ATOM 437   O O   . VAL A 1 54  ? 59.862  85.690  129.970 1.00 10.00 ? 54  VAL A O   1 
ATOM 438   C CB  . VAL A 1 54  ? 57.421  85.603  127.896 1.00 10.00 ? 54  VAL A CB  1 
ATOM 439   C CG1 . VAL A 1 54  ? 57.129  85.025  126.496 1.00 10.00 ? 54  VAL A CG1 1 
ATOM 440   C CG2 . VAL A 1 54  ? 57.342  84.493  128.959 1.00 10.00 ? 54  VAL A CG2 1 
ATOM 441   N N   . ARG A 1 55  ? 59.252  87.823  129.799 1.00 10.00 ? 55  ARG A N   1 
ATOM 442   C CA  . ARG A 1 55  ? 59.691  88.084  131.140 1.00 10.00 ? 55  ARG A CA  1 
ATOM 443   C C   . ARG A 1 55  ? 58.321  88.284  131.797 1.00 10.00 ? 55  ARG A C   1 
ATOM 444   O O   . ARG A 1 55  ? 57.591  89.225  131.444 1.00 10.00 ? 55  ARG A O   1 
ATOM 445   C CB  . ARG A 1 55  ? 60.566  89.345  131.175 1.00 10.00 ? 55  ARG A CB  1 
ATOM 446   C CG  . ARG A 1 55  ? 61.995  89.150  130.636 1.00 10.00 ? 55  ARG A CG  1 
ATOM 447   C CD  . ARG A 1 55  ? 62.900  90.358  130.917 1.00 10.00 ? 55  ARG A CD  1 
ATOM 448   N NE  . ARG A 1 55  ? 64.215  90.222  130.304 1.00 10.00 ? 55  ARG A NE  1 
ATOM 449   C CZ  . ARG A 1 55  ? 65.192  91.117  130.419 1.00 10.00 ? 55  ARG A CZ  1 
ATOM 450   N NH1 . ARG A 1 55  ? 65.017  92.220  131.133 1.00 10.00 ? 55  ARG A NH1 1 
ATOM 451   N NH2 . ARG A 1 55  ? 66.345  90.913  129.803 1.00 10.00 ? 55  ARG A NH2 1 
ATOM 452   N N   . LEU A 1 56  ? 57.901  87.375  132.682 1.00 10.00 ? 56  LEU A N   1 
ATOM 453   C CA  . LEU A 1 56  ? 56.596  87.637  133.242 1.00 10.00 ? 56  LEU A CA  1 
ATOM 454   C C   . LEU A 1 56  ? 56.636  88.415  134.500 1.00 10.00 ? 56  LEU A C   1 
ATOM 455   O O   . LEU A 1 56  ? 57.177  88.011  135.531 1.00 10.00 ? 56  LEU A O   1 
ATOM 456   C CB  . LEU A 1 56  ? 55.753  86.414  133.475 1.00 10.00 ? 56  LEU A CB  1 
ATOM 457   C CG  . LEU A 1 56  ? 54.242  86.712  133.437 1.00 10.00 ? 56  LEU A CG  1 
ATOM 458   C CD1 . LEU A 1 56  ? 53.567  85.611  134.142 1.00 10.00 ? 56  LEU A CD1 1 
ATOM 459   C CD2 . LEU A 1 56  ? 53.818  87.951  134.138 1.00 10.00 ? 56  LEU A CD2 1 
ATOM 460   N N   . ARG A 1 57  ? 56.000  89.567  134.378 1.00 10.00 ? 57  ARG A N   1 
ATOM 461   C CA  . ARG A 1 57  ? 55.877  90.525  135.470 1.00 10.00 ? 57  ARG A CA  1 
ATOM 462   C C   . ARG A 1 57  ? 54.595  90.143  136.184 1.00 10.00 ? 57  ARG A C   1 
ATOM 463   O O   . ARG A 1 57  ? 53.503  90.326  135.659 1.00 10.00 ? 57  ARG A O   1 
ATOM 464   C CB  . ARG A 1 57  ? 55.838  91.987  134.938 1.00 10.00 ? 57  ARG A CB  1 
ATOM 465   C CG  . ARG A 1 57  ? 54.485  92.550  134.476 1.00 10.00 ? 57  ARG A CG  1 
ATOM 466   C CD  . ARG A 1 57  ? 54.632  93.783  133.511 1.00 10.00 ? 57  ARG A CD  1 
ATOM 467   N NE  . ARG A 1 57  ? 55.450  94.926  133.982 1.00 10.00 ? 57  ARG A NE  1 
ATOM 468   C CZ  . ARG A 1 57  ? 55.694  96.048  133.285 1.00 10.00 ? 57  ARG A CZ  1 
ATOM 469   N NH1 . ARG A 1 57  ? 55.192  96.233  132.071 1.00 10.00 ? 57  ARG A NH1 1 
ATOM 470   N NH2 . ARG A 1 57  ? 56.478  96.990  133.785 1.00 10.00 ? 57  ARG A NH2 1 
ATOM 471   N N   . GLN A 1 58  ? 54.755  89.541  137.358 1.00 10.00 ? 58  GLN A N   1 
ATOM 472   C CA  . GLN A 1 58  ? 53.625  89.102  138.168 1.00 10.00 ? 58  GLN A CA  1 
ATOM 473   C C   . GLN A 1 58  ? 53.599  89.904  139.454 1.00 10.00 ? 58  GLN A C   1 
ATOM 474   O O   . GLN A 1 58  ? 54.614  89.998  140.142 1.00 10.00 ? 58  GLN A O   1 
ATOM 475   C CB  . GLN A 1 58  ? 53.754  87.612  138.480 1.00 10.00 ? 58  GLN A CB  1 
ATOM 476   C CG  . GLN A 1 58  ? 53.555  86.718  137.273 1.00 10.00 ? 58  GLN A CG  1 
ATOM 477   C CD  . GLN A 1 58  ? 53.893  85.270  137.554 1.00 10.00 ? 58  GLN A CD  1 
ATOM 478   O OE1 . GLN A 1 58  ? 55.048  84.930  137.806 1.00 10.00 ? 58  GLN A OE1 1 
ATOM 479   N NE2 . GLN A 1 58  ? 52.884  84.407  137.515 1.00 10.00 ? 58  GLN A NE2 1 
ATOM 480   N N   . GLN A 1 59  ? 52.451  90.522  139.753 1.00 10.00 ? 59  GLN A N   1 
ATOM 481   C CA  . GLN A 1 59  ? 52.328  91.326  140.983 1.00 10.00 ? 59  GLN A CA  1 
ATOM 482   C C   . GLN A 1 59  ? 51.161  90.918  141.870 1.00 10.00 ? 59  GLN A C   1 
ATOM 483   O O   . GLN A 1 59  ? 50.100  90.534  141.392 1.00 10.00 ? 59  GLN A O   1 
ATOM 484   C CB  . GLN A 1 59  ? 52.161  92.851  140.689 1.00 10.00 ? 59  GLN A CB  1 
ATOM 485   C CG  . GLN A 1 59  ? 53.298  93.639  139.960 1.00 10.00 ? 59  GLN A CG  1 
ATOM 486   C CD  . GLN A 1 59  ? 54.696  93.406  140.509 1.00 10.00 ? 59  GLN A CD  1 
ATOM 487   O OE1 . GLN A 1 59  ? 54.946  93.481  141.710 1.00 10.00 ? 59  GLN A OE1 1 
ATOM 488   N NE2 . GLN A 1 59  ? 55.614  93.139  139.611 1.00 10.00 ? 59  GLN A NE2 1 
ATOM 489   N N   . TRP A 1 60  ? 51.362  91.069  143.174 1.00 10.00 ? 60  TRP A N   1 
ATOM 490   C CA  . TRP A 1 60  ? 50.344  90.752  144.164 1.00 10.00 ? 60  TRP A CA  1 
ATOM 491   C C   . TRP A 1 60  ? 50.816  91.170  145.550 1.00 10.00 ? 60  TRP A C   1 
ATOM 492   O O   . TRP A 1 60  ? 52.000  91.414  145.751 1.00 10.00 ? 60  TRP A O   1 
ATOM 493   C CB  . TRP A 1 60  ? 50.039  89.256  144.151 1.00 10.00 ? 60  TRP A CB  1 
ATOM 494   C CG  . TRP A 1 60  ? 51.247  88.392  144.252 1.00 10.00 ? 60  TRP A CG  1 
ATOM 495   C CD1 . TRP A 1 60  ? 52.047  88.223  145.343 1.00 10.00 ? 60  TRP A CD1 1 
ATOM 496   C CD2 . TRP A 1 60  ? 51.816  87.595  143.209 1.00 10.00 ? 60  TRP A CD2 1 
ATOM 497   N NE1 . TRP A 1 60  ? 53.082  87.370  145.046 1.00 10.00 ? 60  TRP A NE1 1 
ATOM 498   C CE2 . TRP A 1 60  ? 52.965  86.970  143.741 1.00 10.00 ? 60  TRP A CE2 1 
ATOM 499   C CE3 . TRP A 1 60  ? 51.467  87.349  141.875 1.00 10.00 ? 60  TRP A CE3 1 
ATOM 500   C CZ2 . TRP A 1 60  ? 53.770  86.113  142.985 1.00 10.00 ? 60  TRP A CZ2 1 
ATOM 501   C CZ3 . TRP A 1 60  ? 52.267  86.497  141.123 1.00 10.00 ? 60  TRP A CZ3 1 
ATOM 502   C CH2 . TRP A 1 60  ? 53.406  85.889  141.681 1.00 10.00 ? 60  TRP A CH2 1 
ATOM 503   N N   . ILE A 1 61  ? 49.896  91.250  146.506 1.00 10.00 ? 61  ILE A N   1 
ATOM 504   C CA  . ILE A 1 61  ? 50.314  91.629  147.830 1.00 10.00 ? 61  ILE A CA  1 
ATOM 505   C C   . ILE A 1 61  ? 49.908  90.605  148.917 1.00 10.00 ? 61  ILE A C   1 
ATOM 506   O O   . ILE A 1 61  ? 48.841  89.984  148.880 1.00 10.00 ? 61  ILE A O   1 
ATOM 507   C CB  . ILE A 1 61  ? 49.844  93.106  148.195 1.00 10.00 ? 61  ILE A CB  1 
ATOM 508   C CG1 . ILE A 1 61  ? 48.560  93.484  147.427 1.00 10.00 ? 61  ILE A CG1 1 
ATOM 509   C CG2 . ILE A 1 61  ? 51.015  94.092  147.983 1.00 10.00 ? 61  ILE A CG2 1 
ATOM 510   C CD1 . ILE A 1 61  ? 47.751  94.603  148.082 1.00 10.00 ? 61  ILE A CD1 1 
ATOM 511   N N   . ASP A 1 62  ? 50.827  90.433  149.869 1.00 10.00 ? 62  ASP A N   1 
ATOM 512   C CA  . ASP A 1 62  ? 50.675  89.516  150.977 1.00 10.00 ? 62  ASP A CA  1 
ATOM 513   C C   . ASP A 1 62  ? 50.987  90.315  152.230 1.00 10.00 ? 62  ASP A C   1 
ATOM 514   O O   . ASP A 1 62  ? 52.120  90.343  152.702 1.00 10.00 ? 62  ASP A O   1 
ATOM 515   C CB  . ASP A 1 62  ? 51.659  88.350  150.826 1.00 10.00 ? 62  ASP A CB  1 
ATOM 516   C CG  . ASP A 1 62  ? 51.248  87.123  151.623 1.00 10.00 ? 62  ASP A CG  1 
ATOM 517   O OD1 . ASP A 1 62  ? 51.000  87.253  152.838 1.00 10.00 ? 62  ASP A OD1 1 
ATOM 518   O OD2 . ASP A 1 62  ? 51.180  86.024  151.032 1.00 10.00 ? 62  ASP A OD2 1 
ATOM 519   N N   . VAL A 1 63  ? 49.951  90.966  152.753 1.00 10.00 ? 63  VAL A N   1 
ATOM 520   C CA  . VAL A 1 63  ? 50.012  91.801  153.947 1.00 10.00 ? 63  VAL A CA  1 
ATOM 521   C C   . VAL A 1 63  ? 50.686  91.082  155.125 1.00 10.00 ? 63  VAL A C   1 
ATOM 522   O O   . VAL A 1 63  ? 50.891  91.659  156.196 1.00 10.00 ? 63  VAL A O   1 
ATOM 523   C CB  . VAL A 1 63  ? 48.570  92.242  154.317 1.00 10.00 ? 63  VAL A CB  1 
ATOM 524   C CG1 . VAL A 1 63  ? 47.743  92.340  153.015 1.00 10.00 ? 63  VAL A CG1 1 
ATOM 525   C CG2 . VAL A 1 63  ? 47.921  91.258  155.362 1.00 10.00 ? 63  VAL A CG2 1 
ATOM 526   N N   . ARG A 1 64  ? 51.050  89.823  154.895 1.00 10.00 ? 64  ARG A N   1 
ATOM 527   C CA  . ARG A 1 64  ? 51.690  88.981  155.898 1.00 10.00 ? 64  ARG A CA  1 
ATOM 528   C C   . ARG A 1 64  ? 53.194  89.174  155.764 1.00 10.00 ? 64  ARG A C   1 
ATOM 529   O O   . ARG A 1 64  ? 53.971  88.755  156.622 1.00 10.00 ? 64  ARG A O   1 
ATOM 530   C CB  . ARG A 1 64  ? 51.339  87.508  155.641 1.00 10.00 ? 64  ARG A CB  1 
ATOM 531   C CG  . ARG A 1 64  ? 50.060  86.971  156.300 1.00 10.00 ? 64  ARG A CG  1 
ATOM 532   C CD  . ARG A 1 64  ? 49.750  85.573  155.767 1.00 10.00 ? 64  ARG A CD  1 
ATOM 533   N NE  . ARG A 1 64  ? 48.848  84.817  156.631 1.00 10.00 ? 64  ARG A NE  1 
ATOM 534   C CZ  . ARG A 1 64  ? 47.521  84.860  156.535 1.00 10.00 ? 64  ARG A CZ  1 
ATOM 535   N NH1 . ARG A 1 64  ? 46.948  85.626  155.613 1.00 10.00 ? 64  ARG A NH1 1 
ATOM 536   N NH2 . ARG A 1 64  ? 46.765  84.143  157.357 1.00 10.00 ? 64  ARG A NH2 1 
ATOM 537   N N   . LEU A 1 65  ? 53.598  89.824  154.678 1.00 10.00 ? 65  LEU A N   1 
ATOM 538   C CA  . LEU A 1 65  ? 55.006  90.048  154.431 1.00 10.00 ? 65  LEU A CA  1 
ATOM 539   C C   . LEU A 1 65  ? 55.478  91.435  154.867 1.00 10.00 ? 65  LEU A C   1 
ATOM 540   O O   . LEU A 1 65  ? 56.649  91.779  154.715 1.00 10.00 ? 65  LEU A O   1 
ATOM 541   C CB  . LEU A 1 65  ? 55.277  89.775  152.955 1.00 10.00 ? 65  LEU A CB  1 
ATOM 542   C CG  . LEU A 1 65  ? 54.707  88.396  152.605 1.00 10.00 ? 65  LEU A CG  1 
ATOM 543   C CD1 . LEU A 1 65  ? 54.900  88.123  151.136 1.00 10.00 ? 65  LEU A CD1 1 
ATOM 544   C CD2 . LEU A 1 65  ? 55.387  87.326  153.446 1.00 10.00 ? 65  LEU A CD2 1 
ATOM 545   N N   . ARG A 1 66  ? 54.559  92.225  155.414 1.00 10.00 ? 66  ARG A N   1 
ATOM 546   C CA  . ARG A 1 66  ? 54.894  93.561  155.930 1.00 10.00 ? 66  ARG A CA  1 
ATOM 547   C C   . ARG A 1 66  ? 55.805  93.362  157.142 1.00 10.00 ? 66  ARG A C   1 
ATOM 548   O O   . ARG A 1 66  ? 55.697  92.348  157.832 1.00 10.00 ? 66  ARG A O   1 
ATOM 549   C CB  . ARG A 1 66  ? 53.622  94.327  156.333 1.00 10.00 ? 66  ARG A CB  1 
ATOM 550   C CG  . ARG A 1 66  ? 52.966  93.852  157.628 1.00 10.00 ? 66  ARG A CG  1 
ATOM 551   C CD  . ARG A 1 66  ? 52.791  92.331  157.608 1.00 10.00 ? 66  ARG A CD  1 
ATOM 552   N NE  . ARG A 1 66  ? 53.005  91.719  158.925 1.00 10.00 ? 66  ARG A NE  1 
ATOM 553   C CZ  . ARG A 1 66  ? 52.599  90.499  159.270 1.00 10.00 ? 66  ARG A CZ  1 
ATOM 554   N NH1 . ARG A 1 66  ? 51.941  89.741  158.405 1.00 10.00 ? 66  ARG A NH1 1 
ATOM 555   N NH2 . ARG A 1 66  ? 52.869  90.027  160.479 1.00 10.00 ? 66  ARG A NH2 1 
ATOM 556   N N   . TRP A 1 67  ? 56.687  94.326  157.404 1.00 10.00 ? 67  TRP A N   1 
ATOM 557   C CA  . TRP A 1 67  ? 57.648  94.223  158.501 1.00 10.00 ? 67  TRP A CA  1 
ATOM 558   C C   . TRP A 1 67  ? 57.855  95.453  159.367 1.00 10.00 ? 67  TRP A C   1 
ATOM 559   O O   . TRP A 1 67  ? 57.265  96.498  159.131 1.00 10.00 ? 67  TRP A O   1 
ATOM 560   C CB  . TRP A 1 67  ? 59.018  93.831  157.948 1.00 10.00 ? 67  TRP A CB  1 
ATOM 561   C CG  . TRP A 1 67  ? 59.100  92.440  157.432 1.00 10.00 ? 67  TRP A CG  1 
ATOM 562   C CD1 . TRP A 1 67  ? 59.792  92.017  156.339 1.00 10.00 ? 67  TRP A CD1 1 
ATOM 563   C CD2 . TRP A 1 67  ? 58.493  91.275  158.001 1.00 10.00 ? 67  TRP A CD2 1 
ATOM 564   N NE1 . TRP A 1 67  ? 59.657  90.658  156.190 1.00 10.00 ? 67  TRP A NE1 1 
ATOM 565   C CE2 . TRP A 1 67  ? 58.863  90.178  157.197 1.00 10.00 ? 67  TRP A CE2 1 
ATOM 566   C CE3 . TRP A 1 67  ? 57.670  91.053  159.112 1.00 10.00 ? 67  TRP A CE3 1 
ATOM 567   C CZ2 . TRP A 1 67  ? 58.440  88.876  157.467 1.00 10.00 ? 67  TRP A CZ2 1 
ATOM 568   C CZ3 . TRP A 1 67  ? 57.249  89.758  159.382 1.00 10.00 ? 67  TRP A CZ3 1 
ATOM 569   C CH2 . TRP A 1 67  ? 57.635  88.687  158.561 1.00 10.00 ? 67  TRP A CH2 1 
ATOM 570   N N   . ASN A 1 68  ? 58.730  95.309  160.365 1.00 10.00 ? 68  ASN A N   1 
ATOM 571   C CA  . ASN A 1 68  ? 59.073  96.396  161.273 1.00 10.00 ? 68  ASN A CA  1 
ATOM 572   C C   . ASN A 1 68  ? 60.624  96.534  161.203 1.00 10.00 ? 68  ASN A C   1 
ATOM 573   O O   . ASN A 1 68  ? 61.252  95.978  160.292 1.00 10.00 ? 68  ASN A O   1 
ATOM 574   C CB  . ASN A 1 68  ? 58.458  96.085  162.678 1.00 10.00 ? 68  ASN A CB  1 
ATOM 575   C CG  . ASN A 1 68  ? 59.470  95.604  163.713 1.00 10.00 ? 68  ASN A CG  1 
ATOM 576   O OD1 . ASN A 1 68  ? 60.393  94.830  163.416 1.00 10.00 ? 68  ASN A OD1 1 
ATOM 577   N ND2 . ASN A 1 68  ? 59.275  96.043  164.957 1.00 10.00 ? 68  ASN A ND2 1 
ATOM 578   N N   . PRO A 1 69  ? 61.253  97.318  162.096 1.00 10.00 ? 69  PRO A N   1 
ATOM 579   C CA  . PRO A 1 69  ? 62.714  97.501  162.094 1.00 10.00 ? 69  PRO A CA  1 
ATOM 580   C C   . PRO A 1 69  ? 63.601  96.234  162.083 1.00 10.00 ? 69  PRO A C   1 
ATOM 581   O O   . PRO A 1 69  ? 64.826  96.338  161.961 1.00 10.00 ? 69  PRO A O   1 
ATOM 582   C CB  . PRO A 1 69  ? 62.951  98.367  163.349 1.00 10.00 ? 69  PRO A CB  1 
ATOM 583   C CG  . PRO A 1 69  ? 61.755  99.242  163.382 1.00 10.00 ? 69  PRO A CG  1 
ATOM 584   C CD  . PRO A 1 69  ? 60.625  98.283  163.034 1.00 10.00 ? 69  PRO A CD  1 
ATOM 585   N N   . ALA A 1 70  ? 62.994  95.048  162.164 1.00 10.00 ? 70  ALA A N   1 
ATOM 586   C CA  . ALA A 1 70  ? 63.757  93.806  162.219 1.00 10.00 ? 70  ALA A CA  1 
ATOM 587   C C   . ALA A 1 70  ? 63.658  92.946  160.963 1.00 10.00 ? 70  ALA A C   1 
ATOM 588   O O   . ALA A 1 70  ? 63.936  91.748  160.997 1.00 10.00 ? 70  ALA A O   1 
ATOM 589   C CB  . ALA A 1 70  ? 63.307  93.017  163.417 1.00 10.00 ? 70  ALA A CB  1 
ATOM 590   N N   . ASP A 1 71  ? 63.275  93.569  159.855 1.00 10.00 ? 71  ASP A N   1 
ATOM 591   C CA  . ASP A 1 71  ? 63.118  92.871  158.558 1.00 10.00 ? 71  ASP A CA  1 
ATOM 592   C C   . ASP A 1 71  ? 63.167  93.934  157.483 1.00 10.00 ? 71  ASP A C   1 
ATOM 593   O O   . ASP A 1 71  ? 63.939  93.850  156.529 1.00 10.00 ? 71  ASP A O   1 
ATOM 594   C CB  . ASP A 1 71  ? 61.788  92.128  158.484 1.00 10.00 ? 71  ASP A CB  1 
ATOM 595   C CG  . ASP A 1 71  ? 61.867  90.898  157.604 1.00 10.00 ? 71  ASP A CG  1 
ATOM 596   O OD1 . ASP A 1 71  ? 62.223  91.041  156.416 1.00 10.00 ? 71  ASP A OD1 1 
ATOM 597   O OD2 . ASP A 1 71  ? 61.572  89.790  158.097 1.00 10.00 ? 71  ASP A OD2 1 
ATOM 598   N N   . TYR A 1 72  ? 62.387  94.999  157.679 1.00 10.00 ? 72  TYR A N   1 
ATOM 599   C CA  . TYR A 1 72  ? 62.429  96.078  156.703 1.00 10.00 ? 72  TYR A CA  1 
ATOM 600   C C   . TYR A 1 72  ? 63.532  97.013  157.197 1.00 10.00 ? 72  TYR A C   1 
ATOM 601   O O   . TYR A 1 72  ? 64.311  97.517  156.399 1.00 10.00 ? 72  TYR A O   1 
ATOM 602   C CB  . TYR A 1 72  ? 61.040  96.760  156.535 1.00 10.00 ? 72  TYR A CB  1 
ATOM 603   C CG  . TYR A 1 72  ? 60.898  98.223  156.952 1.00 10.00 ? 72  TYR A CG  1 
ATOM 604   C CD1 . TYR A 1 72  ? 61.948  99.129  156.794 1.00 10.00 ? 72  TYR A CD1 1 
ATOM 605   C CD2 . TYR A 1 72  ? 59.721  98.670  157.574 1.00 10.00 ? 72  TYR A CD2 1 
ATOM 606   C CE1 . TYR A 1 72  ? 61.844  100.416 157.270 1.00 10.00 ? 72  TYR A CE1 1 
ATOM 607   C CE2 . TYR A 1 72  ? 59.604  99.952  158.043 1.00 10.00 ? 72  TYR A CE2 1 
ATOM 608   C CZ  . TYR A 1 72  ? 60.678  100.822 157.905 1.00 10.00 ? 72  TYR A CZ  1 
ATOM 609   O OH  . TYR A 1 72  ? 60.654  102.059 158.504 1.00 10.00 ? 72  TYR A OH  1 
ATOM 610   N N   . GLY A 1 73  ? 63.617  97.212  158.514 1.00 10.00 ? 73  GLY A N   1 
ATOM 611   C CA  . GLY A 1 73  ? 64.659  98.055  159.070 1.00 10.00 ? 73  GLY A CA  1 
ATOM 612   C C   . GLY A 1 73  ? 66.035  97.490  158.744 1.00 10.00 ? 73  GLY A C   1 
ATOM 613   O O   . GLY A 1 73  ? 67.026  98.219  158.665 1.00 10.00 ? 73  GLY A O   1 
ATOM 614   N N   . GLY A 1 74  ? 66.097  96.177  158.534 1.00 10.00 ? 74  GLY A N   1 
ATOM 615   C CA  . GLY A 1 74  ? 67.361  95.535  158.222 1.00 10.00 ? 74  GLY A CA  1 
ATOM 616   C C   . GLY A 1 74  ? 67.901  96.032  156.900 1.00 10.00 ? 74  GLY A C   1 
ATOM 617   O O   . GLY A 1 74  ? 69.044  96.479  156.812 1.00 10.00 ? 74  GLY A O   1 
ATOM 618   N N   . ILE A 1 75  ? 67.072  95.952  155.865 1.00 10.00 ? 75  ILE A N   1 
ATOM 619   C CA  . ILE A 1 75  ? 67.469  96.415  154.534 1.00 10.00 ? 75  ILE A CA  1 
ATOM 620   C C   . ILE A 1 75  ? 66.258  96.604  153.617 1.00 10.00 ? 75  ILE A C   1 
ATOM 621   O O   . ILE A 1 75  ? 65.910  95.722  152.830 1.00 10.00 ? 75  ILE A O   1 
ATOM 622   C CB  . ILE A 1 75  ? 68.460  95.422  153.884 1.00 10.00 ? 75  ILE A CB  1 
ATOM 623   C CG1 . ILE A 1 75  ? 68.210  94.011  154.428 1.00 10.00 ? 75  ILE A CG1 1 
ATOM 624   C CG2 . ILE A 1 75  ? 69.890  95.870  154.140 1.00 10.00 ? 75  ILE A CG2 1 
ATOM 625   C CD1 . ILE A 1 75  ? 69.181  92.966  153.925 1.00 10.00 ? 75  ILE A CD1 1 
ATOM 626   N N   . LYS A 1 76  ? 65.601  97.751  153.769 1.00 10.00 ? 76  LYS A N   1 
ATOM 627   C CA  . LYS A 1 76  ? 64.445  98.131  152.960 1.00 10.00 ? 76  LYS A CA  1 
ATOM 628   C C   . LYS A 1 76  ? 63.835  96.981  152.182 1.00 10.00 ? 76  LYS A C   1 
ATOM 629   O O   . LYS A 1 76  ? 63.056  96.186  152.713 1.00 10.00 ? 76  LYS A O   1 
ATOM 630   C CB  . LYS A 1 76  ? 64.847  99.268  151.974 1.00 10.00 ? 76  LYS A CB  1 
ATOM 631   C CG  . LYS A 1 76  ? 63.652  99.885  151.229 1.00 10.00 ? 76  LYS A CG  1 
ATOM 632   C CD  . LYS A 1 76  ? 64.038  100.674 149.971 1.00 10.00 ? 76  LYS A CD  1 
ATOM 633   C CE  . LYS A 1 76  ? 62.766  101.048 149.151 1.00 10.00 ? 76  LYS A CE  1 
ATOM 634   N NZ  . LYS A 1 76  ? 62.995  101.525 147.739 1.00 10.00 ? 76  LYS A NZ  1 
ATOM 635   N N   . LYS A 1 77  ? 64.207  96.924  150.912 1.00 10.00 ? 77  LYS A N   1 
ATOM 636   C CA  . LYS A 1 77  ? 63.724  95.888  150.018 1.00 10.00 ? 77  LYS A CA  1 
ATOM 637   C C   . LYS A 1 77  ? 64.755  94.763  149.948 1.00 10.00 ? 77  LYS A C   1 
ATOM 638   O O   . LYS A 1 77  ? 65.957  95.012  149.990 1.00 10.00 ? 77  LYS A O   1 
ATOM 639   C CB  . LYS A 1 77  ? 63.459  96.465  148.615 1.00 10.00 ? 77  LYS A CB  1 
ATOM 640   C CG  . LYS A 1 77  ? 64.679  97.027  147.883 1.00 10.00 ? 77  LYS A CG  1 
ATOM 641   C CD  . LYS A 1 77  ? 64.310  97.473  146.469 1.00 10.00 ? 77  LYS A CD  1 
ATOM 642   C CE  . LYS A 1 77  ? 63.798  96.317  145.624 1.00 10.00 ? 77  LYS A CE  1 
ATOM 643   N NZ  . LYS A 1 77  ? 63.338  96.781  144.287 1.00 10.00 ? 77  LYS A NZ  1 
ATOM 644   N N   . ILE A 1 78  ? 64.282  93.523  149.854 1.00 10.00 ? 78  ILE A N   1 
ATOM 645   C CA  . ILE A 1 78  ? 65.194  92.387  149.782 1.00 10.00 ? 78  ILE A CA  1 
ATOM 646   C C   . ILE A 1 78  ? 64.743  91.268  148.840 1.00 10.00 ? 78  ILE A C   1 
ATOM 647   O O   . ILE A 1 78  ? 63.633  91.293  148.297 1.00 10.00 ? 78  ILE A O   1 
ATOM 648   C CB  . ILE A 1 78  ? 65.467  91.779  151.183 1.00 10.00 ? 78  ILE A CB  1 
ATOM 649   C CG1 . ILE A 1 78  ? 64.152  91.701  151.970 1.00 10.00 ? 78  ILE A CG1 1 
ATOM 650   C CG2 . ILE A 1 78  ? 66.598  92.515  151.856 1.00 10.00 ? 78  ILE A CG2 1 
ATOM 651   C CD1 . ILE A 1 78  ? 64.239  90.770  153.186 1.00 10.00 ? 78  ILE A CD1 1 
ATOM 652   N N   . ARG A 1 79  ? 65.623  90.283  148.675 1.00 10.00 ? 79  ARG A N   1 
ATOM 653   C CA  . ARG A 1 79  ? 65.416  89.138  147.786 1.00 10.00 ? 79  ARG A CA  1 
ATOM 654   C C   . ARG A 1 79  ? 65.049  87.850  148.514 1.00 10.00 ? 79  ARG A C   1 
ATOM 655   O O   . ARG A 1 79  ? 65.879  87.270  149.203 1.00 10.00 ? 79  ARG A O   1 
ATOM 656   C CB  . ARG A 1 79  ? 66.676  88.888  146.953 1.00 10.00 ? 79  ARG A CB  1 
ATOM 657   C CG  . ARG A 1 79  ? 66.516  87.810  145.892 1.00 10.00 ? 79  ARG A CG  1 
ATOM 658   C CD  . ARG A 1 79  ? 67.766  87.675  145.038 1.00 10.00 ? 79  ARG A CD  1 
ATOM 659   N NE  . ARG A 1 79  ? 68.850  88.552  145.469 1.00 10.00 ? 79  ARG A NE  1 
ATOM 660   C CZ  . ARG A 1 79  ? 69.928  88.813  144.736 1.00 10.00 ? 79  ARG A CZ  1 
ATOM 661   N NH1 . ARG A 1 79  ? 70.066  88.263  143.538 1.00 10.00 ? 79  ARG A NH1 1 
ATOM 662   N NH2 . ARG A 1 79  ? 70.869  89.619  145.198 1.00 10.00 ? 79  ARG A NH2 1 
ATOM 663   N N   . LEU A 1 80  ? 63.806  87.403  148.327 1.00 10.00 ? 80  LEU A N   1 
ATOM 664   C CA  . LEU A 1 80  ? 63.276  86.174  148.908 1.00 10.00 ? 80  LEU A CA  1 
ATOM 665   C C   . LEU A 1 80  ? 62.969  85.246  147.729 1.00 10.00 ? 80  LEU A C   1 
ATOM 666   O O   . LEU A 1 80  ? 62.371  85.680  146.750 1.00 10.00 ? 80  LEU A O   1 
ATOM 667   C CB  . LEU A 1 80  ? 61.985  86.479  149.678 1.00 10.00 ? 80  LEU A CB  1 
ATOM 668   C CG  . LEU A 1 80  ? 60.802  87.065  148.891 1.00 10.00 ? 80  LEU A CG  1 
ATOM 669   C CD1 . LEU A 1 80  ? 60.042  85.963  148.170 1.00 10.00 ? 80  LEU A CD1 1 
ATOM 670   C CD2 . LEU A 1 80  ? 59.864  87.772  149.848 1.00 10.00 ? 80  LEU A CD2 1 
ATOM 671   N N   . PRO A 1 81  ? 63.403  83.973  147.790 1.00 10.00 ? 81  PRO A N   1 
ATOM 672   C CA  . PRO A 1 81  ? 63.119  83.065  146.679 1.00 10.00 ? 81  PRO A CA  1 
ATOM 673   C C   . PRO A 1 81  ? 61.653  82.579  146.618 1.00 10.00 ? 81  PRO A C   1 
ATOM 674   O O   . PRO A 1 81  ? 60.976  82.417  147.643 1.00 10.00 ? 81  PRO A O   1 
ATOM 675   C CB  . PRO A 1 81  ? 64.118  81.931  146.920 1.00 10.00 ? 81  PRO A CB  1 
ATOM 676   C CG  . PRO A 1 81  ? 65.257  82.616  147.582 1.00 10.00 ? 81  PRO A CG  1 
ATOM 677   C CD  . PRO A 1 81  ? 64.525  83.441  148.589 1.00 10.00 ? 81  PRO A CD  1 
ATOM 678   N N   . SER A 1 82  ? 61.176  82.334  145.401 1.00 10.00 ? 82  SER A N   1 
ATOM 679   C CA  . SER A 1 82  ? 59.794  81.884  145.137 1.00 10.00 ? 82  SER A CA  1 
ATOM 680   C C   . SER A 1 82  ? 59.127  80.918  146.090 1.00 10.00 ? 82  SER A C   1 
ATOM 681   O O   . SER A 1 82  ? 58.280  81.316  146.875 1.00 10.00 ? 82  SER A O   1 
ATOM 682   C CB  . SER A 1 82  ? 59.673  81.262  143.752 1.00 10.00 ? 82  SER A CB  1 
ATOM 683   O OG  . SER A 1 82  ? 58.385  80.670  143.620 1.00 10.00 ? 82  SER A OG  1 
ATOM 684   N N   . ASP A 1 83  ? 59.500  79.651  145.958 1.00 10.00 ? 83  ASP A N   1 
ATOM 685   C CA  . ASP A 1 83  ? 58.986  78.538  146.770 1.00 10.00 ? 83  ASP A CA  1 
ATOM 686   C C   . ASP A 1 83  ? 57.832  78.938  147.700 1.00 10.00 ? 83  ASP A C   1 
ATOM 687   O O   . ASP A 1 83  ? 56.681  78.541  147.507 1.00 10.00 ? 83  ASP A O   1 
ATOM 688   C CB  . ASP A 1 83  ? 60.128  77.889  147.617 1.00 10.00 ? 83  ASP A CB  1 
ATOM 689   C CG  . ASP A 1 83  ? 61.392  77.518  146.788 1.00 10.00 ? 83  ASP A CG  1 
ATOM 690   O OD1 . ASP A 1 83  ? 61.267  77.049  145.637 1.00 10.00 ? 83  ASP A OD1 1 
ATOM 691   O OD2 . ASP A 1 83  ? 62.517  77.682  147.310 1.00 10.00 ? 83  ASP A OD2 1 
ATOM 692   N N   . ASP A 1 84  ? 58.173  79.710  148.731 1.00 10.00 ? 84  ASP A N   1 
ATOM 693   C CA  . ASP A 1 84  ? 57.222  80.210  149.727 1.00 10.00 ? 84  ASP A CA  1 
ATOM 694   C C   . ASP A 1 84  ? 56.009  80.895  149.133 1.00 10.00 ? 84  ASP A C   1 
ATOM 695   O O   . ASP A 1 84  ? 55.059  81.183  149.848 1.00 10.00 ? 84  ASP A O   1 
ATOM 696   C CB  . ASP A 1 84  ? 57.890  81.232  150.658 1.00 10.00 ? 84  ASP A CB  1 
ATOM 697   C CG  . ASP A 1 84  ? 58.988  80.633  151.471 1.00 10.00 ? 84  ASP A CG  1 
ATOM 698   O OD1 . ASP A 1 84  ? 59.113  81.032  152.648 1.00 10.00 ? 84  ASP A OD1 1 
ATOM 699   O OD2 . ASP A 1 84  ? 59.725  79.768  150.934 1.00 10.00 ? 84  ASP A OD2 1 
ATOM 700   N N   . VAL A 1 85  ? 56.051  81.162  147.835 1.00 10.00 ? 85  VAL A N   1 
ATOM 701   C CA  . VAL A 1 85  ? 54.973  81.869  147.162 1.00 10.00 ? 85  VAL A CA  1 
ATOM 702   C C   . VAL A 1 85  ? 53.946  81.039  146.407 1.00 10.00 ? 85  VAL A C   1 
ATOM 703   O O   . VAL A 1 85  ? 54.263  80.006  145.811 1.00 10.00 ? 85  VAL A O   1 
ATOM 704   C CB  . VAL A 1 85  ? 55.542  82.898  146.165 1.00 10.00 ? 85  VAL A CB  1 
ATOM 705   C CG1 . VAL A 1 85  ? 54.399  83.574  145.430 1.00 10.00 ? 85  VAL A CG1 1 
ATOM 706   C CG2 . VAL A 1 85  ? 56.452  83.909  146.893 1.00 10.00 ? 85  VAL A CG2 1 
ATOM 707   N N   . TRP A 1 86  ? 52.712  81.533  146.443 1.00 10.00 ? 86  TRP A N   1 
ATOM 708   C CA  . TRP A 1 86  ? 51.586  80.950  145.758 1.00 10.00 ? 86  TRP A CA  1 
ATOM 709   C C   . TRP A 1 86  ? 51.583  81.469  144.324 1.00 10.00 ? 86  TRP A C   1 
ATOM 710   O O   . TRP A 1 86  ? 51.170  82.592  144.063 1.00 10.00 ? 86  TRP A O   1 
ATOM 711   C CB  . TRP A 1 86  ? 50.305  81.353  146.487 1.00 10.00 ? 86  TRP A CB  1 
ATOM 712   C CG  . TRP A 1 86  ? 49.044  80.981  145.794 1.00 10.00 ? 86  TRP A CG  1 
ATOM 713   C CD1 . TRP A 1 86  ? 48.593  79.722  145.520 1.00 10.00 ? 86  TRP A CD1 1 
ATOM 714   C CD2 . TRP A 1 86  ? 48.046  81.883  145.305 1.00 10.00 ? 86  TRP A CD2 1 
ATOM 715   N NE1 . TRP A 1 86  ? 47.372  79.784  144.891 1.00 10.00 ? 86  TRP A NE1 1 
ATOM 716   C CE2 . TRP A 1 86  ? 47.013  81.099  144.746 1.00 10.00 ? 86  TRP A CE2 1 
ATOM 717   C CE3 . TRP A 1 86  ? 47.924  83.279  145.286 1.00 10.00 ? 86  TRP A CE3 1 
ATOM 718   C CZ2 . TRP A 1 86  ? 45.868  81.667  144.172 1.00 10.00 ? 86  TRP A CZ2 1 
ATOM 719   C CZ3 . TRP A 1 86  ? 46.788  83.843  144.715 1.00 10.00 ? 86  TRP A CZ3 1 
ATOM 720   C CH2 . TRP A 1 86  ? 45.775  83.036  144.166 1.00 10.00 ? 86  TRP A CH2 1 
ATOM 721   N N   . LEU A 1 87  ? 52.032  80.610  143.420 1.00 10.00 ? 87  LEU A N   1 
ATOM 722   C CA  . LEU A 1 87  ? 52.185  80.838  141.991 1.00 10.00 ? 87  LEU A CA  1 
ATOM 723   C C   . LEU A 1 87  ? 50.924  80.665  141.141 1.00 10.00 ? 87  LEU A C   1 
ATOM 724   O O   . LEU A 1 87  ? 50.456  79.551  140.976 1.00 10.00 ? 87  LEU A O   1 
ATOM 725   C CB  . LEU A 1 87  ? 53.260  79.864  141.483 1.00 10.00 ? 87  LEU A CB  1 
ATOM 726   C CG  . LEU A 1 87  ? 53.432  78.504  142.191 1.00 10.00 ? 87  LEU A CG  1 
ATOM 727   C CD1 . LEU A 1 87  ? 54.579  78.594  143.142 1.00 10.00 ? 87  LEU A CD1 1 
ATOM 728   C CD2 . LEU A 1 87  ? 52.171  78.074  142.913 1.00 10.00 ? 87  LEU A CD2 1 
ATOM 729   N N   . PRO A 1 88  ? 50.364  81.755  140.578 1.00 10.00 ? 88  PRO A N   1 
ATOM 730   C CA  . PRO A 1 88  ? 49.159  81.545  139.759 1.00 10.00 ? 88  PRO A CA  1 
ATOM 731   C C   . PRO A 1 88  ? 49.428  80.599  138.593 1.00 10.00 ? 88  PRO A C   1 
ATOM 732   O O   . PRO A 1 88  ? 50.426  80.725  137.880 1.00 10.00 ? 88  PRO A O   1 
ATOM 733   C CB  . PRO A 1 88  ? 48.805  82.959  139.303 1.00 10.00 ? 88  PRO A CB  1 
ATOM 734   C CG  . PRO A 1 88  ? 50.148  83.635  139.237 1.00 10.00 ? 88  PRO A CG  1 
ATOM 735   C CD  . PRO A 1 88  ? 50.818  83.154  140.504 1.00 10.00 ? 88  PRO A CD  1 
ATOM 736   N N   . ASP A 1 89  ? 48.538  79.630  138.449 1.00 10.00 ? 89  ASP A N   1 
ATOM 737   C CA  . ASP A 1 89  ? 48.645  78.722  137.328 1.00 10.00 ? 89  ASP A CA  1 
ATOM 738   C C   . ASP A 1 89  ? 48.321  79.427  136.030 1.00 10.00 ? 89  ASP A C   1 
ATOM 739   O O   . ASP A 1 89  ? 47.246  79.282  135.488 1.00 10.00 ? 89  ASP A O   1 
ATOM 740   C CB  . ASP A 1 89  ? 47.655  77.580  137.446 1.00 10.00 ? 89  ASP A CB  1 
ATOM 741   C CG  . ASP A 1 89  ? 46.273  78.121  137.738 1.00 10.00 ? 89  ASP A CG  1 
ATOM 742   O OD1 . ASP A 1 89  ? 45.958  79.229  137.248 1.00 10.00 ? 89  ASP A OD1 1 
ATOM 743   O OD2 . ASP A 1 89  ? 45.500  77.440  138.438 1.00 10.00 ? 89  ASP A OD2 1 
ATOM 744   N N   . LEU A 1 90  ? 49.210  80.343  135.566 1.00 10.00 ? 90  LEU A N   1 
ATOM 745   C CA  . LEU A 1 90  ? 49.041  81.145  134.335 1.00 10.00 ? 90  LEU A CA  1 
ATOM 746   C C   . LEU A 1 90  ? 48.852  80.199  133.144 1.00 10.00 ? 90  LEU A C   1 
ATOM 747   O O   . LEU A 1 90  ? 49.503  79.160  133.102 1.00 10.00 ? 90  LEU A O   1 
ATOM 748   C CB  . LEU A 1 90  ? 50.305  82.000  134.066 1.00 10.00 ? 90  LEU A CB  1 
ATOM 749   C CG  . LEU A 1 90  ? 51.013  82.806  135.176 1.00 10.00 ? 90  LEU A CG  1 
ATOM 750   C CD1 . LEU A 1 90  ? 52.474  82.949  134.848 1.00 10.00 ? 90  LEU A CD1 1 
ATOM 751   C CD2 . LEU A 1 90  ? 50.346  84.166  135.392 1.00 10.00 ? 90  LEU A CD2 1 
ATOM 752   N N   . VAL A 1 91  ? 47.994  80.553  132.179 1.00 10.00 ? 91  VAL A N   1 
ATOM 753   C CA  . VAL A 1 91  ? 47.767  79.708  131.004 1.00 10.00 ? 91  VAL A CA  1 
ATOM 754   C C   . VAL A 1 91  ? 47.202  80.415  129.787 1.00 10.00 ? 91  VAL A C   1 
ATOM 755   O O   . VAL A 1 91  ? 46.199  81.095  129.892 1.00 10.00 ? 91  VAL A O   1 
ATOM 756   C CB  . VAL A 1 91  ? 46.820  78.508  131.343 1.00 10.00 ? 91  VAL A CB  1 
ATOM 757   C CG1 . VAL A 1 91  ? 46.294  77.868  130.063 1.00 10.00 ? 91  VAL A CG1 1 
ATOM 758   C CG2 . VAL A 1 91  ? 47.566  77.457  132.150 1.00 10.00 ? 91  VAL A CG2 1 
ATOM 759   N N   . LEU A 1 92  ? 47.847  80.227  128.635 1.00 10.00 ? 92  LEU A N   1 
ATOM 760   C CA  . LEU A 1 92  ? 47.418  80.834  127.391 1.00 10.00 ? 92  LEU A CA  1 
ATOM 761   C C   . LEU A 1 92  ? 46.229  79.969  126.913 1.00 10.00 ? 92  LEU A C   1 
ATOM 762   O O   . LEU A 1 92  ? 46.405  78.804  126.537 1.00 10.00 ? 92  LEU A O   1 
ATOM 763   C CB  . LEU A 1 92  ? 48.607  80.842  126.399 1.00 10.00 ? 92  LEU A CB  1 
ATOM 764   C CG  . LEU A 1 92  ? 50.082  81.289  126.686 1.00 10.00 ? 92  LEU A CG  1 
ATOM 765   C CD1 . LEU A 1 92  ? 50.368  82.653  126.108 1.00 10.00 ? 92  LEU A CD1 1 
ATOM 766   C CD2 . LEU A 1 92  ? 50.401  81.227  128.148 1.00 10.00 ? 92  LEU A CD2 1 
ATOM 767   N N   . TYR A 1 93  ? 45.017  80.525  126.986 1.00 10.00 ? 93  TYR A N   1 
ATOM 768   C CA  . TYR A 1 93  ? 43.764  79.837  126.635 1.00 10.00 ? 93  TYR A CA  1 
ATOM 769   C C   . TYR A 1 93  ? 43.779  78.866  125.453 1.00 10.00 ? 93  TYR A C   1 
ATOM 770   O O   . TYR A 1 93  ? 43.917  77.658  125.648 1.00 10.00 ? 93  TYR A O   1 
ATOM 771   C CB  . TYR A 1 93  ? 42.639  80.865  126.448 1.00 10.00 ? 93  TYR A CB  1 
ATOM 772   C CG  . TYR A 1 93  ? 42.370  81.679  127.695 1.00 10.00 ? 93  TYR A CG  1 
ATOM 773   C CD1 . TYR A 1 93  ? 41.277  82.536  127.777 1.00 10.00 ? 93  TYR A CD1 1 
ATOM 774   C CD2 . TYR A 1 93  ? 43.245  81.626  128.780 1.00 10.00 ? 93  TYR A CD2 1 
ATOM 775   C CE1 . TYR A 1 93  ? 41.073  83.324  128.901 1.00 10.00 ? 93  TYR A CE1 1 
ATOM 776   C CE2 . TYR A 1 93  ? 43.046  82.398  129.901 1.00 10.00 ? 93  TYR A CE2 1 
ATOM 777   C CZ  . TYR A 1 93  ? 41.965  83.245  129.961 1.00 10.00 ? 93  TYR A CZ  1 
ATOM 778   O OH  . TYR A 1 93  ? 41.778  83.986  131.104 1.00 10.00 ? 93  TYR A OH  1 
ATOM 779   N N   . ASN A 1 94  ? 43.627  79.383  124.238 1.00 10.00 ? 94  ASN A N   1 
ATOM 780   C CA  . ASN A 1 94  ? 43.638  78.554  123.040 1.00 10.00 ? 94  ASN A CA  1 
ATOM 781   C C   . ASN A 1 94  ? 45.061  78.233  122.604 1.00 10.00 ? 94  ASN A C   1 
ATOM 782   O O   . ASN A 1 94  ? 45.290  77.657  121.544 1.00 10.00 ? 94  ASN A O   1 
ATOM 783   C CB  . ASN A 1 94  ? 42.875  79.242  121.908 1.00 10.00 ? 94  ASN A CB  1 
ATOM 784   C CG  . ASN A 1 94  ? 43.577  80.487  121.405 1.00 10.00 ? 94  ASN A CG  1 
ATOM 785   O OD1 . ASN A 1 94  ? 42.992  81.570  121.373 1.00 10.00 ? 94  ASN A OD1 1 
ATOM 786   N ND2 . ASN A 1 94  ? 44.836  80.338  121.011 1.00 10.00 ? 94  ASN A ND2 1 
ATOM 787   N N   . ASN A 1 95  ? 46.011  78.602  123.456 1.00 10.00 ? 95  ASN A N   1 
ATOM 788   C CA  . ASN A 1 95  ? 47.424  78.391  123.200 1.00 10.00 ? 95  ASN A CA  1 
ATOM 789   C C   . ASN A 1 95  ? 47.907  77.443  124.307 1.00 10.00 ? 95  ASN A C   1 
ATOM 790   O O   . ASN A 1 95  ? 47.290  76.396  124.536 1.00 10.00 ? 95  ASN A O   1 
ATOM 791   C CB  . ASN A 1 95  ? 48.146  79.754  123.241 1.00 10.00 ? 95  ASN A CB  1 
ATOM 792   C CG  . ASN A 1 95  ? 47.178  80.949  123.044 1.00 10.00 ? 95  ASN A CG  1 
ATOM 793   O OD1 . ASN A 1 95  ? 47.155  81.573  121.979 1.00 10.00 ? 95  ASN A OD1 1 
ATOM 794   N ND2 . ASN A 1 95  ? 46.407  81.274  124.075 1.00 10.00 ? 95  ASN A ND2 1 
ATOM 795   N N   . ALA A 1 96  ? 49.002  77.781  124.981 1.00 10.00 ? 96  ALA A N   1 
ATOM 796   C CA  . ALA A 1 96  ? 49.484  76.936  126.090 1.00 10.00 ? 96  ALA A CA  1 
ATOM 797   C C   . ALA A 1 96  ? 50.232  75.667  125.714 1.00 10.00 ? 96  ALA A C   1 
ATOM 798   O O   . ALA A 1 96  ? 50.563  74.870  126.584 1.00 10.00 ? 96  ALA A O   1 
ATOM 799   C CB  . ALA A 1 96  ? 48.301  76.558  126.988 1.00 10.00 ? 96  ALA A CB  1 
ATOM 800   N N   . ASP A 1 97  ? 50.482  75.454  124.424 1.00 10.00 ? 97  ASP A N   1 
ATOM 801   C CA  . ASP A 1 97  ? 51.149  74.236  123.964 1.00 10.00 ? 97  ASP A CA  1 
ATOM 802   C C   . ASP A 1 97  ? 52.376  73.792  124.772 1.00 10.00 ? 97  ASP A C   1 
ATOM 803   O O   . ASP A 1 97  ? 52.803  72.640  124.668 1.00 10.00 ? 97  ASP A O   1 
ATOM 804   C CB  . ASP A 1 97  ? 51.512  74.367  122.469 1.00 10.00 ? 97  ASP A CB  1 
ATOM 805   C CG  . ASP A 1 97  ? 51.696  73.017  121.785 1.00 10.00 ? 97  ASP A CG  1 
ATOM 806   O OD1 . ASP A 1 97  ? 51.921  72.014  122.485 1.00 10.00 ? 97  ASP A OD1 1 
ATOM 807   O OD2 . ASP A 1 97  ? 51.606  72.975  120.547 1.00 10.00 ? 97  ASP A OD2 1 
ATOM 808   N N   . GLY A 1 98  ? 52.929  74.676  125.597 1.00 10.00 ? 98  GLY A N   1 
ATOM 809   C CA  . GLY A 1 98  ? 54.102  74.287  126.359 1.00 10.00 ? 98  GLY A CA  1 
ATOM 810   C C   . GLY A 1 98  ? 54.256  74.918  127.725 1.00 10.00 ? 98  GLY A C   1 
ATOM 811   O O   . GLY A 1 98  ? 53.685  75.972  128.004 1.00 10.00 ? 98  GLY A O   1 
ATOM 812   N N   . ASP A 1 99  ? 55.032  74.260  128.580 1.00 10.00 ? 99  ASP A N   1 
ATOM 813   C CA  . ASP A 1 99  ? 55.282  74.756  129.922 1.00 10.00 ? 99  ASP A CA  1 
ATOM 814   C C   . ASP A 1 99  ? 56.066  76.059  129.845 1.00 10.00 ? 99  ASP A C   1 
ATOM 815   O O   . ASP A 1 99  ? 56.809  76.284  128.893 1.00 10.00 ? 99  ASP A O   1 
ATOM 816   C CB  . ASP A 1 99  ? 56.118  73.752  130.730 1.00 10.00 ? 99  ASP A CB  1 
ATOM 817   C CG  . ASP A 1 99  ? 55.425  72.441  130.938 1.00 10.00 ? 99  ASP A CG  1 
ATOM 818   O OD1 . ASP A 1 99  ? 54.187  72.451  131.107 1.00 10.00 ? 99  ASP A OD1 1 
ATOM 819   O OD2 . ASP A 1 99  ? 56.139  71.411  130.949 1.00 10.00 ? 99  ASP A OD2 1 
ATOM 820   N N   . PHE A 1 100 ? 55.873  76.915  130.843 1.00 10.00 ? 100 PHE A N   1 
ATOM 821   C CA  . PHE A 1 100 ? 56.596  78.172  130.966 1.00 10.00 ? 100 PHE A CA  1 
ATOM 822   C C   . PHE A 1 100 ? 58.040  77.710  131.205 1.00 10.00 ? 100 PHE A C   1 
ATOM 823   O O   . PHE A 1 100 ? 58.258  76.819  132.010 1.00 10.00 ? 100 PHE A O   1 
ATOM 824   C CB  . PHE A 1 100 ? 56.078  78.939  132.184 1.00 10.00 ? 100 PHE A CB  1 
ATOM 825   C CG  . PHE A 1 100 ? 55.200  80.110  131.844 1.00 10.00 ? 100 PHE A CG  1 
ATOM 826   C CD1 . PHE A 1 100 ? 54.502  80.781  132.848 1.00 10.00 ? 100 PHE A CD1 1 
ATOM 827   C CD2 . PHE A 1 100 ? 55.082  80.555  130.528 1.00 10.00 ? 100 PHE A CD2 1 
ATOM 828   C CE1 . PHE A 1 100 ? 53.707  81.862  132.552 1.00 10.00 ? 100 PHE A CE1 1 
ATOM 829   C CE2 . PHE A 1 100 ? 54.283  81.648  130.222 1.00 10.00 ? 100 PHE A CE2 1 
ATOM 830   C CZ  . PHE A 1 100 ? 53.591  82.303  131.241 1.00 10.00 ? 100 PHE A CZ  1 
ATOM 831   N N   . ALA A 1 101 ? 59.006  78.270  130.475 1.00 10.00 ? 101 ALA A N   1 
ATOM 832   C CA  . ALA A 1 101 ? 60.386  77.863  130.661 1.00 10.00 ? 101 ALA A CA  1 
ATOM 833   C C   . ALA A 1 101 ? 61.198  78.906  131.426 1.00 10.00 ? 101 ALA A C   1 
ATOM 834   O O   . ALA A 1 101 ? 61.406  80.011  130.944 1.00 10.00 ? 101 ALA A O   1 
ATOM 835   C CB  . ALA A 1 101 ? 61.028  77.573  129.319 1.00 10.00 ? 101 ALA A CB  1 
ATOM 836   N N   . ILE A 1 102 ? 61.632  78.511  132.632 1.00 10.00 ? 102 ILE A N   1 
ATOM 837   C CA  . ILE A 1 102 ? 62.426  79.287  133.597 1.00 10.00 ? 102 ILE A CA  1 
ATOM 838   C C   . ILE A 1 102 ? 61.606  80.127  134.562 1.00 10.00 ? 102 ILE A C   1 
ATOM 839   O O   . ILE A 1 102 ? 62.068  81.125  135.098 1.00 10.00 ? 102 ILE A O   1 
ATOM 840   C CB  . ILE A 1 102 ? 63.510  80.112  132.910 1.00 10.00 ? 102 ILE A CB  1 
ATOM 841   C CG1 . ILE A 1 102 ? 64.174  79.265  131.811 1.00 10.00 ? 102 ILE A CG1 1 
ATOM 842   C CG2 . ILE A 1 102 ? 64.577  80.449  133.936 1.00 10.00 ? 102 ILE A CG2 1 
ATOM 843   C CD1 . ILE A 1 102 ? 65.198  79.985  130.976 1.00 10.00 ? 102 ILE A CD1 1 
ATOM 844   N N   . VAL A 1 103 ? 60.409  79.611  134.787 1.00 10.00 ? 103 VAL A N   1 
ATOM 845   C CA  . VAL A 1 103 ? 59.412  80.125  135.690 1.00 10.00 ? 103 VAL A CA  1 
ATOM 846   C C   . VAL A 1 103 ? 59.762  79.613  137.090 1.00 10.00 ? 103 VAL A C   1 
ATOM 847   O O   . VAL A 1 103 ? 59.656  80.321  138.110 1.00 10.00 ? 103 VAL A O   1 
ATOM 848   C CB  . VAL A 1 103 ? 58.015  79.566  135.323 1.00 10.00 ? 103 VAL A CB  1 
ATOM 849   C CG1 . VAL A 1 103 ? 57.206  79.181  136.598 1.00 10.00 ? 103 VAL A CG1 1 
ATOM 850   C CG2 . VAL A 1 103 ? 57.271  80.597  134.515 1.00 10.00 ? 103 VAL A CG2 1 
ATOM 851   N N   . HIS A 1 104 ? 60.202  78.369  137.132 1.00 10.00 ? 104 HIS A N   1 
ATOM 852   C CA  . HIS A 1 104 ? 60.545  77.709  138.393 1.00 10.00 ? 104 HIS A CA  1 
ATOM 853   C C   . HIS A 1 104 ? 61.724  78.285  139.182 1.00 10.00 ? 104 HIS A C   1 
ATOM 854   O O   . HIS A 1 104 ? 62.524  79.071  138.669 1.00 10.00 ? 104 HIS A O   1 
ATOM 855   C CB  . HIS A 1 104 ? 60.716  76.160  138.233 1.00 10.00 ? 104 HIS A CB  1 
ATOM 856   C CG  . HIS A 1 104 ? 59.693  75.467  137.365 1.00 10.00 ? 104 HIS A CG  1 
ATOM 857   N ND1 . HIS A 1 104 ? 58.450  75.087  137.829 1.00 10.00 ? 104 HIS A ND1 1 
ATOM 858   C CD2 . HIS A 1 104 ? 59.739  75.067  136.070 1.00 10.00 ? 104 HIS A CD2 1 
ATOM 859   C CE1 . HIS A 1 104 ? 57.776  74.496  136.858 1.00 10.00 ? 104 HIS A CE1 1 
ATOM 860   N NE2 . HIS A 1 104 ? 58.536  74.471  135.780 1.00 10.00 ? 104 HIS A NE2 1 
ATOM 861   N N   . MET A 1 105 ? 61.792  77.891  140.452 1.00 10.00 ? 105 MET A N   1 
ATOM 862   C CA  . MET A 1 105 ? 62.831  78.317  141.398 1.00 10.00 ? 105 MET A CA  1 
ATOM 863   C C   . MET A 1 105 ? 63.619  79.573  141.013 1.00 10.00 ? 105 MET A C   1 
ATOM 864   O O   . MET A 1 105 ? 64.809  79.511  140.705 1.00 10.00 ? 105 MET A O   1 
ATOM 865   C CB  . MET A 1 105 ? 63.810  77.160  141.694 1.00 10.00 ? 105 MET A CB  1 
ATOM 866   C CG  . MET A 1 105 ? 64.730  76.780  140.552 1.00 10.00 ? 105 MET A CG  1 
ATOM 867   S SD  . MET A 1 105 ? 63.798  76.189  139.161 1.00 10.00 ? 105 MET A SD  1 
ATOM 868   C CE  . MET A 1 105 ? 64.899  74.904  138.518 1.00 10.00 ? 105 MET A CE  1 
ATOM 869   N N   . THR A 1 106 ? 62.941  80.715  141.038 1.00 10.00 ? 106 THR A N   1 
ATOM 870   C CA  . THR A 1 106 ? 63.566  81.990  140.719 1.00 10.00 ? 106 THR A CA  1 
ATOM 871   C C   . THR A 1 106 ? 63.322  82.834  141.967 1.00 10.00 ? 106 THR A C   1 
ATOM 872   O O   . THR A 1 106 ? 62.890  82.288  142.981 1.00 10.00 ? 106 THR A O   1 
ATOM 873   C CB  . THR A 1 106 ? 62.925  82.623  139.470 1.00 10.00 ? 106 THR A CB  1 
ATOM 874   O OG1 . THR A 1 106 ? 62.994  81.694  138.374 1.00 10.00 ? 106 THR A OG1 1 
ATOM 875   C CG2 . THR A 1 106 ? 63.682  83.921  139.097 1.00 10.00 ? 106 THR A CG2 1 
ATOM 876   N N   . LYS A 1 107 ? 63.592  84.136  141.956 1.00 10.00 ? 107 LYS A N   1 
ATOM 877   C CA  . LYS A 1 107 ? 63.343  84.842  143.205 1.00 10.00 ? 107 LYS A CA  1 
ATOM 878   C C   . LYS A 1 107 ? 62.393  86.019  143.086 1.00 10.00 ? 107 LYS A C   1 
ATOM 879   O O   . LYS A 1 107 ? 61.939  86.398  141.986 1.00 10.00 ? 107 LYS A O   1 
ATOM 880   C CB  . LYS A 1 107 ? 64.671  85.287  143.832 1.00 10.00 ? 107 LYS A CB  1 
ATOM 881   C CG  . LYS A 1 107 ? 65.603  86.022  142.865 1.00 10.00 ? 107 LYS A CG  1 
ATOM 882   C CD  . LYS A 1 107 ? 67.074  85.701  143.126 1.00 10.00 ? 107 LYS A CD  1 
ATOM 883   C CE  . LYS A 1 107 ? 67.929  85.848  141.872 1.00 10.00 ? 107 LYS A CE  1 
ATOM 884   N NZ  . LYS A 1 107 ? 69.314  86.303  142.185 1.00 10.00 ? 107 LYS A NZ  1 
ATOM 885   N N   . LEU A 1 108 ? 62.057  86.620  144.216 1.00 10.00 ? 108 LEU A N   1 
ATOM 886   C CA  . LEU A 1 108 ? 61.170  87.759  144.120 1.00 10.00 ? 108 LEU A CA  1 
ATOM 887   C C   . LEU A 1 108 ? 61.648  88.823  145.127 1.00 10.00 ? 108 LEU A C   1 
ATOM 888   O O   . LEU A 1 108 ? 62.634  88.618  145.859 1.00 10.00 ? 108 LEU A O   1 
ATOM 889   C CB  . LEU A 1 108 ? 59.678  87.328  144.316 1.00 10.00 ? 108 LEU A CB  1 
ATOM 890   C CG  . LEU A 1 108 ? 59.005  86.000  143.826 1.00 10.00 ? 108 LEU A CG  1 
ATOM 891   C CD1 . LEU A 1 108 ? 57.492  86.173  143.584 1.00 10.00 ? 108 LEU A CD1 1 
ATOM 892   C CD2 . LEU A 1 108 ? 59.630  85.536  142.586 1.00 10.00 ? 108 LEU A CD2 1 
ATOM 893   N N   . LEU A 1 109 ? 60.984  89.951  145.140 1.00 10.00 ? 109 LEU A N   1 
ATOM 894   C CA  . LEU A 1 109 ? 61.393  91.038  146.034 1.00 10.00 ? 109 LEU A CA  1 
ATOM 895   C C   . LEU A 1 109 ? 60.237  91.508  146.920 1.00 10.00 ? 109 LEU A C   1 
ATOM 896   O O   . LEU A 1 109 ? 59.127  91.709  146.439 1.00 10.00 ? 109 LEU A O   1 
ATOM 897   C CB  . LEU A 1 109 ? 61.944  92.221  145.230 1.00 10.00 ? 109 LEU A CB  1 
ATOM 898   C CG  . LEU A 1 109 ? 63.170  91.943  144.358 1.00 10.00 ? 109 LEU A CG  1 
ATOM 899   C CD1 . LEU A 1 109 ? 63.599  93.200  143.616 1.00 10.00 ? 109 LEU A CD1 1 
ATOM 900   C CD2 . LEU A 1 109 ? 64.317  91.403  145.200 1.00 10.00 ? 109 LEU A CD2 1 
ATOM 901   N N   . LEU A 1 110 ? 60.576  91.625  148.164 1.00 10.00 ? 110 LEU A N   1 
ATOM 902   C CA  . LEU A 1 110 ? 59.603  92.052  149.157 1.00 10.00 ? 110 LEU A CA  1 
ATOM 903   C C   . LEU A 1 110 ? 59.980  93.438  149.631 1.00 10.00 ? 110 LEU A C   1 
ATOM 904   O O   . LEU A 1 110 ? 61.143  93.700  149.888 1.00 10.00 ? 110 LEU A O   1 
ATOM 905   C CB  . LEU A 1 110 ? 59.604  91.072  150.335 1.00 10.00 ? 110 LEU A CB  1 
ATOM 906   C CG  . LEU A 1 110 ? 58.806  91.395  151.596 1.00 10.00 ? 110 LEU A CG  1 
ATOM 907   C CD1 . LEU A 1 110 ? 57.448  91.951  151.241 1.00 10.00 ? 110 LEU A CD1 1 
ATOM 908   C CD2 . LEU A 1 110 ? 58.672  90.124  152.417 1.00 10.00 ? 110 LEU A CD2 1 
ATOM 909   N N   . ASP A 1 111 ? 58.990  94.317  149.726 1.00 10.00 ? 111 ASP A N   1 
ATOM 910   C CA  . ASP A 1 111 ? 59.220  95.701  150.150 1.00 10.00 ? 111 ASP A CA  1 
ATOM 911   C C   . ASP A 1 111 ? 59.018  95.866  151.649 1.00 10.00 ? 111 ASP A C   1 
ATOM 912   O O   . ASP A 1 111 ? 58.467  94.986  152.301 1.00 10.00 ? 111 ASP A O   1 
ATOM 913   C CB  . ASP A 1 111 ? 58.265  96.654  149.412 1.00 10.00 ? 111 ASP A CB  1 
ATOM 914   C CG  . ASP A 1 111 ? 58.606  96.809  147.936 1.00 10.00 ? 111 ASP A CG  1 
ATOM 915   O OD1 . ASP A 1 111 ? 58.727  95.779  147.238 1.00 10.00 ? 111 ASP A OD1 1 
ATOM 916   O OD2 . ASP A 1 111 ? 58.746  97.964  147.473 1.00 10.00 ? 111 ASP A OD2 1 
ATOM 917   N N   . TYR A 1 112 ? 59.479  96.990  152.194 1.00 10.00 ? 112 TYR A N   1 
ATOM 918   C CA  . TYR A 1 112 ? 59.307  97.269  153.624 1.00 10.00 ? 112 TYR A CA  1 
ATOM 919   C C   . TYR A 1 112 ? 57.859  97.093  154.076 1.00 10.00 ? 112 TYR A C   1 
ATOM 920   O O   . TYR A 1 112 ? 57.597  96.854  155.256 1.00 10.00 ? 112 TYR A O   1 
ATOM 921   C CB  . TYR A 1 112 ? 59.760  98.696  153.990 1.00 10.00 ? 112 TYR A CB  1 
ATOM 922   C CG  . TYR A 1 112 ? 59.879  99.687  152.853 1.00 10.00 ? 112 TYR A CG  1 
ATOM 923   C CD1 . TYR A 1 112 ? 58.865  99.830  151.910 1.00 10.00 ? 112 TYR A CD1 1 
ATOM 924   C CD2 . TYR A 1 112 ? 61.002  100.501 152.742 1.00 10.00 ? 112 TYR A CD2 1 
ATOM 925   C CE1 . TYR A 1 112 ? 58.973  100.762 150.879 1.00 10.00 ? 112 TYR A CE1 1 
ATOM 926   C CE2 . TYR A 1 112 ? 61.115  101.429 151.725 1.00 10.00 ? 112 TYR A CE2 1 
ATOM 927   C CZ  . TYR A 1 112 ? 60.103  101.557 150.793 1.00 10.00 ? 112 TYR A CZ  1 
ATOM 928   O OH  . TYR A 1 112 ? 60.225  102.467 149.765 1.00 10.00 ? 112 TYR A OH  1 
ATOM 929   N N   . THR A 1 113 ? 56.946  97.211  153.116 1.00 10.00 ? 113 THR A N   1 
ATOM 930   C CA  . THR A 1 113 ? 55.491  97.095  153.300 1.00 10.00 ? 113 THR A CA  1 
ATOM 931   C C   . THR A 1 113 ? 54.926  95.709  153.034 1.00 10.00 ? 113 THR A C   1 
ATOM 932   O O   . THR A 1 113 ? 54.131  95.182  153.805 1.00 10.00 ? 113 THR A O   1 
ATOM 933   C CB  . THR A 1 113 ? 54.732  98.040  152.361 1.00 10.00 ? 113 THR A CB  1 
ATOM 934   O OG1 . THR A 1 113 ? 54.737  99.362  152.910 1.00 10.00 ? 113 THR A OG1 1 
ATOM 935   C CG2 . THR A 1 113 ? 53.289  97.561  152.160 1.00 10.00 ? 113 THR A CG2 1 
ATOM 936   N N   . GLY A 1 114 ? 55.373  95.119  151.937 1.00 10.00 ? 114 GLY A N   1 
ATOM 937   C CA  . GLY A 1 114 ? 54.872  93.808  151.572 1.00 10.00 ? 114 GLY A CA  1 
ATOM 938   C C   . GLY A 1 114 ? 54.817  93.529  150.076 1.00 10.00 ? 114 GLY A C   1 
ATOM 939   O O   . GLY A 1 114 ? 55.212  92.453  149.640 1.00 10.00 ? 114 GLY A O   1 
ATOM 940   N N   . LYS A 1 115 ? 54.313  94.480  149.293 1.00 10.00 ? 115 LYS A N   1 
ATOM 941   C CA  . LYS A 1 115 ? 54.207  94.347  147.832 1.00 10.00 ? 115 LYS A CA  1 
ATOM 942   C C   . LYS A 1 115 ? 55.290  93.416  147.230 1.00 10.00 ? 115 LYS A C   1 
ATOM 943   O O   . LYS A 1 115 ? 56.480  93.594  147.490 1.00 10.00 ? 115 LYS A O   1 
ATOM 944   C CB  . LYS A 1 115 ? 54.307  95.733  147.191 1.00 10.00 ? 115 LYS A CB  1 
ATOM 945   C CG  . LYS A 1 115 ? 54.315  95.717  145.679 1.00 10.00 ? 115 LYS A CG  1 
ATOM 946   C CD  . LYS A 1 115 ? 55.078  96.896  145.116 1.00 10.00 ? 115 LYS A CD  1 
ATOM 947   C CE  . LYS A 1 115 ? 55.321  96.711  143.627 1.00 10.00 ? 115 LYS A CE  1 
ATOM 948   N NZ  . LYS A 1 115 ? 56.155  97.797  143.034 1.00 10.00 ? 115 LYS A NZ  1 
ATOM 949   N N   . ILE A 1 116 ? 54.882  92.382  146.486 1.00 10.00 ? 116 ILE A N   1 
ATOM 950   C CA  . ILE A 1 116 ? 55.880  91.491  145.864 1.00 10.00 ? 116 ILE A CA  1 
ATOM 951   C C   . ILE A 1 116 ? 55.795  91.415  144.348 1.00 10.00 ? 116 ILE A C   1 
ATOM 952   O O   . ILE A 1 116 ? 54.715  91.503  143.767 1.00 10.00 ? 116 ILE A O   1 
ATOM 953   C CB  . ILE A 1 116 ? 55.813  89.989  146.349 1.00 10.00 ? 116 ILE A CB  1 
ATOM 954   C CG1 . ILE A 1 116 ? 54.534  89.735  147.151 1.00 10.00 ? 116 ILE A CG1 1 
ATOM 955   C CG2 . ILE A 1 116 ? 57.095  89.623  147.079 1.00 10.00 ? 116 ILE A CG2 1 
ATOM 956   C CD1 . ILE A 1 116 ? 54.383  88.303  147.652 1.00 10.00 ? 116 ILE A CD1 1 
ATOM 957   N N   . MET A 1 117 ? 56.953  91.272  143.712 1.00 10.00 ? 117 MET A N   1 
ATOM 958   C CA  . MET A 1 117 ? 57.006  91.089  142.261 1.00 10.00 ? 117 MET A CA  1 
ATOM 959   C C   . MET A 1 117 ? 57.700  89.742  142.060 1.00 10.00 ? 117 MET A C   1 
ATOM 960   O O   . MET A 1 117 ? 58.543  89.351  142.866 1.00 10.00 ? 117 MET A O   1 
ATOM 961   C CB  . MET A 1 117 ? 57.796  92.207  141.532 1.00 10.00 ? 117 MET A CB  1 
ATOM 962   C CG  . MET A 1 117 ? 57.930  91.966  139.988 1.00 10.00 ? 117 MET A CG  1 
ATOM 963   S SD  . MET A 1 117 ? 57.910  93.373  138.706 1.00 10.00 ? 117 MET A SD  1 
ATOM 964   C CE  . MET A 1 117 ? 59.687  93.398  138.056 1.00 10.00 ? 117 MET A CE  1 
ATOM 965   N N   . TRP A 1 118 ? 57.284  89.036  141.012 1.00 10.00 ? 118 TRP A N   1 
ATOM 966   C CA  . TRP A 1 118 ? 57.811  87.714  140.576 1.00 10.00 ? 118 TRP A CA  1 
ATOM 967   C C   . TRP A 1 118 ? 57.897  87.943  139.102 1.00 10.00 ? 118 TRP A C   1 
ATOM 968   O O   . TRP A 1 118 ? 56.864  87.978  138.462 1.00 10.00 ? 118 TRP A O   1 
ATOM 969   C CB  . TRP A 1 118 ? 56.831  86.515  140.758 1.00 10.00 ? 118 TRP A CB  1 
ATOM 970   C CG  . TRP A 1 118 ? 57.407  85.087  140.193 1.00 10.00 ? 118 TRP A CG  1 
ATOM 971   C CD1 . TRP A 1 118 ? 58.732  84.778  139.850 1.00 10.00 ? 118 TRP A CD1 1 
ATOM 972   C CD2 . TRP A 1 118 ? 56.691  83.824  140.086 1.00 10.00 ? 118 TRP A CD2 1 
ATOM 973   N NE1 . TRP A 1 118 ? 58.857  83.433  139.560 1.00 10.00 ? 118 TRP A NE1 1 
ATOM 974   C CE2 . TRP A 1 118 ? 57.632  82.831  139.700 1.00 10.00 ? 118 TRP A CE2 1 
ATOM 975   C CE3 . TRP A 1 118 ? 55.354  83.440  140.293 1.00 10.00 ? 118 TRP A CE3 1 
ATOM 976   C CZ2 . TRP A 1 118 ? 57.271  81.506  139.529 1.00 10.00 ? 118 TRP A CZ2 1 
ATOM 977   C CZ3 . TRP A 1 118 ? 55.009  82.127  140.121 1.00 10.00 ? 118 TRP A CZ3 1 
ATOM 978   C CH2 . TRP A 1 118 ? 55.961  81.176  139.746 1.00 10.00 ? 118 TRP A CH2 1 
ATOM 979   N N   . THR A 1 119 ? 59.108  88.128  138.593 1.00 10.00 ? 119 THR A N   1 
ATOM 980   C CA  . THR A 1 119 ? 59.307  88.358  137.172 1.00 10.00 ? 119 THR A CA  1 
ATOM 981   C C   . THR A 1 119 ? 60.407  87.502  136.581 1.00 10.00 ? 119 THR A C   1 
ATOM 982   O O   . THR A 1 119 ? 61.427  88.030  136.151 1.00 10.00 ? 119 THR A O   1 
ATOM 983   C CB  . THR A 1 119 ? 59.661  89.821  136.886 1.00 10.00 ? 119 THR A CB  1 
ATOM 984   O OG1 . THR A 1 119 ? 60.745  90.230  137.730 1.00 10.00 ? 119 THR A OG1 1 
ATOM 985   C CG2 . THR A 1 119 ? 58.469  90.698  137.128 1.00 10.00 ? 119 THR A CG2 1 
ATOM 986   N N   . PRO A 1 120 ? 60.211  86.174  136.545 1.00 10.00 ? 120 PRO A N   1 
ATOM 987   C CA  . PRO A 1 120 ? 61.211  85.254  135.995 1.00 10.00 ? 120 PRO A CA  1 
ATOM 988   C C   . PRO A 1 120 ? 61.279  85.223  134.474 1.00 10.00 ? 120 PRO A C   1 
ATOM 989   O O   . PRO A 1 120 ? 60.251  85.134  133.789 1.00 10.00 ? 120 PRO A O   1 
ATOM 990   C CB  . PRO A 1 120 ? 60.816  83.923  136.610 1.00 10.00 ? 120 PRO A CB  1 
ATOM 991   C CG  . PRO A 1 120 ? 59.350  84.066  136.819 1.00 10.00 ? 120 PRO A CG  1 
ATOM 992   C CD  . PRO A 1 120 ? 59.193  85.447  137.311 1.00 10.00 ? 120 PRO A CD  1 
ATOM 993   N N   . PRO A 1 121 ? 62.507  85.277  133.932 1.00 10.00 ? 121 PRO A N   1 
ATOM 994   C CA  . PRO A 1 121 ? 62.839  85.277  132.511 1.00 10.00 ? 121 PRO A CA  1 
ATOM 995   C C   . PRO A 1 121 ? 62.383  84.033  131.815 1.00 10.00 ? 121 PRO A C   1 
ATOM 996   O O   . PRO A 1 121 ? 63.111  82.999  131.836 1.00 10.00 ? 121 PRO A O   1 
ATOM 997   C CB  . PRO A 1 121 ? 64.349  85.427  132.526 1.00 10.00 ? 121 PRO A CB  1 
ATOM 998   C CG  . PRO A 1 121 ? 64.811  85.486  133.972 1.00 10.00 ? 121 PRO A CG  1 
ATOM 999   C CD  . PRO A 1 121 ? 63.627  85.295  134.867 1.00 10.00 ? 121 PRO A CD  1 
ATOM 1000  N N   . ALA A 1 122 ? 61.229  84.143  131.192 1.00 10.00 ? 122 ALA A N   1 
ATOM 1001  C CA  . ALA A 1 122 ? 60.637  83.018  130.477 1.00 10.00 ? 122 ALA A CA  1 
ATOM 1002  C C   . ALA A 1 122 ? 60.861  83.131  128.960 1.00 10.00 ? 122 ALA A C   1 
ATOM 1003  O O   . ALA A 1 122 ? 61.144  84.212  128.429 1.00 10.00 ? 122 ALA A O   1 
ATOM 1004  C CB  . ALA A 1 122 ? 59.129  82.958  130.739 1.00 10.00 ? 122 ALA A CB  1 
ATOM 1005  N N   . ILE A 1 123 ? 60.767  82.044  128.414 1.00 10.00 ? 123 ILE A N   1 
ATOM 1006  C CA  . ILE A 1 123 ? 60.714  81.625  127.018 1.00 10.00 ? 123 ILE A CA  1 
ATOM 1007  C C   . ILE A 1 123 ? 59.960  80.310  126.862 1.00 10.00 ? 123 ILE A C   1 
ATOM 1008  O O   . ILE A 1 123 ? 60.255  79.421  127.719 1.00 10.00 ? 123 ILE A O   1 
ATOM 1009  C CB  . ILE A 1 123 ? 62.122  81.467  126.415 1.00 10.00 ? 123 ILE A CB  1 
ATOM 1010  C CG1 . ILE A 1 123 ? 62.056  81.522  124.887 1.00 10.00 ? 123 ILE A CG1 1 
ATOM 1011  C CG2 . ILE A 1 123 ? 62.758  80.166  126.883 1.00 10.00 ? 123 ILE A CG2 1 
ATOM 1012  C CD1 . ILE A 1 123 ? 63.412  81.601  124.220 1.00 10.00 ? 123 ILE A CD1 1 
ATOM 1013  N N   . PHE A 1 124 ? 58.926  80.232  126.064 1.00 10.00 ? 124 PHE A N   1 
ATOM 1014  C CA  . PHE A 1 124 ? 58.124  79.016  126.061 1.00 10.00 ? 124 PHE A CA  1 
ATOM 1015  C C   . PHE A 1 124 ? 57.617  78.714  124.655 1.00 10.00 ? 124 PHE A C   1 
ATOM 1016  O O   . PHE A 1 124 ? 57.993  79.311  123.646 1.00 10.00 ? 124 PHE A O   1 
ATOM 1017  C CB  . PHE A 1 124 ? 56.929  79.131  127.015 1.00 10.00 ? 124 PHE A CB  1 
ATOM 1018  C CG  . PHE A 1 124 ? 55.851  80.078  126.567 1.00 10.00 ? 124 PHE A CG  1 
ATOM 1019  C CD1 . PHE A 1 124 ? 54.732  80.285  127.355 1.00 10.00 ? 124 PHE A CD1 1 
ATOM 1020  C CD2 . PHE A 1 124 ? 55.955  80.760  125.368 1.00 10.00 ? 124 PHE A CD2 1 
ATOM 1021  C CE1 . PHE A 1 124 ? 53.733  81.152  126.953 1.00 10.00 ? 124 PHE A CE1 1 
ATOM 1022  C CE2 . PHE A 1 124 ? 54.959  81.628  124.959 1.00 10.00 ? 124 PHE A CE2 1 
ATOM 1023  C CZ  . PHE A 1 124 ? 53.847  81.823  125.753 1.00 10.00 ? 124 PHE A CZ  1 
ATOM 1024  N N   . LYS A 1 125 ? 56.729  77.686  124.665 1.00 10.00 ? 125 LYS A N   1 
ATOM 1025  C CA  . LYS A 1 125 ? 56.084  77.103  123.475 1.00 10.00 ? 125 LYS A CA  1 
ATOM 1026  C C   . LYS A 1 125 ? 54.647  77.601  123.345 1.00 10.00 ? 125 LYS A C   1 
ATOM 1027  O O   . LYS A 1 125 ? 53.845  77.334  124.228 1.00 10.00 ? 125 LYS A O   1 
ATOM 1028  C CB  . LYS A 1 125 ? 56.045  75.579  123.628 1.00 10.00 ? 125 LYS A CB  1 
ATOM 1029  C CG  . LYS A 1 125 ? 56.753  74.834  122.499 1.00 10.00 ? 125 LYS A CG  1 
ATOM 1030  C CD  . LYS A 1 125 ? 58.279  74.881  122.602 1.00 10.00 ? 125 LYS A CD  1 
ATOM 1031  C CE  . LYS A 1 125 ? 58.967  73.825  121.732 1.00 10.00 ? 125 LYS A CE  1 
ATOM 1032  N NZ  . LYS A 1 125 ? 58.356  73.685  120.401 1.00 10.00 ? 125 LYS A NZ  1 
ATOM 1033  N N   . SER A 1 126 ? 54.324  78.266  122.231 1.00 10.00 ? 126 SER A N   1 
ATOM 1034  C CA  . SER A 1 126 ? 52.994  78.848  121.974 1.00 10.00 ? 126 SER A CA  1 
ATOM 1035  C C   . SER A 1 126 ? 52.188  78.229  120.815 1.00 10.00 ? 126 SER A C   1 
ATOM 1036  O O   . SER A 1 126 ? 52.729  77.549  119.950 1.00 10.00 ? 126 SER A O   1 
ATOM 1037  C CB  . SER A 1 126 ? 53.185  80.345  121.746 1.00 10.00 ? 126 SER A CB  1 
ATOM 1038  O OG  . SER A 1 126 ? 54.472  80.740  122.203 1.00 10.00 ? 126 SER A OG  1 
ATOM 1039  N N   . TYR A 1 127 ? 51.001  78.650  120.831 1.00 10.00 ? 127 TYR A N   1 
ATOM 1040  C CA  . TYR A 1 127 ? 50.013  78.024  119.944 1.00 10.00 ? 127 TYR A CA  1 
ATOM 1041  C C   . TYR A 1 127 ? 48.942  79.100  119.603 1.00 10.00 ? 127 TYR A C   1 
ATOM 1042  O O   . TYR A 1 127 ? 48.015  79.311  120.385 1.00 10.00 ? 127 TYR A O   1 
ATOM 1043  C CB  . TYR A 1 127 ? 49.380  76.876  120.733 1.00 10.00 ? 127 TYR A CB  1 
ATOM 1044  C CG  . TYR A 1 127 ? 48.379  75.936  120.061 1.00 10.00 ? 127 TYR A CG  1 
ATOM 1045  C CD1 . TYR A 1 127 ? 48.762  75.055  119.035 1.00 10.00 ? 127 TYR A CD1 1 
ATOM 1046  C CD2 . TYR A 1 127 ? 47.059  75.859  120.527 1.00 10.00 ? 127 TYR A CD2 1 
ATOM 1047  C CE1 . TYR A 1 127 ? 47.849  74.127  118.494 1.00 10.00 ? 127 TYR A CE1 1 
ATOM 1048  C CE2 . TYR A 1 127 ? 46.155  74.942  120.002 1.00 10.00 ? 127 TYR A CE2 1 
ATOM 1049  C CZ  . TYR A 1 127 ? 46.545  74.086  118.984 1.00 10.00 ? 127 TYR A CZ  1 
ATOM 1050  O OH  . TYR A 1 127 ? 45.600  73.255  118.420 1.00 10.00 ? 127 TYR A OH  1 
ATOM 1051  N N   . CYS A 1 128 ? 49.083  79.828  118.484 1.00 10.00 ? 128 CYS A N   1 
ATOM 1052  C CA  . CYS A 1 128 ? 48.096  80.851  118.124 1.00 10.00 ? 128 CYS A CA  1 
ATOM 1053  C C   . CYS A 1 128 ? 47.569  80.712  116.721 1.00 10.00 ? 128 CYS A C   1 
ATOM 1054  O O   . CYS A 1 128 ? 48.227  80.141  115.858 1.00 10.00 ? 128 CYS A O   1 
ATOM 1055  C CB  . CYS A 1 128 ? 48.655  82.276  118.335 1.00 10.00 ? 128 CYS A CB  1 
ATOM 1056  S SG  . CYS A 1 128 ? 49.885  83.041  117.204 1.00 10.00 ? 128 CYS A SG  1 
ATOM 1057  N N   . GLU A 1 129 ? 46.361  81.228  116.509 1.00 10.00 ? 129 GLU A N   1 
ATOM 1058  C CA  . GLU A 1 129 ? 45.740  81.174  115.198 1.00 10.00 ? 129 GLU A CA  1 
ATOM 1059  C C   . GLU A 1 129 ? 46.742  81.624  114.152 1.00 10.00 ? 129 GLU A C   1 
ATOM 1060  O O   . GLU A 1 129 ? 47.690  82.328  114.435 1.00 10.00 ? 129 GLU A O   1 
ATOM 1061  C CB  . GLU A 1 129 ? 44.484  82.060  115.155 1.00 10.00 ? 129 GLU A CB  1 
ATOM 1062  C CG  . GLU A 1 129 ? 43.897  82.272  113.755 1.00 10.00 ? 129 GLU A CG  1 
ATOM 1063  C CD  . GLU A 1 129 ? 43.982  83.705  113.307 1.00 10.00 ? 129 GLU A CD  1 
ATOM 1064  O OE1 . GLU A 1 129 ? 45.105  84.241  113.335 1.00 10.00 ? 129 GLU A OE1 1 
ATOM 1065  O OE2 . GLU A 1 129 ? 42.935  84.279  112.934 1.00 10.00 ? 129 GLU A OE2 1 
ATOM 1066  N N   . ILE A 1 130 ? 46.572  81.100  112.968 1.00 10.00 ? 130 ILE A N   1 
ATOM 1067  C CA  . ILE A 1 130 ? 47.405  81.482  111.837 1.00 10.00 ? 130 ILE A CA  1 
ATOM 1068  C C   . ILE A 1 130 ? 46.397  81.218  110.755 1.00 10.00 ? 130 ILE A C   1 
ATOM 1069  O O   . ILE A 1 130 ? 46.299  81.940  109.768 1.00 10.00 ? 130 ILE A O   1 
ATOM 1070  C CB  . ILE A 1 130 ? 48.660  80.527  111.598 1.00 10.00 ? 130 ILE A CB  1 
ATOM 1071  C CG1 . ILE A 1 130 ? 48.195  79.171  111.047 1.00 10.00 ? 130 ILE A CG1 1 
ATOM 1072  C CG2 . ILE A 1 130 ? 49.508  80.395  112.880 1.00 10.00 ? 130 ILE A CG2 1 
ATOM 1073  C CD1 . ILE A 1 130 ? 47.101  78.499  111.884 1.00 10.00 ? 130 ILE A CD1 1 
ATOM 1074  N N   . ILE A 1 131 ? 45.598  80.188  111.018 1.00 10.00 ? 131 ILE A N   1 
ATOM 1075  C CA  . ILE A 1 131 ? 44.589  79.700  110.109 1.00 10.00 ? 131 ILE A CA  1 
ATOM 1076  C C   . ILE A 1 131 ? 45.172  79.760  108.715 1.00 10.00 ? 131 ILE A C   1 
ATOM 1077  O O   . ILE A 1 131 ? 46.326  80.152  108.510 1.00 10.00 ? 131 ILE A O   1 
ATOM 1078  C CB  . ILE A 1 131 ? 43.264  80.512  110.191 1.00 10.00 ? 131 ILE A CB  1 
ATOM 1079  C CG1 . ILE A 1 131 ? 43.549  82.016  110.186 1.00 10.00 ? 131 ILE A CG1 1 
ATOM 1080  C CG2 . ILE A 1 131 ? 42.473  80.087  111.430 1.00 10.00 ? 131 ILE A CG2 1 
ATOM 1081  C CD1 . ILE A 1 131 ? 42.306  82.875  110.304 1.00 10.00 ? 131 ILE A CD1 1 
ATOM 1082  N N   . VAL A 1 132 ? 44.397  79.350  107.734 1.00 10.00 ? 132 VAL A N   1 
ATOM 1083  C CA  . VAL A 1 132 ? 44.937  79.398  106.404 1.00 10.00 ? 132 VAL A CA  1 
ATOM 1084  C C   . VAL A 1 132 ? 44.842  80.869  105.934 1.00 10.00 ? 132 VAL A C   1 
ATOM 1085  O O   . VAL A 1 132 ? 45.098  81.185  104.781 1.00 10.00 ? 132 VAL A O   1 
ATOM 1086  C CB  . VAL A 1 132 ? 44.213  78.331  105.506 1.00 10.00 ? 132 VAL A CB  1 
ATOM 1087  C CG1 . VAL A 1 132 ? 45.063  77.019  105.470 1.00 10.00 ? 132 VAL A CG1 1 
ATOM 1088  C CG2 . VAL A 1 132 ? 42.820  77.999  106.097 1.00 10.00 ? 132 VAL A CG2 1 
ATOM 1089  N N   . THR A 1 133 ? 44.545  81.764  106.888 1.00 10.00 ? 133 THR A N   1 
ATOM 1090  C CA  . THR A 1 133 ? 44.411  83.205  106.667 1.00 10.00 ? 133 THR A CA  1 
ATOM 1091  C C   . THR A 1 133 ? 45.572  84.028  107.277 1.00 10.00 ? 133 THR A C   1 
ATOM 1092  O O   . THR A 1 133 ? 45.457  85.245  107.440 1.00 10.00 ? 133 THR A O   1 
ATOM 1093  C CB  . THR A 1 133 ? 43.075  83.730  107.276 1.00 10.00 ? 133 THR A CB  1 
ATOM 1094  O OG1 . THR A 1 133 ? 41.962  83.034  106.690 1.00 10.00 ? 133 THR A OG1 1 
ATOM 1095  C CG2 . THR A 1 133 ? 42.919  85.228  107.027 1.00 10.00 ? 133 THR A CG2 1 
ATOM 1096  N N   . HIS A 1 134 ? 46.696  83.393  107.603 1.00 10.00 ? 134 HIS A N   1 
ATOM 1097  C CA  . HIS A 1 134 ? 47.797  84.146  108.188 1.00 10.00 ? 134 HIS A CA  1 
ATOM 1098  C C   . HIS A 1 134 ? 48.840  84.589  107.174 1.00 10.00 ? 134 HIS A C   1 
ATOM 1099  O O   . HIS A 1 134 ? 49.347  85.706  107.241 1.00 10.00 ? 134 HIS A O   1 
ATOM 1100  C CB  . HIS A 1 134 ? 48.475  83.344  109.279 1.00 10.00 ? 134 HIS A CB  1 
ATOM 1101  C CG  . HIS A 1 134 ? 49.804  83.891  109.669 1.00 10.00 ? 134 HIS A CG  1 
ATOM 1102  N ND1 . HIS A 1 134 ? 50.915  83.788  108.860 1.00 10.00 ? 134 HIS A ND1 1 
ATOM 1103  C CD2 . HIS A 1 134 ? 50.193  84.602  110.752 1.00 10.00 ? 134 HIS A CD2 1 
ATOM 1104  C CE1 . HIS A 1 134 ? 51.932  84.412  109.424 1.00 10.00 ? 134 HIS A CE1 1 
ATOM 1105  N NE2 . HIS A 1 134 ? 51.520  84.916  110.574 1.00 10.00 ? 134 HIS A NE2 1 
ATOM 1106  N N   . PHE A 1 135 ? 49.135  83.716  106.221 1.00 10.00 ? 135 PHE A N   1 
ATOM 1107  C CA  . PHE A 1 135 ? 50.113  83.999  105.180 1.00 10.00 ? 135 PHE A CA  1 
ATOM 1108  C C   . PHE A 1 135 ? 49.618  84.982  104.105 1.00 10.00 ? 135 PHE A C   1 
ATOM 1109  O O   . PHE A 1 135 ? 50.369  85.322  103.189 1.00 10.00 ? 135 PHE A O   1 
ATOM 1110  C CB  . PHE A 1 135 ? 50.522  82.677  104.519 1.00 10.00 ? 135 PHE A CB  1 
ATOM 1111  C CG  . PHE A 1 135 ? 51.392  82.829  103.310 1.00 10.00 ? 135 PHE A CG  1 
ATOM 1112  C CD1 . PHE A 1 135 ? 52.763  82.632  103.391 1.00 10.00 ? 135 PHE A CD1 1 
ATOM 1113  C CD2 . PHE A 1 135 ? 50.829  83.111  102.080 1.00 10.00 ? 135 PHE A CD2 1 
ATOM 1114  C CE1 . PHE A 1 135 ? 53.560  82.705  102.263 1.00 10.00 ? 135 PHE A CE1 1 
ATOM 1115  C CE2 . PHE A 1 135 ? 51.600  83.187  100.956 1.00 10.00 ? 135 PHE A CE2 1 
ATOM 1116  C CZ  . PHE A 1 135 ? 52.981  82.980  101.047 1.00 10.00 ? 135 PHE A CZ  1 
ATOM 1117  N N   . PRO A 1 136 ? 48.326  85.354  104.262 1.00 10.00 ? 136 PRO A N   1 
ATOM 1118  C CA  . PRO A 1 136 ? 47.809  86.316  103.338 1.00 10.00 ? 136 PRO A CA  1 
ATOM 1119  C C   . PRO A 1 136 ? 48.621  87.614  103.348 1.00 10.00 ? 136 PRO A C   1 
ATOM 1120  O O   . PRO A 1 136 ? 49.468  87.791  104.211 1.00 10.00 ? 136 PRO A O   1 
ATOM 1121  C CB  . PRO A 1 136 ? 46.358  86.479  103.725 1.00 10.00 ? 136 PRO A CB  1 
ATOM 1122  C CG  . PRO A 1 136 ? 46.085  85.554  104.892 1.00 10.00 ? 136 PRO A CG  1 
ATOM 1123  C CD  . PRO A 1 136 ? 47.373  84.879  105.274 1.00 10.00 ? 136 PRO A CD  1 
ATOM 1124  N N   . PHE A 1 137 ? 48.344  88.435  102.361 1.00 10.00 ? 137 PHE A N   1 
ATOM 1125  C CA  . PHE A 1 137 ? 48.948  89.764  102.221 1.00 10.00 ? 137 PHE A CA  1 
ATOM 1126  C C   . PHE A 1 137 ? 48.131  90.649  103.133 1.00 10.00 ? 137 PHE A C   1 
ATOM 1127  O O   . PHE A 1 137 ? 48.579  91.707  103.572 1.00 10.00 ? 137 PHE A O   1 
ATOM 1128  C CB  . PHE A 1 137 ? 48.820  90.252  100.775 1.00 10.00 ? 137 PHE A CB  1 
ATOM 1129  C CG  . PHE A 1 137 ? 50.028  89.959  99.943  1.00 10.00 ? 137 PHE A CG  1 
ATOM 1130  C CD1 . PHE A 1 137 ? 49.961  89.987  98.558  1.00 10.00 ? 137 PHE A CD1 1 
ATOM 1131  C CD2 . PHE A 1 137 ? 51.261  89.693  100.558 1.00 10.00 ? 137 PHE A CD2 1 
ATOM 1132  C CE1 . PHE A 1 137 ? 51.106  89.759  97.792  1.00 10.00 ? 137 PHE A CE1 1 
ATOM 1133  C CE2 . PHE A 1 137 ? 52.396  89.467  99.804  1.00 10.00 ? 137 PHE A CE2 1 
ATOM 1134  C CZ  . PHE A 1 137 ? 52.316  89.502  98.410  1.00 10.00 ? 137 PHE A CZ  1 
ATOM 1135  N N   . ASP A 1 138 ? 46.954  90.119  103.456 1.00 10.00 ? 138 ASP A N   1 
ATOM 1136  C CA  . ASP A 1 138 ? 45.929  90.753  104.277 1.00 10.00 ? 138 ASP A CA  1 
ATOM 1137  C C   . ASP A 1 138 ? 45.881  90.189  105.690 1.00 10.00 ? 138 ASP A C   1 
ATOM 1138  O O   . ASP A 1 138 ? 44.950  90.466  106.439 1.00 10.00 ? 138 ASP A O   1 
ATOM 1139  C CB  . ASP A 1 138 ? 44.567  90.539  103.627 1.00 10.00 ? 138 ASP A CB  1 
ATOM 1140  C CG  . ASP A 1 138 ? 44.281  89.067  103.352 1.00 10.00 ? 138 ASP A CG  1 
ATOM 1141  O OD1 . ASP A 1 138 ? 45.129  88.409  102.709 1.00 10.00 ? 138 ASP A OD1 1 
ATOM 1142  O OD2 . ASP A 1 138 ? 43.215  88.567  103.779 1.00 10.00 ? 138 ASP A OD2 1 
ATOM 1143  N N   . GLN A 1 139 ? 46.873  89.361  106.014 1.00 10.00 ? 139 GLN A N   1 
ATOM 1144  C CA  . GLN A 1 139 ? 47.018  88.749  107.332 1.00 10.00 ? 139 GLN A CA  1 
ATOM 1145  C C   . GLN A 1 139 ? 45.742  88.297  108.065 1.00 10.00 ? 139 GLN A C   1 
ATOM 1146  O O   . GLN A 1 139 ? 44.630  88.301  107.520 1.00 10.00 ? 139 GLN A O   1 
ATOM 1147  C CB  . GLN A 1 139 ? 47.840  89.676  108.239 1.00 10.00 ? 139 GLN A CB  1 
ATOM 1148  C CG  . GLN A 1 139 ? 47.056  90.624  109.129 1.00 10.00 ? 139 GLN A CG  1 
ATOM 1149  C CD  . GLN A 1 139 ? 46.200  91.595  108.358 1.00 10.00 ? 139 GLN A CD  1 
ATOM 1150  O OE1 . GLN A 1 139 ? 46.678  92.283  107.461 1.00 10.00 ? 139 GLN A OE1 1 
ATOM 1151  N NE2 . GLN A 1 139 ? 44.921  91.661  108.707 1.00 10.00 ? 139 GLN A NE2 1 
ATOM 1152  N N   . GLN A 1 140 ? 45.952  87.828  109.229 1.00 10.00 ? 140 GLN A N   1 
ATOM 1153  C CA  . GLN A 1 140 ? 44.979  87.413  110.231 1.00 10.00 ? 140 GLN A CA  1 
ATOM 1154  C C   . GLN A 1 140 ? 45.414  87.838  111.628 1.00 10.00 ? 140 GLN A C   1 
ATOM 1155  O O   . GLN A 1 140 ? 46.664  87.895  111.805 1.00 10.00 ? 140 GLN A O   1 
ATOM 1156  C CB  . GLN A 1 140 ? 44.765  85.900  110.176 1.00 10.00 ? 140 GLN A CB  1 
ATOM 1157  C CG  . GLN A 1 140 ? 43.600  85.407  111.019 1.00 10.00 ? 140 GLN A CG  1 
ATOM 1158  C CD  . GLN A 1 140 ? 42.255  85.803  110.443 1.00 10.00 ? 140 GLN A CD  1 
ATOM 1159  O OE1 . GLN A 1 140 ? 42.183  86.447  109.396 1.00 10.00 ? 140 GLN A OE1 1 
ATOM 1160  N NE2 . GLN A 1 140 ? 41.063  85.524  110.959 1.00 10.00 ? 140 GLN A NE2 1 
ATOM 1161  N N   . ASN A 1 141 ? 44.591  88.176  112.518 1.00 10.00 ? 141 ASN A N   1 
ATOM 1162  C CA  . ASN A 1 141 ? 45.019  88.564  113.874 1.00 10.00 ? 141 ASN A CA  1 
ATOM 1163  C C   . ASN A 1 141 ? 45.083  87.415  114.904 1.00 10.00 ? 141 ASN A C   1 
ATOM 1164  O O   . ASN A 1 141 ? 44.057  87.009  115.460 1.00 10.00 ? 141 ASN A O   1 
ATOM 1165  C CB  . ASN A 1 141 ? 44.124  89.700  114.393 1.00 10.00 ? 141 ASN A CB  1 
ATOM 1166  C CG  . ASN A 1 141 ? 42.673  89.554  113.956 1.00 10.00 ? 141 ASN A CG  1 
ATOM 1167  O OD1 . ASN A 1 141 ? 42.393  89.291  112.790 1.00 10.00 ? 141 ASN A OD1 1 
ATOM 1168  N ND2 . ASN A 1 141 ? 41.745  89.750  114.886 1.00 10.00 ? 141 ASN A ND2 1 
ATOM 1169  N N   . CYS A 1 142 ? 46.293  86.887  115.130 1.00 10.00 ? 142 CYS A N   1 
ATOM 1170  C CA  . CYS A 1 142 ? 46.529  85.783  116.087 1.00 10.00 ? 142 CYS A CA  1 
ATOM 1171  C C   . CYS A 1 142 ? 45.855  86.129  117.413 1.00 10.00 ? 142 CYS A C   1 
ATOM 1172  O O   . CYS A 1 142 ? 46.343  86.970  118.167 1.00 10.00 ? 142 CYS A O   1 
ATOM 1173  C CB  . CYS A 1 142 ? 48.057  85.516  116.320 1.00 10.00 ? 142 CYS A CB  1 
ATOM 1174  S SG  . CYS A 1 142 ? 48.701  83.875  115.756 1.00 10.00 ? 142 CYS A SG  1 
ATOM 1175  N N   . THR A 1 143 ? 44.718  85.486  117.678 1.00 10.00 ? 143 THR A N   1 
ATOM 1176  C CA  . THR A 1 143 ? 43.947  85.707  118.900 1.00 10.00 ? 143 THR A CA  1 
ATOM 1177  C C   . THR A 1 143 ? 44.585  84.887  120.040 1.00 10.00 ? 143 THR A C   1 
ATOM 1178  O O   . THR A 1 143 ? 44.515  83.654  120.032 1.00 10.00 ? 143 THR A O   1 
ATOM 1179  C CB  . THR A 1 143 ? 42.419  85.297  118.714 1.00 10.00 ? 143 THR A CB  1 
ATOM 1180  O OG1 . THR A 1 143 ? 42.252  83.886  118.861 1.00 10.00 ? 143 THR A OG1 1 
ATOM 1181  C CG2 . THR A 1 143 ? 41.925  85.669  117.344 1.00 10.00 ? 143 THR A CG2 1 
ATOM 1182  N N   . MET A 1 144 ? 45.252  85.617  120.987 1.00 10.00 ? 144 MET A N   1 
ATOM 1183  C CA  . MET A 1 144 ? 45.860  84.903  122.099 1.00 10.00 ? 144 MET A CA  1 
ATOM 1184  C C   . MET A 1 144 ? 45.432  85.418  123.500 1.00 10.00 ? 144 MET A C   1 
ATOM 1185  O O   . MET A 1 144 ? 45.803  86.518  123.956 1.00 10.00 ? 144 MET A O   1 
ATOM 1186  C CB  . MET A 1 144 ? 47.394  84.895  121.926 1.00 10.00 ? 144 MET A CB  1 
ATOM 1187  C CG  . MET A 1 144 ? 47.944  83.950  120.833 1.00 10.00 ? 144 MET A CG  1 
ATOM 1188  S SD  . MET A 1 144 ? 49.357  82.974  121.452 1.00 10.00 ? 144 MET A SD  1 
ATOM 1189  C CE  . MET A 1 144 ? 50.614  83.206  120.220 1.00 10.00 ? 144 MET A CE  1 
ATOM 1190  N N   . LYS A 1 145 ? 44.630  84.593  124.169 1.00 10.00 ? 145 LYS A N   1 
ATOM 1191  C CA  . LYS A 1 145 ? 44.090  84.892  125.522 1.00 10.00 ? 145 LYS A CA  1 
ATOM 1192  C C   . LYS A 1 145 ? 44.935  84.342  126.647 1.00 10.00 ? 145 LYS A C   1 
ATOM 1193  O O   . LYS A 1 145 ? 45.383  83.193  126.610 1.00 10.00 ? 145 LYS A O   1 
ATOM 1194  C CB  . LYS A 1 145 ? 42.676  84.326  125.728 1.00 10.00 ? 145 LYS A CB  1 
ATOM 1195  C CG  . LYS A 1 145 ? 41.580  85.331  126.067 1.00 10.00 ? 145 LYS A CG  1 
ATOM 1196  C CD  . LYS A 1 145 ? 40.162  84.836  125.680 1.00 10.00 ? 145 LYS A CD  1 
ATOM 1197  C CE  . LYS A 1 145 ? 39.052  85.869  126.044 1.00 10.00 ? 145 LYS A CE  1 
ATOM 1198  N NZ  . LYS A 1 145 ? 39.518  87.184  126.597 1.00 10.00 ? 145 LYS A NZ  1 
ATOM 1199  N N   . LEU A 1 146 ? 45.131  85.156  127.670 1.00 10.00 ? 146 LEU A N   1 
ATOM 1200  C CA  . LEU A 1 146 ? 45.920  84.762  128.828 1.00 10.00 ? 146 LEU A CA  1 
ATOM 1201  C C   . LEU A 1 146 ? 45.217  85.082  130.122 1.00 10.00 ? 146 LEU A C   1 
ATOM 1202  O O   . LEU A 1 146 ? 44.546  86.101  130.241 1.00 10.00 ? 146 LEU A O   1 
ATOM 1203  C CB  . LEU A 1 146 ? 47.264  85.446  128.815 1.00 10.00 ? 146 LEU A CB  1 
ATOM 1204  C CG  . LEU A 1 146 ? 48.098  85.016  127.619 1.00 10.00 ? 146 LEU A CG  1 
ATOM 1205  C CD1 . LEU A 1 146 ? 47.544  85.496  126.294 1.00 10.00 ? 146 LEU A CD1 1 
ATOM 1206  C CD2 . LEU A 1 146 ? 49.474  85.556  127.851 1.00 10.00 ? 146 LEU A CD2 1 
ATOM 1207  N N   . GLY A 1 147 ? 45.323  84.166  131.079 1.00 10.00 ? 147 GLY A N   1 
ATOM 1208  C CA  . GLY A 1 147 ? 44.714  84.391  132.369 1.00 10.00 ? 147 GLY A CA  1 
ATOM 1209  C C   . GLY A 1 147 ? 44.766  83.204  133.296 1.00 10.00 ? 147 GLY A C   1 
ATOM 1210  O O   . GLY A 1 147 ? 45.079  82.089  132.897 1.00 10.00 ? 147 GLY A O   1 
ATOM 1211  N N   . ILE A 1 148 ? 44.484  83.507  134.547 1.00 10.00 ? 148 ILE A N   1 
ATOM 1212  C CA  . ILE A 1 148 ? 44.430  82.579  135.656 1.00 10.00 ? 148 ILE A CA  1 
ATOM 1213  C C   . ILE A 1 148 ? 43.896  81.222  135.112 1.00 10.00 ? 148 ILE A C   1 
ATOM 1214  O O   . ILE A 1 148 ? 42.913  81.221  134.377 1.00 10.00 ? 148 ILE A O   1 
ATOM 1215  C CB  . ILE A 1 148 ? 43.485  83.267  136.640 1.00 10.00 ? 148 ILE A CB  1 
ATOM 1216  C CG1 . ILE A 1 148 ? 43.771  82.900  138.092 1.00 10.00 ? 148 ILE A CG1 1 
ATOM 1217  C CG2 . ILE A 1 148 ? 42.099  83.048  136.175 1.00 10.00 ? 148 ILE A CG2 1 
ATOM 1218  C CD1 . ILE A 1 148 ? 43.106  83.873  139.036 1.00 10.00 ? 148 ILE A CD1 1 
ATOM 1219  N N   . TRP A 1 149 ? 44.532  80.083  135.434 1.00 10.00 ? 149 TRP A N   1 
ATOM 1220  C CA  . TRP A 1 149 ? 44.052  78.786  134.911 1.00 10.00 ? 149 TRP A CA  1 
ATOM 1221  C C   . TRP A 1 149 ? 43.030  78.078  135.829 1.00 10.00 ? 149 TRP A C   1 
ATOM 1222  O O   . TRP A 1 149 ? 41.841  78.083  135.482 1.00 10.00 ? 149 TRP A O   1 
ATOM 1223  C CB  . TRP A 1 149 ? 45.287  77.954  134.397 1.00 10.00 ? 149 TRP A CB  1 
ATOM 1224  C CG  . TRP A 1 149 ? 45.547  76.474  134.711 1.00 10.00 ? 149 TRP A CG  1 
ATOM 1225  C CD1 . TRP A 1 149 ? 46.744  75.943  135.137 1.00 10.00 ? 149 TRP A CD1 1 
ATOM 1226  C CD2 . TRP A 1 149 ? 44.646  75.350  134.598 1.00 10.00 ? 149 TRP A CD2 1 
ATOM 1227  N NE1 . TRP A 1 149 ? 46.639  74.583  135.307 1.00 10.00 ? 149 TRP A NE1 1 
ATOM 1228  C CE2 . TRP A 1 149 ? 45.366  74.191  134.987 1.00 10.00 ? 149 TRP A CE2 1 
ATOM 1229  C CE3 . TRP A 1 149 ? 43.306  75.206  134.211 1.00 10.00 ? 149 TRP A CE3 1 
ATOM 1230  C CZ2 . TRP A 1 149 ? 44.788  72.924  135.003 1.00 10.00 ? 149 TRP A CZ2 1 
ATOM 1231  C CZ3 . TRP A 1 149 ? 42.742  73.928  134.230 1.00 10.00 ? 149 TRP A CZ3 1 
ATOM 1232  C CH2 . TRP A 1 149 ? 43.484  72.816  134.625 1.00 10.00 ? 149 TRP A CH2 1 
ATOM 1233  N N   . THR A 1 150 ? 43.393  77.559  137.005 1.00 10.00 ? 150 THR A N   1 
ATOM 1234  C CA  . THR A 1 150 ? 42.349  76.887  137.801 1.00 10.00 ? 150 THR A CA  1 
ATOM 1235  C C   . THR A 1 150 ? 41.637  77.675  138.917 1.00 10.00 ? 150 THR A C   1 
ATOM 1236  O O   . THR A 1 150 ? 40.943  77.082  139.745 1.00 10.00 ? 150 THR A O   1 
ATOM 1237  C CB  . THR A 1 150 ? 42.836  75.509  138.389 1.00 10.00 ? 150 THR A CB  1 
ATOM 1238  O OG1 . THR A 1 150 ? 41.739  74.873  139.066 1.00 10.00 ? 150 THR A OG1 1 
ATOM 1239  C CG2 . THR A 1 150 ? 44.026  75.701  139.336 1.00 10.00 ? 150 THR A CG2 1 
ATOM 1240  N N   . TYR A 1 151 ? 41.767  79.000  138.947 1.00 10.00 ? 151 TYR A N   1 
ATOM 1241  C CA  . TYR A 1 151 ? 41.070  79.759  139.982 1.00 10.00 ? 151 TYR A CA  1 
ATOM 1242  C C   . TYR A 1 151 ? 40.114  80.821  139.416 1.00 10.00 ? 151 TYR A C   1 
ATOM 1243  O O   . TYR A 1 151 ? 40.424  81.495  138.436 1.00 10.00 ? 151 TYR A O   1 
ATOM 1244  C CB  . TYR A 1 151 ? 42.090  80.370  140.930 1.00 10.00 ? 151 TYR A CB  1 
ATOM 1245  C CG  . TYR A 1 151 ? 43.254  79.448  141.181 1.00 10.00 ? 151 TYR A CG  1 
ATOM 1246  C CD1 . TYR A 1 151 ? 44.465  79.633  140.513 1.00 10.00 ? 151 TYR A CD1 1 
ATOM 1247  C CD2 . TYR A 1 151 ? 43.129  78.351  142.029 1.00 10.00 ? 151 TYR A CD2 1 
ATOM 1248  C CE1 . TYR A 1 151 ? 45.520  78.753  140.680 1.00 10.00 ? 151 TYR A CE1 1 
ATOM 1249  C CE2 . TYR A 1 151 ? 44.184  77.458  142.203 1.00 10.00 ? 151 TYR A CE2 1 
ATOM 1250  C CZ  . TYR A 1 151 ? 45.376  77.666  141.524 1.00 10.00 ? 151 TYR A CZ  1 
ATOM 1251  O OH  . TYR A 1 151 ? 46.420  76.788  141.688 1.00 10.00 ? 151 TYR A OH  1 
ATOM 1252  N N   . ASP A 1 152 ? 38.955  80.952  140.060 1.00 10.00 ? 152 ASP A N   1 
ATOM 1253  C CA  . ASP A 1 152 ? 37.889  81.852  139.659 1.00 10.00 ? 152 ASP A CA  1 
ATOM 1254  C C   . ASP A 1 152 ? 38.018  83.270  140.227 1.00 10.00 ? 152 ASP A C   1 
ATOM 1255  O O   . ASP A 1 152 ? 38.785  83.532  141.162 1.00 10.00 ? 152 ASP A O   1 
ATOM 1256  C CB  . ASP A 1 152 ? 36.543  81.223  140.073 1.00 10.00 ? 152 ASP A CB  1 
ATOM 1257  C CG  . ASP A 1 152 ? 36.146  80.048  139.200 1.00 10.00 ? 152 ASP A CG  1 
ATOM 1258  O OD1 . ASP A 1 152 ? 36.810  78.985  139.259 1.00 10.00 ? 152 ASP A OD1 1 
ATOM 1259  O OD2 . ASP A 1 152 ? 35.158  80.200  138.461 1.00 10.00 ? 152 ASP A OD2 1 
ATOM 1260  N N   . GLY A 1 153 ? 37.259  84.188  139.639 1.00 10.00 ? 153 GLY A N   1 
ATOM 1261  C CA  . GLY A 1 153 ? 37.277  85.563  140.086 1.00 10.00 ? 153 GLY A CA  1 
ATOM 1262  C C   . GLY A 1 153 ? 36.863  85.699  141.536 1.00 10.00 ? 153 GLY A C   1 
ATOM 1263  O O   . GLY A 1 153 ? 36.917  86.782  142.082 1.00 10.00 ? 153 GLY A O   1 
ATOM 1264  N N   . THR A 1 154 ? 36.450  84.611  142.173 1.00 10.00 ? 154 THR A N   1 
ATOM 1265  C CA  . THR A 1 154 ? 36.045  84.685  143.566 1.00 10.00 ? 154 THR A CA  1 
ATOM 1266  C C   . THR A 1 154 ? 37.230  84.286  144.457 1.00 10.00 ? 154 THR A C   1 
ATOM 1267  O O   . THR A 1 154 ? 37.372  84.776  145.577 1.00 10.00 ? 154 THR A O   1 
ATOM 1268  C CB  . THR A 1 154 ? 34.806  83.798  143.800 1.00 10.00 ? 154 THR A CB  1 
ATOM 1269  O OG1 . THR A 1 154 ? 33.739  84.249  142.956 1.00 10.00 ? 154 THR A OG1 1 
ATOM 1270  C CG2 . THR A 1 154 ? 34.345  83.871  145.248 1.00 10.00 ? 154 THR A CG2 1 
ATOM 1271  N N   . LYS A 1 155 ? 38.095  83.422  143.933 1.00 10.00 ? 155 LYS A N   1 
ATOM 1272  C CA  . LYS A 1 155 ? 39.296  82.973  144.639 1.00 10.00 ? 155 LYS A CA  1 
ATOM 1273  C C   . LYS A 1 155 ? 40.430  83.859  144.148 1.00 10.00 ? 155 LYS A C   1 
ATOM 1274  O O   . LYS A 1 155 ? 41.252  84.348  144.932 1.00 10.00 ? 155 LYS A O   1 
ATOM 1275  C CB  . LYS A 1 155 ? 39.584  81.502  144.335 1.00 10.00 ? 155 LYS A CB  1 
ATOM 1276  C CG  . LYS A 1 155 ? 38.556  80.557  144.934 1.00 10.00 ? 155 LYS A CG  1 
ATOM 1277  C CD  . LYS A 1 155 ? 38.240  80.952  146.369 1.00 10.00 ? 155 LYS A CD  1 
ATOM 1278  C CE  . LYS A 1 155 ? 36.835  80.544  146.773 1.00 10.00 ? 155 LYS A CE  1 
ATOM 1279  N NZ  . LYS A 1 155 ? 36.483  81.088  148.114 1.00 10.00 ? 155 LYS A NZ  1 
ATOM 1280  N N   . VAL A 1 156 ? 40.481  84.080  142.838 1.00 10.00 ? 156 VAL A N   1 
ATOM 1281  C CA  . VAL A 1 156 ? 41.499  84.996  142.345 1.00 10.00 ? 156 VAL A CA  1 
ATOM 1282  C C   . VAL A 1 156 ? 41.225  85.652  140.991 1.00 10.00 ? 156 VAL A C   1 
ATOM 1283  O O   . VAL A 1 156 ? 40.279  85.310  140.264 1.00 10.00 ? 156 VAL A O   1 
ATOM 1284  C CB  . VAL A 1 156 ? 42.925  84.358  142.444 1.00 10.00 ? 156 VAL A CB  1 
ATOM 1285  C CG1 . VAL A 1 156 ? 42.922  82.991  141.867 1.00 10.00 ? 156 VAL A CG1 1 
ATOM 1286  C CG2 . VAL A 1 156 ? 43.969  85.249  141.787 1.00 10.00 ? 156 VAL A CG2 1 
ATOM 1287  N N   . SER A 1 157 ? 42.011  86.678  140.704 1.00 10.00 ? 157 SER A N   1 
ATOM 1288  C CA  . SER A 1 157 ? 41.836  87.442  139.475 1.00 10.00 ? 157 SER A CA  1 
ATOM 1289  C C   . SER A 1 157 ? 43.108  88.028  138.873 1.00 10.00 ? 157 SER A C   1 
ATOM 1290  O O   . SER A 1 157 ? 43.841  88.815  139.488 1.00 10.00 ? 157 SER A O   1 
ATOM 1291  C CB  . SER A 1 157 ? 40.825  88.571  139.705 1.00 10.00 ? 157 SER A CB  1 
ATOM 1292  O OG  . SER A 1 157 ? 41.298  89.494  140.670 1.00 10.00 ? 157 SER A OG  1 
ATOM 1293  N N   . ILE A 1 158 ? 43.325  87.630  137.631 1.00 10.00 ? 158 ILE A N   1 
ATOM 1294  C CA  . ILE A 1 158 ? 44.475  88.032  136.820 1.00 10.00 ? 158 ILE A CA  1 
ATOM 1295  C C   . ILE A 1 158 ? 44.090  89.321  136.079 1.00 10.00 ? 158 ILE A C   1 
ATOM 1296  O O   . ILE A 1 158 ? 43.082  89.342  135.393 1.00 10.00 ? 158 ILE A O   1 
ATOM 1297  C CB  . ILE A 1 158 ? 44.830  86.873  135.804 1.00 10.00 ? 158 ILE A CB  1 
ATOM 1298  C CG1 . ILE A 1 158 ? 46.351  86.605  135.834 1.00 10.00 ? 158 ILE A CG1 1 
ATOM 1299  C CG2 . ILE A 1 158 ? 44.246  87.170  134.406 1.00 10.00 ? 158 ILE A CG2 1 
ATOM 1300  C CD1 . ILE A 1 158 ? 46.835  85.383  135.039 1.00 10.00 ? 158 ILE A CD1 1 
ATOM 1301  N N   . SER A 1 159 ? 44.865  90.397  136.222 1.00 10.00 ? 159 SER A N   1 
ATOM 1302  C CA  . SER A 1 159 ? 44.522  91.658  135.535 1.00 10.00 ? 159 SER A CA  1 
ATOM 1303  C C   . SER A 1 159 ? 45.665  92.123  134.636 1.00 10.00 ? 159 SER A C   1 
ATOM 1304  O O   . SER A 1 159 ? 46.801  91.681  134.796 1.00 10.00 ? 159 SER A O   1 
ATOM 1305  C CB  . SER A 1 159 ? 44.187  92.754  136.555 1.00 10.00 ? 159 SER A CB  1 
ATOM 1306  O OG  . SER A 1 159 ? 45.312  93.091  137.345 1.00 10.00 ? 159 SER A OG  1 
ATOM 1307  N N   . PRO A 1 160 ? 45.383  93.031  133.688 1.00 10.00 ? 160 PRO A N   1 
ATOM 1308  C CA  . PRO A 1 160 ? 46.477  93.470  132.817 1.00 10.00 ? 160 PRO A CA  1 
ATOM 1309  C C   . PRO A 1 160 ? 47.389  94.534  133.407 1.00 10.00 ? 160 PRO A C   1 
ATOM 1310  O O   . PRO A 1 160 ? 47.177  95.007  134.528 1.00 10.00 ? 160 PRO A O   1 
ATOM 1311  C CB  . PRO A 1 160 ? 45.747  93.943  131.565 1.00 10.00 ? 160 PRO A CB  1 
ATOM 1312  C CG  . PRO A 1 160 ? 44.498  94.484  132.117 1.00 10.00 ? 160 PRO A CG  1 
ATOM 1313  C CD  . PRO A 1 160 ? 44.084  93.466  133.150 1.00 10.00 ? 160 PRO A CD  1 
ATOM 1314  N N   . GLU A 1 161 ? 48.413  94.913  132.648 1.00 10.00 ? 161 GLU A N   1 
ATOM 1315  C CA  . GLU A 1 161 ? 49.332  95.907  133.151 1.00 10.00 ? 161 GLU A CA  1 
ATOM 1316  C C   . GLU A 1 161 ? 49.605  97.068  132.175 1.00 10.00 ? 161 GLU A C   1 
ATOM 1317  O O   . GLU A 1 161 ? 49.700  98.204  132.630 1.00 10.00 ? 161 GLU A O   1 
ATOM 1318  C CB  . GLU A 1 161 ? 50.608  95.191  133.669 1.00 10.00 ? 161 GLU A CB  1 
ATOM 1319  C CG  . GLU A 1 161 ? 51.898  95.418  132.905 1.00 10.00 ? 161 GLU A CG  1 
ATOM 1320  C CD  . GLU A 1 161 ? 52.859  96.356  133.602 1.00 10.00 ? 161 GLU A CD  1 
ATOM 1321  O OE1 . GLU A 1 161 ? 53.190  96.100  134.777 1.00 10.00 ? 161 GLU A OE1 1 
ATOM 1322  O OE2 . GLU A 1 161 ? 53.289  97.338  132.961 1.00 10.00 ? 161 GLU A OE2 1 
ATOM 1323  N N   . SER A 1 162 ? 49.685  96.822  130.858 1.00 10.00 ? 162 SER A N   1 
ATOM 1324  C CA  . SER A 1 162 ? 49.911  97.923  129.925 1.00 10.00 ? 162 SER A CA  1 
ATOM 1325  C C   . SER A 1 162 ? 49.873  97.569  128.422 1.00 10.00 ? 162 SER A C   1 
ATOM 1326  O O   . SER A 1 162 ? 49.841  96.395  128.042 1.00 10.00 ? 162 SER A O   1 
ATOM 1327  C CB  . SER A 1 162 ? 51.257  98.573  130.257 1.00 10.00 ? 162 SER A CB  1 
ATOM 1328  O OG  . SER A 1 162 ? 52.316  97.622  130.250 1.00 10.00 ? 162 SER A OG  1 
ATOM 1329  N N   . ASP A 1 163 ? 49.870  98.603  127.575 1.00 10.00 ? 163 ASP A N   1 
ATOM 1330  C CA  . ASP A 1 163 ? 49.913  98.475  126.140 1.00 10.00 ? 163 ASP A CA  1 
ATOM 1331  C C   . ASP A 1 163 ? 51.354  98.518  125.668 1.00 10.00 ? 163 ASP A C   1 
ATOM 1332  O O   . ASP A 1 163 ? 52.214  99.149  126.292 1.00 10.00 ? 163 ASP A O   1 
ATOM 1333  C CB  . ASP A 1 163 ? 49.117  99.591  125.470 1.00 10.00 ? 163 ASP A CB  1 
ATOM 1334  C CG  . ASP A 1 163 ? 48.950  99.366  123.974 1.00 10.00 ? 163 ASP A CG  1 
ATOM 1335  O OD1 . ASP A 1 163 ? 49.752  98.569  123.357 1.00 10.00 ? 163 ASP A OD1 1 
ATOM 1336  O OD2 . ASP A 1 163 ? 48.011  99.970  123.338 1.00 10.00 ? 163 ASP A OD2 1 
ATOM 1337  N N   . ARG A 1 164 ? 51.552  97.737  124.697 1.00 10.00 ? 164 ARG A N   1 
ATOM 1338  C CA  . ARG A 1 164 ? 52.875  97.553  124.093 1.00 10.00 ? 164 ARG A CA  1 
ATOM 1339  C C   . ARG A 1 164 ? 52.755  96.741  122.801 1.00 10.00 ? 164 ARG A C   1 
ATOM 1340  O O   . ARG A 1 164 ? 51.920  95.837  122.696 1.00 10.00 ? 164 ARG A O   1 
ATOM 1341  C CB  . ARG A 1 164 ? 53.868  96.892  125.071 1.00 10.00 ? 164 ARG A CB  1 
ATOM 1342  C CG  . ARG A 1 164 ? 53.277  96.320  126.359 1.00 10.00 ? 164 ARG A CG  1 
ATOM 1343  C CD  . ARG A 1 164 ? 53.084  94.817  126.260 1.00 10.00 ? 164 ARG A CD  1 
ATOM 1344  N NE  . ARG A 1 164 ? 54.345  94.116  126.022 1.00 10.00 ? 164 ARG A NE  1 
ATOM 1345  C CZ  . ARG A 1 164 ? 54.431  92.869  125.568 1.00 10.00 ? 164 ARG A CZ  1 
ATOM 1346  N NH1 . ARG A 1 164 ? 53.327  92.183  125.300 1.00 10.00 ? 164 ARG A NH1 1 
ATOM 1347  N NH2 . ARG A 1 164 ? 55.619  92.306  125.386 1.00 10.00 ? 164 ARG A NH2 1 
ATOM 1348  N N   . PRO A 1 165 ? 53.559  97.087  121.773 1.00 10.00 ? 165 PRO A N   1 
ATOM 1349  C CA  . PRO A 1 165 ? 53.547  96.391  120.473 1.00 10.00 ? 165 PRO A CA  1 
ATOM 1350  C C   . PRO A 1 165 ? 54.147  94.980  120.508 1.00 10.00 ? 165 PRO A C   1 
ATOM 1351  O O   . PRO A 1 165 ? 54.865  94.617  121.448 1.00 10.00 ? 165 PRO A O   1 
ATOM 1352  C CB  . PRO A 1 165 ? 54.345  97.334  119.566 1.00 10.00 ? 165 PRO A CB  1 
ATOM 1353  C CG  . PRO A 1 165 ? 55.324  97.962  120.511 1.00 10.00 ? 165 PRO A CG  1 
ATOM 1354  C CD  . PRO A 1 165 ? 54.459  98.259  121.727 1.00 10.00 ? 165 PRO A CD  1 
ATOM 1355  N N   . ASP A 1 166 ? 53.810  94.182  119.500 1.00 10.00 ? 166 ASP A N   1 
ATOM 1356  C CA  . ASP A 1 166 ? 54.354  92.838  119.394 1.00 10.00 ? 166 ASP A CA  1 
ATOM 1357  C C   . ASP A 1 166 ? 55.563  92.944  118.488 1.00 10.00 ? 166 ASP A C   1 
ATOM 1358  O O   . ASP A 1 166 ? 56.443  92.076  118.503 1.00 10.00 ? 166 ASP A O   1 
ATOM 1359  C CB  . ASP A 1 166 ? 53.359  91.860  118.774 1.00 10.00 ? 166 ASP A CB  1 
ATOM 1360  C CG  . ASP A 1 166 ? 54.026  90.572  118.323 1.00 10.00 ? 166 ASP A CG  1 
ATOM 1361  O OD1 . ASP A 1 166 ? 54.914  90.079  119.052 1.00 10.00 ? 166 ASP A OD1 1 
ATOM 1362  O OD2 . ASP A 1 166 ? 53.667  90.055  117.246 1.00 10.00 ? 166 ASP A OD2 1 
ATOM 1363  N N   . LEU A 1 167 ? 55.590  94.006  117.683 1.00 10.00 ? 167 LEU A N   1 
ATOM 1364  C CA  . LEU A 1 167 ? 56.716  94.215  116.782 1.00 10.00 ? 167 LEU A CA  1 
ATOM 1365  C C   . LEU A 1 167 ? 57.774  95.004  117.560 1.00 10.00 ? 167 LEU A C   1 
ATOM 1366  O O   . LEU A 1 167 ? 58.795  95.417  117.014 1.00 10.00 ? 167 LEU A O   1 
ATOM 1367  C CB  . LEU A 1 167 ? 56.283  94.922  115.476 1.00 10.00 ? 167 LEU A CB  1 
ATOM 1368  C CG  . LEU A 1 167 ? 57.186  94.639  114.263 1.00 10.00 ? 167 LEU A CG  1 
ATOM 1369  C CD1 . LEU A 1 167 ? 56.383  94.703  113.045 1.00 10.00 ? 167 LEU A CD1 1 
ATOM 1370  C CD2 . LEU A 1 167 ? 58.333  95.627  114.160 1.00 10.00 ? 167 LEU A CD2 1 
ATOM 1371  N N   . SER A 1 168 ? 57.516  95.185  118.854 1.00 10.00 ? 168 SER A N   1 
ATOM 1372  C CA  . SER A 1 168 ? 58.443  95.850  119.745 1.00 10.00 ? 168 SER A CA  1 
ATOM 1373  C C   . SER A 1 168 ? 59.704  94.960  119.832 1.00 10.00 ? 168 SER A C   1 
ATOM 1374  O O   . SER A 1 168 ? 60.837  95.442  119.954 1.00 10.00 ? 168 SER A O   1 
ATOM 1375  C CB  . SER A 1 168 ? 57.792  96.015  121.135 1.00 10.00 ? 168 SER A CB  1 
ATOM 1376  O OG  . SER A 1 168 ? 57.495  94.772  121.766 1.00 10.00 ? 168 SER A OG  1 
ATOM 1377  N N   . THR A 1 169 ? 59.485  93.647  119.799 1.00 10.00 ? 169 THR A N   1 
ATOM 1378  C CA  . THR A 1 169 ? 60.582  92.677  119.843 1.00 10.00 ? 169 THR A CA  1 
ATOM 1379  C C   . THR A 1 169 ? 60.294  91.583  118.837 1.00 10.00 ? 169 THR A C   1 
ATOM 1380  O O   . THR A 1 169 ? 60.623  90.414  119.058 1.00 10.00 ? 169 THR A O   1 
ATOM 1381  C CB  . THR A 1 169 ? 60.722  92.001  121.209 1.00 10.00 ? 169 THR A CB  1 
ATOM 1382  O OG1 . THR A 1 169 ? 59.616  91.115  121.418 1.00 10.00 ? 169 THR A OG1 1 
ATOM 1383  C CG2 . THR A 1 169 ? 60.742  93.038  122.301 1.00 10.00 ? 169 THR A CG2 1 
ATOM 1384  N N   . PHE A 1 170 ? 59.644  91.965  117.746 1.00 10.00 ? 170 PHE A N   1 
ATOM 1385  C CA  . PHE A 1 170 ? 59.312  91.017  116.681 1.00 10.00 ? 170 PHE A CA  1 
ATOM 1386  C C   . PHE A 1 170 ? 60.607  90.541  116.058 1.00 10.00 ? 170 PHE A C   1 
ATOM 1387  O O   . PHE A 1 170 ? 61.544  91.322  115.900 1.00 10.00 ? 170 PHE A O   1 
ATOM 1388  C CB  . PHE A 1 170 ? 58.476  91.691  115.593 1.00 10.00 ? 170 PHE A CB  1 
ATOM 1389  C CG  . PHE A 1 170 ? 58.270  90.853  114.360 1.00 10.00 ? 170 PHE A CG  1 
ATOM 1390  C CD1 . PHE A 1 170 ? 57.388  89.779  114.371 1.00 10.00 ? 170 PHE A CD1 1 
ATOM 1391  C CD2 . PHE A 1 170 ? 58.906  91.178  113.170 1.00 10.00 ? 170 PHE A CD2 1 
ATOM 1392  C CE1 . PHE A 1 170 ? 57.137  89.051  113.213 1.00 10.00 ? 170 PHE A CE1 1 
ATOM 1393  C CE2 . PHE A 1 170 ? 58.658  90.451  112.000 1.00 10.00 ? 170 PHE A CE2 1 
ATOM 1394  C CZ  . PHE A 1 170 ? 57.771  89.391  112.026 1.00 10.00 ? 170 PHE A CZ  1 
ATOM 1395  N N   . MET A 1 171 ? 60.656  89.257  115.721 1.00 10.00 ? 171 MET A N   1 
ATOM 1396  C CA  . MET A 1 171 ? 61.839  88.662  115.081 1.00 10.00 ? 171 MET A CA  1 
ATOM 1397  C C   . MET A 1 171 ? 62.063  89.162  113.681 1.00 10.00 ? 171 MET A C   1 
ATOM 1398  O O   . MET A 1 171 ? 61.192  89.028  112.828 1.00 10.00 ? 171 MET A O   1 
ATOM 1399  C CB  . MET A 1 171 ? 61.743  87.128  114.967 1.00 10.00 ? 171 MET A CB  1 
ATOM 1400  C CG  . MET A 1 171 ? 62.838  86.475  114.043 1.00 10.00 ? 171 MET A CG  1 
ATOM 1401  S SD  . MET A 1 171 ? 63.101  84.679  114.294 1.00 10.00 ? 171 MET A SD  1 
ATOM 1402  C CE  . MET A 1 171 ? 61.311  84.089  114.435 1.00 10.00 ? 171 MET A CE  1 
ATOM 1403  N N   . GLU A 1 172 ? 63.248  89.723  113.467 1.00 10.00 ? 172 GLU A N   1 
ATOM 1404  C CA  . GLU A 1 172 ? 63.616  90.197  112.139 1.00 10.00 ? 172 GLU A CA  1 
ATOM 1405  C C   . GLU A 1 172 ? 63.981  89.036  111.221 1.00 10.00 ? 172 GLU A C   1 
ATOM 1406  O O   . GLU A 1 172 ? 64.158  89.198  110.022 1.00 10.00 ? 172 GLU A O   1 
ATOM 1407  C CB  . GLU A 1 172 ? 64.772  91.194  112.228 1.00 10.00 ? 172 GLU A CB  1 
ATOM 1408  C CG  . GLU A 1 172 ? 64.461  92.431  113.053 1.00 10.00 ? 172 GLU A CG  1 
ATOM 1409  C CD  . GLU A 1 172 ? 65.633  93.391  113.130 1.00 10.00 ? 172 GLU A CD  1 
ATOM 1410  O OE1 . GLU A 1 172 ? 66.686  93.090  112.530 1.00 10.00 ? 172 GLU A OE1 1 
ATOM 1411  O OE2 . GLU A 1 172 ? 65.497  94.443  113.789 1.00 10.00 ? 172 GLU A OE2 1 
ATOM 1412  N N   . SER A 1 173 ? 64.065  87.832  111.820 1.00 10.00 ? 173 SER A N   1 
ATOM 1413  C CA  . SER A 1 173 ? 64.385  86.601  111.080 1.00 10.00 ? 173 SER A CA  1 
ATOM 1414  C C   . SER A 1 173 ? 63.094  85.883  110.665 1.00 10.00 ? 173 SER A C   1 
ATOM 1415  O O   . SER A 1 173 ? 63.126  84.811  110.050 1.00 10.00 ? 173 SER A O   1 
ATOM 1416  C CB  . SER A 1 173 ? 65.255  85.666  111.931 1.00 10.00 ? 173 SER A CB  1 
ATOM 1417  O OG  . SER A 1 173 ? 65.757  84.593  111.154 1.00 10.00 ? 173 SER A OG  1 
ATOM 1418  N N   . GLY A 1 174 ? 61.959  86.502  110.986 1.00 10.00 ? 174 GLY A N   1 
ATOM 1419  C CA  . GLY A 1 174 ? 60.674  85.921  110.641 1.00 10.00 ? 174 GLY A CA  1 
ATOM 1420  C C   . GLY A 1 174 ? 60.371  86.034  109.159 1.00 10.00 ? 174 GLY A C   1 
ATOM 1421  O O   . GLY A 1 174 ? 60.761  87.007  108.519 1.00 10.00 ? 174 GLY A O   1 
ATOM 1422  N N   . GLU A 1 175 ? 59.693  85.131  108.522 1.00 10.00 ? 175 GLU A N   1 
ATOM 1423  C CA  . GLU A 1 175 ? 59.287  85.078  107.121 1.00 10.00 ? 175 GLU A CA  1 
ATOM 1424  C C   . GLU A 1 175 ? 57.983  85.850  106.949 1.00 10.00 ? 175 GLU A C   1 
ATOM 1425  O O   . GLU A 1 175 ? 57.297  85.801  105.954 1.00 10.00 ? 175 GLU A O   1 
ATOM 1426  C CB  . GLU A 1 175 ? 59.068  83.620  106.708 1.00 10.00 ? 175 GLU A CB  1 
ATOM 1427  C CG  . GLU A 1 175 ? 60.350  82.789  106.758 1.00 10.00 ? 175 GLU A CG  1 
ATOM 1428  C CD  . GLU A 1 175 ? 61.523  83.490  106.080 1.00 10.00 ? 175 GLU A CD  1 
ATOM 1429  O OE1 . GLU A 1 175 ? 61.354  84.653  105.553 1.00 10.00 ? 175 GLU A OE1 1 
ATOM 1430  O OE2 . GLU A 1 175 ? 62.675  82.917  106.036 1.00 10.00 ? 175 GLU A OE2 1 
ATOM 1431  N N   . TRP A 1 176 ? 57.687  86.602  108.029 1.00 10.00 ? 176 TRP A N   1 
ATOM 1432  C CA  . TRP A 1 176 ? 56.461  87.387  108.114 1.00 10.00 ? 176 TRP A CA  1 
ATOM 1433  C C   . TRP A 1 176 ? 56.800  88.797  108.591 1.00 10.00 ? 176 TRP A C   1 
ATOM 1434  O O   . TRP A 1 176 ? 57.935  89.081  108.968 1.00 10.00 ? 176 TRP A O   1 
ATOM 1435  C CB  . TRP A 1 176 ? 55.446  86.723  109.069 1.00 10.00 ? 176 TRP A CB  1 
ATOM 1436  C CG  . TRP A 1 176 ? 55.891  86.481  110.520 1.00 10.00 ? 176 TRP A CG  1 
ATOM 1437  C CD1 . TRP A 1 176 ? 55.383  87.067  111.644 1.00 10.00 ? 176 TRP A CD1 1 
ATOM 1438  C CD2 . TRP A 1 176 ? 56.857  85.518  110.982 1.00 10.00 ? 176 TRP A CD2 1 
ATOM 1439  N NE1 . TRP A 1 176 ? 55.959  86.530  112.768 1.00 10.00 ? 176 TRP A NE1 1 
ATOM 1440  C CE2 . TRP A 1 176 ? 56.867  85.577  112.391 1.00 10.00 ? 176 TRP A CE2 1 
ATOM 1441  C CE3 . TRP A 1 176 ? 57.709  84.609  110.340 1.00 10.00 ? 176 TRP A CE3 1 
ATOM 1442  C CZ2 . TRP A 1 176 ? 57.694  84.762  113.169 1.00 10.00 ? 176 TRP A CZ2 1 
ATOM 1443  C CZ3 . TRP A 1 176 ? 58.530  83.800  111.115 1.00 10.00 ? 176 TRP A CZ3 1 
ATOM 1444  C CH2 . TRP A 1 176 ? 58.515  83.882  112.514 1.00 10.00 ? 176 TRP A CH2 1 
ATOM 1445  N N   . VAL A 1 177 ? 55.812  89.694  108.508 1.00 10.00 ? 177 VAL A N   1 
ATOM 1446  C CA  . VAL A 1 177 ? 56.012  91.072  108.927 1.00 10.00 ? 177 VAL A CA  1 
ATOM 1447  C C   . VAL A 1 177 ? 54.716  91.571  109.597 1.00 10.00 ? 177 VAL A C   1 
ATOM 1448  O O   . VAL A 1 177 ? 53.598  91.206  109.201 1.00 10.00 ? 177 VAL A O   1 
ATOM 1449  C CB  . VAL A 1 177 ? 56.436  91.900  107.719 1.00 10.00 ? 177 VAL A CB  1 
ATOM 1450  C CG1 . VAL A 1 177 ? 55.236  92.150  106.820 1.00 10.00 ? 177 VAL A CG1 1 
ATOM 1451  C CG2 . VAL A 1 177 ? 57.176  93.116  108.179 1.00 10.00 ? 177 VAL A CG2 1 
ATOM 1452  N N   . MET A 1 178 ? 54.879  92.396  110.656 1.00 10.00 ? 178 MET A N   1 
ATOM 1453  C CA  . MET A 1 178 ? 53.870  92.898  111.580 1.00 10.00 ? 178 MET A CA  1 
ATOM 1454  C C   . MET A 1 178 ? 53.159  94.119  111.010 1.00 10.00 ? 178 MET A C   1 
ATOM 1455  O O   . MET A 1 178 ? 53.669  94.970  110.308 1.00 10.00 ? 178 MET A O   1 
ATOM 1456  C CB  . MET A 1 178 ? 54.503  93.231  112.933 1.00 10.00 ? 178 MET A CB  1 
ATOM 1457  C CG  . MET A 1 178 ? 55.151  92.041  113.624 1.00 10.00 ? 178 MET A CG  1 
ATOM 1458  S SD  . MET A 1 178 ? 53.943  90.876  114.281 1.00 10.00 ? 178 MET A SD  1 
ATOM 1459  C CE  . MET A 1 178 ? 53.283  91.812  115.659 1.00 10.00 ? 178 MET A CE  1 
ATOM 1460  N N   . LYS A 1 179 ? 51.846  94.252  111.410 1.00 10.00 ? 179 LYS A N   1 
ATOM 1461  C CA  . LYS A 1 179 ? 51.015  95.406  111.114 1.00 10.00 ? 179 LYS A CA  1 
ATOM 1462  C C   . LYS A 1 179 ? 50.785  96.240  112.367 1.00 10.00 ? 179 LYS A C   1 
ATOM 1463  O O   . LYS A 1 179 ? 51.030  97.439  112.412 1.00 10.00 ? 179 LYS A O   1 
ATOM 1464  C CB  . LYS A 1 179 ? 49.692  94.958  110.497 1.00 10.00 ? 179 LYS A CB  1 
ATOM 1465  C CG  . LYS A 1 179 ? 49.838  94.335  109.118 1.00 10.00 ? 179 LYS A CG  1 
ATOM 1466  C CD  . LYS A 1 179 ? 49.945  95.397  108.039 1.00 10.00 ? 179 LYS A CD  1 
ATOM 1467  C CE  . LYS A 1 179 ? 50.010  94.772  106.654 1.00 10.00 ? 179 LYS A CE  1 
ATOM 1468  N NZ  . LYS A 1 179 ? 50.240  95.790  105.594 1.00 10.00 ? 179 LYS A NZ  1 
ATOM 1469  N N   . ASP A 1 180 ? 50.382  95.554  113.440 1.00 10.00 ? 180 ASP A N   1 
ATOM 1470  C CA  . ASP A 1 180 ? 50.130  96.091  114.754 1.00 10.00 ? 180 ASP A CA  1 
ATOM 1471  C C   . ASP A 1 180 ? 49.683  95.004  115.712 1.00 10.00 ? 180 ASP A C   1 
ATOM 1472  O O   . ASP A 1 180 ? 49.403  93.916  115.336 1.00 10.00 ? 180 ASP A O   1 
ATOM 1473  C CB  . ASP A 1 180 ? 49.081  97.197  114.699 1.00 10.00 ? 180 ASP A CB  1 
ATOM 1474  C CG  . ASP A 1 180 ? 49.545  98.459  115.397 1.00 10.00 ? 180 ASP A CG  1 
ATOM 1475  O OD1 . ASP A 1 180 ? 50.581  99.020  114.979 1.00 10.00 ? 180 ASP A OD1 1 
ATOM 1476  O OD2 . ASP A 1 180 ? 48.875  98.888  116.358 1.00 10.00 ? 180 ASP A OD2 1 
ATOM 1477  N N   . TYR A 1 181 ? 49.756  95.261  117.016 1.00 10.00 ? 181 TYR A N   1 
ATOM 1478  C CA  . TYR A 1 181 ? 49.183  94.316  117.961 1.00 10.00 ? 181 TYR A CA  1 
ATOM 1479  C C   . TYR A 1 181 ? 48.724  95.031  119.216 1.00 10.00 ? 181 TYR A C   1 
ATOM 1480  O O   . TYR A 1 181 ? 49.429  95.870  119.782 1.00 10.00 ? 181 TYR A O   1 
ATOM 1481  C CB  . TYR A 1 181 ? 50.212  93.195  118.237 1.00 10.00 ? 181 TYR A CB  1 
ATOM 1482  C CG  . TYR A 1 181 ? 50.487  92.762  119.687 1.00 10.00 ? 181 TYR A CG  1 
ATOM 1483  C CD1 . TYR A 1 181 ? 50.087  91.498  120.174 1.00 10.00 ? 181 TYR A CD1 1 
ATOM 1484  C CD2 . TYR A 1 181 ? 51.266  93.576  120.534 1.00 10.00 ? 181 TYR A CD2 1 
ATOM 1485  C CE1 . TYR A 1 181 ? 50.468  91.069  121.469 1.00 10.00 ? 181 TYR A CE1 1 
ATOM 1486  C CE2 . TYR A 1 181 ? 51.655  93.158  121.814 1.00 10.00 ? 181 TYR A CE2 1 
ATOM 1487  C CZ  . TYR A 1 181 ? 51.255  91.909  122.279 1.00 10.00 ? 181 TYR A CZ  1 
ATOM 1488  O OH  . TYR A 1 181 ? 51.621  91.514  123.549 1.00 10.00 ? 181 TYR A OH  1 
ATOM 1489  N N   . ARG A 1 182 ? 47.508  94.713  119.628 1.00 10.00 ? 182 ARG A N   1 
ATOM 1490  C CA  . ARG A 1 182 ? 46.935  95.341  120.796 1.00 10.00 ? 182 ARG A CA  1 
ATOM 1491  C C   . ARG A 1 182 ? 46.394  94.327  121.778 1.00 10.00 ? 182 ARG A C   1 
ATOM 1492  O O   . ARG A 1 182 ? 46.091  93.196  121.420 1.00 10.00 ? 182 ARG A O   1 
ATOM 1493  C CB  . ARG A 1 182 ? 45.825  96.269  120.353 1.00 10.00 ? 182 ARG A CB  1 
ATOM 1494  C CG  . ARG A 1 182 ? 44.557  95.600  119.866 1.00 10.00 ? 182 ARG A CG  1 
ATOM 1495  C CD  . ARG A 1 182 ? 43.493  96.658  119.696 1.00 10.00 ? 182 ARG A CD  1 
ATOM 1496  N NE  . ARG A 1 182 ? 42.126  96.136  119.681 1.00 10.00 ? 182 ARG A NE  1 
ATOM 1497  C CZ  . ARG A 1 182 ? 41.062  96.857  119.331 1.00 10.00 ? 182 ARG A CZ  1 
ATOM 1498  N NH1 . ARG A 1 182 ? 41.202  98.128  118.959 1.00 10.00 ? 182 ARG A NH1 1 
ATOM 1499  N NH2 . ARG A 1 182 ? 39.856  96.313  119.374 1.00 10.00 ? 182 ARG A NH2 1 
ATOM 1500  N N   . GLY A 1 183 ? 46.267  94.730  123.031 1.00 10.00 ? 183 GLY A N   1 
ATOM 1501  C CA  . GLY A 1 183 ? 45.756  93.806  124.021 1.00 10.00 ? 183 GLY A CA  1 
ATOM 1502  C C   . GLY A 1 183 ? 44.888  94.511  125.031 1.00 10.00 ? 183 GLY A C   1 
ATOM 1503  O O   . GLY A 1 183 ? 45.332  95.442  125.696 1.00 10.00 ? 183 GLY A O   1 
ATOM 1504  N N   . TRP A 1 184 ? 43.638  94.091  125.144 1.00 10.00 ? 184 TRP A N   1 
ATOM 1505  C CA  . TRP A 1 184 ? 42.765  94.743  126.138 1.00 10.00 ? 184 TRP A CA  1 
ATOM 1506  C C   . TRP A 1 184 ? 42.221  93.683  127.092 1.00 10.00 ? 184 TRP A C   1 
ATOM 1507  O O   . TRP A 1 184 ? 42.172  92.486  126.768 1.00 10.00 ? 184 TRP A O   1 
ATOM 1508  C CB  . TRP A 1 184 ? 41.592  95.550  125.498 1.00 10.00 ? 184 TRP A CB  1 
ATOM 1509  C CG  . TRP A 1 184 ? 40.665  94.721  124.614 1.00 10.00 ? 184 TRP A CG  1 
ATOM 1510  C CD1 . TRP A 1 184 ? 40.929  94.274  123.336 1.00 10.00 ? 184 TRP A CD1 1 
ATOM 1511  C CD2 . TRP A 1 184 ? 39.345  94.253  124.932 1.00 10.00 ? 184 TRP A CD2 1 
ATOM 1512  N NE1 . TRP A 1 184 ? 39.856  93.565  122.844 1.00 10.00 ? 184 TRP A NE1 1 
ATOM 1513  C CE2 . TRP A 1 184 ? 38.870  93.531  123.795 1.00 10.00 ? 184 TRP A CE2 1 
ATOM 1514  C CE3 . TRP A 1 184 ? 38.520  94.364  126.052 1.00 10.00 ? 184 TRP A CE3 1 
ATOM 1515  C CZ2 . TRP A 1 184 ? 37.598  92.925  123.754 1.00 10.00 ? 184 TRP A CZ2 1 
ATOM 1516  C CZ3 . TRP A 1 184 ? 37.250  93.754  126.007 1.00 10.00 ? 184 TRP A CZ3 1 
ATOM 1517  C CH2 . TRP A 1 184 ? 36.810  93.047  124.860 1.00 10.00 ? 184 TRP A CH2 1 
ATOM 1518  N N   . LYS A 1 185 ? 41.820  94.143  128.267 1.00 10.00 ? 185 LYS A N   1 
ATOM 1519  C CA  . LYS A 1 185 ? 41.314  93.261  129.321 1.00 10.00 ? 185 LYS A CA  1 
ATOM 1520  C C   . LYS A 1 185 ? 39.872  92.813  129.202 1.00 10.00 ? 185 LYS A C   1 
ATOM 1521  O O   . LYS A 1 185 ? 39.090  93.346  128.414 1.00 10.00 ? 185 LYS A O   1 
ATOM 1522  C CB  . LYS A 1 185 ? 41.525  93.890  130.713 1.00 10.00 ? 185 LYS A CB  1 
ATOM 1523  C CG  . LYS A 1 185 ? 40.508  94.939  131.195 1.00 10.00 ? 185 LYS A CG  1 
ATOM 1524  C CD  . LYS A 1 185 ? 41.208  95.879  132.185 1.00 10.00 ? 185 LYS A CD  1 
ATOM 1525  C CE  . LYS A 1 185 ? 42.381  96.597  131.496 1.00 10.00 ? 185 LYS A CE  1 
ATOM 1526  N NZ  . LYS A 1 185 ? 43.495  97.014  132.407 1.00 10.00 ? 185 LYS A NZ  1 
ATOM 1527  N N   . HIS A 1 186 ? 39.535  91.809  130.002 1.00 10.00 ? 186 HIS A N   1 
ATOM 1528  C CA  . HIS A 1 186 ? 38.174  91.262  130.012 1.00 10.00 ? 186 HIS A CA  1 
ATOM 1529  C C   . HIS A 1 186 ? 38.035  90.257  131.141 1.00 10.00 ? 186 HIS A C   1 
ATOM 1530  O O   . HIS A 1 186 ? 38.988  89.586  131.552 1.00 10.00 ? 186 HIS A O   1 
ATOM 1531  C CB  . HIS A 1 186 ? 37.817  90.590  128.665 1.00 10.00 ? 186 HIS A CB  1 
ATOM 1532  C CG  . HIS A 1 186 ? 36.382  90.138  128.540 1.00 10.00 ? 186 HIS A CG  1 
ATOM 1533  N ND1 . HIS A 1 186 ? 35.696  89.485  129.547 1.00 10.00 ? 186 HIS A ND1 1 
ATOM 1534  C CD2 . HIS A 1 186 ? 35.532  90.178  127.481 1.00 10.00 ? 186 HIS A CD2 1 
ATOM 1535  C CE1 . HIS A 1 186 ? 34.492  89.144  129.114 1.00 10.00 ? 186 HIS A CE1 1 
ATOM 1536  N NE2 . HIS A 1 186 ? 34.364  89.551  127.864 1.00 10.00 ? 186 HIS A NE2 1 
ATOM 1537  N N   . TRP A 1 187 ? 36.843  90.204  131.612 1.00 10.00 ? 187 TRP A N   1 
ATOM 1538  C CA  . TRP A 1 187 ? 36.297  89.330  132.638 1.00 10.00 ? 187 TRP A CA  1 
ATOM 1539  C C   . TRP A 1 187 ? 35.259  88.376  132.067 1.00 10.00 ? 187 TRP A C   1 
ATOM 1540  O O   . TRP A 1 187 ? 34.310  88.908  131.495 1.00 10.00 ? 187 TRP A O   1 
ATOM 1541  C CB  . TRP A 1 187 ? 35.690  90.142  133.779 1.00 10.00 ? 187 TRP A CB  1 
ATOM 1542  C CG  . TRP A 1 187 ? 34.855  89.317  134.707 1.00 10.00 ? 187 TRP A CG  1 
ATOM 1543  C CD1 . TRP A 1 187 ? 35.305  88.463  135.672 1.00 10.00 ? 187 TRP A CD1 1 
ATOM 1544  C CD2 . TRP A 1 187 ? 33.426  89.264  134.758 1.00 10.00 ? 187 TRP A CD2 1 
ATOM 1545  N NE1 . TRP A 1 187 ? 34.244  87.882  136.321 1.00 10.00 ? 187 TRP A NE1 1 
ATOM 1546  C CE2 . TRP A 1 187 ? 33.078  88.358  135.779 1.00 10.00 ? 187 TRP A CE2 1 
ATOM 1547  C CE3 . TRP A 1 187 ? 32.406  89.895  134.041 1.00 10.00 ? 187 TRP A CE3 1 
ATOM 1548  C CZ2 . TRP A 1 187 ? 31.755  88.068  136.101 1.00 10.00 ? 187 TRP A CZ2 1 
ATOM 1549  C CZ3 . TRP A 1 187 ? 31.092  89.606  134.362 1.00 10.00 ? 187 TRP A CZ3 1 
ATOM 1550  C CH2 . TRP A 1 187 ? 30.779  88.701  135.383 1.00 10.00 ? 187 TRP A CH2 1 
ATOM 1551  N N   . VAL A 1 188 ? 35.467  87.096  132.101 1.00 10.00 ? 188 VAL A N   1 
ATOM 1552  C CA  . VAL A 1 188 ? 34.544  86.166  131.447 1.00 10.00 ? 188 VAL A CA  1 
ATOM 1553  C C   . VAL A 1 188 ? 33.541  85.477  132.370 1.00 10.00 ? 188 VAL A C   1 
ATOM 1554  O O   . VAL A 1 188 ? 33.902  84.523  133.034 1.00 10.00 ? 188 VAL A O   1 
ATOM 1555  C CB  . VAL A 1 188 ? 35.324  85.039  130.715 1.00 10.00 ? 188 VAL A CB  1 
ATOM 1556  C CG1 . VAL A 1 188 ? 34.363  84.172  129.921 1.00 10.00 ? 188 VAL A CG1 1 
ATOM 1557  C CG2 . VAL A 1 188 ? 36.395  85.633  129.816 1.00 10.00 ? 188 VAL A CG2 1 
ATOM 1558  N N   . TYR A 1 189 ? 32.291  85.935  132.401 1.00 10.00 ? 189 TYR A N   1 
ATOM 1559  C CA  . TYR A 1 189 ? 31.287  85.300  133.227 1.00 10.00 ? 189 TYR A CA  1 
ATOM 1560  C C   . TYR A 1 189 ? 30.499  84.405  132.221 1.00 10.00 ? 189 TYR A C   1 
ATOM 1561  O O   . TYR A 1 189 ? 30.233  84.844  131.102 1.00 10.00 ? 189 TYR A O   1 
ATOM 1562  C CB  . TYR A 1 189 ? 30.447  86.419  133.881 1.00 10.00 ? 189 TYR A CB  1 
ATOM 1563  C CG  . TYR A 1 189 ? 29.333  86.904  133.012 1.00 10.00 ? 189 TYR A CG  1 
ATOM 1564  C CD1 . TYR A 1 189 ? 28.014  86.665  133.373 1.00 10.00 ? 189 TYR A CD1 1 
ATOM 1565  C CD2 . TYR A 1 189 ? 29.589  87.478  131.763 1.00 10.00 ? 189 TYR A CD2 1 
ATOM 1566  C CE1 . TYR A 1 189 ? 26.969  86.970  132.509 1.00 10.00 ? 189 TYR A CE1 1 
ATOM 1567  C CE2 . TYR A 1 189 ? 28.551  87.785  130.881 1.00 10.00 ? 189 TYR A CE2 1 
ATOM 1568  C CZ  . TYR A 1 189 ? 27.239  87.523  131.258 1.00 10.00 ? 189 TYR A CZ  1 
ATOM 1569  O OH  . TYR A 1 189 ? 26.187  87.778  130.398 1.00 10.00 ? 189 TYR A OH  1 
ATOM 1570  N N   . TYR A 1 190 ? 30.174  83.150  132.561 1.00 10.00 ? 190 TYR A N   1 
ATOM 1571  C CA  . TYR A 1 190 ? 29.450  82.306  131.599 1.00 10.00 ? 190 TYR A CA  1 
ATOM 1572  C C   . TYR A 1 190 ? 27.965  82.110  131.891 1.00 10.00 ? 190 TYR A C   1 
ATOM 1573  O O   . TYR A 1 190 ? 27.569  81.870  133.032 1.00 10.00 ? 190 TYR A O   1 
ATOM 1574  C CB  . TYR A 1 190 ? 30.093  80.917  131.448 1.00 10.00 ? 190 TYR A CB  1 
ATOM 1575  C CG  . TYR A 1 190 ? 31.592  80.859  131.225 1.00 10.00 ? 190 TYR A CG  1 
ATOM 1576  C CD1 . TYR A 1 190 ? 32.483  81.237  132.228 1.00 10.00 ? 190 TYR A CD1 1 
ATOM 1577  C CD2 . TYR A 1 190 ? 32.119  80.353  130.037 1.00 10.00 ? 190 TYR A CD2 1 
ATOM 1578  C CE1 . TYR A 1 190 ? 33.860  81.103  132.059 1.00 10.00 ? 190 TYR A CE1 1 
ATOM 1579  C CE2 . TYR A 1 190 ? 33.496  80.221  129.856 1.00 10.00 ? 190 TYR A CE2 1 
ATOM 1580  C CZ  . TYR A 1 190 ? 34.359  80.596  130.872 1.00 10.00 ? 190 TYR A CZ  1 
ATOM 1581  O OH  . TYR A 1 190 ? 35.719  80.465  130.705 1.00 10.00 ? 190 TYR A OH  1 
ATOM 1582  N N   . THR A 1 191 ? 27.137  82.195  130.853 1.00 10.00 ? 191 THR A N   1 
ATOM 1583  C CA  . THR A 1 191 ? 25.702  82.001  131.035 1.00 10.00 ? 191 THR A CA  1 
ATOM 1584  C C   . THR A 1 191 ? 25.472  80.644  131.710 1.00 10.00 ? 191 THR A C   1 
ATOM 1585  O O   . THR A 1 191 ? 24.378  80.349  132.193 1.00 10.00 ? 191 THR A O   1 
ATOM 1586  C CB  . THR A 1 191 ? 24.949  82.040  129.689 1.00 10.00 ? 191 THR A CB  1 
ATOM 1587  O OG1 . THR A 1 191 ? 25.336  83.211  128.957 1.00 10.00 ? 191 THR A OG1 1 
ATOM 1588  C CG2 . THR A 1 191 ? 23.444  82.085  129.926 1.00 10.00 ? 191 THR A CG2 1 
ATOM 1589  N N   . CYS A 1 192 ? 26.521  79.824  131.736 1.00 10.00 ? 192 CYS A N   1 
ATOM 1590  C CA  . CYS A 1 192 ? 26.483  78.504  132.372 1.00 10.00 ? 192 CYS A CA  1 
ATOM 1591  C C   . CYS A 1 192 ? 26.008  78.654  133.789 1.00 10.00 ? 192 CYS A C   1 
ATOM 1592  O O   . CYS A 1 192 ? 24.906  78.274  134.188 1.00 10.00 ? 192 CYS A O   1 
ATOM 1593  C CB  . CYS A 1 192 ? 27.893  77.890  132.488 1.00 10.00 ? 192 CYS A CB  1 
ATOM 1594  S SG  . CYS A 1 192 ? 29.143  78.805  133.507 1.00 10.00 ? 192 CYS A SG  1 
ATOM 1595  N N   . CYS A 1 193 ? 26.931  79.237  134.527 1.00 10.00 ? 193 CYS A N   1 
ATOM 1596  C CA  . CYS A 1 193 ? 26.860  79.469  135.936 1.00 10.00 ? 193 CYS A CA  1 
ATOM 1597  C C   . CYS A 1 193 ? 26.619  80.938  136.202 1.00 10.00 ? 193 CYS A C   1 
ATOM 1598  O O   . CYS A 1 193 ? 27.117  81.816  135.479 1.00 10.00 ? 193 CYS A O   1 
ATOM 1599  C CB  . CYS A 1 193 ? 28.199  79.050  136.520 1.00 10.00 ? 193 CYS A CB  1 
ATOM 1600  S SG  . CYS A 1 193 ? 29.221  78.012  135.398 1.00 10.00 ? 193 CYS A SG  1 
ATOM 1601  N N   . PRO A 1 194 ? 25.870  81.243  137.269 1.00 10.00 ? 194 PRO A N   1 
ATOM 1602  C CA  . PRO A 1 194 ? 25.543  82.627  137.674 1.00 10.00 ? 194 PRO A CA  1 
ATOM 1603  C C   . PRO A 1 194 ? 26.747  83.304  138.353 1.00 10.00 ? 194 PRO A C   1 
ATOM 1604  O O   . PRO A 1 194 ? 26.681  84.469  138.710 1.00 10.00 ? 194 PRO A O   1 
ATOM 1605  C CB  . PRO A 1 194 ? 24.368  82.449  138.636 1.00 10.00 ? 194 PRO A CB  1 
ATOM 1606  C CG  . PRO A 1 194 ? 24.750  81.117  139.323 1.00 10.00 ? 194 PRO A CG  1 
ATOM 1607  C CD  . PRO A 1 194 ? 25.194  80.257  138.135 1.00 10.00 ? 194 PRO A CD  1 
ATOM 1608  N N   . ASP A 1 195 ? 27.850  82.560  138.454 1.00 10.00 ? 195 ASP A N   1 
ATOM 1609  C CA  . ASP A 1 195 ? 29.079  83.010  139.094 1.00 10.00 ? 195 ASP A CA  1 
ATOM 1610  C C   . ASP A 1 195 ? 29.934  83.951  138.241 1.00 10.00 ? 195 ASP A C   1 
ATOM 1611  O O   . ASP A 1 195 ? 29.731  84.073  137.032 1.00 10.00 ? 195 ASP A O   1 
ATOM 1612  C CB  . ASP A 1 195 ? 29.874  81.769  139.532 1.00 10.00 ? 195 ASP A CB  1 
ATOM 1613  C CG  . ASP A 1 195 ? 31.378  81.858  139.231 1.00 10.00 ? 195 ASP A CG  1 
ATOM 1614  O OD1 . ASP A 1 195 ? 31.755  82.272  138.115 1.00 10.00 ? 195 ASP A OD1 1 
ATOM 1615  O OD2 . ASP A 1 195 ? 32.189  81.473  140.103 1.00 10.00 ? 195 ASP A OD2 1 
ATOM 1616  N N   . THR A 1 196 ? 30.875  84.628  138.906 1.00 10.00 ? 196 THR A N   1 
ATOM 1617  C CA  . THR A 1 196 ? 31.802  85.575  138.289 1.00 10.00 ? 196 THR A CA  1 
ATOM 1618  C C   . THR A 1 196 ? 33.189  84.917  138.086 1.00 10.00 ? 196 THR A C   1 
ATOM 1619  O O   . THR A 1 196 ? 33.968  84.801  139.026 1.00 10.00 ? 196 THR A O   1 
ATOM 1620  C CB  . THR A 1 196 ? 31.887  86.822  139.194 1.00 10.00 ? 196 THR A CB  1 
ATOM 1621  O OG1 . THR A 1 196 ? 30.565  87.357  139.354 1.00 10.00 ? 196 THR A OG1 1 
ATOM 1622  C CG2 . THR A 1 196 ? 32.823  87.884  138.605 1.00 10.00 ? 196 THR A CG2 1 
ATOM 1623  N N   . PRO A 1 197 ? 33.479  84.444  136.853 1.00 10.00 ? 197 PRO A N   1 
ATOM 1624  C CA  . PRO A 1 197 ? 34.702  83.772  136.395 1.00 10.00 ? 197 PRO A CA  1 
ATOM 1625  C C   . PRO A 1 197 ? 35.983  84.557  136.125 1.00 10.00 ? 197 PRO A C   1 
ATOM 1626  O O   . PRO A 1 197 ? 35.965  85.779  136.021 1.00 10.00 ? 197 PRO A O   1 
ATOM 1627  C CB  . PRO A 1 197 ? 34.230  83.016  135.153 1.00 10.00 ? 197 PRO A CB  1 
ATOM 1628  C CG  . PRO A 1 197 ? 32.724  82.935  135.328 1.00 10.00 ? 197 PRO A CG  1 
ATOM 1629  C CD  . PRO A 1 197 ? 32.410  84.276  135.862 1.00 10.00 ? 197 PRO A CD  1 
ATOM 1630  N N   . TYR A 1 198 ? 37.094  83.825  136.007 1.00 10.00 ? 198 TYR A N   1 
ATOM 1631  C CA  . TYR A 1 198 ? 38.426  84.373  135.767 1.00 10.00 ? 198 TYR A CA  1 
ATOM 1632  C C   . TYR A 1 198 ? 38.542  85.579  134.838 1.00 10.00 ? 198 TYR A C   1 
ATOM 1633  O O   . TYR A 1 198 ? 37.647  85.872  134.042 1.00 10.00 ? 198 TYR A O   1 
ATOM 1634  C CB  . TYR A 1 198 ? 39.384  83.284  135.254 1.00 10.00 ? 198 TYR A CB  1 
ATOM 1635  C CG  . TYR A 1 198 ? 39.202  82.831  133.808 1.00 10.00 ? 198 TYR A CG  1 
ATOM 1636  C CD1 . TYR A 1 198 ? 40.310  82.425  133.035 1.00 10.00 ? 198 TYR A CD1 1 
ATOM 1637  C CD2 . TYR A 1 198 ? 37.915  82.677  133.248 1.00 10.00 ? 198 TYR A CD2 1 
ATOM 1638  C CE1 . TYR A 1 198 ? 40.136  81.854  131.755 1.00 10.00 ? 198 TYR A CE1 1 
ATOM 1639  C CE2 . TYR A 1 198 ? 37.732  82.114  131.963 1.00 10.00 ? 198 TYR A CE2 1 
ATOM 1640  C CZ  . TYR A 1 198 ? 38.840  81.698  131.230 1.00 10.00 ? 198 TYR A CZ  1 
ATOM 1641  O OH  . TYR A 1 198 ? 38.620  81.088  130.011 1.00 10.00 ? 198 TYR A OH  1 
ATOM 1642  N N   . LEU A 1 199 ? 39.665  86.284  134.971 1.00 10.00 ? 199 LEU A N   1 
ATOM 1643  C CA  . LEU A 1 199 ? 39.956  87.450  134.136 1.00 10.00 ? 199 LEU A CA  1 
ATOM 1644  C C   . LEU A 1 199 ? 40.983  87.016  133.091 1.00 10.00 ? 199 LEU A C   1 
ATOM 1645  O O   . LEU A 1 199 ? 41.648  86.001  133.265 1.00 10.00 ? 199 LEU A O   1 
ATOM 1646  C CB  . LEU A 1 199 ? 40.506  88.591  134.995 1.00 10.00 ? 199 LEU A CB  1 
ATOM 1647  C CG  . LEU A 1 199 ? 39.685  89.010  136.224 1.00 10.00 ? 199 LEU A CG  1 
ATOM 1648  C CD1 . LEU A 1 199 ? 40.363  90.192  136.905 1.00 10.00 ? 199 LEU A CD1 1 
ATOM 1649  C CD2 . LEU A 1 199 ? 38.265  89.379  135.811 1.00 10.00 ? 199 LEU A CD2 1 
ATOM 1650  N N   . ASP A 1 200 ? 41.112  87.796  132.024 1.00 10.00 ? 200 ASP A N   1 
ATOM 1651  C CA  . ASP A 1 200 ? 42.009  87.432  130.935 1.00 10.00 ? 200 ASP A CA  1 
ATOM 1652  C C   . ASP A 1 200 ? 42.641  88.532  130.080 1.00 10.00 ? 200 ASP A C   1 
ATOM 1653  O O   . ASP A 1 200 ? 42.030  89.573  129.842 1.00 10.00 ? 200 ASP A O   1 
ATOM 1654  C CB  . ASP A 1 200 ? 41.255  86.511  130.014 1.00 10.00 ? 200 ASP A CB  1 
ATOM 1655  C CG  . ASP A 1 200 ? 39.742  86.569  130.224 1.00 10.00 ? 200 ASP A CG  1 
ATOM 1656  O OD1 . ASP A 1 200 ? 39.288  86.396  131.373 1.00 10.00 ? 200 ASP A OD1 1 
ATOM 1657  O OD2 . ASP A 1 200 ? 39.001  86.766  129.232 1.00 10.00 ? 200 ASP A OD2 1 
ATOM 1658  N N   . ILE A 1 201 ? 43.871  88.295  129.624 1.00 10.00 ? 201 ILE A N   1 
ATOM 1659  C CA  . ILE A 1 201 ? 44.591  89.241  128.753 1.00 10.00 ? 201 ILE A CA  1 
ATOM 1660  C C   . ILE A 1 201 ? 44.488  88.664  127.333 1.00 10.00 ? 201 ILE A C   1 
ATOM 1661  O O   . ILE A 1 201 ? 44.983  87.558  127.070 1.00 10.00 ? 201 ILE A O   1 
ATOM 1662  C CB  . ILE A 1 201 ? 46.111  89.321  129.026 1.00 10.00 ? 201 ILE A CB  1 
ATOM 1663  C CG1 . ILE A 1 201 ? 46.457  90.338  130.086 1.00 10.00 ? 201 ILE A CG1 1 
ATOM 1664  C CG2 . ILE A 1 201 ? 46.797  89.734  127.778 1.00 10.00 ? 201 ILE A CG2 1 
ATOM 1665  C CD1 . ILE A 1 201 ? 47.924  90.768  130.001 1.00 10.00 ? 201 ILE A CD1 1 
ATOM 1666  N N   . THR A 1 202 ? 43.861  89.383  126.419 1.00 10.00 ? 202 THR A N   1 
ATOM 1667  C CA  . THR A 1 202 ? 43.721  88.912  125.043 1.00 10.00 ? 202 THR A CA  1 
ATOM 1668  C C   . THR A 1 202 ? 44.676  89.634  124.082 1.00 10.00 ? 202 THR A C   1 
ATOM 1669  O O   . THR A 1 202 ? 44.523  90.830  123.842 1.00 10.00 ? 202 THR A O   1 
ATOM 1670  C CB  . THR A 1 202 ? 42.251  89.083  124.497 1.00 10.00 ? 202 THR A CB  1 
ATOM 1671  O OG1 . THR A 1 202 ? 41.744  90.396  124.796 1.00 10.00 ? 202 THR A OG1 1 
ATOM 1672  C CG2 . THR A 1 202 ? 41.353  88.056  125.078 1.00 10.00 ? 202 THR A CG2 1 
ATOM 1673  N N   . TYR A 1 203 ? 45.628  88.884  123.519 1.00 10.00 ? 203 TYR A N   1 
ATOM 1674  C CA  . TYR A 1 203 ? 46.611  89.382  122.557 1.00 10.00 ? 203 TYR A CA  1 
ATOM 1675  C C   . TYR A 1 203 ? 45.993  89.312  121.169 1.00 10.00 ? 203 TYR A C   1 
ATOM 1676  O O   . TYR A 1 203 ? 45.193  88.425  120.895 1.00 10.00 ? 203 TYR A O   1 
ATOM 1677  C CB  . TYR A 1 203 ? 47.862  88.481  122.494 1.00 10.00 ? 203 TYR A CB  1 
ATOM 1678  C CG  . TYR A 1 203 ? 48.634  88.276  123.764 1.00 10.00 ? 203 TYR A CG  1 
ATOM 1679  C CD1 . TYR A 1 203 ? 49.898  87.698  123.738 1.00 10.00 ? 203 TYR A CD1 1 
ATOM 1680  C CD2 . TYR A 1 203 ? 48.147  88.719  124.983 1.00 10.00 ? 203 TYR A CD2 1 
ATOM 1681  C CE1 . TYR A 1 203 ? 50.672  87.581  124.917 1.00 10.00 ? 203 TYR A CE1 1 
ATOM 1682  C CE2 . TYR A 1 203 ? 48.910  88.608  126.150 1.00 10.00 ? 203 TYR A CE2 1 
ATOM 1683  C CZ  . TYR A 1 203 ? 50.166  88.048  126.116 1.00 10.00 ? 203 TYR A CZ  1 
ATOM 1684  O OH  . TYR A 1 203 ? 50.889  88.006  127.280 1.00 10.00 ? 203 TYR A OH  1 
ATOM 1685  N N   . HIS A 1 204 ? 46.367  90.243  120.301 1.00 10.00 ? 204 HIS A N   1 
ATOM 1686  C CA  . HIS A 1 204 ? 45.924  90.221  118.942 1.00 10.00 ? 204 HIS A CA  1 
ATOM 1687  C C   . HIS A 1 204 ? 47.163  90.516  118.128 1.00 10.00 ? 204 HIS A C   1 
ATOM 1688  O O   . HIS A 1 204 ? 47.756  91.576  118.252 1.00 10.00 ? 204 HIS A O   1 
ATOM 1689  C CB  . HIS A 1 204 ? 44.829  91.229  118.694 1.00 10.00 ? 204 HIS A CB  1 
ATOM 1690  C CG  . HIS A 1 204 ? 43.459  90.644  118.772 1.00 10.00 ? 204 HIS A CG  1 
ATOM 1691  N ND1 . HIS A 1 204 ? 42.577  90.666  117.711 1.00 10.00 ? 204 HIS A ND1 1 
ATOM 1692  C CD2 . HIS A 1 204 ? 42.807  90.036  119.789 1.00 10.00 ? 204 HIS A CD2 1 
ATOM 1693  C CE1 . HIS A 1 204 ? 41.438  90.101  118.073 1.00 10.00 ? 204 HIS A CE1 1 
ATOM 1694  N NE2 . HIS A 1 204 ? 41.551  89.710  119.329 1.00 10.00 ? 204 HIS A NE2 1 
ATOM 1695  N N   . PHE A 1 205 ? 47.569  89.531  117.324 1.00 10.00 ? 205 PHE A N   1 
ATOM 1696  C CA  . PHE A 1 205 ? 48.748  89.652  116.475 1.00 10.00 ? 205 PHE A CA  1 
ATOM 1697  C C   . PHE A 1 205 ? 48.284  89.915  115.047 1.00 10.00 ? 205 PHE A C   1 
ATOM 1698  O O   . PHE A 1 205 ? 47.721  89.032  114.427 1.00 10.00 ? 205 PHE A O   1 
ATOM 1699  C CB  . PHE A 1 205 ? 49.555  88.354  116.500 1.00 10.00 ? 205 PHE A CB  1 
ATOM 1700  C CG  . PHE A 1 205 ? 50.284  88.107  117.773 1.00 10.00 ? 205 PHE A CG  1 
ATOM 1701  C CD1 . PHE A 1 205 ? 49.604  88.064  118.973 1.00 10.00 ? 205 PHE A CD1 1 
ATOM 1702  C CD2 . PHE A 1 205 ? 51.648  87.893  117.761 1.00 10.00 ? 205 PHE A CD2 1 
ATOM 1703  C CE1 . PHE A 1 205 ? 50.274  87.809  120.154 1.00 10.00 ? 205 PHE A CE1 1 
ATOM 1704  C CE2 . PHE A 1 205 ? 52.327  87.639  118.918 1.00 10.00 ? 205 PHE A CE2 1 
ATOM 1705  C CZ  . PHE A 1 205 ? 51.642  87.594  120.131 1.00 10.00 ? 205 PHE A CZ  1 
ATOM 1706  N N   . ILE A 1 206 ? 48.428  91.088  114.633 1.00 10.00 ? 206 ILE A N   1 
ATOM 1707  C CA  . ILE A 1 206 ? 48.106  91.409  113.237 1.00 10.00 ? 206 ILE A CA  1 
ATOM 1708  C C   . ILE A 1 206 ? 49.367  91.529  112.382 1.00 10.00 ? 206 ILE A C   1 
ATOM 1709  O O   . ILE A 1 206 ? 50.124  92.493  112.546 1.00 10.00 ? 206 ILE A O   1 
ATOM 1710  C CB  . ILE A 1 206 ? 47.311  92.726  113.117 1.00 10.00 ? 206 ILE A CB  1 
ATOM 1711  C CG1 . ILE A 1 206 ? 46.068  92.683  114.008 1.00 10.00 ? 206 ILE A CG1 1 
ATOM 1712  C CG2 . ILE A 1 206 ? 46.928  92.989  111.667 1.00 10.00 ? 206 ILE A CG2 1 
ATOM 1713  C CD1 . ILE A 1 206 ? 46.320  93.130  115.431 1.00 10.00 ? 206 ILE A CD1 1 
ATOM 1714  N N   . MET A 1 207 ? 49.739  90.407  111.684 1.00 10.00 ? 207 MET A N   1 
ATOM 1715  C CA  . MET A 1 207 ? 50.869  90.485  110.765 1.00 10.00 ? 207 MET A CA  1 
ATOM 1716  C C   . MET A 1 207 ? 50.590  89.710  109.482 1.00 10.00 ? 207 MET A C   1 
ATOM 1717  O O   . MET A 1 207 ? 50.060  88.631  109.378 1.00 10.00 ? 207 MET A O   1 
ATOM 1718  C CB  . MET A 1 207 ? 52.142  89.967  111.437 1.00 10.00 ? 207 MET A CB  1 
ATOM 1719  C CG  . MET A 1 207 ? 52.154  88.465  111.666 1.00 10.00 ? 207 MET A CG  1 
ATOM 1720  S SD  . MET A 1 207 ? 50.864  87.925  112.805 1.00 10.00 ? 207 MET A SD  1 
ATOM 1721  C CE  . MET A 1 207 ? 49.593  87.405  111.655 1.00 10.00 ? 207 MET A CE  1 
ATOM 1722  N N   . GLN A 1 208 ? 51.203  90.337  108.396 1.00 10.00 ? 208 GLN A N   1 
ATOM 1723  C CA  . GLN A 1 208 ? 51.143  89.840  107.009 1.00 10.00 ? 208 GLN A CA  1 
ATOM 1724  C C   . GLN A 1 208 ? 52.505  89.186  106.636 1.00 10.00 ? 208 GLN A C   1 
ATOM 1725  O O   . GLN A 1 208 ? 53.573  89.692  107.009 1.00 10.00 ? 208 GLN A O   1 
ATOM 1726  C CB  . GLN A 1 208 ? 50.855  90.995  106.049 1.00 10.00 ? 208 GLN A CB  1 
ATOM 1727  C CG  . GLN A 1 208 ? 51.994  92.007  105.975 1.00 10.00 ? 208 GLN A CG  1 
ATOM 1728  C CD  . GLN A 1 208 ? 51.662  93.208  105.092 1.00 10.00 ? 208 GLN A CD  1 
ATOM 1729  O OE1 . GLN A 1 208 ? 50.575  93.269  104.519 1.00 10.00 ? 208 GLN A OE1 1 
ATOM 1730  N NE2 . GLN A 1 208 ? 52.545  94.177  104.947 1.00 10.00 ? 208 GLN A NE2 1 
ATOM 1731  N N   . ARG A 1 209 ? 52.437  88.085  105.866 1.00 10.00 ? 209 ARG A N   1 
ATOM 1732  C CA  . ARG A 1 209 ? 53.627  87.219  105.572 1.00 10.00 ? 209 ARG A CA  1 
ATOM 1733  C C   . ARG A 1 209 ? 54.325  87.416  104.238 1.00 10.00 ? 209 ARG A C   1 
ATOM 1734  O O   . ARG A 1 209 ? 54.434  88.454  103.679 1.00 10.00 ? 209 ARG A O   1 
ATOM 1735  C CB  . ARG A 1 209 ? 53.221  85.744  105.613 1.00 10.00 ? 209 ARG A CB  1 
ATOM 1736  C CG  . ARG A 1 209 ? 54.392  84.813  105.930 1.00 10.00 ? 209 ARG A CG  1 
ATOM 1737  C CD  . ARG A 1 209 ? 54.200  84.012  107.221 1.00 10.00 ? 209 ARG A CD  1 
ATOM 1738  N NE  . ARG A 1 209 ? 55.323  83.101  107.486 1.00 10.00 ? 209 ARG A NE  1 
ATOM 1739  C CZ  . ARG A 1 209 ? 55.490  82.416  108.624 1.00 10.00 ? 209 ARG A CZ  1 
ATOM 1740  N NH1 . ARG A 1 209 ? 54.612  82.520  109.629 1.00 10.00 ? 209 ARG A NH1 1 
ATOM 1741  N NH2 . ARG A 1 209 ? 56.520  81.590  108.853 1.00 10.00 ? 209 ARG A NH2 1 
ATOM 1742  N N   . ILE A 1 210 ? 55.029  86.308  103.782 1.00 10.00 ? 210 ILE A N   1 
ATOM 1743  C CA  . ILE A 1 210 ? 55.670  86.037  102.504 1.00 10.00 ? 210 ILE A CA  1 
ATOM 1744  C C   . ILE A 1 210 ? 56.965  86.852  102.380 1.00 10.00 ? 210 ILE A C   1 
ATOM 1745  O O   . ILE A 1 210 ? 56.945  87.972  101.891 1.00 10.00 ? 210 ILE A O   1 
ATOM 1746  C CB  . ILE A 1 210 ? 54.741  86.322  101.318 1.00 10.00 ? 210 ILE A CB  1 
ATOM 1747  C CG1 . ILE A 1 210 ? 53.278  86.228  101.756 1.00 10.00 ? 210 ILE A CG1 1 
ATOM 1748  C CG2 . ILE A 1 210 ? 55.028  85.355  100.179 1.00 10.00 ? 210 ILE A CG2 1 
ATOM 1749  C CD1 . ILE A 1 210 ? 52.309  86.882  100.797 1.00 10.00 ? 210 ILE A CD1 1 
ATOM 1750  N N   . PRO A 1 211 ? 58.154  86.214  102.625 1.00 10.00 ? 211 PRO A N   1 
ATOM 1751  C CA  . PRO A 1 211 ? 59.458  86.831  102.280 1.00 10.00 ? 211 PRO A CA  1 
ATOM 1752  C C   . PRO A 1 211 ? 59.560  86.803  100.680 1.00 10.00 ? 211 PRO A C   1 
ATOM 1753  O O   . PRO A 1 211 ? 59.217  85.764  100.035 1.00 10.00 ? 211 PRO A O   1 
ATOM 1754  C CB  . PRO A 1 211 ? 60.486  85.906  102.963 1.00 10.00 ? 211 PRO A CB  1 
ATOM 1755  C CG  . PRO A 1 211 ? 59.741  84.642  103.234 1.00 10.00 ? 211 PRO A CG  1 
ATOM 1756  C CD  . PRO A 1 211 ? 58.343  85.086  103.551 1.00 10.00 ? 211 PRO A CD  1 
ATOM 1757  N N   . LEU A 1 212 ? 60.000  87.966  100.139 1.00 10.00 ? 212 LEU A N   1 
ATOM 1758  C CA  . LEU A 1 212 ? 60.111  88.222  98.704  1.00 10.00 ? 212 LEU A CA  1 
ATOM 1759  C C   . LEU A 1 212 ? 60.971  87.375  97.775  1.00 10.00 ? 212 LEU A C   1 
ATOM 1760  O O   . LEU A 1 212 ? 60.827  87.484  96.558  1.00 10.00 ? 212 LEU A O   1 
ATOM 1761  C CB  . LEU A 1 212 ? 60.516  89.686  98.497  1.00 10.00 ? 212 LEU A CB  1 
ATOM 1762  C CG  . LEU A 1 212 ? 59.668  90.780  99.154  1.00 10.00 ? 212 LEU A CG  1 
ATOM 1763  C CD1 . LEU A 1 212 ? 60.321  92.134  98.922  1.00 10.00 ? 212 LEU A CD1 1 
ATOM 1764  C CD2 . LEU A 1 212 ? 58.257  90.761  98.586  1.00 10.00 ? 212 LEU A CD2 1 
ATOM 1765  N N   . TYR A 1 213 ? 61.870  86.539  98.296  1.00 10.00 ? 213 TYR A N   1 
ATOM 1766  C CA  . TYR A 1 213 ? 62.715  85.720  97.406  1.00 10.00 ? 213 TYR A CA  1 
ATOM 1767  C C   . TYR A 1 213 ? 61.789  84.860  96.530  1.00 10.00 ? 213 TYR A C   1 
ATOM 1768  O O   . TYR A 1 213 ? 61.889  84.835  95.298  1.00 10.00 ? 213 TYR A O   1 
ATOM 1769  C CB  . TYR A 1 213 ? 63.665  84.839  98.232  1.00 10.00 ? 213 TYR A CB  1 
ATOM 1770  C CG  . TYR A 1 213 ? 63.100  83.495  98.644  1.00 10.00 ? 213 TYR A CG  1 
ATOM 1771  C CD1 . TYR A 1 213 ? 63.242  82.376  97.822  1.00 10.00 ? 213 TYR A CD1 1 
ATOM 1772  C CD2 . TYR A 1 213 ? 62.412  83.342  99.847  1.00 10.00 ? 213 TYR A CD2 1 
ATOM 1773  C CE1 . TYR A 1 213 ? 62.715  81.136  98.188  1.00 10.00 ? 213 TYR A CE1 1 
ATOM 1774  C CE2 . TYR A 1 213 ? 61.879  82.105  100.222 1.00 10.00 ? 213 TYR A CE2 1 
ATOM 1775  C CZ  . TYR A 1 213 ? 62.036  81.009  99.388  1.00 10.00 ? 213 TYR A CZ  1 
ATOM 1776  O OH  . TYR A 1 213 ? 61.519  79.786  99.753  1.00 10.00 ? 213 TYR A OH  1 
ATOM 1777  N N   . PHE A 1 214 ? 60.855  84.192  97.190  1.00 10.00 ? 214 PHE A N   1 
ATOM 1778  C CA  . PHE A 1 214 ? 59.880  83.339  96.541  1.00 10.00 ? 214 PHE A CA  1 
ATOM 1779  C C   . PHE A 1 214 ? 59.301  84.026  95.301  1.00 10.00 ? 214 PHE A C   1 
ATOM 1780  O O   . PHE A 1 214 ? 59.264  83.461  94.196  1.00 10.00 ? 214 PHE A O   1 
ATOM 1781  C CB  . PHE A 1 214 ? 58.784  83.017  97.558  1.00 10.00 ? 214 PHE A CB  1 
ATOM 1782  C CG  . PHE A 1 214 ? 57.615  82.284  96.987  1.00 10.00 ? 214 PHE A CG  1 
ATOM 1783  C CD1 . PHE A 1 214 ? 57.769  81.435  95.896  1.00 10.00 ? 214 PHE A CD1 1 
ATOM 1784  C CD2 . PHE A 1 214 ? 56.375  82.392  97.573  1.00 10.00 ? 214 PHE A CD2 1 
ATOM 1785  C CE1 . PHE A 1 214 ? 56.726  80.706  95.400  1.00 10.00 ? 214 PHE A CE1 1 
ATOM 1786  C CE2 . PHE A 1 214 ? 55.319  81.662  97.081  1.00 10.00 ? 214 PHE A CE2 1 
ATOM 1787  C CZ  . PHE A 1 214 ? 55.496  80.812  95.987  1.00 10.00 ? 214 PHE A CZ  1 
ATOM 1788  N N   . VAL A 1 215 ? 58.848  85.250  95.524  1.00 10.00 ? 215 VAL A N   1 
ATOM 1789  C CA  . VAL A 1 215 ? 58.253  86.134  94.539  1.00 10.00 ? 215 VAL A CA  1 
ATOM 1790  C C   . VAL A 1 215 ? 59.008  86.052  93.194  1.00 10.00 ? 215 VAL A C   1 
ATOM 1791  O O   . VAL A 1 215 ? 58.456  85.638  92.159  1.00 10.00 ? 215 VAL A O   1 
ATOM 1792  C CB  . VAL A 1 215 ? 58.266  87.618  95.110  1.00 10.00 ? 215 VAL A CB  1 
ATOM 1793  C CG1 . VAL A 1 215 ? 57.188  88.479  94.442  1.00 10.00 ? 215 VAL A CG1 1 
ATOM 1794  C CG2 . VAL A 1 215 ? 58.059  87.608  96.631  1.00 10.00 ? 215 VAL A CG2 1 
ATOM 1795  N N   . VAL A 1 216 ? 60.293  86.384  93.213  1.00 10.00 ? 216 VAL A N   1 
ATOM 1796  C CA  . VAL A 1 216 ? 61.048  86.392  91.970  1.00 10.00 ? 216 VAL A CA  1 
ATOM 1797  C C   . VAL A 1 216 ? 61.206  85.071  91.228  1.00 10.00 ? 216 VAL A C   1 
ATOM 1798  O O   . VAL A 1 216 ? 60.849  85.022  90.062  1.00 10.00 ? 216 VAL A O   1 
ATOM 1799  C CB  . VAL A 1 216 ? 62.422  87.043  92.155  1.00 10.00 ? 216 VAL A CB  1 
ATOM 1800  C CG1 . VAL A 1 216 ? 63.120  87.161  90.809  1.00 10.00 ? 216 VAL A CG1 1 
ATOM 1801  C CG2 . VAL A 1 216 ? 62.250  88.425  92.785  1.00 10.00 ? 216 VAL A CG2 1 
ATOM 1802  N N   . ASN A 1 217 ? 61.736  84.020  91.860  1.00 10.00 ? 217 ASN A N   1 
ATOM 1803  C CA  . ASN A 1 217 ? 61.884  82.742  91.178  1.00 10.00 ? 217 ASN A CA  1 
ATOM 1804  C C   . ASN A 1 217 ? 60.633  82.291  90.432  1.00 10.00 ? 217 ASN A C   1 
ATOM 1805  O O   . ASN A 1 217 ? 60.712  81.970  89.257  1.00 10.00 ? 217 ASN A O   1 
ATOM 1806  C CB  . ASN A 1 217 ? 62.295  81.650  92.174  1.00 10.00 ? 217 ASN A CB  1 
ATOM 1807  C CG  . ASN A 1 217 ? 62.591  80.317  91.498  1.00 10.00 ? 217 ASN A CG  1 
ATOM 1808  O OD1 . ASN A 1 217 ? 63.532  80.202  90.713  1.00 10.00 ? 217 ASN A OD1 1 
ATOM 1809  N ND2 . ASN A 1 217 ? 61.785  79.305  91.802  1.00 10.00 ? 217 ASN A ND2 1 
ATOM 1810  N N   . VAL A 1 218 ? 59.489  82.255  91.110  1.00 10.00 ? 218 VAL A N   1 
ATOM 1811  C CA  . VAL A 1 218 ? 58.260  81.794  90.467  1.00 10.00 ? 218 VAL A CA  1 
ATOM 1812  C C   . VAL A 1 218 ? 57.673  82.633  89.344  1.00 10.00 ? 218 VAL A C   1 
ATOM 1813  O O   . VAL A 1 218 ? 57.333  82.085  88.295  1.00 10.00 ? 218 VAL A O   1 
ATOM 1814  C CB  . VAL A 1 218 ? 57.116  81.557  91.479  1.00 10.00 ? 218 VAL A CB  1 
ATOM 1815  C CG1 . VAL A 1 218 ? 56.348  82.832  91.682  1.00 10.00 ? 218 VAL A CG1 1 
ATOM 1816  C CG2 . VAL A 1 218 ? 56.173  80.469  90.983  1.00 10.00 ? 218 VAL A CG2 1 
ATOM 1817  N N   . ILE A 1 219 ? 57.503  83.941  89.516  1.00 10.00 ? 219 ILE A N   1 
ATOM 1818  C CA  . ILE A 1 219 ? 56.903  84.654  88.391  1.00 10.00 ? 219 ILE A CA  1 
ATOM 1819  C C   . ILE A 1 219 ? 57.819  84.752  87.183  1.00 10.00 ? 219 ILE A C   1 
ATOM 1820  O O   . ILE A 1 219 ? 57.330  84.956  86.080  1.00 10.00 ? 219 ILE A O   1 
ATOM 1821  C CB  . ILE A 1 219 ? 56.370  86.096  88.737  1.00 10.00 ? 219 ILE A CB  1 
ATOM 1822  C CG1 . ILE A 1 219 ? 54.966  86.020  89.358  1.00 10.00 ? 219 ILE A CG1 1 
ATOM 1823  C CG2 . ILE A 1 219 ? 56.260  86.934  87.466  1.00 10.00 ? 219 ILE A CG2 1 
ATOM 1824  C CD1 . ILE A 1 219 ? 54.209  87.332  89.331  1.00 10.00 ? 219 ILE A CD1 1 
ATOM 1825  N N   . ILE A 1 220 ? 59.129  84.573  87.340  1.00 10.00 ? 220 ILE A N   1 
ATOM 1826  C CA  . ILE A 1 220 ? 59.942  84.711  86.145  1.00 10.00 ? 220 ILE A CA  1 
ATOM 1827  C C   . ILE A 1 220 ? 59.941  83.477  85.205  1.00 10.00 ? 220 ILE A C   1 
ATOM 1828  O O   . ILE A 1 220 ? 60.070  83.646  84.002  1.00 10.00 ? 220 ILE A O   1 
ATOM 1829  C CB  . ILE A 1 220 ? 61.388  85.149  86.490  1.00 10.00 ? 220 ILE A CB  1 
ATOM 1830  C CG1 . ILE A 1 220 ? 61.349  86.409  87.370  1.00 10.00 ? 220 ILE A CG1 1 
ATOM 1831  C CG2 . ILE A 1 220 ? 62.173  85.421  85.198  1.00 10.00 ? 220 ILE A CG2 1 
ATOM 1832  C CD1 . ILE A 1 220 ? 62.699  86.851  87.850  1.00 10.00 ? 220 ILE A CD1 1 
ATOM 1833  N N   . PRO A 1 221 ? 59.833  82.216  85.727  1.00 10.00 ? 221 PRO A N   1 
ATOM 1834  C CA  . PRO A 1 221 ? 59.814  81.123  84.757  1.00 10.00 ? 221 PRO A CA  1 
ATOM 1835  C C   . PRO A 1 221 ? 58.435  81.187  84.079  1.00 10.00 ? 221 PRO A C   1 
ATOM 1836  O O   . PRO A 1 221 ? 58.186  80.552  83.045  1.00 10.00 ? 221 PRO A O   1 
ATOM 1837  C CB  . PRO A 1 221 ? 59.978  79.889  85.633  1.00 10.00 ? 221 PRO A CB  1 
ATOM 1838  C CG  . PRO A 1 221 ? 59.212  80.269  86.849  1.00 10.00 ? 221 PRO A CG  1 
ATOM 1839  C CD  . PRO A 1 221 ? 59.667  81.698  87.091  1.00 10.00 ? 221 PRO A CD  1 
ATOM 1840  N N   . CYS A 1 222 ? 57.533  81.969  84.670  1.00 10.00 ? 222 CYS A N   1 
ATOM 1841  C CA  . CYS A 1 222 ? 56.225  82.096  84.103  1.00 10.00 ? 222 CYS A CA  1 
ATOM 1842  C C   . CYS A 1 222 ? 56.350  83.003  82.898  1.00 10.00 ? 222 CYS A C   1 
ATOM 1843  O O   . CYS A 1 222 ? 55.821  82.678  81.846  1.00 10.00 ? 222 CYS A O   1 
ATOM 1844  C CB  . CYS A 1 222 ? 55.242  82.664  85.111  1.00 10.00 ? 222 CYS A CB  1 
ATOM 1845  S SG  . CYS A 1 222 ? 54.799  81.489  86.284  1.00 10.00 ? 222 CYS A SG  1 
ATOM 1846  N N   . LEU A 1 223 ? 56.985  84.162  83.056  1.00 10.00 ? 223 LEU A N   1 
ATOM 1847  C CA  . LEU A 1 223 ? 57.150  84.999  81.878  1.00 10.00 ? 223 LEU A CA  1 
ATOM 1848  C C   . LEU A 1 223 ? 58.115  84.243  80.977  1.00 10.00 ? 223 LEU A C   1 
ATOM 1849  O O   . LEU A 1 223 ? 58.124  84.461  79.773  1.00 10.00 ? 223 LEU A O   1 
ATOM 1850  C CB  . LEU A 1 223 ? 57.665  86.392  82.224  1.00 10.00 ? 223 LEU A CB  1 
ATOM 1851  C CG  . LEU A 1 223 ? 56.676  87.136  83.133  1.00 10.00 ? 223 LEU A CG  1 
ATOM 1852  C CD1 . LEU A 1 223 ? 57.133  88.576  83.259  1.00 10.00 ? 223 LEU A CD1 1 
ATOM 1853  C CD2 . LEU A 1 223 ? 55.222  87.043  82.606  1.00 10.00 ? 223 LEU A CD2 1 
ATOM 1854  N N   . LEU A 1 224 ? 58.924  83.363  81.578  1.00 10.00 ? 224 LEU A N   1 
ATOM 1855  C CA  . LEU A 1 224 ? 59.854  82.458  80.829  1.00 10.00 ? 224 LEU A CA  1 
ATOM 1856  C C   . LEU A 1 224 ? 59.021  81.646  79.899  1.00 10.00 ? 224 LEU A C   1 
ATOM 1857  O O   . LEU A 1 224 ? 59.159  81.696  78.685  1.00 10.00 ? 224 LEU A O   1 
ATOM 1858  C CB  . LEU A 1 224 ? 60.520  81.370  81.710  1.00 10.00 ? 224 LEU A CB  1 
ATOM 1859  C CG  . LEU A 1 224 ? 60.435  79.831  81.378  1.00 10.00 ? 224 LEU A CG  1 
ATOM 1860  C CD1 . LEU A 1 224 ? 61.329  79.482  80.182  1.00 10.00 ? 224 LEU A CD1 1 
ATOM 1861  C CD2 . LEU A 1 224 ? 60.858  78.987  82.591  1.00 10.00 ? 224 LEU A CD2 1 
ATOM 1862  N N   . PHE A 1 225 ? 58.204  80.832  80.550  1.00 10.00 ? 225 PHE A N   1 
ATOM 1863  C CA  . PHE A 1 225 ? 57.300  79.903  79.876  1.00 10.00 ? 225 PHE A CA  1 
ATOM 1864  C C   . PHE A 1 225 ? 56.438  80.765  78.973  1.00 10.00 ? 225 PHE A C   1 
ATOM 1865  O O   . PHE A 1 225 ? 56.091  80.372  77.858  1.00 10.00 ? 225 PHE A O   1 
ATOM 1866  C CB  . PHE A 1 225 ? 56.480  79.060  80.917  1.00 10.00 ? 225 PHE A CB  1 
ATOM 1867  C CG  . PHE A 1 225 ? 54.998  79.403  81.004  1.00 10.00 ? 225 PHE A CG  1 
ATOM 1868  C CD1 . PHE A 1 225 ? 54.432  79.775  82.211  1.00 10.00 ? 225 PHE A CD1 1 
ATOM 1869  C CD2 . PHE A 1 225 ? 54.187  79.410  79.878  1.00 10.00 ? 225 PHE A CD2 1 
ATOM 1870  C CE1 . PHE A 1 225 ? 53.107  80.155  82.289  1.00 10.00 ? 225 PHE A CE1 1 
ATOM 1871  C CE2 . PHE A 1 225 ? 52.865  79.791  79.957  1.00 10.00 ? 225 PHE A CE2 1 
ATOM 1872  C CZ  . PHE A 1 225 ? 52.330  80.164  81.162  1.00 10.00 ? 225 PHE A CZ  1 
ATOM 1873  N N   . SER A 1 226 ? 56.132  81.968  79.445  1.00 10.00 ? 226 SER A N   1 
ATOM 1874  C CA  . SER A 1 226 ? 55.337  82.892  78.669  1.00 10.00 ? 226 SER A CA  1 
ATOM 1875  C C   . SER A 1 226 ? 56.034  83.013  77.311  1.00 10.00 ? 226 SER A C   1 
ATOM 1876  O O   . SER A 1 226 ? 55.417  82.789  76.285  1.00 10.00 ? 226 SER A O   1 
ATOM 1877  C CB  . SER A 1 226 ? 55.233  84.256  79.392  1.00 10.00 ? 226 SER A CB  1 
ATOM 1878  O OG  . SER A 1 226 ? 54.575  84.189  80.658  1.00 10.00 ? 226 SER A OG  1 
ATOM 1879  N N   . PHE A 1 227 ? 57.333  83.301  77.305  1.00 10.00 ? 227 PHE A N   1 
ATOM 1880  C CA  . PHE A 1 227 ? 58.024  83.441  76.018  1.00 10.00 ? 227 PHE A CA  1 
ATOM 1881  C C   . PHE A 1 227 ? 58.095  82.160  75.222  1.00 10.00 ? 227 PHE A C   1 
ATOM 1882  O O   . PHE A 1 227 ? 58.009  82.202  74.008  1.00 10.00 ? 227 PHE A O   1 
ATOM 1883  C CB  . PHE A 1 227 ? 59.446  83.997  76.187  1.00 10.00 ? 227 PHE A CB  1 
ATOM 1884  C CG  . PHE A 1 227 ? 60.080  84.473  74.891  1.00 10.00 ? 227 PHE A CG  1 
ATOM 1885  C CD1 . PHE A 1 227 ? 59.288  84.780  73.779  1.00 10.00 ? 227 PHE A CD1 1 
ATOM 1886  C CD2 . PHE A 1 227 ? 61.458  84.736  74.816  1.00 10.00 ? 227 PHE A CD2 1 
ATOM 1887  C CE1 . PHE A 1 227 ? 59.853  85.358  72.615  1.00 10.00 ? 227 PHE A CE1 1 
ATOM 1888  C CE2 . PHE A 1 227 ? 62.025  85.320  73.642  1.00 10.00 ? 227 PHE A CE2 1 
ATOM 1889  C CZ  . PHE A 1 227 ? 61.215  85.629  72.550  1.00 10.00 ? 227 PHE A CZ  1 
ATOM 1890  N N   . LEU A 1 228 ? 58.293  81.010  75.881  1.00 10.00 ? 228 LEU A N   1 
ATOM 1891  C CA  . LEU A 1 228 ? 58.339  79.748  75.100  1.00 10.00 ? 228 LEU A CA  1 
ATOM 1892  C C   . LEU A 1 228 ? 56.954  79.494  74.538  1.00 10.00 ? 228 LEU A C   1 
ATOM 1893  O O   . LEU A 1 228 ? 56.819  79.056  73.400  1.00 10.00 ? 228 LEU A O   1 
ATOM 1894  C CB  . LEU A 1 228 ? 58.751  78.484  75.910  1.00 10.00 ? 228 LEU A CB  1 
ATOM 1895  C CG  . LEU A 1 228 ? 60.186  77.929  76.110  1.00 10.00 ? 228 LEU A CG  1 
ATOM 1896  C CD1 . LEU A 1 228 ? 60.111  76.470  76.374  1.00 10.00 ? 228 LEU A CD1 1 
ATOM 1897  C CD2 . LEU A 1 228 ? 61.032  78.093  74.927  1.00 10.00 ? 228 LEU A CD2 1 
ATOM 1898  N N   . THR A 1 229 ? 55.920  79.767  75.331  1.00 10.00 ? 229 THR A N   1 
ATOM 1899  C CA  . THR A 1 229 ? 54.576  79.543  74.845  1.00 10.00 ? 229 THR A CA  1 
ATOM 1900  C C   . THR A 1 229 ? 54.393  80.722  73.863  1.00 10.00 ? 229 THR A C   1 
ATOM 1901  O O   . THR A 1 229 ? 53.722  80.577  72.852  1.00 10.00 ? 229 THR A O   1 
ATOM 1902  C CB  . THR A 1 229 ? 53.514  79.531  76.033  1.00 10.00 ? 229 THR A CB  1 
ATOM 1903  O OG1 . THR A 1 229 ? 53.948  78.637  77.059  1.00 10.00 ? 229 THR A OG1 1 
ATOM 1904  C CG2 . THR A 1 229 ? 52.149  79.044  75.569  1.00 10.00 ? 229 THR A CG2 1 
ATOM 1905  N N   . VAL A 1 230 ? 55.020  81.865  74.174  1.00 10.00 ? 230 VAL A N   1 
ATOM 1906  C CA  . VAL A 1 230 ? 54.998  83.060  73.325  1.00 10.00 ? 230 VAL A CA  1 
ATOM 1907  C C   . VAL A 1 230 ? 55.625  82.611  72.020  1.00 10.00 ? 230 VAL A C   1 
ATOM 1908  O O   . VAL A 1 230 ? 55.222  83.021  70.928  1.00 10.00 ? 230 VAL A O   1 
ATOM 1909  C CB  . VAL A 1 230 ? 55.882  84.202  73.899  1.00 10.00 ? 230 VAL A CB  1 
ATOM 1910  C CG1 . VAL A 1 230 ? 56.302  85.146  72.787  1.00 10.00 ? 230 VAL A CG1 1 
ATOM 1911  C CG2 . VAL A 1 230 ? 55.133  84.971  74.972  1.00 10.00 ? 230 VAL A CG2 1 
ATOM 1912  N N   . LEU A 1 231 ? 56.645  81.775  72.157  1.00 10.00 ? 231 LEU A N   1 
ATOM 1913  C CA  . LEU A 1 231 ? 57.334  81.225  71.007  1.00 10.00 ? 231 LEU A CA  1 
ATOM 1914  C C   . LEU A 1 231 ? 56.404  80.140  70.507  1.00 10.00 ? 231 LEU A C   1 
ATOM 1915  O O   . LEU A 1 231 ? 56.316  79.888  69.318  1.00 10.00 ? 231 LEU A O   1 
ATOM 1916  C CB  . LEU A 1 231 ? 58.683  80.630  71.416  1.00 10.00 ? 231 LEU A CB  1 
ATOM 1917  C CG  . LEU A 1 231 ? 59.752  81.637  71.850  1.00 10.00 ? 231 LEU A CG  1 
ATOM 1918  C CD1 . LEU A 1 231 ? 60.984  80.896  72.341  1.00 10.00 ? 231 LEU A CD1 1 
ATOM 1919  C CD2 . LEU A 1 231 ? 60.100  82.550  70.683  1.00 10.00 ? 231 LEU A CD2 1 
ATOM 1920  N N   . VAL A 1 232 ? 55.698  79.509  71.438  1.00 10.00 ? 232 VAL A N   1 
ATOM 1921  C CA  . VAL A 1 232 ? 54.734  78.456  71.092  1.00 10.00 ? 232 VAL A CA  1 
ATOM 1922  C C   . VAL A 1 232 ? 53.748  79.092  70.102  1.00 10.00 ? 232 VAL A C   1 
ATOM 1923  O O   . VAL A 1 232 ? 53.162  78.393  69.266  1.00 10.00 ? 232 VAL A O   1 
ATOM 1924  C CB  . VAL A 1 232 ? 53.971  77.871  72.386  1.00 10.00 ? 232 VAL A CB  1 
ATOM 1925  C CG1 . VAL A 1 232 ? 52.548  77.353  72.024  1.00 10.00 ? 232 VAL A CG1 1 
ATOM 1926  C CG2 . VAL A 1 232 ? 54.772  76.725  73.009  1.00 10.00 ? 232 VAL A CG2 1 
ATOM 1927  N N   . PHE A 1 233 ? 53.600  80.422  70.158  1.00 10.00 ? 233 PHE A N   1 
ATOM 1928  C CA  . PHE A 1 233 ? 52.679  81.075  69.246  1.00 10.00 ? 233 PHE A CA  1 
ATOM 1929  C C   . PHE A 1 233 ? 53.502  81.518  68.028  1.00 10.00 ? 233 PHE A C   1 
ATOM 1930  O O   . PHE A 1 233 ? 53.195  81.143  66.908  1.00 10.00 ? 233 PHE A O   1 
ATOM 1931  C CB  . PHE A 1 233 ? 52.032  82.338  69.847  1.00 10.00 ? 233 PHE A CB  1 
ATOM 1932  C CG  . PHE A 1 233 ? 51.415  82.166  71.196  1.00 10.00 ? 233 PHE A CG  1 
ATOM 1933  C CD1 . PHE A 1 233 ? 52.195  82.087  72.324  1.00 10.00 ? 233 PHE A CD1 1 
ATOM 1934  C CD2 . PHE A 1 233 ? 50.039  82.219  71.344  1.00 10.00 ? 233 PHE A CD2 1 
ATOM 1935  C CE1 . PHE A 1 233 ? 51.634  82.071  73.594  1.00 10.00 ? 233 PHE A CE1 1 
ATOM 1936  C CE2 . PHE A 1 233 ? 49.455  82.205  72.621  1.00 10.00 ? 233 PHE A CE2 1 
ATOM 1937  C CZ  . PHE A 1 233 ? 50.260  82.131  73.746  1.00 10.00 ? 233 PHE A CZ  1 
ATOM 1938  N N   . TYR A 1 234 ? 54.552  82.311  68.268  1.00 10.00 ? 234 TYR A N   1 
ATOM 1939  C CA  . TYR A 1 234 ? 55.357  82.831  67.166  1.00 10.00 ? 234 TYR A CA  1 
ATOM 1940  C C   . TYR A 1 234 ? 56.206  81.828  66.377  1.00 10.00 ? 234 TYR A C   1 
ATOM 1941  O O   . TYR A 1 234 ? 56.489  82.044  65.193  1.00 10.00 ? 234 TYR A O   1 
ATOM 1942  C CB  . TYR A 1 234 ? 56.243  83.977  67.667  1.00 10.00 ? 234 TYR A CB  1 
ATOM 1943  C CG  . TYR A 1 234 ? 55.566  85.334  67.617  1.00 10.00 ? 234 TYR A CG  1 
ATOM 1944  C CD1 . TYR A 1 234 ? 55.176  85.896  66.399  1.00 10.00 ? 234 TYR A CD1 1 
ATOM 1945  C CD2 . TYR A 1 234 ? 55.316  86.058  68.781  1.00 10.00 ? 234 TYR A CD2 1 
ATOM 1946  C CE1 . TYR A 1 234 ? 54.557  87.142  66.343  1.00 10.00 ? 234 TYR A CE1 1 
ATOM 1947  C CE2 . TYR A 1 234 ? 54.697  87.307  68.735  1.00 10.00 ? 234 TYR A CE2 1 
ATOM 1948  C CZ  . TYR A 1 234 ? 54.321  87.840  67.514  1.00 10.00 ? 234 TYR A CZ  1 
ATOM 1949  O OH  . TYR A 1 234 ? 53.705  89.067  67.470  1.00 10.00 ? 234 TYR A OH  1 
ATOM 1950  N N   . LEU A 1 235 ? 56.626  80.743  67.032  1.00 10.00 ? 235 LEU A N   1 
ATOM 1951  C CA  . LEU A 1 235 ? 57.440  79.717  66.377  1.00 10.00 ? 235 LEU A CA  1 
ATOM 1952  C C   . LEU A 1 235 ? 56.732  79.069  65.190  1.00 10.00 ? 235 LEU A C   1 
ATOM 1953  O O   . LEU A 1 235 ? 57.320  78.882  64.121  1.00 10.00 ? 235 LEU A O   1 
ATOM 1954  C CB  . LEU A 1 235 ? 57.853  78.643  67.382  1.00 10.00 ? 235 LEU A CB  1 
ATOM 1955  C CG  . LEU A 1 235 ? 58.991  77.715  66.998  1.00 10.00 ? 235 LEU A CG  1 
ATOM 1956  C CD1 . LEU A 1 235 ? 60.001  77.675  68.105  1.00 10.00 ? 235 LEU A CD1 1 
ATOM 1957  C CD2 . LEU A 1 235 ? 58.438  76.352  66.734  1.00 10.00 ? 235 LEU A CD2 1 
ATOM 1958  N N   . PRO A 1 236 ? 55.455  78.713  65.372  1.00 10.00 ? 236 PRO A N   1 
ATOM 1959  C CA  . PRO A 1 236 ? 54.559  78.079  64.387  1.00 10.00 ? 236 PRO A CA  1 
ATOM 1960  C C   . PRO A 1 236 ? 54.191  78.981  63.214  1.00 10.00 ? 236 PRO A C   1 
ATOM 1961  O O   . PRO A 1 236 ? 54.280  78.597  62.049  1.00 10.00 ? 236 PRO A O   1 
ATOM 1962  C CB  . PRO A 1 236 ? 53.302  77.752  65.210  1.00 10.00 ? 236 PRO A CB  1 
ATOM 1963  C CG  . PRO A 1 236 ? 53.266  78.839  66.250  1.00 10.00 ? 236 PRO A CG  1 
ATOM 1964  C CD  . PRO A 1 236 ? 54.736  78.892  66.660  1.00 10.00 ? 236 PRO A CD  1 
ATOM 1965  N N   . THR A 1 237 ? 53.770  80.207  63.532  1.00 10.00 ? 237 THR A N   1 
ATOM 1966  C CA  . THR A 1 237 ? 53.360  81.118  62.464  1.00 10.00 ? 237 THR A CA  1 
ATOM 1967  C C   . THR A 1 237 ? 54.534  81.646  61.655  1.00 10.00 ? 237 THR A C   1 
ATOM 1968  O O   . THR A 1 237 ? 54.367  82.014  60.503  1.00 10.00 ? 237 THR A O   1 
ATOM 1969  C CB  . THR A 1 237 ? 52.568  82.335  62.992  1.00 10.00 ? 237 THR A CB  1 
ATOM 1970  O OG1 . THR A 1 237 ? 52.103  83.112  61.886  1.00 10.00 ? 237 THR A OG1 1 
ATOM 1971  C CG2 . THR A 1 237 ? 53.447  83.164  63.898  1.00 10.00 ? 237 THR A CG2 1 
ATOM 1972  N N   . ASP A 1 238 ? 55.719  81.675  62.252  1.00 10.00 ? 238 ASP A N   1 
ATOM 1973  C CA  . ASP A 1 238 ? 56.881  82.175  61.571  1.00 10.00 ? 238 ASP A CA  1 
ATOM 1974  C C   . ASP A 1 238 ? 57.712  80.937  61.095  1.00 10.00 ? 238 ASP A C   1 
ATOM 1975  O O   . ASP A 1 238 ? 58.640  81.048  60.273  1.00 10.00 ? 238 ASP A O   1 
ATOM 1976  C CB  . ASP A 1 238 ? 57.637  83.091  62.544  1.00 10.00 ? 238 ASP A CB  1 
ATOM 1977  C CG  . ASP A 1 238 ? 57.864  84.506  61.988  1.00 10.00 ? 238 ASP A CG  1 
ATOM 1978  O OD1 . ASP A 1 238 ? 57.625  84.707  60.776  1.00 10.00 ? 238 ASP A OD1 1 
ATOM 1979  O OD2 . ASP A 1 238 ? 58.292  85.399  62.770  1.00 10.00 ? 238 ASP A OD2 1 
ATOM 1980  N N   . SER A 1 239 ? 57.366  79.753  61.623  1.00 10.00 ? 239 SER A N   1 
ATOM 1981  C CA  . SER A 1 239 ? 58.016  78.482  61.225  1.00 10.00 ? 239 SER A CA  1 
ATOM 1982  C C   . SER A 1 239 ? 57.330  77.240  61.758  1.00 10.00 ? 239 SER A C   1 
ATOM 1983  O O   . SER A 1 239 ? 57.491  76.833  62.908  1.00 10.00 ? 239 SER A O   1 
ATOM 1984  C CB  . SER A 1 239 ? 59.497  78.435  61.609  1.00 10.00 ? 239 SER A CB  1 
ATOM 1985  O OG  . SER A 1 239 ? 60.167  77.553  60.749  1.00 10.00 ? 239 SER A OG  1 
ATOM 1986  N N   . GLY A 1 240 ? 56.572  76.622  60.873  1.00 10.00 ? 240 GLY A N   1 
ATOM 1987  C CA  . GLY A 1 240 ? 55.867  75.413  61.232  1.00 10.00 ? 240 GLY A CA  1 
ATOM 1988  C C   . GLY A 1 240 ? 56.744  74.189  61.029  1.00 10.00 ? 240 GLY A C   1 
ATOM 1989  O O   . GLY A 1 240 ? 56.287  73.055  61.151  1.00 10.00 ? 240 GLY A O   1 
ATOM 1990  N N   . GLU A 1 241 ? 58.045  74.388  60.749  1.00 10.00 ? 241 GLU A N   1 
ATOM 1991  C CA  . GLU A 1 241 ? 58.989  73.309  60.488  1.00 10.00 ? 241 GLU A CA  1 
ATOM 1992  C C   . GLU A 1 241 ? 59.347  72.567  61.771  1.00 10.00 ? 241 GLU A C   1 
ATOM 1993  O O   . GLU A 1 241 ? 59.803  71.417  61.693  1.00 10.00 ? 241 GLU A O   1 
ATOM 1994  C CB  . GLU A 1 241 ? 60.252  73.851  59.816  1.00 10.00 ? 241 GLU A CB  1 
ATOM 1995  C CG  . GLU A 1 241 ? 61.189  72.774  59.295  1.00 10.00 ? 241 GLU A CG  1 
ATOM 1996  C CD  . GLU A 1 241 ? 62.433  73.348  58.645  1.00 10.00 ? 241 GLU A CD  1 
ATOM 1997  O OE1 . GLU A 1 241 ? 62.301  74.304  57.852  1.00 10.00 ? 241 GLU A OE1 1 
ATOM 1998  O OE2 . GLU A 1 241 ? 63.539  72.842  58.928  1.00 10.00 ? 241 GLU A OE2 1 
ATOM 1999  N N   . LYS A 1 242 ? 59.158  73.171  62.925  1.00 10.00 ? 242 LYS A N   1 
ATOM 2000  C CA  . LYS A 1 242 ? 59.555  72.481  64.131  1.00 10.00 ? 242 LYS A CA  1 
ATOM 2001  C C   . LYS A 1 242 ? 58.413  72.374  65.122  1.00 10.00 ? 242 LYS A C   1 
ATOM 2002  O O   . LYS A 1 242 ? 58.544  72.630  66.332  1.00 10.00 ? 242 LYS A O   1 
ATOM 2003  C CB  . LYS A 1 242 ? 60.775  73.151  64.743  1.00 10.00 ? 242 LYS A CB  1 
ATOM 2004  C CG  . LYS A 1 242 ? 60.581  74.513  65.281  1.00 10.00 ? 242 LYS A CG  1 
ATOM 2005  C CD  . LYS A 1 242 ? 61.924  75.070  65.607  1.00 10.00 ? 242 LYS A CD  1 
ATOM 2006  C CE  . LYS A 1 242 ? 61.825  76.427  66.190  1.00 10.00 ? 242 LYS A CE  1 
ATOM 2007  N NZ  . LYS A 1 242 ? 63.156  76.903  66.590  1.00 10.00 ? 242 LYS A NZ  1 
ATOM 2008  N N   . MET A 1 243 ? 57.261  72.007  64.567  1.00 10.00 ? 243 MET A N   1 
ATOM 2009  C CA  . MET A 1 243 ? 56.033  71.805  65.316  1.00 10.00 ? 243 MET A CA  1 
ATOM 2010  C C   . MET A 1 243 ? 56.292  70.724  66.346  1.00 10.00 ? 243 MET A C   1 
ATOM 2011  O O   . MET A 1 243 ? 56.076  70.928  67.536  1.00 10.00 ? 243 MET A O   1 
ATOM 2012  C CB  . MET A 1 243 ? 54.925  71.344  64.373  1.00 10.00 ? 243 MET A CB  1 
ATOM 2013  C CG  . MET A 1 243 ? 55.278  70.108  63.531  1.00 10.00 ? 243 MET A CG  1 
ATOM 2014  S SD  . MET A 1 243 ? 56.462  70.406  62.194  1.00 10.00 ? 243 MET A SD  1 
ATOM 2015  C CE  . MET A 1 243 ? 57.918  69.617  62.835  1.00 10.00 ? 243 MET A CE  1 
ATOM 2016  N N   . THR A 1 244 ? 56.759  69.574  65.868  1.00 10.00 ? 244 THR A N   1 
ATOM 2017  C CA  . THR A 1 244 ? 57.060  68.462  66.745  1.00 10.00 ? 244 THR A CA  1 
ATOM 2018  C C   . THR A 1 244 ? 58.180  68.918  67.654  1.00 10.00 ? 244 THR A C   1 
ATOM 2019  O O   . THR A 1 244 ? 58.179  68.642  68.849  1.00 10.00 ? 244 THR A O   1 
ATOM 2020  C CB  . THR A 1 244 ? 57.529  67.211  65.974  1.00 10.00 ? 244 THR A CB  1 
ATOM 2021  O OG1 . THR A 1 244 ? 57.780  66.150  66.904  1.00 10.00 ? 244 THR A OG1 1 
ATOM 2022  C CG2 . THR A 1 244 ? 58.805  67.500  65.200  1.00 10.00 ? 244 THR A CG2 1 
ATOM 2023  N N   . LEU A 1 245 ? 59.148  69.633  67.100  1.00 10.00 ? 245 LEU A N   1 
ATOM 2024  C CA  . LEU A 1 245 ? 60.263  70.142  67.920  1.00 10.00 ? 245 LEU A CA  1 
ATOM 2025  C C   . LEU A 1 245 ? 59.685  70.783  69.167  1.00 10.00 ? 245 LEU A C   1 
ATOM 2026  O O   . LEU A 1 245 ? 60.127  70.509  70.285  1.00 10.00 ? 245 LEU A O   1 
ATOM 2027  C CB  . LEU A 1 245 ? 61.104  71.173  67.188  1.00 10.00 ? 245 LEU A CB  1 
ATOM 2028  C CG  . LEU A 1 245 ? 62.482  71.303  67.847  1.00 10.00 ? 245 LEU A CG  1 
ATOM 2029  C CD1 . LEU A 1 245 ? 63.131  69.928  67.888  1.00 10.00 ? 245 LEU A CD1 1 
ATOM 2030  C CD2 . LEU A 1 245 ? 63.372  72.306  67.090  1.00 10.00 ? 245 LEU A CD2 1 
ATOM 2031  N N   . SER A 1 246 ? 58.622  71.544  68.976  1.00 10.00 ? 246 SER A N   1 
ATOM 2032  C CA  . SER A 1 246 ? 57.991  72.184  70.115  1.00 10.00 ? 246 SER A CA  1 
ATOM 2033  C C   . SER A 1 246 ? 57.222  71.113  70.906  1.00 10.00 ? 246 SER A C   1 
ATOM 2034  O O   . SER A 1 246 ? 56.990  71.282  72.099  1.00 10.00 ? 246 SER A O   1 
ATOM 2035  C CB  . SER A 1 246 ? 57.080  73.336  69.660  1.00 10.00 ? 246 SER A CB  1 
ATOM 2036  O OG  . SER A 1 246 ? 57.110  74.412  70.603  1.00 10.00 ? 246 SER A OG  1 
ATOM 2037  N N   . ILE A 1 247 ? 56.841  70.012  70.246  1.00 10.00 ? 247 ILE A N   1 
ATOM 2038  C CA  . ILE A 1 247 ? 56.151  68.885  70.926  1.00 10.00 ? 247 ILE A CA  1 
ATOM 2039  C C   . ILE A 1 247 ? 57.008  68.641  72.140  1.00 10.00 ? 247 ILE A C   1 
ATOM 2040  O O   . ILE A 1 247 ? 56.544  68.453  73.274  1.00 10.00 ? 247 ILE A O   1 
ATOM 2041  C CB  . ILE A 1 247 ? 56.177  67.515  70.123  1.00 10.00 ? 247 ILE A CB  1 
ATOM 2042  C CG1 . ILE A 1 247 ? 55.058  66.580  70.669  1.00 10.00 ? 247 ILE A CG1 1 
ATOM 2043  C CG2 . ILE A 1 247 ? 57.586  66.819  70.221  1.00 10.00 ? 247 ILE A CG2 1 
ATOM 2044  C CD1 . ILE A 1 247 ? 54.775  66.638  72.253  1.00 10.00 ? 247 ILE A CD1 1 
ATOM 2045  N N   . SER A 1 248 ? 58.296  68.609  71.860  1.00 10.00 ? 248 SER A N   1 
ATOM 2046  C CA  . SER A 1 248 ? 59.258  68.414  72.939  1.00 10.00 ? 248 SER A CA  1 
ATOM 2047  C C   . SER A 1 248 ? 59.017  69.397  74.066  1.00 10.00 ? 248 SER A C   1 
ATOM 2048  O O   . SER A 1 248 ? 59.055  69.203  75.224  1.00 10.00 ? 248 SER A O   1 
ATOM 2049  C CB  . SER A 1 248 ? 60.677  68.357  72.341  1.00 10.00 ? 248 SER A CB  1 
ATOM 2050  O OG  . SER A 1 248 ? 61.171  69.651  72.074  1.00 10.00 ? 248 SER A OG  1 
ATOM 2051  N N   . VAL A 1 249 ? 59.033  70.675  73.690  1.00 10.00 ? 249 VAL A N   1 
ATOM 2052  C CA  . VAL A 1 249 ? 58.916  71.678  74.764  1.00 10.00 ? 249 VAL A CA  1 
ATOM 2053  C C   . VAL A 1 249 ? 57.672  71.536  75.562  1.00 10.00 ? 249 VAL A C   1 
ATOM 2054  O O   . VAL A 1 249 ? 57.671  71.718  76.777  1.00 10.00 ? 249 VAL A O   1 
ATOM 2055  C CB  . VAL A 1 249 ? 58.904  73.135  74.311  1.00 10.00 ? 249 VAL A CB  1 
ATOM 2056  C CG1 . VAL A 1 249 ? 57.744  73.850  74.949  1.00 10.00 ? 249 VAL A CG1 1 
ATOM 2057  C CG2 . VAL A 1 249 ? 60.147  73.813  74.758  1.00 10.00 ? 249 VAL A CG2 1 
ATOM 2058  N N   . LEU A 1 250 ? 56.586  71.271  74.866  1.00 10.00 ? 250 LEU A N   1 
ATOM 2059  C CA  . LEU A 1 250 ? 55.356  71.145  75.591  1.00 10.00 ? 250 LEU A CA  1 
ATOM 2060  C C   . LEU A 1 250 ? 55.560  70.087  76.655  1.00 10.00 ? 250 LEU A C   1 
ATOM 2061  O O   . LEU A 1 250 ? 55.043  70.241  77.748  1.00 10.00 ? 250 LEU A O   1 
ATOM 2062  C CB  . LEU A 1 250 ? 54.221  70.793  74.640  1.00 10.00 ? 250 LEU A CB  1 
ATOM 2063  C CG  . LEU A 1 250 ? 53.853  71.985  73.761  1.00 10.00 ? 250 LEU A CG  1 
ATOM 2064  C CD1 . LEU A 1 250 ? 53.592  71.507  72.319  1.00 10.00 ? 250 LEU A CD1 1 
ATOM 2065  C CD2 . LEU A 1 250 ? 52.664  72.724  74.415  1.00 10.00 ? 250 LEU A CD2 1 
ATOM 2066  N N   . LEU A 1 251 ? 56.321  69.033  76.340  1.00 10.00 ? 251 LEU A N   1 
ATOM 2067  C CA  . LEU A 1 251 ? 56.587  68.002  77.348  1.00 10.00 ? 251 LEU A CA  1 
ATOM 2068  C C   . LEU A 1 251 ? 57.527  68.511  78.444  1.00 10.00 ? 251 LEU A C   1 
ATOM 2069  O O   . LEU A 1 251 ? 57.216  68.441  79.640  1.00 10.00 ? 251 LEU A O   1 
ATOM 2070  C CB  . LEU A 1 251 ? 57.183  66.750  76.695  1.00 10.00 ? 251 LEU A CB  1 
ATOM 2071  C CG  . LEU A 1 251 ? 56.322  66.055  75.637  1.00 10.00 ? 251 LEU A CG  1 
ATOM 2072  C CD1 . LEU A 1 251 ? 57.041  64.838  75.074  1.00 10.00 ? 251 LEU A CD1 1 
ATOM 2073  C CD2 . LEU A 1 251 ? 54.974  65.658  76.217  1.00 10.00 ? 251 LEU A CD2 1 
ATOM 2074  N N   . SER A 1 252 ? 58.675  69.031  77.999  1.00 10.00 ? 252 SER A N   1 
ATOM 2075  C CA  . SER A 1 252 ? 59.617  69.586  78.963  1.00 10.00 ? 252 SER A CA  1 
ATOM 2076  C C   . SER A 1 252 ? 58.977  70.692  79.834  1.00 10.00 ? 252 SER A C   1 
ATOM 2077  O O   . SER A 1 252 ? 59.365  70.903  80.989  1.00 10.00 ? 252 SER A O   1 
ATOM 2078  C CB  . SER A 1 252 ? 60.845  70.152  78.246  1.00 10.00 ? 252 SER A CB  1 
ATOM 2079  O OG  . SER A 1 252 ? 60.465  71.233  77.408  1.00 10.00 ? 252 SER A OG  1 
ATOM 2080  N N   . LEU A 1 253 ? 58.061  71.489  79.292  1.00 10.00 ? 253 LEU A N   1 
ATOM 2081  C CA  . LEU A 1 253 ? 57.577  72.576  80.149  1.00 10.00 ? 253 LEU A CA  1 
ATOM 2082  C C   . LEU A 1 253 ? 56.422  72.295  81.096  1.00 10.00 ? 253 LEU A C   1 
ATOM 2083  O O   . LEU A 1 253 ? 56.467  72.751  82.235  1.00 10.00 ? 253 LEU A O   1 
ATOM 2084  C CB  . LEU A 1 253 ? 57.360  73.892  79.352  1.00 10.00 ? 253 LEU A CB  1 
ATOM 2085  C CG  . LEU A 1 253 ? 56.278  74.234  78.333  1.00 10.00 ? 253 LEU A CG  1 
ATOM 2086  C CD1 . LEU A 1 253 ? 54.949  74.670  79.016  1.00 10.00 ? 253 LEU A CD1 1 
ATOM 2087  C CD2 . LEU A 1 253 ? 56.855  75.348  77.505  1.00 10.00 ? 253 LEU A CD2 1 
ATOM 2088  N N   . THR A 1 254 ? 55.398  71.553  80.688  1.00 10.00 ? 254 THR A N   1 
ATOM 2089  C CA  . THR A 1 254 ? 54.366  71.292  81.668  1.00 10.00 ? 254 THR A CA  1 
ATOM 2090  C C   . THR A 1 254 ? 55.008  70.443  82.745  1.00 10.00 ? 254 THR A C   1 
ATOM 2091  O O   . THR A 1 254 ? 54.632  70.539  83.911  1.00 10.00 ? 254 THR A O   1 
ATOM 2092  C CB  . THR A 1 254 ? 53.142  70.520  81.127  1.00 10.00 ? 254 THR A CB  1 
ATOM 2093  O OG1 . THR A 1 254 ? 52.054  71.436  80.900  1.00 10.00 ? 254 THR A OG1 1 
ATOM 2094  C CG2 . THR A 1 254 ? 52.693  69.444  82.160  1.00 10.00 ? 254 THR A CG2 1 
ATOM 2095  N N   . VAL A 1 255 ? 55.983  69.612  82.377  1.00 10.00 ? 255 VAL A N   1 
ATOM 2096  C CA  . VAL A 1 255 ? 56.605  68.799  83.400  1.00 10.00 ? 255 VAL A CA  1 
ATOM 2097  C C   . VAL A 1 255 ? 57.369  69.793  84.286  1.00 10.00 ? 255 VAL A C   1 
ATOM 2098  O O   . VAL A 1 255 ? 57.353  69.660  85.509  1.00 10.00 ? 255 VAL A O   1 
ATOM 2099  C CB  . VAL A 1 255 ? 57.453  67.627  82.789  1.00 10.00 ? 255 VAL A CB  1 
ATOM 2100  C CG1 . VAL A 1 255 ? 58.920  67.945  82.766  1.00 10.00 ? 255 VAL A CG1 1 
ATOM 2101  C CG2 . VAL A 1 255 ? 57.137  66.362  83.553  1.00 10.00 ? 255 VAL A CG2 1 
ATOM 2102  N N   . PHE A 1 256 ? 57.999  70.814  83.695  1.00 10.00 ? 256 PHE A N   1 
ATOM 2103  C CA  . PHE A 1 256 ? 58.626  71.831  84.527  1.00 10.00 ? 256 PHE A CA  1 
ATOM 2104  C C   . PHE A 1 256 ? 57.603  72.413  85.467  1.00 10.00 ? 256 PHE A C   1 
ATOM 2105  O O   . PHE A 1 256 ? 57.886  72.684  86.639  1.00 10.00 ? 256 PHE A O   1 
ATOM 2106  C CB  . PHE A 1 256 ? 59.241  72.928  83.658  1.00 10.00 ? 256 PHE A CB  1 
ATOM 2107  C CG  . PHE A 1 256 ? 60.418  72.454  82.829  1.00 10.00 ? 256 PHE A CG  1 
ATOM 2108  C CD1 . PHE A 1 256 ? 60.647  71.088  82.668  1.00 10.00 ? 256 PHE A CD1 1 
ATOM 2109  C CD2 . PHE A 1 256 ? 61.257  73.393  82.232  1.00 10.00 ? 256 PHE A CD2 1 
ATOM 2110  C CE1 . PHE A 1 256 ? 61.731  70.654  81.902  1.00 10.00 ? 256 PHE A CE1 1 
ATOM 2111  C CE2 . PHE A 1 256 ? 62.341  72.960  81.464  1.00 10.00 ? 256 PHE A CE2 1 
ATOM 2112  C CZ  . PHE A 1 256 ? 62.579  71.590  81.300  1.00 10.00 ? 256 PHE A CZ  1 
ATOM 2113  N N   . LEU A 1 257 ? 56.402  72.658  84.953  1.00 10.00 ? 257 LEU A N   1 
ATOM 2114  C CA  . LEU A 1 257 ? 55.307  73.204  85.761  1.00 10.00 ? 257 LEU A CA  1 
ATOM 2115  C C   . LEU A 1 257 ? 54.826  72.173  86.776  1.00 10.00 ? 257 LEU A C   1 
ATOM 2116  O O   . LEU A 1 257 ? 54.343  72.526  87.855  1.00 10.00 ? 257 LEU A O   1 
ATOM 2117  C CB  . LEU A 1 257 ? 54.107  73.609  84.887  1.00 10.00 ? 257 LEU A CB  1 
ATOM 2118  C CG  . LEU A 1 257 ? 53.965  74.927  84.138  1.00 10.00 ? 257 LEU A CG  1 
ATOM 2119  C CD1 . LEU A 1 257 ? 52.604  75.399  84.598  1.00 10.00 ? 257 LEU A CD1 1 
ATOM 2120  C CD2 . LEU A 1 257 ? 55.129  75.959  84.366  1.00 10.00 ? 257 LEU A CD2 1 
ATOM 2121  N N   . LEU A 1 258 ? 54.959  70.903  86.424  1.00 10.00 ? 258 LEU A N   1 
ATOM 2122  C CA  . LEU A 1 258 ? 54.518  69.826  87.294  1.00 10.00 ? 258 LEU A CA  1 
ATOM 2123  C C   . LEU A 1 258 ? 55.453  69.740  88.481  1.00 10.00 ? 258 LEU A C   1 
ATOM 2124  O O   . LEU A 1 258 ? 55.019  69.692  89.636  1.00 10.00 ? 258 LEU A O   1 
ATOM 2125  C CB  . LEU A 1 258 ? 54.535  68.486  86.547  1.00 10.00 ? 258 LEU A CB  1 
ATOM 2126  C CG  . LEU A 1 258 ? 53.764  68.311  85.233  1.00 10.00 ? 258 LEU A CG  1 
ATOM 2127  C CD1 . LEU A 1 258 ? 53.991  66.899  84.717  1.00 10.00 ? 258 LEU A CD1 1 
ATOM 2128  C CD2 . LEU A 1 258 ? 52.280  68.578  85.437  1.00 10.00 ? 258 LEU A CD2 1 
ATOM 2129  N N   . VAL A 1 259 ? 56.747  69.748  88.189  1.00 10.00 ? 259 VAL A N   1 
ATOM 2130  C CA  . VAL A 1 259 ? 57.740  69.629  89.246  1.00 10.00 ? 259 VAL A CA  1 
ATOM 2131  C C   . VAL A 1 259 ? 57.782  70.902  90.104  1.00 10.00 ? 259 VAL A C   1 
ATOM 2132  O O   . VAL A 1 259 ? 58.157  70.835  91.270  1.00 10.00 ? 259 VAL A O   1 
ATOM 2133  C CB  . VAL A 1 259 ? 59.151  69.304  88.654  1.00 10.00 ? 259 VAL A CB  1 
ATOM 2134  C CG1 . VAL A 1 259 ? 60.039  68.601  89.694  1.00 10.00 ? 259 VAL A CG1 1 
ATOM 2135  C CG2 . VAL A 1 259 ? 59.004  68.521  87.365  1.00 10.00 ? 259 VAL A CG2 1 
ATOM 2136  N N   . ILE A 1 260 ? 57.384  72.052  89.549  1.00 10.00 ? 260 ILE A N   1 
ATOM 2137  C CA  . ILE A 1 260 ? 57.383  73.293  90.330  1.00 10.00 ? 260 ILE A CA  1 
ATOM 2138  C C   . ILE A 1 260 ? 56.259  73.129  91.359  1.00 10.00 ? 260 ILE A C   1 
ATOM 2139  O O   . ILE A 1 260 ? 56.296  73.723  92.434  1.00 10.00 ? 260 ILE A O   1 
ATOM 2140  C CB  . ILE A 1 260 ? 57.097  74.552  89.445  1.00 10.00 ? 260 ILE A CB  1 
ATOM 2141  C CG1 . ILE A 1 260 ? 57.716  75.834  90.073  1.00 10.00 ? 260 ILE A CG1 1 
ATOM 2142  C CG2 . ILE A 1 260 ? 55.588  74.783  89.342  1.00 10.00 ? 260 ILE A CG2 1 
ATOM 2143  C CD1 . ILE A 1 260 ? 59.248  76.186  89.740  1.00 10.00 ? 260 ILE A CD1 1 
ATOM 2144  N N   . VAL A 1 261 ? 55.263  72.318  90.999  1.00 10.00 ? 261 VAL A N   1 
ATOM 2145  C CA  . VAL A 1 261 ? 54.118  72.010  91.847  1.00 10.00 ? 261 VAL A CA  1 
ATOM 2146  C C   . VAL A 1 261 ? 54.437  71.233  93.103  1.00 10.00 ? 261 VAL A C   1 
ATOM 2147  O O   . VAL A 1 261 ? 53.742  71.395  94.096  1.00 10.00 ? 261 VAL A O   1 
ATOM 2148  C CB  . VAL A 1 261 ? 53.023  71.274  91.042  1.00 10.00 ? 261 VAL A CB  1 
ATOM 2149  C CG1 . VAL A 1 261 ? 52.159  70.424  91.968  1.00 10.00 ? 261 VAL A CG1 1 
ATOM 2150  C CG2 . VAL A 1 261 ? 52.154  72.309  90.307  1.00 10.00 ? 261 VAL A CG2 1 
ATOM 2151  N N   . GLU A 1 262 ? 55.458  70.377  93.038  1.00 10.00 ? 262 GLU A N   1 
ATOM 2152  C CA  . GLU A 1 262 ? 55.895  69.610  94.197  1.00 10.00 ? 262 GLU A CA  1 
ATOM 2153  C C   . GLU A 1 262 ? 56.541  70.513  95.243  1.00 10.00 ? 262 GLU A C   1 
ATOM 2154  O O   . GLU A 1 262 ? 56.345  70.418  96.428  1.00 10.00 ? 262 GLU A O   1 
ATOM 2155  C CB  . GLU A 1 262 ? 56.862  68.504  93.773  1.00 10.00 ? 262 GLU A CB  1 
ATOM 2156  C CG  . GLU A 1 262 ? 56.245  67.459  92.859  1.00 10.00 ? 262 GLU A CG  1 
ATOM 2157  C CD  . GLU A 1 262 ? 57.287  66.616  92.149  1.00 10.00 ? 262 GLU A CD  1 
ATOM 2158  O OE1 . GLU A 1 262 ? 58.143  67.197  91.448  1.00 10.00 ? 262 GLU A OE1 1 
ATOM 2159  O OE2 . GLU A 1 262 ? 57.246  65.376  92.290  1.00 10.00 ? 262 GLU A OE2 1 
ATOM 2160  N N   . LEU A 1 263 ? 57.305  71.395  94.614  1.00 10.00 ? 263 LEU A N   1 
ATOM 2161  C CA  . LEU A 1 263 ? 58.093  72.361  95.351  1.00 10.00 ? 263 LEU A CA  1 
ATOM 2162  C C   . LEU A 1 263 ? 57.295  73.409  96.093  1.00 10.00 ? 263 LEU A C   1 
ATOM 2163  O O   . LEU A 1 263 ? 57.528  73.607  97.273  1.00 10.00 ? 263 LEU A O   1 
ATOM 2164  C CB  . LEU A 1 263 ? 59.118  72.999  94.397  1.00 10.00 ? 263 LEU A CB  1 
ATOM 2165  C CG  . LEU A 1 263 ? 59.666  71.877  93.508  1.00 10.00 ? 263 LEU A CG  1 
ATOM 2166  C CD1 . LEU A 1 263 ? 60.808  72.384  92.666  1.00 10.00 ? 263 LEU A CD1 1 
ATOM 2167  C CD2 . LEU A 1 263 ? 60.111  70.692  94.389  1.00 10.00 ? 263 LEU A CD2 1 
ATOM 2168  N N   . ILE A 1 264 ? 56.331  74.037  95.424  1.00 10.00 ? 264 ILE A N   1 
ATOM 2169  C CA  . ILE A 1 264 ? 55.519  75.083  96.039  1.00 10.00 ? 264 ILE A CA  1 
ATOM 2170  C C   . ILE A 1 264 ? 54.297  74.640  96.882  1.00 10.00 ? 264 ILE A C   1 
ATOM 2171  O O   . ILE A 1 264 ? 53.716  75.459  97.599  1.00 10.00 ? 264 ILE A O   1 
ATOM 2172  C CB  . ILE A 1 264 ? 55.020  76.088  94.963  1.00 10.00 ? 264 ILE A CB  1 
ATOM 2173  C CG1 . ILE A 1 264 ? 53.721  75.582  94.361  1.00 10.00 ? 264 ILE A CG1 1 
ATOM 2174  C CG2 . ILE A 1 264 ? 56.031  76.233  93.855  1.00 10.00 ? 264 ILE A CG2 1 
ATOM 2175  C CD1 . ILE A 1 264 ? 53.029  76.579  93.545  1.00 10.00 ? 264 ILE A CD1 1 
ATOM 2176  N N   . PRO A 1 265 ? 53.891  73.354  96.820  1.00 10.00 ? 265 PRO A N   1 
ATOM 2177  C CA  . PRO A 1 265 ? 52.736  72.916  97.606  1.00 10.00 ? 265 PRO A CA  1 
ATOM 2178  C C   . PRO A 1 265 ? 53.320  72.503  98.934  1.00 10.00 ? 265 PRO A C   1 
ATOM 2179  O O   . PRO A 1 265 ? 52.669  72.573  99.969  1.00 10.00 ? 265 PRO A O   1 
ATOM 2180  C CB  . PRO A 1 265 ? 52.236  71.710  96.825  1.00 10.00 ? 265 PRO A CB  1 
ATOM 2181  C CG  . PRO A 1 265 ? 53.489  71.036  96.570  1.00 10.00 ? 265 PRO A CG  1 
ATOM 2182  C CD  . PRO A 1 265 ? 54.477  72.175  96.174  1.00 10.00 ? 265 PRO A CD  1 
ATOM 2183  N N   . SER A 1 266 ? 54.561  72.031  98.879  1.00 10.00 ? 266 SER A N   1 
ATOM 2184  C CA  . SER A 1 266 ? 55.248  71.652  100.092 1.00 10.00 ? 266 SER A CA  1 
ATOM 2185  C C   . SER A 1 266 ? 55.484  73.004  100.743 1.00 10.00 ? 266 SER A C   1 
ATOM 2186  O O   . SER A 1 266 ? 55.496  73.106  101.957 1.00 10.00 ? 266 SER A O   1 
ATOM 2187  C CB  . SER A 1 266 ? 56.561  70.919  99.769  1.00 10.00 ? 266 SER A CB  1 
ATOM 2188  O OG  . SER A 1 266 ? 57.099  71.340  98.525  1.00 10.00 ? 266 SER A OG  1 
ATOM 2189  N N   . THR A 1 267 ? 55.667  74.037  99.914  1.00 10.00 ? 267 THR A N   1 
ATOM 2190  C CA  . THR A 1 267 ? 55.824  75.411  100.422 1.00 10.00 ? 267 THR A CA  1 
ATOM 2191  C C   . THR A 1 267 ? 54.456  75.630  101.055 1.00 10.00 ? 267 THR A C   1 
ATOM 2192  O O   . THR A 1 267 ? 54.334  76.058  102.200 1.00 10.00 ? 267 THR A O   1 
ATOM 2193  C CB  . THR A 1 267 ? 55.978  76.517  99.298  1.00 10.00 ? 267 THR A CB  1 
ATOM 2194  O OG1 . THR A 1 267 ? 57.157  76.285  98.510  1.00 10.00 ? 267 THR A OG1 1 
ATOM 2195  C CG2 . THR A 1 267 ? 56.054  77.899  99.939  1.00 10.00 ? 267 THR A CG2 1 
ATOM 2196  N N   . SER A 1 268 ? 53.430  75.307  100.272 1.00 10.00 ? 268 SER A N   1 
ATOM 2197  C CA  . SER A 1 268 ? 52.027  75.420  100.674 1.00 10.00 ? 268 SER A CA  1 
ATOM 2198  C C   . SER A 1 268 ? 51.818  74.699  101.992 1.00 10.00 ? 268 SER A C   1 
ATOM 2199  O O   . SER A 1 268 ? 51.137  75.193  102.890 1.00 10.00 ? 268 SER A O   1 
ATOM 2200  C CB  . SER A 1 268 ? 51.112  74.791  99.604  1.00 10.00 ? 268 SER A CB  1 
ATOM 2201  O OG  . SER A 1 268 ? 49.951  74.198  100.182 1.00 10.00 ? 268 SER A OG  1 
ATOM 2202  N N   . SER A 1 269 ? 52.423  73.522  102.088 1.00 10.00 ? 269 SER A N   1 
ATOM 2203  C CA  . SER A 1 269 ? 52.329  72.683  103.276 1.00 10.00 ? 269 SER A CA  1 
ATOM 2204  C C   . SER A 1 269 ? 53.330  73.124  104.339 1.00 10.00 ? 269 SER A C   1 
ATOM 2205  O O   . SER A 1 269 ? 53.224  72.775  105.496 1.00 10.00 ? 269 SER A O   1 
ATOM 2206  C CB  . SER A 1 269 ? 52.546  71.213  102.913 1.00 10.00 ? 269 SER A CB  1 
ATOM 2207  O OG  . SER A 1 269 ? 51.340  70.613  102.474 1.00 10.00 ? 269 SER A OG  1 
ATOM 2208  N N   . ALA A 1 270 ? 54.314  73.900  103.864 1.00 10.00 ? 270 ALA A N   1 
ATOM 2209  C CA  . ALA A 1 270 ? 55.428  74.488  104.690 1.00 10.00 ? 270 ALA A CA  1 
ATOM 2210  C C   . ALA A 1 270 ? 54.975  75.746  105.353 1.00 10.00 ? 270 ALA A C   1 
ATOM 2211  O O   . ALA A 1 270 ? 55.401  76.074  106.452 1.00 10.00 ? 270 ALA A O   1 
ATOM 2212  C CB  . ALA A 1 270 ? 56.668  74.825  103.819 1.00 10.00 ? 270 ALA A CB  1 
ATOM 2213  N N   . VAL A 1 271 ? 54.078  76.437  104.655 1.00 10.00 ? 271 VAL A N   1 
ATOM 2214  C CA  . VAL A 1 271 ? 53.519  77.682  105.130 1.00 10.00 ? 271 VAL A CA  1 
ATOM 2215  C C   . VAL A 1 271 ? 52.083  77.775  104.669 1.00 10.00 ? 271 VAL A C   1 
ATOM 2216  O O   . VAL A 1 271 ? 51.784  77.671  103.481 1.00 10.00 ? 271 VAL A O   1 
ATOM 2217  C CB  . VAL A 1 271 ? 54.326  78.898  104.608 1.00 10.00 ? 271 VAL A CB  1 
ATOM 2218  C CG1 . VAL A 1 271 ? 55.701  78.925  105.266 1.00 10.00 ? 271 VAL A CG1 1 
ATOM 2219  C CG2 . VAL A 1 271 ? 54.470  78.827  103.093 1.00 10.00 ? 271 VAL A CG2 1 
ATOM 2220  N N   . PRO A 1 272 ? 51.187  78.040  105.619 1.00 10.00 ? 272 PRO A N   1 
ATOM 2221  C CA  . PRO A 1 272 ? 49.750  78.148  105.346 1.00 10.00 ? 272 PRO A CA  1 
ATOM 2222  C C   . PRO A 1 272 ? 49.345  79.464  104.716 1.00 10.00 ? 272 PRO A C   1 
ATOM 2223  O O   . PRO A 1 272 ? 49.261  80.489  105.385 1.00 10.00 ? 272 PRO A O   1 
ATOM 2224  C CB  . PRO A 1 272 ? 49.122  77.968  106.726 1.00 10.00 ? 272 PRO A CB  1 
ATOM 2225  C CG  . PRO A 1 272 ? 50.031  78.749  107.584 1.00 10.00 ? 272 PRO A CG  1 
ATOM 2226  C CD  . PRO A 1 272 ? 51.452  78.385  107.032 1.00 10.00 ? 272 PRO A CD  1 
ATOM 2227  N N   . LEU A 1 273 ? 49.090  79.420  103.419 1.00 10.00 ? 273 LEU A N   1 
ATOM 2228  C CA  . LEU A 1 273 ? 48.684  80.607  102.677 1.00 10.00 ? 273 LEU A CA  1 
ATOM 2229  C C   . LEU A 1 273 ? 47.214  80.460  102.324 1.00 10.00 ? 273 LEU A C   1 
ATOM 2230  O O   . LEU A 1 273 ? 46.779  79.378  101.930 1.00 10.00 ? 273 LEU A O   1 
ATOM 2231  C CB  . LEU A 1 273 ? 49.546  80.743  101.418 1.00 10.00 ? 273 LEU A CB  1 
ATOM 2232  C CG  . LEU A 1 273 ? 49.347  79.941  100.141 1.00 10.00 ? 273 LEU A CG  1 
ATOM 2233  C CD1 . LEU A 1 273 ? 50.672  79.936  99.409  1.00 10.00 ? 273 LEU A CD1 1 
ATOM 2234  C CD2 . LEU A 1 273 ? 48.915  78.546  100.429 1.00 10.00 ? 273 LEU A CD2 1 
ATOM 2235  N N   . ILE A 1 274 ? 46.440  81.535  102.467 1.00 10.00 ? 274 ILE A N   1 
ATOM 2236  C CA  . ILE A 1 274 ? 45.018  81.406  102.162 1.00 10.00 ? 274 ILE A CA  1 
ATOM 2237  C C   . ILE A 1 274 ? 44.795  80.848  100.759 1.00 10.00 ? 274 ILE A C   1 
ATOM 2238  O O   . ILE A 1 274 ? 45.247  81.408  99.750  1.00 10.00 ? 274 ILE A O   1 
ATOM 2239  C CB  . ILE A 1 274 ? 44.292  82.759  102.279 1.00 10.00 ? 274 ILE A CB  1 
ATOM 2240  C CG1 . ILE A 1 274 ? 44.706  83.688  101.135 1.00 10.00 ? 274 ILE A CG1 1 
ATOM 2241  C CG2 . ILE A 1 274 ? 44.577  83.401  103.627 1.00 10.00 ? 274 ILE A CG2 1 
ATOM 2242  C CD1 . ILE A 1 274 ? 43.872  84.946  101.037 1.00 10.00 ? 274 ILE A CD1 1 
ATOM 2243  N N   . GLY A 1 275 ? 44.155  79.687  100.733 1.00 10.00 ? 275 GLY A N   1 
ATOM 2244  C CA  . GLY A 1 275 ? 43.869  78.974  99.501  1.00 10.00 ? 275 GLY A CA  1 
ATOM 2245  C C   . GLY A 1 275 ? 43.478  79.817  98.307  1.00 10.00 ? 275 GLY A C   1 
ATOM 2246  O O   . GLY A 1 275 ? 43.805  79.477  97.173  1.00 10.00 ? 275 GLY A O   1 
ATOM 2247  N N   . LYS A 1 276 ? 42.771  80.918  98.543  1.00 10.00 ? 276 LYS A N   1 
ATOM 2248  C CA  . LYS A 1 276 ? 42.372  81.778  97.442  1.00 10.00 ? 276 LYS A CA  1 
ATOM 2249  C C   . LYS A 1 276 ? 43.591  82.295  96.693  1.00 10.00 ? 276 LYS A C   1 
ATOM 2250  O O   . LYS A 1 276 ? 43.479  82.932  95.642  1.00 10.00 ? 276 LYS A O   1 
ATOM 2251  C CB  . LYS A 1 276 ? 41.510  82.928  97.958  1.00 10.00 ? 276 LYS A CB  1 
ATOM 2252  C CG  . LYS A 1 276 ? 40.286  82.476  98.739  1.00 10.00 ? 276 LYS A CG  1 
ATOM 2253  C CD  . LYS A 1 276 ? 40.654  82.058  100.152 1.00 10.00 ? 276 LYS A CD  1 
ATOM 2254  C CE  . LYS A 1 276 ? 39.429  81.600  100.928 1.00 10.00 ? 276 LYS A CE  1 
ATOM 2255  N NZ  . LYS A 1 276 ? 39.773  81.192  102.317 1.00 10.00 ? 276 LYS A NZ  1 
ATOM 2256  N N   . TYR A 1 277 ? 44.777  82.014  97.246  1.00 10.00 ? 277 TYR A N   1 
ATOM 2257  C CA  . TYR A 1 277 ? 46.073  82.380  96.666  1.00 10.00 ? 277 TYR A CA  1 
ATOM 2258  C C   . TYR A 1 277 ? 46.305  81.340  95.563  1.00 10.00 ? 277 TYR A C   1 
ATOM 2259  O O   . TYR A 1 277 ? 46.769  81.648  94.464  1.00 10.00 ? 277 TYR A O   1 
ATOM 2260  C CB  . TYR A 1 277 ? 47.213  82.224  97.697  1.00 10.00 ? 277 TYR A CB  1 
ATOM 2261  C CG  . TYR A 1 277 ? 47.588  83.433  98.597  1.00 10.00 ? 277 TYR A CG  1 
ATOM 2262  C CD1 . TYR A 1 277 ? 46.723  83.919  99.598  1.00 10.00 ? 277 TYR A CD1 1 
ATOM 2263  C CD2 . TYR A 1 277 ? 48.863  84.024  98.501  1.00 10.00 ? 277 TYR A CD2 1 
ATOM 2264  C CE1 . TYR A 1 277 ? 47.125  84.936  100.456 1.00 10.00 ? 277 TYR A CE1 1 
ATOM 2265  C CE2 . TYR A 1 277 ? 49.251  85.028  99.353  1.00 10.00 ? 277 TYR A CE2 1 
ATOM 2266  C CZ  . TYR A 1 277 ? 48.383  85.468  100.308 1.00 10.00 ? 277 TYR A CZ  1 
ATOM 2267  O OH  . TYR A 1 277 ? 48.795  86.486  101.072 1.00 10.00 ? 277 TYR A OH  1 
ATOM 2268  N N   . MET A 1 278 ? 45.961  80.099  95.895  1.00 10.00 ? 278 MET A N   1 
ATOM 2269  C CA  . MET A 1 278 ? 46.108  78.933  95.024  1.00 10.00 ? 278 MET A CA  1 
ATOM 2270  C C   . MET A 1 278 ? 45.396  79.133  93.682  1.00 10.00 ? 278 MET A C   1 
ATOM 2271  O O   . MET A 1 278 ? 45.947  78.817  92.625  1.00 10.00 ? 278 MET A O   1 
ATOM 2272  C CB  . MET A 1 278 ? 45.574  77.669  95.750  1.00 10.00 ? 278 MET A CB  1 
ATOM 2273  C CG  . MET A 1 278 ? 46.478  76.434  95.684  1.00 10.00 ? 278 MET A CG  1 
ATOM 2274  S SD  . MET A 1 278 ? 45.940  75.258  94.440  1.00 10.00 ? 278 MET A SD  1 
ATOM 2275  C CE  . MET A 1 278 ? 44.246  75.086  94.908  1.00 10.00 ? 278 MET A CE  1 
ATOM 2276  N N   . LEU A 1 279 ? 44.184  79.678  93.699  1.00 10.00 ? 279 LEU A N   1 
ATOM 2277  C CA  . LEU A 1 279 ? 43.490  79.859  92.426  1.00 10.00 ? 279 LEU A CA  1 
ATOM 2278  C C   . LEU A 1 279 ? 44.297  80.712  91.462  1.00 10.00 ? 279 LEU A C   1 
ATOM 2279  O O   . LEU A 1 279 ? 44.137  80.566  90.249  1.00 10.00 ? 279 LEU A O   1 
ATOM 2280  C CB  . LEU A 1 279 ? 42.117  80.490  92.603  1.00 10.00 ? 279 LEU A CB  1 
ATOM 2281  C CG  . LEU A 1 279 ? 40.858  79.830  91.998  1.00 10.00 ? 279 LEU A CG  1 
ATOM 2282  C CD1 . LEU A 1 279 ? 41.180  79.076  90.723  1.00 10.00 ? 279 LEU A CD1 1 
ATOM 2283  C CD2 . LEU A 1 279 ? 40.250  78.911  93.032  1.00 10.00 ? 279 LEU A CD2 1 
ATOM 2284  N N   . PHE A 1 280 ? 45.143  81.609  91.980  1.00 10.00 ? 280 PHE A N   1 
ATOM 2285  C CA  . PHE A 1 280 ? 45.979  82.437  91.067  1.00 10.00 ? 280 PHE A CA  1 
ATOM 2286  C C   . PHE A 1 280 ? 46.620  81.412  90.157  1.00 10.00 ? 280 PHE A C   1 
ATOM 2287  O O   . PHE A 1 280 ? 46.369  81.378  88.966  1.00 10.00 ? 280 PHE A O   1 
ATOM 2288  C CB  . PHE A 1 280 ? 47.190  83.180  91.711  1.00 10.00 ? 280 PHE A CB  1 
ATOM 2289  C CG  . PHE A 1 280 ? 46.897  83.894  92.995  1.00 10.00 ? 280 PHE A CG  1 
ATOM 2290  C CD1 . PHE A 1 280 ? 47.954  84.236  93.841  1.00 10.00 ? 280 PHE A CD1 1 
ATOM 2291  C CD2 . PHE A 1 280 ? 45.591  84.123  93.422  1.00 10.00 ? 280 PHE A CD2 1 
ATOM 2292  C CE1 . PHE A 1 280 ? 47.722  84.784  95.106  1.00 10.00 ? 280 PHE A CE1 1 
ATOM 2293  C CE2 . PHE A 1 280 ? 45.340  84.673  94.686  1.00 10.00 ? 280 PHE A CE2 1 
ATOM 2294  C CZ  . PHE A 1 280 ? 46.410  85.002  95.534  1.00 10.00 ? 280 PHE A CZ  1 
ATOM 2295  N N   . THR A 1 281 ? 47.445  80.556  90.761  1.00 10.00 ? 281 THR A N   1 
ATOM 2296  C CA  . THR A 1 281 ? 48.149  79.517  90.005  1.00 10.00 ? 281 THR A CA  1 
ATOM 2297  C C   . THR A 1 281 ? 47.130  78.669  89.243  1.00 10.00 ? 281 THR A C   1 
ATOM 2298  O O   . THR A 1 281 ? 47.322  78.382  88.060  1.00 10.00 ? 281 THR A O   1 
ATOM 2299  C CB  . THR A 1 281 ? 49.015  78.593  90.941  1.00 10.00 ? 281 THR A CB  1 
ATOM 2300  O OG1 . THR A 1 281 ? 49.913  77.783  90.161  1.00 10.00 ? 281 THR A OG1 1 
ATOM 2301  C CG2 . THR A 1 281 ? 48.135  77.726  91.754  1.00 10.00 ? 281 THR A CG2 1 
ATOM 2302  N N   . MET A 1 282 ? 46.034  78.309  89.916  1.00 10.00 ? 282 MET A N   1 
ATOM 2303  C CA  . MET A 1 282 ? 44.987  77.483  89.314  1.00 10.00 ? 282 MET A CA  1 
ATOM 2304  C C   . MET A 1 282 ? 44.754  77.905  87.862  1.00 10.00 ? 282 MET A C   1 
ATOM 2305  O O   . MET A 1 282 ? 45.410  77.379  86.972  1.00 10.00 ? 282 MET A O   1 
ATOM 2306  C CB  . MET A 1 282 ? 43.679  77.575  90.123  1.00 10.00 ? 282 MET A CB  1 
ATOM 2307  C CG  . MET A 1 282 ? 43.007  76.237  90.463  1.00 10.00 ? 282 MET A CG  1 
ATOM 2308  S SD  . MET A 1 282 ? 43.771  75.265  91.849  1.00 10.00 ? 282 MET A SD  1 
ATOM 2309  C CE  . MET A 1 282 ? 42.244  74.492  92.811  1.00 10.00 ? 282 MET A CE  1 
ATOM 2310  N N   . ILE A 1 283 ? 43.865  78.865  87.611  1.00 10.00 ? 283 ILE A N   1 
ATOM 2311  C CA  . ILE A 1 283 ? 43.597  79.284  86.224  1.00 10.00 ? 283 ILE A CA  1 
ATOM 2312  C C   . ILE A 1 283 ? 44.868  79.658  85.430  1.00 10.00 ? 283 ILE A C   1 
ATOM 2313  O O   . ILE A 1 283 ? 45.009  79.268  84.271  1.00 10.00 ? 283 ILE A O   1 
ATOM 2314  C CB  . ILE A 1 283 ? 42.638  80.497  86.111  1.00 10.00 ? 283 ILE A CB  1 
ATOM 2315  C CG1 . ILE A 1 283 ? 41.447  80.384  87.068  1.00 10.00 ? 283 ILE A CG1 1 
ATOM 2316  C CG2 . ILE A 1 283 ? 42.107  80.561  84.674  1.00 10.00 ? 283 ILE A CG2 1 
ATOM 2317  C CD1 . ILE A 1 283 ? 40.413  81.546  86.904  1.00 10.00 ? 283 ILE A CD1 1 
ATOM 2318  N N   . PHE A 1 284 ? 45.779  80.426  86.041  1.00 10.00 ? 284 PHE A N   1 
ATOM 2319  C CA  . PHE A 1 284 ? 47.034  80.843  85.374  1.00 10.00 ? 284 PHE A CA  1 
ATOM 2320  C C   . PHE A 1 284 ? 47.729  79.655  84.738  1.00 10.00 ? 284 PHE A C   1 
ATOM 2321  O O   . PHE A 1 284 ? 47.829  79.551  83.517  1.00 10.00 ? 284 PHE A O   1 
ATOM 2322  C CB  . PHE A 1 284 ? 48.012  81.512  86.356  1.00 10.00 ? 284 PHE A CB  1 
ATOM 2323  C CG  . PHE A 1 284 ? 47.446  82.700  87.096  1.00 10.00 ? 284 PHE A CG  1 
ATOM 2324  C CD1 . PHE A 1 284 ? 48.241  83.396  88.003  1.00 10.00 ? 284 PHE A CD1 1 
ATOM 2325  C CD2 . PHE A 1 284 ? 46.108  83.071  86.961  1.00 10.00 ? 284 PHE A CD2 1 
ATOM 2326  C CE1 . PHE A 1 284 ? 47.717  84.432  88.769  1.00 10.00 ? 284 PHE A CE1 1 
ATOM 2327  C CE2 . PHE A 1 284 ? 45.573  84.107  87.726  1.00 10.00 ? 284 PHE A CE2 1 
ATOM 2328  C CZ  . PHE A 1 284 ? 46.379  84.786  88.632  1.00 10.00 ? 284 PHE A CZ  1 
ATOM 2329  N N   . VAL A 1 285 ? 48.192  78.760  85.599  1.00 10.00 ? 285 VAL A N   1 
ATOM 2330  C CA  . VAL A 1 285 ? 48.882  77.522  85.226  1.00 10.00 ? 285 VAL A CA  1 
ATOM 2331  C C   . VAL A 1 285 ? 47.992  76.675  84.307  1.00 10.00 ? 285 VAL A C   1 
ATOM 2332  O O   . VAL A 1 285 ? 48.413  76.105  83.284  1.00 10.00 ? 285 VAL A O   1 
ATOM 2333  C CB  . VAL A 1 285 ? 49.195  76.673  86.517  1.00 10.00 ? 285 VAL A CB  1 
ATOM 2334  C CG1 . VAL A 1 285 ? 47.894  76.056  87.068  1.00 10.00 ? 285 VAL A CG1 1 
ATOM 2335  C CG2 . VAL A 1 285 ? 50.244  75.575  86.210  1.00 10.00 ? 285 VAL A CG2 1 
ATOM 2336  N N   . ILE A 1 286 ? 46.723  76.615  84.660  1.00 10.00 ? 286 ILE A N   1 
ATOM 2337  C CA  . ILE A 1 286 ? 45.848  75.767  83.883  1.00 10.00 ? 286 ILE A CA  1 
ATOM 2338  C C   . ILE A 1 286 ? 45.526  76.369  82.507  1.00 10.00 ? 286 ILE A C   1 
ATOM 2339  O O   . ILE A 1 286 ? 45.186  75.637  81.591  1.00 10.00 ? 286 ILE A O   1 
ATOM 2340  C CB  . ILE A 1 286 ? 44.616  75.346  84.761  1.00 10.00 ? 286 ILE A CB  1 
ATOM 2341  C CG1 . ILE A 1 286 ? 45.149  74.767  86.088  1.00 10.00 ? 286 ILE A CG1 1 
ATOM 2342  C CG2 . ILE A 1 286 ? 43.714  74.276  84.039  1.00 10.00 ? 286 ILE A CG2 1 
ATOM 2343  C CD1 . ILE A 1 286 ? 44.084  74.139  87.007  1.00 10.00 ? 286 ILE A CD1 1 
ATOM 2344  N N   . SER A 1 287 ? 45.671  77.682  82.325  1.00 10.00 ? 287 SER A N   1 
ATOM 2345  C CA  . SER A 1 287 ? 45.445  78.231  80.992  1.00 10.00 ? 287 SER A CA  1 
ATOM 2346  C C   . SER A 1 287 ? 46.647  77.824  80.140  1.00 10.00 ? 287 SER A C   1 
ATOM 2347  O O   . SER A 1 287 ? 46.522  77.642  78.929  1.00 10.00 ? 287 SER A O   1 
ATOM 2348  C CB  . SER A 1 287 ? 45.333  79.751  81.004  1.00 10.00 ? 287 SER A CB  1 
ATOM 2349  O OG  . SER A 1 287 ? 45.402  80.247  79.673  1.00 10.00 ? 287 SER A OG  1 
ATOM 2350  N N   . SER A 1 288 ? 47.813  77.690  80.777  1.00 10.00 ? 288 SER A N   1 
ATOM 2351  C CA  . SER A 1 288 ? 49.013  77.269  80.083  1.00 10.00 ? 288 SER A CA  1 
ATOM 2352  C C   . SER A 1 288 ? 48.566  75.957  79.508  1.00 10.00 ? 288 SER A C   1 
ATOM 2353  O O   . SER A 1 288 ? 48.959  75.551  78.414  1.00 10.00 ? 288 SER A O   1 
ATOM 2354  C CB  . SER A 1 288 ? 50.145  77.036  81.059  1.00 10.00 ? 288 SER A CB  1 
ATOM 2355  O OG  . SER A 1 288 ? 51.196  76.423  80.350  1.00 10.00 ? 288 SER A OG  1 
ATOM 2356  N N   . ILE A 1 289 ? 47.683  75.328  80.284  1.00 10.00 ? 289 ILE A N   1 
ATOM 2357  C CA  . ILE A 1 289 ? 47.089  74.052  80.006  1.00 10.00 ? 289 ILE A CA  1 
ATOM 2358  C C   . ILE A 1 289 ? 46.000  74.117  78.925  1.00 10.00 ? 289 ILE A C   1 
ATOM 2359  O O   . ILE A 1 289 ? 46.136  73.504  77.854  1.00 10.00 ? 289 ILE A O   1 
ATOM 2360  C CB  . ILE A 1 289 ? 46.579  73.491  81.341  1.00 10.00 ? 289 ILE A CB  1 
ATOM 2361  C CG1 . ILE A 1 289 ? 47.781  72.922  82.141  1.00 10.00 ? 289 ILE A CG1 1 
ATOM 2362  C CG2 . ILE A 1 289 ? 45.400  72.576  81.116  1.00 10.00 ? 289 ILE A CG2 1 
ATOM 2363  C CD1 . ILE A 1 289 ? 49.045  72.449  81.321  1.00 10.00 ? 289 ILE A CD1 1 
ATOM 2364  N N   . ILE A 1 290 ? 44.932  74.874  79.157  1.00 10.00 ? 290 ILE A N   1 
ATOM 2365  C CA  . ILE A 1 290 ? 43.869  74.934  78.140  1.00 10.00 ? 290 ILE A CA  1 
ATOM 2366  C C   . ILE A 1 290 ? 44.386  75.552  76.837  1.00 10.00 ? 290 ILE A C   1 
ATOM 2367  O O   . ILE A 1 290 ? 44.041  75.080  75.757  1.00 10.00 ? 290 ILE A O   1 
ATOM 2368  C CB  . ILE A 1 290 ? 42.561  75.732  78.588  1.00 10.00 ? 290 ILE A CB  1 
ATOM 2369  C CG1 . ILE A 1 290 ? 42.603  76.121  80.066  1.00 10.00 ? 290 ILE A CG1 1 
ATOM 2370  C CG2 . ILE A 1 290 ? 41.300  74.881  78.317  1.00 10.00 ? 290 ILE A CG2 1 
ATOM 2371  C CD1 . ILE A 1 290 ? 41.227  76.503  80.617  1.00 10.00 ? 290 ILE A CD1 1 
ATOM 2372  N N   . VAL A 1 291 ? 45.225  76.586  76.939  1.00 10.00 ? 291 VAL A N   1 
ATOM 2373  C CA  . VAL A 1 291 ? 45.772  77.256  75.766  1.00 10.00 ? 291 VAL A CA  1 
ATOM 2374  C C   . VAL A 1 291 ? 46.592  76.228  74.970  1.00 10.00 ? 291 VAL A C   1 
ATOM 2375  O O   . VAL A 1 291 ? 46.332  76.024  73.788  1.00 10.00 ? 291 VAL A O   1 
ATOM 2376  C CB  . VAL A 1 291 ? 46.669  78.496  76.187  1.00 10.00 ? 291 VAL A CB  1 
ATOM 2377  C CG1 . VAL A 1 291 ? 47.259  79.204  74.962  1.00 10.00 ? 291 VAL A CG1 1 
ATOM 2378  C CG2 . VAL A 1 291 ? 45.834  79.496  76.996  1.00 10.00 ? 291 VAL A CG2 1 
ATOM 2379  N N   . THR A 1 292 ? 47.596  75.597  75.588  1.00 10.00 ? 292 THR A N   1 
ATOM 2380  C CA  . THR A 1 292 ? 48.387  74.569  74.898  1.00 10.00 ? 292 THR A CA  1 
ATOM 2381  C C   . THR A 1 292 ? 47.496  73.648  74.105  1.00 10.00 ? 292 THR A C   1 
ATOM 2382  O O   . THR A 1 292 ? 47.357  73.767  72.883  1.00 10.00 ? 292 THR A O   1 
ATOM 2383  C CB  . THR A 1 292 ? 49.088  73.708  75.859  1.00 10.00 ? 292 THR A CB  1 
ATOM 2384  O OG1 . THR A 1 292 ? 48.332  73.692  77.068  1.00 10.00 ? 292 THR A OG1 1 
ATOM 2385  C CG2 . THR A 1 292 ? 50.479  74.193  76.077  1.00 10.00 ? 292 THR A CG2 1 
ATOM 2386  N N   . VAL A 1 293 ? 46.874  72.740  74.843  1.00 10.00 ? 293 VAL A N   1 
ATOM 2387  C CA  . VAL A 1 293 ? 45.963  71.767  74.303  1.00 10.00 ? 293 VAL A CA  1 
ATOM 2388  C C   . VAL A 1 293 ? 45.236  72.367  73.064  1.00 10.00 ? 293 VAL A C   1 
ATOM 2389  O O   . VAL A 1 293 ? 45.183  71.738  72.001  1.00 10.00 ? 293 VAL A O   1 
ATOM 2390  C CB  . VAL A 1 293 ? 44.981  71.312  75.433  1.00 10.00 ? 293 VAL A CB  1 
ATOM 2391  C CG1 . VAL A 1 293 ? 43.746  72.216  75.467  1.00 10.00 ? 293 VAL A CG1 1 
ATOM 2392  C CG2 . VAL A 1 293 ? 44.630  69.838  75.269  1.00 10.00 ? 293 VAL A CG2 1 
ATOM 2393  N N   . VAL A 1 294 ? 44.696  73.584  73.156  1.00 10.00 ? 294 VAL A N   1 
ATOM 2394  C CA  . VAL A 1 294 ? 44.059  74.138  71.937  1.00 10.00 ? 294 VAL A CA  1 
ATOM 2395  C C   . VAL A 1 294 ? 45.108  74.636  70.974  1.00 10.00 ? 294 VAL A C   1 
ATOM 2396  O O   . VAL A 1 294 ? 45.105  74.233  69.826  1.00 10.00 ? 294 VAL A O   1 
ATOM 2397  C CB  . VAL A 1 294 ? 43.102  75.349  72.132  1.00 10.00 ? 294 VAL A CB  1 
ATOM 2398  C CG1 . VAL A 1 294 ? 43.887  76.641  72.441  1.00 10.00 ? 294 VAL A CG1 1 
ATOM 2399  C CG2 . VAL A 1 294 ? 42.284  75.549  70.837  1.00 10.00 ? 294 VAL A CG2 1 
ATOM 2400  N N   . VAL A 1 295 ? 45.961  75.546  71.446  1.00 10.00 ? 295 VAL A N   1 
ATOM 2401  C CA  . VAL A 1 295 ? 47.056  76.112  70.646  1.00 10.00 ? 295 VAL A CA  1 
ATOM 2402  C C   . VAL A 1 295 ? 47.770  74.979  69.917  1.00 10.00 ? 295 VAL A C   1 
ATOM 2403  O O   . VAL A 1 295 ? 47.902  74.988  68.692  1.00 10.00 ? 295 VAL A O   1 
ATOM 2404  C CB  . VAL A 1 295 ? 48.126  76.858  71.538  1.00 10.00 ? 295 VAL A CB  1 
ATOM 2405  C CG1 . VAL A 1 295 ? 49.244  77.473  70.672  1.00 10.00 ? 295 VAL A CG1 1 
ATOM 2406  C CG2 . VAL A 1 295 ? 47.471  77.944  72.343  1.00 10.00 ? 295 VAL A CG2 1 
ATOM 2407  N N   . ILE A 1 296 ? 48.224  73.979  70.660  1.00 10.00 ? 296 ILE A N   1 
ATOM 2408  C CA  . ILE A 1 296 ? 48.935  72.904  69.986  1.00 10.00 ? 296 ILE A CA  1 
ATOM 2409  C C   . ILE A 1 296 ? 48.059  71.881  69.265  1.00 10.00 ? 296 ILE A C   1 
ATOM 2410  O O   . ILE A 1 296 ? 48.533  71.206  68.361  1.00 10.00 ? 296 ILE A O   1 
ATOM 2411  C CB  . ILE A 1 296 ? 49.940  72.188  70.914  1.00 10.00 ? 296 ILE A CB  1 
ATOM 2412  C CG1 . ILE A 1 296 ? 49.616  72.494  72.371  1.00 10.00 ? 296 ILE A CG1 1 
ATOM 2413  C CG2 . ILE A 1 296 ? 51.369  72.569  70.512  1.00 10.00 ? 296 ILE A CG2 1 
ATOM 2414  C CD1 . ILE A 1 296 ? 50.122  73.812  72.822  1.00 10.00 ? 296 ILE A CD1 1 
ATOM 2415  N N   . ASN A 1 297 ? 46.793  71.745  69.650  1.00 10.00 ? 297 ASN A N   1 
ATOM 2416  C CA  . ASN A 1 297 ? 45.919  70.828  68.925  1.00 10.00 ? 297 ASN A CA  1 
ATOM 2417  C C   . ASN A 1 297 ? 45.687  71.590  67.617  1.00 10.00 ? 297 ASN A C   1 
ATOM 2418  O O   . ASN A 1 297 ? 45.696  71.018  66.519  1.00 10.00 ? 297 ASN A O   1 
ATOM 2419  C CB  . ASN A 1 297 ? 44.604  70.576  69.708  1.00 10.00 ? 297 ASN A CB  1 
ATOM 2420  C CG  . ASN A 1 297 ? 43.377  70.448  68.801  1.00 10.00 ? 297 ASN A CG  1 
ATOM 2421  O OD1 . ASN A 1 297 ? 43.456  69.902  67.701  1.00 10.00 ? 297 ASN A OD1 1 
ATOM 2422  N ND2 . ASN A 1 297 ? 42.230  70.943  69.276  1.00 10.00 ? 297 ASN A ND2 1 
ATOM 2423  N N   . THR A 1 298 ? 45.563  72.910  67.741  1.00 10.00 ? 298 THR A N   1 
ATOM 2424  C CA  . THR A 1 298 ? 45.335  73.761  66.573  1.00 10.00 ? 298 THR A CA  1 
ATOM 2425  C C   . THR A 1 298 ? 46.637  73.850  65.808  1.00 10.00 ? 298 THR A C   1 
ATOM 2426  O O   . THR A 1 298 ? 46.637  73.849  64.579  1.00 10.00 ? 298 THR A O   1 
ATOM 2427  C CB  . THR A 1 298 ? 44.871  75.185  66.954  1.00 10.00 ? 298 THR A CB  1 
ATOM 2428  O OG1 . THR A 1 298 ? 43.440  75.245  66.940  1.00 10.00 ? 298 THR A OG1 1 
ATOM 2429  C CG2 . THR A 1 298 ? 45.437  76.208  65.977  1.00 10.00 ? 298 THR A CG2 1 
ATOM 2430  N N   . HIS A 1 299 ? 47.727  73.954  66.569  1.00 10.00 ? 299 HIS A N   1 
ATOM 2431  C CA  . HIS A 1 299 ? 49.088  73.988  66.077  1.00 10.00 ? 299 HIS A CA  1 
ATOM 2432  C C   . HIS A 1 299 ? 49.010  72.840  65.065  1.00 10.00 ? 299 HIS A C   1 
ATOM 2433  O O   . HIS A 1 299 ? 49.334  72.984  63.874  1.00 10.00 ? 299 HIS A O   1 
ATOM 2434  C CB  . HIS A 1 299 ? 49.963  73.608  67.269  1.00 10.00 ? 299 HIS A CB  1 
ATOM 2435  C CG  . HIS A 1 299 ? 51.280  74.289  67.337  1.00 10.00 ? 299 HIS A CG  1 
ATOM 2436  N ND1 . HIS A 1 299 ? 52.270  74.079  66.408  1.00 10.00 ? 299 HIS A ND1 1 
ATOM 2437  C CD2 . HIS A 1 299 ? 51.835  75.039  68.315  1.00 10.00 ? 299 HIS A CD2 1 
ATOM 2438  C CE1 . HIS A 1 299 ? 53.385  74.657  66.818  1.00 10.00 ? 299 HIS A CE1 1 
ATOM 2439  N NE2 . HIS A 1 299 ? 53.147  75.245  67.975  1.00 10.00 ? 299 HIS A NE2 1 
ATOM 2440  N N   . HIS A 1 300 ? 48.498  71.725  65.590  1.00 10.00 ? 300 HIS A N   1 
ATOM 2441  C CA  . HIS A 1 300 ? 48.284  70.452  64.902  1.00 10.00 ? 300 HIS A CA  1 
ATOM 2442  C C   . HIS A 1 300 ? 47.145  70.435  63.852  1.00 10.00 ? 300 HIS A C   1 
ATOM 2443  O O   . HIS A 1 300 ? 47.248  69.800  62.795  1.00 10.00 ? 300 HIS A O   1 
ATOM 2444  C CB  . HIS A 1 300 ? 48.094  69.377  65.991  1.00 10.00 ? 300 HIS A CB  1 
ATOM 2445  C CG  . HIS A 1 300 ? 49.357  69.076  66.727  1.00 10.00 ? 300 HIS A CG  1 
ATOM 2446  N ND1 . HIS A 1 300 ? 49.425  68.168  67.755  1.00 10.00 ? 300 HIS A ND1 1 
ATOM 2447  C CD2 . HIS A 1 300 ? 50.623  69.516  66.521  1.00 10.00 ? 300 HIS A CD2 1 
ATOM 2448  C CE1 . HIS A 1 300 ? 50.681  68.051  68.143  1.00 10.00 ? 300 HIS A CE1 1 
ATOM 2449  N NE2 . HIS A 1 300 ? 51.428  68.856  67.410  1.00 10.00 ? 300 HIS A NE2 1 
ATOM 2450  N N   . ARG A 1 301 ? 46.085  71.173  64.151  1.00 10.00 ? 301 ARG A N   1 
ATOM 2451  C CA  . ARG A 1 301 ? 44.871  71.322  63.318  1.00 10.00 ? 301 ARG A CA  1 
ATOM 2452  C C   . ARG A 1 301 ? 44.828  71.292  61.777  1.00 10.00 ? 301 ARG A C   1 
ATOM 2453  O O   . ARG A 1 301 ? 43.801  71.680  61.230  1.00 10.00 ? 301 ARG A O   1 
ATOM 2454  C CB  . ARG A 1 301 ? 44.132  72.601  63.736  1.00 10.00 ? 301 ARG A CB  1 
ATOM 2455  C CG  . ARG A 1 301 ? 44.487  73.808  62.866  1.00 10.00 ? 301 ARG A CG  1 
ATOM 2456  C CD  . ARG A 1 301 ? 43.764  75.074  63.284  1.00 10.00 ? 301 ARG A CD  1 
ATOM 2457  N NE  . ARG A 1 301 ? 44.010  76.166  62.344  1.00 10.00 ? 301 ARG A NE  1 
ATOM 2458  C CZ  . ARG A 1 301 ? 45.216  76.624  62.021  1.00 10.00 ? 301 ARG A CZ  1 
ATOM 2459  N NH1 . ARG A 1 301 ? 46.303  76.090  62.561  1.00 10.00 ? 301 ARG A NH1 1 
ATOM 2460  N NH2 . ARG A 1 301 ? 45.336  77.619  61.153  1.00 10.00 ? 301 ARG A NH2 1 
ATOM 2461  N N   . SER A 1 302 ? 45.854  70.838  61.053  1.00 10.00 ? 302 SER A N   1 
ATOM 2462  C CA  . SER A 1 302 ? 45.754  70.844  59.594  1.00 10.00 ? 302 SER A CA  1 
ATOM 2463  C C   . SER A 1 302 ? 45.865  69.465  58.971  1.00 10.00 ? 302 SER A C   1 
ATOM 2464  O O   . SER A 1 302 ? 46.760  68.688  59.314  1.00 10.00 ? 302 SER A O   1 
ATOM 2465  C CB  . SER A 1 302 ? 46.806  71.776  58.970  1.00 10.00 ? 302 SER A CB  1 
ATOM 2466  O OG  . SER A 1 302 ? 46.326  73.103  58.905  1.00 10.00 ? 302 SER A OG  1 
ATOM 2467  N N   . PRO A 1 303 ? 44.943  69.143  58.043  1.00 10.00 ? 303 PRO A N   1 
ATOM 2468  C CA  . PRO A 1 303 ? 44.903  67.868  57.342  1.00 10.00 ? 303 PRO A CA  1 
ATOM 2469  C C   . PRO A 1 303 ? 46.213  67.034  57.249  1.00 10.00 ? 303 PRO A C   1 
ATOM 2470  O O   . PRO A 1 303 ? 46.301  65.927  57.810  1.00 10.00 ? 303 PRO A O   1 
ATOM 2471  C CB  . PRO A 1 303 ? 44.332  68.280  55.982  1.00 10.00 ? 303 PRO A CB  1 
ATOM 2472  C CG  . PRO A 1 303 ? 43.301  69.177  56.349  1.00 10.00 ? 303 PRO A CG  1 
ATOM 2473  C CD  . PRO A 1 303 ? 43.963  70.055  57.421  1.00 10.00 ? 303 PRO A CD  1 
ATOM 2474  N N   . SER A 1 304 ? 47.213  67.546  56.532  1.00 10.00 ? 304 SER A N   1 
ATOM 2475  C CA  . SER A 1 304 ? 48.500  66.837  56.370  1.00 10.00 ? 304 SER A CA  1 
ATOM 2476  C C   . SER A 1 304 ? 49.730  67.603  56.810  1.00 10.00 ? 304 SER A C   1 
ATOM 2477  O O   . SER A 1 304 ? 50.784  67.026  57.023  1.00 10.00 ? 304 SER A O   1 
ATOM 2478  C CB  . SER A 1 304 ? 48.722  66.463  54.898  1.00 10.00 ? 304 SER A CB  1 
ATOM 2479  O OG  . SER A 1 304 ? 47.777  65.522  54.419  1.00 10.00 ? 304 SER A OG  1 
ATOM 2480  N N   . THR A 1 305 ? 49.583  68.920  56.907  1.00 10.00 ? 305 THR A N   1 
ATOM 2481  C CA  . THR A 1 305 ? 50.696  69.822  57.261  1.00 10.00 ? 305 THR A CA  1 
ATOM 2482  C C   . THR A 1 305 ? 51.059  69.929  58.737  1.00 10.00 ? 305 THR A C   1 
ATOM 2483  O O   . THR A 1 305 ? 52.203  70.232  59.052  1.00 10.00 ? 305 THR A O   1 
ATOM 2484  C CB  . THR A 1 305 ? 50.473  71.310  56.758  1.00 10.00 ? 305 THR A CB  1 
ATOM 2485  O OG1 . THR A 1 305 ? 49.130  71.480  56.291  1.00 10.00 ? 305 THR A OG1 1 
ATOM 2486  C CG2 . THR A 1 305 ? 51.479  71.686  55.650  1.00 10.00 ? 305 THR A CG2 1 
ATOM 2487  N N   . HIS A 1 306 ? 50.081  69.697  59.612  1.00 10.00 ? 306 HIS A N   1 
ATOM 2488  C CA  . HIS A 1 306 ? 50.216  69.778  61.091  1.00 10.00 ? 306 HIS A CA  1 
ATOM 2489  C C   . HIS A 1 306 ? 49.419  70.917  61.671  1.00 10.00 ? 306 HIS A C   1 
ATOM 2490  O O   . HIS A 1 306 ? 49.484  71.159  62.858  1.00 10.00 ? 306 HIS A O   1 
ATOM 2491  C CB  . HIS A 1 306 ? 51.686  69.872  61.581  1.00 10.00 ? 306 HIS A CB  1 
ATOM 2492  C CG  . HIS A 1 306 ? 52.323  71.238  61.506  1.00 10.00 ? 306 HIS A CG  1 
ATOM 2493  N ND1 . HIS A 1 306 ? 53.641  71.446  61.862  1.00 10.00 ? 306 HIS A ND1 1 
ATOM 2494  C CD2 . HIS A 1 306 ? 51.852  72.446  61.115  1.00 10.00 ? 306 HIS A CD2 1 
ATOM 2495  C CE1 . HIS A 1 306 ? 53.954  72.716  61.698  1.00 10.00 ? 306 HIS A CE1 1 
ATOM 2496  N NE2 . HIS A 1 306 ? 52.886  73.346  61.245  1.00 10.00 ? 306 HIS A NE2 1 
ATOM 2497  N N   . SER A 1 307 ? 53.337  66.428  17.616  1.00 10.00 ? 374 SER A N   1 
ATOM 2498  C CA  . SER A 1 307 ? 52.016  65.807  17.665  1.00 10.00 ? 374 SER A CA  1 
ATOM 2499  C C   . SER A 1 307 ? 51.927  64.756  18.760  1.00 10.00 ? 374 SER A C   1 
ATOM 2500  O O   . SER A 1 307 ? 51.646  65.119  19.889  1.00 10.00 ? 374 SER A O   1 
ATOM 2501  C CB  . SER A 1 307 ? 51.650  65.186  16.326  1.00 10.00 ? 374 SER A CB  1 
ATOM 2502  O OG  . SER A 1 307 ? 51.644  66.143  15.294  1.00 10.00 ? 374 SER A OG  1 
ATOM 2503  N N   . ALA A 1 308 ? 52.160  63.471  18.466  1.00 10.00 ? 375 ALA A N   1 
ATOM 2504  C CA  . ALA A 1 308 ? 52.063  62.497  19.535  1.00 10.00 ? 375 ALA A CA  1 
ATOM 2505  C C   . ALA A 1 308 ? 53.218  62.654  20.516  1.00 10.00 ? 375 ALA A C   1 
ATOM 2506  O O   . ALA A 1 308 ? 53.051  62.434  21.721  1.00 10.00 ? 375 ALA A O   1 
ATOM 2507  C CB  . ALA A 1 308 ? 52.051  61.086  18.952  1.00 10.00 ? 375 ALA A CB  1 
ATOM 2508  N N   . ILE A 1 309 ? 54.396  62.975  19.993  1.00 10.00 ? 376 ILE A N   1 
ATOM 2509  C CA  . ILE A 1 309 ? 55.571  63.170  20.822  1.00 10.00 ? 376 ILE A CA  1 
ATOM 2510  C C   . ILE A 1 309 ? 55.258  64.349  21.764  1.00 10.00 ? 376 ILE A C   1 
ATOM 2511  O O   . ILE A 1 309 ? 55.606  64.342  22.947  1.00 10.00 ? 376 ILE A O   1 
ATOM 2512  C CB  . ILE A 1 309 ? 56.813  63.478  19.936  1.00 10.00 ? 376 ILE A CB  1 
ATOM 2513  C CG1 . ILE A 1 309 ? 57.966  62.504  20.246  1.00 10.00 ? 376 ILE A CG1 1 
ATOM 2514  C CG2 . ILE A 1 309 ? 57.284  64.894  20.167  1.00 10.00 ? 376 ILE A CG2 1 
ATOM 2515  C CD1 . ILE A 1 309 ? 57.904  61.144  19.523  1.00 10.00 ? 376 ILE A CD1 1 
ATOM 2516  N N   . GLU A 1 310 ? 54.552  65.343  21.233  1.00 10.00 ? 377 GLU A N   1 
ATOM 2517  C CA  . GLU A 1 310 ? 54.180  66.525  22.032  1.00 10.00 ? 377 GLU A CA  1 
ATOM 2518  C C   . GLU A 1 310 ? 53.227  66.119  23.128  1.00 10.00 ? 377 GLU A C   1 
ATOM 2519  O O   . GLU A 1 310 ? 53.318  66.612  24.246  1.00 10.00 ? 377 GLU A O   1 
ATOM 2520  C CB  . GLU A 1 310 ? 53.454  67.576  21.185  1.00 10.00 ? 377 GLU A CB  1 
ATOM 2521  C CG  . GLU A 1 310 ? 54.309  68.413  20.263  1.00 10.00 ? 377 GLU A CG  1 
ATOM 2522  C CD  . GLU A 1 310 ? 53.561  68.755  19.010  1.00 10.00 ? 377 GLU A CD  1 
ATOM 2523  O OE1 . GLU A 1 310 ? 52.315  68.864  19.088  1.00 10.00 ? 377 GLU A OE1 1 
ATOM 2524  O OE2 . GLU A 1 310 ? 54.213  68.911  17.957  1.00 10.00 ? 377 GLU A OE2 1 
ATOM 2525  N N   . GLY A 1 311 ? 52.293  65.239  22.778  1.00 10.00 ? 378 GLY A N   1 
ATOM 2526  C CA  . GLY A 1 311 ? 51.306  64.790  23.740  1.00 10.00 ? 378 GLY A CA  1 
ATOM 2527  C C   . GLY A 1 311 ? 51.998  64.108  24.905  1.00 10.00 ? 378 GLY A C   1 
ATOM 2528  O O   . GLY A 1 311 ? 51.573  64.238  26.051  1.00 10.00 ? 378 GLY A O   1 
ATOM 2529  N N   . VAL A 1 312 ? 53.051  63.348  24.587  1.00 10.00 ? 379 VAL A N   1 
ATOM 2530  C CA  . VAL A 1 312 ? 53.859  62.619  25.580  1.00 10.00 ? 379 VAL A CA  1 
ATOM 2531  C C   . VAL A 1 312 ? 54.199  63.641  26.627  1.00 10.00 ? 379 VAL A C   1 
ATOM 2532  O O   . VAL A 1 312 ? 54.059  63.433  27.830  1.00 10.00 ? 379 VAL A O   1 
ATOM 2533  C CB  . VAL A 1 312 ? 55.218  62.158  24.996  1.00 10.00 ? 379 VAL A CB  1 
ATOM 2534  C CG1 . VAL A 1 312 ? 56.176  61.774  26.112  1.00 10.00 ? 379 VAL A CG1 1 
ATOM 2535  C CG2 . VAL A 1 312 ? 55.024  61.019  24.027  1.00 10.00 ? 379 VAL A CG2 1 
ATOM 2536  N N   . LYS A 1 313 ? 54.661  64.773  26.113  1.00 10.00 ? 380 LYS A N   1 
ATOM 2537  C CA  . LYS A 1 313 ? 55.087  65.895  26.913  1.00 10.00 ? 380 LYS A CA  1 
ATOM 2538  C C   . LYS A 1 313 ? 53.911  66.438  27.696  1.00 10.00 ? 380 LYS A C   1 
ATOM 2539  O O   . LYS A 1 313 ? 54.088  66.963  28.784  1.00 10.00 ? 380 LYS A O   1 
ATOM 2540  C CB  . LYS A 1 313 ? 55.672  66.964  25.989  1.00 10.00 ? 380 LYS A CB  1 
ATOM 2541  C CG  . LYS A 1 313 ? 56.544  66.360  24.902  1.00 10.00 ? 380 LYS A CG  1 
ATOM 2542  C CD  . LYS A 1 313 ? 57.033  67.393  23.917  1.00 10.00 ? 380 LYS A CD  1 
ATOM 2543  C CE  . LYS A 1 313 ? 57.481  66.730  22.627  1.00 10.00 ? 380 LYS A CE  1 
ATOM 2544  N NZ  . LYS A 1 313 ? 58.405  65.582  22.850  1.00 10.00 ? 380 LYS A NZ  1 
ATOM 2545  N N   . TYR A 1 314 ? 52.703  66.292  27.165  1.00 10.00 ? 381 TYR A N   1 
ATOM 2546  C CA  . TYR A 1 314 ? 51.579  66.817  27.899  1.00 10.00 ? 381 TYR A CA  1 
ATOM 2547  C C   . TYR A 1 314 ? 50.961  65.796  28.847  1.00 10.00 ? 381 TYR A C   1 
ATOM 2548  O O   . TYR A 1 314 ? 50.294  66.177  29.803  1.00 10.00 ? 381 TYR A O   1 
ATOM 2549  C CB  . TYR A 1 314 ? 50.563  67.426  26.931  1.00 10.00 ? 381 TYR A CB  1 
ATOM 2550  C CG  . TYR A 1 314 ? 51.132  68.622  26.141  1.00 10.00 ? 381 TYR A CG  1 
ATOM 2551  C CD1 . TYR A 1 314 ? 50.278  69.565  25.560  1.00 10.00 ? 381 TYR A CD1 1 
ATOM 2552  C CD2 . TYR A 1 314 ? 52.507  68.765  25.918  1.00 10.00 ? 381 TYR A CD2 1 
ATOM 2553  C CE1 . TYR A 1 314 ? 50.762  70.567  24.794  1.00 10.00 ? 381 TYR A CE1 1 
ATOM 2554  C CE2 . TYR A 1 314 ? 52.991  69.780  25.155  1.00 10.00 ? 381 TYR A CE2 1 
ATOM 2555  C CZ  . TYR A 1 314 ? 52.110  70.668  24.593  1.00 10.00 ? 381 TYR A CZ  1 
ATOM 2556  O OH  . TYR A 1 314 ? 52.571  71.663  23.778  1.00 10.00 ? 381 TYR A OH  1 
ATOM 2557  N N   . ILE A 1 315 ? 51.171  64.502  28.595  1.00 10.00 ? 382 ILE A N   1 
ATOM 2558  C CA  . ILE A 1 315 ? 50.685  63.455  29.511  1.00 10.00 ? 382 ILE A CA  1 
ATOM 2559  C C   . ILE A 1 315 ? 51.682  63.481  30.672  1.00 10.00 ? 382 ILE A C   1 
ATOM 2560  O O   . ILE A 1 315 ? 51.333  63.232  31.822  1.00 10.00 ? 382 ILE A O   1 
ATOM 2561  C CB  . ILE A 1 315 ? 50.687  62.009  28.854  1.00 10.00 ? 382 ILE A CB  1 
ATOM 2562  C CG1 . ILE A 1 315 ? 51.558  62.008  27.598  1.00 10.00 ? 382 ILE A CG1 1 
ATOM 2563  C CG2 . ILE A 1 315 ? 49.233  61.508  28.561  1.00 10.00 ? 382 ILE A CG2 1 
ATOM 2564  C CD1 . ILE A 1 315 ? 51.448  60.741  26.769  1.00 10.00 ? 382 ILE A CD1 1 
ATOM 2565  N N   . ALA A 1 316 ? 52.919  63.853  30.356  1.00 10.00 ? 383 ALA A N   1 
ATOM 2566  C CA  . ALA A 1 316 ? 53.989  63.907  31.357  1.00 10.00 ? 383 ALA A CA  1 
ATOM 2567  C C   . ALA A 1 316 ? 53.904  65.220  32.125  1.00 10.00 ? 383 ALA A C   1 
ATOM 2568  O O   . ALA A 1 316 ? 54.064  65.254  33.341  1.00 10.00 ? 383 ALA A O   1 
ATOM 2569  C CB  . ALA A 1 316 ? 55.375  63.786  30.684  1.00 10.00 ? 383 ALA A CB  1 
ATOM 2570  N N   . GLU A 1 317 ? 53.627  66.290  31.379  1.00 10.00 ? 384 GLU A N   1 
ATOM 2571  C CA  . GLU A 1 317 ? 53.511  67.624  31.950  1.00 10.00 ? 384 GLU A CA  1 
ATOM 2572  C C   . GLU A 1 317 ? 52.242  67.686  32.800  1.00 10.00 ? 384 GLU A C   1 
ATOM 2573  O O   . GLU A 1 317 ? 52.186  68.404  33.798  1.00 10.00 ? 384 GLU A O   1 
ATOM 2574  C CB  . GLU A 1 317 ? 53.493  68.668  30.799  1.00 10.00 ? 384 GLU A CB  1 
ATOM 2575  C CG  . GLU A 1 317 ? 54.035  70.045  31.186  1.00 10.00 ? 384 GLU A CG  1 
ATOM 2576  C CD  . GLU A 1 317 ? 55.470  70.007  31.595  1.00 10.00 ? 384 GLU A CD  1 
ATOM 2577  O OE1 . GLU A 1 317 ? 56.314  69.835  30.716  1.00 10.00 ? 384 GLU A OE1 1 
ATOM 2578  O OE2 . GLU A 1 317 ? 55.744  70.140  32.793  1.00 10.00 ? 384 GLU A OE2 1 
ATOM 2579  N N   . HIS A 1 318 ? 51.240  66.938  32.369  1.00 10.00 ? 385 HIS A N   1 
ATOM 2580  C CA  . HIS A 1 318 ? 49.955  66.870  33.040  1.00 10.00 ? 385 HIS A CA  1 
ATOM 2581  C C   . HIS A 1 318 ? 50.160  66.177  34.398  1.00 10.00 ? 385 HIS A C   1 
ATOM 2582  O O   . HIS A 1 318 ? 49.450  66.447  35.371  1.00 10.00 ? 385 HIS A O   1 
ATOM 2583  C CB  . HIS A 1 318 ? 48.987  66.067  32.162  1.00 10.00 ? 385 HIS A CB  1 
ATOM 2584  C CG  . HIS A 1 318 ? 47.725  65.645  32.847  1.00 10.00 ? 385 HIS A CG  1 
ATOM 2585  N ND1 . HIS A 1 318 ? 47.707  65.086  34.106  1.00 10.00 ? 385 HIS A ND1 1 
ATOM 2586  C CD2 . HIS A 1 318 ? 46.445  65.613  32.410  1.00 10.00 ? 385 HIS A CD2 1 
ATOM 2587  C CE1 . HIS A 1 318 ? 46.474  64.727  34.413  1.00 10.00 ? 385 HIS A CE1 1 
ATOM 2588  N NE2 . HIS A 1 318 ? 45.688  65.034  33.399  1.00 10.00 ? 385 HIS A NE2 1 
ATOM 2589  N N   . MET A 1 319 ? 51.135  65.261  34.461  1.00 10.00 ? 386 MET A N   1 
ATOM 2590  C CA  . MET A 1 319 ? 51.457  64.510  35.676  1.00 10.00 ? 386 MET A CA  1 
ATOM 2591  C C   . MET A 1 319 ? 52.083  65.415  36.733  1.00 10.00 ? 386 MET A C   1 
ATOM 2592  O O   . MET A 1 319 ? 51.778  65.321  37.923  1.00 10.00 ? 386 MET A O   1 
ATOM 2593  C CB  . MET A 1 319 ? 52.418  63.353  35.336  1.00 10.00 ? 386 MET A CB  1 
ATOM 2594  C CG  . MET A 1 319 ? 51.874  62.422  34.300  1.00 10.00 ? 386 MET A CG  1 
ATOM 2595  S SD  . MET A 1 319 ? 50.137  62.346  34.658  1.00 10.00 ? 386 MET A SD  1 
ATOM 2596  C CE  . MET A 1 319 ? 49.431  62.335  33.122  1.00 10.00 ? 386 MET A CE  1 
ATOM 2597  N N   . LYS A 1 320 ? 52.961  66.294  36.271  1.00 10.00 ? 387 LYS A N   1 
ATOM 2598  C CA  . LYS A 1 320 ? 53.662  67.234  37.126  1.00 10.00 ? 387 LYS A CA  1 
ATOM 2599  C C   . LYS A 1 320 ? 52.706  68.308  37.649  1.00 10.00 ? 387 LYS A C   1 
ATOM 2600  O O   . LYS A 1 320 ? 52.828  68.766  38.788  1.00 10.00 ? 387 LYS A O   1 
ATOM 2601  C CB  . LYS A 1 320 ? 54.842  67.840  36.333  1.00 10.00 ? 387 LYS A CB  1 
ATOM 2602  C CG  . LYS A 1 320 ? 54.833  67.498  34.823  1.00 10.00 ? 387 LYS A CG  1 
ATOM 2603  C CD  . LYS A 1 320 ? 56.266  67.370  34.231  1.00 10.00 ? 387 LYS A CD  1 
ATOM 2604  C CE  . LYS A 1 320 ? 57.197  68.581  34.564  1.00 10.00 ? 387 LYS A CE  1 
ATOM 2605  N NZ  . LYS A 1 320 ? 58.596  68.538  33.993  1.00 10.00 ? 387 LYS A NZ  1 
ATOM 2606  N N   . SER A 1 321 ? 51.727  68.666  36.826  1.00 10.00 ? 388 SER A N   1 
ATOM 2607  C CA  . SER A 1 321 ? 50.770  69.676  37.191  1.00 10.00 ? 388 SER A CA  1 
ATOM 2608  C C   . SER A 1 321 ? 49.738  69.251  38.216  1.00 10.00 ? 388 SER A C   1 
ATOM 2609  O O   . SER A 1 321 ? 49.421  70.018  39.128  1.00 10.00 ? 388 SER A O   1 
ATOM 2610  C CB  . SER A 1 321 ? 50.053  70.185  35.938  1.00 10.00 ? 388 SER A CB  1 
ATOM 2611  O OG  . SER A 1 321 ? 49.377  69.130  35.276  1.00 10.00 ? 388 SER A OG  1 
ATOM 2612  N N   . ASP A 1 322 ? 49.185  68.050  38.129  1.00 10.00 ? 389 ASP A N   1 
ATOM 2613  C CA  . ASP A 1 322 ? 48.213  67.809  39.163  1.00 10.00 ? 389 ASP A CA  1 
ATOM 2614  C C   . ASP A 1 322 ? 48.864  67.460  40.503  1.00 10.00 ? 389 ASP A C   1 
ATOM 2615  O O   . ASP A 1 322 ? 48.228  67.592  41.539  1.00 10.00 ? 389 ASP A O   1 
ATOM 2616  C CB  . ASP A 1 322 ? 47.160  66.813  38.715  1.00 10.00 ? 389 ASP A CB  1 
ATOM 2617  C CG  . ASP A 1 322 ? 45.773  67.362  38.864  1.00 10.00 ? 389 ASP A CG  1 
ATOM 2618  O OD1 . ASP A 1 322 ? 45.504  67.935  39.939  1.00 10.00 ? 389 ASP A OD1 1 
ATOM 2619  O OD2 . ASP A 1 322 ? 44.959  67.228  37.926  1.00 10.00 ? 389 ASP A OD2 1 
ATOM 2620  N N   . GLU A 1 323 ? 50.100  66.964  40.465  1.00 10.00 ? 390 GLU A N   1 
ATOM 2621  C CA  . GLU A 1 323 ? 50.801  66.863  41.740  1.00 10.00 ? 390 GLU A CA  1 
ATOM 2622  C C   . GLU A 1 323 ? 51.232  68.236  42.240  1.00 10.00 ? 390 GLU A C   1 
ATOM 2623  O O   . GLU A 1 323 ? 51.449  68.503  43.361  1.00 10.00 ? 390 GLU A O   1 
ATOM 2624  C CB  . GLU A 1 323 ? 52.011  65.937  41.612  1.00 10.00 ? 390 GLU A CB  1 
ATOM 2625  C CG  . GLU A 1 323 ? 53.152  66.516  40.790  1.00 10.00 ? 390 GLU A CG  1 
ATOM 2626  C CD  . GLU A 1 323 ? 54.049  67.429  41.601  1.00 10.00 ? 390 GLU A CD  1 
ATOM 2627  O OE1 . GLU A 1 323 ? 53.910  67.450  42.841  1.00 10.00 ? 390 GLU A OE1 1 
ATOM 2628  O OE2 . GLU A 1 323 ? 54.891  68.126  40.994  1.00 10.00 ? 390 GLU A OE2 1 
ATOM 2629  N N   . GLU A 1 324 ? 51.249  69.135  41.199  1.00 10.00 ? 391 GLU A N   1 
ATOM 2630  C CA  . GLU A 1 324 ? 51.578  70.559  41.416  1.00 10.00 ? 391 GLU A CA  1 
ATOM 2631  C C   . GLU A 1 324 ? 50.465  70.991  42.373  1.00 10.00 ? 391 GLU A C   1 
ATOM 2632  O O   . GLU A 1 324 ? 50.705  71.500  43.458  1.00 10.00 ? 391 GLU A O   1 
ATOM 2633  C CB  . GLU A 1 324 ? 51.522  71.344  40.066  1.00 10.00 ? 391 GLU A CB  1 
ATOM 2634  C CG  . GLU A 1 324 ? 51.601  72.936  40.136  1.00 10.00 ? 391 GLU A CG  1 
ATOM 2635  C CD  . GLU A 1 324 ? 50.807  73.694  39.031  1.00 10.00 ? 391 GLU A CD  1 
ATOM 2636  O OE1 . GLU A 1 324 ? 49.565  73.556  38.965  1.00 10.00 ? 391 GLU A OE1 1 
ATOM 2637  O OE2 . GLU A 1 324 ? 51.433  74.435  38.246  1.00 10.00 ? 391 GLU A OE2 1 
ATOM 2638  N N   . SER A 1 325 ? 49.242  70.732  41.935  1.00 10.00 ? 392 SER A N   1 
ATOM 2639  C CA  . SER A 1 325 ? 47.992  70.979  42.652  1.00 10.00 ? 392 SER A CA  1 
ATOM 2640  C C   . SER A 1 325 ? 48.131  70.480  44.089  1.00 10.00 ? 392 SER A C   1 
ATOM 2641  O O   . SER A 1 325 ? 48.040  71.215  45.099  1.00 10.00 ? 392 SER A O   1 
ATOM 2642  C CB  . SER A 1 325 ? 46.871  70.171  41.940  1.00 10.00 ? 392 SER A CB  1 
ATOM 2643  O OG  . SER A 1 325 ? 45.650  70.086  42.678  1.00 10.00 ? 392 SER A OG  1 
ATOM 2644  N N   . SER A 1 326 ? 48.397  69.188  44.161  1.00 10.00 ? 393 SER A N   1 
ATOM 2645  C CA  . SER A 1 326 ? 48.497  68.451  45.415  1.00 10.00 ? 393 SER A CA  1 
ATOM 2646  C C   . SER A 1 326 ? 49.375  69.190  46.419  1.00 10.00 ? 393 SER A C   1 
ATOM 2647  O O   . SER A 1 326 ? 48.934  69.430  47.540  1.00 10.00 ? 393 SER A O   1 
ATOM 2648  C CB  . SER A 1 326 ? 49.038  67.042  45.167  1.00 10.00 ? 393 SER A CB  1 
ATOM 2649  O OG  . SER A 1 326 ? 50.358  67.085  44.652  1.00 10.00 ? 393 SER A OG  1 
ATOM 2650  N N   . ASN A 1 327 ? 50.562  69.602  45.985  1.00 10.00 ? 394 ASN A N   1 
ATOM 2651  C CA  . ASN A 1 327 ? 51.478  70.309  46.878  1.00 10.00 ? 394 ASN A CA  1 
ATOM 2652  C C   . ASN A 1 327 ? 50.800  71.488  47.552  1.00 10.00 ? 394 ASN A C   1 
ATOM 2653  O O   . ASN A 1 327 ? 50.905  71.655  48.762  1.00 10.00 ? 394 ASN A O   1 
ATOM 2654  C CB  . ASN A 1 327 ? 52.707  70.825  46.127  1.00 10.00 ? 394 ASN A CB  1 
ATOM 2655  C CG  . ASN A 1 327 ? 52.359  71.848  45.056  1.00 10.00 ? 394 ASN A CG  1 
ATOM 2656  O OD1 . ASN A 1 327 ? 51.531  72.738  45.246  1.00 10.00 ? 394 ASN A OD1 1 
ATOM 2657  N ND2 . ASN A 1 327 ? 53.011  71.724  43.915  1.00 10.00 ? 394 ASN A ND2 1 
ATOM 2658  N N   . ALA A 1 328 ? 50.113  72.294  46.745  1.00 10.00 ? 395 ALA A N   1 
ATOM 2659  C CA  . ALA A 1 328 ? 49.407  73.480  47.178  1.00 10.00 ? 395 ALA A CA  1 
ATOM 2660  C C   . ALA A 1 328 ? 48.291  73.124  48.152  1.00 10.00 ? 395 ALA A C   1 
ATOM 2661  O O   . ALA A 1 328 ? 47.967  73.902  49.051  1.00 10.00 ? 395 ALA A O   1 
ATOM 2662  C CB  . ALA A 1 328 ? 48.844  74.188  45.953  1.00 10.00 ? 395 ALA A CB  1 
ATOM 2663  N N   . ALA A 1 329 ? 47.712  71.940  47.975  1.00 10.00 ? 396 ALA A N   1 
ATOM 2664  C CA  . ALA A 1 329 ? 46.627  71.491  48.846  1.00 10.00 ? 396 ALA A CA  1 
ATOM 2665  C C   . ALA A 1 329 ? 47.087  71.432  50.293  1.00 10.00 ? 396 ALA A C   1 
ATOM 2666  O O   . ALA A 1 329 ? 46.563  72.145  51.145  1.00 10.00 ? 396 ALA A O   1 
ATOM 2667  C CB  . ALA A 1 329 ? 46.109  70.115  48.408  1.00 10.00 ? 396 ALA A CB  1 
ATOM 2668  N N   . GLU A 1 330 ? 48.086  70.602  50.571  1.00 10.00 ? 397 GLU A N   1 
ATOM 2669  C CA  . GLU A 1 330 ? 48.554  70.481  51.952  1.00 10.00 ? 397 GLU A CA  1 
ATOM 2670  C C   . GLU A 1 330 ? 49.018  71.832  52.503  1.00 10.00 ? 397 GLU A C   1 
ATOM 2671  O O   . GLU A 1 330 ? 48.963  72.069  53.703  1.00 10.00 ? 397 GLU A O   1 
ATOM 2672  C CB  . GLU A 1 330 ? 49.686  69.445  52.059  1.00 10.00 ? 397 GLU A CB  1 
ATOM 2673  C CG  . GLU A 1 330 ? 49.192  68.006  52.223  1.00 10.00 ? 397 GLU A CG  1 
ATOM 2674  C CD  . GLU A 1 330 ? 50.282  66.974  51.998  1.00 10.00 ? 397 GLU A CD  1 
ATOM 2675  O OE1 . GLU A 1 330 ? 51.422  67.221  52.449  1.00 10.00 ? 397 GLU A OE1 1 
ATOM 2676  O OE2 . GLU A 1 330 ? 49.998  65.920  51.381  1.00 10.00 ? 397 GLU A OE2 1 
ATOM 2677  N N   . GLU A 1 331 ? 49.509  72.713  51.626  1.00 10.00 ? 398 GLU A N   1 
ATOM 2678  C CA  . GLU A 1 331 ? 49.931  74.035  52.100  1.00 10.00 ? 398 GLU A CA  1 
ATOM 2679  C C   . GLU A 1 331 ? 48.625  74.809  52.320  1.00 10.00 ? 398 GLU A C   1 
ATOM 2680  O O   . GLU A 1 331 ? 48.550  75.663  53.189  1.00 10.00 ? 398 GLU A O   1 
ATOM 2681  C CB  . GLU A 1 331 ? 50.870  74.709  51.082  1.00 10.00 ? 398 GLU A CB  1 
ATOM 2682  C CG  . GLU A 1 331 ? 52.002  73.759  50.682  1.00 10.00 ? 398 GLU A CG  1 
ATOM 2683  C CD  . GLU A 1 331 ? 53.047  74.376  49.768  1.00 10.00 ? 398 GLU A CD  1 
ATOM 2684  O OE1 . GLU A 1 331 ? 52.702  75.323  49.029  1.00 10.00 ? 398 GLU A OE1 1 
ATOM 2685  O OE2 . GLU A 1 331 ? 54.214  73.909  49.767  1.00 10.00 ? 398 GLU A OE2 1 
ATOM 2686  N N   . TRP A 1 332 ? 47.589  74.479  51.546  1.00 10.00 ? 399 TRP A N   1 
ATOM 2687  C CA  . TRP A 1 332 ? 46.303  75.134  51.729  1.00 10.00 ? 399 TRP A CA  1 
ATOM 2688  C C   . TRP A 1 332 ? 45.772  74.639  53.072  1.00 10.00 ? 399 TRP A C   1 
ATOM 2689  O O   . TRP A 1 332 ? 44.689  75.032  53.517  1.00 10.00 ? 399 TRP A O   1 
ATOM 2690  C CB  . TRP A 1 332 ? 45.327  74.745  50.613  1.00 10.00 ? 399 TRP A CB  1 
ATOM 2691  C CG  . TRP A 1 332 ? 45.437  75.538  49.326  1.00 10.00 ? 399 TRP A CG  1 
ATOM 2692  C CD1 . TRP A 1 332 ? 44.793  75.270  48.150  1.00 10.00 ? 399 TRP A CD1 1 
ATOM 2693  C CD2 . TRP A 1 332 ? 46.199  76.736  49.097  1.00 10.00 ? 399 TRP A CD2 1 
ATOM 2694  N NE1 . TRP A 1 332 ? 45.102  76.220  47.208  1.00 10.00 ? 399 TRP A NE1 1 
ATOM 2695  C CE2 . TRP A 1 332 ? 45.963  77.131  47.761  1.00 10.00 ? 399 TRP A CE2 1 
ATOM 2696  C CE3 . TRP A 1 332 ? 47.056  77.513  49.890  1.00 10.00 ? 399 TRP A CE3 1 
ATOM 2697  C CZ2 . TRP A 1 332 ? 46.552  78.269  47.199  1.00 10.00 ? 399 TRP A CZ2 1 
ATOM 2698  C CZ3 . TRP A 1 332 ? 47.643  78.646  49.330  1.00 10.00 ? 399 TRP A CZ3 1 
ATOM 2699  C CH2 . TRP A 1 332 ? 47.386  79.011  47.997  1.00 10.00 ? 399 TRP A CH2 1 
ATOM 2700  N N   . LYS A 1 333 ? 46.548  73.757  53.692  1.00 10.00 ? 400 LYS A N   1 
ATOM 2701  C CA  . LYS A 1 333 ? 46.232  73.175  54.994  1.00 10.00 ? 400 LYS A CA  1 
ATOM 2702  C C   . LYS A 1 333 ? 46.826  73.993  56.142  1.00 10.00 ? 400 LYS A C   1 
ATOM 2703  O O   . LYS A 1 333 ? 46.094  74.469  57.019  1.00 10.00 ? 400 LYS A O   1 
ATOM 2704  C CB  . LYS A 1 333 ? 46.743  71.736  55.071  1.00 10.00 ? 400 LYS A CB  1 
ATOM 2705  C CG  . LYS A 1 333 ? 46.028  70.778  54.123  1.00 10.00 ? 400 LYS A CG  1 
ATOM 2706  C CD  . LYS A 1 333 ? 46.475  69.350  54.327  1.00 10.00 ? 400 LYS A CD  1 
ATOM 2707  C CE  . LYS A 1 333 ? 45.651  68.438  53.445  1.00 10.00 ? 400 LYS A CE  1 
ATOM 2708  N NZ  . LYS A 1 333 ? 46.027  67.003  53.579  1.00 10.00 ? 400 LYS A NZ  1 
ATOM 2709  N N   . TYR A 1 334 ? 48.147  74.161  56.134  1.00 10.00 ? 401 TYR A N   1 
ATOM 2710  C CA  . TYR A 1 334 ? 48.826  74.966  57.172  1.00 10.00 ? 401 TYR A CA  1 
ATOM 2711  C C   . TYR A 1 334 ? 48.983  76.365  56.633  1.00 10.00 ? 401 TYR A C   1 
ATOM 2712  O O   . TYR A 1 334 ? 49.977  76.675  55.989  1.00 10.00 ? 401 TYR A O   1 
ATOM 2713  C CB  . TYR A 1 334 ? 50.230  74.409  57.601  1.00 10.00 ? 401 TYR A CB  1 
ATOM 2714  C CG  . TYR A 1 334 ? 51.439  74.674  56.660  1.00 10.00 ? 401 TYR A CG  1 
ATOM 2715  C CD1 . TYR A 1 334 ? 51.279  74.764  55.274  1.00 10.00 ? 401 TYR A CD1 1 
ATOM 2716  C CD2 . TYR A 1 334 ? 52.744  74.696  57.160  1.00 10.00 ? 401 TYR A CD2 1 
ATOM 2717  C CE1 . TYR A 1 334 ? 52.342  74.823  54.421  1.00 10.00 ? 401 TYR A CE1 1 
ATOM 2718  C CE2 . TYR A 1 334 ? 53.838  74.783  56.305  1.00 10.00 ? 401 TYR A CE2 1 
ATOM 2719  C CZ  . TYR A 1 334 ? 53.625  74.834  54.929  1.00 10.00 ? 401 TYR A CZ  1 
ATOM 2720  O OH  . TYR A 1 334 ? 54.688  74.866  54.044  1.00 10.00 ? 401 TYR A OH  1 
ATOM 2721  N N   . VAL A 1 335 ? 48.004  77.207  56.922  1.00 10.00 ? 402 VAL A N   1 
ATOM 2722  C CA  . VAL A 1 335 ? 48.022  78.586  56.481  1.00 10.00 ? 402 VAL A CA  1 
ATOM 2723  C C   . VAL A 1 335 ? 48.803  79.374  57.537  1.00 10.00 ? 402 VAL A C   1 
ATOM 2724  O O   . VAL A 1 335 ? 48.986  78.901  58.660  1.00 10.00 ? 402 VAL A O   1 
ATOM 2725  C CB  . VAL A 1 335 ? 46.583  79.174  56.371  1.00 10.00 ? 402 VAL A CB  1 
ATOM 2726  C CG1 . VAL A 1 335 ? 46.491  80.045  55.106  1.00 10.00 ? 402 VAL A CG1 1 
ATOM 2727  C CG2 . VAL A 1 335 ? 45.519  78.047  56.418  1.00 10.00 ? 402 VAL A CG2 1 
ATOM 2728  N N   . ALA A 1 336 ? 49.245  80.573  57.179  1.00 10.00 ? 403 ALA A N   1 
ATOM 2729  C CA  . ALA A 1 336 ? 50.001  81.429  58.080  1.00 10.00 ? 403 ALA A CA  1 
ATOM 2730  C C   . ALA A 1 336 ? 49.168  82.664  58.407  1.00 10.00 ? 403 ALA A C   1 
ATOM 2731  O O   . ALA A 1 336 ? 49.652  83.580  59.065  1.00 10.00 ? 403 ALA A O   1 
ATOM 2732  C CB  . ALA A 1 336 ? 51.330  81.846  57.418  1.00 10.00 ? 403 ALA A CB  1 
ATOM 2733  N N   . MET A 1 337 ? 47.914  82.672  57.957  1.00 10.00 ? 404 MET A N   1 
ATOM 2734  C CA  . MET A 1 337 ? 47.023  83.799  58.170  1.00 10.00 ? 404 MET A CA  1 
ATOM 2735  C C   . MET A 1 337 ? 46.357  83.797  59.549  1.00 10.00 ? 404 MET A C   1 
ATOM 2736  O O   . MET A 1 337 ? 46.285  84.835  60.201  1.00 10.00 ? 404 MET A O   1 
ATOM 2737  C CB  . MET A 1 337 ? 45.988  83.911  57.005  1.00 10.00 ? 404 MET A CB  1 
ATOM 2738  C CG  . MET A 1 337 ? 45.064  82.708  56.679  1.00 10.00 ? 404 MET A CG  1 
ATOM 2739  S SD  . MET A 1 337 ? 44.082  82.985  55.134  1.00 10.00 ? 404 MET A SD  1 
ATOM 2740  C CE  . MET A 1 337 ? 42.471  83.290  55.818  1.00 10.00 ? 404 MET A CE  1 
ATOM 2741  N N   . VAL A 1 338 ? 45.905  82.647  60.030  1.00 10.00 ? 405 VAL A N   1 
ATOM 2742  C CA  . VAL A 1 338 ? 45.281  82.648  61.349  1.00 10.00 ? 405 VAL A CA  1 
ATOM 2743  C C   . VAL A 1 338 ? 46.221  82.267  62.468  1.00 10.00 ? 405 VAL A C   1 
ATOM 2744  O O   . VAL A 1 338 ? 45.873  82.430  63.640  1.00 10.00 ? 405 VAL A O   1 
ATOM 2745  C CB  . VAL A 1 338 ? 43.969  81.728  61.455  1.00 10.00 ? 405 VAL A CB  1 
ATOM 2746  C CG1 . VAL A 1 338 ? 43.461  81.306  60.073  1.00 10.00 ? 405 VAL A CG1 1 
ATOM 2747  C CG2 . VAL A 1 338 ? 44.213  80.526  62.332  1.00 10.00 ? 405 VAL A CG2 1 
ATOM 2748  N N   . ILE A 1 339 ? 47.407  81.761  62.149  1.00 10.00 ? 406 ILE A N   1 
ATOM 2749  C CA  . ILE A 1 339 ? 48.305  81.408  63.231  1.00 10.00 ? 406 ILE A CA  1 
ATOM 2750  C C   . ILE A 1 339 ? 48.678  82.773  63.795  1.00 10.00 ? 406 ILE A C   1 
ATOM 2751  O O   . ILE A 1 339 ? 49.091  82.899  64.945  1.00 10.00 ? 406 ILE A O   1 
ATOM 2752  C CB  . ILE A 1 339 ? 49.548  80.569  62.764  1.00 10.00 ? 406 ILE A CB  1 
ATOM 2753  C CG1 . ILE A 1 339 ? 49.101  79.400  61.879  1.00 10.00 ? 406 ILE A CG1 1 
ATOM 2754  C CG2 . ILE A 1 339 ? 50.284  80.033  63.985  1.00 10.00 ? 406 ILE A CG2 1 
ATOM 2755  C CD1 . ILE A 1 339 ? 47.915  78.644  62.429  1.00 10.00 ? 406 ILE A CD1 1 
ATOM 2756  N N   . ASP A 1 340 ? 48.476  83.805  62.976  1.00 10.00 ? 407 ASP A N   1 
ATOM 2757  C CA  . ASP A 1 340 ? 48.719  85.163  63.387  1.00 10.00 ? 407 ASP A CA  1 
ATOM 2758  C C   . ASP A 1 340 ? 47.562  85.576  64.284  1.00 10.00 ? 407 ASP A C   1 
ATOM 2759  O O   . ASP A 1 340 ? 47.755  86.281  65.274  1.00 10.00 ? 407 ASP A O   1 
ATOM 2760  C CB  . ASP A 1 340 ? 48.806  86.025  62.146  1.00 10.00 ? 407 ASP A CB  1 
ATOM 2761  C CG  . ASP A 1 340 ? 50.110  85.856  61.456  1.00 10.00 ? 407 ASP A CG  1 
ATOM 2762  O OD1 . ASP A 1 340 ? 50.803  84.882  61.793  1.00 10.00 ? 407 ASP A OD1 1 
ATOM 2763  O OD2 . ASP A 1 340 ? 50.444  86.681  60.583  1.00 10.00 ? 407 ASP A OD2 1 
ATOM 2764  N N   . HIS A 1 341 ? 46.364  85.108  63.937  1.00 10.00 ? 408 HIS A N   1 
ATOM 2765  C CA  . HIS A 1 341 ? 45.148  85.398  64.716  1.00 10.00 ? 408 HIS A CA  1 
ATOM 2766  C C   . HIS A 1 341 ? 45.373  84.853  66.137  1.00 10.00 ? 408 HIS A C   1 
ATOM 2767  O O   . HIS A 1 341 ? 45.207  85.579  67.106  1.00 10.00 ? 408 HIS A O   1 
ATOM 2768  C CB  . HIS A 1 341 ? 43.867  84.690  64.174  1.00 10.00 ? 408 HIS A CB  1 
ATOM 2769  C CG  . HIS A 1 341 ? 43.310  85.212  62.874  1.00 10.00 ? 408 HIS A CG  1 
ATOM 2770  N ND1 . HIS A 1 341 ? 44.096  85.587  61.808  1.00 10.00 ? 408 HIS A ND1 1 
ATOM 2771  C CD2 . HIS A 1 341 ? 42.035  85.219  62.413  1.00 10.00 ? 408 HIS A CD2 1 
ATOM 2772  C CE1 . HIS A 1 341 ? 43.330  85.791  60.748  1.00 10.00 ? 408 HIS A CE1 1 
ATOM 2773  N NE2 . HIS A 1 341 ? 42.076  85.573  61.089  1.00 10.00 ? 408 HIS A NE2 1 
ATOM 2774  N N   . ILE A 1 342 ? 45.741  83.574  66.257  1.00 10.00 ? 409 ILE A N   1 
ATOM 2775  C CA  . ILE A 1 342 ? 45.936  82.943  67.570  1.00 10.00 ? 409 ILE A CA  1 
ATOM 2776  C C   . ILE A 1 342 ? 47.033  83.684  68.338  1.00 10.00 ? 409 ILE A C   1 
ATOM 2777  O O   . ILE A 1 342 ? 47.012  83.778  69.572  1.00 10.00 ? 409 ILE A O   1 
ATOM 2778  C CB  . ILE A 1 342 ? 46.301  81.397  67.451  1.00 10.00 ? 409 ILE A CB  1 
ATOM 2779  C CG1 . ILE A 1 342 ? 46.544  81.002  65.978  1.00 10.00 ? 409 ILE A CG1 1 
ATOM 2780  C CG2 . ILE A 1 342 ? 45.192  80.534  68.094  1.00 10.00 ? 409 ILE A CG2 1 
ATOM 2781  C CD1 . ILE A 1 342 ? 47.584  79.866  65.774  1.00 10.00 ? 409 ILE A CD1 1 
ATOM 2782  N N   . LEU A 1 343 ? 47.973  84.239  67.582  1.00 10.00 ? 410 LEU A N   1 
ATOM 2783  C CA  . LEU A 1 343 ? 49.094  84.983  68.131  1.00 10.00 ? 410 LEU A CA  1 
ATOM 2784  C C   . LEU A 1 343 ? 48.566  86.184  68.901  1.00 10.00 ? 410 LEU A C   1 
ATOM 2785  O O   . LEU A 1 343 ? 48.886  86.366  70.076  1.00 10.00 ? 410 LEU A O   1 
ATOM 2786  C CB  . LEU A 1 343 ? 49.991  85.447  66.995  1.00 10.00 ? 410 LEU A CB  1 
ATOM 2787  C CG  . LEU A 1 343 ? 51.407  85.984  67.291  1.00 10.00 ? 410 LEU A CG  1 
ATOM 2788  C CD1 . LEU A 1 343 ? 51.308  87.070  68.339  1.00 10.00 ? 410 LEU A CD1 1 
ATOM 2789  C CD2 . LEU A 1 343 ? 52.363  84.886  67.733  1.00 10.00 ? 410 LEU A CD2 1 
ATOM 2790  N N   . LEU A 1 344 ? 47.772  87.015  68.230  1.00 10.00 ? 411 LEU A N   1 
ATOM 2791  C CA  . LEU A 1 344 ? 47.182  88.199  68.892  1.00 10.00 ? 411 LEU A CA  1 
ATOM 2792  C C   . LEU A 1 344 ? 45.920  87.753  69.632  1.00 10.00 ? 411 LEU A C   1 
ATOM 2793  O O   . LEU A 1 344 ? 45.532  88.373  70.617  1.00 10.00 ? 411 LEU A O   1 
ATOM 2794  C CB  . LEU A 1 344 ? 46.798  89.353  67.909  1.00 10.00 ? 411 LEU A CB  1 
ATOM 2795  C CG  . LEU A 1 344 ? 47.778  90.307  67.145  1.00 10.00 ? 411 LEU A CG  1 
ATOM 2796  C CD1 . LEU A 1 344 ? 47.042  91.624  66.781  1.00 10.00 ? 411 LEU A CD1 1 
ATOM 2797  C CD2 . LEU A 1 344 ? 49.031  90.648  67.985  1.00 10.00 ? 411 LEU A CD2 1 
ATOM 2798  N N   . CYS A 1 345 ? 45.294  86.670  69.158  1.00 10.00 ? 412 CYS A N   1 
ATOM 2799  C CA  . CYS A 1 345 ? 44.065  86.138  69.783  1.00 10.00 ? 412 CYS A CA  1 
ATOM 2800  C C   . CYS A 1 345 ? 44.351  85.975  71.270  1.00 10.00 ? 412 CYS A C   1 
ATOM 2801  O O   . CYS A 1 345 ? 43.716  86.602  72.120  1.00 10.00 ? 412 CYS A O   1 
ATOM 2802  C CB  . CYS A 1 345 ? 43.671  84.737  69.237  1.00 10.00 ? 412 CYS A CB  1 
ATOM 2803  S SG  . CYS A 1 345 ? 42.916  84.555  67.570  1.00 10.00 ? 412 CYS A SG  1 
ATOM 2804  N N   . VAL A 1 346 ? 45.346  85.141  71.550  1.00 10.00 ? 413 VAL A N   1 
ATOM 2805  C CA  . VAL A 1 346 ? 45.753  84.810  72.894  1.00 10.00 ? 413 VAL A CA  1 
ATOM 2806  C C   . VAL A 1 346 ? 46.736  85.764  73.563  1.00 10.00 ? 413 VAL A C   1 
ATOM 2807  O O   . VAL A 1 346 ? 46.699  85.917  74.780  1.00 10.00 ? 413 VAL A O   1 
ATOM 2808  C CB  . VAL A 1 346 ? 46.367  83.384  72.933  1.00 10.00 ? 413 VAL A CB  1 
ATOM 2809  C CG1 . VAL A 1 346 ? 46.695  82.985  74.367  1.00 10.00 ? 413 VAL A CG1 1 
ATOM 2810  C CG2 . VAL A 1 346 ? 45.408  82.387  72.301  1.00 10.00 ? 413 VAL A CG2 1 
ATOM 2811  N N   . PHE A 1 347 ? 47.633  86.386  72.804  1.00 10.00 ? 414 PHE A N   1 
ATOM 2812  C CA  . PHE A 1 347 ? 48.598  87.293  73.432  1.00 10.00 ? 414 PHE A CA  1 
ATOM 2813  C C   . PHE A 1 347 ? 47.830  88.406  74.175  1.00 10.00 ? 414 PHE A C   1 
ATOM 2814  O O   . PHE A 1 347 ? 48.261  88.879  75.220  1.00 10.00 ? 414 PHE A O   1 
ATOM 2815  C CB  . PHE A 1 347 ? 49.568  87.851  72.387  1.00 10.00 ? 414 PHE A CB  1 
ATOM 2816  C CG  . PHE A 1 347 ? 50.977  87.350  72.544  1.00 10.00 ? 414 PHE A CG  1 
ATOM 2817  C CD1 . PHE A 1 347 ? 51.556  87.253  73.797  1.00 10.00 ? 414 PHE A CD1 1 
ATOM 2818  C CD2 . PHE A 1 347 ? 51.752  87.059  71.436  1.00 10.00 ? 414 PHE A CD2 1 
ATOM 2819  C CE1 . PHE A 1 347 ? 52.886  86.886  73.933  1.00 10.00 ? 414 PHE A CE1 1 
ATOM 2820  C CE2 . PHE A 1 347 ? 53.082  86.692  71.576  1.00 10.00 ? 414 PHE A CE2 1 
ATOM 2821  C CZ  . PHE A 1 347 ? 53.641  86.610  72.820  1.00 10.00 ? 414 PHE A CZ  1 
ATOM 2822  N N   . MET A 1 348 ? 46.681  88.793  73.616  1.00 10.00 ? 415 MET A N   1 
ATOM 2823  C CA  . MET A 1 348 ? 45.776  89.789  74.228  1.00 10.00 ? 415 MET A CA  1 
ATOM 2824  C C   . MET A 1 348 ? 45.126  89.028  75.391  1.00 10.00 ? 415 MET A C   1 
ATOM 2825  O O   . MET A 1 348 ? 44.818  89.599  76.435  1.00 10.00 ? 415 MET A O   1 
ATOM 2826  C CB  . MET A 1 348 ? 44.671  90.247  73.245  1.00 10.00 ? 415 MET A CB  1 
ATOM 2827  C CG  . MET A 1 348 ? 44.618  91.750  72.997  1.00 10.00 ? 415 MET A CG  1 
ATOM 2828  S SD  . MET A 1 348 ? 46.050  92.408  72.034  1.00 10.00 ? 415 MET A SD  1 
ATOM 2829  C CE  . MET A 1 348 ? 47.436  92.341  73.167  1.00 10.00 ? 415 MET A CE  1 
ATOM 2830  N N   . LEU A 1 349 ? 44.908  87.730  75.146  1.00 10.00 ? 416 LEU A N   1 
ATOM 2831  C CA  . LEU A 1 349 ? 44.368  86.820  76.159  1.00 10.00 ? 416 LEU A CA  1 
ATOM 2832  C C   . LEU A 1 349 ? 45.300  86.728  77.365  1.00 10.00 ? 416 LEU A C   1 
ATOM 2833  O O   . LEU A 1 349 ? 44.930  86.807  78.502  1.00 10.00 ? 416 LEU A O   1 
ATOM 2834  C CB  . LEU A 1 349 ? 44.147  85.432  75.549  1.00 10.00 ? 416 LEU A CB  1 
ATOM 2835  C CG  . LEU A 1 349 ? 43.377  84.426  76.406  1.00 10.00 ? 416 LEU A CG  1 
ATOM 2836  C CD1 . LEU A 1 349 ? 41.911  84.818  76.503  1.00 10.00 ? 416 LEU A CD1 1 
ATOM 2837  C CD2 . LEU A 1 349 ? 43.518  83.021  75.841  1.00 10.00 ? 416 LEU A CD2 1 
ATOM 2838  N N   . ILE A 1 350 ? 46.570  86.601  76.978  1.00 10.00 ? 417 ILE A N   1 
ATOM 2839  C CA  . ILE A 1 350 ? 47.636  86.485  77.965  1.00 10.00 ? 417 ILE A CA  1 
ATOM 2840  C C   . ILE A 1 350 ? 47.846  87.846  78.578  1.00 10.00 ? 417 ILE A C   1 
ATOM 2841  O O   . ILE A 1 350 ? 48.158  87.964  79.757  1.00 10.00 ? 417 ILE A O   1 
ATOM 2842  C CB  . ILE A 1 350 ? 48.974  86.027  77.332  1.00 10.00 ? 417 ILE A CB  1 
ATOM 2843  C CG1 . ILE A 1 350 ? 48.721  84.894  76.330  1.00 10.00 ? 417 ILE A CG1 1 
ATOM 2844  C CG2 . ILE A 1 350 ? 49.969  85.613  78.460  1.00 10.00 ? 417 ILE A CG2 1 
ATOM 2845  C CD1 . ILE A 1 350 ? 49.807  84.739  75.279  1.00 10.00 ? 417 ILE A CD1 1 
ATOM 2846  N N   . CYS A 1 351 ? 47.696  88.889  77.768  1.00 10.00 ? 418 CYS A N   1 
ATOM 2847  C CA  . CYS A 1 351 ? 47.859  90.225  78.302  1.00 10.00 ? 418 CYS A CA  1 
ATOM 2848  C C   . CYS A 1 351 ? 46.584  90.556  79.067  1.00 10.00 ? 418 CYS A C   1 
ATOM 2849  O O   . CYS A 1 351 ? 46.588  91.453  79.902  1.00 10.00 ? 418 CYS A O   1 
ATOM 2850  C CB  . CYS A 1 351 ? 48.224  91.241  77.194  1.00 10.00 ? 418 CYS A CB  1 
ATOM 2851  S SG  . CYS A 1 351 ? 50.078  91.285  76.894  1.00 10.00 ? 418 CYS A SG  1 
ATOM 2852  N N   . ILE A 1 352 ? 45.524  89.779  78.829  1.00 10.00 ? 419 ILE A N   1 
ATOM 2853  C CA  . ILE A 1 352 ? 44.278  89.947  79.553  1.00 10.00 ? 419 ILE A CA  1 
ATOM 2854  C C   . ILE A 1 352 ? 44.459  89.051  80.794  1.00 10.00 ? 419 ILE A C   1 
ATOM 2855  O O   . ILE A 1 352 ? 44.699  89.560  81.888  1.00 10.00 ? 419 ILE A O   1 
ATOM 2856  C CB  . ILE A 1 352 ? 43.039  89.588  78.640  1.00 10.00 ? 419 ILE A CB  1 
ATOM 2857  C CG1 . ILE A 1 352 ? 41.798  90.378  79.081  1.00 10.00 ? 419 ILE A CG1 1 
ATOM 2858  C CG2 . ILE A 1 352 ? 42.729  88.119  78.648  1.00 10.00 ? 419 ILE A CG2 1 
ATOM 2859  C CD1 . ILE A 1 352 ? 41.113  89.886  80.347  1.00 10.00 ? 419 ILE A CD1 1 
ATOM 2860  N N   . ILE A 1 353 ? 44.395  87.712  80.614  1.00 10.00 ? 420 ILE A N   1 
ATOM 2861  C CA  . ILE A 1 353 ? 44.634  86.821  81.746  1.00 10.00 ? 420 ILE A CA  1 
ATOM 2862  C C   . ILE A 1 353 ? 45.798  87.308  82.604  1.00 10.00 ? 420 ILE A C   1 
ATOM 2863  O O   . ILE A 1 353 ? 45.679  87.552  83.787  1.00 10.00 ? 420 ILE A O   1 
ATOM 2864  C CB  . ILE A 1 353 ? 44.926  85.384  81.280  1.00 10.00 ? 420 ILE A CB  1 
ATOM 2865  C CG1 . ILE A 1 353 ? 46.302  85.308  80.614  1.00 10.00 ? 420 ILE A CG1 1 
ATOM 2866  C CG2 . ILE A 1 353 ? 43.840  84.899  80.334  1.00 10.00 ? 420 ILE A CG2 1 
ATOM 2867  C CD1 . ILE A 1 353 ? 46.770  83.897  80.336  1.00 10.00 ? 420 ILE A CD1 1 
ATOM 2868  N N   . GLY A 1 354 ? 46.918  87.572  81.908  1.00 10.00 ? 421 GLY A N   1 
ATOM 2869  C CA  . GLY A 1 354 ? 48.093  88.083  82.585  1.00 10.00 ? 421 GLY A CA  1 
ATOM 2870  C C   . GLY A 1 354 ? 47.796  89.346  83.361  1.00 10.00 ? 421 GLY A C   1 
ATOM 2871  O O   . GLY A 1 354 ? 48.067  89.415  84.555  1.00 10.00 ? 421 GLY A O   1 
ATOM 2872  N N   . THR A 1 355 ? 47.238  90.348  82.688  1.00 10.00 ? 422 THR A N   1 
ATOM 2873  C CA  . THR A 1 355 ? 46.913  91.588  83.344  1.00 10.00 ? 422 THR A CA  1 
ATOM 2874  C C   . THR A 1 355 ? 45.737  91.359  84.314  1.00 10.00 ? 422 THR A C   1 
ATOM 2875  O O   . THR A 1 355 ? 45.482  92.165  85.211  1.00 10.00 ? 422 THR A O   1 
ATOM 2876  C CB  . THR A 1 355 ? 46.616  92.647  82.275  1.00 10.00 ? 422 THR A CB  1 
ATOM 2877  O OG1 . THR A 1 355 ? 47.820  92.936  81.541  1.00 10.00 ? 422 THR A OG1 1 
ATOM 2878  C CG2 . THR A 1 355 ? 46.086  93.888  82.898  1.00 10.00 ? 422 THR A CG2 1 
ATOM 2879  N N   . VAL A 1 356 ? 45.034  90.240  84.147  1.00 10.00 ? 423 VAL A N   1 
ATOM 2880  C CA  . VAL A 1 356 ? 43.932  89.913  85.038  1.00 10.00 ? 423 VAL A CA  1 
ATOM 2881  C C   . VAL A 1 356 ? 44.499  89.208  86.258  1.00 10.00 ? 423 VAL A C   1 
ATOM 2882  O O   . VAL A 1 356 ? 43.937  89.278  87.356  1.00 10.00 ? 423 VAL A O   1 
ATOM 2883  C CB  . VAL A 1 356 ? 42.891  88.991  84.380  1.00 10.00 ? 423 VAL A CB  1 
ATOM 2884  C CG1 . VAL A 1 356 ? 41.691  88.822  85.323  1.00 10.00 ? 423 VAL A CG1 1 
ATOM 2885  C CG2 . VAL A 1 356 ? 42.437  89.568  83.065  1.00 10.00 ? 423 VAL A CG2 1 
ATOM 2886  N N   . SER A 1 357 ? 45.582  88.489  86.006  1.00 10.00 ? 424 SER A N   1 
ATOM 2887  C CA  . SER A 1 357 ? 46.316  87.838  87.084  1.00 10.00 ? 424 SER A CA  1 
ATOM 2888  C C   . SER A 1 357 ? 47.073  88.858  87.927  1.00 10.00 ? 424 SER A C   1 
ATOM 2889  O O   . SER A 1 357 ? 47.251  88.765  89.097  1.00 10.00 ? 424 SER A O   1 
ATOM 2890  C CB  . SER A 1 357 ? 47.277  86.789  86.521  1.00 10.00 ? 424 SER A CB  1 
ATOM 2891  O OG  . SER A 1 357 ? 46.630  85.965  85.567  1.00 10.00 ? 424 SER A OG  1 
ATOM 2892  N N   . VAL A 1 358 ? 47.411  89.926  87.165  1.00 10.00 ? 425 VAL A N   1 
ATOM 2893  C CA  . VAL A 1 358 ? 48.106  91.029  87.765  1.00 10.00 ? 425 VAL A CA  1 
ATOM 2894  C C   . VAL A 1 358 ? 47.009  91.807  88.503  1.00 10.00 ? 425 VAL A C   1 
ATOM 2895  O O   . VAL A 1 358 ? 47.266  92.432  89.530  1.00 10.00 ? 425 VAL A O   1 
ATOM 2896  C CB  . VAL A 1 358 ? 48.847  91.868  86.640  1.00 10.00 ? 425 VAL A CB  1 
ATOM 2897  C CG1 . VAL A 1 358 ? 47.941  92.968  86.099  1.00 10.00 ? 425 VAL A CG1 1 
ATOM 2898  C CG2 . VAL A 1 358 ? 50.201  92.412  87.165  1.00 10.00 ? 425 VAL A CG2 1 
ATOM 2899  N N   . PHE A 1 359 ? 45.792  91.776  87.956  1.00 10.00 ? 426 PHE A N   1 
ATOM 2900  C CA  . PHE A 1 359 ? 44.624  92.438  88.551  1.00 10.00 ? 426 PHE A CA  1 
ATOM 2901  C C   . PHE A 1 359 ? 44.572  92.194  90.054  1.00 10.00 ? 426 PHE A C   1 
ATOM 2902  O O   . PHE A 1 359 ? 45.036  93.020  90.849  1.00 10.00 ? 426 PHE A O   1 
ATOM 2903  C CB  . PHE A 1 359 ? 43.325  91.917  87.888  1.00 10.00 ? 426 PHE A CB  1 
ATOM 2904  C CG  . PHE A 1 359 ? 42.046  92.366  88.550  1.00 10.00 ? 426 PHE A CG  1 
ATOM 2905  C CD1 . PHE A 1 359 ? 41.097  93.065  87.826  1.00 10.00 ? 426 PHE A CD1 1 
ATOM 2906  C CD2 . PHE A 1 359 ? 41.760  92.043  89.862  1.00 10.00 ? 426 PHE A CD2 1 
ATOM 2907  C CE1 . PHE A 1 359 ? 39.861  93.438  88.407  1.00 10.00 ? 426 PHE A CE1 1 
ATOM 2908  C CE2 . PHE A 1 359 ? 40.561  92.403  90.442  1.00 10.00 ? 426 PHE A CE2 1 
ATOM 2909  C CZ  . PHE A 1 359 ? 39.593  93.109  89.710  1.00 10.00 ? 426 PHE A CZ  1 
ATOM 2910  N N   . ALA A 1 360 ? 44.014  91.051  90.442  1.00 10.00 ? 427 ALA A N   1 
ATOM 2911  C CA  . ALA A 1 360 ? 43.881  90.750  91.873  1.00 10.00 ? 427 ALA A CA  1 
ATOM 2912  C C   . ALA A 1 360 ? 45.236  90.779  92.549  1.00 10.00 ? 427 ALA A C   1 
ATOM 2913  O O   . ALA A 1 360 ? 45.313  91.011  93.748  1.00 10.00 ? 427 ALA A O   1 
ATOM 2914  C CB  . ALA A 1 360 ? 43.197  89.396  92.113  1.00 10.00 ? 427 ALA A CB  1 
ATOM 2915  N N   . GLY A 1 361 ? 46.298  90.559  91.777  1.00 10.00 ? 428 GLY A N   1 
ATOM 2916  C CA  . GLY A 1 361 ? 47.617  90.632  92.361  1.00 10.00 ? 428 GLY A CA  1 
ATOM 2917  C C   . GLY A 1 361 ? 47.772  92.066  92.836  1.00 10.00 ? 428 GLY A C   1 
ATOM 2918  O O   . GLY A 1 361 ? 47.924  92.326  94.025  1.00 10.00 ? 428 GLY A O   1 
ATOM 2919  N N   . ARG A 1 362 ? 47.690  92.994  91.886  1.00 10.00 ? 429 ARG A N   1 
ATOM 2920  C CA  . ARG A 1 362 ? 47.779  94.422  92.115  1.00 10.00 ? 429 ARG A CA  1 
ATOM 2921  C C   . ARG A 1 362 ? 46.734  94.937  93.116  1.00 10.00 ? 429 ARG A C   1 
ATOM 2922  O O   . ARG A 1 362 ? 47.049  95.692  94.050  1.00 10.00 ? 429 ARG A O   1 
ATOM 2923  C CB  . ARG A 1 362 ? 47.607  95.132  90.775  1.00 10.00 ? 429 ARG A CB  1 
ATOM 2924  C CG  . ARG A 1 362 ? 48.715  94.846  89.772  1.00 10.00 ? 429 ARG A CG  1 
ATOM 2925  C CD  . ARG A 1 362 ? 50.111  95.176  90.318  1.00 10.00 ? 429 ARG A CD  1 
ATOM 2926  N NE  . ARG A 1 362 ? 50.089  96.260  91.301  1.00 10.00 ? 429 ARG A NE  1 
ATOM 2927  C CZ  . ARG A 1 362 ? 51.133  97.014  91.643  1.00 10.00 ? 429 ARG A CZ  1 
ATOM 2928  N NH1 . ARG A 1 362 ? 52.321  96.832  91.079  1.00 10.00 ? 429 ARG A NH1 1 
ATOM 2929  N NH2 . ARG A 1 362 ? 50.985  97.944  92.573  1.00 10.00 ? 429 ARG A NH2 1 
ATOM 2930  N N   . LEU A 1 363 ? 45.490  94.531  92.907  1.00 10.00 ? 430 LEU A N   1 
ATOM 2931  C CA  . LEU A 1 363 ? 44.391  94.965  93.763  1.00 10.00 ? 430 LEU A CA  1 
ATOM 2932  C C   . LEU A 1 363 ? 44.643  94.760  95.235  1.00 10.00 ? 430 LEU A C   1 
ATOM 2933  O O   . LEU A 1 363 ? 44.739  95.728  95.977  1.00 10.00 ? 430 LEU A O   1 
ATOM 2934  C CB  . LEU A 1 363 ? 43.064  94.263  93.418  1.00 10.00 ? 430 LEU A CB  1 
ATOM 2935  C CG  . LEU A 1 363 ? 41.696  94.911  93.788  1.00 10.00 ? 430 LEU A CG  1 
ATOM 2936  C CD1 . LEU A 1 363 ? 40.644  93.821  93.868  1.00 10.00 ? 430 LEU A CD1 1 
ATOM 2937  C CD2 . LEU A 1 363 ? 41.712  95.629  95.122  1.00 10.00 ? 430 LEU A CD2 1 
ATOM 2938  N N   . ILE A 1 364 ? 44.697  93.523  95.704  1.00 10.00 ? 431 ILE A N   1 
ATOM 2939  C CA  . ILE A 1 364 ? 44.899  93.423  97.141  1.00 10.00 ? 431 ILE A CA  1 
ATOM 2940  C C   . ILE A 1 364 ? 46.326  93.807  97.519  1.00 10.00 ? 431 ILE A C   1 
ATOM 2941  O O   . ILE A 1 364 ? 46.734  93.727  98.678  1.00 10.00 ? 431 ILE A O   1 
ATOM 2942  C CB  . ILE A 1 364 ? 44.474  92.049  97.725  1.00 10.00 ? 431 ILE A CB  1 
ATOM 2943  C CG1 . ILE A 1 364 ? 42.945  91.893  97.665  1.00 10.00 ? 431 ILE A CG1 1 
ATOM 2944  C CG2 . ILE A 1 364 ? 44.837  91.986  99.198  1.00 10.00 ? 431 ILE A CG2 1 
ATOM 2945  C CD1 . ILE A 1 364 ? 42.342  92.028  96.291  1.00 10.00 ? 431 ILE A CD1 1 
ATOM 2946  N N   . GLU A 1 365 ? 47.112  94.222  96.532  1.00 10.00 ? 432 GLU A N   1 
ATOM 2947  C CA  . GLU A 1 365 ? 48.431  94.703  96.863  1.00 10.00 ? 432 GLU A CA  1 
ATOM 2948  C C   . GLU A 1 365 ? 48.183  96.205  97.064  1.00 10.00 ? 432 GLU A C   1 
ATOM 2949  O O   . GLU A 1 365 ? 49.005  96.930  97.619  1.00 10.00 ? 432 GLU A O   1 
ATOM 2950  C CB  . GLU A 1 365 ? 49.424  94.361  95.757  1.00 10.00 ? 432 GLU A CB  1 
ATOM 2951  C CG  . GLU A 1 365 ? 50.846  94.714  96.190  1.00 10.00 ? 432 GLU A CG  1 
ATOM 2952  C CD  . GLU A 1 365 ? 51.346  93.891  97.345  1.00 10.00 ? 432 GLU A CD  1 
ATOM 2953  O OE1 . GLU A 1 365 ? 50.678  92.897  97.688  1.00 10.00 ? 432 GLU A OE1 1 
ATOM 2954  O OE2 . GLU A 1 365 ? 52.402  94.239  97.914  1.00 10.00 ? 432 GLU A OE2 1 
ATOM 2955  N N   . LEU A 1 366 ? 46.985  96.637  96.664  1.00 10.00 ? 433 LEU A N   1 
ATOM 2956  C CA  . LEU A 1 366 ? 46.565  98.027  96.863  1.00 10.00 ? 433 LEU A CA  1 
ATOM 2957  C C   . LEU A 1 366 ? 45.971  98.101  98.269  1.00 10.00 ? 433 LEU A C   1 
ATOM 2958  O O   . LEU A 1 366 ? 45.793  99.179  98.822  1.00 10.00 ? 433 LEU A O   1 
ATOM 2959  C CB  . LEU A 1 366 ? 45.490  98.444  95.857  1.00 10.00 ? 433 LEU A CB  1 
ATOM 2960  C CG  . LEU A 1 366 ? 44.743  99.744  96.181  1.00 10.00 ? 433 LEU A CG  1 
ATOM 2961  C CD1 . LEU A 1 366 ? 45.747  100.845 96.559  1.00 10.00 ? 433 LEU A CD1 1 
ATOM 2962  C CD2 . LEU A 1 366 ? 43.898  100.146 94.965  1.00 10.00 ? 433 LEU A CD2 1 
ATOM 2963  N N   . SER A 1 367 ? 45.697  96.930  98.838  1.00 10.00 ? 434 SER A N   1 
ATOM 2964  C CA  . SER A 1 367 ? 45.128  96.821  100.176 1.00 10.00 ? 434 SER A CA  1 
ATOM 2965  C C   . SER A 1 367 ? 46.228  96.470  101.180 1.00 10.00 ? 434 SER A C   1 
ATOM 2966  O O   . SER A 1 367 ? 46.330  97.069  102.251 1.00 10.00 ? 434 SER A O   1 
ATOM 2967  C CB  . SER A 1 367 ? 44.038  95.742  100.185 1.00 10.00 ? 434 SER A CB  1 
ATOM 2968  O OG  . SER A 1 367 ? 42.822  96.257  100.704 1.00 10.00 ? 434 SER A OG  1 
ATOM 2969  N N   . GLN A 1 368 ? 47.060  95.500  100.821 1.00 10.00 ? 435 GLN A N   1 
ATOM 2970  C CA  . GLN A 1 368 ? 48.140  95.073  101.677 1.00 10.00 ? 435 GLN A CA  1 
ATOM 2971  C C   . GLN A 1 368 ? 49.178  96.143  101.877 1.00 10.00 ? 435 GLN A C   1 
ATOM 2972  O O   . GLN A 1 368 ? 49.520  96.511  103.013 1.00 10.00 ? 435 GLN A O   1 
ATOM 2973  C CB  . GLN A 1 368 ? 48.805  93.838  101.081 1.00 10.00 ? 435 GLN A CB  1 
ATOM 2974  C CG  . GLN A 1 368 ? 49.736  93.119  102.026 1.00 10.00 ? 435 GLN A CG  1 
ATOM 2975  C CD  . GLN A 1 368 ? 50.813  92.434  101.261 1.00 10.00 ? 435 GLN A CD  1 
ATOM 2976  O OE1 . GLN A 1 368 ? 51.803  92.004  101.851 1.00 10.00 ? 435 GLN A OE1 1 
ATOM 2977  N NE2 . GLN A 1 368 ? 50.653  92.342  99.946  1.00 10.00 ? 435 GLN A NE2 1 
ATOM 2978  N N   . GLU A 1 369 ? 49.688  96.651  100.765 1.00 10.00 ? 436 GLU A N   1 
ATOM 2979  C CA  . GLU A 1 369 ? 50.743  97.669  100.836 1.00 10.00 ? 436 GLU A CA  1 
ATOM 2980  C C   . GLU A 1 369 ? 50.311  98.845  101.730 1.00 10.00 ? 436 GLU A C   1 
ATOM 2981  O O   . GLU A 1 369 ? 51.154  99.585  102.209 1.00 10.00 ? 436 GLU A O   1 
ATOM 2982  C CB  . GLU A 1 369 ? 51.138  98.159  99.411  1.00 10.00 ? 436 GLU A CB  1 
ATOM 2983  C CG  . GLU A 1 369 ? 51.509  97.050  98.412  1.00 10.00 ? 436 GLU A CG  1 
ATOM 2984  C CD  . GLU A 1 369 ? 52.043  97.568  97.096  1.00 10.00 ? 436 GLU A CD  1 
ATOM 2985  O OE1 . GLU A 1 369 ? 53.142  98.160  97.101  1.00 10.00 ? 436 GLU A OE1 1 
ATOM 2986  O OE2 . GLU A 1 369 ? 51.366  97.382  96.062  1.00 10.00 ? 436 GLU A OE2 1 
ATOM 2987  N N   . GLY A 1 370 ? 48.999  98.980  101.951 1.00 10.00 ? 437 GLY A N   1 
ATOM 2988  C CA  . GLY A 1 370 ? 48.497  100.064 102.785 1.00 10.00 ? 437 GLY A CA  1 
ATOM 2989  C C   . GLY A 1 370 ? 48.512  99.786  104.290 1.00 10.00 ? 437 GLY A C   1 
ATOM 2990  O O   . GLY A 1 370 ? 47.401  99.646  104.891 1.00 10.00 ? 437 GLY A O   1 
ATOM 2991  O OXT . GLY A 1 370 ? 49.624  99.700  104.872 1.00 10.00 ? 437 GLY A OXT 1 
ATOM 2992  N N   . SER B 2 1   ? 91.519  64.256  166.947 1.00 10.00 ? 1   SER B N   1 
ATOM 2993  C CA  . SER B 2 1   ? 90.683  64.524  168.169 1.00 10.00 ? 1   SER B CA  1 
ATOM 2994  C C   . SER B 2 1   ? 90.521  65.992  168.452 1.00 10.00 ? 1   SER B C   1 
ATOM 2995  O O   . SER B 2 1   ? 89.423  66.459  168.735 1.00 10.00 ? 1   SER B O   1 
ATOM 2996  C CB  . SER B 2 1   ? 91.308  63.926  169.436 1.00 10.00 ? 1   SER B CB  1 
ATOM 2997  O OG  . SER B 2 1   ? 90.942  64.688  170.587 1.00 10.00 ? 1   SER B OG  1 
ATOM 2998  N N   . VAL B 2 2   ? 91.642  66.702  168.390 1.00 10.00 ? 2   VAL B N   1 
ATOM 2999  C CA  . VAL B 2 2   ? 91.669  68.136  168.691 1.00 10.00 ? 2   VAL B CA  1 
ATOM 3000  C C   . VAL B 2 2   ? 90.403  68.842  168.222 1.00 10.00 ? 2   VAL B C   1 
ATOM 3001  O O   . VAL B 2 2   ? 90.318  69.393  167.120 1.00 10.00 ? 2   VAL B O   1 
ATOM 3002  C CB  . VAL B 2 2   ? 92.905  68.827  168.096 1.00 10.00 ? 2   VAL B CB  1 
ATOM 3003  C CG1 . VAL B 2 2   ? 92.867  70.309  168.451 1.00 10.00 ? 2   VAL B CG1 1 
ATOM 3004  C CG2 . VAL B 2 2   ? 94.188  68.177  168.629 1.00 10.00 ? 2   VAL B CG2 1 
ATOM 3005  N N   . MET B 2 3   ? 89.409  68.757  169.100 1.00 10.00 ? 3   MET B N   1 
ATOM 3006  C CA  . MET B 2 3   ? 88.088  69.328  168.909 1.00 10.00 ? 3   MET B CA  1 
ATOM 3007  C C   . MET B 2 3   ? 87.504  68.968  167.543 1.00 10.00 ? 3   MET B C   1 
ATOM 3008  O O   . MET B 2 3   ? 86.626  69.654  167.016 1.00 10.00 ? 3   MET B O   1 
ATOM 3009  C CB  . MET B 2 3   ? 88.157  70.842  169.163 1.00 10.00 ? 3   MET B CB  1 
ATOM 3010  C CG  . MET B 2 3   ? 88.428  71.147  170.654 1.00 10.00 ? 3   MET B CG  1 
ATOM 3011  S SD  . MET B 2 3   ? 89.098  72.780  171.102 1.00 10.00 ? 3   MET B SD  1 
ATOM 3012  C CE  . MET B 2 3   ? 90.823  72.682  170.502 1.00 10.00 ? 3   MET B CE  1 
ATOM 3013  N N   . GLU B 2 4   ? 87.987  67.858  166.988 1.00 10.00 ? 4   GLU B N   1 
ATOM 3014  C CA  . GLU B 2 4   ? 87.508  67.378  165.699 1.00 10.00 ? 4   GLU B CA  1 
ATOM 3015  C C   . GLU B 2 4   ? 86.001  67.239  165.700 1.00 10.00 ? 4   GLU B C   1 
ATOM 3016  O O   . GLU B 2 4   ? 85.336  67.995  165.003 1.00 10.00 ? 4   GLU B O   1 
ATOM 3017  C CB  . GLU B 2 4   ? 88.172  66.046  165.305 1.00 10.00 ? 4   GLU B CB  1 
ATOM 3018  C CG  . GLU B 2 4   ? 89.040  66.134  164.056 1.00 10.00 ? 4   GLU B CG  1 
ATOM 3019  C CD  . GLU B 2 4   ? 88.405  67.008  162.980 1.00 10.00 ? 4   GLU B CD  1 
ATOM 3020  O OE1 . GLU B 2 4   ? 87.244  66.730  162.592 1.00 10.00 ? 4   GLU B OE1 1 
ATOM 3021  O OE2 . GLU B 2 4   ? 89.066  67.965  162.524 1.00 10.00 ? 4   GLU B OE2 1 
ATOM 3022  N N   . ASP B 2 5   ? 85.452  66.287  166.460 1.00 10.00 ? 5   ASP B N   1 
ATOM 3023  C CA  . ASP B 2 5   ? 83.990  66.136  166.510 1.00 10.00 ? 5   ASP B CA  1 
ATOM 3024  C C   . ASP B 2 5   ? 83.390  67.533  166.679 1.00 10.00 ? 5   ASP B C   1 
ATOM 3025  O O   . ASP B 2 5   ? 82.401  67.888  166.032 1.00 10.00 ? 5   ASP B O   1 
ATOM 3026  C CB  . ASP B 2 5   ? 83.530  65.255  167.695 1.00 10.00 ? 5   ASP B CB  1 
ATOM 3027  C CG  . ASP B 2 5   ? 84.036  63.840  167.607 1.00 10.00 ? 5   ASP B CG  1 
ATOM 3028  O OD1 . ASP B 2 5   ? 83.976  63.255  166.509 1.00 10.00 ? 5   ASP B OD1 1 
ATOM 3029  O OD2 . ASP B 2 5   ? 84.489  63.323  168.644 1.00 10.00 ? 5   ASP B OD2 1 
ATOM 3030  N N   . THR B 2 6   ? 84.025  68.318  167.545 1.00 10.00 ? 6   THR B N   1 
ATOM 3031  C CA  . THR B 2 6   ? 83.600  69.682  167.849 1.00 10.00 ? 6   THR B CA  1 
ATOM 3032  C C   . THR B 2 6   ? 83.547  70.529  166.592 1.00 10.00 ? 6   THR B C   1 
ATOM 3033  O O   . THR B 2 6   ? 82.481  70.976  166.180 1.00 10.00 ? 6   THR B O   1 
ATOM 3034  C CB  . THR B 2 6   ? 84.577  70.336  168.818 1.00 10.00 ? 6   THR B CB  1 
ATOM 3035  O OG1 . THR B 2 6   ? 84.885  69.400  169.862 1.00 10.00 ? 6   THR B OG1 1 
ATOM 3036  C CG2 . THR B 2 6   ? 83.983  71.599  169.415 1.00 10.00 ? 6   THR B CG2 1 
ATOM 3037  N N   . LEU B 2 7   ? 84.715  70.771  166.007 1.00 10.00 ? 7   LEU B N   1 
ATOM 3038  C CA  . LEU B 2 7   ? 84.807  71.555  164.757 1.00 10.00 ? 7   LEU B CA  1 
ATOM 3039  C C   . LEU B 2 7   ? 83.754  71.013  163.830 1.00 10.00 ? 7   LEU B C   1 
ATOM 3040  O O   . LEU B 2 7   ? 82.731  71.646  163.540 1.00 10.00 ? 7   LEU B O   1 
ATOM 3041  C CB  . LEU B 2 7   ? 86.153  71.355  164.043 1.00 10.00 ? 7   LEU B CB  1 
ATOM 3042  C CG  . LEU B 2 7   ? 87.460  71.605  164.777 1.00 10.00 ? 7   LEU B CG  1 
ATOM 3043  C CD1 . LEU B 2 7   ? 88.582  71.543  163.798 1.00 10.00 ? 7   LEU B CD1 1 
ATOM 3044  C CD2 . LEU B 2 7   ? 87.438  72.941  165.426 1.00 10.00 ? 7   LEU B CD2 1 
ATOM 3045  N N   . LEU B 2 8   ? 84.050  69.807  163.371 1.00 10.00 ? 8   LEU B N   1 
ATOM 3046  C CA  . LEU B 2 8   ? 83.196  69.083  162.471 1.00 10.00 ? 8   LEU B CA  1 
ATOM 3047  C C   . LEU B 2 8   ? 81.746  69.434  162.726 1.00 10.00 ? 8   LEU B C   1 
ATOM 3048  O O   . LEU B 2 8   ? 81.014  69.832  161.814 1.00 10.00 ? 8   LEU B O   1 
ATOM 3049  C CB  . LEU B 2 8   ? 83.363  67.573  162.662 1.00 10.00 ? 8   LEU B CB  1 
ATOM 3050  C CG  . LEU B 2 8   ? 84.605  66.875  162.116 1.00 10.00 ? 8   LEU B CG  1 
ATOM 3051  C CD1 . LEU B 2 8   ? 84.508  65.380  162.375 1.00 10.00 ? 8   LEU B CD1 1 
ATOM 3052  C CD2 . LEU B 2 8   ? 84.745  67.155  160.633 1.00 10.00 ? 8   LEU B CD2 1 
ATOM 3053  N N   . SER B 2 9   ? 81.347  69.258  163.972 1.00 10.00 ? 9   SER B N   1 
ATOM 3054  C CA  . SER B 2 9   ? 79.989  69.520  164.393 1.00 10.00 ? 9   SER B CA  1 
ATOM 3055  C C   . SER B 2 9   ? 79.572  70.968  164.204 1.00 10.00 ? 9   SER B C   1 
ATOM 3056  O O   . SER B 2 9   ? 78.754  71.293  163.337 1.00 10.00 ? 9   SER B O   1 
ATOM 3057  C CB  . SER B 2 9   ? 79.787  69.086  165.851 1.00 10.00 ? 9   SER B CB  1 
ATOM 3058  O OG  . SER B 2 9   ? 80.632  69.790  166.742 1.00 10.00 ? 9   SER B OG  1 
ATOM 3059  N N   . VAL B 2 10  ? 80.135  71.829  165.034 1.00 10.00 ? 10  VAL B N   1 
ATOM 3060  C CA  . VAL B 2 10  ? 79.861  73.267  164.993 1.00 10.00 ? 10  VAL B CA  1 
ATOM 3061  C C   . VAL B 2 10  ? 79.669  73.715  163.535 1.00 10.00 ? 10  VAL B C   1 
ATOM 3062  O O   . VAL B 2 10  ? 78.643  74.301  163.202 1.00 10.00 ? 10  VAL B O   1 
ATOM 3063  C CB  . VAL B 2 10  ? 81.011  74.006  165.719 1.00 10.00 ? 10  VAL B CB  1 
ATOM 3064  C CG1 . VAL B 2 10  ? 82.183  74.162  164.817 1.00 10.00 ? 10  VAL B CG1 1 
ATOM 3065  C CG2 . VAL B 2 10  ? 80.518  75.293  166.286 1.00 10.00 ? 10  VAL B CG2 1 
ATOM 3066  N N   . LEU B 2 11  ? 80.625  73.379  162.672 1.00 10.00 ? 11  LEU B N   1 
ATOM 3067  C CA  . LEU B 2 11  ? 80.563  73.711  161.271 1.00 10.00 ? 11  LEU B CA  1 
ATOM 3068  C C   . LEU B 2 11  ? 79.211  73.377  160.672 1.00 10.00 ? 11  LEU B C   1 
ATOM 3069  O O   . LEU B 2 11  ? 78.504  74.238  160.132 1.00 10.00 ? 11  LEU B O   1 
ATOM 3070  C CB  . LEU B 2 11  ? 81.635  72.949  160.521 1.00 10.00 ? 11  LEU B CB  1 
ATOM 3071  C CG  . LEU B 2 11  ? 82.972  73.642  160.659 1.00 10.00 ? 11  LEU B CG  1 
ATOM 3072  C CD1 . LEU B 2 11  ? 82.970  74.907  159.833 1.00 10.00 ? 11  LEU B CD1 1 
ATOM 3073  C CD2 . LEU B 2 11  ? 83.233  73.918  162.114 1.00 10.00 ? 11  LEU B CD2 1 
ATOM 3074  N N   . PHE B 2 12  ? 78.858  72.104  160.740 1.00 10.00 ? 12  PHE B N   1 
ATOM 3075  C CA  . PHE B 2 12  ? 77.569  71.654  160.196 1.00 10.00 ? 12  PHE B CA  1 
ATOM 3076  C C   . PHE B 2 12  ? 76.412  72.176  161.038 1.00 10.00 ? 12  PHE B C   1 
ATOM 3077  O O   . PHE B 2 12  ? 75.283  72.228  160.571 1.00 10.00 ? 12  PHE B O   1 
ATOM 3078  C CB  . PHE B 2 12  ? 77.535  70.105  160.044 1.00 10.00 ? 12  PHE B CB  1 
ATOM 3079  C CG  . PHE B 2 12  ? 77.125  69.330  161.291 1.00 10.00 ? 12  PHE B CG  1 
ATOM 3080  C CD1 . PHE B 2 12  ? 75.829  68.825  161.418 1.00 10.00 ? 12  PHE B CD1 1 
ATOM 3081  C CD2 . PHE B 2 12  ? 78.037  69.067  162.304 1.00 10.00 ? 12  PHE B CD2 1 
ATOM 3082  C CE1 . PHE B 2 12  ? 75.461  68.064  162.546 1.00 10.00 ? 12  PHE B CE1 1 
ATOM 3083  C CE2 . PHE B 2 12  ? 77.680  68.327  163.416 1.00 10.00 ? 12  PHE B CE2 1 
ATOM 3084  C CZ  . PHE B 2 12  ? 76.394  67.821  163.545 1.00 10.00 ? 12  PHE B CZ  1 
ATOM 3085  N N   . GLU B 2 13  ? 76.736  72.606  162.259 1.00 10.00 ? 13  GLU B N   1 
ATOM 3086  C CA  . GLU B 2 13  ? 75.783  73.167  163.229 1.00 10.00 ? 13  GLU B CA  1 
ATOM 3087  C C   . GLU B 2 13  ? 75.405  74.595  162.768 1.00 10.00 ? 13  GLU B C   1 
ATOM 3088  O O   . GLU B 2 13  ? 74.218  74.953  162.640 1.00 10.00 ? 13  GLU B O   1 
ATOM 3089  C CB  . GLU B 2 13  ? 76.417  73.217  164.654 1.00 10.00 ? 13  GLU B CB  1 
ATOM 3090  C CG  . GLU B 2 13  ? 76.761  71.834  165.360 1.00 10.00 ? 13  GLU B CG  1 
ATOM 3091  C CD  . GLU B 2 13  ? 77.485  71.949  166.740 1.00 10.00 ? 13  GLU B CD  1 
ATOM 3092  O OE1 . GLU B 2 13  ? 77.070  72.777  167.567 1.00 10.00 ? 13  GLU B OE1 1 
ATOM 3093  O OE2 . GLU B 2 13  ? 78.453  71.212  167.018 1.00 10.00 ? 13  GLU B OE2 1 
ATOM 3094  N N   . ASN B 2 14  ? 76.434  75.375  162.449 1.00 10.00 ? 14  ASN B N   1 
ATOM 3095  C CA  . ASN B 2 14  ? 76.294  76.779  162.028 1.00 10.00 ? 14  ASN B CA  1 
ATOM 3096  C C   . ASN B 2 14  ? 76.349  77.106  160.535 1.00 10.00 ? 14  ASN B C   1 
ATOM 3097  O O   . ASN B 2 14  ? 75.798  78.114  160.110 1.00 10.00 ? 14  ASN B O   1 
ATOM 3098  C CB  . ASN B 2 14  ? 77.345  77.651  162.744 1.00 10.00 ? 14  ASN B CB  1 
ATOM 3099  C CG  . ASN B 2 14  ? 76.826  78.244  164.042 1.00 10.00 ? 14  ASN B CG  1 
ATOM 3100  O OD1 . ASN B 2 14  ? 75.884  79.055  164.038 1.00 10.00 ? 14  ASN B OD1 1 
ATOM 3101  N ND2 . ASN B 2 14  ? 77.428  77.836  165.165 1.00 10.00 ? 14  ASN B ND2 1 
ATOM 3102  N N   . TYR B 2 15  ? 77.042  76.284  159.761 1.00 10.00 ? 15  TYR B N   1 
ATOM 3103  C CA  . TYR B 2 15  ? 77.193  76.464  158.318 1.00 10.00 ? 15  TYR B CA  1 
ATOM 3104  C C   . TYR B 2 15  ? 75.874  76.625  157.569 1.00 10.00 ? 15  TYR B C   1 
ATOM 3105  O O   . TYR B 2 15  ? 74.941  75.876  157.819 1.00 10.00 ? 15  TYR B O   1 
ATOM 3106  C CB  . TYR B 2 15  ? 78.008  75.281  157.722 1.00 10.00 ? 15  TYR B CB  1 
ATOM 3107  C CG  . TYR B 2 15  ? 77.268  74.196  156.882 1.00 10.00 ? 15  TYR B CG  1 
ATOM 3108  C CD1 . TYR B 2 15  ? 77.881  73.643  155.753 1.00 10.00 ? 15  TYR B CD1 1 
ATOM 3109  C CD2 . TYR B 2 15  ? 75.986  73.722  157.218 1.00 10.00 ? 15  TYR B CD2 1 
ATOM 3110  C CE1 . TYR B 2 15  ? 77.249  72.672  154.993 1.00 10.00 ? 15  TYR B CE1 1 
ATOM 3111  C CE2 . TYR B 2 15  ? 75.342  72.750  156.453 1.00 10.00 ? 15  TYR B CE2 1 
ATOM 3112  C CZ  . TYR B 2 15  ? 75.984  72.233  155.342 1.00 10.00 ? 15  TYR B CZ  1 
ATOM 3113  O OH  . TYR B 2 15  ? 75.372  71.279  154.555 1.00 10.00 ? 15  TYR B OH  1 
ATOM 3114  N N   . ASN B 2 16  ? 75.800  77.573  156.638 1.00 10.00 ? 16  ASN B N   1 
ATOM 3115  C CA  . ASN B 2 16  ? 74.601  77.753  155.903 1.00 10.00 ? 16  ASN B CA  1 
ATOM 3116  C C   . ASN B 2 16  ? 74.826  77.380  154.406 1.00 10.00 ? 16  ASN B C   1 
ATOM 3117  O O   . ASN B 2 16  ? 75.617  78.015  153.695 1.00 10.00 ? 16  ASN B O   1 
ATOM 3118  C CB  . ASN B 2 16  ? 74.128  79.198  156.112 1.00 10.00 ? 16  ASN B CB  1 
ATOM 3119  C CG  . ASN B 2 16  ? 72.642  79.291  156.425 1.00 10.00 ? 16  ASN B CG  1 
ATOM 3120  O OD1 . ASN B 2 16  ? 71.800  79.181  155.535 1.00 10.00 ? 16  ASN B OD1 1 
ATOM 3121  N ND2 . ASN B 2 16  ? 72.319  79.481  157.699 1.00 10.00 ? 16  ASN B ND2 1 
ATOM 3122  N N   . PRO B 2 17  ? 74.104  76.342  153.920 1.00 10.00 ? 17  PRO B N   1 
ATOM 3123  C CA  . PRO B 2 17  ? 74.107  75.777  152.560 1.00 10.00 ? 17  PRO B CA  1 
ATOM 3124  C C   . PRO B 2 17  ? 73.708  76.777  151.478 1.00 10.00 ? 17  PRO B C   1 
ATOM 3125  O O   . PRO B 2 17  ? 74.418  76.981  150.499 1.00 10.00 ? 17  PRO B O   1 
ATOM 3126  C CB  . PRO B 2 17  ? 73.052  74.671  152.649 1.00 10.00 ? 17  PRO B CB  1 
ATOM 3127  C CG  . PRO B 2 17  ? 72.076  75.185  153.722 1.00 10.00 ? 17  PRO B CG  1 
ATOM 3128  C CD  . PRO B 2 17  ? 73.091  75.634  154.751 1.00 10.00 ? 17  PRO B CD  1 
ATOM 3129  N N   . LYS B 2 18  ? 72.545  77.384  151.692 1.00 10.00 ? 18  LYS B N   1 
ATOM 3130  C CA  . LYS B 2 18  ? 71.920  78.318  150.790 1.00 10.00 ? 18  LYS B CA  1 
ATOM 3131  C C   . LYS B 2 18  ? 72.436  79.758  150.901 1.00 10.00 ? 18  LYS B C   1 
ATOM 3132  O O   . LYS B 2 18  ? 71.794  80.681  150.391 1.00 10.00 ? 18  LYS B O   1 
ATOM 3133  C CB  . LYS B 2 18  ? 70.389  78.252  151.006 1.00 10.00 ? 18  LYS B CB  1 
ATOM 3134  C CG  . LYS B 2 18  ? 69.746  79.289  151.966 1.00 10.00 ? 18  LYS B CG  1 
ATOM 3135  C CD  . LYS B 2 18  ? 70.256  79.264  153.409 1.00 10.00 ? 18  LYS B CD  1 
ATOM 3136  C CE  . LYS B 2 18  ? 69.342  80.110  154.305 1.00 10.00 ? 18  LYS B CE  1 
ATOM 3137  N NZ  . LYS B 2 18  ? 69.897  80.345  155.656 1.00 10.00 ? 18  LYS B NZ  1 
ATOM 3138  N N   . VAL B 2 19  ? 73.602  79.960  151.520 1.00 10.00 ? 19  VAL B N   1 
ATOM 3139  C CA  . VAL B 2 19  ? 74.116  81.309  151.652 1.00 10.00 ? 19  VAL B CA  1 
ATOM 3140  C C   . VAL B 2 19  ? 75.340  81.597  150.793 1.00 10.00 ? 19  VAL B C   1 
ATOM 3141  O O   . VAL B 2 19  ? 76.090  80.700  150.409 1.00 10.00 ? 19  VAL B O   1 
ATOM 3142  C CB  . VAL B 2 19  ? 74.420  81.663  153.131 1.00 10.00 ? 19  VAL B CB  1 
ATOM 3143  C CG1 . VAL B 2 19  ? 75.923  81.949  153.319 1.00 10.00 ? 19  VAL B CG1 1 
ATOM 3144  C CG2 . VAL B 2 19  ? 73.580  82.886  153.558 1.00 10.00 ? 19  VAL B CG2 1 
ATOM 3145  N N   . ARG B 2 20  ? 75.516  82.898  150.518 1.00 10.00 ? 20  ARG B N   1 
ATOM 3146  C CA  . ARG B 2 20  ? 76.534  83.510  149.683 1.00 10.00 ? 20  ARG B CA  1 
ATOM 3147  C C   . ARG B 2 20  ? 77.780  83.827  150.494 1.00 10.00 ? 20  ARG B C   1 
ATOM 3148  O O   . ARG B 2 20  ? 77.712  84.545  151.473 1.00 10.00 ? 20  ARG B O   1 
ATOM 3149  C CB  . ARG B 2 20  ? 75.995  84.777  149.020 1.00 10.00 ? 20  ARG B CB  1 
ATOM 3150  C CG  . ARG B 2 20  ? 75.638  85.886  149.995 1.00 10.00 ? 20  ARG B CG  1 
ATOM 3151  C CD  . ARG B 2 20  ? 74.510  85.460  150.920 1.00 10.00 ? 20  ARG B CD  1 
ATOM 3152  N NE  . ARG B 2 20  ? 74.319  86.401  152.019 1.00 10.00 ? 20  ARG B NE  1 
ATOM 3153  C CZ  . ARG B 2 20  ? 73.737  87.588  151.889 1.00 10.00 ? 20  ARG B CZ  1 
ATOM 3154  N NH1 . ARG B 2 20  ? 73.288  87.980  150.706 1.00 10.00 ? 20  ARG B NH1 1 
ATOM 3155  N NH2 . ARG B 2 20  ? 73.604  88.380  152.944 1.00 10.00 ? 20  ARG B NH2 1 
ATOM 3156  N N   . PRO B 2 21  ? 78.977  83.352  150.046 1.00 10.00 ? 21  PRO B N   1 
ATOM 3157  C CA  . PRO B 2 21  ? 80.260  83.609  150.709 1.00 10.00 ? 21  PRO B CA  1 
ATOM 3158  C C   . PRO B 2 21  ? 80.628  85.104  150.864 1.00 10.00 ? 21  PRO B C   1 
ATOM 3159  O O   . PRO B 2 21  ? 81.807  85.442  150.790 1.00 10.00 ? 21  PRO B O   1 
ATOM 3160  C CB  . PRO B 2 21  ? 81.266  82.881  149.802 1.00 10.00 ? 21  PRO B CB  1 
ATOM 3161  C CG  . PRO B 2 21  ? 80.475  81.781  149.267 1.00 10.00 ? 21  PRO B CG  1 
ATOM 3162  C CD  . PRO B 2 21  ? 79.181  82.465  148.898 1.00 10.00 ? 21  PRO B CD  1 
ATOM 3163  N N   . SER B 2 22  ? 79.652  86.000  151.057 1.00 10.00 ? 22  SER B N   1 
ATOM 3164  C CA  . SER B 2 22  ? 79.975  87.416  151.220 1.00 10.00 ? 22  SER B CA  1 
ATOM 3165  C C   . SER B 2 22  ? 79.241  88.037  152.387 1.00 10.00 ? 22  SER B C   1 
ATOM 3166  O O   . SER B 2 22  ? 78.260  87.485  152.890 1.00 10.00 ? 22  SER B O   1 
ATOM 3167  C CB  . SER B 2 22  ? 79.642  88.187  149.938 1.00 10.00 ? 22  SER B CB  1 
ATOM 3168  O OG  . SER B 2 22  ? 78.257  88.120  149.639 1.00 10.00 ? 22  SER B OG  1 
ATOM 3169  N N   . GLN B 2 23  ? 79.705  89.211  152.786 1.00 10.00 ? 23  GLN B N   1 
ATOM 3170  C CA  . GLN B 2 23  ? 79.105  89.915  153.900 1.00 10.00 ? 23  GLN B CA  1 
ATOM 3171  C C   . GLN B 2 23  ? 78.430  91.193  153.436 1.00 10.00 ? 23  GLN B C   1 
ATOM 3172  O O   . GLN B 2 23  ? 79.082  92.184  153.108 1.00 10.00 ? 23  GLN B O   1 
ATOM 3173  C CB  . GLN B 2 23  ? 80.151  90.216  154.977 1.00 10.00 ? 23  GLN B CB  1 
ATOM 3174  C CG  . GLN B 2 23  ? 81.332  91.037  154.534 1.00 10.00 ? 23  GLN B CG  1 
ATOM 3175  C CD  . GLN B 2 23  ? 82.285  90.315  153.614 1.00 10.00 ? 23  GLN B CD  1 
ATOM 3176  O OE1 . GLN B 2 23  ? 83.381  90.808  153.343 1.00 10.00 ? 23  GLN B OE1 1 
ATOM 3177  N NE2 . GLN B 2 23  ? 81.885  89.147  153.125 1.00 10.00 ? 23  GLN B NE2 1 
ATOM 3178  N N   . THR B 2 24  ? 77.102  91.146  153.427 1.00 10.00 ? 24  THR B N   1 
ATOM 3179  C CA  . THR B 2 24  ? 76.221  92.243  153.020 1.00 10.00 ? 24  THR B CA  1 
ATOM 3180  C C   . THR B 2 24  ? 76.391  92.714  151.564 1.00 10.00 ? 24  THR B C   1 
ATOM 3181  O O   . THR B 2 24  ? 76.931  92.000  150.722 1.00 10.00 ? 24  THR B O   1 
ATOM 3182  C CB  . THR B 2 24  ? 76.402  93.454  153.966 1.00 10.00 ? 24  THR B CB  1 
ATOM 3183  O OG1 . THR B 2 24  ? 76.575  92.985  155.309 1.00 10.00 ? 24  THR B OG1 1 
ATOM 3184  C CG2 . THR B 2 24  ? 75.173  94.354  153.927 1.00 10.00 ? 24  THR B CG2 1 
ATOM 3185  N N   . VAL B 2 25  ? 75.968  93.959  151.316 1.00 10.00 ? 25  VAL B N   1 
ATOM 3186  C CA  . VAL B 2 25  ? 75.982  94.628  149.999 1.00 10.00 ? 25  VAL B CA  1 
ATOM 3187  C C   . VAL B 2 25  ? 77.312  95.334  149.759 1.00 10.00 ? 25  VAL B C   1 
ATOM 3188  O O   . VAL B 2 25  ? 77.489  96.444  150.241 1.00 10.00 ? 25  VAL B O   1 
ATOM 3189  C CB  . VAL B 2 25  ? 74.866  95.737  149.921 1.00 10.00 ? 25  VAL B CB  1 
ATOM 3190  C CG1 . VAL B 2 25  ? 74.414  95.971  148.484 1.00 10.00 ? 25  VAL B CG1 1 
ATOM 3191  C CG2 . VAL B 2 25  ? 73.684  95.347  150.796 1.00 10.00 ? 25  VAL B CG2 1 
ATOM 3192  N N   . GLY B 2 26  ? 78.232  94.718  149.013 1.00 10.00 ? 26  GLY B N   1 
ATOM 3193  C CA  . GLY B 2 26  ? 79.512  95.373  148.774 1.00 10.00 ? 26  GLY B CA  1 
ATOM 3194  C C   . GLY B 2 26  ? 80.245  94.917  147.534 1.00 10.00 ? 26  GLY B C   1 
ATOM 3195  O O   . GLY B 2 26  ? 79.634  94.723  146.480 1.00 10.00 ? 26  GLY B O   1 
ATOM 3196  N N   . ASP B 2 27  ? 81.555  94.745  147.663 1.00 10.00 ? 27  ASP B N   1 
ATOM 3197  C CA  . ASP B 2 27  ? 82.408  94.300  146.561 1.00 10.00 ? 27  ASP B CA  1 
ATOM 3198  C C   . ASP B 2 27  ? 82.022  92.863  146.176 1.00 10.00 ? 27  ASP B C   1 
ATOM 3199  O O   . ASP B 2 27  ? 82.400  92.369  145.111 1.00 10.00 ? 27  ASP B O   1 
ATOM 3200  C CB  . ASP B 2 27  ? 83.880  94.326  146.972 1.00 10.00 ? 27  ASP B CB  1 
ATOM 3201  C CG  . ASP B 2 27  ? 84.208  93.252  147.977 1.00 10.00 ? 27  ASP B CG  1 
ATOM 3202  O OD1 . ASP B 2 27  ? 83.451  93.136  148.963 1.00 10.00 ? 27  ASP B OD1 1 
ATOM 3203  O OD2 . ASP B 2 27  ? 85.208  92.529  147.787 1.00 10.00 ? 27  ASP B OD2 1 
ATOM 3204  N N   . LYS B 2 28  ? 81.293  92.189  147.073 1.00 10.00 ? 28  LYS B N   1 
ATOM 3205  C CA  . LYS B 2 28  ? 80.802  90.825  146.851 1.00 10.00 ? 28  LYS B CA  1 
ATOM 3206  C C   . LYS B 2 28  ? 81.888  89.728  146.810 1.00 10.00 ? 28  LYS B C   1 
ATOM 3207  O O   . LYS B 2 28  ? 83.028  89.944  147.223 1.00 10.00 ? 28  LYS B O   1 
ATOM 3208  C CB  . LYS B 2 28  ? 80.013  90.821  145.545 1.00 10.00 ? 28  LYS B CB  1 
ATOM 3209  C CG  . LYS B 2 28  ? 79.072  92.007  145.385 1.00 10.00 ? 28  LYS B CG  1 
ATOM 3210  C CD  . LYS B 2 28  ? 79.543  93.052  144.364 1.00 10.00 ? 28  LYS B CD  1 
ATOM 3211  C CE  . LYS B 2 28  ? 78.488  94.172  144.228 1.00 10.00 ? 28  LYS B CE  1 
ATOM 3212  N NZ  . LYS B 2 28  ? 78.846  95.338  143.366 1.00 10.00 ? 28  LYS B NZ  1 
ATOM 3213  N N   . VAL B 2 29  ? 81.522  88.550  146.289 1.00 10.00 ? 29  VAL B N   1 
ATOM 3214  C CA  . VAL B 2 29  ? 82.463  87.426  146.167 1.00 10.00 ? 29  VAL B CA  1 
ATOM 3215  C C   . VAL B 2 29  ? 82.967  87.490  144.729 1.00 10.00 ? 29  VAL B C   1 
ATOM 3216  O O   . VAL B 2 29  ? 82.174  87.488  143.788 1.00 10.00 ? 29  VAL B O   1 
ATOM 3217  C CB  . VAL B 2 29  ? 81.814  85.983  146.403 1.00 10.00 ? 29  VAL B CB  1 
ATOM 3218  C CG1 . VAL B 2 29  ? 82.703  85.174  147.330 1.00 10.00 ? 29  VAL B CG1 1 
ATOM 3219  C CG2 . VAL B 2 29  ? 80.402  86.077  146.960 1.00 10.00 ? 29  VAL B CG2 1 
ATOM 3220  N N   . THR B 2 30  ? 84.280  87.571  144.556 1.00 10.00 ? 30  THR B N   1 
ATOM 3221  C CA  . THR B 2 30  ? 84.851  87.642  143.219 1.00 10.00 ? 30  THR B CA  1 
ATOM 3222  C C   . THR B 2 30  ? 85.060  86.216  142.693 1.00 10.00 ? 30  THR B C   1 
ATOM 3223  O O   . THR B 2 30  ? 86.075  85.582  142.965 1.00 10.00 ? 30  THR B O   1 
ATOM 3224  C CB  . THR B 2 30  ? 86.176  88.461  143.257 1.00 10.00 ? 30  THR B CB  1 
ATOM 3225  O OG1 . THR B 2 30  ? 85.949  89.640  144.040 1.00 10.00 ? 30  THR B OG1 1 
ATOM 3226  C CG2 . THR B 2 30  ? 86.626  88.873  141.851 1.00 10.00 ? 30  THR B CG2 1 
ATOM 3227  N N   . VAL B 2 31  ? 84.059  85.721  141.965 1.00 10.00 ? 31  VAL B N   1 
ATOM 3228  C CA  . VAL B 2 31  ? 84.080  84.393  141.384 1.00 10.00 ? 31  VAL B CA  1 
ATOM 3229  C C   . VAL B 2 31  ? 84.906  84.423  140.097 1.00 10.00 ? 31  VAL B C   1 
ATOM 3230  O O   . VAL B 2 31  ? 84.853  85.385  139.335 1.00 10.00 ? 31  VAL B O   1 
ATOM 3231  C CB  . VAL B 2 31  ? 82.612  83.917  141.097 1.00 10.00 ? 31  VAL B CB  1 
ATOM 3232  C CG1 . VAL B 2 31  ? 82.470  83.314  139.706 1.00 10.00 ? 31  VAL B CG1 1 
ATOM 3233  C CG2 . VAL B 2 31  ? 82.179  82.903  142.178 1.00 10.00 ? 31  VAL B CG2 1 
ATOM 3234  N N   . ARG B 2 32  ? 85.665  83.356  139.857 1.00 10.00 ? 32  ARG B N   1 
ATOM 3235  C CA  . ARG B 2 32  ? 86.515  83.225  138.698 1.00 10.00 ? 32  ARG B CA  1 
ATOM 3236  C C   . ARG B 2 32  ? 85.764  82.300  137.743 1.00 10.00 ? 32  ARG B C   1 
ATOM 3237  O O   . ARG B 2 32  ? 85.317  81.241  138.164 1.00 10.00 ? 32  ARG B O   1 
ATOM 3238  C CB  . ARG B 2 32  ? 87.828  82.594  139.155 1.00 10.00 ? 32  ARG B CB  1 
ATOM 3239  C CG  . ARG B 2 32  ? 88.323  83.147  140.469 1.00 10.00 ? 32  ARG B CG  1 
ATOM 3240  C CD  . ARG B 2 32  ? 89.356  82.256  141.113 1.00 10.00 ? 32  ARG B CD  1 
ATOM 3241  N NE  . ARG B 2 32  ? 88.900  81.805  142.425 1.00 10.00 ? 32  ARG B NE  1 
ATOM 3242  C CZ  . ARG B 2 32  ? 89.430  82.188  143.584 1.00 10.00 ? 32  ARG B CZ  1 
ATOM 3243  N NH1 . ARG B 2 32  ? 90.453  83.032  143.588 1.00 10.00 ? 32  ARG B NH1 1 
ATOM 3244  N NH2 . ARG B 2 32  ? 88.923  81.753  144.739 1.00 10.00 ? 32  ARG B NH2 1 
ATOM 3245  N N   . VAL B 2 33  ? 85.605  82.721  136.485 1.00 10.00 ? 33  VAL B N   1 
ATOM 3246  C CA  . VAL B 2 33  ? 84.913  81.950  135.439 1.00 10.00 ? 33  VAL B CA  1 
ATOM 3247  C C   . VAL B 2 33  ? 85.927  81.804  134.319 1.00 10.00 ? 33  VAL B C   1 
ATOM 3248  O O   . VAL B 2 33  ? 86.531  82.793  133.909 1.00 10.00 ? 33  VAL B O   1 
ATOM 3249  C CB  . VAL B 2 33  ? 83.646  82.686  134.821 1.00 10.00 ? 33  VAL B CB  1 
ATOM 3250  C CG1 . VAL B 2 33  ? 82.421  82.435  135.644 1.00 10.00 ? 33  VAL B CG1 1 
ATOM 3251  C CG2 . VAL B 2 33  ? 83.907  84.170  134.695 1.00 10.00 ? 33  VAL B CG2 1 
ATOM 3252  N N   . GLY B 2 34  ? 86.115  80.580  133.833 1.00 10.00 ? 34  GLY B N   1 
ATOM 3253  C CA  . GLY B 2 34  ? 87.061  80.354  132.759 1.00 10.00 ? 34  GLY B CA  1 
ATOM 3254  C C   . GLY B 2 34  ? 86.840  78.957  132.241 1.00 10.00 ? 34  GLY B C   1 
ATOM 3255  O O   . GLY B 2 34  ? 86.944  78.011  133.006 1.00 10.00 ? 34  GLY B O   1 
ATOM 3256  N N   . LEU B 2 35  ? 86.525  78.829  130.955 1.00 10.00 ? 35  LEU B N   1 
ATOM 3257  C CA  . LEU B 2 35  ? 86.268  77.529  130.341 1.00 10.00 ? 35  LEU B CA  1 
ATOM 3258  C C   . LEU B 2 35  ? 87.247  77.075  129.313 1.00 10.00 ? 35  LEU B C   1 
ATOM 3259  O O   . LEU B 2 35  ? 87.415  77.737  128.311 1.00 10.00 ? 35  LEU B O   1 
ATOM 3260  C CB  . LEU B 2 35  ? 84.924  77.501  129.650 1.00 10.00 ? 35  LEU B CB  1 
ATOM 3261  C CG  . LEU B 2 35  ? 83.796  78.086  130.459 1.00 10.00 ? 35  LEU B CG  1 
ATOM 3262  C CD1 . LEU B 2 35  ? 82.487  77.563  129.887 1.00 10.00 ? 35  LEU B CD1 1 
ATOM 3263  C CD2 . LEU B 2 35  ? 83.973  77.737  131.939 1.00 10.00 ? 35  LEU B CD2 1 
ATOM 3264  N N   . THR B 2 36  ? 87.844  75.909  129.542 1.00 10.00 ? 36  THR B N   1 
ATOM 3265  C CA  . THR B 2 36  ? 88.771  75.325  128.586 1.00 10.00 ? 36  THR B CA  1 
ATOM 3266  C C   . THR B 2 36  ? 87.813  74.495  127.724 1.00 10.00 ? 36  THR B C   1 
ATOM 3267  O O   . THR B 2 36  ? 87.195  73.576  128.228 1.00 10.00 ? 36  THR B O   1 
ATOM 3268  C CB  . THR B 2 36  ? 89.825  74.401  129.297 1.00 10.00 ? 36  THR B CB  1 
ATOM 3269  O OG1 . THR B 2 36  ? 90.487  75.137  130.321 1.00 10.00 ? 36  THR B OG1 1 
ATOM 3270  C CG2 . THR B 2 36  ? 90.879  73.947  128.328 1.00 10.00 ? 36  THR B CG2 1 
ATOM 3271  N N   . LEU B 2 37  ? 87.652  74.875  126.456 1.00 10.00 ? 37  LEU B N   1 
ATOM 3272  C CA  . LEU B 2 37  ? 86.795  74.224  125.498 1.00 10.00 ? 37  LEU B CA  1 
ATOM 3273  C C   . LEU B 2 37  ? 87.273  72.784  125.235 1.00 10.00 ? 37  LEU B C   1 
ATOM 3274  O O   . LEU B 2 37  ? 88.463  72.501  125.341 1.00 10.00 ? 37  LEU B O   1 
ATOM 3275  C CB  . LEU B 2 37  ? 86.834  75.085  124.234 1.00 10.00 ? 37  LEU B CB  1 
ATOM 3276  C CG  . LEU B 2 37  ? 85.825  75.053  123.098 1.00 10.00 ? 37  LEU B CG  1 
ATOM 3277  C CD1 . LEU B 2 37  ? 84.907  76.281  123.109 1.00 10.00 ? 37  LEU B CD1 1 
ATOM 3278  C CD2 . LEU B 2 37  ? 86.628  75.019  121.820 1.00 10.00 ? 37  LEU B CD2 1 
ATOM 3279  N N   . THR B 2 38  ? 86.340  71.879  124.935 1.00 10.00 ? 38  THR B N   1 
ATOM 3280  C CA  . THR B 2 38  ? 86.663  70.467  124.626 1.00 10.00 ? 38  THR B CA  1 
ATOM 3281  C C   . THR B 2 38  ? 86.819  70.461  123.104 1.00 10.00 ? 38  THR B C   1 
ATOM 3282  O O   . THR B 2 38  ? 87.916  70.374  122.536 1.00 10.00 ? 38  THR B O   1 
ATOM 3283  C CB  . THR B 2 38  ? 85.488  69.523  124.989 1.00 10.00 ? 38  THR B CB  1 
ATOM 3284  O OG1 . THR B 2 38  ? 84.324  69.872  124.234 1.00 10.00 ? 38  THR B OG1 1 
ATOM 3285  C CG2 . THR B 2 38  ? 85.161  69.624  126.461 1.00 10.00 ? 38  THR B CG2 1 
ATOM 3286  N N   . SER B 2 39  ? 85.673  70.631  122.464 1.00 10.00 ? 39  SER B N   1 
ATOM 3287  C CA  . SER B 2 39  ? 85.545  70.698  121.017 1.00 10.00 ? 39  SER B CA  1 
ATOM 3288  C C   . SER B 2 39  ? 84.081  71.086  120.748 1.00 10.00 ? 39  SER B C   1 
ATOM 3289  O O   . SER B 2 39  ? 83.267  71.165  121.684 1.00 10.00 ? 39  SER B O   1 
ATOM 3290  C CB  . SER B 2 39  ? 85.886  69.335  120.411 1.00 10.00 ? 39  SER B CB  1 
ATOM 3291  O OG  . SER B 2 39  ? 87.084  68.821  120.971 1.00 10.00 ? 39  SER B OG  1 
ATOM 3292  N N   . LEU B 2 40  ? 83.761  71.338  119.489 1.00 10.00 ? 40  LEU B N   1 
ATOM 3293  C CA  . LEU B 2 40  ? 82.432  71.717  119.079 1.00 10.00 ? 40  LEU B CA  1 
ATOM 3294  C C   . LEU B 2 40  ? 81.885  70.619  118.158 1.00 10.00 ? 40  LEU B C   1 
ATOM 3295  O O   . LEU B 2 40  ? 82.631  70.046  117.354 1.00 10.00 ? 40  LEU B O   1 
ATOM 3296  C CB  . LEU B 2 40  ? 82.496  73.047  118.319 1.00 10.00 ? 40  LEU B CB  1 
ATOM 3297  C CG  . LEU B 2 40  ? 81.279  73.628  117.585 1.00 10.00 ? 40  LEU B CG  1 
ATOM 3298  C CD1 . LEU B 2 40  ? 80.862  72.729  116.434 1.00 10.00 ? 40  LEU B CD1 1 
ATOM 3299  C CD2 . LEU B 2 40  ? 80.138  73.803  118.551 1.00 10.00 ? 40  LEU B CD2 1 
ATOM 3300  N N   . LEU B 2 41  ? 80.579  70.350  118.205 1.00 10.00 ? 41  LEU B N   1 
ATOM 3301  C CA  . LEU B 2 41  ? 80.046  69.296  117.362 1.00 10.00 ? 41  LEU B CA  1 
ATOM 3302  C C   . LEU B 2 41  ? 79.112  69.701  116.247 1.00 10.00 ? 41  LEU B C   1 
ATOM 3303  O O   . LEU B 2 41  ? 79.063  69.031  115.221 1.00 10.00 ? 41  LEU B O   1 
ATOM 3304  C CB  . LEU B 2 41  ? 79.394  68.224  118.223 1.00 10.00 ? 41  LEU B CB  1 
ATOM 3305  C CG  . LEU B 2 41  ? 80.197  66.935  118.226 1.00 10.00 ? 41  LEU B CG  1 
ATOM 3306  C CD1 . LEU B 2 41  ? 79.497  65.991  117.276 1.00 10.00 ? 41  LEU B CD1 1 
ATOM 3307  C CD2 . LEU B 2 41  ? 81.676  67.181  117.868 1.00 10.00 ? 41  LEU B CD2 1 
ATOM 3308  N N   . ILE B 2 42  ? 78.350  70.770  116.426 1.00 10.00 ? 42  ILE B N   1 
ATOM 3309  C CA  . ILE B 2 42  ? 77.477  71.173  115.317 1.00 10.00 ? 42  ILE B CA  1 
ATOM 3310  C C   . ILE B 2 42  ? 77.251  72.680  115.206 1.00 10.00 ? 42  ILE B C   1 
ATOM 3311  O O   . ILE B 2 42  ? 76.919  73.389  116.170 1.00 10.00 ? 42  ILE B O   1 
ATOM 3312  C CB  . ILE B 2 42  ? 76.067  70.388  115.272 1.00 10.00 ? 42  ILE B CB  1 
ATOM 3313  C CG1 . ILE B 2 42  ? 76.138  69.215  114.264 1.00 10.00 ? 42  ILE B CG1 1 
ATOM 3314  C CG2 . ILE B 2 42  ? 74.927  71.335  114.828 1.00 10.00 ? 42  ILE B CG2 1 
ATOM 3315  C CD1 . ILE B 2 42  ? 74.782  68.683  113.848 1.00 10.00 ? 42  ILE B CD1 1 
ATOM 3316  N N   . LEU B 2 43  ? 77.533  73.169  114.010 1.00 10.00 ? 43  LEU B N   1 
ATOM 3317  C CA  . LEU B 2 43  ? 77.352  74.561  113.701 1.00 10.00 ? 43  LEU B CA  1 
ATOM 3318  C C   . LEU B 2 43  ? 76.220  74.566  112.714 1.00 10.00 ? 43  LEU B C   1 
ATOM 3319  O O   . LEU B 2 43  ? 76.320  73.969  111.651 1.00 10.00 ? 43  LEU B O   1 
ATOM 3320  C CB  . LEU B 2 43  ? 78.608  75.148  113.055 1.00 10.00 ? 43  LEU B CB  1 
ATOM 3321  C CG  . LEU B 2 43  ? 79.057  76.529  113.567 1.00 10.00 ? 43  LEU B CG  1 
ATOM 3322  C CD1 . LEU B 2 43  ? 78.371  76.848  114.889 1.00 10.00 ? 43  LEU B CD1 1 
ATOM 3323  C CD2 . LEU B 2 43  ? 80.574  76.578  113.727 1.00 10.00 ? 43  LEU B CD2 1 
ATOM 3324  N N   . ASN B 2 44  ? 75.110  75.167  113.111 1.00 10.00 ? 44  ASN B N   1 
ATOM 3325  C CA  . ASN B 2 44  ? 73.954  75.298  112.215 1.00 10.00 ? 44  ASN B CA  1 
ATOM 3326  C C   . ASN B 2 44  ? 74.226  76.719  111.835 1.00 10.00 ? 44  ASN B C   1 
ATOM 3327  O O   . ASN B 2 44  ? 73.851  77.644  112.553 1.00 10.00 ? 44  ASN B O   1 
ATOM 3328  C CB  . ASN B 2 44  ? 72.629  75.226  112.966 1.00 10.00 ? 44  ASN B CB  1 
ATOM 3329  C CG  . ASN B 2 44  ? 71.477  74.901  112.065 1.00 10.00 ? 44  ASN B CG  1 
ATOM 3330  O OD1 . ASN B 2 44  ? 71.338  75.468  110.996 1.00 10.00 ? 44  ASN B OD1 1 
ATOM 3331  N ND2 . ASN B 2 44  ? 70.633  73.978  112.499 1.00 10.00 ? 44  ASN B ND2 1 
ATOM 3332  N N   . GLU B 2 45  ? 74.986  76.871  110.766 1.00 10.00 ? 45  GLU B N   1 
ATOM 3333  C CA  . GLU B 2 45  ? 75.376  78.202  110.320 1.00 10.00 ? 45  GLU B CA  1 
ATOM 3334  C C   . GLU B 2 45  ? 74.179  78.970  109.768 1.00 10.00 ? 45  GLU B C   1 
ATOM 3335  O O   . GLU B 2 45  ? 74.270  80.164  109.620 1.00 10.00 ? 45  GLU B O   1 
ATOM 3336  C CB  . GLU B 2 45  ? 76.483  78.113  109.268 1.00 10.00 ? 45  GLU B CB  1 
ATOM 3337  C CG  . GLU B 2 45  ? 76.316  79.080  108.108 1.00 10.00 ? 45  GLU B CG  1 
ATOM 3338  C CD  . GLU B 2 45  ? 77.164  78.705  106.909 1.00 10.00 ? 45  GLU B CD  1 
ATOM 3339  O OE1 . GLU B 2 45  ? 76.665  77.963  106.037 1.00 10.00 ? 45  GLU B OE1 1 
ATOM 3340  O OE2 . GLU B 2 45  ? 78.329  79.152  106.841 1.00 10.00 ? 45  GLU B OE2 1 
ATOM 3341  N N   . LYS B 2 46  ? 73.110  78.251  109.489 1.00 10.00 ? 46  LYS B N   1 
ATOM 3342  C CA  . LYS B 2 46  ? 71.921  78.838  108.892 1.00 10.00 ? 46  LYS B CA  1 
ATOM 3343  C C   . LYS B 2 46  ? 71.041  79.493  109.949 1.00 10.00 ? 46  LYS B C   1 
ATOM 3344  O O   . LYS B 2 46  ? 70.557  80.591  109.694 1.00 10.00 ? 46  LYS B O   1 
ATOM 3345  C CB  . LYS B 2 46  ? 71.134  77.779  108.120 1.00 10.00 ? 46  LYS B CB  1 
ATOM 3346  C CG  . LYS B 2 46  ? 69.741  78.221  107.704 1.00 10.00 ? 46  LYS B CG  1 
ATOM 3347  C CD  . LYS B 2 46  ? 69.019  77.122  106.942 1.00 10.00 ? 46  LYS B CD  1 
ATOM 3348  C CE  . LYS B 2 46  ? 67.589  77.523  106.622 1.00 10.00 ? 46  LYS B CE  1 
ATOM 3349  N NZ  . LYS B 2 46  ? 66.707  76.336  106.443 1.00 10.00 ? 46  LYS B NZ  1 
ATOM 3350  N N   . ASN B 2 47  ? 70.774  78.871  111.084 1.00 10.00 ? 47  ASN B N   1 
ATOM 3351  C CA  . ASN B 2 47  ? 69.910  79.586  112.014 1.00 10.00 ? 47  ASN B CA  1 
ATOM 3352  C C   . ASN B 2 47  ? 70.693  80.295  113.096 1.00 10.00 ? 47  ASN B C   1 
ATOM 3353  O O   . ASN B 2 47  ? 70.110  80.969  113.937 1.00 10.00 ? 47  ASN B O   1 
ATOM 3354  C CB  . ASN B 2 47  ? 68.898  78.614  112.619 1.00 10.00 ? 47  ASN B CB  1 
ATOM 3355  C CG  . ASN B 2 47  ? 68.190  77.781  111.560 1.00 10.00 ? 47  ASN B CG  1 
ATOM 3356  O OD1 . ASN B 2 47  ? 67.585  78.319  110.630 1.00 10.00 ? 47  ASN B OD1 1 
ATOM 3357  N ND2 . ASN B 2 47  ? 68.266  76.461  111.697 1.00 10.00 ? 47  ASN B ND2 1 
ATOM 3358  N N   . GLU B 2 48  ? 72.017  80.144  113.040 1.00 10.00 ? 48  GLU B N   1 
ATOM 3359  C CA  . GLU B 2 48  ? 72.942  80.701  114.020 1.00 10.00 ? 48  GLU B CA  1 
ATOM 3360  C C   . GLU B 2 48  ? 72.805  79.999  115.365 1.00 10.00 ? 48  GLU B C   1 
ATOM 3361  O O   . GLU B 2 48  ? 72.598  80.598  116.409 1.00 10.00 ? 48  GLU B O   1 
ATOM 3362  C CB  . GLU B 2 48  ? 72.714  82.205  114.177 1.00 10.00 ? 48  GLU B CB  1 
ATOM 3363  C CG  . GLU B 2 48  ? 71.416  82.565  114.883 1.00 10.00 ? 48  GLU B CG  1 
ATOM 3364  C CD  . GLU B 2 48  ? 71.116  84.050  114.826 1.00 10.00 ? 48  GLU B CD  1 
ATOM 3365  O OE1 . GLU B 2 48  ? 71.930  84.800  114.249 1.00 10.00 ? 48  GLU B OE1 1 
ATOM 3366  O OE2 . GLU B 2 48  ? 70.065  84.464  115.362 1.00 10.00 ? 48  GLU B OE2 1 
ATOM 3367  N N   . GLU B 2 49  ? 72.911  78.670  115.279 1.00 10.00 ? 49  GLU B N   1 
ATOM 3368  C CA  . GLU B 2 49  ? 72.741  77.775  116.432 1.00 10.00 ? 49  GLU B CA  1 
ATOM 3369  C C   . GLU B 2 49  ? 74.120  77.100  116.705 1.00 10.00 ? 49  GLU B C   1 
ATOM 3370  O O   . GLU B 2 49  ? 74.794  76.659  115.764 1.00 10.00 ? 49  GLU B O   1 
ATOM 3371  C CB  . GLU B 2 49  ? 71.615  76.769  116.098 1.00 10.00 ? 49  GLU B CB  1 
ATOM 3372  C CG  . GLU B 2 49  ? 70.270  77.461  115.706 1.00 10.00 ? 49  GLU B CG  1 
ATOM 3373  C CD  . GLU B 2 49  ? 69.280  76.612  114.834 1.00 10.00 ? 49  GLU B CD  1 
ATOM 3374  O OE1 . GLU B 2 49  ? 69.731  75.989  113.861 1.00 10.00 ? 49  GLU B OE1 1 
ATOM 3375  O OE2 . GLU B 2 49  ? 68.051  76.591  115.096 1.00 10.00 ? 49  GLU B OE2 1 
ATOM 3376  N N   . MET B 2 50  ? 74.541  77.029  117.974 1.00 10.00 ? 50  MET B N   1 
ATOM 3377  C CA  . MET B 2 50  ? 75.847  76.494  118.353 1.00 10.00 ? 50  MET B CA  1 
ATOM 3378  C C   . MET B 2 50  ? 75.887  75.464  119.512 1.00 10.00 ? 50  MET B C   1 
ATOM 3379  O O   . MET B 2 50  ? 75.738  75.836  120.674 1.00 10.00 ? 50  MET B O   1 
ATOM 3380  C CB  . MET B 2 50  ? 76.714  77.717  118.656 1.00 10.00 ? 50  MET B CB  1 
ATOM 3381  C CG  . MET B 2 50  ? 78.028  77.463  119.280 1.00 10.00 ? 50  MET B CG  1 
ATOM 3382  S SD  . MET B 2 50  ? 78.777  79.027  119.745 1.00 10.00 ? 50  MET B SD  1 
ATOM 3383  C CE  . MET B 2 50  ? 80.221  79.059  118.705 1.00 10.00 ? 50  MET B CE  1 
ATOM 3384  N N   . THR B 2 51  ? 76.092  74.174  119.206 1.00 10.00 ? 51  THR B N   1 
ATOM 3385  C CA  . THR B 2 51  ? 76.168  73.134  120.232 1.00 10.00 ? 51  THR B CA  1 
ATOM 3386  C C   . THR B 2 51  ? 77.636  72.756  120.467 1.00 10.00 ? 51  THR B C   1 
ATOM 3387  O O   . THR B 2 51  ? 78.225  72.012  119.678 1.00 10.00 ? 51  THR B O   1 
ATOM 3388  C CB  . THR B 2 51  ? 75.387  71.869  119.798 1.00 10.00 ? 51  THR B CB  1 
ATOM 3389  O OG1 . THR B 2 51  ? 74.004  72.199  119.615 1.00 10.00 ? 51  THR B OG1 1 
ATOM 3390  C CG2 . THR B 2 51  ? 75.508  70.773  120.848 1.00 10.00 ? 51  THR B CG2 1 
ATOM 3391  N N   . THR B 2 52  ? 78.230  73.261  121.547 1.00 10.00 ? 52  THR B N   1 
ATOM 3392  C CA  . THR B 2 52  ? 79.637  72.951  121.818 1.00 10.00 ? 52  THR B CA  1 
ATOM 3393  C C   . THR B 2 52  ? 79.784  72.285  123.196 1.00 10.00 ? 52  THR B C   1 
ATOM 3394  O O   . THR B 2 52  ? 78.798  71.970  123.872 1.00 10.00 ? 52  THR B O   1 
ATOM 3395  C CB  . THR B 2 52  ? 80.491  74.246  121.824 1.00 10.00 ? 52  THR B CB  1 
ATOM 3396  O OG1 . THR B 2 52  ? 79.955  75.185  120.884 1.00 10.00 ? 52  THR B OG1 1 
ATOM 3397  C CG2 . THR B 2 52  ? 81.930  73.940  121.455 1.00 10.00 ? 52  THR B CG2 1 
ATOM 3398  N N   . SER B 2 53  ? 81.029  72.078  123.615 1.00 10.00 ? 53  SER B N   1 
ATOM 3399  C CA  . SER B 2 53  ? 81.309  71.493  124.902 1.00 10.00 ? 53  SER B CA  1 
ATOM 3400  C C   . SER B 2 53  ? 82.624  72.014  125.446 1.00 10.00 ? 53  SER B C   1 
ATOM 3401  O O   . SER B 2 53  ? 83.633  72.102  124.747 1.00 10.00 ? 53  SER B O   1 
ATOM 3402  C CB  . SER B 2 53  ? 81.343  69.966  124.803 1.00 10.00 ? 53  SER B CB  1 
ATOM 3403  O OG  . SER B 2 53  ? 82.128  69.526  123.709 1.00 10.00 ? 53  SER B OG  1 
ATOM 3404  N N   . VAL B 2 54  ? 82.599  72.296  126.741 1.00 10.00 ? 54  VAL B N   1 
ATOM 3405  C CA  . VAL B 2 54  ? 83.751  72.844  127.421 1.00 10.00 ? 54  VAL B CA  1 
ATOM 3406  C C   . VAL B 2 54  ? 83.712  72.521  128.903 1.00 10.00 ? 54  VAL B C   1 
ATOM 3407  O O   . VAL B 2 54  ? 82.857  71.768  129.345 1.00 10.00 ? 54  VAL B O   1 
ATOM 3408  C CB  . VAL B 2 54  ? 83.719  74.322  127.234 1.00 10.00 ? 54  VAL B CB  1 
ATOM 3409  C CG1 . VAL B 2 54  ? 83.995  74.632  125.788 1.00 10.00 ? 54  VAL B CG1 1 
ATOM 3410  C CG2 . VAL B 2 54  ? 82.290  74.837  127.603 1.00 10.00 ? 54  VAL B CG2 1 
ATOM 3411  N N   . PHE B 2 55  ? 84.640  73.095  129.664 1.00 10.00 ? 55  PHE B N   1 
ATOM 3412  C CA  . PHE B 2 55  ? 84.707  72.871  131.107 1.00 10.00 ? 55  PHE B CA  1 
ATOM 3413  C C   . PHE B 2 55  ? 84.234  74.131  131.785 1.00 10.00 ? 55  PHE B C   1 
ATOM 3414  O O   . PHE B 2 55  ? 84.610  75.222  131.394 1.00 10.00 ? 55  PHE B O   1 
ATOM 3415  C CB  . PHE B 2 55  ? 86.141  72.628  131.596 1.00 10.00 ? 55  PHE B CB  1 
ATOM 3416  C CG  . PHE B 2 55  ? 86.994  71.865  130.643 1.00 10.00 ? 55  PHE B CG  1 
ATOM 3417  C CD1 . PHE B 2 55  ? 88.291  71.544  130.991 1.00 10.00 ? 55  PHE B CD1 1 
ATOM 3418  C CD2 . PHE B 2 55  ? 86.497  71.424  129.419 1.00 10.00 ? 55  PHE B CD2 1 
ATOM 3419  C CE1 . PHE B 2 55  ? 89.074  70.795  130.147 1.00 10.00 ? 55  PHE B CE1 1 
ATOM 3420  C CE2 . PHE B 2 55  ? 87.265  70.685  128.568 1.00 10.00 ? 55  PHE B CE2 1 
ATOM 3421  C CZ  . PHE B 2 55  ? 88.556  70.363  128.930 1.00 10.00 ? 55  PHE B CZ  1 
ATOM 3422  N N   . LEU B 2 56  ? 83.415  73.985  132.809 1.00 10.00 ? 56  LEU B N   1 
ATOM 3423  C CA  . LEU B 2 56  ? 82.949  75.132  133.535 1.00 10.00 ? 56  LEU B CA  1 
ATOM 3424  C C   . LEU B 2 56  ? 83.841  75.219  134.756 1.00 10.00 ? 56  LEU B C   1 
ATOM 3425  O O   . LEU B 2 56  ? 83.508  74.676  135.788 1.00 10.00 ? 56  LEU B O   1 
ATOM 3426  C CB  . LEU B 2 56  ? 81.482  74.943  133.929 1.00 10.00 ? 56  LEU B CB  1 
ATOM 3427  C CG  . LEU B 2 56  ? 80.454  75.044  132.787 1.00 10.00 ? 56  LEU B CG  1 
ATOM 3428  C CD1 . LEU B 2 56  ? 80.484  73.784  131.970 1.00 10.00 ? 56  LEU B CD1 1 
ATOM 3429  C CD2 . LEU B 2 56  ? 79.057  75.269  133.328 1.00 10.00 ? 56  LEU B CD2 1 
ATOM 3430  N N   . ASN B 2 57  ? 84.996  75.876  134.652 1.00 10.00 ? 57  ASN B N   1 
ATOM 3431  C CA  . ASN B 2 57  ? 85.860  75.963  135.805 1.00 10.00 ? 57  ASN B CA  1 
ATOM 3432  C C   . ASN B 2 57  ? 85.402  77.168  136.582 1.00 10.00 ? 57  ASN B C   1 
ATOM 3433  O O   . ASN B 2 57  ? 85.448  78.282  136.060 1.00 10.00 ? 57  ASN B O   1 
ATOM 3434  C CB  . ASN B 2 57  ? 87.297  76.153  135.370 1.00 10.00 ? 57  ASN B CB  1 
ATOM 3435  C CG  . ASN B 2 57  ? 88.252  75.874  136.472 1.00 10.00 ? 57  ASN B CG  1 
ATOM 3436  O OD1 . ASN B 2 57  ? 88.036  76.298  137.615 1.00 10.00 ? 57  ASN B OD1 1 
ATOM 3437  N ND2 . ASN B 2 57  ? 89.332  75.161  136.151 1.00 10.00 ? 57  ASN B ND2 1 
ATOM 3438  N N   . LEU B 2 58  ? 84.873  76.972  137.781 1.00 10.00 ? 58  LEU B N   1 
ATOM 3439  C CA  . LEU B 2 58  ? 84.472  78.103  138.595 1.00 10.00 ? 58  LEU B CA  1 
ATOM 3440  C C   . LEU B 2 58  ? 85.372  78.042  139.803 1.00 10.00 ? 58  LEU B C   1 
ATOM 3441  O O   . LEU B 2 58  ? 85.946  76.997  140.095 1.00 10.00 ? 58  LEU B O   1 
ATOM 3442  C CB  . LEU B 2 58  ? 82.993  78.014  139.007 1.00 10.00 ? 58  LEU B CB  1 
ATOM 3443  C CG  . LEU B 2 58  ? 82.309  76.657  139.230 1.00 10.00 ? 58  LEU B CG  1 
ATOM 3444  C CD1 . LEU B 2 58  ? 82.163  76.416  140.727 1.00 10.00 ? 58  LEU B CD1 1 
ATOM 3445  C CD2 . LEU B 2 58  ? 80.929  76.648  138.531 1.00 10.00 ? 58  LEU B CD2 1 
ATOM 3446  N N   . ALA B 2 59  ? 85.545  79.167  140.476 1.00 10.00 ? 59  ALA B N   1 
ATOM 3447  C CA  . ALA B 2 59  ? 86.380  79.177  141.661 1.00 10.00 ? 59  ALA B CA  1 
ATOM 3448  C C   . ALA B 2 59  ? 86.382  80.529  142.343 1.00 10.00 ? 59  ALA B C   1 
ATOM 3449  O O   . ALA B 2 59  ? 86.573  81.586  141.731 1.00 10.00 ? 59  ALA B O   1 
ATOM 3450  C CB  . ALA B 2 59  ? 87.836  78.724  141.327 1.00 10.00 ? 59  ALA B CB  1 
ATOM 3451  N N   . TRP B 2 60  ? 86.112  80.480  143.633 1.00 10.00 ? 60  TRP B N   1 
ATOM 3452  C CA  . TRP B 2 60  ? 86.072  81.671  144.474 1.00 10.00 ? 60  TRP B CA  1 
ATOM 3453  C C   . TRP B 2 60  ? 86.450  81.131  145.830 1.00 10.00 ? 60  TRP B C   1 
ATOM 3454  O O   . TRP B 2 60  ? 86.916  80.004  145.917 1.00 10.00 ? 60  TRP B O   1 
ATOM 3455  C CB  . TRP B 2 60  ? 84.658  82.265  144.521 1.00 10.00 ? 60  TRP B CB  1 
ATOM 3456  C CG  . TRP B 2 60  ? 83.772  81.586  145.513 1.00 10.00 ? 60  TRP B CG  1 
ATOM 3457  C CD1 . TRP B 2 60  ? 83.388  82.063  146.733 1.00 10.00 ? 60  TRP B CD1 1 
ATOM 3458  C CD2 . TRP B 2 60  ? 83.254  80.260  145.420 1.00 10.00 ? 60  TRP B CD2 1 
ATOM 3459  N NE1 . TRP B 2 60  ? 82.669  81.111  147.409 1.00 10.00 ? 60  TRP B NE1 1 
ATOM 3460  C CE2 . TRP B 2 60  ? 82.572  79.993  146.626 1.00 10.00 ? 60  TRP B CE2 1 
ATOM 3461  C CE3 . TRP B 2 60  ? 83.303  79.266  144.435 1.00 10.00 ? 60  TRP B CE3 1 
ATOM 3462  C CZ2 . TRP B 2 60  ? 81.946  78.773  146.873 1.00 10.00 ? 60  TRP B CZ2 1 
ATOM 3463  C CZ3 . TRP B 2 60  ? 82.679  78.054  144.681 1.00 10.00 ? 60  TRP B CZ3 1 
ATOM 3464  C CH2 . TRP B 2 60  ? 82.011  77.818  145.891 1.00 10.00 ? 60  TRP B CH2 1 
ATOM 3465  N N   . THR B 2 61  ? 86.226  81.900  146.886 1.00 10.00 ? 61  THR B N   1 
ATOM 3466  C CA  . THR B 2 61  ? 86.585  81.417  148.206 1.00 10.00 ? 61  THR B CA  1 
ATOM 3467  C C   . THR B 2 61  ? 85.475  81.418  149.239 1.00 10.00 ? 61  THR B C   1 
ATOM 3468  O O   . THR B 2 61  ? 84.691  82.356  149.351 1.00 10.00 ? 61  THR B O   1 
ATOM 3469  C CB  . THR B 2 61  ? 87.804  82.159  148.778 1.00 10.00 ? 61  THR B CB  1 
ATOM 3470  O OG1 . THR B 2 61  ? 88.960  81.820  148.008 1.00 10.00 ? 61  THR B OG1 1 
ATOM 3471  C CG2 . THR B 2 61  ? 88.043  81.771  150.226 1.00 10.00 ? 61  THR B CG2 1 
ATOM 3472  N N   . ASP B 2 62  ? 85.417  80.312  149.976 1.00 10.00 ? 62  ASP B N   1 
ATOM 3473  C CA  . ASP B 2 62  ? 84.447  80.097  151.039 1.00 10.00 ? 62  ASP B CA  1 
ATOM 3474  C C   . ASP B 2 62  ? 85.152  80.229  152.373 1.00 10.00 ? 62  ASP B C   1 
ATOM 3475  O O   . ASP B 2 62  ? 85.466  79.216  152.988 1.00 10.00 ? 62  ASP B O   1 
ATOM 3476  C CB  . ASP B 2 62  ? 83.875  78.682  150.974 1.00 10.00 ? 62  ASP B CB  1 
ATOM 3477  C CG  . ASP B 2 62  ? 82.743  78.470  151.959 1.00 10.00 ? 62  ASP B CG  1 
ATOM 3478  O OD1 . ASP B 2 62  ? 82.926  78.843  153.132 1.00 10.00 ? 62  ASP B OD1 1 
ATOM 3479  O OD2 . ASP B 2 62  ? 81.680  77.933  151.562 1.00 10.00 ? 62  ASP B OD2 1 
ATOM 3480  N N   . TYR B 2 63  ? 85.402  81.451  152.828 1.00 10.00 ? 63  TYR B N   1 
ATOM 3481  C CA  . TYR B 2 63  ? 86.073  81.631  154.114 1.00 10.00 ? 63  TYR B CA  1 
ATOM 3482  C C   . TYR B 2 63  ? 85.160  81.095  155.218 1.00 10.00 ? 63  TYR B C   1 
ATOM 3483  O O   . TYR B 2 63  ? 85.448  81.222  156.411 1.00 10.00 ? 63  TYR B O   1 
ATOM 3484  C CB  . TYR B 2 63  ? 86.408  83.110  154.349 1.00 10.00 ? 63  TYR B CB  1 
ATOM 3485  C CG  . TYR B 2 63  ? 87.879  83.508  154.177 1.00 10.00 ? 63  TYR B CG  1 
ATOM 3486  C CD1 . TYR B 2 63  ? 88.596  83.175  153.025 1.00 10.00 ? 63  TYR B CD1 1 
ATOM 3487  C CD2 . TYR B 2 63  ? 88.533  84.284  155.150 1.00 10.00 ? 63  TYR B CD2 1 
ATOM 3488  C CE1 . TYR B 2 63  ? 89.938  83.614  152.843 1.00 10.00 ? 63  TYR B CE1 1 
ATOM 3489  C CE2 . TYR B 2 63  ? 89.859  84.725  154.975 1.00 10.00 ? 63  TYR B CE2 1 
ATOM 3490  C CZ  . TYR B 2 63  ? 90.553  84.390  153.820 1.00 10.00 ? 63  TYR B CZ  1 
ATOM 3491  O OH  . TYR B 2 63  ? 91.834  84.867  153.628 1.00 10.00 ? 63  TYR B OH  1 
ATOM 3492  N N   . ARG B 2 64  ? 84.082  80.433  154.806 1.00 10.00 ? 64  ARG B N   1 
ATOM 3493  C CA  . ARG B 2 64  ? 83.140  79.861  155.739 1.00 10.00 ? 64  ARG B CA  1 
ATOM 3494  C C   . ARG B 2 64  ? 83.466  78.357  155.878 1.00 10.00 ? 64  ARG B C   1 
ATOM 3495  O O   . ARG B 2 64  ? 82.990  77.677  156.799 1.00 10.00 ? 64  ARG B O   1 
ATOM 3496  C CB  . ARG B 2 64  ? 81.712  80.085  155.224 1.00 10.00 ? 64  ARG B CB  1 
ATOM 3497  C CG  . ARG B 2 64  ? 81.639  81.054  154.054 1.00 10.00 ? 64  ARG B CG  1 
ATOM 3498  C CD  . ARG B 2 64  ? 80.596  82.168  154.237 1.00 10.00 ? 64  ARG B CD  1 
ATOM 3499  N NE  . ARG B 2 64  ? 81.084  83.305  155.035 1.00 10.00 ? 64  ARG B NE  1 
ATOM 3500  C CZ  . ARG B 2 64  ? 80.336  84.350  155.395 1.00 10.00 ? 64  ARG B CZ  1 
ATOM 3501  N NH1 . ARG B 2 64  ? 79.062  84.412  155.025 1.00 10.00 ? 64  ARG B NH1 1 
ATOM 3502  N NH2 . ARG B 2 64  ? 80.853  85.321  156.145 1.00 10.00 ? 64  ARG B NH2 1 
ATOM 3503  N N   . LEU B 2 65  ? 84.288  77.842  154.966 1.00 10.00 ? 65  LEU B N   1 
ATOM 3504  C CA  . LEU B 2 65  ? 84.664  76.421  154.991 1.00 10.00 ? 65  LEU B CA  1 
ATOM 3505  C C   . LEU B 2 65  ? 86.140  76.188  155.371 1.00 10.00 ? 65  LEU B C   1 
ATOM 3506  O O   . LEU B 2 65  ? 86.639  75.066  155.261 1.00 10.00 ? 65  LEU B O   1 
ATOM 3507  C CB  . LEU B 2 65  ? 84.363  75.767  153.621 1.00 10.00 ? 65  LEU B CB  1 
ATOM 3508  C CG  . LEU B 2 65  ? 83.754  74.355  153.403 1.00 10.00 ? 65  LEU B CG  1 
ATOM 3509  C CD1 . LEU B 2 65  ? 82.308  74.204  154.013 1.00 10.00 ? 65  LEU B CD1 1 
ATOM 3510  C CD2 . LEU B 2 65  ? 83.715  74.106  151.858 1.00 10.00 ? 65  LEU B CD2 1 
ATOM 3511  N N   . GLN B 2 66  ? 86.850  77.228  155.814 1.00 10.00 ? 66  GLN B N   1 
ATOM 3512  C CA  . GLN B 2 66  ? 88.249  77.021  156.205 1.00 10.00 ? 66  GLN B CA  1 
ATOM 3513  C C   . GLN B 2 66  ? 88.186  76.010  157.359 1.00 10.00 ? 66  GLN B C   1 
ATOM 3514  O O   . GLN B 2 66  ? 87.408  76.176  158.295 1.00 10.00 ? 66  GLN B O   1 
ATOM 3515  C CB  . GLN B 2 66  ? 88.902  78.334  156.654 1.00 10.00 ? 66  GLN B CB  1 
ATOM 3516  C CG  . GLN B 2 66  ? 90.404  78.229  156.903 1.00 10.00 ? 66  GLN B CG  1 
ATOM 3517  C CD  . GLN B 2 66  ? 91.110  79.578  156.807 1.00 10.00 ? 66  GLN B CD  1 
ATOM 3518  O OE1 . GLN B 2 66  ? 91.032  80.255  155.780 1.00 10.00 ? 66  GLN B OE1 1 
ATOM 3519  N NE2 . GLN B 2 66  ? 91.804  79.973  157.877 1.00 10.00 ? 66  GLN B NE2 1 
ATOM 3520  N N   . TRP B 2 67  ? 88.968  74.938  157.265 1.00 10.00 ? 67  TRP B N   1 
ATOM 3521  C CA  . TRP B 2 67  ? 88.967  73.882  158.288 1.00 10.00 ? 67  TRP B CA  1 
ATOM 3522  C C   . TRP B 2 67  ? 90.039  74.078  159.344 1.00 10.00 ? 67  TRP B C   1 
ATOM 3523  O O   . TRP B 2 67  ? 90.590  75.166  159.482 1.00 10.00 ? 67  TRP B O   1 
ATOM 3524  C CB  . TRP B 2 67  ? 89.138  72.481  157.661 1.00 10.00 ? 67  TRP B CB  1 
ATOM 3525  C CG  . TRP B 2 67  ? 88.002  72.048  156.792 1.00 10.00 ? 67  TRP B CG  1 
ATOM 3526  C CD1 . TRP B 2 67  ? 88.027  71.910  155.430 1.00 10.00 ? 67  TRP B CD1 1 
ATOM 3527  C CD2 . TRP B 2 67  ? 86.636  71.809  157.193 1.00 10.00 ? 67  TRP B CD2 1 
ATOM 3528  N NE1 . TRP B 2 67  ? 86.758  71.612  154.952 1.00 10.00 ? 67  TRP B NE1 1 
ATOM 3529  C CE2 . TRP B 2 67  ? 85.887  71.545  156.009 1.00 10.00 ? 67  TRP B CE2 1 
ATOM 3530  C CE3 . TRP B 2 67  ? 85.972  71.799  158.425 1.00 10.00 ? 67  TRP B CE3 1 
ATOM 3531  C CZ2 . TRP B 2 67  ? 84.511  71.273  156.026 1.00 10.00 ? 67  TRP B CZ2 1 
ATOM 3532  C CZ3 . TRP B 2 67  ? 84.605  71.527  158.446 1.00 10.00 ? 67  TRP B CZ3 1 
ATOM 3533  C CH2 . TRP B 2 67  ? 83.890  71.270  157.250 1.00 10.00 ? 67  TRP B CH2 1 
ATOM 3534  N N   . ASP B 2 68  ? 90.339  73.016  160.089 1.00 10.00 ? 68  ASP B N   1 
ATOM 3535  C CA  . ASP B 2 68  ? 91.359  73.118  161.128 1.00 10.00 ? 68  ASP B CA  1 
ATOM 3536  C C   . ASP B 2 68  ? 92.433  71.987  161.147 1.00 10.00 ? 68  ASP B C   1 
ATOM 3537  O O   . ASP B 2 68  ? 93.096  71.761  160.137 1.00 10.00 ? 68  ASP B O   1 
ATOM 3538  C CB  . ASP B 2 68  ? 90.672  73.313  162.492 1.00 10.00 ? 68  ASP B CB  1 
ATOM 3539  C CG  . ASP B 2 68  ? 90.842  74.728  163.056 1.00 10.00 ? 68  ASP B CG  1 
ATOM 3540  O OD1 . ASP B 2 68  ? 91.994  75.167  163.259 1.00 10.00 ? 68  ASP B OD1 1 
ATOM 3541  O OD2 . ASP B 2 68  ? 89.821  75.397  163.316 1.00 10.00 ? 68  ASP B OD2 1 
ATOM 3542  N N   . PRO B 2 69  ? 92.579  71.216  162.244 1.00 10.00 ? 69  PRO B N   1 
ATOM 3543  C CA  . PRO B 2 69  ? 93.631  70.195  162.200 1.00 10.00 ? 69  PRO B CA  1 
ATOM 3544  C C   . PRO B 2 69  ? 93.462  69.052  161.192 1.00 10.00 ? 69  PRO B C   1 
ATOM 3545  O O   . PRO B 2 69  ? 94.283  68.861  160.286 1.00 10.00 ? 69  PRO B O   1 
ATOM 3546  C CB  . PRO B 2 69  ? 93.657  69.710  163.637 1.00 10.00 ? 69  PRO B CB  1 
ATOM 3547  C CG  . PRO B 2 69  ? 92.195  69.641  163.939 1.00 10.00 ? 69  PRO B CG  1 
ATOM 3548  C CD  . PRO B 2 69  ? 91.608  70.873  163.309 1.00 10.00 ? 69  PRO B CD  1 
ATOM 3549  N N   . ALA B 2 70  ? 92.353  68.332  161.316 1.00 10.00 ? 70  ALA B N   1 
ATOM 3550  C CA  . ALA B 2 70  ? 92.113  67.144  160.477 1.00 10.00 ? 70  ALA B CA  1 
ATOM 3551  C C   . ALA B 2 70  ? 91.688  67.293  159.008 1.00 10.00 ? 70  ALA B C   1 
ATOM 3552  O O   . ALA B 2 70  ? 92.142  66.525  158.154 1.00 10.00 ? 70  ALA B O   1 
ATOM 3553  C CB  . ALA B 2 70  ? 91.139  66.188  161.207 1.00 10.00 ? 70  ALA B CB  1 
ATOM 3554  N N   . ALA B 2 71  ? 90.811  68.250  158.710 1.00 10.00 ? 71  ALA B N   1 
ATOM 3555  C CA  . ALA B 2 71  ? 90.340  68.442  157.324 1.00 10.00 ? 71  ALA B CA  1 
ATOM 3556  C C   . ALA B 2 71  ? 91.017  69.607  156.621 1.00 10.00 ? 71  ALA B C   1 
ATOM 3557  O O   . ALA B 2 71  ? 90.889  69.766  155.405 1.00 10.00 ? 71  ALA B O   1 
ATOM 3558  C CB  . ALA B 2 71  ? 88.800  68.631  157.290 1.00 10.00 ? 71  ALA B CB  1 
ATOM 3559  N N   . TYR B 2 72  ? 91.736  70.409  157.399 1.00 10.00 ? 72  TYR B N   1 
ATOM 3560  C CA  . TYR B 2 72  ? 92.435  71.605  156.918 1.00 10.00 ? 72  TYR B CA  1 
ATOM 3561  C C   . TYR B 2 72  ? 93.924  71.307  156.844 1.00 10.00 ? 72  TYR B C   1 
ATOM 3562  O O   . TYR B 2 72  ? 94.566  71.426  155.798 1.00 10.00 ? 72  TYR B O   1 
ATOM 3563  C CB  . TYR B 2 72  ? 92.165  72.756  157.902 1.00 10.00 ? 72  TYR B CB  1 
ATOM 3564  C CG  . TYR B 2 72  ? 93.230  73.819  158.037 1.00 10.00 ? 72  TYR B CG  1 
ATOM 3565  C CD1 . TYR B 2 72  ? 93.679  74.525  156.924 1.00 10.00 ? 72  TYR B CD1 1 
ATOM 3566  C CD2 . TYR B 2 72  ? 93.720  74.179  159.287 1.00 10.00 ? 72  TYR B CD2 1 
ATOM 3567  C CE1 . TYR B 2 72  ? 94.579  75.570  157.051 1.00 10.00 ? 72  TYR B CE1 1 
ATOM 3568  C CE2 . TYR B 2 72  ? 94.616  75.218  159.427 1.00 10.00 ? 72  TYR B CE2 1 
ATOM 3569  C CZ  . TYR B 2 72  ? 95.041  75.915  158.301 1.00 10.00 ? 72  TYR B CZ  1 
ATOM 3570  O OH  . TYR B 2 72  ? 95.914  76.976  158.418 1.00 10.00 ? 72  TYR B OH  1 
ATOM 3571  N N   . GLU B 2 73  ? 94.447  70.907  157.989 1.00 10.00 ? 73  GLU B N   1 
ATOM 3572  C CA  . GLU B 2 73  ? 95.863  70.570  158.170 1.00 10.00 ? 73  GLU B CA  1 
ATOM 3573  C C   . GLU B 2 73  ? 96.023  69.059  158.016 1.00 10.00 ? 73  GLU B C   1 
ATOM 3574  O O   . GLU B 2 73  ? 97.123  68.547  157.811 1.00 10.00 ? 73  GLU B O   1 
ATOM 3575  C CB  . GLU B 2 73  ? 96.337  70.997  159.581 1.00 10.00 ? 73  GLU B CB  1 
ATOM 3576  C CG  . GLU B 2 73  ? 97.323  72.204  159.689 1.00 10.00 ? 73  GLU B CG  1 
ATOM 3577  C CD  . GLU B 2 73  ? 97.453  72.997  158.411 1.00 10.00 ? 73  GLU B CD  1 
ATOM 3578  O OE1 . GLU B 2 73  ? 96.431  73.511  157.911 1.00 10.00 ? 73  GLU B OE1 1 
ATOM 3579  O OE2 . GLU B 2 73  ? 98.587  73.110  157.906 1.00 10.00 ? 73  GLU B OE2 1 
ATOM 3580  N N   . GLY B 2 74  ? 94.898  68.357  158.071 1.00 10.00 ? 74  GLY B N   1 
ATOM 3581  C CA  . GLY B 2 74  ? 94.901  66.900  157.968 1.00 10.00 ? 74  GLY B CA  1 
ATOM 3582  C C   . GLY B 2 74  ? 94.974  66.488  156.517 1.00 10.00 ? 74  GLY B C   1 
ATOM 3583  O O   . GLY B 2 74  ? 95.779  65.646  156.110 1.00 10.00 ? 74  GLY B O   1 
ATOM 3584  N N   . ILE B 2 75  ? 94.143  67.150  155.726 1.00 10.00 ? 75  ILE B N   1 
ATOM 3585  C CA  . ILE B 2 75  ? 94.070  66.899  154.291 1.00 10.00 ? 75  ILE B CA  1 
ATOM 3586  C C   . ILE B 2 75  ? 93.680  68.175  153.555 1.00 10.00 ? 75  ILE B C   1 
ATOM 3587  O O   . ILE B 2 75  ? 92.546  68.348  153.133 1.00 10.00 ? 75  ILE B O   1 
ATOM 3588  C CB  . ILE B 2 75  ? 93.055  65.785  153.977 1.00 10.00 ? 75  ILE B CB  1 
ATOM 3589  C CG1 . ILE B 2 75  ? 91.608  66.279  154.152 1.00 10.00 ? 75  ILE B CG1 1 
ATOM 3590  C CG2 . ILE B 2 75  ? 93.289  64.649  154.927 1.00 10.00 ? 75  ILE B CG2 1 
ATOM 3591  C CD1 . ILE B 2 75  ? 90.677  65.836  153.054 1.00 10.00 ? 75  ILE B CD1 1 
ATOM 3592  N N   . LYS B 2 76  ? 94.646  69.068  153.401 1.00 10.00 ? 76  LYS B N   1 
ATOM 3593  C CA  . LYS B 2 76  ? 94.430  70.341  152.743 1.00 10.00 ? 76  LYS B CA  1 
ATOM 3594  C C   . LYS B 2 76  ? 93.462  70.375  151.556 1.00 10.00 ? 76  LYS B C   1 
ATOM 3595  O O   . LYS B 2 76  ? 92.890  71.428  151.252 1.00 10.00 ? 76  LYS B O   1 
ATOM 3596  C CB  . LYS B 2 76  ? 95.796  70.911  152.352 1.00 10.00 ? 76  LYS B CB  1 
ATOM 3597  C CG  . LYS B 2 76  ? 96.668  71.179  153.582 1.00 10.00 ? 76  LYS B CG  1 
ATOM 3598  C CD  . LYS B 2 76  ? 97.598  72.373  153.400 1.00 10.00 ? 76  LYS B CD  1 
ATOM 3599  C CE  . LYS B 2 76  ? 98.211  72.764  154.736 1.00 10.00 ? 76  LYS B CE  1 
ATOM 3600  N NZ  . LYS B 2 76  ? 99.211  73.852  154.601 1.00 10.00 ? 76  LYS B NZ  1 
ATOM 3601  N N   . ASP B 2 77  ? 93.292  69.247  150.873 1.00 10.00 ? 77  ASP B N   1 
ATOM 3602  C CA  . ASP B 2 77  ? 92.383  69.158  149.720 1.00 10.00 ? 77  ASP B CA  1 
ATOM 3603  C C   . ASP B 2 77  ? 91.417  67.994  149.911 1.00 10.00 ? 77  ASP B C   1 
ATOM 3604  O O   . ASP B 2 77  ? 91.841  66.883  150.218 1.00 10.00 ? 77  ASP B O   1 
ATOM 3605  C CB  . ASP B 2 77  ? 93.160  68.945  148.411 1.00 10.00 ? 77  ASP B CB  1 
ATOM 3606  C CG  . ASP B 2 77  ? 92.325  69.255  147.178 1.00 10.00 ? 77  ASP B CG  1 
ATOM 3607  O OD1 . ASP B 2 77  ? 91.253  68.648  147.004 1.00 10.00 ? 77  ASP B OD1 1 
ATOM 3608  O OD2 . ASP B 2 77  ? 92.748  70.115  146.385 1.00 10.00 ? 77  ASP B OD2 1 
ATOM 3609  N N   . LEU B 2 78  ? 90.152  68.241  149.723 1.00 10.00 ? 78  LEU B N   1 
ATOM 3610  C CA  . LEU B 2 78  ? 89.093  67.239  149.857 1.00 10.00 ? 78  LEU B CA  1 
ATOM 3611  C C   . LEU B 2 78  ? 87.955  67.511  148.875 1.00 10.00 ? 78  LEU B C   1 
ATOM 3612  O O   . LEU B 2 78  ? 87.732  68.692  148.543 1.00 10.00 ? 78  LEU B O   1 
ATOM 3613  C CB  . LEU B 2 78  ? 88.565  67.225  151.295 1.00 10.00 ? 78  LEU B CB  1 
ATOM 3614  C CG  . LEU B 2 78  ? 87.617  66.082  151.662 1.00 10.00 ? 78  LEU B CG  1 
ATOM 3615  C CD1 . LEU B 2 78  ? 88.371  64.764  151.732 1.00 10.00 ? 78  LEU B CD1 1 
ATOM 3616  C CD2 . LEU B 2 78  ? 86.917  66.369  152.982 1.00 10.00 ? 78  LEU B CD2 1 
ATOM 3617  N N   . SER B 2 79  ? 87.331  66.489  148.365 1.00 10.00 ? 79  SER B N   1 
ATOM 3618  C CA  . SER B 2 79  ? 86.267  66.661  147.388 1.00 10.00 ? 79  SER B CA  1 
ATOM 3619  C C   . SER B 2 79  ? 84.902  66.644  148.059 1.00 10.00 ? 79  SER B C   1 
ATOM 3620  O O   . SER B 2 79  ? 84.656  65.840  148.955 1.00 10.00 ? 79  SER B O   1 
ATOM 3621  C CB  . SER B 2 79  ? 86.361  65.546  146.356 1.00 10.00 ? 79  SER B CB  1 
ATOM 3622  O OG  . SER B 2 79  ? 87.542  64.791  146.582 1.00 10.00 ? 79  SER B OG  1 
ATOM 3623  N N   . ILE B 2 80  ? 84.022  67.542  147.630 1.00 10.00 ? 80  ILE B N   1 
ATOM 3624  C CA  . ILE B 2 80  ? 82.686  67.633  148.185 1.00 10.00 ? 80  ILE B CA  1 
ATOM 3625  C C   . ILE B 2 80  ? 81.674  68.130  147.155 1.00 10.00 ? 80  ILE B C   1 
ATOM 3626  O O   . ILE B 2 80  ? 81.855  69.200  146.557 1.00 10.00 ? 80  ILE B O   1 
ATOM 3627  C CB  . ILE B 2 80  ? 82.668  68.628  149.384 1.00 10.00 ? 80  ILE B CB  1 
ATOM 3628  C CG1 . ILE B 2 80  ? 83.493  68.071  150.547 1.00 10.00 ? 80  ILE B CG1 1 
ATOM 3629  C CG2 . ILE B 2 80  ? 81.233  68.929  149.809 1.00 10.00 ? 80  ILE B CG2 1 
ATOM 3630  C CD1 . ILE B 2 80  ? 84.828  68.762  150.737 1.00 10.00 ? 80  ILE B CD1 1 
ATOM 3631  N N   . PRO B 2 81  ? 80.554  67.412  146.994 1.00 10.00 ? 81  PRO B N   1 
ATOM 3632  C CA  . PRO B 2 81  ? 79.512  67.796  146.034 1.00 10.00 ? 81  PRO B CA  1 
ATOM 3633  C C   . PRO B 2 81  ? 79.108  69.273  146.184 1.00 10.00 ? 81  PRO B C   1 
ATOM 3634  O O   . PRO B 2 81  ? 79.037  69.795  147.306 1.00 10.00 ? 81  PRO B O   1 
ATOM 3635  C CB  . PRO B 2 81  ? 78.354  66.854  146.391 1.00 10.00 ? 81  PRO B CB  1 
ATOM 3636  C CG  . PRO B 2 81  ? 79.041  65.649  146.760 1.00 10.00 ? 81  PRO B CG  1 
ATOM 3637  C CD  . PRO B 2 81  ? 80.221  66.117  147.607 1.00 10.00 ? 81  PRO B CD  1 
ATOM 3638  N N   . SER B 2 82  ? 78.838  69.933  145.059 1.00 10.00 ? 82  SER B N   1 
ATOM 3639  C CA  . SER B 2 82  ? 78.403  71.342  145.088 1.00 10.00 ? 82  SER B CA  1 
ATOM 3640  C C   . SER B 2 82  ? 77.068  71.355  145.803 1.00 10.00 ? 82  SER B C   1 
ATOM 3641  O O   . SER B 2 82  ? 76.981  70.907  146.932 1.00 10.00 ? 82  SER B O   1 
ATOM 3642  C CB  . SER B 2 82  ? 78.200  71.918  143.683 1.00 10.00 ? 82  SER B CB  1 
ATOM 3643  O OG  . SER B 2 82  ? 79.307  72.683  143.259 1.00 10.00 ? 82  SER B OG  1 
ATOM 3644  N N   . ASP B 2 83  ? 76.036  71.868  145.145 1.00 10.00 ? 83  ASP B N   1 
ATOM 3645  C CA  . ASP B 2 83  ? 74.720  71.910  145.742 1.00 10.00 ? 83  ASP B CA  1 
ATOM 3646  C C   . ASP B 2 83  ? 74.685  72.830  146.965 1.00 10.00 ? 83  ASP B C   1 
ATOM 3647  O O   . ASP B 2 83  ? 73.612  73.149  147.483 1.00 10.00 ? 83  ASP B O   1 
ATOM 3648  C CB  . ASP B 2 83  ? 74.322  70.494  146.140 1.00 10.00 ? 83  ASP B CB  1 
ATOM 3649  C CG  . ASP B 2 83  ? 72.826  70.343  146.324 1.00 10.00 ? 83  ASP B CG  1 
ATOM 3650  O OD1 . ASP B 2 83  ? 72.344  69.181  146.434 1.00 10.00 ? 83  ASP B OD1 1 
ATOM 3651  O OD2 . ASP B 2 83  ? 72.123  71.385  146.360 1.00 10.00 ? 83  ASP B OD2 1 
ATOM 3652  N N   . ASP B 2 84  ? 75.860  73.266  147.416 1.00 10.00 ? 84  ASP B N   1 
ATOM 3653  C CA  . ASP B 2 84  ? 75.958  74.138  148.593 1.00 10.00 ? 84  ASP B CA  1 
ATOM 3654  C C   . ASP B 2 84  ? 76.490  75.554  148.351 1.00 10.00 ? 84  ASP B C   1 
ATOM 3655  O O   . ASP B 2 84  ? 76.847  76.245  149.305 1.00 10.00 ? 84  ASP B O   1 
ATOM 3656  C CB  . ASP B 2 84  ? 76.815  73.478  149.688 1.00 10.00 ? 84  ASP B CB  1 
ATOM 3657  C CG  . ASP B 2 84  ? 75.978  72.773  150.748 1.00 10.00 ? 84  ASP B CG  1 
ATOM 3658  O OD1 . ASP B 2 84  ? 75.075  73.417  151.311 1.00 10.00 ? 84  ASP B OD1 1 
ATOM 3659  O OD2 . ASP B 2 84  ? 76.227  71.582  151.027 1.00 10.00 ? 84  ASP B OD2 1 
ATOM 3660  N N   . VAL B 2 85  ? 76.556  75.988  147.095 1.00 10.00 ? 85  VAL B N   1 
ATOM 3661  C CA  . VAL B 2 85  ? 77.035  77.336  146.799 1.00 10.00 ? 85  VAL B CA  1 
ATOM 3662  C C   . VAL B 2 85  ? 76.205  77.960  145.713 1.00 10.00 ? 85  VAL B C   1 
ATOM 3663  O O   . VAL B 2 85  ? 75.655  77.264  144.869 1.00 10.00 ? 85  VAL B O   1 
ATOM 3664  C CB  . VAL B 2 85  ? 78.477  77.373  146.263 1.00 10.00 ? 85  VAL B CB  1 
ATOM 3665  C CG1 . VAL B 2 85  ? 78.892  78.857  146.007 1.00 10.00 ? 85  VAL B CG1 1 
ATOM 3666  C CG2 . VAL B 2 85  ? 79.438  76.654  147.238 1.00 10.00 ? 85  VAL B CG2 1 
ATOM 3667  N N   . TRP B 2 86  ? 76.142  79.284  145.730 1.00 10.00 ? 86  TRP B N   1 
ATOM 3668  C CA  . TRP B 2 86  ? 75.417  80.021  144.713 1.00 10.00 ? 86  TRP B CA  1 
ATOM 3669  C C   . TRP B 2 86  ? 76.037  79.591  143.387 1.00 10.00 ? 86  TRP B C   1 
ATOM 3670  O O   . TRP B 2 86  ? 77.261  79.656  143.205 1.00 10.00 ? 86  TRP B O   1 
ATOM 3671  C CB  . TRP B 2 86  ? 75.626  81.522  144.919 1.00 10.00 ? 86  TRP B CB  1 
ATOM 3672  C CG  . TRP B 2 86  ? 75.590  82.302  143.610 1.00 10.00 ? 86  TRP B CG  1 
ATOM 3673  C CD1 . TRP B 2 86  ? 74.505  82.607  142.889 1.00 10.00 ? 86  TRP B CD1 1 
ATOM 3674  C CD2 . TRP B 2 86  ? 76.726  82.830  142.948 1.00 10.00 ? 86  TRP B CD2 1 
ATOM 3675  N NE1 . TRP B 2 86  ? 74.956  83.331  141.743 1.00 10.00 ? 86  TRP B NE1 1 
ATOM 3676  C CE2 . TRP B 2 86  ? 76.262  83.448  141.794 1.00 10.00 ? 86  TRP B CE2 1 
ATOM 3677  C CE3 . TRP B 2 86  ? 78.100  82.833  143.221 1.00 10.00 ? 86  TRP B CE3 1 
ATOM 3678  C CZ2 . TRP B 2 86  ? 77.108  84.074  140.870 1.00 10.00 ? 86  TRP B CZ2 1 
ATOM 3679  C CZ3 . TRP B 2 86  ? 78.944  83.470  142.288 1.00 10.00 ? 86  TRP B CZ3 1 
ATOM 3680  C CH2 . TRP B 2 86  ? 78.469  84.060  141.167 1.00 10.00 ? 86  TRP B CH2 1 
ATOM 3681  N N   . GLN B 2 87  ? 75.212  79.128  142.486 1.00 10.00 ? 87  GLN B N   1 
ATOM 3682  C CA  . GLN B 2 87  ? 75.693  78.670  141.189 1.00 10.00 ? 87  GLN B CA  1 
ATOM 3683  C C   . GLN B 2 87  ? 75.185  79.542  140.062 1.00 10.00 ? 87  GLN B C   1 
ATOM 3684  O O   . GLN B 2 87  ? 73.970  79.722  139.893 1.00 10.00 ? 87  GLN B O   1 
ATOM 3685  C CB  . GLN B 2 87  ? 75.284  77.216  140.950 1.00 10.00 ? 87  GLN B CB  1 
ATOM 3686  C CG  . GLN B 2 87  ? 75.517  76.294  142.148 1.00 10.00 ? 87  GLN B CG  1 
ATOM 3687  C CD  . GLN B 2 87  ? 74.577  75.082  142.145 1.00 10.00 ? 87  GLN B CD  1 
ATOM 3688  O OE1 . GLN B 2 87  ? 73.359  75.250  142.094 1.00 10.00 ? 87  GLN B OE1 1 
ATOM 3689  N NE2 . GLN B 2 87  ? 75.063  73.855  142.193 1.00 10.00 ? 87  GLN B NE2 1 
ATOM 3690  N N   . PRO B 2 88  ? 76.092  80.115  139.261 1.00 10.00 ? 88  PRO B N   1 
ATOM 3691  C CA  . PRO B 2 88  ? 75.697  80.982  138.180 1.00 10.00 ? 88  PRO B CA  1 
ATOM 3692  C C   . PRO B 2 88  ? 74.740  80.301  137.196 1.00 10.00 ? 88  PRO B C   1 
ATOM 3693  O O   . PRO B 2 88  ? 75.239  79.588  136.297 1.00 10.00 ? 88  PRO B O   1 
ATOM 3694  C CB  . PRO B 2 88  ? 77.003  81.432  137.566 1.00 10.00 ? 88  PRO B CB  1 
ATOM 3695  C CG  . PRO B 2 88  ? 78.132  80.800  138.359 1.00 10.00 ? 88  PRO B CG  1 
ATOM 3696  C CD  . PRO B 2 88  ? 77.538  79.913  139.410 1.00 10.00 ? 88  PRO B CD  1 
ATOM 3697  N N   . ASP B 2 89  ? 73.491  80.504  137.477 1.00 10.00 ? 89  ASP B N   1 
ATOM 3698  C CA  . ASP B 2 89  ? 72.453  79.942  136.624 1.00 10.00 ? 89  ASP B CA  1 
ATOM 3699  C C   . ASP B 2 89  ? 72.531  80.593  135.262 1.00 10.00 ? 89  ASP B C   1 
ATOM 3700  O O   . ASP B 2 89  ? 71.639  81.277  134.806 1.00 10.00 ? 89  ASP B O   1 
ATOM 3701  C CB  . ASP B 2 89  ? 71.079  80.224  137.206 1.00 10.00 ? 89  ASP B CB  1 
ATOM 3702  C CG  . ASP B 2 89  ? 70.958  81.665  137.658 1.00 10.00 ? 89  ASP B CG  1 
ATOM 3703  O OD1 . ASP B 2 89  ? 71.850  82.152  138.448 1.00 10.00 ? 89  ASP B OD1 1 
ATOM 3704  O OD2 . ASP B 2 89  ? 69.980  82.388  137.247 1.00 10.00 ? 89  ASP B OD2 1 
ATOM 3705  N N   . ILE B 2 90  ? 73.740  80.447  134.714 1.00 10.00 ? 90  ILE B N   1 
ATOM 3706  C CA  . ILE B 2 90  ? 74.191  81.187  133.544 1.00 10.00 ? 90  ILE B CA  1 
ATOM 3707  C C   . ILE B 2 90  ? 73.417  80.729  132.300 1.00 10.00 ? 90  ILE B C   1 
ATOM 3708  O O   . ILE B 2 90  ? 73.347  79.622  131.785 1.00 10.00 ? 90  ILE B O   1 
ATOM 3709  C CB  . ILE B 2 90  ? 75.701  81.049  133.318 1.00 10.00 ? 90  ILE B CB  1 
ATOM 3710  C CG1 . ILE B 2 90  ? 76.471  81.693  134.472 1.00 10.00 ? 90  ILE B CG1 1 
ATOM 3711  C CG2 . ILE B 2 90  ? 76.094  81.677  131.989 1.00 10.00 ? 90  ILE B CG2 1 
ATOM 3712  C CD1 . ILE B 2 90  ? 77.957  81.412  134.448 1.00 10.00 ? 90  ILE B CD1 1 
ATOM 3713  N N   . VAL B 2 91  ? 72.957  81.845  131.583 1.00 10.00 ? 91  VAL B N   1 
ATOM 3714  C CA  . VAL B 2 91  ? 72.276  81.830  130.301 1.00 10.00 ? 91  VAL B CA  1 
ATOM 3715  C C   . VAL B 2 91  ? 73.089  82.686  129.357 1.00 10.00 ? 91  VAL B C   1 
ATOM 3716  O O   . VAL B 2 91  ? 73.894  83.500  129.797 1.00 10.00 ? 91  VAL B O   1 
ATOM 3717  C CB  . VAL B 2 91  ? 70.867  82.435  130.413 1.00 10.00 ? 91  VAL B CB  1 
ATOM 3718  C CG1 . VAL B 2 91  ? 70.969  83.898  130.813 1.00 10.00 ? 91  VAL B CG1 1 
ATOM 3719  C CG2 . VAL B 2 91  ? 70.119  82.281  129.090 1.00 10.00 ? 91  VAL B CG2 1 
ATOM 3720  N N   . LEU B 2 92  ? 72.898  82.505  128.057 1.00 10.00 ? 92  LEU B N   1 
ATOM 3721  C CA  . LEU B 2 92  ? 73.659  83.306  127.105 1.00 10.00 ? 92  LEU B CA  1 
ATOM 3722  C C   . LEU B 2 92  ? 72.748  84.254  126.328 1.00 10.00 ? 92  LEU B C   1 
ATOM 3723  O O   . LEU B 2 92  ? 71.901  83.819  125.558 1.00 10.00 ? 92  LEU B O   1 
ATOM 3724  C CB  . LEU B 2 92  ? 74.449  82.394  126.161 1.00 10.00 ? 92  LEU B CB  1 
ATOM 3725  C CG  . LEU B 2 92  ? 74.997  81.110  126.807 1.00 10.00 ? 92  LEU B CG  1 
ATOM 3726  C CD1 . LEU B 2 92  ? 75.940  80.416  125.850 1.00 10.00 ? 92  LEU B CD1 1 
ATOM 3727  C CD2 . LEU B 2 92  ? 75.694  81.419  128.114 1.00 10.00 ? 92  LEU B CD2 1 
ATOM 3728  N N   . MET B 2 93  ? 72.935  85.555  126.561 1.00 10.00 ? 93  MET B N   1 
ATOM 3729  C CA  . MET B 2 93  ? 72.109  86.592  125.920 1.00 10.00 ? 93  MET B CA  1 
ATOM 3730  C C   . MET B 2 93  ? 71.716  86.278  124.470 1.00 10.00 ? 93  MET B C   1 
ATOM 3731  O O   . MET B 2 93  ? 70.556  86.456  124.105 1.00 10.00 ? 93  MET B O   1 
ATOM 3732  C CB  . MET B 2 93  ? 72.795  87.970  126.011 1.00 10.00 ? 93  MET B CB  1 
ATOM 3733  C CG  . MET B 2 93  ? 73.078  88.472  127.455 1.00 10.00 ? 93  MET B CG  1 
ATOM 3734  S SD  . MET B 2 93  ? 71.764  89.406  128.321 1.00 10.00 ? 93  MET B SD  1 
ATOM 3735  C CE  . MET B 2 93  ? 70.604  88.070  128.802 1.00 10.00 ? 93  MET B CE  1 
ATOM 3736  N N   . ASN B 2 94  ? 72.671  85.888  123.637 1.00 10.00 ? 94  ASN B N   1 
ATOM 3737  C CA  . ASN B 2 94  ? 72.316  85.440  122.301 1.00 10.00 ? 94  ASN B CA  1 
ATOM 3738  C C   . ASN B 2 94  ? 72.048  83.941  122.290 1.00 10.00 ? 94  ASN B C   1 
ATOM 3739  O O   . ASN B 2 94  ? 70.950  83.458  122.119 1.00 10.00 ? 94  ASN B O   1 
ATOM 3740  C CB  . ASN B 2 94  ? 73.419  85.800  121.304 1.00 10.00 ? 94  ASN B CB  1 
ATOM 3741  C CG  . ASN B 2 94  ? 73.005  85.556  119.867 1.00 10.00 ? 94  ASN B CG  1 
ATOM 3742  O OD1 . ASN B 2 94  ? 71.882  85.130  119.598 1.00 10.00 ? 94  ASN B OD1 1 
ATOM 3743  N ND2 . ASN B 2 94  ? 73.915  85.826  118.938 1.00 10.00 ? 94  ASN B ND2 1 
ATOM 3744  N N   . ASN B 2 95  ? 73.087  83.217  122.712 1.00 10.00 ? 95  ASN B N   1 
ATOM 3745  C CA  . ASN B 2 95  ? 73.240  81.779  122.730 1.00 10.00 ? 95  ASN B CA  1 
ATOM 3746  C C   . ASN B 2 95  ? 72.326  81.156  123.766 1.00 10.00 ? 95  ASN B C   1 
ATOM 3747  O O   . ASN B 2 95  ? 71.079  81.166  123.725 1.00 10.00 ? 95  ASN B O   1 
ATOM 3748  C CB  . ASN B 2 95  ? 74.708  81.412  122.917 1.00 10.00 ? 95  ASN B CB  1 
ATOM 3749  C CG  . ASN B 2 95  ? 75.620  82.511  122.407 1.00 10.00 ? 95  ASN B CG  1 
ATOM 3750  O OD1 . ASN B 2 95  ? 75.862  83.502  123.101 1.00 10.00 ? 95  ASN B OD1 1 
ATOM 3751  N ND2 . ASN B 2 95  ? 76.132  82.344  121.194 1.00 10.00 ? 95  ASN B ND2 1 
ATOM 3752  N N   . ASN B 2 96  ? 72.948  80.318  124.687 1.00 10.00 ? 96  ASN B N   1 
ATOM 3753  C CA  . ASN B 2 96  ? 72.210  79.578  125.708 1.00 10.00 ? 96  ASN B CA  1 
ATOM 3754  C C   . ASN B 2 96  ? 70.845  79.258  125.168 1.00 10.00 ? 96  ASN B C   1 
ATOM 3755  O O   . ASN B 2 96  ? 69.860  79.619  125.789 1.00 10.00 ? 96  ASN B O   1 
ATOM 3756  C CB  . ASN B 2 96  ? 72.011  80.435  126.943 1.00 10.00 ? 96  ASN B CB  1 
ATOM 3757  C CG  . ASN B 2 96  ? 71.900  79.623  128.192 1.00 10.00 ? 96  ASN B CG  1 
ATOM 3758  O OD1 . ASN B 2 96  ? 70.858  79.048  128.505 1.00 10.00 ? 96  ASN B OD1 1 
ATOM 3759  N ND2 . ASN B 2 96  ? 72.992  79.552  128.922 1.00 10.00 ? 96  ASN B ND2 1 
ATOM 3760  N N   . ASP B 2 97  ? 70.805  78.603  124.014 1.00 10.00 ? 97  ASP B N   1 
ATOM 3761  C CA  . ASP B 2 97  ? 69.593  78.262  123.336 1.00 10.00 ? 97  ASP B CA  1 
ATOM 3762  C C   . ASP B 2 97  ? 69.020  76.998  123.978 1.00 10.00 ? 97  ASP B C   1 
ATOM 3763  O O   . ASP B 2 97  ? 68.058  76.432  123.474 1.00 10.00 ? 97  ASP B O   1 
ATOM 3764  C CB  . ASP B 2 97  ? 69.926  78.096  121.842 1.00 10.00 ? 97  ASP B CB  1 
ATOM 3765  C CG  . ASP B 2 97  ? 69.001  78.883  120.942 1.00 10.00 ? 97  ASP B CG  1 
ATOM 3766  O OD1 . ASP B 2 97  ? 69.272  78.993  119.723 1.00 10.00 ? 97  ASP B OD1 1 
ATOM 3767  O OD2 . ASP B 2 97  ? 67.989  79.371  121.466 1.00 10.00 ? 97  ASP B OD2 1 
ATOM 3768  N N   . GLY B 2 98  ? 69.621  76.569  125.095 1.00 10.00 ? 98  GLY B N   1 
ATOM 3769  C CA  . GLY B 2 98  ? 69.132  75.417  125.809 1.00 10.00 ? 98  GLY B CA  1 
ATOM 3770  C C   . GLY B 2 98  ? 69.974  75.069  127.074 1.00 10.00 ? 98  GLY B C   1 
ATOM 3771  O O   . GLY B 2 98  ? 71.094  75.549  127.260 1.00 10.00 ? 98  GLY B O   1 
ATOM 3772  N N   . SER B 2 99  ? 69.419  74.181  127.903 1.00 10.00 ? 99  SER B N   1 
ATOM 3773  C CA  . SER B 2 99  ? 69.831  73.720  129.223 1.00 10.00 ? 99  SER B CA  1 
ATOM 3774  C C   . SER B 2 99  ? 71.301  73.318  129.232 1.00 10.00 ? 99  SER B C   1 
ATOM 3775  O O   . SER B 2 99  ? 72.037  73.270  128.252 1.00 10.00 ? 99  SER B O   1 
ATOM 3776  C CB  . SER B 2 99  ? 68.955  72.552  129.679 1.00 10.00 ? 99  SER B CB  1 
ATOM 3777  O OG  . SER B 2 99  ? 69.112  71.432  128.826 1.00 10.00 ? 99  SER B OG  1 
ATOM 3778  N N   . PHE B 2 100 ? 71.731  72.967  130.526 1.00 10.00 ? 100 PHE B N   1 
ATOM 3779  C CA  . PHE B 2 100 ? 73.069  72.541  130.912 1.00 10.00 ? 100 PHE B CA  1 
ATOM 3780  C C   . PHE B 2 100 ? 73.124  71.025  131.066 1.00 10.00 ? 100 PHE B C   1 
ATOM 3781  O O   . PHE B 2 100 ? 72.233  70.395  131.659 1.00 10.00 ? 100 PHE B O   1 
ATOM 3782  C CB  . PHE B 2 100 ? 73.508  73.199  132.226 1.00 10.00 ? 100 PHE B CB  1 
ATOM 3783  C CG  . PHE B 2 100 ? 72.786  72.710  133.450 1.00 10.00 ? 100 PHE B CG  1 
ATOM 3784  C CD1 . PHE B 2 100 ? 73.282  71.637  134.172 1.00 10.00 ? 100 PHE B CD1 1 
ATOM 3785  C CD2 . PHE B 2 100 ? 71.620  73.317  133.880 1.00 10.00 ? 100 PHE B CD2 1 
ATOM 3786  C CE1 . PHE B 2 100 ? 72.627  71.176  135.298 1.00 10.00 ? 100 PHE B CE1 1 
ATOM 3787  C CE2 . PHE B 2 100 ? 70.958  72.861  135.005 1.00 10.00 ? 100 PHE B CE2 1 
ATOM 3788  C CZ  . PHE B 2 100 ? 71.463  71.789  135.714 1.00 10.00 ? 100 PHE B CZ  1 
ATOM 3789  N N   . GLU B 2 101 ? 74.198  70.424  130.521 1.00 10.00 ? 101 GLU B N   1 
ATOM 3790  C CA  . GLU B 2 101 ? 74.504  69.001  130.585 1.00 10.00 ? 101 GLU B CA  1 
ATOM 3791  C C   . GLU B 2 101 ? 75.899  68.764  131.153 1.00 10.00 ? 101 GLU B C   1 
ATOM 3792  O O   . GLU B 2 101 ? 76.908  69.029  130.486 1.00 10.00 ? 101 GLU B O   1 
ATOM 3793  C CB  . GLU B 2 101 ? 74.372  68.362  129.202 1.00 10.00 ? 101 GLU B CB  1 
ATOM 3794  C CG  . GLU B 2 101 ? 73.064  68.677  128.497 1.00 10.00 ? 101 GLU B CG  1 
ATOM 3795  C CD  . GLU B 2 101 ? 72.982  68.057  127.115 1.00 10.00 ? 101 GLU B CD  1 
ATOM 3796  O OE1 . GLU B 2 101 ? 73.795  67.156  126.820 1.00 10.00 ? 101 GLU B OE1 1 
ATOM 3797  O OE2 . GLU B 2 101 ? 72.106  68.472  126.328 1.00 10.00 ? 101 GLU B OE2 1 
ATOM 3798  N N   . ILE B 2 102 ? 75.991  68.296  132.397 1.00 10.00 ? 102 ILE B N   1 
ATOM 3799  C CA  . ILE B 2 102 ? 77.265  68.132  133.080 1.00 10.00 ? 102 ILE B CA  1 
ATOM 3800  C C   . ILE B 2 102 ? 77.778  69.493  133.572 1.00 10.00 ? 102 ILE B C   1 
ATOM 3801  O O   . ILE B 2 102 ? 78.984  69.748  133.636 1.00 10.00 ? 102 ILE B O   1 
ATOM 3802  C CB  . ILE B 2 102 ? 78.316  67.452  132.194 1.00 10.00 ? 102 ILE B CB  1 
ATOM 3803  C CG1 . ILE B 2 102 ? 77.659  66.380  131.323 1.00 10.00 ? 102 ILE B CG1 1 
ATOM 3804  C CG2 . ILE B 2 102 ? 79.418  66.850  133.053 1.00 10.00 ? 102 ILE B CG2 1 
ATOM 3805  C CD1 . ILE B 2 102 ? 78.573  65.810  130.261 1.00 10.00 ? 102 ILE B CD1 1 
ATOM 3806  N N   . THR B 2 103 ? 76.820  70.354  133.903 1.00 10.00 ? 103 THR B N   1 
ATOM 3807  C CA  . THR B 2 103 ? 77.122  71.751  134.272 1.00 10.00 ? 103 THR B CA  1 
ATOM 3808  C C   . THR B 2 103 ? 76.920  72.065  135.763 1.00 10.00 ? 103 THR B C   1 
ATOM 3809  O O   . THR B 2 103 ? 77.707  72.812  136.363 1.00 10.00 ? 103 THR B O   1 
ATOM 3810  C CB  . THR B 2 103 ? 76.214  72.711  133.503 1.00 10.00 ? 103 THR B CB  1 
ATOM 3811  O OG1 . THR B 2 103 ? 76.401  72.543  132.106 1.00 10.00 ? 103 THR B OG1 1 
ATOM 3812  C CG2 . THR B 2 103 ? 76.493  74.179  133.834 1.00 10.00 ? 103 THR B CG2 1 
ATOM 3813  N N   . LEU B 2 104 ? 75.870  71.509  136.334 1.00 10.00 ? 104 LEU B N   1 
ATOM 3814  C CA  . LEU B 2 104 ? 75.500  71.774  137.743 1.00 10.00 ? 104 LEU B CA  1 
ATOM 3815  C C   . LEU B 2 104 ? 75.205  70.464  138.466 1.00 10.00 ? 104 LEU B C   1 
ATOM 3816  O O   . LEU B 2 104 ? 74.879  69.461  137.838 1.00 10.00 ? 104 LEU B O   1 
ATOM 3817  C CB  . LEU B 2 104 ? 74.213  72.655  137.740 1.00 10.00 ? 104 LEU B CB  1 
ATOM 3818  C CG  . LEU B 2 104 ? 74.055  73.694  138.883 1.00 10.00 ? 104 LEU B CG  1 
ATOM 3819  C CD1 . LEU B 2 104 ? 75.282  74.581  139.103 1.00 10.00 ? 104 LEU B CD1 1 
ATOM 3820  C CD2 . LEU B 2 104 ? 72.889  74.679  138.624 1.00 10.00 ? 104 LEU B CD2 1 
ATOM 3821  N N   . HIS B 2 105 ? 75.302  70.503  139.788 1.00 10.00 ? 105 HIS B N   1 
ATOM 3822  C CA  . HIS B 2 105 ? 75.096  69.329  140.685 1.00 10.00 ? 105 HIS B CA  1 
ATOM 3823  C C   . HIS B 2 105 ? 76.257  68.358  140.734 1.00 10.00 ? 105 HIS B C   1 
ATOM 3824  O O   . HIS B 2 105 ? 76.077  67.195  141.083 1.00 10.00 ? 105 HIS B O   1 
ATOM 3825  C CB  . HIS B 2 105 ? 73.869  68.444  140.367 1.00 10.00 ? 105 HIS B CB  1 
ATOM 3826  C CG  . HIS B 2 105 ? 73.524  67.504  141.502 1.00 10.00 ? 105 HIS B CG  1 
ATOM 3827  N ND1 . HIS B 2 105 ? 72.943  66.265  141.312 1.00 10.00 ? 105 HIS B ND1 1 
ATOM 3828  C CD2 . HIS B 2 105 ? 73.654  67.652  142.845 1.00 10.00 ? 105 HIS B CD2 1 
ATOM 3829  C CE1 . HIS B 2 105 ? 72.724  65.697  142.487 1.00 10.00 ? 105 HIS B CE1 1 
ATOM 3830  N NE2 . HIS B 2 105 ? 73.144  66.519  143.432 1.00 10.00 ? 105 HIS B NE2 1 
ATOM 3831  N N   . VAL B 2 106 ? 77.442  68.802  140.368 1.00 10.00 ? 106 VAL B N   1 
ATOM 3832  C CA  . VAL B 2 106 ? 78.598  67.907  140.415 1.00 10.00 ? 106 VAL B CA  1 
ATOM 3833  C C   . VAL B 2 106 ? 79.568  68.323  141.486 1.00 10.00 ? 106 VAL B C   1 
ATOM 3834  O O   . VAL B 2 106 ? 79.663  69.500  141.827 1.00 10.00 ? 106 VAL B O   1 
ATOM 3835  C CB  . VAL B 2 106 ? 79.381  67.843  139.094 1.00 10.00 ? 106 VAL B CB  1 
ATOM 3836  C CG1 . VAL B 2 106 ? 80.880  68.088  139.348 1.00 10.00 ? 106 VAL B CG1 1 
ATOM 3837  C CG2 . VAL B 2 106 ? 79.175  66.467  138.447 1.00 10.00 ? 106 VAL B CG2 1 
ATOM 3838  N N   . ASN B 2 107 ? 80.296  67.341  141.990 1.00 10.00 ? 107 ASN B N   1 
ATOM 3839  C CA  . ASN B 2 107 ? 81.251  67.574  143.033 1.00 10.00 ? 107 ASN B CA  1 
ATOM 3840  C C   . ASN B 2 107 ? 82.176  68.752  142.698 1.00 10.00 ? 107 ASN B C   1 
ATOM 3841  O O   . ASN B 2 107 ? 82.214  69.239  141.568 1.00 10.00 ? 107 ASN B O   1 
ATOM 3842  C CB  . ASN B 2 107 ? 82.086  66.306  143.241 1.00 10.00 ? 107 ASN B CB  1 
ATOM 3843  C CG  . ASN B 2 107 ? 81.421  65.062  142.660 1.00 10.00 ? 107 ASN B CG  1 
ATOM 3844  O OD1 . ASN B 2 107 ? 80.411  64.583  143.176 1.00 10.00 ? 107 ASN B OD1 1 
ATOM 3845  N ND2 . ASN B 2 107 ? 81.985  64.541  141.575 1.00 10.00 ? 107 ASN B ND2 1 
ATOM 3846  N N   . VAL B 2 108 ? 82.974  69.158  143.685 1.00 10.00 ? 108 VAL B N   1 
ATOM 3847  C CA  . VAL B 2 108 ? 83.877  70.280  143.505 1.00 10.00 ? 108 VAL B CA  1 
ATOM 3848  C C   . VAL B 2 108 ? 85.148  70.086  144.323 1.00 10.00 ? 108 VAL B C   1 
ATOM 3849  O O   . VAL B 2 108 ? 85.220  69.239  145.223 1.00 10.00 ? 108 VAL B O   1 
ATOM 3850  C CB  . VAL B 2 108 ? 83.166  71.579  143.968 1.00 10.00 ? 108 VAL B CB  1 
ATOM 3851  C CG1 . VAL B 2 108 ? 84.051  72.781  143.780 1.00 10.00 ? 108 VAL B CG1 1 
ATOM 3852  C CG2 . VAL B 2 108 ? 81.877  71.758  143.203 1.00 10.00 ? 108 VAL B CG2 1 
ATOM 3853  N N   . LEU B 2 109 ? 86.158  70.892  144.023 1.00 10.00 ? 109 LEU B N   1 
ATOM 3854  C CA  . LEU B 2 109 ? 87.439  70.816  144.743 1.00 10.00 ? 109 LEU B CA  1 
ATOM 3855  C C   . LEU B 2 109 ? 87.505  71.991  145.699 1.00 10.00 ? 109 LEU B C   1 
ATOM 3856  O O   . LEU B 2 109 ? 87.550  73.158  145.291 1.00 10.00 ? 109 LEU B O   1 
ATOM 3857  C CB  . LEU B 2 109 ? 88.612  70.875  143.759 1.00 10.00 ? 109 LEU B CB  1 
ATOM 3858  C CG  . LEU B 2 109 ? 89.970  70.374  144.259 1.00 10.00 ? 109 LEU B CG  1 
ATOM 3859  C CD1 . LEU B 2 109 ? 89.920  68.859  144.420 1.00 10.00 ? 109 LEU B CD1 1 
ATOM 3860  C CD2 . LEU B 2 109 ? 91.060  70.760  143.268 1.00 10.00 ? 109 LEU B CD2 1 
ATOM 3861  N N   . VAL B 2 110 ? 87.532  71.653  146.969 1.00 10.00 ? 110 VAL B N   1 
ATOM 3862  C CA  . VAL B 2 110 ? 87.527  72.612  148.068 1.00 10.00 ? 110 VAL B CA  1 
ATOM 3863  C C   . VAL B 2 110 ? 88.928  72.647  148.752 1.00 10.00 ? 110 VAL B C   1 
ATOM 3864  O O   . VAL B 2 110 ? 89.417  71.624  149.221 1.00 10.00 ? 110 VAL B O   1 
ATOM 3865  C CB  . VAL B 2 110 ? 86.339  72.177  149.038 1.00 10.00 ? 110 VAL B CB  1 
ATOM 3866  C CG1 . VAL B 2 110 ? 86.292  73.008  150.294 1.00 10.00 ? 110 VAL B CG1 1 
ATOM 3867  C CG2 . VAL B 2 110 ? 84.993  72.251  148.295 1.00 10.00 ? 110 VAL B CG2 1 
ATOM 3868  N N   . GLN B 2 111 ? 89.596  73.807  148.764 1.00 10.00 ? 111 GLN B N   1 
ATOM 3869  C CA  . GLN B 2 111 ? 90.907  73.915  149.385 1.00 10.00 ? 111 GLN B CA  1 
ATOM 3870  C C   . GLN B 2 111 ? 90.826  74.294  150.861 1.00 10.00 ? 111 GLN B C   1 
ATOM 3871  O O   . GLN B 2 111 ? 89.785  74.757  151.335 1.00 10.00 ? 111 GLN B O   1 
ATOM 3872  C CB  . GLN B 2 111 ? 91.754  74.942  148.630 1.00 10.00 ? 111 GLN B CB  1 
ATOM 3873  C CG  . GLN B 2 111 ? 92.052  74.568  147.189 1.00 10.00 ? 111 GLN B CG  1 
ATOM 3874  C CD  . GLN B 2 111 ? 92.705  75.695  146.425 1.00 10.00 ? 111 GLN B CD  1 
ATOM 3875  O OE1 . GLN B 2 111 ? 93.786  76.164  146.783 1.00 10.00 ? 111 GLN B OE1 1 
ATOM 3876  N NE2 . GLN B 2 111 ? 92.048  76.142  145.366 1.00 10.00 ? 111 GLN B NE2 1 
ATOM 3877  N N   . HIS B 2 112 ? 91.945  74.156  151.581 1.00 10.00 ? 112 HIS B N   1 
ATOM 3878  C CA  . HIS B 2 112 ? 91.986  74.433  153.019 1.00 10.00 ? 112 HIS B CA  1 
ATOM 3879  C C   . HIS B 2 112 ? 91.466  75.787  153.515 1.00 10.00 ? 112 HIS B C   1 
ATOM 3880  O O   . HIS B 2 112 ? 90.538  75.810  154.320 1.00 10.00 ? 112 HIS B O   1 
ATOM 3881  C CB  . HIS B 2 112 ? 93.393  74.227  153.542 1.00 10.00 ? 112 HIS B CB  1 
ATOM 3882  C CG  . HIS B 2 112 ? 94.354  75.263  153.070 1.00 10.00 ? 112 HIS B CG  1 
ATOM 3883  N ND1 . HIS B 2 112 ? 94.486  75.592  151.741 1.00 10.00 ? 112 HIS B ND1 1 
ATOM 3884  C CD2 . HIS B 2 112 ? 95.251  76.022  153.743 1.00 10.00 ? 112 HIS B CD2 1 
ATOM 3885  C CE1 . HIS B 2 112 ? 95.429  76.507  151.616 1.00 10.00 ? 112 HIS B CE1 1 
ATOM 3886  N NE2 . HIS B 2 112 ? 95.912  76.783  152.814 1.00 10.00 ? 112 HIS B NE2 1 
ATOM 3887  N N   . THR B 2 113 ? 92.059  76.910  153.099 1.00 10.00 ? 113 THR B N   1 
ATOM 3888  C CA  . THR B 2 113 ? 91.537  78.179  153.601 1.00 10.00 ? 113 THR B CA  1 
ATOM 3889  C C   . THR B 2 113 ? 90.283  78.670  152.879 1.00 10.00 ? 113 THR B C   1 
ATOM 3890  O O   . THR B 2 113 ? 89.959  79.859  152.902 1.00 10.00 ? 113 THR B O   1 
ATOM 3891  C CB  . THR B 2 113 ? 92.616  79.288  153.617 1.00 10.00 ? 113 THR B CB  1 
ATOM 3892  O OG1 . THR B 2 113 ? 93.209  79.426  152.319 1.00 10.00 ? 113 THR B OG1 1 
ATOM 3893  C CG2 . THR B 2 113 ? 93.673  78.959  154.654 1.00 10.00 ? 113 THR B CG2 1 
ATOM 3894  N N   . GLY B 2 114 ? 89.582  77.753  152.220 1.00 10.00 ? 114 GLY B N   1 
ATOM 3895  C CA  . GLY B 2 114 ? 88.339  78.124  151.563 1.00 10.00 ? 114 GLY B CA  1 
ATOM 3896  C C   . GLY B 2 114 ? 88.253  78.214  150.052 1.00 10.00 ? 114 GLY B C   1 
ATOM 3897  O O   . GLY B 2 114 ? 87.167  78.440  149.518 1.00 10.00 ? 114 GLY B O   1 
ATOM 3898  N N   . ALA B 2 115 ? 89.367  78.052  149.350 1.00 10.00 ? 115 ALA B N   1 
ATOM 3899  C CA  . ALA B 2 115 ? 89.330  78.132  147.884 1.00 10.00 ? 115 ALA B CA  1 
ATOM 3900  C C   . ALA B 2 115 ? 88.413  77.050  147.327 1.00 10.00 ? 115 ALA B C   1 
ATOM 3901  O O   . ALA B 2 115 ? 88.342  75.947  147.858 1.00 10.00 ? 115 ALA B O   1 
ATOM 3902  C CB  . ALA B 2 115 ? 90.747  77.997  147.288 1.00 10.00 ? 115 ALA B CB  1 
ATOM 3903  N N   . VAL B 2 116 ? 87.685  77.375  146.271 1.00 10.00 ? 116 VAL B N   1 
ATOM 3904  C CA  . VAL B 2 116 ? 86.810  76.378  145.669 1.00 10.00 ? 116 VAL B CA  1 
ATOM 3905  C C   . VAL B 2 116 ? 87.044  76.243  144.180 1.00 10.00 ? 116 VAL B C   1 
ATOM 3906  O O   . VAL B 2 116 ? 87.023  77.221  143.439 1.00 10.00 ? 116 VAL B O   1 
ATOM 3907  C CB  . VAL B 2 116 ? 85.355  76.698  145.924 1.00 10.00 ? 116 VAL B CB  1 
ATOM 3908  C CG1 . VAL B 2 116 ? 84.460  75.509  145.490 1.00 10.00 ? 116 VAL B CG1 1 
ATOM 3909  C CG2 . VAL B 2 116 ? 85.193  77.039  147.389 1.00 10.00 ? 116 VAL B CG2 1 
ATOM 3910  N N   . SER B 2 117 ? 87.253  74.996  143.779 1.00 10.00 ? 117 SER B N   1 
ATOM 3911  C CA  . SER B 2 117 ? 87.547  74.574  142.418 1.00 10.00 ? 117 SER B CA  1 
ATOM 3912  C C   . SER B 2 117 ? 86.473  73.647  141.898 1.00 10.00 ? 117 SER B C   1 
ATOM 3913  O O   . SER B 2 117 ? 86.274  72.612  142.477 1.00 10.00 ? 117 SER B O   1 
ATOM 3914  C CB  . SER B 2 117 ? 88.886  73.816  142.381 1.00 10.00 ? 117 SER B CB  1 
ATOM 3915  O OG  . SER B 2 117 ? 89.646  74.008  143.552 1.00 10.00 ? 117 SER B OG  1 
ATOM 3916  N N   . TRP B 2 118 ? 85.810  73.984  140.799 1.00 10.00 ? 118 TRP B N   1 
ATOM 3917  C CA  . TRP B 2 118 ? 84.788  73.094  140.264 1.00 10.00 ? 118 TRP B CA  1 
ATOM 3918  C C   . TRP B 2 118 ? 85.041  73.128  138.743 1.00 10.00 ? 118 TRP B C   1 
ATOM 3919  O O   . TRP B 2 118 ? 84.919  74.178  138.107 1.00 10.00 ? 118 TRP B O   1 
ATOM 3920  C CB  . TRP B 2 118 ? 83.352  73.551  140.674 1.00 10.00 ? 118 TRP B CB  1 
ATOM 3921  C CG  . TRP B 2 118 ? 82.245  72.660  140.112 1.00 10.00 ? 118 TRP B CG  1 
ATOM 3922  C CD1 . TRP B 2 118 ? 82.423  71.498  139.414 1.00 10.00 ? 118 TRP B CD1 1 
ATOM 3923  C CD2 . TRP B 2 118 ? 80.867  72.982  139.980 1.00 10.00 ? 118 TRP B CD2 1 
ATOM 3924  N NE1 . TRP B 2 118 ? 81.263  71.099  138.829 1.00 10.00 ? 118 TRP B NE1 1 
ATOM 3925  C CE2 . TRP B 2 118 ? 80.282  71.991  139.155 1.00 10.00 ? 118 TRP B CE2 1 
ATOM 3926  C CE3 . TRP B 2 118 ? 80.071  74.013  140.456 1.00 10.00 ? 118 TRP B CE3 1 
ATOM 3927  C CZ2 . TRP B 2 118 ? 78.928  72.007  138.789 1.00 10.00 ? 118 TRP B CZ2 1 
ATOM 3928  C CZ3 . TRP B 2 118 ? 78.715  74.034  140.090 1.00 10.00 ? 118 TRP B CZ3 1 
ATOM 3929  C CH2 . TRP B 2 118 ? 78.162  73.032  139.261 1.00 10.00 ? 118 TRP B CH2 1 
ATOM 3930  N N   . HIS B 2 119 ? 85.428  71.971  138.194 1.00 10.00 ? 119 HIS B N   1 
ATOM 3931  C CA  . HIS B 2 119 ? 85.786  71.824  136.805 1.00 10.00 ? 119 HIS B CA  1 
ATOM 3932  C C   . HIS B 2 119 ? 84.886  70.842  136.035 1.00 10.00 ? 119 HIS B C   1 
ATOM 3933  O O   . HIS B 2 119 ? 85.261  69.698  135.805 1.00 10.00 ? 119 HIS B O   1 
ATOM 3934  C CB  . HIS B 2 119 ? 87.255  71.394  136.768 1.00 10.00 ? 119 HIS B CB  1 
ATOM 3935  C CG  . HIS B 2 119 ? 88.051  71.833  137.977 1.00 10.00 ? 119 HIS B CG  1 
ATOM 3936  N ND1 . HIS B 2 119 ? 89.427  71.945  137.967 1.00 10.00 ? 119 HIS B ND1 1 
ATOM 3937  C CD2 . HIS B 2 119 ? 87.673  72.128  139.246 1.00 10.00 ? 119 HIS B CD2 1 
ATOM 3938  C CE1 . HIS B 2 119 ? 89.857  72.282  139.172 1.00 10.00 ? 119 HIS B CE1 1 
ATOM 3939  N NE2 . HIS B 2 119 ? 88.811  72.398  139.967 1.00 10.00 ? 119 HIS B NE2 1 
ATOM 3940  N N   . PRO B 2 120 ? 83.670  71.263  135.632 1.00 10.00 ? 120 PRO B N   1 
ATOM 3941  C CA  . PRO B 2 120 ? 82.857  70.284  134.903 1.00 10.00 ? 120 PRO B CA  1 
ATOM 3942  C C   . PRO B 2 120 ? 82.728  70.551  133.408 1.00 10.00 ? 120 PRO B C   1 
ATOM 3943  O O   . PRO B 2 120 ? 82.461  71.677  132.981 1.00 10.00 ? 120 PRO B O   1 
ATOM 3944  C CB  . PRO B 2 120 ? 81.517  70.377  135.609 1.00 10.00 ? 120 PRO B CB  1 
ATOM 3945  C CG  . PRO B 2 120 ? 81.405  71.843  135.833 1.00 10.00 ? 120 PRO B CG  1 
ATOM 3946  C CD  . PRO B 2 120 ? 82.797  72.224  136.329 1.00 10.00 ? 120 PRO B CD  1 
ATOM 3947  N N   . SER B 2 121 ? 82.914  69.505  132.613 1.00 10.00 ? 121 SER B N   1 
ATOM 3948  C CA  . SER B 2 121 ? 82.790  69.635  131.147 1.00 10.00 ? 121 SER B CA  1 
ATOM 3949  C C   . SER B 2 121 ? 81.293  69.567  130.880 1.00 10.00 ? 121 SER B C   1 
ATOM 3950  O O   . SER B 2 121 ? 80.554  68.968  131.649 1.00 10.00 ? 121 SER B O   1 
ATOM 3951  C CB  . SER B 2 121 ? 83.522  68.496  130.376 1.00 10.00 ? 121 SER B CB  1 
ATOM 3952  O OG  . SER B 2 121 ? 83.435  68.656  128.954 1.00 10.00 ? 121 SER B OG  1 
ATOM 3953  N N   . ALA B 2 122 ? 80.826  70.185  129.806 1.00 10.00 ? 122 ALA B N   1 
ATOM 3954  C CA  . ALA B 2 122 ? 79.395  70.147  129.541 1.00 10.00 ? 122 ALA B CA  1 
ATOM 3955  C C   . ALA B 2 122 ? 79.070  70.407  128.088 1.00 10.00 ? 122 ALA B C   1 
ATOM 3956  O O   . ALA B 2 122 ? 79.872  70.952  127.353 1.00 10.00 ? 122 ALA B O   1 
ATOM 3957  C CB  . ALA B 2 122 ? 78.654  71.159  130.444 1.00 10.00 ? 122 ALA B CB  1 
ATOM 3958  N N   . ILE B 2 123 ? 77.878  70.016  127.690 1.00 10.00 ? 123 ILE B N   1 
ATOM 3959  C CA  . ILE B 2 123 ? 77.490  70.257  126.334 1.00 10.00 ? 123 ILE B CA  1 
ATOM 3960  C C   . ILE B 2 123 ? 76.465  71.381  126.567 1.00 10.00 ? 123 ILE B C   1 
ATOM 3961  O O   . ILE B 2 123 ? 75.738  71.374  127.581 1.00 10.00 ? 123 ILE B O   1 
ATOM 3962  C CB  . ILE B 2 123 ? 76.873  68.962  125.713 1.00 10.00 ? 123 ILE B CB  1 
ATOM 3963  C CG1 . ILE B 2 123 ? 77.238  68.875  124.222 1.00 10.00 ? 123 ILE B CG1 1 
ATOM 3964  C CG2 . ILE B 2 123 ? 75.368  68.936  125.886 1.00 10.00 ? 123 ILE B CG2 1 
ATOM 3965  C CD1 . ILE B 2 123 ? 76.782  67.574  123.492 1.00 10.00 ? 123 ILE B CD1 1 
ATOM 3966  N N   . TYR B 2 124 ? 76.461  72.390  125.697 1.00 10.00 ? 124 TYR B N   1 
ATOM 3967  C CA  . TYR B 2 124 ? 75.512  73.502  125.825 1.00 10.00 ? 124 TYR B CA  1 
ATOM 3968  C C   . TYR B 2 124 ? 75.003  73.961  124.483 1.00 10.00 ? 124 TYR B C   1 
ATOM 3969  O O   . TYR B 2 124 ? 75.756  74.158  123.519 1.00 10.00 ? 124 TYR B O   1 
ATOM 3970  C CB  . TYR B 2 124 ? 76.087  74.689  126.670 1.00 10.00 ? 124 TYR B CB  1 
ATOM 3971  C CG  . TYR B 2 124 ? 77.284  75.499  126.155 1.00 10.00 ? 124 TYR B CG  1 
ATOM 3972  C CD1 . TYR B 2 124 ? 77.158  76.376  125.071 1.00 10.00 ? 124 TYR B CD1 1 
ATOM 3973  C CD2 . TYR B 2 124 ? 78.532  75.431  126.803 1.00 10.00 ? 124 TYR B CD2 1 
ATOM 3974  C CE1 . TYR B 2 124 ? 78.245  77.173  124.644 1.00 10.00 ? 124 TYR B CE1 1 
ATOM 3975  C CE2 . TYR B 2 124 ? 79.628  76.222  126.379 1.00 10.00 ? 124 TYR B CE2 1 
ATOM 3976  C CZ  . TYR B 2 124 ? 79.473  77.089  125.299 1.00 10.00 ? 124 TYR B CZ  1 
ATOM 3977  O OH  . TYR B 2 124 ? 80.535  77.840  124.859 1.00 10.00 ? 124 TYR B OH  1 
ATOM 3978  N N   . ARG B 2 125 ? 73.689  74.064  124.447 1.00 10.00 ? 125 ARG B N   1 
ATOM 3979  C CA  . ARG B 2 125 ? 72.943  74.518  123.287 1.00 10.00 ? 125 ARG B CA  1 
ATOM 3980  C C   . ARG B 2 125 ? 72.961  76.035  123.192 1.00 10.00 ? 125 ARG B C   1 
ATOM 3981  O O   . ARG B 2 125 ? 72.335  76.688  124.027 1.00 10.00 ? 125 ARG B O   1 
ATOM 3982  C CB  . ARG B 2 125 ? 71.508  73.998  123.328 1.00 10.00 ? 125 ARG B CB  1 
ATOM 3983  C CG  . ARG B 2 125 ? 70.707  74.302  122.072 1.00 10.00 ? 125 ARG B CG  1 
ATOM 3984  C CD  . ARG B 2 125 ? 71.420  73.800  120.826 1.00 10.00 ? 125 ARG B CD  1 
ATOM 3985  N NE  . ARG B 2 125 ? 70.485  73.497  119.747 1.00 10.00 ? 125 ARG B NE  1 
ATOM 3986  C CZ  . ARG B 2 125 ? 70.847  73.103  118.529 1.00 10.00 ? 125 ARG B CZ  1 
ATOM 3987  N NH1 . ARG B 2 125 ? 72.133  72.964  118.232 1.00 10.00 ? 125 ARG B NH1 1 
ATOM 3988  N NH2 . ARG B 2 125 ? 69.924  72.850  117.612 1.00 10.00 ? 125 ARG B NH2 1 
ATOM 3989  N N   . SER B 2 126 ? 73.769  76.577  122.300 1.00 10.00 ? 126 SER B N   1 
ATOM 3990  C CA  . SER B 2 126 ? 73.873  78.025  122.180 1.00 10.00 ? 126 SER B CA  1 
ATOM 3991  C C   . SER B 2 126 ? 73.418  78.544  120.824 1.00 10.00 ? 126 SER B C   1 
ATOM 3992  O O   . SER B 2 126 ? 73.187  77.775  119.890 1.00 10.00 ? 126 SER B O   1 
ATOM 3993  C CB  . SER B 2 126 ? 75.311  78.443  122.395 1.00 10.00 ? 126 SER B CB  1 
ATOM 3994  O OG  . SER B 2 126 ? 76.100  78.059  121.281 1.00 10.00 ? 126 SER B OG  1 
ATOM 3995  N N   . SER B 2 127 ? 73.406  79.826  120.679 1.00 10.00 ? 127 SER B N   1 
ATOM 3996  C CA  . SER B 2 127 ? 73.030  80.447  119.412 1.00 10.00 ? 127 SER B CA  1 
ATOM 3997  C C   . SER B 2 127 ? 73.747  81.760  119.195 1.00 10.00 ? 127 SER B C   1 
ATOM 3998  O O   . SER B 2 127 ? 73.416  82.778  119.801 1.00 10.00 ? 127 SER B O   1 
ATOM 3999  C CB  . SER B 2 127 ? 71.522  80.691  119.358 1.00 10.00 ? 127 SER B CB  1 
ATOM 4000  O OG  . SER B 2 127 ? 71.133  81.320  118.145 1.00 10.00 ? 127 SER B OG  1 
ATOM 4001  N N   . CYS B 2 128 ? 74.743  81.743  118.336 1.00 10.00 ? 128 CYS B N   1 
ATOM 4002  C CA  . CYS B 2 128 ? 75.441  82.968  118.076 1.00 10.00 ? 128 CYS B CA  1 
ATOM 4003  C C   . CYS B 2 128 ? 75.159  83.441  116.619 1.00 10.00 ? 128 CYS B C   1 
ATOM 4004  O O   . CYS B 2 128 ? 74.813  82.654  115.740 1.00 10.00 ? 128 CYS B O   1 
ATOM 4005  C CB  . CYS B 2 128 ? 76.921  82.799  118.383 1.00 10.00 ? 128 CYS B CB  1 
ATOM 4006  S SG  . CYS B 2 128 ? 77.541  84.212  119.324 1.00 10.00 ? 128 CYS B SG  1 
ATOM 4007  N N   . THR B 2 129 ? 75.328  84.746  116.373 1.00 10.00 ? 129 THR B N   1 
ATOM 4008  C CA  . THR B 2 129 ? 74.988  85.379  115.084 1.00 10.00 ? 129 THR B CA  1 
ATOM 4009  C C   . THR B 2 129 ? 75.835  85.027  113.922 1.00 10.00 ? 129 THR B C   1 
ATOM 4010  O O   . THR B 2 129 ? 76.414  85.900  113.263 1.00 10.00 ? 129 THR B O   1 
ATOM 4011  C CB  . THR B 2 129 ? 74.983  86.942  115.183 1.00 10.00 ? 129 THR B CB  1 
ATOM 4012  O OG1 . THR B 2 129 ? 74.330  87.498  114.051 1.00 10.00 ? 129 THR B OG1 1 
ATOM 4013  C CG2 . THR B 2 129 ? 76.390  87.541  115.241 1.00 10.00 ? 129 THR B CG2 1 
ATOM 4014  N N   . ILE B 2 130 ? 75.885  83.893  113.792 1.00 10.00 ? 130 ILE B N   1 
ATOM 4015  C CA  . ILE B 2 130 ? 76.711  83.549  112.675 1.00 10.00 ? 130 ILE B CA  1 
ATOM 4016  C C   . ILE B 2 130 ? 75.887  83.970  111.448 1.00 10.00 ? 130 ILE B C   1 
ATOM 4017  O O   . ILE B 2 130 ? 76.368  83.981  110.311 1.00 10.00 ? 130 ILE B O   1 
ATOM 4018  C CB  . ILE B 2 130 ? 77.091  82.051  112.766 1.00 10.00 ? 130 ILE B CB  1 
ATOM 4019  C CG1 . ILE B 2 130 ? 75.844  81.147  112.888 1.00 10.00 ? 130 ILE B CG1 1 
ATOM 4020  C CG2 . ILE B 2 130 ? 78.047  81.887  113.959 1.00 10.00 ? 130 ILE B CG2 1 
ATOM 4021  C CD1 . ILE B 2 130 ? 76.137  79.667  113.064 1.00 10.00 ? 130 ILE B CD1 1 
ATOM 4022  N N   . LYS B 2 131 ? 74.652  84.392  111.732 1.00 10.00 ? 131 LYS B N   1 
ATOM 4023  C CA  . LYS B 2 131 ? 73.694  84.880  110.735 1.00 10.00 ? 131 LYS B CA  1 
ATOM 4024  C C   . LYS B 2 131 ? 73.847  84.216  109.370 1.00 10.00 ? 131 LYS B C   1 
ATOM 4025  O O   . LYS B 2 131 ? 74.475  83.171  109.233 1.00 10.00 ? 131 LYS B O   1 
ATOM 4026  C CB  . LYS B 2 131 ? 73.828  86.415  110.586 1.00 10.00 ? 131 LYS B CB  1 
ATOM 4027  C CG  . LYS B 2 131 ? 72.588  87.160  110.007 1.00 10.00 ? 131 LYS B CG  1 
ATOM 4028  C CD  . LYS B 2 131 ? 72.635  87.386  108.487 1.00 10.00 ? 131 LYS B CD  1 
ATOM 4029  C CE  . LYS B 2 131 ? 71.225  87.419  107.916 1.00 10.00 ? 131 LYS B CE  1 
ATOM 4030  N NZ  . LYS B 2 131 ? 71.191  87.327  106.439 1.00 10.00 ? 131 LYS B NZ  1 
ATOM 4031  N N   . VAL B 2 132 ? 73.234  84.828  108.368 1.00 10.00 ? 132 VAL B N   1 
ATOM 4032  C CA  . VAL B 2 132 ? 73.313  84.339  107.007 1.00 10.00 ? 132 VAL B CA  1 
ATOM 4033  C C   . VAL B 2 132 ? 74.548  85.040  106.429 1.00 10.00 ? 132 VAL B C   1 
ATOM 4034  O O   . VAL B 2 132 ? 74.599  85.385  105.247 1.00 10.00 ? 132 VAL B O   1 
ATOM 4035  C CB  . VAL B 2 132 ? 72.021  84.703  106.229 1.00 10.00 ? 132 VAL B CB  1 
ATOM 4036  C CG1 . VAL B 2 132 ? 72.003  84.046  104.868 1.00 10.00 ? 132 VAL B CG1 1 
ATOM 4037  C CG2 . VAL B 2 132 ? 70.802  84.258  107.026 1.00 10.00 ? 132 VAL B CG2 1 
ATOM 4038  N N   . MET B 2 133 ? 75.532  85.254  107.305 1.00 10.00 ? 133 MET B N   1 
ATOM 4039  C CA  . MET B 2 133 ? 76.801  85.885  106.966 1.00 10.00 ? 133 MET B CA  1 
ATOM 4040  C C   . MET B 2 133 ? 77.981  85.076  107.518 1.00 10.00 ? 133 MET B C   1 
ATOM 4041  O O   . MET B 2 133 ? 78.977  85.639  107.967 1.00 10.00 ? 133 MET B O   1 
ATOM 4042  C CB  . MET B 2 133 ? 76.841  87.331  107.478 1.00 10.00 ? 133 MET B CB  1 
ATOM 4043  C CG  . MET B 2 133 ? 76.160  87.554  108.811 1.00 10.00 ? 133 MET B CG  1 
ATOM 4044  S SD  . MET B 2 133 ? 77.016  86.823  110.210 1.00 10.00 ? 133 MET B SD  1 
ATOM 4045  C CE  . MET B 2 133 ? 77.022  88.205  111.351 1.00 10.00 ? 133 MET B CE  1 
ATOM 4046  N N   . TYR B 2 134 ? 77.876  83.858  107.445 1.00 10.00 ? 134 TYR B N   1 
ATOM 4047  C CA  . TYR B 2 134 ? 78.887  82.827  107.906 1.00 10.00 ? 134 TYR B CA  1 
ATOM 4048  C C   . TYR B 2 134 ? 79.615  82.166  106.701 1.00 10.00 ? 134 TYR B C   1 
ATOM 4049  O O   . TYR B 2 134 ? 80.353  81.175  106.852 1.00 10.00 ? 134 TYR B O   1 
ATOM 4050  C CB  . TYR B 2 134 ? 78.171  81.657  108.654 1.00 10.00 ? 134 TYR B CB  1 
ATOM 4051  C CG  . TYR B 2 134 ? 78.922  81.057  109.879 1.00 10.00 ? 134 TYR B CG  1 
ATOM 4052  C CD1 . TYR B 2 134 ? 80.303  81.250  110.054 1.00 10.00 ? 134 TYR B CD1 1 
ATOM 4053  C CD2 . TYR B 2 134 ? 78.219  80.295  110.840 1.00 10.00 ? 134 TYR B CD2 1 
ATOM 4054  C CE1 . TYR B 2 134 ? 80.960  80.726  111.187 1.00 10.00 ? 134 TYR B CE1 1 
ATOM 4055  C CE2 . TYR B 2 134 ? 78.874  79.785  111.975 1.00 10.00 ? 134 TYR B CE2 1 
ATOM 4056  C CZ  . TYR B 2 134 ? 80.244  80.004  112.151 1.00 10.00 ? 134 TYR B CZ  1 
ATOM 4057  O OH  . TYR B 2 134 ? 80.880  79.526  113.259 1.00 10.00 ? 134 TYR B OH  1 
ATOM 4058  N N   . PHE B 2 135 ? 79.400  82.715  105.503 1.00 10.00 ? 135 PHE B N   1 
ATOM 4059  C CA  . PHE B 2 135 ? 80.002  82.152  104.270 1.00 10.00 ? 135 PHE B CA  1 
ATOM 4060  C C   . PHE B 2 135 ? 80.830  83.172  103.498 1.00 10.00 ? 135 PHE B C   1 
ATOM 4061  O O   . PHE B 2 135 ? 81.660  82.783  102.684 1.00 10.00 ? 135 PHE B O   1 
ATOM 4062  C CB  . PHE B 2 135 ? 78.926  81.595  103.337 1.00 10.00 ? 135 PHE B CB  1 
ATOM 4063  C CG  . PHE B 2 135 ? 79.217  80.149  102.916 1.00 10.00 ? 135 PHE B CG  1 
ATOM 4064  C CD1 . PHE B 2 135 ? 79.302  79.140  103.886 1.00 10.00 ? 135 PHE B CD1 1 
ATOM 4065  C CD2 . PHE B 2 135 ? 79.403  79.829  101.564 1.00 10.00 ? 135 PHE B CD2 1 
ATOM 4066  C CE1 . PHE B 2 135 ? 79.571  77.819  103.505 1.00 10.00 ? 135 PHE B CE1 1 
ATOM 4067  C CE2 . PHE B 2 135 ? 79.672  78.508  101.184 1.00 10.00 ? 135 PHE B CE2 1 
ATOM 4068  C CZ  . PHE B 2 135 ? 79.756  77.503  102.154 1.00 10.00 ? 135 PHE B CZ  1 
ATOM 4069  N N   . PRO B 2 136 ? 80.603  84.501  103.783 1.00 10.00 ? 136 PRO B N   1 
ATOM 4070  C CA  . PRO B 2 136 ? 81.452  85.365  102.950 1.00 10.00 ? 136 PRO B CA  1 
ATOM 4071  C C   . PRO B 2 136 ? 82.867  85.173  103.439 1.00 10.00 ? 136 PRO B C   1 
ATOM 4072  O O   . PRO B 2 136 ? 83.094  84.952  104.626 1.00 10.00 ? 136 PRO B O   1 
ATOM 4073  C CB  . PRO B 2 136 ? 80.938  86.757  103.264 1.00 10.00 ? 136 PRO B CB  1 
ATOM 4074  C CG  . PRO B 2 136 ? 80.671  86.649  104.776 1.00 10.00 ? 136 PRO B CG  1 
ATOM 4075  C CD  . PRO B 2 136 ? 79.939  85.293  104.850 1.00 10.00 ? 136 PRO B CD  1 
ATOM 4076  N N   . PHE B 2 137 ? 83.814  85.248  102.526 1.00 10.00 ? 137 PHE B N   1 
ATOM 4077  C CA  . PHE B 2 137 ? 85.209  85.069  102.875 1.00 10.00 ? 137 PHE B CA  1 
ATOM 4078  C C   . PHE B 2 137 ? 85.608  86.158  103.860 1.00 10.00 ? 137 PHE B C   1 
ATOM 4079  O O   . PHE B 2 137 ? 86.662  86.089  104.506 1.00 10.00 ? 137 PHE B O   1 
ATOM 4080  C CB  . PHE B 2 137 ? 86.068  85.117  101.608 1.00 10.00 ? 137 PHE B CB  1 
ATOM 4081  C CG  . PHE B 2 137 ? 85.634  84.134  100.549 1.00 10.00 ? 137 PHE B CG  1 
ATOM 4082  C CD1 . PHE B 2 137 ? 84.491  84.367  99.788  1.00 10.00 ? 137 PHE B CD1 1 
ATOM 4083  C CD2 . PHE B 2 137 ? 86.348  82.958  100.339 1.00 10.00 ? 137 PHE B CD2 1 
ATOM 4084  C CE1 . PHE B 2 137 ? 84.065  83.443  98.837  1.00 10.00 ? 137 PHE B CE1 1 
ATOM 4085  C CE2 . PHE B 2 137 ? 85.928  82.028  99.391  1.00 10.00 ? 137 PHE B CE2 1 
ATOM 4086  C CZ  . PHE B 2 137 ? 84.785  82.273  98.641  1.00 10.00 ? 137 PHE B CZ  1 
ATOM 4087  N N   . ASP B 2 138 ? 84.896  87.163  103.873 1.00 10.00 ? 138 ASP B N   1 
ATOM 4088  C CA  . ASP B 2 138 ? 85.221  88.214  104.814 1.00 10.00 ? 138 ASP B CA  1 
ATOM 4089  C C   . ASP B 2 138 ? 84.531  87.843  106.134 1.00 10.00 ? 138 ASP B C   1 
ATOM 4090  O O   . ASP B 2 138 ? 84.801  88.417  107.198 1.00 10.00 ? 138 ASP B O   1 
ATOM 4091  C CB  . ASP B 2 138 ? 84.737  89.573  104.286 1.00 10.00 ? 138 ASP B CB  1 
ATOM 4092  C CG  . ASP B 2 138 ? 83.518  89.457  103.388 1.00 10.00 ? 138 ASP B CG  1 
ATOM 4093  O OD1 . ASP B 2 138 ? 83.588  88.729  102.375 1.00 10.00 ? 138 ASP B OD1 1 
ATOM 4094  O OD2 . ASP B 2 138 ? 82.492  90.100  103.691 1.00 10.00 ? 138 ASP B OD2 1 
ATOM 4095  N N   . TRP B 2 139 ? 83.655  86.848  106.032 1.00 10.00 ? 139 TRP B N   1 
ATOM 4096  C CA  . TRP B 2 139 ? 82.891  86.348  107.158 1.00 10.00 ? 139 TRP B CA  1 
ATOM 4097  C C   . TRP B 2 139 ? 82.505  87.435  108.121 1.00 10.00 ? 139 TRP B C   1 
ATOM 4098  O O   . TRP B 2 139 ? 82.501  88.594  107.768 1.00 10.00 ? 139 TRP B O   1 
ATOM 4099  C CB  . TRP B 2 139 ? 83.683  85.252  107.879 1.00 10.00 ? 139 TRP B CB  1 
ATOM 4100  C CG  . TRP B 2 139 ? 83.672  83.948  107.136 1.00 10.00 ? 139 TRP B CG  1 
ATOM 4101  C CD1 . TRP B 2 139 ? 82.610  83.108  106.981 1.00 10.00 ? 139 TRP B CD1 1 
ATOM 4102  C CD2 . TRP B 2 139 ? 84.746  83.377  106.378 1.00 10.00 ? 139 TRP B CD2 1 
ATOM 4103  N NE1 . TRP B 2 139 ? 82.950  82.052  106.171 1.00 10.00 ? 139 TRP B NE1 1 
ATOM 4104  C CE2 . TRP B 2 139 ? 84.256  82.192  105.785 1.00 10.00 ? 139 TRP B CE2 1 
ATOM 4105  C CE3 . TRP B 2 139 ? 86.074  83.753  106.138 1.00 10.00 ? 139 TRP B CE3 1 
ATOM 4106  C CZ2 . TRP B 2 139 ? 85.047  81.379  104.967 1.00 10.00 ? 139 TRP B CZ2 1 
ATOM 4107  C CZ3 . TRP B 2 139 ? 86.862  82.943  105.323 1.00 10.00 ? 139 TRP B CZ3 1 
ATOM 4108  C CH2 . TRP B 2 139 ? 86.343  81.769  104.749 1.00 10.00 ? 139 TRP B CH2 1 
ATOM 4109  N N   . GLN B 2 140 ? 82.179  87.053  109.347 1.00 10.00 ? 140 GLN B N   1 
ATOM 4110  C CA  . GLN B 2 140 ? 81.789  88.038  110.343 1.00 10.00 ? 140 GLN B CA  1 
ATOM 4111  C C   . GLN B 2 140 ? 82.227  87.594  111.732 1.00 10.00 ? 140 GLN B C   1 
ATOM 4112  O O   . GLN B 2 140 ? 82.923  86.589  111.897 1.00 10.00 ? 140 GLN B O   1 
ATOM 4113  C CB  . GLN B 2 140 ? 80.267  88.226  110.330 1.00 10.00 ? 140 GLN B CB  1 
ATOM 4114  C CG  . GLN B 2 140 ? 79.661  88.593  108.976 1.00 10.00 ? 140 GLN B CG  1 
ATOM 4115  C CD  . GLN B 2 140 ? 79.950  90.022  108.558 1.00 10.00 ? 140 GLN B CD  1 
ATOM 4116  O OE1 . GLN B 2 140 ? 79.653  90.966  109.290 1.00 10.00 ? 140 GLN B OE1 1 
ATOM 4117  N NE2 . GLN B 2 140 ? 80.524  90.189  107.373 1.00 10.00 ? 140 GLN B NE2 1 
ATOM 4118  N N   . ASN B 2 141 ? 81.795  88.345  112.733 1.00 10.00 ? 141 ASN B N   1 
ATOM 4119  C CA  . ASN B 2 141 ? 82.133  88.029  114.105 1.00 10.00 ? 141 ASN B CA  1 
ATOM 4120  C C   . ASN B 2 141 ? 80.823  87.879  114.887 1.00 10.00 ? 141 ASN B C   1 
ATOM 4121  O O   . ASN B 2 141 ? 79.753  88.240  114.389 1.00 10.00 ? 141 ASN B O   1 
ATOM 4122  C CB  . ASN B 2 141 ? 82.999  89.158  114.688 1.00 10.00 ? 141 ASN B CB  1 
ATOM 4123  C CG  . ASN B 2 141 ? 84.302  89.371  113.909 1.00 10.00 ? 141 ASN B CG  1 
ATOM 4124  O OD1 . ASN B 2 141 ? 84.321  89.338  112.680 1.00 10.00 ? 141 ASN B OD1 1 
ATOM 4125  N ND2 . ASN B 2 141 ? 85.387  89.609  114.630 1.00 10.00 ? 141 ASN B ND2 1 
ATOM 4126  N N   . CYS B 2 142 ? 80.894  87.297  116.085 1.00 10.00 ? 142 CYS B N   1 
ATOM 4127  C CA  . CYS B 2 142 ? 79.682  87.147  116.910 1.00 10.00 ? 142 CYS B CA  1 
ATOM 4128  C C   . CYS B 2 142 ? 79.891  87.552  118.346 1.00 10.00 ? 142 CYS B C   1 
ATOM 4129  O O   . CYS B 2 142 ? 81.019  87.700  118.800 1.00 10.00 ? 142 CYS B O   1 
ATOM 4130  C CB  . CYS B 2 142 ? 79.112  85.713  116.944 1.00 10.00 ? 142 CYS B CB  1 
ATOM 4131  S SG  . CYS B 2 142 ? 77.534  85.679  117.896 1.00 10.00 ? 142 CYS B SG  1 
ATOM 4132  N N   . THR B 2 143 ? 78.763  87.678  119.040 1.00 10.00 ? 143 THR B N   1 
ATOM 4133  C CA  . THR B 2 143 ? 78.655  88.065  120.458 1.00 10.00 ? 143 THR B CA  1 
ATOM 4134  C C   . THR B 2 143 ? 78.157  86.855  121.264 1.00 10.00 ? 143 THR B C   1 
ATOM 4135  O O   . THR B 2 143 ? 77.015  86.435  121.086 1.00 10.00 ? 143 THR B O   1 
ATOM 4136  C CB  . THR B 2 143 ? 77.624  89.294  120.656 1.00 10.00 ? 143 THR B CB  1 
ATOM 4137  O OG1 . THR B 2 143 ? 78.317  90.538  120.480 1.00 10.00 ? 143 THR B OG1 1 
ATOM 4138  C CG2 . THR B 2 143 ? 76.938  89.277  122.051 1.00 10.00 ? 143 THR B CG2 1 
ATOM 4139  N N   . MET B 2 144 ? 79.014  86.267  122.104 1.00 10.00 ? 144 MET B N   1 
ATOM 4140  C CA  . MET B 2 144 ? 78.587  85.160  122.935 1.00 10.00 ? 144 MET B CA  1 
ATOM 4141  C C   . MET B 2 144 ? 78.550  85.682  124.369 1.00 10.00 ? 144 MET B C   1 
ATOM 4142  O O   . MET B 2 144 ? 79.585  85.804  125.012 1.00 10.00 ? 144 MET B O   1 
ATOM 4143  C CB  . MET B 2 144 ? 79.552  83.967  122.829 1.00 10.00 ? 144 MET B CB  1 
ATOM 4144  C CG  . MET B 2 144 ? 79.648  83.376  121.399 1.00 10.00 ? 144 MET B CG  1 
ATOM 4145  S SD  . MET B 2 144 ? 80.561  81.814  121.206 1.00 10.00 ? 144 MET B SD  1 
ATOM 4146  C CE  . MET B 2 144 ? 82.264  82.312  121.536 1.00 10.00 ? 144 MET B CE  1 
ATOM 4147  N N   . VAL B 2 145 ? 77.263  85.929  124.870 1.00 10.00 ? 145 VAL B N   1 
ATOM 4148  C CA  . VAL B 2 145 ? 77.189  86.488  126.215 1.00 10.00 ? 145 VAL B CA  1 
ATOM 4149  C C   . VAL B 2 145 ? 76.640  85.543  127.283 1.00 10.00 ? 145 VAL B C   1 
ATOM 4150  O O   . VAL B 2 145 ? 75.460  85.239  127.309 1.00 10.00 ? 145 VAL B O   1 
ATOM 4151  C CB  . VAL B 2 145 ? 76.375  87.798  126.209 1.00 10.00 ? 145 VAL B CB  1 
ATOM 4152  C CG1 . VAL B 2 145 ? 77.269  88.962  126.612 1.00 10.00 ? 145 VAL B CG1 1 
ATOM 4153  C CG2 . VAL B 2 145 ? 75.803  88.049  124.817 1.00 10.00 ? 145 VAL B CG2 1 
ATOM 4154  N N   . PHE B 2 146 ? 77.538  85.112  128.166 1.00 10.00 ? 146 PHE B N   1 
ATOM 4155  C CA  . PHE B 2 146 ? 77.234  84.201  129.264 1.00 10.00 ? 146 PHE B CA  1 
ATOM 4156  C C   . PHE B 2 146 ? 76.893  84.979  130.542 1.00 10.00 ? 146 PHE B C   1 
ATOM 4157  O O   . PHE B 2 146 ? 77.428  86.060  130.781 1.00 10.00 ? 146 PHE B O   1 
ATOM 4158  C CB  . PHE B 2 146 ? 78.472  83.335  129.569 1.00 10.00 ? 146 PHE B CB  1 
ATOM 4159  C CG  . PHE B 2 146 ? 78.713  82.149  128.601 1.00 10.00 ? 146 PHE B CG  1 
ATOM 4160  C CD1 . PHE B 2 146 ? 78.520  82.279  127.224 1.00 10.00 ? 146 PHE B CD1 1 
ATOM 4161  C CD2 . PHE B 2 146 ? 79.267  80.936  129.086 1.00 10.00 ? 146 PHE B CD2 1 
ATOM 4162  C CE1 . PHE B 2 146 ? 78.877  81.254  126.371 1.00 10.00 ? 146 PHE B CE1 1 
ATOM 4163  C CE2 . PHE B 2 146 ? 79.623  79.921  128.238 1.00 10.00 ? 146 PHE B CE2 1 
ATOM 4164  C CZ  . PHE B 2 146 ? 79.433  80.074  126.882 1.00 10.00 ? 146 PHE B CZ  1 
ATOM 4165  N N   . LYS B 2 147 ? 75.992  84.427  131.357 1.00 10.00 ? 147 LYS B N   1 
ATOM 4166  C CA  . LYS B 2 147 ? 75.616  85.021  132.648 1.00 10.00 ? 147 LYS B CA  1 
ATOM 4167  C C   . LYS B 2 147 ? 74.358  84.406  133.226 1.00 10.00 ? 147 LYS B C   1 
ATOM 4168  O O   . LYS B 2 147 ? 73.517  83.867  132.509 1.00 10.00 ? 147 LYS B O   1 
ATOM 4169  C CB  . LYS B 2 147 ? 75.421  86.540  132.573 1.00 10.00 ? 147 LYS B CB  1 
ATOM 4170  C CG  . LYS B 2 147 ? 74.887  87.138  133.854 1.00 10.00 ? 147 LYS B CG  1 
ATOM 4171  C CD  . LYS B 2 147 ? 75.962  87.237  134.911 1.00 10.00 ? 147 LYS B CD  1 
ATOM 4172  C CE  . LYS B 2 147 ? 75.394  87.599  136.323 1.00 10.00 ? 147 LYS B CE  1 
ATOM 4173  N NZ  . LYS B 2 147 ? 74.609  88.887  136.547 1.00 10.00 ? 147 LYS B NZ  1 
ATOM 4174  N N   . SER B 2 148 ? 74.127  84.624  134.508 1.00 10.00 ? 148 SER B N   1 
ATOM 4175  C CA  . SER B 2 148 ? 73.107  83.893  135.251 1.00 10.00 ? 148 SER B CA  1 
ATOM 4176  C C   . SER B 2 148 ? 71.726  84.418  134.885 1.00 10.00 ? 148 SER B C   1 
ATOM 4177  O O   . SER B 2 148 ? 71.583  85.532  134.368 1.00 10.00 ? 148 SER B O   1 
ATOM 4178  C CB  . SER B 2 148 ? 73.364  83.996  136.755 1.00 10.00 ? 148 SER B CB  1 
ATOM 4179  O OG  . SER B 2 148 ? 73.258  85.348  137.177 1.00 10.00 ? 148 SER B OG  1 
ATOM 4180  N N   . TYR B 2 149 ? 70.698  83.605  135.189 1.00 10.00 ? 149 TYR B N   1 
ATOM 4181  C CA  . TYR B 2 149 ? 69.347  83.920  134.743 1.00 10.00 ? 149 TYR B CA  1 
ATOM 4182  C C   . TYR B 2 149 ? 68.393  84.065  135.923 1.00 10.00 ? 149 TYR B C   1 
ATOM 4183  O O   . TYR B 2 149 ? 67.173  83.744  135.794 1.00 10.00 ? 149 TYR B O   1 
ATOM 4184  C CB  . TYR B 2 149 ? 68.838  82.850  133.777 1.00 10.00 ? 149 TYR B CB  1 
ATOM 4185  C CG  . TYR B 2 149 ? 67.899  83.383  132.720 1.00 10.00 ? 149 TYR B CG  1 
ATOM 4186  C CD1 . TYR B 2 149 ? 68.146  84.597  132.093 1.00 10.00 ? 149 TYR B CD1 1 
ATOM 4187  C CD2 . TYR B 2 149 ? 66.765  82.673  132.351 1.00 10.00 ? 149 TYR B CD2 1 
ATOM 4188  C CE1 . TYR B 2 149 ? 67.289  85.088  131.127 1.00 10.00 ? 149 TYR B CE1 1 
ATOM 4189  C CE2 . TYR B 2 149 ? 65.903  83.157  131.386 1.00 10.00 ? 149 TYR B CE2 1 
ATOM 4190  C CZ  . TYR B 2 149 ? 66.170  84.364  130.777 1.00 10.00 ? 149 TYR B CZ  1 
ATOM 4191  O OH  . TYR B 2 149 ? 65.312  84.847  129.816 1.00 10.00 ? 149 TYR B OH  1 
ATOM 4192  N N   . THR B 2 150 ? 68.826  84.564  137.038 1.00 10.00 ? 150 THR B N   1 
ATOM 4193  C CA  . THR B 2 150 ? 68.005  84.903  138.190 1.00 10.00 ? 150 THR B CA  1 
ATOM 4194  C C   . THR B 2 150 ? 68.747  85.836  139.132 1.00 10.00 ? 150 THR B C   1 
ATOM 4195  O O   . THR B 2 150 ? 68.170  86.587  139.904 1.00 10.00 ? 150 THR B O   1 
ATOM 4196  C CB  . THR B 2 150 ? 67.577  83.662  138.973 1.00 10.00 ? 150 THR B CB  1 
ATOM 4197  O OG1 . THR B 2 150 ? 66.809  82.800  138.127 1.00 10.00 ? 150 THR B OG1 1 
ATOM 4198  C CG2 . THR B 2 150 ? 66.752  84.059  140.188 1.00 10.00 ? 150 THR B CG2 1 
ATOM 4199  N N   . TYR B 2 151 ? 70.083  85.811  139.011 1.00 10.00 ? 151 TYR B N   1 
ATOM 4200  C CA  . TYR B 2 151 ? 70.984  86.643  139.799 1.00 10.00 ? 151 TYR B CA  1 
ATOM 4201  C C   . TYR B 2 151 ? 71.382  87.892  139.026 1.00 10.00 ? 151 TYR B C   1 
ATOM 4202  O O   . TYR B 2 151 ? 71.286  87.870  137.793 1.00 10.00 ? 151 TYR B O   1 
ATOM 4203  C CB  . TYR B 2 151 ? 72.219  85.846  140.222 1.00 10.00 ? 151 TYR B CB  1 
ATOM 4204  C CG  . TYR B 2 151 ? 71.906  84.639  141.080 1.00 10.00 ? 151 TYR B CG  1 
ATOM 4205  C CD1 . TYR B 2 151 ? 71.620  83.410  140.504 1.00 10.00 ? 151 TYR B CD1 1 
ATOM 4206  C CD2 . TYR B 2 151 ? 71.897  84.730  142.467 1.00 10.00 ? 151 TYR B CD2 1 
ATOM 4207  C CE1 . TYR B 2 151 ? 71.335  82.304  141.282 1.00 10.00 ? 151 TYR B CE1 1 
ATOM 4208  C CE2 . TYR B 2 151 ? 71.615  83.630  143.254 1.00 10.00 ? 151 TYR B CE2 1 
ATOM 4209  C CZ  . TYR B 2 151 ? 71.334  82.420  142.656 1.00 10.00 ? 151 TYR B CZ  1 
ATOM 4210  O OH  . TYR B 2 151 ? 71.052  81.321  143.436 1.00 10.00 ? 151 TYR B OH  1 
ATOM 4211  N N   . ASP B 2 152 ? 71.711  88.955  139.720 1.00 10.00 ? 152 ASP B N   1 
ATOM 4212  C CA  . ASP B 2 152 ? 72.100  90.213  139.107 1.00 10.00 ? 152 ASP B CA  1 
ATOM 4213  C C   . ASP B 2 152 ? 73.425  90.545  139.739 1.00 10.00 ? 152 ASP B C   1 
ATOM 4214  O O   . ASP B 2 152 ? 73.537  90.475  140.954 1.00 10.00 ? 152 ASP B O   1 
ATOM 4215  C CB  . ASP B 2 152 ? 71.098  91.304  139.478 1.00 10.00 ? 152 ASP B CB  1 
ATOM 4216  C CG  . ASP B 2 152 ? 69.661  90.860  139.312 1.00 10.00 ? 152 ASP B CG  1 
ATOM 4217  O OD1 . ASP B 2 152 ? 69.284  90.449  138.194 1.00 10.00 ? 152 ASP B OD1 1 
ATOM 4218  O OD2 . ASP B 2 152 ? 68.904  90.927  140.303 1.00 10.00 ? 152 ASP B OD2 1 
ATOM 4219  N N   . THR B 2 153 ? 74.426  90.966  138.969 1.00 10.00 ? 153 THR B N   1 
ATOM 4220  C CA  . THR B 2 153 ? 75.703  91.235  139.619 1.00 10.00 ? 153 THR B CA  1 
ATOM 4221  C C   . THR B 2 153 ? 75.590  92.323  140.687 1.00 10.00 ? 153 THR B C   1 
ATOM 4222  O O   . THR B 2 153 ? 75.646  93.531  140.400 1.00 10.00 ? 153 THR B O   1 
ATOM 4223  C CB  . THR B 2 153 ? 76.791  91.623  138.623 1.00 10.00 ? 153 THR B CB  1 
ATOM 4224  O OG1 . THR B 2 153 ? 76.855  90.665  137.565 1.00 10.00 ? 153 THR B OG1 1 
ATOM 4225  C CG2 . THR B 2 153 ? 78.122  91.684  139.318 1.00 10.00 ? 153 THR B CG2 1 
ATOM 4226  N N   . SER B 2 154 ? 75.410  91.868  141.924 1.00 10.00 ? 154 SER B N   1 
ATOM 4227  C CA  . SER B 2 154 ? 75.285  92.750  143.102 1.00 10.00 ? 154 SER B CA  1 
ATOM 4228  C C   . SER B 2 154 ? 75.953  91.980  144.254 1.00 10.00 ? 154 SER B C   1 
ATOM 4229  O O   . SER B 2 154 ? 76.619  92.576  145.083 1.00 10.00 ? 154 SER B O   1 
ATOM 4230  C CB  . SER B 2 154 ? 73.815  93.065  143.482 1.00 10.00 ? 154 SER B CB  1 
ATOM 4231  O OG  . SER B 2 154 ? 72.995  93.430  142.385 1.00 10.00 ? 154 SER B OG  1 
ATOM 4232  N N   . GLU B 2 155 ? 75.801  90.644  144.284 1.00 10.00 ? 155 GLU B N   1 
ATOM 4233  C CA  . GLU B 2 155 ? 76.407  89.820  145.322 1.00 10.00 ? 155 GLU B CA  1 
ATOM 4234  C C   . GLU B 2 155 ? 77.424  88.851  144.731 1.00 10.00 ? 155 GLU B C   1 
ATOM 4235  O O   . GLU B 2 155 ? 77.397  87.649  145.021 1.00 10.00 ? 155 GLU B O   1 
ATOM 4236  C CB  . GLU B 2 155 ? 75.330  89.061  146.099 1.00 10.00 ? 155 GLU B CB  1 
ATOM 4237  C CG  . GLU B 2 155 ? 74.483  89.940  147.003 1.00 10.00 ? 155 GLU B CG  1 
ATOM 4238  C CD  . GLU B 2 155 ? 73.281  89.208  147.568 1.00 10.00 ? 155 GLU B CD  1 
ATOM 4239  O OE1 . GLU B 2 155 ? 73.469  88.118  148.149 1.00 10.00 ? 155 GLU B OE1 1 
ATOM 4240  O OE2 . GLU B 2 155 ? 72.152  89.724  147.432 1.00 10.00 ? 155 GLU B OE2 1 
ATOM 4241  N N   . VAL B 2 156 ? 78.319  89.390  143.902 1.00 10.00 ? 156 VAL B N   1 
ATOM 4242  C CA  . VAL B 2 156 ? 79.426  88.690  143.236 1.00 10.00 ? 156 VAL B CA  1 
ATOM 4243  C C   . VAL B 2 156 ? 79.906  89.472  142.029 1.00 10.00 ? 156 VAL B C   1 
ATOM 4244  O O   . VAL B 2 156 ? 79.132  90.168  141.382 1.00 10.00 ? 156 VAL B O   1 
ATOM 4245  C CB  . VAL B 2 156 ? 79.062  87.330  142.674 1.00 10.00 ? 156 VAL B CB  1 
ATOM 4246  C CG1 . VAL B 2 156 ? 77.853  87.459  141.791 1.00 10.00 ? 156 VAL B CG1 1 
ATOM 4247  C CG2 . VAL B 2 156 ? 80.229  86.812  141.848 1.00 10.00 ? 156 VAL B CG2 1 
ATOM 4248  N N   . ILE B 2 157 ? 81.184  89.320  141.709 1.00 10.00 ? 157 ILE B N   1 
ATOM 4249  C CA  . ILE B 2 157 ? 81.753  89.997  140.555 1.00 10.00 ? 157 ILE B CA  1 
ATOM 4250  C C   . ILE B 2 157 ? 82.299  88.897  139.639 1.00 10.00 ? 157 ILE B C   1 
ATOM 4251  O O   . ILE B 2 157 ? 82.870  87.912  140.125 1.00 10.00 ? 157 ILE B O   1 
ATOM 4252  C CB  . ILE B 2 157 ? 82.902  90.955  141.000 1.00 10.00 ? 157 ILE B CB  1 
ATOM 4253  C CG1 . ILE B 2 157 ? 82.339  92.097  141.866 1.00 10.00 ? 157 ILE B CG1 1 
ATOM 4254  C CG2 . ILE B 2 157 ? 83.660  91.488  139.785 1.00 10.00 ? 157 ILE B CG2 1 
ATOM 4255  C CD1 . ILE B 2 157 ? 83.459  93.009  142.478 1.00 10.00 ? 157 ILE B CD1 1 
ATOM 4256  N N   . LEU B 2 158 ? 82.088  89.003  138.328 1.00 10.00 ? 158 LEU B N   1 
ATOM 4257  C CA  . LEU B 2 158 ? 82.666  87.970  137.473 1.00 10.00 ? 158 LEU B CA  1 
ATOM 4258  C C   . LEU B 2 158 ? 83.954  88.440  136.852 1.00 10.00 ? 158 LEU B C   1 
ATOM 4259  O O   . LEU B 2 158 ? 84.121  89.620  136.539 1.00 10.00 ? 158 LEU B O   1 
ATOM 4260  C CB  . LEU B 2 158 ? 81.707  87.461  136.381 1.00 10.00 ? 158 LEU B CB  1 
ATOM 4261  C CG  . LEU B 2 158 ? 81.293  85.988  136.661 1.00 10.00 ? 158 LEU B CG  1 
ATOM 4262  C CD1 . LEU B 2 158 ? 80.947  85.241  135.367 1.00 10.00 ? 158 LEU B CD1 1 
ATOM 4263  C CD2 . LEU B 2 158 ? 82.443  85.268  137.394 1.00 10.00 ? 158 LEU B CD2 1 
ATOM 4264  N N   . GLN B 2 159 ? 84.877  87.501  136.730 1.00 10.00 ? 159 GLN B N   1 
ATOM 4265  C CA  . GLN B 2 159 ? 86.173  87.788  136.161 1.00 10.00 ? 159 GLN B CA  1 
ATOM 4266  C C   . GLN B 2 159 ? 86.692  86.563  135.407 1.00 10.00 ? 159 GLN B C   1 
ATOM 4267  O O   . GLN B 2 159 ? 86.498  85.426  135.832 1.00 10.00 ? 159 GLN B O   1 
ATOM 4268  C CB  . GLN B 2 159 ? 87.176  88.177  137.257 1.00 10.00 ? 159 GLN B CB  1 
ATOM 4269  C CG  . GLN B 2 159 ? 87.729  87.002  138.064 1.00 10.00 ? 159 GLN B CG  1 
ATOM 4270  C CD  . GLN B 2 159 ? 89.255  86.970  138.088 1.00 10.00 ? 159 GLN B CD  1 
ATOM 4271  O OE1 . GLN B 2 159 ? 89.905  87.919  138.530 1.00 10.00 ? 159 GLN B OE1 1 
ATOM 4272  N NE2 . GLN B 2 159 ? 89.829  85.873  137.613 1.00 10.00 ? 159 GLN B NE2 1 
ATOM 4273  N N   . HIS B 2 160 ? 87.400  87.061  134.239 1.00 10.00 ? 160 HIS B N   1 
ATOM 4274  C CA  . HIS B 2 160 ? 87.922  86.228  133.149 1.00 10.00 ? 160 HIS B CA  1 
ATOM 4275  C C   . HIS B 2 160 ? 89.423  85.914  133.251 1.00 10.00 ? 160 HIS B C   1 
ATOM 4276  O O   . HIS B 2 160 ? 90.133  86.397  134.142 1.00 10.00 ? 160 HIS B O   1 
ATOM 4277  C CB  . HIS B 2 160 ? 87.685  86.917  131.795 1.00 10.00 ? 160 HIS B CB  1 
ATOM 4278  C CG  . HIS B 2 160 ? 86.310  86.723  131.238 1.00 10.00 ? 160 HIS B CG  1 
ATOM 4279  N ND1 . HIS B 2 160 ? 85.213  86.462  132.031 1.00 10.00 ? 160 HIS B ND1 1 
ATOM 4280  C CD2 . HIS B 2 160 ? 85.847  86.802  129.967 1.00 10.00 ? 160 HIS B CD2 1 
ATOM 4281  C CE1 . HIS B 2 160 ? 84.134  86.392  131.273 1.00 10.00 ? 160 HIS B CE1 1 
ATOM 4282  N NE2 . HIS B 2 160 ? 84.491  86.597  130.018 1.00 10.00 ? 160 HIS B NE2 1 
ATOM 4283  N N   . ALA B 2 161 ? 89.879  85.097  132.304 1.00 10.00 ? 161 ALA B N   1 
ATOM 4284  C CA  . ALA B 2 161 ? 91.265  84.681  132.166 1.00 10.00 ? 161 ALA B CA  1 
ATOM 4285  C C   . ALA B 2 161 ? 91.766  85.428  130.916 1.00 10.00 ? 161 ALA B C   1 
ATOM 4286  O O   . ALA B 2 161 ? 91.784  86.665  130.903 1.00 10.00 ? 161 ALA B O   1 
ATOM 4287  C CB  . ALA B 2 161 ? 91.329  83.157  131.971 1.00 10.00 ? 161 ALA B CB  1 
ATOM 4288  N N   . LEU B 2 162 ? 92.154  84.708  129.865 1.00 10.00 ? 162 LEU B N   1 
ATOM 4289  C CA  . LEU B 2 162 ? 92.615  85.397  128.641 1.00 10.00 ? 162 LEU B CA  1 
ATOM 4290  C C   . LEU B 2 162 ? 91.451  85.786  127.744 1.00 10.00 ? 162 LEU B C   1 
ATOM 4291  O O   . LEU B 2 162 ? 90.309  85.331  127.921 1.00 10.00 ? 162 LEU B O   1 
ATOM 4292  C CB  . LEU B 2 162 ? 93.583  84.550  127.803 1.00 10.00 ? 162 LEU B CB  1 
ATOM 4293  C CG  . LEU B 2 162 ? 94.896  84.164  128.476 1.00 10.00 ? 162 LEU B CG  1 
ATOM 4294  C CD1 . LEU B 2 162 ? 95.900  83.685  127.405 1.00 10.00 ? 162 LEU B CD1 1 
ATOM 4295  C CD2 . LEU B 2 162 ? 95.426  85.372  129.276 1.00 10.00 ? 162 LEU B CD2 1 
ATOM 4296  N N   . ASP B 2 163 ? 91.781  86.573  126.727 1.00 10.00 ? 163 ASP B N   1 
ATOM 4297  C CA  . ASP B 2 163 ? 90.796  87.088  125.781 1.00 10.00 ? 163 ASP B CA  1 
ATOM 4298  C C   . ASP B 2 163 ? 91.208  86.923  124.309 1.00 10.00 ? 163 ASP B C   1 
ATOM 4299  O O   . ASP B 2 163 ? 90.438  87.279  123.411 1.00 10.00 ? 163 ASP B O   1 
ATOM 4300  C CB  . ASP B 2 163 ? 90.487  88.580  126.080 1.00 10.00 ? 163 ASP B CB  1 
ATOM 4301  C CG  . ASP B 2 163 ? 91.765  89.440  126.352 1.00 10.00 ? 163 ASP B CG  1 
ATOM 4302  O OD1 . ASP B 2 163 ? 92.815  89.221  125.699 1.00 10.00 ? 163 ASP B OD1 1 
ATOM 4303  O OD2 . ASP B 2 163 ? 91.711  90.358  127.209 1.00 10.00 ? 163 ASP B OD2 1 
ATOM 4304  N N   . ALA B 2 164 ? 92.406  86.375  124.061 1.00 10.00 ? 164 ALA B N   1 
ATOM 4305  C CA  . ALA B 2 164 ? 92.908  86.185  122.690 1.00 10.00 ? 164 ALA B CA  1 
ATOM 4306  C C   . ALA B 2 164 ? 92.449  84.869  122.054 1.00 10.00 ? 164 ALA B C   1 
ATOM 4307  O O   . ALA B 2 164 ? 91.620  84.870  121.131 1.00 10.00 ? 164 ALA B O   1 
ATOM 4308  C CB  . ALA B 2 164 ? 94.441  86.274  122.661 1.00 10.00 ? 164 ALA B CB  1 
ATOM 4309  N N   . MET B 2 165 ? 91.328  83.539  126.371 1.00 10.00 ? 174 MET B N   1 
ATOM 4310  C CA  . MET B 2 165 ? 91.851  82.400  125.643 1.00 10.00 ? 174 MET B CA  1 
ATOM 4311  C C   . MET B 2 165 ? 91.161  82.328  124.281 1.00 10.00 ? 174 MET B C   1 
ATOM 4312  O O   . MET B 2 165 ? 90.075  82.909  124.073 1.00 10.00 ? 174 MET B O   1 
ATOM 4313  C CB  . MET B 2 165 ? 91.612  81.111  126.439 1.00 10.00 ? 174 MET B CB  1 
ATOM 4314  C CG  . MET B 2 165 ? 90.170  80.888  126.863 1.00 10.00 ? 174 MET B CG  1 
ATOM 4315  S SD  . MET B 2 165 ? 89.923  79.273  127.619 1.00 10.00 ? 174 MET B SD  1 
ATOM 4316  C CE  . MET B 2 165 ? 89.581  79.686  129.315 1.00 10.00 ? 174 MET B CE  1 
ATOM 4317  N N   . ILE B 2 166 ? 91.777  81.608  123.348 1.00 10.00 ? 175 ILE B N   1 
ATOM 4318  C CA  . ILE B 2 166 ? 91.216  81.484  121.999 1.00 10.00 ? 175 ILE B CA  1 
ATOM 4319  C C   . ILE B 2 166 ? 90.105  80.439  121.937 1.00 10.00 ? 175 ILE B C   1 
ATOM 4320  O O   . ILE B 2 166 ? 89.929  79.637  122.862 1.00 10.00 ? 175 ILE B O   1 
ATOM 4321  C CB  . ILE B 2 166 ? 92.299  81.114  120.958 1.00 10.00 ? 175 ILE B CB  1 
ATOM 4322  C CG1 . ILE B 2 166 ? 91.754  81.348  119.537 1.00 10.00 ? 175 ILE B CG1 1 
ATOM 4323  C CG2 . ILE B 2 166 ? 92.717  79.659  121.142 1.00 10.00 ? 175 ILE B CG2 1 
ATOM 4324  C CD1 . ILE B 2 166 ? 92.836  81.479  118.449 1.00 10.00 ? 175 ILE B CD1 1 
ATOM 4325  N N   . ASN B 2 167 ? 89.336  80.467  120.856 1.00 10.00 ? 176 ASN B N   1 
ATOM 4326  C CA  . ASN B 2 167 ? 88.263  79.494  120.707 1.00 10.00 ? 176 ASN B CA  1 
ATOM 4327  C C   . ASN B 2 167 ? 88.773  78.335  119.862 1.00 10.00 ? 176 ASN B C   1 
ATOM 4328  O O   . ASN B 2 167 ? 88.116  77.293  119.766 1.00 10.00 ? 176 ASN B O   1 
ATOM 4329  C CB  . ASN B 2 167 ? 87.018  80.085  120.033 1.00 10.00 ? 176 ASN B CB  1 
ATOM 4330  C CG  . ASN B 2 167 ? 85.946  79.018  119.745 1.00 10.00 ? 176 ASN B CG  1 
ATOM 4331  O OD1 . ASN B 2 167 ? 85.401  78.407  120.667 1.00 10.00 ? 176 ASN B OD1 1 
ATOM 4332  N ND2 . ASN B 2 167 ? 85.657  78.788  118.465 1.00 10.00 ? 176 ASN B ND2 1 
ATOM 4333  N N   . GLN B 2 168 ? 89.920  78.536  119.219 1.00 10.00 ? 177 GLN B N   1 
ATOM 4334  C CA  . GLN B 2 168 ? 90.523  77.475  118.430 1.00 10.00 ? 177 GLN B CA  1 
ATOM 4335  C C   . GLN B 2 168 ? 91.345  76.673  119.442 1.00 10.00 ? 177 GLN B C   1 
ATOM 4336  O O   . GLN B 2 168 ? 92.074  75.739  119.096 1.00 10.00 ? 177 GLN B O   1 
ATOM 4337  C CB  . GLN B 2 168 ? 91.415  78.045  117.319 1.00 10.00 ? 177 GLN B CB  1 
ATOM 4338  C CG  . GLN B 2 168 ? 91.995  76.974  116.395 1.00 10.00 ? 177 GLN B CG  1 
ATOM 4339  C CD  . GLN B 2 168 ? 92.400  77.516  115.038 1.00 10.00 ? 177 GLN B CD  1 
ATOM 4340  O OE1 . GLN B 2 168 ? 93.194  78.451  114.940 1.00 10.00 ? 177 GLN B OE1 1 
ATOM 4341  N NE2 . GLN B 2 168 ? 91.856  76.926  113.982 1.00 10.00 ? 177 GLN B NE2 1 
ATOM 4342  N N   . ASP B 2 169 ? 91.201  77.053  120.710 1.00 10.00 ? 178 ASP B N   1 
ATOM 4343  C CA  . ASP B 2 169 ? 91.888  76.381  121.804 1.00 10.00 ? 178 ASP B CA  1 
ATOM 4344  C C   . ASP B 2 169 ? 91.329  74.967  121.846 1.00 10.00 ? 178 ASP B C   1 
ATOM 4345  O O   . ASP B 2 169 ? 92.015  74.017  122.218 1.00 10.00 ? 178 ASP B O   1 
ATOM 4346  C CB  . ASP B 2 169 ? 91.609  77.121  123.119 1.00 10.00 ? 178 ASP B CB  1 
ATOM 4347  C CG  . ASP B 2 169 ? 92.122  76.372  124.346 1.00 10.00 ? 178 ASP B CG  1 
ATOM 4348  O OD1 . ASP B 2 169 ? 91.313  75.603  124.919 1.00 10.00 ? 178 ASP B OD1 1 
ATOM 4349  O OD2 . ASP B 2 169 ? 93.308  76.551  124.731 1.00 10.00 ? 178 ASP B OD2 1 
ATOM 4350  N N   . ALA B 2 170 ? 90.071  74.845  121.433 1.00 10.00 ? 179 ALA B N   1 
ATOM 4351  C CA  . ALA B 2 170 ? 89.379  73.569  121.398 1.00 10.00 ? 179 ALA B CA  1 
ATOM 4352  C C   . ALA B 2 170 ? 88.427  73.512  120.212 1.00 10.00 ? 179 ALA B C   1 
ATOM 4353  O O   . ALA B 2 170 ? 87.336  72.929  120.294 1.00 10.00 ? 179 ALA B O   1 
ATOM 4354  C CB  . ALA B 2 170 ? 88.625  73.360  122.671 1.00 10.00 ? 179 ALA B CB  1 
ATOM 4355  N N   . PHE B 2 171 ? 88.853  74.164  119.129 1.00 10.00 ? 180 PHE B N   1 
ATOM 4356  C CA  . PHE B 2 171 ? 88.133  74.210  117.850 1.00 10.00 ? 180 PHE B CA  1 
ATOM 4357  C C   . PHE B 2 171 ? 87.965  72.781  117.392 1.00 10.00 ? 180 PHE B C   1 
ATOM 4358  O O   . PHE B 2 171 ? 88.895  72.000  117.554 1.00 10.00 ? 180 PHE B O   1 
ATOM 4359  C CB  . PHE B 2 171 ? 88.964  74.965  116.801 1.00 10.00 ? 180 PHE B CB  1 
ATOM 4360  C CG  . PHE B 2 171 ? 88.725  74.513  115.369 1.00 10.00 ? 180 PHE B CG  1 
ATOM 4361  C CD1 . PHE B 2 171 ? 87.454  74.562  114.798 1.00 10.00 ? 180 PHE B CD1 1 
ATOM 4362  C CD2 . PHE B 2 171 ? 89.797  74.079  114.573 1.00 10.00 ? 180 PHE B CD2 1 
ATOM 4363  C CE1 . PHE B 2 171 ? 87.270  74.192  113.465 1.00 10.00 ? 180 PHE B CE1 1 
ATOM 4364  C CE2 . PHE B 2 171 ? 89.617  73.706  113.227 1.00 10.00 ? 180 PHE B CE2 1 
ATOM 4365  C CZ  . PHE B 2 171 ? 88.358  73.764  112.679 1.00 10.00 ? 180 PHE B CZ  1 
ATOM 4366  N N   . THR B 2 172 ? 86.795  72.433  116.849 1.00 10.00 ? 181 THR B N   1 
ATOM 4367  C CA  . THR B 2 172 ? 86.595  71.066  116.354 1.00 10.00 ? 181 THR B CA  1 
ATOM 4368  C C   . THR B 2 172 ? 87.337  70.834  115.054 1.00 10.00 ? 181 THR B C   1 
ATOM 4369  O O   . THR B 2 172 ? 87.185  71.587  114.102 1.00 10.00 ? 181 THR B O   1 
ATOM 4370  C CB  . THR B 2 172 ? 85.100  70.685  116.093 1.00 10.00 ? 181 THR B CB  1 
ATOM 4371  O OG1 . THR B 2 172 ? 84.862  69.362  116.612 1.00 10.00 ? 181 THR B OG1 1 
ATOM 4372  C CG2 . THR B 2 172 ? 84.777  70.646  114.586 1.00 10.00 ? 181 THR B CG2 1 
ATOM 4373  N N   . GLU B 2 173 ? 88.156  69.790  115.051 1.00 10.00 ? 182 GLU B N   1 
ATOM 4374  C CA  . GLU B 2 173 ? 88.936  69.370  113.894 1.00 10.00 ? 182 GLU B CA  1 
ATOM 4375  C C   . GLU B 2 173 ? 87.959  68.830  112.852 1.00 10.00 ? 182 GLU B C   1 
ATOM 4376  O O   . GLU B 2 173 ? 88.297  68.670  111.675 1.00 10.00 ? 182 GLU B O   1 
ATOM 4377  C CB  . GLU B 2 173 ? 89.898  68.250  114.303 1.00 10.00 ? 182 GLU B CB  1 
ATOM 4378  C CG  . GLU B 2 173 ? 90.139  68.142  115.814 1.00 10.00 ? 182 GLU B CG  1 
ATOM 4379  C CD  . GLU B 2 173 ? 88.963  67.536  116.581 1.00 10.00 ? 182 GLU B CD  1 
ATOM 4380  O OE1 . GLU B 2 173 ? 87.870  67.395  115.996 1.00 10.00 ? 182 GLU B OE1 1 
ATOM 4381  O OE2 . GLU B 2 173 ? 89.133  67.205  117.775 1.00 10.00 ? 182 GLU B OE2 1 
ATOM 4382  N N   . ASN B 2 174 ? 86.741  68.563  113.313 1.00 10.00 ? 183 ASN B N   1 
ATOM 4383  C CA  . ASN B 2 174 ? 85.662  68.011  112.491 1.00 10.00 ? 183 ASN B CA  1 
ATOM 4384  C C   . ASN B 2 174 ? 84.909  69.113  111.784 1.00 10.00 ? 183 ASN B C   1 
ATOM 4385  O O   . ASN B 2 174 ? 83.988  68.849  111.014 1.00 10.00 ? 183 ASN B O   1 
ATOM 4386  C CB  . ASN B 2 174 ? 84.667  67.241  113.365 1.00 10.00 ? 183 ASN B CB  1 
ATOM 4387  C CG  . ASN B 2 174 ? 83.491  66.690  112.571 1.00 10.00 ? 183 ASN B CG  1 
ATOM 4388  O OD1 . ASN B 2 174 ? 83.660  65.823  111.716 1.00 10.00 ? 183 ASN B OD1 1 
ATOM 4389  N ND2 . ASN B 2 174 ? 82.296  67.200  112.848 1.00 10.00 ? 183 ASN B ND2 1 
ATOM 4390  N N   . GLY B 2 175 ? 85.311  70.345  112.056 1.00 10.00 ? 184 GLY B N   1 
ATOM 4391  C CA  . GLY B 2 175 ? 84.652  71.490  111.470 1.00 10.00 ? 184 GLY B CA  1 
ATOM 4392  C C   . GLY B 2 175 ? 85.026  71.788  110.038 1.00 10.00 ? 184 GLY B C   1 
ATOM 4393  O O   . GLY B 2 175 ? 86.201  71.864  109.685 1.00 10.00 ? 184 GLY B O   1 
ATOM 4394  N N   . GLN B 2 176 ? 83.999  71.840  109.153 1.00 10.00 ? 185 GLN B N   1 
ATOM 4395  C CA  . GLN B 2 176 ? 84.194  72.226  107.762 1.00 10.00 ? 185 GLN B CA  1 
ATOM 4396  C C   . GLN B 2 176 ? 84.643  73.677  107.649 1.00 10.00 ? 185 GLN B C   1 
ATOM 4397  O O   . GLN B 2 176 ? 84.716  74.260  106.571 1.00 10.00 ? 185 GLN B O   1 
ATOM 4398  C CB  . GLN B 2 176 ? 82.911  71.998  106.960 1.00 10.00 ? 185 GLN B CB  1 
ATOM 4399  C CG  . GLN B 2 176 ? 82.446  70.551  106.934 1.00 10.00 ? 185 GLN B CG  1 
ATOM 4400  C CD  . GLN B 2 176 ? 81.174  70.362  106.131 1.00 10.00 ? 185 GLN B CD  1 
ATOM 4401  O OE1 . GLN B 2 176 ? 80.623  71.319  105.589 1.00 10.00 ? 185 GLN B OE1 1 
ATOM 4402  N NE2 . GLN B 2 176 ? 80.536  69.215  105.925 1.00 10.00 ? 185 GLN B NE2 1 
ATOM 4403  N N   . TRP B 2 177 ? 84.982  74.308  108.832 1.00 10.00 ? 186 TRP B N   1 
ATOM 4404  C CA  . TRP B 2 177 ? 85.362  75.703  108.896 1.00 10.00 ? 186 TRP B CA  1 
ATOM 4405  C C   . TRP B 2 177 ? 86.767  75.841  109.407 1.00 10.00 ? 186 TRP B C   1 
ATOM 4406  O O   . TRP B 2 177 ? 87.621  74.982  109.288 1.00 10.00 ? 186 TRP B O   1 
ATOM 4407  C CB  . TRP B 2 177 ? 84.421  76.523  109.789 1.00 10.00 ? 186 TRP B CB  1 
ATOM 4408  C CG  . TRP B 2 177 ? 84.083  75.905  111.116 1.00 10.00 ? 186 TRP B CG  1 
ATOM 4409  C CD1 . TRP B 2 177 ? 84.528  76.294  112.354 1.00 10.00 ? 186 TRP B CD1 1 
ATOM 4410  C CD2 . TRP B 2 177 ? 83.218  74.791  111.341 1.00 10.00 ? 186 TRP B CD2 1 
ATOM 4411  N NE1 . TRP B 2 177 ? 83.959  75.507  113.331 1.00 10.00 ? 186 TRP B NE1 1 
ATOM 4412  C CE2 . TRP B 2 177 ? 83.138  74.587  112.733 1.00 10.00 ? 186 TRP B CE2 1 
ATOM 4413  C CE3 . TRP B 2 177 ? 82.488  73.960  110.492 1.00 10.00 ? 186 TRP B CE3 1 
ATOM 4414  C CZ2 . TRP B 2 177 ? 82.325  73.604  113.294 1.00 10.00 ? 186 TRP B CZ2 1 
ATOM 4415  C CZ3 . TRP B 2 177 ? 81.696  72.975  111.048 1.00 10.00 ? 186 TRP B CZ3 1 
ATOM 4416  C CH2 . TRP B 2 177 ? 81.618  72.807  112.435 1.00 10.00 ? 186 TRP B CH2 1 
ATOM 4417  N N   . SER B 2 178 ? 87.042  77.026  110.042 1.00 10.00 ? 187 SER B N   1 
ATOM 4418  C CA  . SER B 2 178 ? 88.328  77.383  110.636 1.00 10.00 ? 187 SER B CA  1 
ATOM 4419  C C   . SER B 2 178 ? 88.092  78.690  111.439 1.00 10.00 ? 187 SER B C   1 
ATOM 4420  O O   . SER B 2 178 ? 87.062  79.345  111.268 1.00 10.00 ? 187 SER B O   1 
ATOM 4421  C CB  . SER B 2 178 ? 89.394  77.560  109.534 1.00 10.00 ? 187 SER B CB  1 
ATOM 4422  O OG  . SER B 2 178 ? 89.454  76.437  108.665 1.00 10.00 ? 187 SER B OG  1 
ATOM 4423  N N   . ILE B 2 179 ? 89.035  79.068  112.299 1.00 10.00 ? 188 ILE B N   1 
ATOM 4424  C CA  . ILE B 2 179 ? 88.901  80.246  113.150 1.00 10.00 ? 188 ILE B CA  1 
ATOM 4425  C C   . ILE B 2 179 ? 90.152  81.132  113.176 1.00 10.00 ? 188 ILE B C   1 
ATOM 4426  O O   . ILE B 2 179 ? 91.263  80.626  113.036 1.00 10.00 ? 188 ILE B O   1 
ATOM 4427  C CB  . ILE B 2 179 ? 88.557  79.751  114.572 1.00 10.00 ? 188 ILE B CB  1 
ATOM 4428  C CG1 . ILE B 2 179 ? 87.166  79.112  114.511 1.00 10.00 ? 188 ILE B CG1 1 
ATOM 4429  C CG2 . ILE B 2 179 ? 88.694  80.884  115.615 1.00 10.00 ? 188 ILE B CG2 1 
ATOM 4430  C CD1 . ILE B 2 179 ? 86.057  80.009  114.959 1.00 10.00 ? 188 ILE B CD1 1 
ATOM 4431  N N   . GLU B 2 180 ? 89.976  82.447  113.333 1.00 10.00 ? 189 GLU B N   1 
ATOM 4432  C CA  . GLU B 2 180 ? 91.132  83.347  113.403 1.00 10.00 ? 189 GLU B CA  1 
ATOM 4433  C C   . GLU B 2 180 ? 91.371  83.823  114.834 1.00 10.00 ? 189 GLU B C   1 
ATOM 4434  O O   . GLU B 2 180 ? 92.513  83.863  115.278 1.00 10.00 ? 189 GLU B O   1 
ATOM 4435  C CB  . GLU B 2 180 ? 90.954  84.559  112.490 1.00 10.00 ? 189 GLU B CB  1 
ATOM 4436  C CG  . GLU B 2 180 ? 92.269  85.261  112.130 1.00 10.00 ? 189 GLU B CG  1 
ATOM 4437  C CD  . GLU B 2 180 ? 92.986  85.860  113.323 1.00 10.00 ? 189 GLU B CD  1 
ATOM 4438  O OE1 . GLU B 2 180 ? 92.388  86.711  114.013 1.00 10.00 ? 189 GLU B OE1 1 
ATOM 4439  O OE2 . GLU B 2 180 ? 94.151  85.483  113.566 1.00 10.00 ? 189 GLU B OE2 1 
ATOM 4440  N N   . HIS B 2 181 ? 90.342  84.203  115.557 1.00 10.00 ? 190 HIS B N   1 
ATOM 4441  C CA  . HIS B 2 181 ? 90.445  84.615  116.928 1.00 10.00 ? 190 HIS B CA  1 
ATOM 4442  C C   . HIS B 2 181 ? 89.208  84.737  117.806 1.00 10.00 ? 190 HIS B C   1 
ATOM 4443  O O   . HIS B 2 181 ? 88.098  84.879  117.237 1.00 10.00 ? 190 HIS B O   1 
ATOM 4444  C CB  . HIS B 2 181 ? 91.120  85.945  117.125 1.00 10.00 ? 190 HIS B CB  1 
ATOM 4445  C CG  . HIS B 2 181 ? 92.617  85.709  116.996 1.00 10.00 ? 190 HIS B CG  1 
ATOM 4446  N ND1 . HIS B 2 181 ? 93.500  86.639  116.517 1.00 10.00 ? 190 HIS B ND1 1 
ATOM 4447  C CD2 . HIS B 2 181 ? 93.319  84.606  117.316 1.00 10.00 ? 190 HIS B CD2 1 
ATOM 4448  C CE1 . HIS B 2 181 ? 94.715  86.114  116.541 1.00 10.00 ? 190 HIS B CE1 1 
ATOM 4449  N NE2 . HIS B 2 181 ? 94.631  84.880  117.020 1.00 10.00 ? 190 HIS B NE2 1 
ATOM 4450  N N   . LYS B 2 182 ? 89.363  84.648  119.097 1.00 10.00 ? 191 LYS B N   1 
ATOM 4451  C CA  . LYS B 2 182 ? 88.267  84.717  120.063 1.00 10.00 ? 191 LYS B CA  1 
ATOM 4452  C C   . LYS B 2 182 ? 88.477  85.843  121.075 1.00 10.00 ? 191 LYS B C   1 
ATOM 4453  O O   . LYS B 2 182 ? 89.302  85.721  121.972 1.00 10.00 ? 191 LYS B O   1 
ATOM 4454  C CB  . LYS B 2 182 ? 88.134  83.379  120.823 1.00 10.00 ? 191 LYS B CB  1 
ATOM 4455  C CG  . LYS B 2 182 ? 87.134  83.390  122.041 1.00 10.00 ? 191 LYS B CG  1 
ATOM 4456  C CD  . LYS B 2 182 ? 85.629  83.473  121.668 1.00 10.00 ? 191 LYS B CD  1 
ATOM 4457  C CE  . LYS B 2 182 ? 84.713  83.025  122.802 1.00 10.00 ? 191 LYS B CE  1 
ATOM 4458  N NZ  . LYS B 2 182 ? 84.862  81.608  123.222 1.00 10.00 ? 191 LYS B NZ  1 
ATOM 4459  N N   . PRO B 2 183 ? 87.765  86.969  120.919 1.00 10.00 ? 192 PRO B N   1 
ATOM 4460  C CA  . PRO B 2 183 ? 87.904  88.090  121.864 1.00 10.00 ? 192 PRO B CA  1 
ATOM 4461  C C   . PRO B 2 183 ? 87.007  87.857  123.087 1.00 10.00 ? 192 PRO B C   1 
ATOM 4462  O O   . PRO B 2 183 ? 85.917  87.290  122.960 1.00 10.00 ? 192 PRO B O   1 
ATOM 4463  C CB  . PRO B 2 183 ? 87.418  89.299  121.059 1.00 10.00 ? 192 PRO B CB  1 
ATOM 4464  C CG  . PRO B 2 183 ? 87.660  88.917  119.663 1.00 10.00 ? 192 PRO B CG  1 
ATOM 4465  C CD  . PRO B 2 183 ? 87.274  87.456  119.617 1.00 10.00 ? 192 PRO B CD  1 
ATOM 4466  N N   . SER B 2 184 ? 87.460  88.275  124.268 1.00 10.00 ? 193 SER B N   1 
ATOM 4467  C CA  . SER B 2 184 ? 86.650  88.123  125.462 1.00 10.00 ? 193 SER B CA  1 
ATOM 4468  C C   . SER B 2 184 ? 86.558  89.408  126.257 1.00 10.00 ? 193 SER B C   1 
ATOM 4469  O O   . SER B 2 184 ? 87.508  89.798  126.931 1.00 10.00 ? 193 SER B O   1 
ATOM 4470  C CB  . SER B 2 184 ? 87.197  86.999  126.354 1.00 10.00 ? 193 SER B CB  1 
ATOM 4471  O OG  . SER B 2 184 ? 88.324  87.418  127.099 1.00 10.00 ? 193 SER B OG  1 
ATOM 4472  N N   . ARG B 2 185 ? 85.378  90.016  126.236 1.00 10.00 ? 194 ARG B N   1 
ATOM 4473  C CA  . ARG B 2 185 ? 85.167  91.263  126.948 1.00 10.00 ? 194 ARG B CA  1 
ATOM 4474  C C   . ARG B 2 185 ? 83.985  91.223  127.943 1.00 10.00 ? 194 ARG B C   1 
ATOM 4475  O O   . ARG B 2 185 ? 82.865  90.850  127.598 1.00 10.00 ? 194 ARG B O   1 
ATOM 4476  C CB  . ARG B 2 185 ? 85.051  92.410  125.914 1.00 10.00 ? 194 ARG B CB  1 
ATOM 4477  C CG  . ARG B 2 185 ? 86.441  93.050  125.585 1.00 10.00 ? 194 ARG B CG  1 
ATOM 4478  C CD  . ARG B 2 185 ? 86.775  93.317  124.084 1.00 10.00 ? 194 ARG B CD  1 
ATOM 4479  N NE  . ARG B 2 185 ? 88.231  93.452  123.911 1.00 10.00 ? 194 ARG B NE  1 
ATOM 4480  C CZ  . ARG B 2 185 ? 88.886  93.378  122.753 1.00 10.00 ? 194 ARG B CZ  1 
ATOM 4481  N NH1 . ARG B 2 185 ? 88.231  93.175  121.622 1.00 10.00 ? 194 ARG B NH1 1 
ATOM 4482  N NH2 . ARG B 2 185 ? 90.208  93.480  122.731 1.00 10.00 ? 194 ARG B NH2 1 
ATOM 4483  N N   . LYS B 2 186 ? 84.297  91.567  129.193 1.00 10.00 ? 195 LYS B N   1 
ATOM 4484  C CA  . LYS B 2 186 ? 83.388  91.626  130.343 1.00 10.00 ? 195 LYS B CA  1 
ATOM 4485  C C   . LYS B 2 186 ? 82.335  92.736  130.219 1.00 10.00 ? 195 LYS B C   1 
ATOM 4486  O O   . LYS B 2 186 ? 82.709  93.887  130.048 1.00 10.00 ? 195 LYS B O   1 
ATOM 4487  C CB  . LYS B 2 186 ? 84.260  91.876  131.567 1.00 10.00 ? 195 LYS B CB  1 
ATOM 4488  C CG  . LYS B 2 186 ? 85.687  91.312  131.357 1.00 10.00 ? 195 LYS B CG  1 
ATOM 4489  C CD  . LYS B 2 186 ? 86.392  90.887  132.665 1.00 10.00 ? 195 LYS B CD  1 
ATOM 4490  C CE  . LYS B 2 186 ? 87.311  89.670  132.457 1.00 10.00 ? 195 LYS B CE  1 
ATOM 4491  N NZ  . LYS B 2 186 ? 88.083  89.374  133.683 1.00 10.00 ? 195 LYS B NZ  1 
ATOM 4492  N N   . ASN B 2 187 ? 81.040  92.420  130.346 1.00 10.00 ? 196 ASN B N   1 
ATOM 4493  C CA  . ASN B 2 187 ? 80.009  93.464  130.199 1.00 10.00 ? 196 ASN B CA  1 
ATOM 4494  C C   . ASN B 2 187 ? 78.909  93.594  131.242 1.00 10.00 ? 196 ASN B C   1 
ATOM 4495  O O   . ASN B 2 187 ? 78.511  92.623  131.906 1.00 10.00 ? 196 ASN B O   1 
ATOM 4496  C CB  . ASN B 2 187 ? 79.316  93.351  128.843 1.00 10.00 ? 196 ASN B CB  1 
ATOM 4497  C CG  . ASN B 2 187 ? 77.804  93.087  128.965 1.00 10.00 ? 196 ASN B CG  1 
ATOM 4498  O OD1 . ASN B 2 187 ? 77.050  93.868  129.556 1.00 10.00 ? 196 ASN B OD1 1 
ATOM 4499  N ND2 . ASN B 2 187 ? 77.364  91.977  128.384 1.00 10.00 ? 196 ASN B ND2 1 
ATOM 4500  N N   . TRP B 2 188 ? 78.378  94.812  131.334 1.00 10.00 ? 197 TRP B N   1 
ATOM 4501  C CA  . TRP B 2 188 ? 77.319  95.218  132.209 1.00 10.00 ? 197 TRP B CA  1 
ATOM 4502  C C   . TRP B 2 188 ? 76.401  96.248  131.646 1.00 10.00 ? 197 TRP B C   1 
ATOM 4503  O O   . TRP B 2 188 ? 76.341  97.414  132.091 1.00 10.00 ? 197 TRP B O   1 
ATOM 4504  C CB  . TRP B 2 188 ? 77.808  95.580  133.581 1.00 10.00 ? 197 TRP B CB  1 
ATOM 4505  C CG  . TRP B 2 188 ? 78.791  94.553  133.961 1.00 10.00 ? 197 TRP B CG  1 
ATOM 4506  C CD1 . TRP B 2 188 ? 78.525  93.304  134.426 1.00 10.00 ? 197 TRP B CD1 1 
ATOM 4507  C CD2 . TRP B 2 188 ? 80.202  94.678  133.869 1.00 10.00 ? 197 TRP B CD2 1 
ATOM 4508  N NE1 . TRP B 2 188 ? 79.697  92.615  134.588 1.00 10.00 ? 197 TRP B NE1 1 
ATOM 4509  C CE2 . TRP B 2 188 ? 80.742  93.432  134.232 1.00 10.00 ? 197 TRP B CE2 1 
ATOM 4510  C CE3 . TRP B 2 188 ? 81.065  95.712  133.500 1.00 10.00 ? 197 TRP B CE3 1 
ATOM 4511  C CZ2 . TRP B 2 188 ? 82.107  93.175  134.186 1.00 10.00 ? 197 TRP B CZ2 1 
ATOM 4512  C CZ3 . TRP B 2 188 ? 82.423  95.464  133.486 1.00 10.00 ? 197 TRP B CZ3 1 
ATOM 4513  C CH2 . TRP B 2 188 ? 82.931  94.204  133.821 1.00 10.00 ? 197 TRP B CH2 1 
ATOM 4514  N N   . ARG B 2 189 ? 75.658  95.871  130.570 1.00 10.00 ? 198 ARG B N   1 
ATOM 4515  C CA  . ARG B 2 189 ? 74.684  96.767  129.966 1.00 10.00 ? 198 ARG B CA  1 
ATOM 4516  C C   . ARG B 2 189 ? 73.867  97.499  131.021 1.00 10.00 ? 198 ARG B C   1 
ATOM 4517  O O   . ARG B 2 189 ? 73.426  96.865  132.000 1.00 10.00 ? 198 ARG B O   1 
ATOM 4518  C CB  . ARG B 2 189 ? 73.743  95.999  129.040 1.00 10.00 ? 198 ARG B CB  1 
ATOM 4519  C CG  . ARG B 2 189 ? 74.090  96.102  127.566 1.00 10.00 ? 198 ARG B CG  1 
ATOM 4520  C CD  . ARG B 2 189 ? 73.171  95.227  126.732 1.00 10.00 ? 198 ARG B CD  1 
ATOM 4521  N NE  . ARG B 2 189 ? 73.084  95.681  125.350 1.00 10.00 ? 198 ARG B NE  1 
ATOM 4522  C CZ  . ARG B 2 189 ? 74.090  96.235  124.685 1.00 10.00 ? 198 ARG B CZ  1 
ATOM 4523  N NH1 . ARG B 2 189 ? 75.263  96.405  125.281 1.00 10.00 ? 198 ARG B NH1 1 
ATOM 4524  N NH2 . ARG B 2 189 ? 73.924  96.618  123.426 1.00 10.00 ? 198 ARG B NH2 1 
ATOM 4525  N N   . SER B 2 190 ? 73.682  98.795  130.884 1.00 10.00 ? 199 SER B N   1 
ATOM 4526  C CA  . SER B 2 190 ? 73.013  99.598  131.901 1.00 10.00 ? 199 SER B CA  1 
ATOM 4527  C C   . SER B 2 190 ? 71.511  99.663  131.650 1.00 10.00 ? 199 SER B C   1 
ATOM 4528  O O   . SER B 2 190 ? 70.784  100.475 132.282 1.00 10.00 ? 199 SER B O   1 
ATOM 4529  C CB  . SER B 2 190 ? 73.608  101.007 131.948 1.00 10.00 ? 199 SER B CB  1 
ATOM 4530  O OG  . SER B 2 190 ? 73.393  101.693 130.727 1.00 10.00 ? 199 SER B OG  1 
ATOM 4531  N N   . ASP B 2 191 ? 70.970  98.838  130.756 1.00 10.00 ? 200 ASP B N   1 
ATOM 4532  C CA  . ASP B 2 191 ? 69.554  98.797  130.492 1.00 10.00 ? 200 ASP B CA  1 
ATOM 4533  C C   . ASP B 2 191 ? 68.825  97.974  131.537 1.00 10.00 ? 200 ASP B C   1 
ATOM 4534  O O   . ASP B 2 191 ? 67.587  97.949  131.621 1.00 10.00 ? 200 ASP B O   1 
ATOM 4535  C CB  . ASP B 2 191 ? 69.275  98.233  129.102 1.00 10.00 ? 200 ASP B CB  1 
ATOM 4536  C CG  . ASP B 2 191 ? 67.820  98.383  128.706 1.00 10.00 ? 200 ASP B CG  1 
ATOM 4537  O OD1 . ASP B 2 191 ? 66.976  98.560  129.609 1.00 10.00 ? 200 ASP B OD1 1 
ATOM 4538  O OD2 . ASP B 2 191 ? 67.525  98.325  127.495 1.00 10.00 ? 200 ASP B OD2 1 
ATOM 4539  N N   . ASP B 2 192 ? 69.629  97.293  132.322 1.00 10.00 ? 201 ASP B N   1 
ATOM 4540  C CA  . ASP B 2 192 ? 69.229  96.487  133.448 1.00 10.00 ? 201 ASP B CA  1 
ATOM 4541  C C   . ASP B 2 192 ? 70.093  96.776  134.661 1.00 10.00 ? 201 ASP B C   1 
ATOM 4542  O O   . ASP B 2 192 ? 71.302  97.037  134.527 1.00 10.00 ? 201 ASP B O   1 
ATOM 4543  C CB  . ASP B 2 192 ? 69.295  95.002  133.107 1.00 10.00 ? 201 ASP B CB  1 
ATOM 4544  C CG  . ASP B 2 192 ? 68.167  94.219  133.747 1.00 10.00 ? 201 ASP B CG  1 
ATOM 4545  O OD1 . ASP B 2 192 ? 67.230  94.854  134.276 1.00 10.00 ? 201 ASP B OD1 1 
ATOM 4546  O OD2 . ASP B 2 192 ? 68.218  92.972  133.721 1.00 10.00 ? 201 ASP B OD2 1 
ATOM 4547  N N   . PRO B 2 193 ? 69.538  96.887  135.846 1.00 10.00 ? 202 PRO B N   1 
ATOM 4548  C CA  . PRO B 2 193 ? 70.316  97.193  137.055 1.00 10.00 ? 202 PRO B CA  1 
ATOM 4549  C C   . PRO B 2 193 ? 71.382  96.131  137.261 1.00 10.00 ? 202 PRO B C   1 
ATOM 4550  O O   . PRO B 2 193 ? 72.512  96.407  137.673 1.00 10.00 ? 202 PRO B O   1 
ATOM 4551  C CB  . PRO B 2 193 ? 69.260  97.163  138.166 1.00 10.00 ? 202 PRO B CB  1 
ATOM 4552  C CG  . PRO B 2 193 ? 68.331  96.088  137.689 1.00 10.00 ? 202 PRO B CG  1 
ATOM 4553  C CD  . PRO B 2 193 ? 68.190  96.414  136.197 1.00 10.00 ? 202 PRO B CD  1 
ATOM 4554  N N   . SER B 2 194 ? 71.007  94.905  136.929 1.00 10.00 ? 203 SER B N   1 
ATOM 4555  C CA  . SER B 2 194 ? 71.882  93.773  137.093 1.00 10.00 ? 203 SER B CA  1 
ATOM 4556  C C   . SER B 2 194 ? 73.111  93.754  136.195 1.00 10.00 ? 203 SER B C   1 
ATOM 4557  O O   . SER B 2 194 ? 73.000  93.574  134.986 1.00 10.00 ? 203 SER B O   1 
ATOM 4558  C CB  . SER B 2 194 ? 71.067  92.477  136.913 1.00 10.00 ? 203 SER B CB  1 
ATOM 4559  O OG  . SER B 2 194 ? 70.347  92.412  135.692 1.00 10.00 ? 203 SER B OG  1 
ATOM 4560  N N   . TYR B 2 195 ? 74.272  94.064  136.829 1.00 10.00 ? 204 TYR B N   1 
ATOM 4561  C CA  . TYR B 2 195 ? 75.450  93.823  136.005 1.00 10.00 ? 204 TYR B CA  1 
ATOM 4562  C C   . TYR B 2 195 ? 75.425  92.416  135.423 1.00 10.00 ? 204 TYR B C   1 
ATOM 4563  O O   . TYR B 2 195 ? 74.910  91.605  136.251 1.00 10.00 ? 204 TYR B O   1 
ATOM 4564  C CB  . TYR B 2 195 ? 76.728  94.057  136.814 1.00 10.00 ? 204 TYR B CB  1 
ATOM 4565  C CG  . TYR B 2 195 ? 76.869  95.468  137.344 1.00 10.00 ? 204 TYR B CG  1 
ATOM 4566  C CD1 . TYR B 2 195 ? 76.381  95.810  138.596 1.00 10.00 ? 204 TYR B CD1 1 
ATOM 4567  C CD2 . TYR B 2 195 ? 77.490  96.456  136.590 1.00 10.00 ? 204 TYR B CD2 1 
ATOM 4568  C CE1 . TYR B 2 195 ? 76.508  97.095  139.086 1.00 10.00 ? 204 TYR B CE1 1 
ATOM 4569  C CE2 . TYR B 2 195 ? 77.623  97.744  137.072 1.00 10.00 ? 204 TYR B CE2 1 
ATOM 4570  C CZ  . TYR B 2 195 ? 77.130  98.058  138.321 1.00 10.00 ? 204 TYR B CZ  1 
ATOM 4571  O OH  . TYR B 2 195 ? 77.260  99.341  138.804 1.00 10.00 ? 204 TYR B OH  1 
ATOM 4572  N N   . GLU B 2 196 ? 75.696  92.173  134.238 1.00 10.00 ? 205 GLU B N   1 
ATOM 4573  C CA  . GLU B 2 196 ? 75.482  90.813  133.763 1.00 10.00 ? 205 GLU B CA  1 
ATOM 4574  C C   . GLU B 2 196 ? 76.526  90.111  132.887 1.00 10.00 ? 205 GLU B C   1 
ATOM 4575  O O   . GLU B 2 196 ? 77.667  89.854  133.306 1.00 10.00 ? 205 GLU B O   1 
ATOM 4576  C CB  . GLU B 2 196 ? 74.109  90.743  133.074 1.00 10.00 ? 205 GLU B CB  1 
ATOM 4577  C CG  . GLU B 2 196 ? 72.921  90.838  134.028 1.00 10.00 ? 205 GLU B CG  1 
ATOM 4578  C CD  . GLU B 2 196 ? 72.489  89.501  134.589 1.00 10.00 ? 205 GLU B CD  1 
ATOM 4579  O OE1 . GLU B 2 196 ? 72.154  88.606  133.790 1.00 10.00 ? 205 GLU B OE1 1 
ATOM 4580  O OE2 . GLU B 2 196 ? 72.481  89.339  135.827 1.00 10.00 ? 205 GLU B OE2 1 
ATOM 4581  N N   . ASP B 2 197 ? 76.061  89.768  131.691 1.00 10.00 ? 206 ASP B N   1 
ATOM 4582  C CA  . ASP B 2 197 ? 76.773  89.054  130.637 1.00 10.00 ? 206 ASP B CA  1 
ATOM 4583  C C   . ASP B 2 197 ? 78.138  89.541  130.167 1.00 10.00 ? 206 ASP B C   1 
ATOM 4584  O O   . ASP B 2 197 ? 78.528  90.686  130.387 1.00 10.00 ? 206 ASP B O   1 
ATOM 4585  C CB  . ASP B 2 197 ? 75.838  88.879  129.409 1.00 10.00 ? 206 ASP B CB  1 
ATOM 4586  C CG  . ASP B 2 197 ? 75.069  90.154  129.035 1.00 10.00 ? 206 ASP B CG  1 
ATOM 4587  O OD1 . ASP B 2 197 ? 74.367  90.709  129.908 1.00 10.00 ? 206 ASP B OD1 1 
ATOM 4588  O OD2 . ASP B 2 197 ? 75.153  90.583  127.861 1.00 10.00 ? 206 ASP B OD2 1 
ATOM 4589  N N   . VAL B 2 198 ? 78.957  88.531  129.581 1.00 10.00 ? 207 VAL B N   1 
ATOM 4590  C CA  . VAL B 2 198 ? 80.252  88.767  128.978 1.00 10.00 ? 207 VAL B CA  1 
ATOM 4591  C C   . VAL B 2 198 ? 80.176  88.374  127.490 1.00 10.00 ? 207 VAL B C   1 
ATOM 4592  O O   . VAL B 2 198 ? 79.803  87.252  127.168 1.00 10.00 ? 207 VAL B O   1 
ATOM 4593  C CB  . VAL B 2 198 ? 81.330  87.940  129.767 1.00 10.00 ? 207 VAL B CB  1 
ATOM 4594  C CG1 . VAL B 2 198 ? 82.733  88.347  129.364 1.00 10.00 ? 207 VAL B CG1 1 
ATOM 4595  C CG2 . VAL B 2 198 ? 81.145  88.155  131.270 1.00 10.00 ? 207 VAL B CG2 1 
ATOM 4596  N N   . THR B 2 199 ? 80.521  89.320  126.611 1.00 10.00 ? 208 THR B N   1 
ATOM 4597  C CA  . THR B 2 199 ? 80.502  89.154  125.150 1.00 10.00 ? 208 THR B CA  1 
ATOM 4598  C C   . THR B 2 199 ? 81.727  88.417  124.645 1.00 10.00 ? 208 THR B C   1 
ATOM 4599  O O   . THR B 2 199 ? 82.846  88.864  124.872 1.00 10.00 ? 208 THR B O   1 
ATOM 4600  C CB  . THR B 2 199 ? 80.541  90.524  124.391 1.00 10.00 ? 208 THR B CB  1 
ATOM 4601  O OG1 . THR B 2 199 ? 79.647  91.463  125.012 1.00 10.00 ? 208 THR B OG1 1 
ATOM 4602  C CG2 . THR B 2 199 ? 80.159  90.331  122.899 1.00 10.00 ? 208 THR B CG2 1 
ATOM 4603  N N   . PHE B 2 200 ? 81.547  87.303  123.947 1.00 10.00 ? 209 PHE B N   1 
ATOM 4604  C CA  . PHE B 2 200 ? 82.755  86.642  123.412 1.00 10.00 ? 209 PHE B CA  1 
ATOM 4605  C C   . PHE B 2 200 ? 82.621  86.599  121.891 1.00 10.00 ? 209 PHE B C   1 
ATOM 4606  O O   . PHE B 2 200 ? 81.636  86.094  121.335 1.00 10.00 ? 209 PHE B O   1 
ATOM 4607  C CB  . PHE B 2 200 ? 82.966  85.237  124.002 1.00 10.00 ? 209 PHE B CB  1 
ATOM 4608  C CG  . PHE B 2 200 ? 82.867  85.190  125.489 1.00 10.00 ? 209 PHE B CG  1 
ATOM 4609  C CD1 . PHE B 2 200 ? 81.734  84.636  126.104 1.00 10.00 ? 209 PHE B CD1 1 
ATOM 4610  C CD2 . PHE B 2 200 ? 83.883  85.726  126.279 1.00 10.00 ? 209 PHE B CD2 1 
ATOM 4611  C CE1 . PHE B 2 200 ? 81.605  84.619  127.490 1.00 10.00 ? 209 PHE B CE1 1 
ATOM 4612  C CE2 . PHE B 2 200 ? 83.776  85.719  127.668 1.00 10.00 ? 209 PHE B CE2 1 
ATOM 4613  C CZ  . PHE B 2 200 ? 82.624  85.161  128.280 1.00 10.00 ? 209 PHE B CZ  1 
ATOM 4614  N N   . TYR B 2 201 ? 83.646  87.135  121.247 1.00 10.00 ? 210 TYR B N   1 
ATOM 4615  C CA  . TYR B 2 201 ? 83.722  87.274  119.795 1.00 10.00 ? 210 TYR B CA  1 
ATOM 4616  C C   . TYR B 2 201 ? 84.278  86.116  118.953 1.00 10.00 ? 210 TYR B C   1 
ATOM 4617  O O   . TYR B 2 201 ? 85.372  85.623  119.185 1.00 10.00 ? 210 TYR B O   1 
ATOM 4618  C CB  . TYR B 2 201 ? 84.529  88.533  119.447 1.00 10.00 ? 210 TYR B CB  1 
ATOM 4619  C CG  . TYR B 2 201 ? 83.736  89.801  119.365 1.00 10.00 ? 210 TYR B CG  1 
ATOM 4620  C CD1 . TYR B 2 201 ? 84.359  91.035  119.595 1.00 10.00 ? 210 TYR B CD1 1 
ATOM 4621  C CD2 . TYR B 2 201 ? 82.356  89.780  119.064 1.00 10.00 ? 210 TYR B CD2 1 
ATOM 4622  C CE1 . TYR B 2 201 ? 83.637  92.234  119.536 1.00 10.00 ? 210 TYR B CE1 1 
ATOM 4623  C CE2 . TYR B 2 201 ? 81.617  90.973  119.003 1.00 10.00 ? 210 TYR B CE2 1 
ATOM 4624  C CZ  . TYR B 2 201 ? 82.265  92.199  119.243 1.00 10.00 ? 210 TYR B CZ  1 
ATOM 4625  O OH  . TYR B 2 201 ? 81.550  93.375  119.213 1.00 10.00 ? 210 TYR B OH  1 
ATOM 4626  N N   . LEU B 2 202 ? 83.508  85.724  117.945 1.00 10.00 ? 211 LEU B N   1 
ATOM 4627  C CA  . LEU B 2 202 ? 83.909  84.679  117.024 1.00 10.00 ? 211 LEU B CA  1 
ATOM 4628  C C   . LEU B 2 202 ? 84.182  85.354  115.699 1.00 10.00 ? 211 LEU B C   1 
ATOM 4629  O O   . LEU B 2 202 ? 83.265  85.852  115.069 1.00 10.00 ? 211 LEU B O   1 
ATOM 4630  C CB  . LEU B 2 202 ? 82.789  83.660  116.855 1.00 10.00 ? 211 LEU B CB  1 
ATOM 4631  C CG  . LEU B 2 202 ? 82.344  82.965  118.136 1.00 10.00 ? 211 LEU B CG  1 
ATOM 4632  C CD1 . LEU B 2 202 ? 81.314  81.904  117.800 1.00 10.00 ? 211 LEU B CD1 1 
ATOM 4633  C CD2 . LEU B 2 202 ? 83.551  82.351  118.820 1.00 10.00 ? 211 LEU B CD2 1 
ATOM 4634  N N   . ILE B 2 203 ? 85.456  85.430  115.324 1.00 10.00 ? 212 ILE B N   1 
ATOM 4635  C CA  . ILE B 2 203 ? 85.892  86.001  114.048 1.00 10.00 ? 212 ILE B CA  1 
ATOM 4636  C C   . ILE B 2 203 ? 86.069  84.744  113.213 1.00 10.00 ? 212 ILE B C   1 
ATOM 4637  O O   . ILE B 2 203 ? 87.174  84.441  112.800 1.00 10.00 ? 212 ILE B O   1 
ATOM 4638  C CB  . ILE B 2 203 ? 87.279  86.754  114.185 1.00 10.00 ? 212 ILE B CB  1 
ATOM 4639  C CG1 . ILE B 2 203 ? 87.077  88.097  114.892 1.00 10.00 ? 212 ILE B CG1 1 
ATOM 4640  C CG2 . ILE B 2 203 ? 87.930  87.000  112.815 1.00 10.00 ? 212 ILE B CG2 1 
ATOM 4641  C CD1 . ILE B 2 203 ? 88.365  88.854  115.126 1.00 10.00 ? 212 ILE B CD1 1 
ATOM 4642  N N   . ILE B 2 204 ? 84.965  84.023  113.008 1.00 10.00 ? 213 ILE B N   1 
ATOM 4643  C CA  . ILE B 2 204 ? 84.952  82.757  112.274 1.00 10.00 ? 213 ILE B CA  1 
ATOM 4644  C C   . ILE B 2 204 ? 85.204  82.712  110.789 1.00 10.00 ? 213 ILE B C   1 
ATOM 4645  O O   . ILE B 2 204 ? 84.763  83.572  110.055 1.00 10.00 ? 213 ILE B O   1 
ATOM 4646  C CB  . ILE B 2 204 ? 83.613  81.998  112.508 1.00 10.00 ? 213 ILE B CB  1 
ATOM 4647  C CG1 . ILE B 2 204 ? 82.591  82.368  111.427 1.00 10.00 ? 213 ILE B CG1 1 
ATOM 4648  C CG2 . ILE B 2 204 ? 83.046  82.344  113.873 1.00 10.00 ? 213 ILE B CG2 1 
ATOM 4649  C CD1 . ILE B 2 204 ? 82.216  83.830  111.392 1.00 10.00 ? 213 ILE B CD1 1 
ATOM 4650  N N   . GLN B 2 205 ? 85.900  81.655  110.353 1.00 10.00 ? 214 GLN B N   1 
ATOM 4651  C CA  . GLN B 2 205 ? 86.187  81.452  108.894 1.00 10.00 ? 214 GLN B CA  1 
ATOM 4652  C C   . GLN B 2 205 ? 85.849  80.008  108.533 1.00 10.00 ? 214 GLN B C   1 
ATOM 4653  O O   . GLN B 2 205 ? 86.472  79.097  109.033 1.00 10.00 ? 214 GLN B O   1 
ATOM 4654  C CB  . GLN B 2 205 ? 87.655  81.773  108.477 1.00 10.00 ? 214 GLN B CB  1 
ATOM 4655  C CG  . GLN B 2 205 ? 88.747  81.015  109.185 1.00 10.00 ? 214 GLN B CG  1 
ATOM 4656  C CD  . GLN B 2 205 ? 89.987  80.828  108.314 1.00 10.00 ? 214 GLN B CD  1 
ATOM 4657  O OE1 . GLN B 2 205 ? 89.879  80.497  107.137 1.00 10.00 ? 214 GLN B OE1 1 
ATOM 4658  N NE2 . GLN B 2 205 ? 91.171  81.013  108.900 1.00 10.00 ? 214 GLN B NE2 1 
ATOM 4659  N N   . ARG B 2 206 ? 84.816  79.840  107.716 1.00 10.00 ? 215 ARG B N   1 
ATOM 4660  C CA  . ARG B 2 206 ? 84.319  78.544  107.300 1.00 10.00 ? 215 ARG B CA  1 
ATOM 4661  C C   . ARG B 2 206 ? 84.456  78.287  105.776 1.00 10.00 ? 215 ARG B C   1 
ATOM 4662  O O   . ARG B 2 206 ? 83.556  78.609  105.010 1.00 10.00 ? 215 ARG B O   1 
ATOM 4663  C CB  . ARG B 2 206 ? 82.846  78.432  107.793 1.00 10.00 ? 215 ARG B CB  1 
ATOM 4664  C CG  . ARG B 2 206 ? 82.003  77.189  107.412 1.00 10.00 ? 215 ARG B CG  1 
ATOM 4665  C CD  . ARG B 2 206 ? 80.920  76.924  108.459 1.00 10.00 ? 215 ARG B CD  1 
ATOM 4666  N NE  . ARG B 2 206 ? 80.028  75.825  108.116 1.00 10.00 ? 215 ARG B NE  1 
ATOM 4667  C CZ  . ARG B 2 206 ? 79.058  75.367  108.901 1.00 10.00 ? 215 ARG B CZ  1 
ATOM 4668  N NH1 . ARG B 2 206 ? 78.837  75.899  110.085 1.00 10.00 ? 215 ARG B NH1 1 
ATOM 4669  N NH2 . ARG B 2 206 ? 78.310  74.357  108.501 1.00 10.00 ? 215 ARG B NH2 1 
ATOM 4670  N N   . LYS B 2 207 ? 85.549  77.624  105.361 1.00 10.00 ? 216 LYS B N   1 
ATOM 4671  C CA  . LYS B 2 207 ? 85.798  77.339  103.942 1.00 10.00 ? 216 LYS B CA  1 
ATOM 4672  C C   . LYS B 2 207 ? 85.744  75.872  103.550 1.00 10.00 ? 216 LYS B C   1 
ATOM 4673  O O   . LYS B 2 207 ? 86.771  75.237  103.373 1.00 10.00 ? 216 LYS B O   1 
ATOM 4674  C CB  . LYS B 2 207 ? 87.156  77.897  103.502 1.00 10.00 ? 216 LYS B CB  1 
ATOM 4675  C CG  . LYS B 2 207 ? 88.311  77.646  104.465 1.00 10.00 ? 216 LYS B CG  1 
ATOM 4676  C CD  . LYS B 2 207 ? 88.337  76.206  105.057 1.00 10.00 ? 216 LYS B CD  1 
ATOM 4677  C CE  . LYS B 2 207 ? 87.564  76.059  106.403 1.00 10.00 ? 216 LYS B CE  1 
ATOM 4678  N NZ  . LYS B 2 207 ? 87.163  74.657  106.760 1.00 10.00 ? 216 LYS B NZ  1 
ATOM 4679  N N   . PRO B 2 208 ? 84.536  75.315  103.408 1.00 10.00 ? 217 PRO B N   1 
ATOM 4680  C CA  . PRO B 2 208 ? 84.446  73.909  103.019 1.00 10.00 ? 217 PRO B CA  1 
ATOM 4681  C C   . PRO B 2 208 ? 84.384  73.821  101.475 1.00 10.00 ? 217 PRO B C   1 
ATOM 4682  O O   . PRO B 2 208 ? 83.318  74.022  100.875 1.00 10.00 ? 217 PRO B O   1 
ATOM 4683  C CB  . PRO B 2 208 ? 83.145  73.473  103.676 1.00 10.00 ? 217 PRO B CB  1 
ATOM 4684  C CG  . PRO B 2 208 ? 82.292  74.671  103.491 1.00 10.00 ? 217 PRO B CG  1 
ATOM 4685  C CD  . PRO B 2 208 ? 83.228  75.810  103.873 1.00 10.00 ? 217 PRO B CD  1 
ATOM 4686  N N   . LEU B 2 209 ? 85.509  73.534  100.824 1.00 10.00 ? 218 LEU B N   1 
ATOM 4687  C CA  . LEU B 2 209 ? 85.483  73.461  99.361  1.00 10.00 ? 218 LEU B CA  1 
ATOM 4688  C C   . LEU B 2 209 ? 85.338  72.016  98.902  1.00 10.00 ? 218 LEU B C   1 
ATOM 4689  O O   . LEU B 2 209 ? 86.275  71.205  98.977  1.00 10.00 ? 218 LEU B O   1 
ATOM 4690  C CB  . LEU B 2 209 ? 86.729  74.123  98.754  1.00 10.00 ? 218 LEU B CB  1 
ATOM 4691  C CG  . LEU B 2 209 ? 87.064  73.846  97.272  1.00 10.00 ? 218 LEU B CG  1 
ATOM 4692  C CD1 . LEU B 2 209 ? 85.824  73.983  96.396  1.00 10.00 ? 218 LEU B CD1 1 
ATOM 4693  C CD2 . LEU B 2 209 ? 88.173  74.779  96.802  1.00 10.00 ? 218 LEU B CD2 1 
ATOM 4694  N N   . PHE B 2 210 ? 84.128  71.683  98.461  1.00 10.00 ? 219 PHE B N   1 
ATOM 4695  C CA  . PHE B 2 210 ? 83.848  70.337  98.033  1.00 10.00 ? 219 PHE B CA  1 
ATOM 4696  C C   . PHE B 2 210 ? 82.929  70.215  96.779  1.00 10.00 ? 219 PHE B C   1 
ATOM 4697  O O   . PHE B 2 210 ? 83.366  69.678  95.754  1.00 10.00 ? 219 PHE B O   1 
ATOM 4698  C CB  . PHE B 2 210 ? 83.295  69.612  99.270  1.00 10.00 ? 219 PHE B CB  1 
ATOM 4699  C CG  . PHE B 2 210 ? 84.063  69.944  100.559 1.00 10.00 ? 219 PHE B CG  1 
ATOM 4700  C CD1 . PHE B 2 210 ? 83.413  70.423  101.681 1.00 10.00 ? 219 PHE B CD1 1 
ATOM 4701  C CD2 . PHE B 2 210 ? 85.441  69.814  100.623 1.00 10.00 ? 219 PHE B CD2 1 
ATOM 4702  C CE1 . PHE B 2 210 ? 84.119  70.761  102.816 1.00 10.00 ? 219 PHE B CE1 1 
ATOM 4703  C CE2 . PHE B 2 210 ? 86.147  70.163  101.765 1.00 10.00 ? 219 PHE B CE2 1 
ATOM 4704  C CZ  . PHE B 2 210 ? 85.484  70.635  102.854 1.00 10.00 ? 219 PHE B CZ  1 
ATOM 4705  N N   . TYR B 2 211 ? 81.693  70.722  96.810  1.00 10.00 ? 220 TYR B N   1 
ATOM 4706  C CA  . TYR B 2 211 ? 80.834  70.553  95.619  1.00 10.00 ? 220 TYR B CA  1 
ATOM 4707  C C   . TYR B 2 211 ? 80.761  71.701  94.612  1.00 10.00 ? 220 TYR B C   1 
ATOM 4708  O O   . TYR B 2 211 ? 80.263  71.504  93.513  1.00 10.00 ? 220 TYR B O   1 
ATOM 4709  C CB  . TYR B 2 211 ? 79.385  70.229  95.981  1.00 10.00 ? 220 TYR B CB  1 
ATOM 4710  C CG  . TYR B 2 211 ? 79.112  69.082  96.920  1.00 10.00 ? 220 TYR B CG  1 
ATOM 4711  C CD1 . TYR B 2 211 ? 80.098  68.587  97.803  1.00 10.00 ? 220 TYR B CD1 1 
ATOM 4712  C CD2 . TYR B 2 211 ? 77.809  68.588  97.024  1.00 10.00 ? 220 TYR B CD2 1 
ATOM 4713  C CE1 . TYR B 2 211 ? 79.775  67.639  98.759  1.00 10.00 ? 220 TYR B CE1 1 
ATOM 4714  C CE2 . TYR B 2 211 ? 77.473  67.664  97.969  1.00 10.00 ? 220 TYR B CE2 1 
ATOM 4715  C CZ  . TYR B 2 211 ? 78.443  67.188  98.833  1.00 10.00 ? 220 TYR B CZ  1 
ATOM 4716  O OH  . TYR B 2 211 ? 78.050  66.262  99.772  1.00 10.00 ? 220 TYR B OH  1 
ATOM 4717  N N   . ILE B 2 212 ? 81.192  72.899  94.995  1.00 10.00 ? 221 ILE B N   1 
ATOM 4718  C CA  . ILE B 2 212 ? 81.192  74.034  94.112  1.00 10.00 ? 221 ILE B CA  1 
ATOM 4719  C C   . ILE B 2 212 ? 82.103  73.627  92.909  1.00 10.00 ? 221 ILE B C   1 
ATOM 4720  O O   . ILE B 2 212 ? 82.026  74.169  91.787  1.00 10.00 ? 221 ILE B O   1 
ATOM 4721  C CB  . ILE B 2 212 ? 81.658  75.245  94.990  1.00 10.00 ? 221 ILE B CB  1 
ATOM 4722  C CG1 . ILE B 2 212 ? 83.041  74.973  95.607  1.00 10.00 ? 221 ILE B CG1 1 
ATOM 4723  C CG2 . ILE B 2 212 ? 80.659  75.401  96.172  1.00 10.00 ? 221 ILE B CG2 1 
ATOM 4724  C CD1 . ILE B 2 212 ? 83.144  75.192  97.116  1.00 10.00 ? 221 ILE B CD1 1 
ATOM 4725  N N   . VAL B 2 213 ? 82.881  72.570  93.140  1.00 10.00 ? 222 VAL B N   1 
ATOM 4726  C CA  . VAL B 2 213 ? 83.817  72.044  92.167  1.00 10.00 ? 222 VAL B CA  1 
ATOM 4727  C C   . VAL B 2 213 ? 83.027  71.409  91.059  1.00 10.00 ? 222 VAL B C   1 
ATOM 4728  O O   . VAL B 2 213 ? 83.197  71.752  89.887  1.00 10.00 ? 222 VAL B O   1 
ATOM 4729  C CB  . VAL B 2 213 ? 84.731  70.956  92.791  1.00 10.00 ? 222 VAL B CB  1 
ATOM 4730  C CG1 . VAL B 2 213 ? 85.931  70.687  91.874  1.00 10.00 ? 222 VAL B CG1 1 
ATOM 4731  C CG2 . VAL B 2 213 ? 85.146  71.366  94.219  1.00 10.00 ? 222 VAL B CG2 1 
ATOM 4732  N N   . TYR B 2 214 ? 82.163  70.461  91.408  1.00 10.00 ? 223 TYR B N   1 
ATOM 4733  C CA  . TYR B 2 214 ? 81.425  69.877  90.296  1.00 10.00 ? 223 TYR B CA  1 
ATOM 4734  C C   . TYR B 2 214 ? 80.252  70.761  89.890  1.00 10.00 ? 223 TYR B C   1 
ATOM 4735  O O   . TYR B 2 214 ? 79.566  70.439  88.948  1.00 10.00 ? 223 TYR B O   1 
ATOM 4736  C CB  . TYR B 2 214 ? 80.937  68.472  90.654  1.00 10.00 ? 223 TYR B CB  1 
ATOM 4737  C CG  . TYR B 2 214 ? 79.822  68.450  91.675  1.00 10.00 ? 223 TYR B CG  1 
ATOM 4738  C CD1 . TYR B 2 214 ? 78.517  68.759  91.315  1.00 10.00 ? 223 TYR B CD1 1 
ATOM 4739  C CD2 . TYR B 2 214 ? 80.075  68.121  93.000  1.00 10.00 ? 223 TYR B CD2 1 
ATOM 4740  C CE1 . TYR B 2 214 ? 77.495  68.739  92.245  1.00 10.00 ? 223 TYR B CE1 1 
ATOM 4741  C CE2 . TYR B 2 214 ? 79.060  68.098  93.937  1.00 10.00 ? 223 TYR B CE2 1 
ATOM 4742  C CZ  . TYR B 2 214 ? 77.773  68.408  93.554  1.00 10.00 ? 223 TYR B CZ  1 
ATOM 4743  O OH  . TYR B 2 214 ? 76.761  68.386  94.487  1.00 10.00 ? 223 TYR B OH  1 
ATOM 4744  N N   . THR B 2 215 ? 80.074  71.894  90.582  1.00 10.00 ? 224 THR B N   1 
ATOM 4745  C CA  . THR B 2 215 ? 79.071  72.926  90.273  1.00 10.00 ? 224 THR B CA  1 
ATOM 4746  C C   . THR B 2 215 ? 79.659  73.735  89.076  1.00 10.00 ? 224 THR B C   1 
ATOM 4747  O O   . THR B 2 215 ? 78.958  74.139  88.128  1.00 10.00 ? 224 THR B O   1 
ATOM 4748  C CB  . THR B 2 215 ? 78.878  73.867  91.508  1.00 10.00 ? 224 THR B CB  1 
ATOM 4749  O OG1 . THR B 2 215 ? 78.123  73.187  92.518  1.00 10.00 ? 224 THR B OG1 1 
ATOM 4750  C CG2 . THR B 2 215 ? 78.137  75.141  91.130  1.00 10.00 ? 224 THR B CG2 1 
ATOM 4751  N N   . ILE B 2 216 ? 80.973  73.920  89.123  1.00 10.00 ? 225 ILE B N   1 
ATOM 4752  C CA  . ILE B 2 216 ? 81.762  74.635  88.098  1.00 10.00 ? 225 ILE B CA  1 
ATOM 4753  C C   . ILE B 2 216 ? 81.596  73.809  86.817  1.00 10.00 ? 225 ILE B C   1 
ATOM 4754  O O   . ILE B 2 216 ? 81.282  74.327  85.741  1.00 10.00 ? 225 ILE B O   1 
ATOM 4755  C CB  . ILE B 2 216 ? 83.323  74.685  88.507  1.00 10.00 ? 225 ILE B CB  1 
ATOM 4756  C CG1 . ILE B 2 216 ? 83.692  76.079  89.096  1.00 10.00 ? 225 ILE B CG1 1 
ATOM 4757  C CG2 . ILE B 2 216 ? 84.197  74.250  87.321  1.00 10.00 ? 225 ILE B CG2 1 
ATOM 4758  C CD1 . ILE B 2 216 ? 85.137  76.254  89.631  1.00 10.00 ? 225 ILE B CD1 1 
ATOM 4759  N N   . VAL B 2 217 ? 81.760  72.492  86.958  1.00 10.00 ? 226 VAL B N   1 
ATOM 4760  C CA  . VAL B 2 217 ? 81.652  71.645  85.768  1.00 10.00 ? 226 VAL B CA  1 
ATOM 4761  C C   . VAL B 2 217 ? 80.340  71.888  85.063  1.00 10.00 ? 226 VAL B C   1 
ATOM 4762  O O   . VAL B 2 217 ? 80.321  71.943  83.854  1.00 10.00 ? 226 VAL B O   1 
ATOM 4763  C CB  . VAL B 2 217 ? 81.819  70.126  86.033  1.00 10.00 ? 226 VAL B CB  1 
ATOM 4764  C CG1 . VAL B 2 217 ? 83.137  69.872  86.706  1.00 10.00 ? 226 VAL B CG1 1 
ATOM 4765  C CG2 . VAL B 2 217 ? 80.653  69.587  86.796  1.00 10.00 ? 226 VAL B CG2 1 
ATOM 4766  N N   . PRO B 2 218 ? 79.218  71.992  85.799  1.00 10.00 ? 227 PRO B N   1 
ATOM 4767  C CA  . PRO B 2 218 ? 77.966  72.256  85.084  1.00 10.00 ? 227 PRO B CA  1 
ATOM 4768  C C   . PRO B 2 218 ? 78.179  73.513  84.292  1.00 10.00 ? 227 PRO B C   1 
ATOM 4769  O O   . PRO B 2 218 ? 78.270  73.495  83.072  1.00 10.00 ? 227 PRO B O   1 
ATOM 4770  C CB  . PRO B 2 218 ? 76.966  72.538  86.194  1.00 10.00 ? 227 PRO B CB  1 
ATOM 4771  C CG  . PRO B 2 218 ? 77.449  71.735  87.300  1.00 10.00 ? 227 PRO B CG  1 
ATOM 4772  C CD  . PRO B 2 218 ? 78.951  71.818  87.227  1.00 10.00 ? 227 PRO B CD  1 
ATOM 4773  N N   . CYS B 2 219 ? 78.280  74.618  85.020  1.00 10.00 ? 228 CYS B N   1 
ATOM 4774  C CA  . CYS B 2 219 ? 78.472  75.914  84.377  1.00 10.00 ? 228 CYS B CA  1 
ATOM 4775  C C   . CYS B 2 219 ? 79.329  75.771  83.119  1.00 10.00 ? 228 CYS B C   1 
ATOM 4776  O O   . CYS B 2 219 ? 78.879  76.173  82.066  1.00 10.00 ? 228 CYS B O   1 
ATOM 4777  C CB  . CYS B 2 219 ? 79.063  76.975  85.354  1.00 10.00 ? 228 CYS B CB  1 
ATOM 4778  S SG  . CYS B 2 219 ? 77.858  77.687  86.572  1.00 10.00 ? 228 CYS B SG  1 
ATOM 4779  N N   . ILE B 2 220 ? 80.506  75.145  83.215  1.00 10.00 ? 229 ILE B N   1 
ATOM 4780  C CA  . ILE B 2 220 ? 81.409  74.973  82.073  1.00 10.00 ? 229 ILE B CA  1 
ATOM 4781  C C   . ILE B 2 220 ? 81.074  73.807  81.129  1.00 10.00 ? 229 ILE B C   1 
ATOM 4782  O O   . ILE B 2 220 ? 81.183  73.932  79.907  1.00 10.00 ? 229 ILE B O   1 
ATOM 4783  C CB  . ILE B 2 220 ? 82.860  74.789  82.564  1.00 10.00 ? 229 ILE B CB  1 
ATOM 4784  C CG1 . ILE B 2 220 ? 83.238  75.940  83.500  1.00 10.00 ? 229 ILE B CG1 1 
ATOM 4785  C CG2 . ILE B 2 220 ? 83.810  74.732  81.376  1.00 10.00 ? 229 ILE B CG2 1 
ATOM 4786  C CD1 . ILE B 2 220 ? 84.613  75.803  84.124  1.00 10.00 ? 229 ILE B CD1 1 
ATOM 4787  N N   . LEU B 2 221 ? 80.691  72.670  81.699  1.00 10.00 ? 230 LEU B N   1 
ATOM 4788  C CA  . LEU B 2 221 ? 80.339  71.471  80.923  1.00 10.00 ? 230 LEU B CA  1 
ATOM 4789  C C   . LEU B 2 221 ? 78.994  71.730  80.255  1.00 10.00 ? 230 LEU B C   1 
ATOM 4790  O O   . LEU B 2 221 ? 78.762  71.348  79.113  1.00 10.00 ? 230 LEU B O   1 
ATOM 4791  C CB  . LEU B 2 221 ? 80.241  70.241  81.832  1.00 10.00 ? 230 LEU B CB  1 
ATOM 4792  C CG  . LEU B 2 221 ? 81.390  69.907  82.794  1.00 10.00 ? 230 LEU B CG  1 
ATOM 4793  C CD1 . LEU B 2 221 ? 81.012  68.637  83.516  1.00 10.00 ? 230 LEU B CD1 1 
ATOM 4794  C CD2 . LEU B 2 221 ? 82.724  69.766  82.082  1.00 10.00 ? 230 LEU B CD2 1 
ATOM 4795  N N   . ILE B 2 222 ? 78.103  72.394  80.985  1.00 10.00 ? 231 ILE B N   1 
ATOM 4796  C CA  . ILE B 2 222 ? 76.816  72.739  80.410  1.00 10.00 ? 231 ILE B CA  1 
ATOM 4797  C C   . ILE B 2 222 ? 77.145  73.687  79.302  1.00 10.00 ? 231 ILE B C   1 
ATOM 4798  O O   . ILE B 2 222 ? 76.455  73.741  78.290  1.00 10.00 ? 231 ILE B O   1 
ATOM 4799  C CB  . ILE B 2 222 ? 75.949  73.483  81.375  1.00 10.00 ? 231 ILE B CB  1 
ATOM 4800  C CG1 . ILE B 2 222 ? 75.856  72.663  82.662  1.00 10.00 ? 231 ILE B CG1 1 
ATOM 4801  C CG2 . ILE B 2 222 ? 74.589  73.837  80.689  1.00 10.00 ? 231 ILE B CG2 1 
ATOM 4802  C CD1 . ILE B 2 222 ? 74.995  71.428  82.531  1.00 10.00 ? 231 ILE B CD1 1 
ATOM 4803  N N   . SER B 2 223 ? 78.181  74.472  79.575  1.00 10.00 ? 232 SER B N   1 
ATOM 4804  C CA  . SER B 2 223 ? 78.682  75.361  78.534  1.00 10.00 ? 232 SER B CA  1 
ATOM 4805  C C   . SER B 2 223 ? 79.179  74.570  77.330  1.00 10.00 ? 232 SER B C   1 
ATOM 4806  O O   . SER B 2 223 ? 79.012  74.940  76.217  1.00 10.00 ? 232 SER B O   1 
ATOM 4807  C CB  . SER B 2 223 ? 79.793  76.257  79.083  1.00 10.00 ? 232 SER B CB  1 
ATOM 4808  O OG  . SER B 2 223 ? 79.259  77.316  79.858  1.00 10.00 ? 232 SER B OG  1 
ATOM 4809  N N   . ILE B 2 224 ? 79.734  73.384  77.665  1.00 10.00 ? 233 ILE B N   1 
ATOM 4810  C CA  . ILE B 2 224 ? 80.209  72.522  76.608  1.00 10.00 ? 233 ILE B CA  1 
ATOM 4811  C C   . ILE B 2 224 ? 79.084  72.305  75.626  1.00 10.00 ? 233 ILE B C   1 
ATOM 4812  O O   . ILE B 2 224 ? 79.233  72.584  74.439  1.00 10.00 ? 233 ILE B O   1 
ATOM 4813  C CB  . ILE B 2 224 ? 80.694  71.160  77.121  1.00 10.00 ? 233 ILE B CB  1 
ATOM 4814  C CG1 . ILE B 2 224 ? 81.550  71.319  78.384  1.00 10.00 ? 233 ILE B CG1 1 
ATOM 4815  C CG2 . ILE B 2 224 ? 81.556  70.513  76.036  1.00 10.00 ? 233 ILE B CG2 1 
ATOM 4816  C CD1 . ILE B 2 224 ? 82.298  70.067  78.807  1.00 10.00 ? 233 ILE B CD1 1 
ATOM 4817  N N   . LEU B 2 225 ? 77.943  71.858  76.131  1.00 10.00 ? 234 LEU B N   1 
ATOM 4818  C CA  . LEU B 2 225 ? 76.786  71.594  75.288  1.00 10.00 ? 234 LEU B CA  1 
ATOM 4819  C C   . LEU B 2 225 ? 76.253  72.987  74.836  1.00 10.00 ? 234 LEU B C   1 
ATOM 4820  O O   . LEU B 2 225 ? 75.764  73.147  73.714  1.00 10.00 ? 234 LEU B O   1 
ATOM 4821  C CB  . LEU B 2 225 ? 75.730  70.710  76.053  1.00 10.00 ? 234 LEU B CB  1 
ATOM 4822  C CG  . LEU B 2 225 ? 76.044  69.594  77.118  1.00 10.00 ? 234 LEU B CG  1 
ATOM 4823  C CD1 . LEU B 2 225 ? 74.771  68.849  77.413  1.00 10.00 ? 234 LEU B CD1 1 
ATOM 4824  C CD2 . LEU B 2 225 ? 77.104  68.589  76.672  1.00 10.00 ? 234 LEU B CD2 1 
ATOM 4825  N N   . ALA B 2 226 ? 76.420  74.008  75.683  1.00 10.00 ? 235 ALA B N   1 
ATOM 4826  C CA  . ALA B 2 226 ? 75.998  75.359  75.371  1.00 10.00 ? 235 ALA B CA  1 
ATOM 4827  C C   . ALA B 2 226 ? 76.813  75.854  74.169  1.00 10.00 ? 235 ALA B C   1 
ATOM 4828  O O   . ALA B 2 226 ? 76.274  76.017  73.070  1.00 10.00 ? 235 ALA B O   1 
ATOM 4829  C CB  . ALA B 2 226 ? 76.227  76.245  76.571  1.00 10.00 ? 235 ALA B CB  1 
ATOM 4830  N N   . ILE B 2 227 ? 78.094  76.147  74.386  1.00 10.00 ? 236 ILE B N   1 
ATOM 4831  C CA  . ILE B 2 227 ? 78.990  76.576  73.284  1.00 10.00 ? 236 ILE B CA  1 
ATOM 4832  C C   . ILE B 2 227 ? 78.754  75.663  72.116  1.00 10.00 ? 236 ILE B C   1 
ATOM 4833  O O   . ILE B 2 227 ? 78.866  76.060  70.968  1.00 10.00 ? 236 ILE B O   1 
ATOM 4834  C CB  . ILE B 2 227 ? 80.545  76.487  73.599  1.00 10.00 ? 236 ILE B CB  1 
ATOM 4835  C CG1 . ILE B 2 227 ? 81.333  76.579  72.285  1.00 10.00 ? 236 ILE B CG1 1 
ATOM 4836  C CG2 . ILE B 2 227 ? 80.934  75.173  74.249  1.00 10.00 ? 236 ILE B CG2 1 
ATOM 4837  C CD1 . ILE B 2 227 ? 82.671  77.302  72.412  1.00 10.00 ? 236 ILE B CD1 1 
ATOM 4838  N N   . LEU B 2 228 ? 78.415  74.426  72.459  1.00 10.00 ? 237 LEU B N   1 
ATOM 4839  C CA  . LEU B 2 228 ? 78.138  73.350  71.501  1.00 10.00 ? 237 LEU B CA  1 
ATOM 4840  C C   . LEU B 2 228 ? 76.872  73.669  70.714  1.00 10.00 ? 237 LEU B C   1 
ATOM 4841  O O   . LEU B 2 228 ? 76.848  73.562  69.495  1.00 10.00 ? 237 LEU B O   1 
ATOM 4842  C CB  . LEU B 2 228 ? 77.970  72.001  72.243  1.00 10.00 ? 237 LEU B CB  1 
ATOM 4843  C CG  . LEU B 2 228 ? 78.976  70.809  72.169  1.00 10.00 ? 237 LEU B CG  1 
ATOM 4844  C CD1 . LEU B 2 228 ? 80.425  71.233  71.868  1.00 10.00 ? 237 LEU B CD1 1 
ATOM 4845  C CD2 . LEU B 2 228 ? 78.927  70.042  73.478  1.00 10.00 ? 237 LEU B CD2 1 
ATOM 4846  N N   . VAL B 2 229 ? 75.830  74.098  71.415  1.00 10.00 ? 238 VAL B N   1 
ATOM 4847  C CA  . VAL B 2 229 ? 74.544  74.418  70.765  1.00 10.00 ? 238 VAL B CA  1 
ATOM 4848  C C   . VAL B 2 229 ? 74.679  75.716  69.994  1.00 10.00 ? 238 VAL B C   1 
ATOM 4849  O O   . VAL B 2 229 ? 73.885  76.015  69.115  1.00 10.00 ? 238 VAL B O   1 
ATOM 4850  C CB  . VAL B 2 229 ? 73.372  74.588  71.796  1.00 10.00 ? 238 VAL B CB  1 
ATOM 4851  C CG1 . VAL B 2 229 ? 72.190  75.278  71.175  1.00 10.00 ? 238 VAL B CG1 1 
ATOM 4852  C CG2 . VAL B 2 229 ? 72.922  73.224  72.315  1.00 10.00 ? 238 VAL B CG2 1 
ATOM 4853  N N   . PHE B 2 230 ? 75.713  76.484  70.325  1.00 10.00 ? 239 PHE B N   1 
ATOM 4854  C CA  . PHE B 2 230 ? 75.988  77.774  69.701  1.00 10.00 ? 239 PHE B CA  1 
ATOM 4855  C C   . PHE B 2 230 ? 77.015  77.506  68.612  1.00 10.00 ? 239 PHE B C   1 
ATOM 4856  O O   . PHE B 2 230 ? 77.147  78.247  67.636  1.00 10.00 ? 239 PHE B O   1 
ATOM 4857  C CB  . PHE B 2 230 ? 76.534  78.668  70.791  1.00 10.00 ? 239 PHE B CB  1 
ATOM 4858  C CG  . PHE B 2 230 ? 75.830  78.471  72.119  1.00 10.00 ? 239 PHE B CG  1 
ATOM 4859  C CD1 . PHE B 2 230 ? 76.514  78.604  73.324  1.00 10.00 ? 239 PHE B CD1 1 
ATOM 4860  C CD2 . PHE B 2 230 ? 74.475  78.130  72.161  1.00 10.00 ? 239 PHE B CD2 1 
ATOM 4861  C CE1 . PHE B 2 230 ? 75.861  78.396  74.544  1.00 10.00 ? 239 PHE B CE1 1 
ATOM 4862  C CE2 . PHE B 2 230 ? 73.815  77.919  73.375  1.00 10.00 ? 239 PHE B CE2 1 
ATOM 4863  C CZ  . PHE B 2 230 ? 74.507  78.050  74.569  1.00 10.00 ? 239 PHE B CZ  1 
ATOM 4864  N N   . TYR B 2 231 ? 77.687  76.368  68.774  1.00 10.00 ? 240 TYR B N   1 
ATOM 4865  C CA  . TYR B 2 231 ? 78.738  75.925  67.862  1.00 10.00 ? 240 TYR B CA  1 
ATOM 4866  C C   . TYR B 2 231 ? 78.162  74.932  66.867  1.00 10.00 ? 240 TYR B C   1 
ATOM 4867  O O   . TYR B 2 231 ? 78.617  74.848  65.731  1.00 10.00 ? 240 TYR B O   1 
ATOM 4868  C CB  . TYR B 2 231 ? 79.842  75.258  68.678  1.00 10.00 ? 240 TYR B CB  1 
ATOM 4869  C CG  . TYR B 2 231 ? 81.179  75.139  68.038  1.00 10.00 ? 240 TYR B CG  1 
ATOM 4870  C CD1 . TYR B 2 231 ? 82.285  74.879  68.808  1.00 10.00 ? 240 TYR B CD1 1 
ATOM 4871  C CD2 . TYR B 2 231 ? 81.340  75.242  66.684  1.00 10.00 ? 240 TYR B CD2 1 
ATOM 4872  C CE1 . TYR B 2 231 ? 83.504  74.720  68.251  1.00 10.00 ? 240 TYR B CE1 1 
ATOM 4873  C CE2 . TYR B 2 231 ? 82.561  75.086  66.123  1.00 10.00 ? 240 TYR B CE2 1 
ATOM 4874  C CZ  . TYR B 2 231 ? 83.632  74.823  66.912  1.00 10.00 ? 240 TYR B CZ  1 
ATOM 4875  O OH  . TYR B 2 231 ? 84.854  74.631  66.358  1.00 10.00 ? 240 TYR B OH  1 
ATOM 4876  N N   . LEU B 2 232 ? 77.156  74.189  67.318  1.00 10.00 ? 241 LEU B N   1 
ATOM 4877  C CA  . LEU B 2 232 ? 76.465  73.164  66.522  1.00 10.00 ? 241 LEU B CA  1 
ATOM 4878  C C   . LEU B 2 232 ? 75.752  73.780  65.301  1.00 10.00 ? 241 LEU B C   1 
ATOM 4879  O O   . LEU B 2 232 ? 75.628  73.120  64.272  1.00 10.00 ? 241 LEU B O   1 
ATOM 4880  C CB  . LEU B 2 232 ? 75.481  72.332  67.424  1.00 10.00 ? 241 LEU B CB  1 
ATOM 4881  C CG  . LEU B 2 232 ? 74.543  71.192  66.927  1.00 10.00 ? 241 LEU B CG  1 
ATOM 4882  C CD1 . LEU B 2 232 ? 75.281  70.123  66.211  1.00 10.00 ? 241 LEU B CD1 1 
ATOM 4883  C CD2 . LEU B 2 232 ? 73.839  70.562  68.080  1.00 10.00 ? 241 LEU B CD2 1 
ATOM 4884  N N   . PRO B 2 233 ? 75.300  75.057  65.385  1.00 10.00 ? 242 PRO B N   1 
ATOM 4885  C CA  . PRO B 2 233 ? 74.624  75.652  64.224  1.00 10.00 ? 242 PRO B CA  1 
ATOM 4886  C C   . PRO B 2 233 ? 75.526  75.741  62.972  1.00 10.00 ? 242 PRO B C   1 
ATOM 4887  O O   . PRO B 2 233 ? 75.132  75.334  61.876  1.00 10.00 ? 242 PRO B O   1 
ATOM 4888  C CB  . PRO B 2 233 ? 74.157  77.001  64.760  1.00 10.00 ? 242 PRO B CB  1 
ATOM 4889  C CG  . PRO B 2 233 ? 74.963  77.204  66.062  1.00 10.00 ? 242 PRO B CG  1 
ATOM 4890  C CD  . PRO B 2 233 ? 75.109  75.859  66.604  1.00 10.00 ? 242 PRO B CD  1 
ATOM 4891  N N   . PRO B 2 234 ? 76.746  76.285  63.115  1.00 10.00 ? 243 PRO B N   1 
ATOM 4892  C CA  . PRO B 2 234 ? 77.487  76.282  61.849  1.00 10.00 ? 243 PRO B CA  1 
ATOM 4893  C C   . PRO B 2 234 ? 78.339  75.010  61.765  1.00 10.00 ? 243 PRO B C   1 
ATOM 4894  O O   . PRO B 2 234 ? 79.210  74.872  60.909  1.00 10.00 ? 243 PRO B O   1 
ATOM 4895  C CB  . PRO B 2 234 ? 78.337  77.546  61.943  1.00 10.00 ? 243 PRO B CB  1 
ATOM 4896  C CG  . PRO B 2 234 ? 78.589  77.678  63.387  1.00 10.00 ? 243 PRO B CG  1 
ATOM 4897  C CD  . PRO B 2 234 ? 77.227  77.384  63.975  1.00 10.00 ? 243 PRO B CD  1 
ATOM 4898  N N   . ASP B 2 235 ? 78.068  74.096  62.692  1.00 10.00 ? 244 ASP B N   1 
ATOM 4899  C CA  . ASP B 2 235 ? 78.740  72.796  62.808  1.00 10.00 ? 244 ASP B CA  1 
ATOM 4900  C C   . ASP B 2 235 ? 77.851  71.769  62.115  1.00 10.00 ? 244 ASP B C   1 
ATOM 4901  O O   . ASP B 2 235 ? 78.299  70.960  61.288  1.00 10.00 ? 244 ASP B O   1 
ATOM 4902  C CB  . ASP B 2 235 ? 78.911  72.429  64.281  1.00 10.00 ? 244 ASP B CB  1 
ATOM 4903  C CG  . ASP B 2 235 ? 80.286  71.882  64.593  1.00 10.00 ? 244 ASP B CG  1 
ATOM 4904  O OD1 . ASP B 2 235 ? 80.650  71.872  65.786  1.00 10.00 ? 244 ASP B OD1 1 
ATOM 4905  O OD2 . ASP B 2 235 ? 80.998  71.462  63.655  1.00 10.00 ? 244 ASP B OD2 1 
ATOM 4906  N N   . ALA B 2 236 ? 76.572  71.851  62.417  1.00 10.00 ? 245 ALA B N   1 
ATOM 4907  C CA  . ALA B 2 236 ? 75.586  70.967  61.831  1.00 10.00 ? 245 ALA B CA  1 
ATOM 4908  C C   . ALA B 2 236 ? 74.252  71.729  61.824  1.00 10.00 ? 245 ALA B C   1 
ATOM 4909  O O   . ALA B 2 236 ? 73.345  71.469  62.622  1.00 10.00 ? 245 ALA B O   1 
ATOM 4910  C CB  . ALA B 2 236 ? 75.487  69.750  62.637  1.00 10.00 ? 245 ALA B CB  1 
ATOM 4911  N N   . GLY B 2 237 ? 74.164  72.727  60.938  1.00 10.00 ? 246 GLY B N   1 
ATOM 4912  C CA  . GLY B 2 237 ? 72.959  73.549  60.809  1.00 10.00 ? 246 GLY B CA  1 
ATOM 4913  C C   . GLY B 2 237 ? 71.685  72.774  61.096  1.00 10.00 ? 246 GLY B C   1 
ATOM 4914  O O   . GLY B 2 237 ? 70.767  73.298  61.709  1.00 10.00 ? 246 GLY B O   1 
ATOM 4915  N N   . GLU B 2 238 ? 71.631  71.533  60.599  1.00 10.00 ? 247 GLU B N   1 
ATOM 4916  C CA  . GLU B 2 238 ? 70.491  70.663  60.862  1.00 10.00 ? 247 GLU B CA  1 
ATOM 4917  C C   . GLU B 2 238 ? 70.218  70.548  62.357  1.00 10.00 ? 247 GLU B C   1 
ATOM 4918  O O   . GLU B 2 238 ? 69.315  69.897  62.801  1.00 10.00 ? 247 GLU B O   1 
ATOM 4919  C CB  . GLU B 2 238 ? 70.723  69.278  60.254  1.00 10.00 ? 247 GLU B CB  1 
ATOM 4920  C CG  . GLU B 2 238 ? 70.821  69.275  58.736  1.00 10.00 ? 247 GLU B CG  1 
ATOM 4921  C CD  . GLU B 2 238 ? 72.205  69.645  58.242  1.00 10.00 ? 247 GLU B CD  1 
ATOM 4922  O OE1 . GLU B 2 238 ? 73.107  69.836  59.086  1.00 10.00 ? 247 GLU B OE1 1 
ATOM 4923  O OE2 . GLU B 2 238 ? 72.390  69.743  57.011  1.00 10.00 ? 247 GLU B OE2 1 
ATOM 4924  N N   . LYS B 2 239 ? 71.117  71.203  63.091  1.00 10.00 ? 248 LYS B N   1 
ATOM 4925  C CA  . LYS B 2 239 ? 71.055  71.257  64.538  1.00 10.00 ? 248 LYS B CA  1 
ATOM 4926  C C   . LYS B 2 239 ? 69.657  71.802  64.819  1.00 10.00 ? 248 LYS B C   1 
ATOM 4927  O O   . LYS B 2 239 ? 69.056  71.561  65.870  1.00 10.00 ? 248 LYS B O   1 
ATOM 4928  C CB  . LYS B 2 239 ? 72.178  72.198  65.043  1.00 10.00 ? 248 LYS B CB  1 
ATOM 4929  C CG  . LYS B 2 239 ? 71.842  73.666  65.194  1.00 10.00 ? 248 LYS B CG  1 
ATOM 4930  C CD  . LYS B 2 239 ? 71.402  73.931  66.606  1.00 10.00 ? 248 LYS B CD  1 
ATOM 4931  C CE  . LYS B 2 239 ? 72.484  73.594  67.595  1.00 10.00 ? 248 LYS B CE  1 
ATOM 4932  N NZ  . LYS B 2 239 ? 72.023  73.802  68.971  1.00 10.00 ? 248 LYS B NZ  1 
ATOM 4933  N N   . MET B 2 240 ? 69.139  72.486  63.805  1.00 10.00 ? 249 MET B N   1 
ATOM 4934  C CA  . MET B 2 240 ? 67.836  73.125  63.809  1.00 10.00 ? 249 MET B CA  1 
ATOM 4935  C C   . MET B 2 240 ? 66.898  72.636  64.918  1.00 10.00 ? 249 MET B C   1 
ATOM 4936  O O   . MET B 2 240 ? 66.554  73.386  65.835  1.00 10.00 ? 249 MET B O   1 
ATOM 4937  C CB  . MET B 2 240 ? 67.213  72.946  62.415  1.00 10.00 ? 249 MET B CB  1 
ATOM 4938  C CG  . MET B 2 240 ? 67.605  71.627  61.718  1.00 10.00 ? 249 MET B CG  1 
ATOM 4939  S SD  . MET B 2 240 ? 66.978  70.142  62.491  1.00 10.00 ? 249 MET B SD  1 
ATOM 4940  C CE  . MET B 2 240 ? 65.139  70.430  62.328  1.00 10.00 ? 249 MET B CE  1 
ATOM 4941  N N   . SER B 2 241 ? 66.515  71.369  64.841  1.00 10.00 ? 250 SER B N   1 
ATOM 4942  C CA  . SER B 2 241 ? 65.619  70.753  65.815  1.00 10.00 ? 250 SER B CA  1 
ATOM 4943  C C   . SER B 2 241 ? 66.380  70.215  67.007  1.00 10.00 ? 250 SER B C   1 
ATOM 4944  O O   . SER B 2 241 ? 66.077  70.550  68.155  1.00 10.00 ? 250 SER B O   1 
ATOM 4945  C CB  . SER B 2 241 ? 64.830  69.603  65.180  1.00 10.00 ? 250 SER B CB  1 
ATOM 4946  O OG  . SER B 2 241 ? 65.694  68.570  64.734  1.00 10.00 ? 250 SER B OG  1 
ATOM 4947  N N   . LEU B 2 242 ? 67.368  69.372  66.723  1.00 10.00 ? 251 LEU B N   1 
ATOM 4948  C CA  . LEU B 2 242 ? 68.188  68.770  67.772  1.00 10.00 ? 251 LEU B CA  1 
ATOM 4949  C C   . LEU B 2 242 ? 68.569  69.840  68.760  1.00 10.00 ? 251 LEU B C   1 
ATOM 4950  O O   . LEU B 2 242 ? 68.771  69.566  69.947  1.00 10.00 ? 251 LEU B O   1 
ATOM 4951  C CB  . LEU B 2 242 ? 69.472  68.196  67.206  1.00 10.00 ? 251 LEU B CB  1 
ATOM 4952  C CG  . LEU B 2 242 ? 70.775  68.940  67.459  1.00 10.00 ? 251 LEU B CG  1 
ATOM 4953  C CD1 . LEU B 2 242 ? 71.251  68.823  68.872  1.00 10.00 ? 251 LEU B CD1 1 
ATOM 4954  C CD2 . LEU B 2 242 ? 71.784  68.355  66.545  1.00 10.00 ? 251 LEU B CD2 1 
ATOM 4955  N N   . SER B 2 243 ? 68.681  71.064  68.254  1.00 10.00 ? 252 SER B N   1 
ATOM 4956  C CA  . SER B 2 243 ? 69.063  72.194  69.093  1.00 10.00 ? 252 SER B CA  1 
ATOM 4957  C C   . SER B 2 243 ? 68.089  72.373  70.252  1.00 10.00 ? 252 SER B C   1 
ATOM 4958  O O   . SER B 2 243 ? 68.493  72.411  71.403  1.00 10.00 ? 252 SER B O   1 
ATOM 4959  C CB  . SER B 2 243 ? 69.144  73.475  68.260  1.00 10.00 ? 252 SER B CB  1 
ATOM 4960  O OG  . SER B 2 243 ? 67.956  73.675  67.515  1.00 10.00 ? 252 SER B OG  1 
ATOM 4961  N N   . ILE B 2 244 ? 66.812  72.466  69.901  1.00 10.00 ? 253 ILE B N   1 
ATOM 4962  C CA  . ILE B 2 244 ? 65.754  72.613  70.875  1.00 10.00 ? 253 ILE B CA  1 
ATOM 4963  C C   . ILE B 2 244 ? 65.807  71.455  71.877  1.00 10.00 ? 253 ILE B C   1 
ATOM 4964  O O   . ILE B 2 244 ? 65.549  71.657  73.074  1.00 10.00 ? 253 ILE B O   1 
ATOM 4965  C CB  . ILE B 2 244 ? 64.354  72.731  70.148  1.00 10.00 ? 253 ILE B CB  1 
ATOM 4966  C CG1 . ILE B 2 244 ? 63.986  74.231  69.935  1.00 10.00 ? 253 ILE B CG1 1 
ATOM 4967  C CG2 . ILE B 2 244 ? 63.283  71.903  70.881  1.00 10.00 ? 253 ILE B CG2 1 
ATOM 4968  C CD1 . ILE B 2 244 ? 63.297  74.993  71.097  1.00 10.00 ? 253 ILE B CD1 1 
ATOM 4969  N N   . SER B 2 245 ? 66.153  70.248  71.427  1.00 10.00 ? 254 SER B N   1 
ATOM 4970  C CA  . SER B 2 245 ? 66.249  69.119  72.344  1.00 10.00 ? 254 SER B CA  1 
ATOM 4971  C C   . SER B 2 245 ? 67.265  69.393  73.447  1.00 10.00 ? 254 SER B C   1 
ATOM 4972  O O   . SER B 2 245 ? 67.111  68.973  74.593  1.00 10.00 ? 254 SER B O   1 
ATOM 4973  C CB  . SER B 2 245 ? 66.617  67.843  71.584  1.00 10.00 ? 254 SER B CB  1 
ATOM 4974  O OG  . SER B 2 245 ? 68.004  67.573  71.679  1.00 10.00 ? 254 SER B OG  1 
ATOM 4975  N N   . ALA B 2 246 ? 68.332  70.056  73.010  1.00 10.00 ? 255 ALA B N   1 
ATOM 4976  C CA  . ALA B 2 246 ? 69.471  70.440  73.839  1.00 10.00 ? 255 ALA B CA  1 
ATOM 4977  C C   . ALA B 2 246 ? 69.018  71.337  74.964  1.00 10.00 ? 255 ALA B C   1 
ATOM 4978  O O   . ALA B 2 246 ? 69.347  71.100  76.122  1.00 10.00 ? 255 ALA B O   1 
ATOM 4979  C CB  . ALA B 2 246 ? 70.543  71.172  72.988  1.00 10.00 ? 255 ALA B CB  1 
ATOM 4980  N N   . LEU B 2 247 ? 68.265  72.369  74.623  1.00 10.00 ? 256 LEU B N   1 
ATOM 4981  C CA  . LEU B 2 247 ? 67.810  73.277  75.681  1.00 10.00 ? 256 LEU B CA  1 
ATOM 4982  C C   . LEU B 2 247 ? 66.742  72.628  76.563  1.00 10.00 ? 256 LEU B C   1 
ATOM 4983  O O   . LEU B 2 247 ? 66.783  72.840  77.765  1.00 10.00 ? 256 LEU B O   1 
ATOM 4984  C CB  . LEU B 2 247 ? 67.265  74.577  75.078  1.00 10.00 ? 256 LEU B CB  1 
ATOM 4985  C CG  . LEU B 2 247 ? 68.242  75.404  74.239  1.00 10.00 ? 256 LEU B CG  1 
ATOM 4986  C CD1 . LEU B 2 247 ? 67.564  76.656  73.703  1.00 10.00 ? 256 LEU B CD1 1 
ATOM 4987  C CD2 . LEU B 2 247 ? 69.473  75.772  75.055  1.00 10.00 ? 256 LEU B CD2 1 
ATOM 4988  N N   . LEU B 2 248 ? 65.796  71.881  75.999  1.00 10.00 ? 257 LEU B N   1 
ATOM 4989  C CA  . LEU B 2 248 ? 64.929  71.168  76.958  1.00 10.00 ? 257 LEU B CA  1 
ATOM 4990  C C   . LEU B 2 248 ? 65.782  70.502  78.039  1.00 10.00 ? 257 LEU B C   1 
ATOM 4991  O O   . LEU B 2 248 ? 65.558  70.639  79.240  1.00 10.00 ? 257 LEU B O   1 
ATOM 4992  C CB  . LEU B 2 248 ? 64.113  70.075  76.258  1.00 10.00 ? 257 LEU B CB  1 
ATOM 4993  C CG  . LEU B 2 248 ? 62.955  70.606  75.411  1.00 10.00 ? 257 LEU B CG  1 
ATOM 4994  C CD1 . LEU B 2 248 ? 61.789  69.615  75.316  1.00 10.00 ? 257 LEU B CD1 1 
ATOM 4995  C CD2 . LEU B 2 248 ? 62.355  71.906  75.950  1.00 10.00 ? 257 LEU B CD2 1 
ATOM 4996  N N   . ALA B 2 249 ? 66.668  69.661  77.458  1.00 10.00 ? 258 ALA B N   1 
ATOM 4997  C CA  . ALA B 2 249 ? 67.701  69.010  78.246  1.00 10.00 ? 258 ALA B CA  1 
ATOM 4998  C C   . ALA B 2 249 ? 68.491  70.020  79.067  1.00 10.00 ? 258 ALA B C   1 
ATOM 4999  O O   . ALA B 2 249 ? 68.648  69.860  80.306  1.00 10.00 ? 258 ALA B O   1 
ATOM 5000  C CB  . ALA B 2 249 ? 68.632  68.215  77.346  1.00 10.00 ? 258 ALA B CB  1 
ATOM 5001  N N   . LEU B 2 250 ? 69.023  71.062  78.441  1.00 10.00 ? 259 LEU B N   1 
ATOM 5002  C CA  . LEU B 2 250 ? 69.797  72.024  79.208  1.00 10.00 ? 259 LEU B CA  1 
ATOM 5003  C C   . LEU B 2 250 ? 68.987  72.708  80.310  1.00 10.00 ? 259 LEU B C   1 
ATOM 5004  O O   . LEU B 2 250 ? 69.497  72.924  81.412  1.00 10.00 ? 259 LEU B O   1 
ATOM 5005  C CB  . LEU B 2 250 ? 70.439  73.077  78.282  1.00 10.00 ? 259 LEU B CB  1 
ATOM 5006  C CG  . LEU B 2 250 ? 71.787  73.699  78.709  1.00 10.00 ? 259 LEU B CG  1 
ATOM 5007  C CD1 . LEU B 2 250 ? 72.418  74.455  77.542  1.00 10.00 ? 259 LEU B CD1 1 
ATOM 5008  C CD2 . LEU B 2 250 ? 71.585  74.621  79.895  1.00 10.00 ? 259 LEU B CD2 1 
ATOM 5009  N N   . THR B 2 251 ? 67.741  73.048  80.027  1.00 10.00 ? 260 THR B N   1 
ATOM 5010  C CA  . THR B 2 251 ? 66.922  73.712  81.027  1.00 10.00 ? 260 THR B CA  1 
ATOM 5011  C C   . THR B 2 251 ? 66.496  72.795  82.168  1.00 10.00 ? 260 THR B C   1 
ATOM 5012  O O   . THR B 2 251 ? 66.513  73.217  83.320  1.00 10.00 ? 260 THR B O   1 
ATOM 5013  C CB  . THR B 2 251 ? 65.672  74.355  80.400  1.00 10.00 ? 260 THR B CB  1 
ATOM 5014  O OG1 . THR B 2 251 ? 66.076  75.266  79.370  1.00 10.00 ? 260 THR B OG1 1 
ATOM 5015  C CG2 . THR B 2 251 ? 64.881  75.125  81.456  1.00 10.00 ? 260 THR B CG2 1 
ATOM 5016  N N   . VAL B 2 252 ? 66.112  71.554  81.872  1.00 10.00 ? 261 VAL B N   1 
ATOM 5017  C CA  . VAL B 2 252 ? 65.710  70.650  82.942  1.00 10.00 ? 261 VAL B CA  1 
ATOM 5018  C C   . VAL B 2 252 ? 66.904  70.476  83.894  1.00 10.00 ? 261 VAL B C   1 
ATOM 5019  O O   . VAL B 2 252 ? 66.758  70.608  85.107  1.00 10.00 ? 261 VAL B O   1 
ATOM 5020  C CB  . VAL B 2 252 ? 65.237  69.300  82.389  1.00 10.00 ? 261 VAL B CB  1 
ATOM 5021  C CG1 . VAL B 2 252 ? 66.296  68.236  82.623  1.00 10.00 ? 261 VAL B CG1 1 
ATOM 5022  C CG2 . VAL B 2 252 ? 63.910  68.911  83.034  1.00 10.00 ? 261 VAL B CG2 1 
ATOM 5023  N N   . PHE B 2 253 ? 68.079  70.216  83.332  1.00 10.00 ? 262 PHE B N   1 
ATOM 5024  C CA  . PHE B 2 253 ? 69.306  70.068  84.103  1.00 10.00 ? 262 PHE B CA  1 
ATOM 5025  C C   . PHE B 2 253 ? 69.490  71.239  85.053  1.00 10.00 ? 262 PHE B C   1 
ATOM 5026  O O   . PHE B 2 253 ? 69.809  71.056  86.245  1.00 10.00 ? 262 PHE B O   1 
ATOM 5027  C CB  . PHE B 2 253 ? 70.511  69.945  83.172  1.00 10.00 ? 262 PHE B CB  1 
ATOM 5028  C CG  . PHE B 2 253 ? 70.426  68.785  82.229  1.00 10.00 ? 262 PHE B CG  1 
ATOM 5029  C CD1 . PHE B 2 253 ? 71.539  68.372  81.520  1.00 10.00 ? 262 PHE B CD1 1 
ATOM 5030  C CD2 . PHE B 2 253 ? 69.231  68.111  82.054  1.00 10.00 ? 262 PHE B CD2 1 
ATOM 5031  C CE1 . PHE B 2 253 ? 71.465  67.301  80.646  1.00 10.00 ? 262 PHE B CE1 1 
ATOM 5032  C CE2 . PHE B 2 253 ? 69.148  67.040  81.184  1.00 10.00 ? 262 PHE B CE2 1 
ATOM 5033  C CZ  . PHE B 2 253 ? 70.266  66.634  80.479  1.00 10.00 ? 262 PHE B CZ  1 
ATOM 5034  N N   . LEU B 2 254 ? 69.434  72.462  84.541  1.00 10.00 ? 263 LEU B N   1 
ATOM 5035  C CA  . LEU B 2 254 ? 69.646  73.609  85.392  1.00 10.00 ? 263 LEU B CA  1 
ATOM 5036  C C   . LEU B 2 254 ? 68.522  73.823  86.387  1.00 10.00 ? 263 LEU B C   1 
ATOM 5037  O O   . LEU B 2 254 ? 68.717  74.421  87.456  1.00 10.00 ? 263 LEU B O   1 
ATOM 5038  C CB  . LEU B 2 254 ? 69.877  74.852  84.534  1.00 10.00 ? 263 LEU B CB  1 
ATOM 5039  C CG  . LEU B 2 254 ? 71.361  75.203  84.377  1.00 10.00 ? 263 LEU B CG  1 
ATOM 5040  C CD1 . LEU B 2 254 ? 71.623  75.465  82.914  1.00 10.00 ? 263 LEU B CD1 1 
ATOM 5041  C CD2 . LEU B 2 254 ? 71.775  76.388  85.272  1.00 10.00 ? 263 LEU B CD2 1 
ATOM 5042  N N   . LEU B 2 255 ? 67.336  73.338  86.057  1.00 10.00 ? 264 LEU B N   1 
ATOM 5043  C CA  . LEU B 2 255 ? 66.230  73.506  86.968  1.00 10.00 ? 264 LEU B CA  1 
ATOM 5044  C C   . LEU B 2 255 ? 66.381  72.494  88.098  1.00 10.00 ? 264 LEU B C   1 
ATOM 5045  O O   . LEU B 2 255 ? 66.034  72.785  89.250  1.00 10.00 ? 264 LEU B O   1 
ATOM 5046  C CB  . LEU B 2 255 ? 64.894  73.347  86.236  1.00 10.00 ? 264 LEU B CB  1 
ATOM 5047  C CG  . LEU B 2 255 ? 64.591  74.517  85.283  1.00 10.00 ? 264 LEU B CG  1 
ATOM 5048  C CD1 . LEU B 2 255 ? 63.326  74.233  84.490  1.00 10.00 ? 264 LEU B CD1 1 
ATOM 5049  C CD2 . LEU B 2 255 ? 64.452  75.818  86.077  1.00 10.00 ? 264 LEU B CD2 1 
ATOM 5050  N N   . LEU B 2 256 ? 66.908  71.304  87.798  1.00 10.00 ? 265 LEU B N   1 
ATOM 5051  C CA  . LEU B 2 256 ? 67.124  70.292  88.864  1.00 10.00 ? 265 LEU B CA  1 
ATOM 5052  C C   . LEU B 2 256 ? 68.183  70.893  89.780  1.00 10.00 ? 265 LEU B C   1 
ATOM 5053  O O   . LEU B 2 256 ? 68.136  70.716  90.995  1.00 10.00 ? 265 LEU B O   1 
ATOM 5054  C CB  . LEU B 2 256 ? 67.698  68.958  88.344  1.00 10.00 ? 265 LEU B CB  1 
ATOM 5055  C CG  . LEU B 2 256 ? 67.301  68.310  87.022  1.00 10.00 ? 265 LEU B CG  1 
ATOM 5056  C CD1 . LEU B 2 256 ? 68.559  67.623  86.429  1.00 10.00 ? 265 LEU B CD1 1 
ATOM 5057  C CD2 . LEU B 2 256 ? 66.127  67.351  87.232  1.00 10.00 ? 265 LEU B CD2 1 
ATOM 5058  N N   . LEU B 2 257 ? 69.162  71.568  89.170  1.00 10.00 ? 266 LEU B N   1 
ATOM 5059  C CA  . LEU B 2 257 ? 70.224  72.221  89.929  1.00 10.00 ? 266 LEU B CA  1 
ATOM 5060  C C   . LEU B 2 257 ? 69.556  73.243  90.827  1.00 10.00 ? 266 LEU B C   1 
ATOM 5061  O O   . LEU B 2 257 ? 69.997  73.488  91.952  1.00 10.00 ? 266 LEU B O   1 
ATOM 5062  C CB  . LEU B 2 257 ? 71.210  72.922  88.994  1.00 10.00 ? 266 LEU B CB  1 
ATOM 5063  C CG  . LEU B 2 257 ? 72.248  72.037  88.301  1.00 10.00 ? 266 LEU B CG  1 
ATOM 5064  C CD1 . LEU B 2 257 ? 73.014  72.859  87.278  1.00 10.00 ? 266 LEU B CD1 1 
ATOM 5065  C CD2 . LEU B 2 257 ? 73.197  71.447  89.338  1.00 10.00 ? 266 LEU B CD2 1 
ATOM 5066  N N   . ALA B 2 258 ? 68.492  73.843  90.304  1.00 10.00 ? 267 ALA B N   1 
ATOM 5067  C CA  . ALA B 2 258 ? 67.715  74.814  91.040  1.00 10.00 ? 267 ALA B CA  1 
ATOM 5068  C C   . ALA B 2 258 ? 67.125  74.093  92.255  1.00 10.00 ? 267 ALA B C   1 
ATOM 5069  O O   . ALA B 2 258 ? 66.969  74.672  93.339  1.00 10.00 ? 267 ALA B O   1 
ATOM 5070  C CB  . ALA B 2 258 ? 66.628  75.325  90.172  1.00 10.00 ? 267 ALA B CB  1 
ATOM 5071  N N   . ASP B 2 259 ? 66.854  72.804  92.072  1.00 10.00 ? 268 ASP B N   1 
ATOM 5072  C CA  . ASP B 2 259 ? 66.271  71.925  93.063  1.00 10.00 ? 268 ASP B CA  1 
ATOM 5073  C C   . ASP B 2 259 ? 67.206  71.617  94.242  1.00 10.00 ? 268 ASP B C   1 
ATOM 5074  O O   . ASP B 2 259 ? 66.791  71.645  95.410  1.00 10.00 ? 268 ASP B O   1 
ATOM 5075  C CB  . ASP B 2 259 ? 65.848  70.620  92.386  1.00 10.00 ? 268 ASP B CB  1 
ATOM 5076  C CG  . ASP B 2 259 ? 64.537  70.724  91.653  1.00 10.00 ? 268 ASP B CG  1 
ATOM 5077  O OD1 . ASP B 2 259 ? 63.563  71.263  92.218  1.00 10.00 ? 268 ASP B OD1 1 
ATOM 5078  O OD2 . ASP B 2 259 ? 64.487  70.227  90.511  1.00 10.00 ? 268 ASP B OD2 1 
ATOM 5079  N N   . LYS B 2 260 ? 68.476  71.351  93.947  1.00 10.00 ? 269 LYS B N   1 
ATOM 5080  C CA  . LYS B 2 260 ? 69.418  70.983  94.994  1.00 10.00 ? 269 LYS B CA  1 
ATOM 5081  C C   . LYS B 2 260 ? 69.943  72.215  95.718  1.00 10.00 ? 269 LYS B C   1 
ATOM 5082  O O   . LYS B 2 260 ? 70.270  72.113  96.914  1.00 10.00 ? 269 LYS B O   1 
ATOM 5083  C CB  . LYS B 2 260 ? 70.578  70.174  94.412  1.00 10.00 ? 269 LYS B CB  1 
ATOM 5084  C CG  . LYS B 2 260 ? 71.340  70.891  93.309  1.00 10.00 ? 269 LYS B CG  1 
ATOM 5085  C CD  . LYS B 2 260 ? 72.312  71.911  93.882  1.00 10.00 ? 269 LYS B CD  1 
ATOM 5086  C CE  . LYS B 2 260 ? 72.863  72.820  92.795  1.00 10.00 ? 269 LYS B CE  1 
ATOM 5087  N NZ  . LYS B 2 260 ? 74.352  72.823  92.776  1.00 10.00 ? 269 LYS B NZ  1 
ATOM 5088  N N   . VAL B 2 261 ? 70.078  73.348  95.046  1.00 10.00 ? 270 VAL B N   1 
ATOM 5089  C CA  . VAL B 2 261 ? 70.579  74.584  95.675  1.00 10.00 ? 270 VAL B CA  1 
ATOM 5090  C C   . VAL B 2 261 ? 69.737  75.156  96.834  1.00 10.00 ? 270 VAL B C   1 
ATOM 5091  O O   . VAL B 2 261 ? 70.287  75.556  97.864  1.00 10.00 ? 270 VAL B O   1 
ATOM 5092  C CB  . VAL B 2 261 ? 70.754  75.718  94.635  1.00 10.00 ? 270 VAL B CB  1 
ATOM 5093  C CG1 . VAL B 2 261 ? 71.434  76.912  95.294  1.00 10.00 ? 270 VAL B CG1 1 
ATOM 5094  C CG2 . VAL B 2 261 ? 71.571  75.231  93.447  1.00 10.00 ? 270 VAL B CG2 1 
ATOM 5095  N N   . PRO B 2 262 ? 68.398  75.193  96.679  1.00 10.00 ? 271 PRO B N   1 
ATOM 5096  C CA  . PRO B 2 262 ? 67.587  75.745  97.762  1.00 10.00 ? 271 PRO B CA  1 
ATOM 5097  C C   . PRO B 2 262 ? 67.534  74.818  98.962  1.00 10.00 ? 271 PRO B C   1 
ATOM 5098  O O   . PRO B 2 262 ? 67.485  75.271  100.109 1.00 10.00 ? 271 PRO B O   1 
ATOM 5099  C CB  . PRO B 2 262 ? 66.228  75.895  97.109  1.00 10.00 ? 271 PRO B CB  1 
ATOM 5100  C CG  . PRO B 2 262 ? 66.142  74.617  96.345  1.00 10.00 ? 271 PRO B CG  1 
ATOM 5101  C CD  . PRO B 2 262 ? 67.539  74.477  95.725  1.00 10.00 ? 271 PRO B CD  1 
ATOM 5102  N N   . GLU B 2 263 ? 67.543  73.525  98.687  1.00 10.00 ? 272 GLU B N   1 
ATOM 5103  C CA  . GLU B 2 263 ? 67.473  72.561  99.778  1.00 10.00 ? 272 GLU B CA  1 
ATOM 5104  C C   . GLU B 2 263 ? 68.834  72.378  100.439 1.00 10.00 ? 272 GLU B C   1 
ATOM 5105  O O   . GLU B 2 263 ? 68.931  71.828  101.541 1.00 10.00 ? 272 GLU B O   1 
ATOM 5106  C CB  . GLU B 2 263 ? 66.939  71.218  99.274  1.00 10.00 ? 272 GLU B CB  1 
ATOM 5107  C CG  . GLU B 2 263 ? 66.611  70.227  100.379 1.00 10.00 ? 272 GLU B CG  1 
ATOM 5108  C CD  . GLU B 2 263 ? 66.107  68.903  99.842  1.00 10.00 ? 272 GLU B CD  1 
ATOM 5109  O OE1 . GLU B 2 263 ? 64.873  68.725  99.762  1.00 10.00 ? 272 GLU B OE1 1 
ATOM 5110  O OE2 . GLU B 2 263 ? 66.945  68.041  99.503  1.00 10.00 ? 272 GLU B OE2 1 
ATOM 5111  N N   . THR B 2 264 ? 69.910  72.823  99.791  1.00 10.00 ? 273 THR B N   1 
ATOM 5112  C CA  . THR B 2 264 ? 71.227  72.690  100.388 1.00 10.00 ? 273 THR B CA  1 
ATOM 5113  C C   . THR B 2 264 ? 71.560  73.912  101.225 1.00 10.00 ? 273 THR B C   1 
ATOM 5114  O O   . THR B 2 264 ? 72.283  73.802  102.221 1.00 10.00 ? 273 THR B O   1 
ATOM 5115  C CB  . THR B 2 264 ? 72.306  72.481  99.326  1.00 10.00 ? 273 THR B CB  1 
ATOM 5116  O OG1 . THR B 2 264 ? 72.166  73.470  98.299  1.00 10.00 ? 273 THR B OG1 1 
ATOM 5117  C CG2 . THR B 2 264 ? 72.192  71.091  98.720  1.00 10.00 ? 273 THR B CG2 1 
ATOM 5118  N N   . SER B 2 265 ? 71.074  75.097  100.844 1.00 10.00 ? 274 SER B N   1 
ATOM 5119  C CA  . SER B 2 265 ? 71.360  76.274  101.644 1.00 10.00 ? 274 SER B CA  1 
ATOM 5120  C C   . SER B 2 265 ? 70.416  76.100  102.825 1.00 10.00 ? 274 SER B C   1 
ATOM 5121  O O   . SER B 2 265 ? 70.661  76.633  103.879 1.00 10.00 ? 274 SER B O   1 
ATOM 5122  C CB  . SER B 2 265 ? 71.065  77.571  100.872 1.00 10.00 ? 274 SER B CB  1 
ATOM 5123  O OG  . SER B 2 265 ? 69.691  77.675  100.519 1.00 10.00 ? 274 SER B OG  1 
ATOM 5124  N N   . LEU B 2 266 ? 69.368  75.319  102.631 1.00 10.00 ? 275 LEU B N   1 
ATOM 5125  C CA  . LEU B 2 266 ? 68.355  75.033  103.651 1.00 10.00 ? 275 LEU B CA  1 
ATOM 5126  C C   . LEU B 2 266 ? 68.987  74.781  105.022 1.00 10.00 ? 275 LEU B C   1 
ATOM 5127  O O   . LEU B 2 266 ? 68.257  74.772  106.019 1.00 10.00 ? 275 LEU B O   1 
ATOM 5128  C CB  . LEU B 2 266 ? 67.505  73.824  103.243 1.00 10.00 ? 275 LEU B CB  1 
ATOM 5129  C CG  . LEU B 2 266 ? 66.494  74.048  102.117 1.00 10.00 ? 275 LEU B CG  1 
ATOM 5130  C CD1 . LEU B 2 266 ? 65.394  72.999  102.164 1.00 10.00 ? 275 LEU B CD1 1 
ATOM 5131  C CD2 . LEU B 2 266 ? 65.900  75.447  102.198 1.00 10.00 ? 275 LEU B CD2 1 
ATOM 5132  N N   . SER B 2 267 ? 70.279  74.542  105.112 1.00 10.00 ? 276 SER B N   1 
ATOM 5133  C CA  . SER B 2 267 ? 70.875  74.286  106.429 1.00 10.00 ? 276 SER B CA  1 
ATOM 5134  C C   . SER B 2 267 ? 72.147  75.067  106.676 1.00 10.00 ? 276 SER B C   1 
ATOM 5135  O O   . SER B 2 267 ? 72.698  75.037  107.778 1.00 10.00 ? 276 SER B O   1 
ATOM 5136  C CB  . SER B 2 267 ? 71.173  72.789  106.629 1.00 10.00 ? 276 SER B CB  1 
ATOM 5137  O OG  . SER B 2 267 ? 72.276  72.599  107.503 1.00 10.00 ? 276 SER B OG  1 
ATOM 5138  N N   . VAL B 2 268 ? 72.626  75.772  105.662 1.00 10.00 ? 277 VAL B N   1 
ATOM 5139  C CA  . VAL B 2 268 ? 73.860  76.516  105.839 1.00 10.00 ? 277 VAL B CA  1 
ATOM 5140  C C   . VAL B 2 268 ? 73.942  77.797  104.959 1.00 10.00 ? 277 VAL B C   1 
ATOM 5141  O O   . VAL B 2 268 ? 75.003  78.139  104.471 1.00 10.00 ? 277 VAL B O   1 
ATOM 5142  C CB  . VAL B 2 268 ? 75.123  75.516  105.629 1.00 10.00 ? 277 VAL B CB  1 
ATOM 5143  C CG1 . VAL B 2 268 ? 74.954  74.257  106.476 1.00 10.00 ? 277 VAL B CG1 1 
ATOM 5144  C CG2 . VAL B 2 268 ? 75.297  75.098  104.163 1.00 10.00 ? 277 VAL B CG2 1 
ATOM 5145  N N   . PRO B 2 269 ? 72.828  78.561  104.815 1.00 10.00 ? 278 PRO B N   1 
ATOM 5146  C CA  . PRO B 2 269 ? 72.796  79.773  104.002 1.00 10.00 ? 278 PRO B CA  1 
ATOM 5147  C C   . PRO B 2 269 ? 73.493  80.998  104.597 1.00 10.00 ? 278 PRO B C   1 
ATOM 5148  O O   . PRO B 2 269 ? 73.637  81.130  105.815 1.00 10.00 ? 278 PRO B O   1 
ATOM 5149  C CB  . PRO B 2 269 ? 71.295  80.002  103.808 1.00 10.00 ? 278 PRO B CB  1 
ATOM 5150  C CG  . PRO B 2 269 ? 70.765  79.650  105.150 1.00 10.00 ? 278 PRO B CG  1 
ATOM 5151  C CD  . PRO B 2 269 ? 71.562  78.397  105.535 1.00 10.00 ? 278 PRO B CD  1 
ATOM 5152  N N   . ILE B 2 270 ? 73.962  81.844  103.737 1.00 10.00 ? 279 ILE B N   1 
ATOM 5153  C CA  . ILE B 2 270 ? 74.589  83.126  104.021 1.00 10.00 ? 279 ILE B CA  1 
ATOM 5154  C C   . ILE B 2 270 ? 74.414  84.074  102.826 1.00 10.00 ? 279 ILE B C   1 
ATOM 5155  O O   . ILE B 2 270 ? 73.486  83.773  102.059 1.00 10.00 ? 279 ILE B O   1 
ATOM 5156  C CB  . ILE B 2 270 ? 76.074  82.979  104.376 1.00 10.00 ? 279 ILE B CB  1 
ATOM 5157  C CG1 . ILE B 2 270 ? 76.230  82.203  105.684 1.00 10.00 ? 279 ILE B CG1 1 
ATOM 5158  C CG2 . ILE B 2 270 ? 76.729  84.348  104.477 1.00 10.00 ? 279 ILE B CG2 1 
ATOM 5159  C CD1 . ILE B 2 270 ? 77.095  80.968  105.563 1.00 10.00 ? 279 ILE B CD1 1 
ATOM 5160  N N   . ILE B 2 271 ? 75.261  85.025  102.600 1.00 10.00 ? 280 ILE B N   1 
ATOM 5161  C CA  . ILE B 2 271 ? 75.059  85.887  101.424 1.00 10.00 ? 280 ILE B CA  1 
ATOM 5162  C C   . ILE B 2 271 ? 74.980  85.119  100.122 1.00 10.00 ? 280 ILE B C   1 
ATOM 5163  O O   . ILE B 2 271 ? 75.567  84.050  99.978  1.00 10.00 ? 280 ILE B O   1 
ATOM 5164  C CB  . ILE B 2 271 ? 76.140  87.041  101.236 1.00 10.00 ? 280 ILE B CB  1 
ATOM 5165  C CG1 . ILE B 2 271 ? 77.551  86.609  101.697 1.00 10.00 ? 280 ILE B CG1 1 
ATOM 5166  C CG2 . ILE B 2 271 ? 75.597  88.332  101.893 1.00 10.00 ? 280 ILE B CG2 1 
ATOM 5167  C CD1 . ILE B 2 271 ? 77.765  86.703  103.162 1.00 10.00 ? 280 ILE B CD1 1 
ATOM 5168  N N   . ILE B 2 272 ? 74.267  85.722  99.179  1.00 10.00 ? 281 ILE B N   1 
ATOM 5169  C CA  . ILE B 2 272 ? 74.002  85.189  97.836  1.00 10.00 ? 281 ILE B CA  1 
ATOM 5170  C C   . ILE B 2 272 ? 75.234  85.146  96.922  1.00 10.00 ? 281 ILE B C   1 
ATOM 5171  O O   . ILE B 2 272 ? 75.287  84.325  96.010  1.00 10.00 ? 281 ILE B O   1 
ATOM 5172  C CB  . ILE B 2 272 ? 72.873  86.022  97.093  1.00 10.00 ? 281 ILE B CB  1 
ATOM 5173  C CG1 . ILE B 2 272 ? 71.593  86.113  97.931  1.00 10.00 ? 281 ILE B CG1 1 
ATOM 5174  C CG2 . ILE B 2 272 ? 72.466  85.352  95.824  1.00 10.00 ? 281 ILE B CG2 1 
ATOM 5175  C CD1 . ILE B 2 272 ? 71.753  86.829  99.273  1.00 10.00 ? 281 ILE B CD1 1 
ATOM 5176  N N   . SER B 2 273 ? 76.203  86.034  97.153  1.00 10.00 ? 282 SER B N   1 
ATOM 5177  C CA  . SER B 2 273 ? 77.427  86.098  96.355  1.00 10.00 ? 282 SER B CA  1 
ATOM 5178  C C   . SER B 2 273 ? 77.480  85.114  95.201  1.00 10.00 ? 282 SER B C   1 
ATOM 5179  O O   . SER B 2 273 ? 77.174  85.429  94.045  1.00 10.00 ? 282 SER B O   1 
ATOM 5180  C CB  . SER B 2 273 ? 78.625  85.811  97.232  1.00 10.00 ? 282 SER B CB  1 
ATOM 5181  O OG  . SER B 2 273 ? 79.731  85.483  96.417  1.00 10.00 ? 282 SER B OG  1 
ATOM 5182  N N   . TYR B 2 274 ? 77.923  83.914  95.551  1.00 10.00 ? 283 TYR B N   1 
ATOM 5183  C CA  . TYR B 2 274 ? 78.043  82.802  94.612  1.00 10.00 ? 283 TYR B CA  1 
ATOM 5184  C C   . TYR B 2 274 ? 76.762  82.677  93.797  1.00 10.00 ? 283 TYR B C   1 
ATOM 5185  O O   . TYR B 2 274 ? 76.777  82.741  92.571  1.00 10.00 ? 283 TYR B O   1 
ATOM 5186  C CB  . TYR B 2 274 ? 78.243  81.473  95.355  1.00 10.00 ? 283 TYR B CB  1 
ATOM 5187  C CG  . TYR B 2 274 ? 79.421  81.381  96.304  1.00 10.00 ? 283 TYR B CG  1 
ATOM 5188  C CD1 . TYR B 2 274 ? 79.579  82.287  97.353  1.00 10.00 ? 283 TYR B CD1 1 
ATOM 5189  C CD2 . TYR B 2 274 ? 80.332  80.329  96.203  1.00 10.00 ? 283 TYR B CD2 1 
ATOM 5190  C CE1 . TYR B 2 274 ? 80.610  82.141  98.281  1.00 10.00 ? 283 TYR B CE1 1 
ATOM 5191  C CE2 . TYR B 2 274 ? 81.362  80.174  97.124  1.00 10.00 ? 283 TYR B CE2 1 
ATOM 5192  C CZ  . TYR B 2 274 ? 81.493  81.080  98.160  1.00 10.00 ? 283 TYR B CZ  1 
ATOM 5193  O OH  . TYR B 2 274 ? 82.487  80.903  99.092  1.00 10.00 ? 283 TYR B OH  1 
ATOM 5194  N N   . LEU B 2 275 ? 75.655  82.481  94.506  1.00 10.00 ? 284 LEU B N   1 
ATOM 5195  C CA  . LEU B 2 275 ? 74.333  82.319  93.886  1.00 10.00 ? 284 LEU B CA  1 
ATOM 5196  C C   . LEU B 2 275 ? 73.931  83.628  93.179  1.00 10.00 ? 284 LEU B C   1 
ATOM 5197  O O   . LEU B 2 275 ? 73.437  83.608  92.049  1.00 10.00 ? 284 LEU B O   1 
ATOM 5198  C CB  . LEU B 2 275 ? 73.263  81.909  94.956  1.00 10.00 ? 284 LEU B CB  1 
ATOM 5199  C CG  . LEU B 2 275 ? 72.383  80.605  94.908  1.00 10.00 ? 284 LEU B CG  1 
ATOM 5200  C CD1 . LEU B 2 275 ? 71.381  80.541  96.085  1.00 10.00 ? 284 LEU B CD1 1 
ATOM 5201  C CD2 . LEU B 2 275 ? 71.600  80.526  93.596  1.00 10.00 ? 284 LEU B CD2 1 
ATOM 5202  N N   . MET B 2 276 ? 74.197  84.768  93.816  1.00 10.00 ? 285 MET B N   1 
ATOM 5203  C CA  . MET B 2 276 ? 73.810  86.072  93.246  1.00 10.00 ? 285 MET B CA  1 
ATOM 5204  C C   . MET B 2 276 ? 74.192  86.123  91.781  1.00 10.00 ? 285 MET B C   1 
ATOM 5205  O O   . MET B 2 276 ? 73.323  86.308  90.945  1.00 10.00 ? 285 MET B O   1 
ATOM 5206  C CB  . MET B 2 276 ? 74.502  87.233  94.013  1.00 10.00 ? 285 MET B CB  1 
ATOM 5207  C CG  . MET B 2 276 ? 73.779  88.564  94.143  1.00 10.00 ? 285 MET B CG  1 
ATOM 5208  S SD  . MET B 2 276 ? 74.710  89.472  95.399  1.00 10.00 ? 285 MET B SD  1 
ATOM 5209  C CE  . MET B 2 276 ? 76.351  89.447  94.670  1.00 10.00 ? 285 MET B CE  1 
ATOM 5210  N N   . PHE B 2 277 ? 75.471  85.901  91.484  1.00 10.00 ? 286 PHE B N   1 
ATOM 5211  C CA  . PHE B 2 277 ? 75.940  86.027  90.111  1.00 10.00 ? 286 PHE B CA  1 
ATOM 5212  C C   . PHE B 2 277 ? 75.750  84.714  89.360  1.00 10.00 ? 286 PHE B C   1 
ATOM 5213  O O   . PHE B 2 277 ? 75.485  84.755  88.120  1.00 10.00 ? 286 PHE B O   1 
ATOM 5214  C CB  . PHE B 2 277 ? 77.419  86.429  90.060  1.00 10.00 ? 286 PHE B CB  1 
ATOM 5215  C CG  . PHE B 2 277 ? 78.344  85.537  90.839  1.00 10.00 ? 286 PHE B CG  1 
ATOM 5216  C CD1 . PHE B 2 277 ? 78.724  84.307  90.328  1.00 10.00 ? 286 PHE B CD1 1 
ATOM 5217  C CD2 . PHE B 2 277 ? 78.834  85.923  92.073  1.00 10.00 ? 286 PHE B CD2 1 
ATOM 5218  C CE1 . PHE B 2 277 ? 79.572  83.477  91.035  1.00 10.00 ? 286 PHE B CE1 1 
ATOM 5219  C CE2 . PHE B 2 277 ? 79.683  85.097  92.788  1.00 10.00 ? 286 PHE B CE2 1 
ATOM 5220  C CZ  . PHE B 2 277 ? 80.052  83.873  92.267  1.00 10.00 ? 286 PHE B CZ  1 
ATOM 5221  N N   . ILE B 2 278 ? 75.898  83.523  89.950  1.00 10.00 ? 287 ILE B N   1 
ATOM 5222  C CA  . ILE B 2 278 ? 75.692  82.274  89.195  1.00 10.00 ? 287 ILE B CA  1 
ATOM 5223  C C   . ILE B 2 278 ? 74.196  82.297  88.812  1.00 10.00 ? 287 ILE B C   1 
ATOM 5224  O O   . ILE B 2 278 ? 73.790  81.716  87.823  1.00 10.00 ? 287 ILE B O   1 
ATOM 5225  C CB  . ILE B 2 278 ? 76.083  80.983  90.018  1.00 10.00 ? 287 ILE B CB  1 
ATOM 5226  C CG1 . ILE B 2 278 ? 75.109  80.749  91.174  1.00 10.00 ? 287 ILE B CG1 1 
ATOM 5227  C CG2 . ILE B 2 278 ? 77.522  81.102  90.530  1.00 10.00 ? 287 ILE B CG2 1 
ATOM 5228  C CD1 . ILE B 2 278 ? 73.770  80.107  90.798  1.00 10.00 ? 287 ILE B CD1 1 
ATOM 5229  N N   . MET B 2 279 ? 73.421  83.080  89.574  1.00 10.00 ? 288 MET B N   1 
ATOM 5230  C CA  . MET B 2 279 ? 71.979  83.292  89.383  1.00 10.00 ? 288 MET B CA  1 
ATOM 5231  C C   . MET B 2 279 ? 71.854  84.093  88.083  1.00 10.00 ? 288 MET B C   1 
ATOM 5232  O O   . MET B 2 279 ? 70.949  83.895  87.267  1.00 10.00 ? 288 MET B O   1 
ATOM 5233  C CB  . MET B 2 279 ? 71.424  84.104  90.583  1.00 10.00 ? 288 MET B CB  1 
ATOM 5234  C CG  . MET B 2 279 ? 70.037  84.724  90.424  1.00 10.00 ? 288 MET B CG  1 
ATOM 5235  S SD  . MET B 2 279 ? 68.661  83.961  91.351  1.00 10.00 ? 288 MET B SD  1 
ATOM 5236  C CE  . MET B 2 279 ? 67.300  84.120  90.114  1.00 10.00 ? 288 MET B CE  1 
ATOM 5237  N N   . ILE B 2 280 ? 72.817  84.984  87.901  1.00 10.00 ? 289 ILE B N   1 
ATOM 5238  C CA  . ILE B 2 280 ? 72.896  85.859  86.735  1.00 10.00 ? 289 ILE B CA  1 
ATOM 5239  C C   . ILE B 2 280 ? 73.467  85.030  85.611  1.00 10.00 ? 289 ILE B C   1 
ATOM 5240  O O   . ILE B 2 280 ? 72.959  85.018  84.492  1.00 10.00 ? 289 ILE B O   1 
ATOM 5241  C CB  . ILE B 2 280 ? 73.820  87.058  87.023  1.00 10.00 ? 289 ILE B CB  1 
ATOM 5242  C CG1 . ILE B 2 280 ? 73.454  87.683  88.372  1.00 10.00 ? 289 ILE B CG1 1 
ATOM 5243  C CG2 . ILE B 2 280 ? 73.675  88.100  85.945  1.00 10.00 ? 289 ILE B CG2 1 
ATOM 5244  C CD1 . ILE B 2 280 ? 72.021  88.173  88.465  1.00 10.00 ? 289 ILE B CD1 1 
ATOM 5245  N N   . LEU B 2 281 ? 74.493  84.255  85.959  1.00 10.00 ? 290 LEU B N   1 
ATOM 5246  C CA  . LEU B 2 281 ? 75.182  83.355  85.042  1.00 10.00 ? 290 LEU B CA  1 
ATOM 5247  C C   . LEU B 2 281 ? 74.126  82.355  84.575  1.00 10.00 ? 290 LEU B C   1 
ATOM 5248  O O   . LEU B 2 281 ? 74.120  81.894  83.426  1.00 10.00 ? 290 LEU B O   1 
ATOM 5249  C CB  . LEU B 2 281 ? 76.317  82.637  85.795  1.00 10.00 ? 290 LEU B CB  1 
ATOM 5250  C CG  . LEU B 2 281 ? 77.602  83.413  86.103  1.00 10.00 ? 290 LEU B CG  1 
ATOM 5251  C CD1 . LEU B 2 281 ? 78.167  83.078  87.466  1.00 10.00 ? 290 LEU B CD1 1 
ATOM 5252  C CD2 . LEU B 2 281 ? 78.605  83.081  85.013  1.00 10.00 ? 290 LEU B CD2 1 
ATOM 5253  N N   . VAL B 2 282 ? 73.211  82.055  85.490  1.00 10.00 ? 291 VAL B N   1 
ATOM 5254  C CA  . VAL B 2 282 ? 72.131  81.129  85.229  1.00 10.00 ? 291 VAL B CA  1 
ATOM 5255  C C   . VAL B 2 282 ? 71.263  81.784  84.175  1.00 10.00 ? 291 VAL B C   1 
ATOM 5256  O O   . VAL B 2 282 ? 71.154  81.276  83.059  1.00 10.00 ? 291 VAL B O   1 
ATOM 5257  C CB  . VAL B 2 282 ? 71.318  80.836  86.534  1.00 10.00 ? 291 VAL B CB  1 
ATOM 5258  C CG1 . VAL B 2 282 ? 70.007  81.625  86.566  1.00 10.00 ? 291 VAL B CG1 1 
ATOM 5259  C CG2 . VAL B 2 282 ? 71.032  79.325  86.635  1.00 10.00 ? 291 VAL B CG2 1 
ATOM 5260  N N   . ALA B 2 283 ? 70.663  82.913  84.548  1.00 10.00 ? 292 ALA B N   1 
ATOM 5261  C CA  . ALA B 2 283 ? 69.825  83.709  83.699  1.00 10.00 ? 292 ALA B CA  1 
ATOM 5262  C C   . ALA B 2 283 ? 70.524  83.917  82.353  1.00 10.00 ? 292 ALA B C   1 
ATOM 5263  O O   . ALA B 2 283 ? 69.892  83.936  81.283  1.00 10.00 ? 292 ALA B O   1 
ATOM 5264  C CB  . ALA B 2 283 ? 69.584  85.033  84.383  1.00 10.00 ? 292 ALA B CB  1 
ATOM 5265  N N   . PHE B 2 284 ? 71.835  84.044  82.420  1.00 10.00 ? 293 PHE B N   1 
ATOM 5266  C CA  . PHE B 2 284 ? 72.611  84.271  81.229  1.00 10.00 ? 293 PHE B CA  1 
ATOM 5267  C C   . PHE B 2 284 ? 72.533  83.083  80.271  1.00 10.00 ? 293 PHE B C   1 
ATOM 5268  O O   . PHE B 2 284 ? 72.002  83.228  79.178  1.00 10.00 ? 293 PHE B O   1 
ATOM 5269  C CB  . PHE B 2 284 ? 74.030  84.653  81.642  1.00 10.00 ? 293 PHE B CB  1 
ATOM 5270  C CG  . PHE B 2 284 ? 74.121  86.069  82.219  1.00 10.00 ? 293 PHE B CG  1 
ATOM 5271  C CD1 . PHE B 2 284 ? 75.334  86.591  82.686  1.00 10.00 ? 293 PHE B CD1 1 
ATOM 5272  C CD2 . PHE B 2 284 ? 73.005  86.929  82.184  1.00 10.00 ? 293 PHE B CD2 1 
ATOM 5273  C CE1 . PHE B 2 284 ? 75.445  87.953  83.092  1.00 10.00 ? 293 PHE B CE1 1 
ATOM 5274  C CE2 . PHE B 2 284 ? 73.101  88.283  82.586  1.00 10.00 ? 293 PHE B CE2 1 
ATOM 5275  C CZ  . PHE B 2 284 ? 74.329  88.794  83.036  1.00 10.00 ? 293 PHE B CZ  1 
ATOM 5276  N N   . SER B 2 285 ? 73.033  81.907  80.671  1.00 10.00 ? 294 SER B N   1 
ATOM 5277  C CA  . SER B 2 285 ? 72.951  80.690  79.830  1.00 10.00 ? 294 SER B CA  1 
ATOM 5278  C C   . SER B 2 285 ? 71.472  80.421  79.502  1.00 10.00 ? 294 SER B C   1 
ATOM 5279  O O   . SER B 2 285 ? 71.122  79.975  78.399  1.00 10.00 ? 294 SER B O   1 
ATOM 5280  C CB  . SER B 2 285 ? 73.549  79.439  80.548  1.00 10.00 ? 294 SER B CB  1 
ATOM 5281  O OG  . SER B 2 285 ? 74.903  79.203  80.170  1.00 10.00 ? 294 SER B OG  1 
ATOM 5282  N N   . VAL B 2 286 ? 70.604  80.710  80.468  1.00 10.00 ? 295 VAL B N   1 
ATOM 5283  C CA  . VAL B 2 286 ? 69.164  80.490  80.298  1.00 10.00 ? 295 VAL B CA  1 
ATOM 5284  C C   . VAL B 2 286 ? 68.601  81.212  79.085  1.00 10.00 ? 295 VAL B C   1 
ATOM 5285  O O   . VAL B 2 286 ? 68.101  80.575  78.182  1.00 10.00 ? 295 VAL B O   1 
ATOM 5286  C CB  . VAL B 2 286 ? 68.357  80.939  81.547  1.00 10.00 ? 295 VAL B CB  1 
ATOM 5287  C CG1 . VAL B 2 286 ? 66.883  81.216  81.165  1.00 10.00 ? 295 VAL B CG1 1 
ATOM 5288  C CG2 . VAL B 2 286 ? 68.428  79.857  82.629  1.00 10.00 ? 295 VAL B CG2 1 
ATOM 5289  N N   . ILE B 2 287 ? 68.681  82.539  79.114  1.00 10.00 ? 296 ILE B N   1 
ATOM 5290  C CA  . ILE B 2 287 ? 68.225  83.489  78.079  1.00 10.00 ? 296 ILE B CA  1 
ATOM 5291  C C   . ILE B 2 287 ? 69.107  83.438  76.829  1.00 10.00 ? 296 ILE B C   1 
ATOM 5292  O O   . ILE B 2 287 ? 68.654  83.652  75.690  1.00 10.00 ? 296 ILE B O   1 
ATOM 5293  C CB  . ILE B 2 287 ? 68.269  84.989  78.626  1.00 10.00 ? 296 ILE B CB  1 
ATOM 5294  C CG1 . ILE B 2 287 ? 67.032  85.285  79.488  1.00 10.00 ? 296 ILE B CG1 1 
ATOM 5295  C CG2 . ILE B 2 287 ? 68.388  85.996  77.467  1.00 10.00 ? 296 ILE B CG2 1 
ATOM 5296  C CD1 . ILE B 2 287 ? 65.705  85.319  78.722  1.00 10.00 ? 296 ILE B CD1 1 
ATOM 5297  N N   . LEU B 2 288 ? 70.380  83.145  77.027  1.00 10.00 ? 297 LEU B N   1 
ATOM 5298  C CA  . LEU B 2 288 ? 71.253  83.161  75.871  1.00 10.00 ? 297 LEU B CA  1 
ATOM 5299  C C   . LEU B 2 288 ? 70.862  82.020  75.010  1.00 10.00 ? 297 LEU B C   1 
ATOM 5300  O O   . LEU B 2 288 ? 70.817  82.151  73.797  1.00 10.00 ? 297 LEU B O   1 
ATOM 5301  C CB  . LEU B 2 288 ? 72.721  83.058  76.246  1.00 10.00 ? 297 LEU B CB  1 
ATOM 5302  C CG  . LEU B 2 288 ? 73.418  83.785  75.093  1.00 10.00 ? 297 LEU B CG  1 
ATOM 5303  C CD1 . LEU B 2 288 ? 74.721  84.344  75.536  1.00 10.00 ? 297 LEU B CD1 1 
ATOM 5304  C CD2 . LEU B 2 288 ? 73.621  82.856  73.927  1.00 10.00 ? 297 LEU B CD2 1 
ATOM 5305  N N   . SER B 2 289 ? 70.576  80.899  75.657  1.00 10.00 ? 298 SER B N   1 
ATOM 5306  C CA  . SER B 2 289 ? 70.163  79.691  74.966  1.00 10.00 ? 298 SER B CA  1 
ATOM 5307  C C   . SER B 2 289 ? 68.756  79.854  74.389  1.00 10.00 ? 298 SER B C   1 
ATOM 5308  O O   . SER B 2 289 ? 68.422  79.256  73.366  1.00 10.00 ? 298 SER B O   1 
ATOM 5309  C CB  . SER B 2 289 ? 70.195  78.505  75.925  1.00 10.00 ? 298 SER B CB  1 
ATOM 5310  O OG  . SER B 2 289 ? 69.161  78.602  76.886  1.00 10.00 ? 298 SER B OG  1 
ATOM 5311  N N   . VAL B 2 290 ? 67.937  80.672  75.038  1.00 10.00 ? 299 VAL B N   1 
ATOM 5312  C CA  . VAL B 2 290 ? 66.584  80.900  74.570  1.00 10.00 ? 299 VAL B CA  1 
ATOM 5313  C C   . VAL B 2 290 ? 66.533  81.947  73.455  1.00 10.00 ? 299 VAL B C   1 
ATOM 5314  O O   . VAL B 2 290 ? 65.717  81.840  72.537  1.00 10.00 ? 299 VAL B O   1 
ATOM 5315  C CB  . VAL B 2 290 ? 65.675  81.317  75.738  1.00 10.00 ? 299 VAL B CB  1 
ATOM 5316  C CG1 . VAL B 2 290 ? 64.292  81.713  75.221  1.00 10.00 ? 299 VAL B CG1 1 
ATOM 5317  C CG2 . VAL B 2 290 ? 65.570  80.160  76.728  1.00 10.00 ? 299 VAL B CG2 1 
ATOM 5318  N N   . VAL B 2 291 ? 67.394  82.960  73.510  1.00 10.00 ? 300 VAL B N   1 
ATOM 5319  C CA  . VAL B 2 291 ? 67.358  83.952  72.431  1.00 10.00 ? 300 VAL B CA  1 
ATOM 5320  C C   . VAL B 2 291 ? 68.092  83.358  71.233  1.00 10.00 ? 300 VAL B C   1 
ATOM 5321  O O   . VAL B 2 291 ? 67.762  83.675  70.094  1.00 10.00 ? 300 VAL B O   1 
ATOM 5322  C CB  . VAL B 2 291 ? 67.937  85.381  72.825  1.00 10.00 ? 300 VAL B CB  1 
ATOM 5323  C CG1 . VAL B 2 291 ? 69.471  85.425  72.744  1.00 10.00 ? 300 VAL B CG1 1 
ATOM 5324  C CG2 . VAL B 2 291 ? 67.322  86.443  71.912  1.00 10.00 ? 300 VAL B CG2 1 
ATOM 5325  N N   . VAL B 2 292 ? 69.070  82.484  71.482  1.00 10.00 ? 301 VAL B N   1 
ATOM 5326  C CA  . VAL B 2 292 ? 69.767  81.824  70.379  1.00 10.00 ? 301 VAL B CA  1 
ATOM 5327  C C   . VAL B 2 292 ? 68.673  80.941  69.798  1.00 10.00 ? 301 VAL B C   1 
ATOM 5328  O O   . VAL B 2 292 ? 68.663  80.627  68.608  1.00 10.00 ? 301 VAL B O   1 
ATOM 5329  C CB  . VAL B 2 292 ? 70.892  80.877  70.844  1.00 10.00 ? 301 VAL B CB  1 
ATOM 5330  C CG1 . VAL B 2 292 ? 72.141  81.640  71.284  1.00 10.00 ? 301 VAL B CG1 1 
ATOM 5331  C CG2 . VAL B 2 292 ? 70.412  80.078  71.954  1.00 10.00 ? 301 VAL B CG2 1 
ATOM 5332  N N   . LEU B 2 293 ? 67.755  80.531  70.668  1.00 10.00 ? 302 LEU B N   1 
ATOM 5333  C CA  . LEU B 2 293 ? 66.650  79.701  70.252  1.00 10.00 ? 302 LEU B CA  1 
ATOM 5334  C C   . LEU B 2 293 ? 65.811  80.620  69.381  1.00 10.00 ? 302 LEU B C   1 
ATOM 5335  O O   . LEU B 2 293 ? 65.235  80.193  68.385  1.00 10.00 ? 302 LEU B O   1 
ATOM 5336  C CB  . LEU B 2 293 ? 65.864  79.214  71.470  1.00 10.00 ? 302 LEU B CB  1 
ATOM 5337  C CG  . LEU B 2 293 ? 65.076  77.916  71.294  1.00 10.00 ? 302 LEU B CG  1 
ATOM 5338  C CD1 . LEU B 2 293 ? 65.973  76.839  70.691  1.00 10.00 ? 302 LEU B CD1 1 
ATOM 5339  C CD2 . LEU B 2 293 ? 64.537  77.482  72.648  1.00 10.00 ? 302 LEU B CD2 1 
ATOM 5340  N N   . ASN B 2 294 ? 65.750  81.898  69.741  1.00 10.00 ? 303 ASN B N   1 
ATOM 5341  C CA  . ASN B 2 294 ? 64.991  82.814  68.901  1.00 10.00 ? 303 ASN B CA  1 
ATOM 5342  C C   . ASN B 2 294 ? 65.903  83.158  67.716  1.00 10.00 ? 303 ASN B C   1 
ATOM 5343  O O   . ASN B 2 294 ? 65.434  83.553  66.654  1.00 10.00 ? 303 ASN B O   1 
ATOM 5344  C CB  . ASN B 2 294 ? 64.549  84.066  69.661  1.00 10.00 ? 303 ASN B CB  1 
ATOM 5345  C CG  . ASN B 2 294 ? 63.240  84.602  69.137  1.00 10.00 ? 303 ASN B CG  1 
ATOM 5346  O OD1 . ASN B 2 294 ? 62.958  84.476  67.941  1.00 10.00 ? 303 ASN B OD1 1 
ATOM 5347  N ND2 . ASN B 2 294 ? 62.434  85.213  70.016  1.00 10.00 ? 303 ASN B ND2 1 
ATOM 5348  N N   . LEU B 2 295 ? 67.205  82.929  67.898  1.00 10.00 ? 304 LEU B N   1 
ATOM 5349  C CA  . LEU B 2 295 ? 68.195  83.159  66.824  1.00 10.00 ? 304 LEU B CA  1 
ATOM 5350  C C   . LEU B 2 295 ? 67.836  82.061  65.833  1.00 10.00 ? 304 LEU B C   1 
ATOM 5351  O O   . LEU B 2 295 ? 67.794  82.262  64.617  1.00 10.00 ? 304 LEU B O   1 
ATOM 5352  C CB  . LEU B 2 295 ? 69.669  82.949  67.285  1.00 10.00 ? 304 LEU B CB  1 
ATOM 5353  C CG  . LEU B 2 295 ? 70.821  83.025  66.221  1.00 10.00 ? 304 LEU B CG  1 
ATOM 5354  C CD1 . LEU B 2 295 ? 72.201  82.836  66.813  1.00 10.00 ? 304 LEU B CD1 1 
ATOM 5355  C CD2 . LEU B 2 295 ? 70.651  81.974  65.165  1.00 10.00 ? 304 LEU B CD2 1 
ATOM 5356  N N   . HIS B 2 296 ? 67.553  80.892  66.394  1.00 10.00 ? 305 HIS B N   1 
ATOM 5357  C CA  . HIS B 2 296 ? 67.195  79.720  65.619  1.00 10.00 ? 305 HIS B CA  1 
ATOM 5358  C C   . HIS B 2 296 ? 65.879  79.938  64.910  1.00 10.00 ? 305 HIS B C   1 
ATOM 5359  O O   . HIS B 2 296 ? 65.748  79.632  63.723  1.00 10.00 ? 305 HIS B O   1 
ATOM 5360  C CB  . HIS B 2 296 ? 67.114  78.493  66.531  1.00 10.00 ? 305 HIS B CB  1 
ATOM 5361  C CG  . HIS B 2 296 ? 68.443  78.075  67.076  1.00 10.00 ? 305 HIS B CG  1 
ATOM 5362  N ND1 . HIS B 2 296 ? 69.573  78.001  66.292  1.00 10.00 ? 305 HIS B ND1 1 
ATOM 5363  C CD2 . HIS B 2 296 ? 68.855  77.845  68.342  1.00 10.00 ? 305 HIS B CD2 1 
ATOM 5364  C CE1 . HIS B 2 296 ? 70.624  77.765  67.050  1.00 10.00 ? 305 HIS B CE1 1 
ATOM 5365  N NE2 . HIS B 2 296 ? 70.216  77.668  68.299  1.00 10.00 ? 305 HIS B NE2 1 
ATOM 5366  N N   . HIS B 2 297 ? 64.902  80.480  65.629  1.00 10.00 ? 306 HIS B N   1 
ATOM 5367  C CA  . HIS B 2 297 ? 63.611  80.717  65.005  1.00 10.00 ? 306 HIS B CA  1 
ATOM 5368  C C   . HIS B 2 297 ? 63.488  81.664  63.863  1.00 10.00 ? 306 HIS B C   1 
ATOM 5369  O O   . HIS B 2 297 ? 62.825  81.370  62.883  1.00 10.00 ? 306 HIS B O   1 
ATOM 5370  C CB  . HIS B 2 297 ? 62.528  81.196  65.944  1.00 10.00 ? 306 HIS B CB  1 
ATOM 5371  C CG  . HIS B 2 297 ? 61.196  81.191  65.280  1.00 10.00 ? 306 HIS B CG  1 
ATOM 5372  N ND1 . HIS B 2 297 ? 61.014  81.716  64.024  1.00 10.00 ? 306 HIS B ND1 1 
ATOM 5373  C CD2 . HIS B 2 297 ? 60.050  80.550  65.585  1.00 10.00 ? 306 HIS B CD2 1 
ATOM 5374  C CE1 . HIS B 2 297 ? 59.821  81.388  63.579  1.00 10.00 ? 306 HIS B CE1 1 
ATOM 5375  N NE2 . HIS B 2 297 ? 59.213  80.678  64.507  1.00 10.00 ? 306 HIS B NE2 1 
ATOM 5376  N N   . ARG B 2 298 ? 64.086  82.826  64.037  1.00 10.00 ? 307 ARG B N   1 
ATOM 5377  C CA  . ARG B 2 298 ? 63.960  83.895  63.046  1.00 10.00 ? 307 ARG B CA  1 
ATOM 5378  C C   . ARG B 2 298 ? 63.957  83.661  61.520  1.00 10.00 ? 307 ARG B C   1 
ATOM 5379  O O   . ARG B 2 298 ? 63.904  84.631  60.776  1.00 10.00 ? 307 ARG B O   1 
ATOM 5380  C CB  . ARG B 2 298 ? 64.915  85.050  63.421  1.00 10.00 ? 307 ARG B CB  1 
ATOM 5381  C CG  . ARG B 2 298 ? 65.645  85.689  62.287  1.00 10.00 ? 307 ARG B CG  1 
ATOM 5382  C CD  . ARG B 2 298 ? 66.991  85.097  62.207  1.00 10.00 ? 307 ARG B CD  1 
ATOM 5383  N NE  . ARG B 2 298 ? 67.238  84.466  60.933  1.00 10.00 ? 307 ARG B NE  1 
ATOM 5384  C CZ  . ARG B 2 298 ? 68.421  83.985  60.606  1.00 10.00 ? 307 ARG B CZ  1 
ATOM 5385  N NH1 . ARG B 2 298 ? 69.417  84.081  61.480  1.00 10.00 ? 307 ARG B NH1 1 
ATOM 5386  N NH2 . ARG B 2 298 ? 68.609  83.422  59.420  1.00 10.00 ? 307 ARG B NH2 1 
ATOM 5387  N N   . SER B 2 299 ? 64.004  82.424  61.026  1.00 10.00 ? 308 SER B N   1 
ATOM 5388  C CA  . SER B 2 299 ? 63.910  82.244  59.568  1.00 10.00 ? 308 SER B CA  1 
ATOM 5389  C C   . SER B 2 299 ? 62.467  81.798  59.271  1.00 10.00 ? 308 SER B C   1 
ATOM 5390  O O   . SER B 2 299 ? 62.018  80.768  59.755  1.00 10.00 ? 308 SER B O   1 
ATOM 5391  C CB  . SER B 2 299 ? 64.900  81.186  59.102  1.00 10.00 ? 308 SER B CB  1 
ATOM 5392  O OG  . SER B 2 299 ? 66.209  81.481  59.558  1.00 10.00 ? 308 SER B OG  1 
ATOM 5393  N N   . PRO B 2 300 ? 61.721  82.542  58.449  1.00 10.00 ? 309 PRO B N   1 
ATOM 5394  C CA  . PRO B 2 300 ? 60.344  82.108  58.199  1.00 10.00 ? 309 PRO B CA  1 
ATOM 5395  C C   . PRO B 2 300 ? 60.218  80.773  57.490  1.00 10.00 ? 309 PRO B C   1 
ATOM 5396  O O   . PRO B 2 300 ? 59.197  80.120  57.602  1.00 10.00 ? 309 PRO B O   1 
ATOM 5397  C CB  . PRO B 2 300 ? 59.752  83.276  57.399  1.00 10.00 ? 309 PRO B CB  1 
ATOM 5398  C CG  . PRO B 2 300 ? 60.945  83.844  56.683  1.00 10.00 ? 309 PRO B CG  1 
ATOM 5399  C CD  . PRO B 2 300 ? 62.029  83.796  57.739  1.00 10.00 ? 309 PRO B CD  1 
ATOM 5400  N N   . ASN B 2 301 ? 61.254  80.383  56.744  1.00 10.00 ? 310 ASN B N   1 
ATOM 5401  C CA  . ASN B 2 301 ? 61.199  79.099  56.045  1.00 10.00 ? 310 ASN B CA  1 
ATOM 5402  C C   . ASN B 2 301 ? 61.995  78.023  56.824  1.00 10.00 ? 310 ASN B C   1 
ATOM 5403  O O   . ASN B 2 301 ? 61.465  76.951  57.149  1.00 10.00 ? 310 ASN B O   1 
ATOM 5404  C CB  . ASN B 2 301 ? 61.727  79.256  54.584  1.00 10.00 ? 310 ASN B CB  1 
ATOM 5405  C CG  . ASN B 2 301 ? 60.972  80.341  53.765  1.00 10.00 ? 310 ASN B CG  1 
ATOM 5406  O OD1 . ASN B 2 301 ? 59.741  80.329  53.629  1.00 10.00 ? 310 ASN B OD1 1 
ATOM 5407  N ND2 . ASN B 2 301 ? 61.734  81.268  53.216  1.00 10.00 ? 310 ASN B ND2 1 
ATOM 5408  N N   . THR B 2 302 ? 63.253  78.338  57.123  1.00 10.00 ? 311 THR B N   1 
ATOM 5409  C CA  . THR B 2 302 ? 64.128  77.440  57.852  1.00 10.00 ? 311 THR B CA  1 
ATOM 5410  C C   . THR B 2 302 ? 63.600  77.171  59.269  1.00 10.00 ? 311 THR B C   1 
ATOM 5411  O O   . THR B 2 302 ? 63.497  76.016  59.681  1.00 10.00 ? 311 THR B O   1 
ATOM 5412  C CB  . THR B 2 302 ? 65.574  78.019  57.870  1.00 10.00 ? 311 THR B CB  1 
ATOM 5413  O OG1 . THR B 2 302 ? 66.485  77.066  57.292  1.00 10.00 ? 311 THR B OG1 1 
ATOM 5414  C CG2 . THR B 2 302 ? 66.017  78.417  59.301  1.00 10.00 ? 311 THR B CG2 1 
ATOM 5415  N N   . HIS B 2 303 ? 63.304  78.238  60.011  1.00 10.00 ? 312 HIS B N   1 
ATOM 5416  C CA  . HIS B 2 303 ? 62.723  78.247  61.361  1.00 10.00 ? 312 HIS B CA  1 
ATOM 5417  C C   . HIS B 2 303 ? 63.521  79.021  62.377  1.00 10.00 ? 312 HIS B C   1 
ATOM 5418  O O   . HIS B 2 303 ? 63.327  78.805  63.574  1.00 10.00 ? 312 HIS B O   1 
ATOM 5419  C CB  . HIS B 2 303 ? 62.527  76.858  61.941  1.00 10.00 ? 312 HIS B CB  1 
ATOM 5420  C CG  . HIS B 2 303 ? 63.715  76.362  62.695  1.00 10.00 ? 312 HIS B CG  1 
ATOM 5421  N ND1 . HIS B 2 303 ? 63.714  76.202  64.060  1.00 10.00 ? 312 HIS B ND1 1 
ATOM 5422  C CD2 . HIS B 2 303 ? 64.944  75.989  62.271  1.00 10.00 ? 312 HIS B CD2 1 
ATOM 5423  C CE1 . HIS B 2 303 ? 64.890  75.741  64.445  1.00 10.00 ? 312 HIS B CE1 1 
ATOM 5424  N NE2 . HIS B 2 303 ? 65.656  75.603  63.377  1.00 10.00 ? 312 HIS B NE2 1 
ATOM 5425  N N   . GLU B 2 304 ? 61.777  72.012  17.877  1.00 10.00 ? 403 GLU B N   1 
ATOM 5426  C CA  . GLU B 2 304 ? 60.600  72.851  18.084  1.00 10.00 ? 403 GLU B CA  1 
ATOM 5427  C C   . GLU B 2 304 ? 59.792  72.421  19.310  1.00 10.00 ? 403 GLU B C   1 
ATOM 5428  O O   . GLU B 2 304 ? 60.155  72.757  20.447  1.00 10.00 ? 403 GLU B O   1 
ATOM 5429  C CB  . GLU B 2 304 ? 59.696  72.827  16.846  1.00 10.00 ? 403 GLU B CB  1 
ATOM 5430  C CG  . GLU B 2 304 ? 58.863  74.096  16.650  1.00 10.00 ? 403 GLU B CG  1 
ATOM 5431  C CD  . GLU B 2 304 ? 58.084  74.504  17.890  1.00 10.00 ? 403 GLU B CD  1 
ATOM 5432  O OE1 . GLU B 2 304 ? 57.224  73.720  18.343  1.00 10.00 ? 403 GLU B OE1 1 
ATOM 5433  O OE2 . GLU B 2 304 ? 58.333  75.612  18.410  1.00 10.00 ? 403 GLU B OE2 1 
ATOM 5434  N N   . ALA B 2 305 ? 58.714  71.664  19.091  1.00 10.00 ? 404 ALA B N   1 
ATOM 5435  C CA  . ALA B 2 305 ? 57.851  71.240  20.246  1.00 10.00 ? 404 ALA B CA  1 
ATOM 5436  C C   . ALA B 2 305 ? 58.611  70.305  21.188  1.00 10.00 ? 404 ALA B C   1 
ATOM 5437  O O   . ALA B 2 305 ? 58.518  70.461  22.400  1.00 10.00 ? 404 ALA B O   1 
ATOM 5438  C CB  . ALA B 2 305 ? 56.538  70.575  19.775  1.00 10.00 ? 404 ALA B CB  1 
ATOM 5439  N N   . VAL B 2 306 ? 59.335  69.358  20.587  1.00 10.00 ? 405 VAL B N   1 
ATOM 5440  C CA  . VAL B 2 306 ? 60.184  68.396  21.260  1.00 10.00 ? 405 VAL B CA  1 
ATOM 5441  C C   . VAL B 2 306 ? 60.940  69.212  22.303  1.00 10.00 ? 405 VAL B C   1 
ATOM 5442  O O   . VAL B 2 306 ? 60.863  69.002  23.518  1.00 10.00 ? 405 VAL B O   1 
ATOM 5443  C CB  . VAL B 2 306 ? 61.203  67.860  20.227  1.00 10.00 ? 405 VAL B CB  1 
ATOM 5444  C CG1 . VAL B 2 306 ? 61.897  66.579  20.723  1.00 10.00 ? 405 VAL B CG1 1 
ATOM 5445  C CG2 . VAL B 2 306 ? 60.508  67.672  18.883  1.00 10.00 ? 405 VAL B CG2 1 
ATOM 5446  N N   . GLU B 2 307 ? 61.669  70.183  21.788  1.00 10.00 ? 406 GLU B N   1 
ATOM 5447  C CA  . GLU B 2 307 ? 62.472  71.053  22.613  1.00 10.00 ? 406 GLU B CA  1 
ATOM 5448  C C   . GLU B 2 307 ? 61.658  71.870  23.615  1.00 10.00 ? 406 GLU B C   1 
ATOM 5449  O O   . GLU B 2 307 ? 62.174  72.300  24.659  1.00 10.00 ? 406 GLU B O   1 
ATOM 5450  C CB  . GLU B 2 307 ? 63.336  71.941  21.739  1.00 10.00 ? 406 GLU B CB  1 
ATOM 5451  C CG  . GLU B 2 307 ? 64.696  71.365  21.588  1.00 10.00 ? 406 GLU B CG  1 
ATOM 5452  C CD  . GLU B 2 307 ? 65.628  72.407  21.163  1.00 10.00 ? 406 GLU B CD  1 
ATOM 5453  O OE1 . GLU B 2 307 ? 65.384  72.961  20.075  1.00 10.00 ? 406 GLU B OE1 1 
ATOM 5454  O OE2 . GLU B 2 307 ? 66.588  72.690  21.905  1.00 10.00 ? 406 GLU B OE2 1 
ATOM 5455  N N   . ALA B 2 308 ? 60.375  72.019  23.330  1.00 10.00 ? 407 ALA B N   1 
ATOM 5456  C CA  . ALA B 2 308 ? 59.500  72.768  24.222  1.00 10.00 ? 407 ALA B CA  1 
ATOM 5457  C C   . ALA B 2 308 ? 59.411  72.041  25.561  1.00 10.00 ? 407 ALA B C   1 
ATOM 5458  O O   . ALA B 2 308 ? 59.592  72.659  26.607  1.00 10.00 ? 407 ALA B O   1 
ATOM 5459  C CB  . ALA B 2 308 ? 58.112  72.913  23.603  1.00 10.00 ? 407 ALA B CB  1 
ATOM 5460  N N   . ILE B 2 309 ? 59.142  70.734  25.519  1.00 10.00 ? 408 ILE B N   1 
ATOM 5461  C CA  . ILE B 2 309 ? 59.054  69.927  26.751  1.00 10.00 ? 408 ILE B CA  1 
ATOM 5462  C C   . ILE B 2 309 ? 60.332  70.173  27.538  1.00 10.00 ? 408 ILE B C   1 
ATOM 5463  O O   . ILE B 2 309 ? 60.315  70.388  28.747  1.00 10.00 ? 408 ILE B O   1 
ATOM 5464  C CB  . ILE B 2 309 ? 59.016  68.413  26.478  1.00 10.00 ? 408 ILE B CB  1 
ATOM 5465  C CG1 . ILE B 2 309 ? 58.910  67.629  27.800  1.00 10.00 ? 408 ILE B CG1 1 
ATOM 5466  C CG2 . ILE B 2 309 ? 60.318  67.994  25.800  1.00 10.00 ? 408 ILE B CG2 1 
ATOM 5467  C CD1 . ILE B 2 309 ? 57.523  67.501  28.356  1.00 10.00 ? 408 ILE B CD1 1 
ATOM 5468  N N   . LYS B 2 310 ? 61.425  70.118  26.798  1.00 10.00 ? 409 LYS B N   1 
ATOM 5469  C CA  . LYS B 2 310 ? 62.757  70.339  27.289  1.00 10.00 ? 409 LYS B CA  1 
ATOM 5470  C C   . LYS B 2 310 ? 62.756  71.677  27.984  1.00 10.00 ? 409 LYS B C   1 
ATOM 5471  O O   . LYS B 2 310 ? 63.080  71.805  29.171  1.00 10.00 ? 409 LYS B O   1 
ATOM 5472  C CB  . LYS B 2 310 ? 63.706  70.358  26.104  1.00 10.00 ? 409 LYS B CB  1 
ATOM 5473  C CG  . LYS B 2 310 ? 63.712  69.058  25.320  1.00 10.00 ? 409 LYS B CG  1 
ATOM 5474  C CD  . LYS B 2 310 ? 64.544  69.194  24.063  1.00 10.00 ? 409 LYS B CD  1 
ATOM 5475  C CE  . LYS B 2 310 ? 64.895  67.850  23.459  1.00 10.00 ? 409 LYS B CE  1 
ATOM 5476  N NZ  . LYS B 2 310 ? 63.698  67.113  22.980  1.00 10.00 ? 409 LYS B NZ  1 
ATOM 5477  N N   . TYR B 2 311 ? 62.363  72.674  27.218  1.00 10.00 ? 410 TYR B N   1 
ATOM 5478  C CA  . TYR B 2 311 ? 62.265  74.053  27.690  1.00 10.00 ? 410 TYR B CA  1 
ATOM 5479  C C   . TYR B 2 311 ? 61.408  74.082  28.951  1.00 10.00 ? 410 TYR B C   1 
ATOM 5480  O O   . TYR B 2 311 ? 61.757  74.726  29.941  1.00 10.00 ? 410 TYR B O   1 
ATOM 5481  C CB  . TYR B 2 311 ? 61.629  74.926  26.602  1.00 10.00 ? 410 TYR B CB  1 
ATOM 5482  C CG  . TYR B 2 311 ? 61.482  76.390  26.960  1.00 10.00 ? 410 TYR B CG  1 
ATOM 5483  C CD1 . TYR B 2 311 ? 62.597  77.173  27.261  1.00 10.00 ? 410 TYR B CD1 1 
ATOM 5484  C CD2 . TYR B 2 311 ? 60.227  76.999  26.978  1.00 10.00 ? 410 TYR B CD2 1 
ATOM 5485  C CE1 . TYR B 2 311 ? 62.466  78.526  27.569  1.00 10.00 ? 410 TYR B CE1 1 
ATOM 5486  C CE2 . TYR B 2 311 ? 60.084  78.351  27.284  1.00 10.00 ? 410 TYR B CE2 1 
ATOM 5487  C CZ  . TYR B 2 311 ? 61.207  79.107  27.579  1.00 10.00 ? 410 TYR B CZ  1 
ATOM 5488  O OH  . TYR B 2 311 ? 61.071  80.442  27.882  1.00 10.00 ? 410 TYR B OH  1 
ATOM 5489  N N   . ILE B 2 312 ? 60.277  73.384  28.903  1.00 10.00 ? 411 ILE B N   1 
ATOM 5490  C CA  . ILE B 2 312 ? 59.368  73.300  30.053  1.00 10.00 ? 411 ILE B CA  1 
ATOM 5491  C C   . ILE B 2 312 ? 60.089  72.572  31.175  1.00 10.00 ? 411 ILE B C   1 
ATOM 5492  O O   . ILE B 2 312 ? 59.780  72.747  32.349  1.00 10.00 ? 411 ILE B O   1 
ATOM 5493  C CB  . ILE B 2 312 ? 58.078  72.559  29.690  1.00 10.00 ? 411 ILE B CB  1 
ATOM 5494  C CG1 . ILE B 2 312 ? 57.550  73.073  28.340  1.00 10.00 ? 411 ILE B CG1 1 
ATOM 5495  C CG2 . ILE B 2 312 ? 57.074  72.780  30.768  1.00 10.00 ? 411 ILE B CG2 1 
ATOM 5496  C CD1 . ILE B 2 312 ? 56.309  72.408  27.788  1.00 10.00 ? 411 ILE B CD1 1 
ATOM 5497  N N   . ALA B 2 313 ? 61.067  71.762  30.781  1.00 10.00 ? 412 ALA B N   1 
ATOM 5498  C CA  . ALA B 2 313 ? 61.878  71.006  31.729  1.00 10.00 ? 412 ALA B CA  1 
ATOM 5499  C C   . ALA B 2 313 ? 62.950  71.912  32.270  1.00 10.00 ? 412 ALA B C   1 
ATOM 5500  O O   . ALA B 2 313 ? 63.224  71.930  33.468  1.00 10.00 ? 412 ALA B O   1 
ATOM 5501  C CB  . ALA B 2 313 ? 62.531  69.842  31.043  1.00 10.00 ? 412 ALA B CB  1 
ATOM 5502  N N   . GLU B 2 314 ? 63.567  72.661  31.358  1.00 10.00 ? 413 GLU B N   1 
ATOM 5503  C CA  . GLU B 2 314 ? 64.637  73.629  31.653  1.00 10.00 ? 413 GLU B CA  1 
ATOM 5504  C C   . GLU B 2 314 ? 64.152  74.604  32.740  1.00 10.00 ? 413 GLU B C   1 
ATOM 5505  O O   . GLU B 2 314 ? 64.847  74.874  33.724  1.00 10.00 ? 413 GLU B O   1 
ATOM 5506  C CB  . GLU B 2 314 ? 65.031  74.398  30.352  1.00 10.00 ? 413 GLU B CB  1 
ATOM 5507  C CG  . GLU B 2 314 ? 65.981  73.619  29.358  1.00 10.00 ? 413 GLU B CG  1 
ATOM 5508  C CD  . GLU B 2 314 ? 66.192  74.273  27.950  1.00 10.00 ? 413 GLU B CD  1 
ATOM 5509  O OE1 . GLU B 2 314 ? 65.315  74.091  27.070  1.00 10.00 ? 413 GLU B OE1 1 
ATOM 5510  O OE2 . GLU B 2 314 ? 67.235  74.948  27.725  1.00 10.00 ? 413 GLU B OE2 1 
ATOM 5511  N N   . GLN B 2 315 ? 62.913  75.064  32.582  1.00 10.00 ? 414 GLN B N   1 
ATOM 5512  C CA  . GLN B 2 315 ? 62.319  76.021  33.511  1.00 10.00 ? 414 GLN B CA  1 
ATOM 5513  C C   . GLN B 2 315 ? 61.874  75.392  34.821  1.00 10.00 ? 414 GLN B C   1 
ATOM 5514  O O   . GLN B 2 315 ? 62.066  75.978  35.886  1.00 10.00 ? 414 GLN B O   1 
ATOM 5515  C CB  . GLN B 2 315 ? 61.142  76.748  32.860  1.00 10.00 ? 414 GLN B CB  1 
ATOM 5516  C CG  . GLN B 2 315 ? 61.563  77.947  32.034  1.00 10.00 ? 414 GLN B CG  1 
ATOM 5517  C CD  . GLN B 2 315 ? 62.374  78.941  32.843  1.00 10.00 ? 414 GLN B CD  1 
ATOM 5518  O OE1 . GLN B 2 315 ? 61.901  79.473  33.848  1.00 10.00 ? 414 GLN B OE1 1 
ATOM 5519  N NE2 . GLN B 2 315 ? 63.604  79.194  32.412  1.00 10.00 ? 414 GLN B NE2 1 
ATOM 5520  N N   . LEU B 2 316 ? 61.302  74.192  34.764  1.00 10.00 ? 415 LEU B N   1 
ATOM 5521  C CA  . LEU B 2 316 ? 60.844  73.520  35.992  1.00 10.00 ? 415 LEU B CA  1 
ATOM 5522  C C   . LEU B 2 316 ? 61.923  73.559  37.057  1.00 10.00 ? 415 LEU B C   1 
ATOM 5523  O O   . LEU B 2 316 ? 61.823  74.288  38.037  1.00 10.00 ? 415 LEU B O   1 
ATOM 5524  C CB  . LEU B 2 316 ? 60.485  72.046  35.736  1.00 10.00 ? 415 LEU B CB  1 
ATOM 5525  C CG  . LEU B 2 316 ? 59.851  71.213  36.864  1.00 10.00 ? 415 LEU B CG  1 
ATOM 5526  C CD1 . LEU B 2 316 ? 60.836  71.133  37.986  1.00 10.00 ? 415 LEU B CD1 1 
ATOM 5527  C CD2 . LEU B 2 316 ? 58.521  71.796  37.353  1.00 10.00 ? 415 LEU B CD2 1 
ATOM 5528  N N   . GLU B 2 317 ? 62.951  72.748  36.846  1.00 10.00 ? 416 GLU B N   1 
ATOM 5529  C CA  . GLU B 2 317 ? 64.061  72.629  37.766  1.00 10.00 ? 416 GLU B CA  1 
ATOM 5530  C C   . GLU B 2 317 ? 64.662  73.977  38.183  1.00 10.00 ? 416 GLU B C   1 
ATOM 5531  O O   . GLU B 2 317 ? 64.592  74.383  39.341  1.00 10.00 ? 416 GLU B O   1 
ATOM 5532  C CB  . GLU B 2 317 ? 65.154  71.757  37.126  1.00 10.00 ? 416 GLU B CB  1 
ATOM 5533  C CG  . GLU B 2 317 ? 66.401  71.621  37.962  1.00 10.00 ? 416 GLU B CG  1 
ATOM 5534  C CD  . GLU B 2 317 ? 67.510  71.016  37.195  1.00 10.00 ? 416 GLU B CD  1 
ATOM 5535  O OE1 . GLU B 2 317 ? 68.675  71.313  37.483  1.00 10.00 ? 416 GLU B OE1 1 
ATOM 5536  O OE2 . GLU B 2 317 ? 67.211  70.223  36.295  1.00 10.00 ? 416 GLU B OE2 1 
ATOM 5537  N N   . SER B 2 318 ? 65.296  74.660  37.229  1.00 10.00 ? 417 SER B N   1 
ATOM 5538  C CA  . SER B 2 318 ? 65.917  75.946  37.518  1.00 10.00 ? 417 SER B CA  1 
ATOM 5539  C C   . SER B 2 318 ? 64.980  76.863  38.301  1.00 10.00 ? 417 SER B C   1 
ATOM 5540  O O   . SER B 2 318 ? 65.354  77.396  39.344  1.00 10.00 ? 417 SER B O   1 
ATOM 5541  C CB  . SER B 2 318 ? 66.343  76.626  36.211  1.00 10.00 ? 417 SER B CB  1 
ATOM 5542  O OG  . SER B 2 318 ? 65.226  76.799  35.351  1.00 10.00 ? 417 SER B OG  1 
ATOM 5543  N N   . ALA B 2 319 ? 63.754  77.025  37.813  1.00 10.00 ? 418 ALA B N   1 
ATOM 5544  C CA  . ALA B 2 319 ? 62.802  77.914  38.466  1.00 10.00 ? 418 ALA B CA  1 
ATOM 5545  C C   . ALA B 2 319 ? 62.671  77.703  39.970  1.00 10.00 ? 418 ALA B C   1 
ATOM 5546  O O   . ALA B 2 319 ? 62.773  78.663  40.734  1.00 10.00 ? 418 ALA B O   1 
ATOM 5547  C CB  . ALA B 2 319 ? 61.429  77.818  37.796  1.00 10.00 ? 418 ALA B CB  1 
ATOM 5548  N N   . SER B 2 320 ? 62.458  76.470  40.420  1.00 10.00 ? 419 SER B N   1 
ATOM 5549  C CA  . SER B 2 320 ? 62.320  76.298  41.852  1.00 10.00 ? 419 SER B CA  1 
ATOM 5550  C C   . SER B 2 320 ? 63.641  76.176  42.608  1.00 10.00 ? 419 SER B C   1 
ATOM 5551  O O   . SER B 2 320 ? 63.652  76.359  43.818  1.00 10.00 ? 419 SER B O   1 
ATOM 5552  C CB  . SER B 2 320 ? 61.434  75.084  42.159  1.00 10.00 ? 419 SER B CB  1 
ATOM 5553  O OG  . SER B 2 320 ? 62.034  73.874  41.728  1.00 10.00 ? 419 SER B OG  1 
ATOM 5554  N N   . GLU B 2 321 ? 64.743  75.813  41.947  1.00 10.00 ? 420 GLU B N   1 
ATOM 5555  C CA  . GLU B 2 321 ? 65.964  75.747  42.742  1.00 10.00 ? 420 GLU B CA  1 
ATOM 5556  C C   . GLU B 2 321 ? 66.247  77.188  43.212  1.00 10.00 ? 420 GLU B C   1 
ATOM 5557  O O   . GLU B 2 321 ? 66.708  77.376  44.326  1.00 10.00 ? 420 GLU B O   1 
ATOM 5558  C CB  . GLU B 2 321 ? 67.174  75.125  41.983  1.00 10.00 ? 420 GLU B CB  1 
ATOM 5559  C CG  . GLU B 2 321 ? 68.157  74.341  42.959  1.00 10.00 ? 420 GLU B CG  1 
ATOM 5560  C CD  . GLU B 2 321 ? 69.561  74.030  42.399  1.00 10.00 ? 420 GLU B CD  1 
ATOM 5561  O OE1 . GLU B 2 321 ? 70.522  73.957  43.187  1.00 10.00 ? 420 GLU B OE1 1 
ATOM 5562  O OE2 . GLU B 2 321 ? 69.712  73.846  41.181  1.00 10.00 ? 420 GLU B OE2 1 
ATOM 5563  N N   . PHE B 2 322 ? 65.986  78.209  42.375  1.00 10.00 ? 421 PHE B N   1 
ATOM 5564  C CA  . PHE B 2 322 ? 66.195  79.589  42.846  1.00 10.00 ? 421 PHE B CA  1 
ATOM 5565  C C   . PHE B 2 322 ? 65.279  79.771  44.018  1.00 10.00 ? 421 PHE B C   1 
ATOM 5566  O O   . PHE B 2 322 ? 65.623  80.445  44.976  1.00 10.00 ? 421 PHE B O   1 
ATOM 5567  C CB  . PHE B 2 322 ? 65.770  80.651  41.840  1.00 10.00 ? 421 PHE B CB  1 
ATOM 5568  C CG  . PHE B 2 322 ? 66.053  80.291  40.478  1.00 10.00 ? 421 PHE B CG  1 
ATOM 5569  C CD1 . PHE B 2 322 ? 65.034  80.285  39.546  1.00 10.00 ? 421 PHE B CD1 1 
ATOM 5570  C CD2 . PHE B 2 322 ? 67.342  79.934  40.114  1.00 10.00 ? 421 PHE B CD2 1 
ATOM 5571  C CE1 . PHE B 2 322 ? 65.290  79.926  38.249  1.00 10.00 ? 421 PHE B CE1 1 
ATOM 5572  C CE2 . PHE B 2 322 ? 67.626  79.574  38.835  1.00 10.00 ? 421 PHE B CE2 1 
ATOM 5573  C CZ  . PHE B 2 322 ? 66.605  79.565  37.883  1.00 10.00 ? 421 PHE B CZ  1 
ATOM 5574  N N   . ASP B 2 323 ? 64.084  79.204  43.919  1.00 10.00 ? 422 ASP B N   1 
ATOM 5575  C CA  . ASP B 2 323 ? 63.145  79.353  45.014  1.00 10.00 ? 422 ASP B CA  1 
ATOM 5576  C C   . ASP B 2 323 ? 63.781  78.779  46.255  1.00 10.00 ? 422 ASP B C   1 
ATOM 5577  O O   . ASP B 2 323 ? 63.742  79.390  47.318  1.00 10.00 ? 422 ASP B O   1 
ATOM 5578  C CB  . ASP B 2 323 ? 61.824  78.660  44.739  1.00 10.00 ? 422 ASP B CB  1 
ATOM 5579  C CG  . ASP B 2 323 ? 60.821  78.902  45.845  1.00 10.00 ? 422 ASP B CG  1 
ATOM 5580  O OD1 . ASP B 2 323 ? 61.255  79.081  46.992  1.00 10.00 ? 422 ASP B OD1 1 
ATOM 5581  O OD2 . ASP B 2 323 ? 59.603  78.905  45.597  1.00 10.00 ? 422 ASP B OD2 1 
ATOM 5582  N N   . ASP B 2 324 ? 64.369  77.591  46.136  1.00 10.00 ? 423 ASP B N   1 
ATOM 5583  C CA  . ASP B 2 324 ? 65.022  76.982  47.297  1.00 10.00 ? 423 ASP B CA  1 
ATOM 5584  C C   . ASP B 2 324 ? 66.390  77.602  47.442  1.00 10.00 ? 423 ASP B C   1 
ATOM 5585  O O   . ASP B 2 324 ? 67.058  77.419  48.456  1.00 10.00 ? 423 ASP B O   1 
ATOM 5586  C CB  . ASP B 2 324 ? 65.123  75.466  47.149  1.00 10.00 ? 423 ASP B CB  1 
ATOM 5587  C CG  . ASP B 2 324 ? 63.775  74.794  47.254  1.00 10.00 ? 423 ASP B CG  1 
ATOM 5588  O OD1 . ASP B 2 324 ? 63.076  75.074  48.254  1.00 10.00 ? 423 ASP B OD1 1 
ATOM 5589  O OD2 . ASP B 2 324 ? 63.418  74.003  46.344  1.00 10.00 ? 423 ASP B OD2 1 
ATOM 5590  N N   . LEU B 2 325 ? 66.786  78.364  46.427  1.00 10.00 ? 424 LEU B N   1 
ATOM 5591  C CA  . LEU B 2 325 ? 68.049  79.055  46.446  1.00 10.00 ? 424 LEU B CA  1 
ATOM 5592  C C   . LEU B 2 325 ? 67.758  80.309  47.264  1.00 10.00 ? 424 LEU B C   1 
ATOM 5593  O O   . LEU B 2 325 ? 68.629  80.858  47.938  1.00 10.00 ? 424 LEU B O   1 
ATOM 5594  C CB  . LEU B 2 325 ? 68.455  79.404  45.022  1.00 10.00 ? 424 LEU B CB  1 
ATOM 5595  C CG  . LEU B 2 325 ? 69.397  78.414  44.346  1.00 10.00 ? 424 LEU B CG  1 
ATOM 5596  C CD1 . LEU B 2 325 ? 69.566  78.738  42.840  1.00 10.00 ? 424 LEU B CD1 1 
ATOM 5597  C CD2 . LEU B 2 325 ? 70.726  78.461  45.094  1.00 10.00 ? 424 LEU B CD2 1 
ATOM 5598  N N   . LYS B 2 326 ? 66.499  80.733  47.217  1.00 10.00 ? 425 LYS B N   1 
ATOM 5599  C CA  . LYS B 2 326 ? 66.049  81.906  47.958  1.00 10.00 ? 425 LYS B CA  1 
ATOM 5600  C C   . LYS B 2 326 ? 66.170  81.565  49.426  1.00 10.00 ? 425 LYS B C   1 
ATOM 5601  O O   . LYS B 2 326 ? 66.627  82.370  50.233  1.00 10.00 ? 425 LYS B O   1 
ATOM 5602  C CB  . LYS B 2 326 ? 64.605  82.238  47.607  1.00 10.00 ? 425 LYS B CB  1 
ATOM 5603  C CG  . LYS B 2 326 ? 64.287  83.715  47.646  1.00 10.00 ? 425 LYS B CG  1 
ATOM 5604  C CD  . LYS B 2 326 ? 62.898  83.944  47.104  1.00 10.00 ? 425 LYS B CD  1 
ATOM 5605  C CE  . LYS B 2 326 ? 62.553  85.404  47.031  1.00 10.00 ? 425 LYS B CE  1 
ATOM 5606  N NZ  . LYS B 2 326 ? 61.166  85.562  46.526  1.00 10.00 ? 425 LYS B NZ  1 
ATOM 5607  N N   . LYS B 2 327 ? 65.795  80.333  49.756  1.00 10.00 ? 426 LYS B N   1 
ATOM 5608  C CA  . LYS B 2 327 ? 65.874  79.877  51.139  1.00 10.00 ? 426 LYS B CA  1 
ATOM 5609  C C   . LYS B 2 327 ? 67.324  80.024  51.597  1.00 10.00 ? 426 LYS B C   1 
ATOM 5610  O O   . LYS B 2 327 ? 67.568  80.337  52.758  1.00 10.00 ? 426 LYS B O   1 
ATOM 5611  C CB  . LYS B 2 327 ? 65.398  78.414  51.278  1.00 10.00 ? 426 LYS B CB  1 
ATOM 5612  C CG  . LYS B 2 327 ? 64.011  78.222  51.944  1.00 10.00 ? 426 LYS B CG  1 
ATOM 5613  C CD  . LYS B 2 327 ? 63.086  77.460  51.023  1.00 10.00 ? 426 LYS B CD  1 
ATOM 5614  C CE  . LYS B 2 327 ? 61.775  77.171  51.690  1.00 10.00 ? 426 LYS B CE  1 
ATOM 5615  N NZ  . LYS B 2 327 ? 60.844  76.502  50.749  1.00 10.00 ? 426 LYS B NZ  1 
ATOM 5616  N N   . ASP B 2 328 ? 68.283  79.819  50.688  1.00 10.00 ? 427 ASP B N   1 
ATOM 5617  C CA  . ASP B 2 328 ? 69.702  79.977  51.049  1.00 10.00 ? 427 ASP B CA  1 
ATOM 5618  C C   . ASP B 2 328 ? 69.946  81.409  51.436  1.00 10.00 ? 427 ASP B C   1 
ATOM 5619  O O   . ASP B 2 328 ? 70.504  81.692  52.486  1.00 10.00 ? 427 ASP B O   1 
ATOM 5620  C CB  . ASP B 2 328 ? 70.658  79.677  49.889  1.00 10.00 ? 427 ASP B CB  1 
ATOM 5621  C CG  . ASP B 2 328 ? 72.096  80.166  50.170  1.00 10.00 ? 427 ASP B CG  1 
ATOM 5622  O OD1 . ASP B 2 328 ? 72.492  80.273  51.347  1.00 10.00 ? 427 ASP B OD1 1 
ATOM 5623  O OD2 . ASP B 2 328 ? 72.835  80.428  49.210  1.00 10.00 ? 427 ASP B OD2 1 
ATOM 5624  N N   . TRP B 2 329 ? 69.549  82.308  50.545  1.00 10.00 ? 428 TRP B N   1 
ATOM 5625  C CA  . TRP B 2 329 ? 69.714  83.730  50.764  1.00 10.00 ? 428 TRP B CA  1 
ATOM 5626  C C   . TRP B 2 329 ? 69.113  84.091  52.147  1.00 10.00 ? 428 TRP B C   1 
ATOM 5627  O O   . TRP B 2 329 ? 69.649  84.923  52.876  1.00 10.00 ? 428 TRP B O   1 
ATOM 5628  C CB  . TRP B 2 329 ? 69.003  84.463  49.633  1.00 10.00 ? 428 TRP B CB  1 
ATOM 5629  C CG  . TRP B 2 329 ? 69.036  83.759  48.286  1.00 10.00 ? 428 TRP B CG  1 
ATOM 5630  C CD1 . TRP B 2 329 ? 68.009  83.697  47.400  1.00 10.00 ? 428 TRP B CD1 1 
ATOM 5631  C CD2 . TRP B 2 329 ? 70.175  83.181  47.612  1.00 10.00 ? 428 TRP B CD2 1 
ATOM 5632  N NE1 . TRP B 2 329 ? 68.417  83.136  46.220  1.00 10.00 ? 428 TRP B NE1 1 
ATOM 5633  C CE2 . TRP B 2 329 ? 69.745  82.812  46.310  1.00 10.00 ? 428 TRP B CE2 1 
ATOM 5634  C CE3 . TRP B 2 329 ? 71.513  82.950  47.967  1.00 10.00 ? 428 TRP B CE3 1 
ATOM 5635  C CZ2 . TRP B 2 329 ? 70.620  82.211  45.341  1.00 10.00 ? 428 TRP B CZ2 1 
ATOM 5636  C CZ3 . TRP B 2 329 ? 72.395  82.344  46.990  1.00 10.00 ? 428 TRP B CZ3 1 
ATOM 5637  C CH2 . TRP B 2 329 ? 71.931  81.991  45.699  1.00 10.00 ? 428 TRP B CH2 1 
ATOM 5638  N N   . GLN B 2 330 ? 68.027  83.401  52.502  1.00 10.00 ? 429 GLN B N   1 
ATOM 5639  C CA  . GLN B 2 330 ? 67.305  83.624  53.753  1.00 10.00 ? 429 GLN B CA  1 
ATOM 5640  C C   . GLN B 2 330 ? 67.988  83.054  55.008  1.00 10.00 ? 429 GLN B C   1 
ATOM 5641  O O   . GLN B 2 330 ? 68.051  83.730  56.044  1.00 10.00 ? 429 GLN B O   1 
ATOM 5642  C CB  . GLN B 2 330 ? 65.882  83.075  53.617  1.00 10.00 ? 429 GLN B CB  1 
ATOM 5643  C CG  . GLN B 2 330 ? 64.777  84.057  54.026  1.00 10.00 ? 429 GLN B CG  1 
ATOM 5644  C CD  . GLN B 2 330 ? 64.598  85.266  53.070  1.00 10.00 ? 429 GLN B CD  1 
ATOM 5645  O OE1 . GLN B 2 330 ? 63.577  85.391  52.361  1.00 10.00 ? 429 GLN B OE1 1 
ATOM 5646  N NE2 . GLN B 2 330 ? 65.595  86.161  53.061  1.00 10.00 ? 429 GLN B NE2 1 
ATOM 5647  N N   . TYR B 2 331 ? 68.538  81.836  54.924  1.00 10.00 ? 430 TYR B N   1 
ATOM 5648  C CA  . TYR B 2 331 ? 69.233  81.180  56.051  1.00 10.00 ? 430 TYR B CA  1 
ATOM 5649  C C   . TYR B 2 331 ? 70.724  80.919  55.756  1.00 10.00 ? 430 TYR B C   1 
ATOM 5650  O O   . TYR B 2 331 ? 71.177  79.776  55.716  1.00 10.00 ? 430 TYR B O   1 
ATOM 5651  C CB  . TYR B 2 331 ? 68.527  79.861  56.424  1.00 10.00 ? 430 TYR B CB  1 
ATOM 5652  C CG  . TYR B 2 331 ? 68.245  78.888  55.286  1.00 10.00 ? 430 TYR B CG  1 
ATOM 5653  C CD1 . TYR B 2 331 ? 69.274  78.354  54.511  1.00 10.00 ? 430 TYR B CD1 1 
ATOM 5654  C CD2 . TYR B 2 331 ? 66.947  78.452  55.032  1.00 10.00 ? 430 TYR B CD2 1 
ATOM 5655  C CE1 . TYR B 2 331 ? 69.014  77.410  53.518  1.00 10.00 ? 430 TYR B CE1 1 
ATOM 5656  C CE2 . TYR B 2 331 ? 66.678  77.509  54.048  1.00 10.00 ? 430 TYR B CE2 1 
ATOM 5657  C CZ  . TYR B 2 331 ? 67.714  76.992  53.294  1.00 10.00 ? 430 TYR B CZ  1 
ATOM 5658  O OH  . TYR B 2 331 ? 67.450  76.056  52.320  1.00 10.00 ? 430 TYR B OH  1 
ATOM 5659  N N   . VAL B 2 332 ? 71.470  82.015  55.636  1.00 10.00 ? 431 VAL B N   1 
ATOM 5660  C CA  . VAL B 2 332 ? 72.887  82.077  55.267  1.00 10.00 ? 431 VAL B CA  1 
ATOM 5661  C C   . VAL B 2 332 ? 74.017  81.712  56.247  1.00 10.00 ? 431 VAL B C   1 
ATOM 5662  O O   . VAL B 2 332 ? 75.049  81.169  55.842  1.00 10.00 ? 431 VAL B O   1 
ATOM 5663  C CB  . VAL B 2 332 ? 73.180  83.499  54.747  1.00 10.00 ? 431 VAL B CB  1 
ATOM 5664  C CG1 . VAL B 2 332 ? 72.026  83.974  53.858  1.00 10.00 ? 431 VAL B CG1 1 
ATOM 5665  C CG2 . VAL B 2 332 ? 73.367  84.454  55.923  1.00 10.00 ? 431 VAL B CG2 1 
ATOM 5666  N N   . ALA B 2 333 ? 73.831  82.040  57.519  1.00 10.00 ? 432 ALA B N   1 
ATOM 5667  C CA  . ALA B 2 333 ? 74.840  81.802  58.588  1.00 10.00 ? 432 ALA B CA  1 
ATOM 5668  C C   . ALA B 2 333 ? 75.611  83.058  59.034  1.00 10.00 ? 432 ALA B C   1 
ATOM 5669  O O   . ALA B 2 333 ? 76.662  82.941  59.667  1.00 10.00 ? 432 ALA B O   1 
ATOM 5670  C CB  . ALA B 2 333 ? 75.888  80.700  58.167  1.00 10.00 ? 432 ALA B CB  1 
ATOM 5671  N N   . MET B 2 334 ? 75.112  84.244  58.679  1.00 10.00 ? 433 MET B N   1 
ATOM 5672  C CA  . MET B 2 334 ? 75.752  85.504  59.077  1.00 10.00 ? 433 MET B CA  1 
ATOM 5673  C C   . MET B 2 334 ? 75.622  85.681  60.587  1.00 10.00 ? 433 MET B C   1 
ATOM 5674  O O   . MET B 2 334 ? 76.599  85.939  61.310  1.00 10.00 ? 433 MET B O   1 
ATOM 5675  C CB  . MET B 2 334 ? 75.086  86.715  58.384  1.00 10.00 ? 433 MET B CB  1 
ATOM 5676  C CG  . MET B 2 334 ? 75.541  86.953  56.994  1.00 10.00 ? 433 MET B CG  1 
ATOM 5677  S SD  . MET B 2 334 ? 77.332  86.792  56.951  1.00 10.00 ? 433 MET B SD  1 
ATOM 5678  C CE  . MET B 2 334 ? 77.868  88.000  58.124  1.00 10.00 ? 433 MET B CE  1 
ATOM 5679  N N   . VAL B 2 335 ? 74.387  85.521  61.045  1.00 10.00 ? 434 VAL B N   1 
ATOM 5680  C CA  . VAL B 2 335 ? 74.027  85.681  62.455  1.00 10.00 ? 434 VAL B CA  1 
ATOM 5681  C C   . VAL B 2 335 ? 74.771  84.750  63.372  1.00 10.00 ? 434 VAL B C   1 
ATOM 5682  O O   . VAL B 2 335 ? 75.344  85.153  64.374  1.00 10.00 ? 434 VAL B O   1 
ATOM 5683  C CB  . VAL B 2 335 ? 72.580  85.363  62.724  1.00 10.00 ? 434 VAL B CB  1 
ATOM 5684  C CG1 . VAL B 2 335 ? 72.255  85.809  64.106  1.00 10.00 ? 434 VAL B CG1 1 
ATOM 5685  C CG2 . VAL B 2 335 ? 71.696  85.937  61.683  1.00 10.00 ? 434 VAL B CG2 1 
ATOM 5686  N N   . ALA B 2 336 ? 74.666  83.464  63.041  1.00 10.00 ? 435 ALA B N   1 
ATOM 5687  C CA  . ALA B 2 336 ? 75.307  82.382  63.790  1.00 10.00 ? 435 ALA B CA  1 
ATOM 5688  C C   . ALA B 2 336 ? 76.771  82.740  64.060  1.00 10.00 ? 435 ALA B C   1 
ATOM 5689  O O   . ALA B 2 336 ? 77.231  82.725  65.202  1.00 10.00 ? 435 ALA B O   1 
ATOM 5690  C CB  . ALA B 2 336 ? 75.196  81.013  62.991  1.00 10.00 ? 435 ALA B CB  1 
ATOM 5691  N N   . ASP B 2 337 ? 77.490  83.103  63.007  1.00 10.00 ? 436 ASP B N   1 
ATOM 5692  C CA  . ASP B 2 337 ? 78.901  83.447  63.130  1.00 10.00 ? 436 ASP B CA  1 
ATOM 5693  C C   . ASP B 2 337 ? 79.071  84.623  64.083  1.00 10.00 ? 436 ASP B C   1 
ATOM 5694  O O   . ASP B 2 337 ? 79.807  84.555  65.076  1.00 10.00 ? 436 ASP B O   1 
ATOM 5695  C CB  . ASP B 2 337 ? 79.498  83.838  61.772  1.00 10.00 ? 436 ASP B CB  1 
ATOM 5696  C CG  . ASP B 2 337 ? 78.923  83.040  60.624  1.00 10.00 ? 436 ASP B CG  1 
ATOM 5697  O OD1 . ASP B 2 337 ? 78.476  81.898  60.850  1.00 10.00 ? 436 ASP B OD1 1 
ATOM 5698  O OD2 . ASP B 2 337 ? 78.930  83.553  59.482  1.00 10.00 ? 436 ASP B OD2 1 
ATOM 5699  N N   . ARG B 2 338 ? 78.350  85.691  63.767  1.00 10.00 ? 437 ARG B N   1 
ATOM 5700  C CA  . ARG B 2 338 ? 78.372  86.955  64.499  1.00 10.00 ? 437 ARG B CA  1 
ATOM 5701  C C   . ARG B 2 338 ? 77.942  86.803  65.958  1.00 10.00 ? 437 ARG B C   1 
ATOM 5702  O O   . ARG B 2 338 ? 78.618  87.297  66.877  1.00 10.00 ? 437 ARG B O   1 
ATOM 5703  C CB  . ARG B 2 338 ? 77.495  88.005  63.754  1.00 10.00 ? 437 ARG B CB  1 
ATOM 5704  C CG  . ARG B 2 338 ? 78.267  89.218  63.220  1.00 10.00 ? 437 ARG B CG  1 
ATOM 5705  C CD  . ARG B 2 338 ? 79.602  88.752  62.636  1.00 10.00 ? 437 ARG B CD  1 
ATOM 5706  N NE  . ARG B 2 338 ? 80.679  89.756  62.616  1.00 10.00 ? 437 ARG B NE  1 
ATOM 5707  C CZ  . ARG B 2 338 ? 80.745  90.799  61.788  1.00 10.00 ? 437 ARG B CZ  1 
ATOM 5708  N NH1 . ARG B 2 338 ? 79.780  91.002  60.888  1.00 10.00 ? 437 ARG B NH1 1 
ATOM 5709  N NH2 . ARG B 2 338 ? 81.785  91.628  61.853  1.00 10.00 ? 437 ARG B NH2 1 
ATOM 5710  N N   . LEU B 2 339 ? 76.846  86.093  66.203  1.00 10.00 ? 438 LEU B N   1 
ATOM 5711  C CA  . LEU B 2 339 ? 76.444  85.974  67.578  1.00 10.00 ? 438 LEU B CA  1 
ATOM 5712  C C   . LEU B 2 339 ? 77.125  84.757  68.222  1.00 10.00 ? 438 LEU B C   1 
ATOM 5713  O O   . LEU B 2 339 ? 77.186  84.680  69.433  1.00 10.00 ? 438 LEU B O   1 
ATOM 5714  C CB  . LEU B 2 339 ? 74.904  85.984  67.671  1.00 10.00 ? 438 LEU B CB  1 
ATOM 5715  C CG  . LEU B 2 339 ? 74.286  87.360  67.306  1.00 10.00 ? 438 LEU B CG  1 
ATOM 5716  C CD1 . LEU B 2 339 ? 72.788  87.297  66.937  1.00 10.00 ? 438 LEU B CD1 1 
ATOM 5717  C CD2 . LEU B 2 339 ? 74.491  88.274  68.494  1.00 10.00 ? 438 LEU B CD2 1 
ATOM 5718  N N   . PHE B 2 340 ? 77.642  83.805  67.428  1.00 10.00 ? 439 PHE B N   1 
ATOM 5719  C CA  . PHE B 2 340 ? 78.377  82.697  68.045  1.00 10.00 ? 439 PHE B CA  1 
ATOM 5720  C C   . PHE B 2 340 ? 79.677  83.385  68.541  1.00 10.00 ? 439 PHE B C   1 
ATOM 5721  O O   . PHE B 2 340 ? 80.372  82.887  69.424  1.00 10.00 ? 439 PHE B O   1 
ATOM 5722  C CB  . PHE B 2 340 ? 78.586  81.509  67.044  1.00 10.00 ? 439 PHE B CB  1 
ATOM 5723  C CG  . PHE B 2 340 ? 79.898  80.764  67.198  1.00 10.00 ? 439 PHE B CG  1 
ATOM 5724  C CD1 . PHE B 2 340 ? 80.479  80.564  68.439  1.00 10.00 ? 439 PHE B CD1 1 
ATOM 5725  C CD2 . PHE B 2 340 ? 80.597  80.357  66.080  1.00 10.00 ? 439 PHE B CD2 1 
ATOM 5726  C CE1 . PHE B 2 340 ? 81.732  79.998  68.551  1.00 10.00 ? 439 PHE B CE1 1 
ATOM 5727  C CE2 . PHE B 2 340 ? 81.848  79.788  66.200  1.00 10.00 ? 439 PHE B CE2 1 
ATOM 5728  C CZ  . PHE B 2 340 ? 82.413  79.615  67.430  1.00 10.00 ? 439 PHE B CZ  1 
ATOM 5729  N N   . LEU B 2 341 ? 80.008  84.557  68.001  1.00 10.00 ? 440 LEU B N   1 
ATOM 5730  C CA  . LEU B 2 341 ? 81.153  85.231  68.534  1.00 10.00 ? 440 LEU B CA  1 
ATOM 5731  C C   . LEU B 2 341 ? 80.619  86.331  69.488  1.00 10.00 ? 440 LEU B C   1 
ATOM 5732  O O   . LEU B 2 341 ? 81.357  86.864  70.316  1.00 10.00 ? 440 LEU B O   1 
ATOM 5733  C CB  . LEU B 2 341 ? 82.080  85.671  67.390  1.00 10.00 ? 440 LEU B CB  1 
ATOM 5734  C CG  . LEU B 2 341 ? 82.760  84.403  66.789  1.00 10.00 ? 440 LEU B CG  1 
ATOM 5735  C CD1 . LEU B 2 341 ? 82.452  84.259  65.324  1.00 10.00 ? 440 LEU B CD1 1 
ATOM 5736  C CD2 . LEU B 2 341 ? 84.262  84.445  66.981  1.00 10.00 ? 440 LEU B CD2 1 
ATOM 5737  N N   . TYR B 2 342 ? 79.318  86.640  69.401  1.00 10.00 ? 441 TYR B N   1 
ATOM 5738  C CA  . TYR B 2 342 ? 78.712  87.564  70.352  1.00 10.00 ? 441 TYR B CA  1 
ATOM 5739  C C   . TYR B 2 342 ? 78.582  86.579  71.514  1.00 10.00 ? 441 TYR B C   1 
ATOM 5740  O O   . TYR B 2 342 ? 78.483  86.945  72.686  1.00 10.00 ? 441 TYR B O   1 
ATOM 5741  C CB  . TYR B 2 342 ? 77.321  88.019  69.899  1.00 10.00 ? 441 TYR B CB  1 
ATOM 5742  C CG  . TYR B 2 342 ? 76.391  88.372  71.052  1.00 10.00 ? 441 TYR B CG  1 
ATOM 5743  C CD1 . TYR B 2 342 ? 76.651  89.464  71.882  1.00 10.00 ? 441 TYR B CD1 1 
ATOM 5744  C CD2 . TYR B 2 342 ? 75.267  87.590  71.333  1.00 10.00 ? 441 TYR B CD2 1 
ATOM 5745  C CE1 . TYR B 2 342 ? 75.815  89.764  72.964  1.00 10.00 ? 441 TYR B CE1 1 
ATOM 5746  C CE2 . TYR B 2 342 ? 74.428  87.883  72.408  1.00 10.00 ? 441 TYR B CE2 1 
ATOM 5747  C CZ  . TYR B 2 342 ? 74.707  88.968  73.219  1.00 10.00 ? 441 TYR B CZ  1 
ATOM 5748  O OH  . TYR B 2 342 ? 73.885  89.251  74.286  1.00 10.00 ? 441 TYR B OH  1 
ATOM 5749  N N   . ILE B 2 343 ? 78.575  85.305  71.137  1.00 10.00 ? 442 ILE B N   1 
ATOM 5750  C CA  . ILE B 2 343 ? 78.511  84.201  72.053  1.00 10.00 ? 442 ILE B CA  1 
ATOM 5751  C C   . ILE B 2 343 ? 79.922  84.204  72.658  1.00 10.00 ? 442 ILE B C   1 
ATOM 5752  O O   . ILE B 2 343 ? 80.109  83.958  73.849  1.00 10.00 ? 442 ILE B O   1 
ATOM 5753  C CB  . ILE B 2 343 ? 78.183  82.923  71.253  1.00 10.00 ? 442 ILE B CB  1 
ATOM 5754  C CG1 . ILE B 2 343 ? 76.715  82.519  71.527  1.00 10.00 ? 442 ILE B CG1 1 
ATOM 5755  C CG2 . ILE B 2 343 ? 79.211  81.842  71.546  1.00 10.00 ? 442 ILE B CG2 1 
ATOM 5756  C CD1 . ILE B 2 343 ? 75.586  83.125  70.619  1.00 10.00 ? 442 ILE B CD1 1 
ATOM 5757  N N   . PHE B 2 344 ? 80.896  84.527  71.808  1.00 10.00 ? 443 PHE B N   1 
ATOM 5758  C CA  . PHE B 2 344 ? 82.311  84.655  72.171  1.00 10.00 ? 443 PHE B CA  1 
ATOM 5759  C C   . PHE B 2 344 ? 82.425  85.743  73.228  1.00 10.00 ? 443 PHE B C   1 
ATOM 5760  O O   . PHE B 2 344 ? 83.023  85.561  74.283  1.00 10.00 ? 443 PHE B O   1 
ATOM 5761  C CB  . PHE B 2 344 ? 83.117  85.090  70.935  1.00 10.00 ? 443 PHE B CB  1 
ATOM 5762  C CG  . PHE B 2 344 ? 84.455  85.708  71.239  1.00 10.00 ? 443 PHE B CG  1 
ATOM 5763  C CD1 . PHE B 2 344 ? 84.999  86.633  70.362  1.00 10.00 ? 443 PHE B CD1 1 
ATOM 5764  C CD2 . PHE B 2 344 ? 85.212  85.312  72.345  1.00 10.00 ? 443 PHE B CD2 1 
ATOM 5765  C CE1 . PHE B 2 344 ? 86.291  87.153  70.572  1.00 10.00 ? 443 PHE B CE1 1 
ATOM 5766  C CE2 . PHE B 2 344 ? 86.498  85.833  72.559  1.00 10.00 ? 443 PHE B CE2 1 
ATOM 5767  C CZ  . PHE B 2 344 ? 87.036  86.753  71.666  1.00 10.00 ? 443 PHE B CZ  1 
ATOM 5768  N N   . ILE B 2 345 ? 81.850  86.895  72.926  1.00 10.00 ? 444 ILE B N   1 
ATOM 5769  C CA  . ILE B 2 345 ? 81.922  88.026  73.868  1.00 10.00 ? 444 ILE B CA  1 
ATOM 5770  C C   . ILE B 2 345 ? 81.131  87.716  75.137  1.00 10.00 ? 444 ILE B C   1 
ATOM 5771  O O   . ILE B 2 345 ? 81.708  87.589  76.210  1.00 10.00 ? 444 ILE B O   1 
ATOM 5772  C CB  . ILE B 2 345 ? 81.401  89.360  73.237  1.00 10.00 ? 444 ILE B CB  1 
ATOM 5773  C CG1 . ILE B 2 345 ? 81.535  90.499  74.249  1.00 10.00 ? 444 ILE B CG1 1 
ATOM 5774  C CG2 . ILE B 2 345 ? 79.947  89.242  72.829  1.00 10.00 ? 444 ILE B CG2 1 
ATOM 5775  C CD1 . ILE B 2 345 ? 81.065  91.845  73.731  1.00 10.00 ? 444 ILE B CD1 1 
ATOM 5776  N N   . THR B 2 346 ? 79.824  87.536  74.984  1.00 10.00 ? 445 THR B N   1 
ATOM 5777  C CA  . THR B 2 346 ? 78.913  87.227  76.082  1.00 10.00 ? 445 THR B CA  1 
ATOM 5778  C C   . THR B 2 346 ? 79.513  86.211  77.047  1.00 10.00 ? 445 THR B C   1 
ATOM 5779  O O   . THR B 2 346 ? 79.958  86.531  78.164  1.00 10.00 ? 445 THR B O   1 
ATOM 5780  C CB  . THR B 2 346 ? 77.564  86.589  75.575  1.00 10.00 ? 445 THR B CB  1 
ATOM 5781  O OG1 . THR B 2 346 ? 76.983  87.395  74.543  1.00 10.00 ? 445 THR B OG1 1 
ATOM 5782  C CG2 . THR B 2 346 ? 76.566  86.463  76.736  1.00 10.00 ? 445 THR B CG2 1 
ATOM 5783  N N   . MET B 2 347 ? 79.556  84.971  76.586  1.00 10.00 ? 446 MET B N   1 
ATOM 5784  C CA  . MET B 2 347 ? 80.018  83.907  77.458  1.00 10.00 ? 446 MET B CA  1 
ATOM 5785  C C   . MET B 2 347 ? 81.440  84.020  77.976  1.00 10.00 ? 446 MET B C   1 
ATOM 5786  O O   . MET B 2 347 ? 81.702  83.605  79.097  1.00 10.00 ? 446 MET B O   1 
ATOM 5787  C CB  . MET B 2 347 ? 79.754  82.512  76.840  1.00 10.00 ? 446 MET B CB  1 
ATOM 5788  C CG  . MET B 2 347 ? 80.647  82.044  75.690  1.00 10.00 ? 446 MET B CG  1 
ATOM 5789  S SD  . MET B 2 347 ? 80.118  80.408  75.085  1.00 10.00 ? 446 MET B SD  1 
ATOM 5790  C CE  . MET B 2 347 ? 81.359  79.397  75.814  1.00 10.00 ? 446 MET B CE  1 
ATOM 5791  N N   . CYS B 2 348 ? 82.359  84.596  77.212  1.00 10.00 ? 447 CYS B N   1 
ATOM 5792  C CA  . CYS B 2 348 ? 83.697  84.698  77.725  1.00 10.00 ? 447 CYS B CA  1 
ATOM 5793  C C   . CYS B 2 348 ? 83.803  85.997  78.578  1.00 10.00 ? 447 CYS B C   1 
ATOM 5794  O O   . CYS B 2 348 ? 84.663  86.131  79.450  1.00 10.00 ? 447 CYS B O   1 
ATOM 5795  C CB  . CYS B 2 348 ? 84.591  84.621  76.500  1.00 10.00 ? 447 CYS B CB  1 
ATOM 5796  S SG  . CYS B 2 348 ? 83.633  83.711  75.231  1.00 10.00 ? 447 CYS B SG  1 
ATOM 5797  N N   . SER B 2 349 ? 82.893  86.944  78.330  1.00 10.00 ? 448 SER B N   1 
ATOM 5798  C CA  . SER B 2 349 ? 82.885  88.162  79.106  1.00 10.00 ? 448 SER B CA  1 
ATOM 5799  C C   . SER B 2 349 ? 82.192  87.838  80.432  1.00 10.00 ? 448 SER B C   1 
ATOM 5800  O O   . SER B 2 349 ? 82.852  87.827  81.466  1.00 10.00 ? 448 SER B O   1 
ATOM 5801  C CB  . SER B 2 349 ? 82.173  89.274  78.332  1.00 10.00 ? 448 SER B CB  1 
ATOM 5802  O OG  . SER B 2 349 ? 82.836  89.478  77.091  1.00 10.00 ? 448 SER B OG  1 
ATOM 5803  N N   . ILE B 2 350 ? 80.888  87.547  80.414  1.00 10.00 ? 449 ILE B N   1 
ATOM 5804  C CA  . ILE B 2 350 ? 80.178  87.216  81.645  1.00 10.00 ? 449 ILE B CA  1 
ATOM 5805  C C   . ILE B 2 350 ? 80.901  86.080  82.368  1.00 10.00 ? 449 ILE B C   1 
ATOM 5806  O O   . ILE B 2 350 ? 80.812  85.951  83.591  1.00 10.00 ? 449 ILE B O   1 
ATOM 5807  C CB  . ILE B 2 350 ? 78.718  86.807  81.358  1.00 10.00 ? 449 ILE B CB  1 
ATOM 5808  C CG1 . ILE B 2 350 ? 78.687  85.570  80.455  1.00 10.00 ? 449 ILE B CG1 1 
ATOM 5809  C CG2 . ILE B 2 350 ? 77.972  87.979  80.722  1.00 10.00 ? 449 ILE B CG2 1 
ATOM 5810  C CD1 . ILE B 2 350 ? 77.290  85.093  80.092  1.00 10.00 ? 449 ILE B CD1 1 
ATOM 5811  N N   . GLY B 2 351 ? 81.628  85.273  81.601  1.00 10.00 ? 450 GLY B N   1 
ATOM 5812  C CA  . GLY B 2 351 ? 82.371  84.173  82.174  1.00 10.00 ? 450 GLY B CA  1 
ATOM 5813  C C   . GLY B 2 351 ? 83.547  84.642  83.003  1.00 10.00 ? 450 GLY B C   1 
ATOM 5814  O O   . GLY B 2 351 ? 83.678  84.279  84.168  1.00 10.00 ? 450 GLY B O   1 
ATOM 5815  N N   . THR B 2 352 ? 84.414  85.453  82.396  1.00 10.00 ? 451 THR B N   1 
ATOM 5816  C CA  . THR B 2 352 ? 85.593  85.966  83.107  1.00 10.00 ? 451 THR B CA  1 
ATOM 5817  C C   . THR B 2 352 ? 85.186  86.978  84.181  1.00 10.00 ? 451 THR B C   1 
ATOM 5818  O O   . THR B 2 352 ? 86.031  87.449  84.941  1.00 10.00 ? 451 THR B O   1 
ATOM 5819  C CB  . THR B 2 352 ? 86.622  86.593  82.094  1.00 10.00 ? 451 THR B CB  1 
ATOM 5820  O OG1 . THR B 2 352 ? 87.819  87.009  82.771  1.00 10.00 ? 451 THR B OG1 1 
ATOM 5821  C CG2 . THR B 2 352 ? 85.992  87.727  81.353  1.00 10.00 ? 451 THR B CG2 1 
ATOM 5822  N N   . PHE B 2 353 ? 83.892  87.305  84.241  1.00 10.00 ? 452 PHE B N   1 
ATOM 5823  C CA  . PHE B 2 353 ? 83.384  88.246  85.231  1.00 10.00 ? 452 PHE B CA  1 
ATOM 5824  C C   . PHE B 2 353 ? 83.111  87.572  86.549  1.00 10.00 ? 452 PHE B C   1 
ATOM 5825  O O   . PHE B 2 353 ? 83.695  87.941  87.562  1.00 10.00 ? 452 PHE B O   1 
ATOM 5826  C CB  . PHE B 2 353 ? 82.112  88.892  84.727  1.00 10.00 ? 452 PHE B CB  1 
ATOM 5827  C CG  . PHE B 2 353 ? 82.316  89.667  83.487  1.00 10.00 ? 452 PHE B CG  1 
ATOM 5828  C CD1 . PHE B 2 353 ? 81.243  89.952  82.640  1.00 10.00 ? 452 PHE B CD1 1 
ATOM 5829  C CD2 . PHE B 2 353 ? 83.588  90.074  83.131  1.00 10.00 ? 452 PHE B CD2 1 
ATOM 5830  C CE1 . PHE B 2 353 ? 81.432  90.620  81.448  1.00 10.00 ? 452 PHE B CE1 1 
ATOM 5831  C CE2 . PHE B 2 353 ? 83.790  90.737  81.959  1.00 10.00 ? 452 PHE B CE2 1 
ATOM 5832  C CZ  . PHE B 2 353 ? 82.703  91.011  81.106  1.00 10.00 ? 452 PHE B CZ  1 
ATOM 5833  N N   . SER B 2 354 ? 82.196  86.607  86.563  1.00 10.00 ? 453 SER B N   1 
ATOM 5834  C CA  . SER B 2 354 ? 81.939  85.913  87.850  1.00 10.00 ? 453 SER B CA  1 
ATOM 5835  C C   . SER B 2 354 ? 83.214  85.164  88.189  1.00 10.00 ? 453 SER B C   1 
ATOM 5836  O O   . SER B 2 354 ? 83.488  84.942  89.349  1.00 10.00 ? 453 SER B O   1 
ATOM 5837  C CB  . SER B 2 354 ? 80.707  84.951  87.813  1.00 10.00 ? 453 SER B CB  1 
ATOM 5838  O OG  . SER B 2 354 ? 80.682  84.101  86.677  1.00 10.00 ? 453 SER B OG  1 
ATOM 5839  N N   . ILE B 2 355 ? 83.949  84.755  87.148  1.00 10.00 ? 454 ILE B N   1 
ATOM 5840  C CA  . ILE B 2 355 ? 85.256  84.097  87.291  1.00 10.00 ? 454 ILE B CA  1 
ATOM 5841  C C   . ILE B 2 355 ? 86.030  85.067  88.175  1.00 10.00 ? 454 ILE B C   1 
ATOM 5842  O O   . ILE B 2 355 ? 86.686  84.706  89.167  1.00 10.00 ? 454 ILE B O   1 
ATOM 5843  C CB  . ILE B 2 355 ? 86.015  84.017  85.908  1.00 10.00 ? 454 ILE B CB  1 
ATOM 5844  C CG1 . ILE B 2 355 ? 85.569  82.791  85.130  1.00 10.00 ? 454 ILE B CG1 1 
ATOM 5845  C CG2 . ILE B 2 355 ? 87.555  83.987  86.112  1.00 10.00 ? 454 ILE B CG2 1 
ATOM 5846  C CD1 . ILE B 2 355 ? 86.350  82.583  83.854  1.00 10.00 ? 454 ILE B CD1 1 
ATOM 5847  N N   . PHE B 2 356 ? 85.917  86.327  87.783  1.00 10.00 ? 455 PHE B N   1 
ATOM 5848  C CA  . PHE B 2 356 ? 86.583  87.418  88.459  1.00 10.00 ? 455 PHE B CA  1 
ATOM 5849  C C   . PHE B 2 356 ? 85.982  87.674  89.821  1.00 10.00 ? 455 PHE B C   1 
ATOM 5850  O O   . PHE B 2 356 ? 86.706  87.688  90.809  1.00 10.00 ? 455 PHE B O   1 
ATOM 5851  C CB  . PHE B 2 356 ? 86.520  88.697  87.619  1.00 10.00 ? 455 PHE B CB  1 
ATOM 5852  C CG  . PHE B 2 356 ? 87.564  89.715  87.991  1.00 10.00 ? 455 PHE B CG  1 
ATOM 5853  C CD1 . PHE B 2 356 ? 88.903  89.499  87.682  1.00 10.00 ? 455 PHE B CD1 1 
ATOM 5854  C CD2 . PHE B 2 356 ? 87.214  90.880  88.663  1.00 10.00 ? 455 PHE B CD2 1 
ATOM 5855  C CE1 . PHE B 2 356 ? 89.877  90.426  88.038  1.00 10.00 ? 455 PHE B CE1 1 
ATOM 5856  C CE2 . PHE B 2 356 ? 88.182  91.815  89.024  1.00 10.00 ? 455 PHE B CE2 1 
ATOM 5857  C CZ  . PHE B 2 356 ? 89.516  91.586  88.710  1.00 10.00 ? 455 PHE B CZ  1 
ATOM 5858  N N   . LEU B 2 357 ? 84.683  87.940  89.858  1.00 10.00 ? 456 LEU B N   1 
ATOM 5859  C CA  . LEU B 2 357 ? 84.007  88.166  91.129  1.00 10.00 ? 456 LEU B CA  1 
ATOM 5860  C C   . LEU B 2 357 ? 84.434  87.047  92.060  1.00 10.00 ? 456 LEU B C   1 
ATOM 5861  O O   . LEU B 2 357 ? 84.926  87.269  93.166  1.00 10.00 ? 456 LEU B O   1 
ATOM 5862  C CB  . LEU B 2 357 ? 82.492  88.110  90.947  1.00 10.00 ? 456 LEU B CB  1 
ATOM 5863  C CG  . LEU B 2 357 ? 81.780  89.372  90.456  1.00 10.00 ? 456 LEU B CG  1 
ATOM 5864  C CD1 . LEU B 2 357 ? 81.467  90.342  91.629  1.00 10.00 ? 456 LEU B CD1 1 
ATOM 5865  C CD2 . LEU B 2 357 ? 82.659  90.024  89.386  1.00 10.00 ? 456 LEU B CD2 1 
ATOM 5866  N N   . ASP B 2 358 ? 84.209  85.818  91.605  1.00 10.00 ? 457 ASP B N   1 
ATOM 5867  C CA  . ASP B 2 358 ? 84.606  84.648  92.412  1.00 10.00 ? 457 ASP B CA  1 
ATOM 5868  C C   . ASP B 2 358 ? 86.083  84.817  92.779  1.00 10.00 ? 457 ASP B C   1 
ATOM 5869  O O   . ASP B 2 358 ? 86.461  84.627  93.938  1.00 10.00 ? 457 ASP B O   1 
ATOM 5870  C CB  . ASP B 2 358 ? 84.378  83.296  91.671  1.00 10.00 ? 457 ASP B CB  1 
ATOM 5871  C CG  . ASP B 2 358 ? 82.902  82.946  91.539  1.00 10.00 ? 457 ASP B CG  1 
ATOM 5872  O OD1 . ASP B 2 358 ? 82.361  82.217  92.392  1.00 10.00 ? 457 ASP B OD1 1 
ATOM 5873  O OD2 . ASP B 2 358 ? 82.274  83.412  90.585  1.00 10.00 ? 457 ASP B OD2 1 
ATOM 5874  N N   . ALA B 2 359 ? 86.899  85.198  91.795  1.00 10.00 ? 458 ALA B N   1 
ATOM 5875  C CA  . ALA B 2 359 ? 88.325  85.434  91.984  1.00 10.00 ? 458 ALA B CA  1 
ATOM 5876  C C   . ALA B 2 359 ? 88.481  86.475  93.096  1.00 10.00 ? 458 ALA B C   1 
ATOM 5877  O O   . ALA B 2 359 ? 89.109  86.234  94.143  1.00 10.00 ? 458 ALA B O   1 
ATOM 5878  C CB  . ALA B 2 359 ? 88.933  85.938  90.701  1.00 10.00 ? 458 ALA B CB  1 
ATOM 5879  N N   . SER B 2 360 ? 87.849  87.626  92.889  1.00 10.00 ? 459 SER B N   1 
ATOM 5880  C CA  . SER B 2 360 ? 87.873  88.733  93.856  1.00 10.00 ? 459 SER B CA  1 
ATOM 5881  C C   . SER B 2 360 ? 87.267  88.306  95.203  1.00 10.00 ? 459 SER B C   1 
ATOM 5882  O O   . SER B 2 360 ? 87.774  88.639  96.251  1.00 10.00 ? 459 SER B O   1 
ATOM 5883  C CB  . SER B 2 360 ? 87.121  89.946  93.289  1.00 10.00 ? 459 SER B CB  1 
ATOM 5884  O OG  . SER B 2 360 ? 85.818  89.598  92.859  1.00 10.00 ? 459 SER B OG  1 
ATOM 5885  N N   . HIS B 2 361 ? 86.205  87.518  95.163  1.00 10.00 ? 460 HIS B N   1 
ATOM 5886  C CA  . HIS B 2 361 ? 85.566  87.079  96.405  1.00 10.00 ? 460 HIS B CA  1 
ATOM 5887  C C   . HIS B 2 361 ? 86.451  86.257  97.375  1.00 10.00 ? 460 HIS B C   1 
ATOM 5888  O O   . HIS B 2 361 ? 86.348  86.397  98.591  1.00 10.00 ? 460 HIS B O   1 
ATOM 5889  C CB  . HIS B 2 361 ? 84.328  86.255  96.077  1.00 10.00 ? 460 HIS B CB  1 
ATOM 5890  C CG  . HIS B 2 361 ? 83.140  87.051  95.621  1.00 10.00 ? 460 HIS B CG  1 
ATOM 5891  N ND1 . HIS B 2 361 ? 82.399  87.839  96.479  1.00 10.00 ? 460 HIS B ND1 1 
ATOM 5892  C CD2 . HIS B 2 361 ? 82.479  87.061  94.437  1.00 10.00 ? 460 HIS B CD2 1 
ATOM 5893  C CE1 . HIS B 2 361 ? 81.332  88.288  95.845  1.00 10.00 ? 460 HIS B CE1 1 
ATOM 5894  N NE2 . HIS B 2 361 ? 81.358  87.831  94.605  1.00 10.00 ? 460 HIS B NE2 1 
ATOM 5895  N N   . ASN B 2 362 ? 87.328  85.403  96.862  1.00 10.00 ? 461 ASN B N   1 
ATOM 5896  C CA  . ASN B 2 362 ? 88.151  84.574  97.773  1.00 10.00 ? 461 ASN B CA  1 
ATOM 5897  C C   . ASN B 2 362 ? 89.435  85.213  98.235  1.00 10.00 ? 461 ASN B C   1 
ATOM 5898  O O   . ASN B 2 362 ? 89.938  84.909  99.316  1.00 10.00 ? 461 ASN B O   1 
ATOM 5899  C CB  . ASN B 2 362 ? 88.485  83.266  97.116  1.00 10.00 ? 461 ASN B CB  1 
ATOM 5900  C CG  . ASN B 2 362 ? 87.421  82.849  96.196  1.00 10.00 ? 461 ASN B CG  1 
ATOM 5901  O OD1 . ASN B 2 362 ? 86.232  82.876  96.543  1.00 10.00 ? 461 ASN B OD1 1 
ATOM 5902  N ND2 . ASN B 2 362 ? 87.810  82.471  94.987  1.00 10.00 ? 461 ASN B ND2 1 
ATOM 5903  N N   . VAL B 2 363 ? 89.948  86.130  97.432  1.00 10.00 ? 462 VAL B N   1 
ATOM 5904  C CA  . VAL B 2 363 ? 91.188  86.771  97.773  1.00 10.00 ? 462 VAL B CA  1 
ATOM 5905  C C   . VAL B 2 363 ? 90.855  88.141  98.418  1.00 10.00 ? 462 VAL B C   1 
ATOM 5906  O O   . VAL B 2 363 ? 91.214  88.384  99.570  1.00 10.00 ? 462 VAL B O   1 
ATOM 5907  C CB  . VAL B 2 363 ? 92.057  86.774  96.496  1.00 10.00 ? 462 VAL B CB  1 
ATOM 5908  C CG1 . VAL B 2 363 ? 93.376  86.038  96.759  1.00 10.00 ? 462 VAL B CG1 1 
ATOM 5909  C CG2 . VAL B 2 363 ? 91.286  86.046  95.379  1.00 10.00 ? 462 VAL B CG2 1 
ATOM 5910  N N   . PRO B 2 364 ? 90.156  89.040  97.700  1.00 10.00 ? 463 PRO B N   1 
ATOM 5911  C CA  . PRO B 2 364 ? 89.786  90.341  98.258  1.00 10.00 ? 463 PRO B CA  1 
ATOM 5912  C C   . PRO B 2 364 ? 89.109  90.346  99.668  1.00 10.00 ? 463 PRO B C   1 
ATOM 5913  O O   . PRO B 2 364 ? 89.611  90.978  100.614 1.00 10.00 ? 463 PRO B O   1 
ATOM 5914  C CB  . PRO B 2 364 ? 88.885  90.905  97.158  1.00 10.00 ? 463 PRO B CB  1 
ATOM 5915  C CG  . PRO B 2 364 ? 89.667  90.499  95.904  1.00 10.00 ? 463 PRO B CG  1 
ATOM 5916  C CD  . PRO B 2 364 ? 90.089  89.078  96.215  1.00 10.00 ? 463 PRO B CD  1 
ATOM 5917  N N   . PRO B 2 365 ? 87.967  89.650  99.834  1.00 10.00 ? 464 PRO B N   1 
ATOM 5918  C CA  . PRO B 2 365 ? 87.334  89.667  101.166 1.00 10.00 ? 464 PRO B CA  1 
ATOM 5919  C C   . PRO B 2 365 ? 87.846  88.592  102.126 1.00 10.00 ? 464 PRO B C   1 
ATOM 5920  O O   . PRO B 2 365 ? 87.069  88.022  102.874 1.00 10.00 ? 464 PRO B O   1 
ATOM 5921  C CB  . PRO B 2 365 ? 85.858  89.470  100.848 1.00 10.00 ? 464 PRO B CB  1 
ATOM 5922  C CG  . PRO B 2 365 ? 85.936  88.495  99.738  1.00 10.00 ? 464 PRO B CG  1 
ATOM 5923  C CD  . PRO B 2 365 ? 87.095  88.973  98.857  1.00 10.00 ? 464 PRO B CD  1 
ATOM 5924  N N   . ASP B 2 366 ? 89.159  88.370  102.126 1.00 10.00 ? 465 ASP B N   1 
ATOM 5925  C CA  . ASP B 2 366 ? 89.784  87.348  102.953 1.00 10.00 ? 465 ASP B CA  1 
ATOM 5926  C C   . ASP B 2 366 ? 90.501  87.853  104.208 1.00 10.00 ? 465 ASP B C   1 
ATOM 5927  O O   . ASP B 2 366 ? 90.445  87.216  105.265 1.00 10.00 ? 465 ASP B O   1 
ATOM 5928  C CB  . ASP B 2 366 ? 90.766  86.544  102.085 1.00 10.00 ? 465 ASP B CB  1 
ATOM 5929  C CG  . ASP B 2 366 ? 92.114  87.248  101.895 1.00 10.00 ? 465 ASP B CG  1 
ATOM 5930  O OD1 . ASP B 2 366 ? 92.137  88.446  101.543 1.00 10.00 ? 465 ASP B OD1 1 
ATOM 5931  O OD2 . ASP B 2 366 ? 93.161  86.591  102.093 1.00 10.00 ? 465 ASP B OD2 1 
ATOM 5932  N N   . ASN B 2 367 ? 91.150  89.007  104.111 1.00 10.00 ? 466 ASN B N   1 
ATOM 5933  C CA  . ASN B 2 367 ? 91.911  89.521  105.250 1.00 10.00 ? 466 ASN B CA  1 
ATOM 5934  C C   . ASN B 2 367 ? 91.145  90.072  106.451 1.00 10.00 ? 466 ASN B C   1 
ATOM 5935  O O   . ASN B 2 367 ? 91.748  90.349  107.478 1.00 10.00 ? 466 ASN B O   1 
ATOM 5936  C CB  . ASN B 2 367 ? 92.919  90.568  104.761 1.00 10.00 ? 466 ASN B CB  1 
ATOM 5937  C CG  . ASN B 2 367 ? 92.309  91.559  103.791 1.00 10.00 ? 466 ASN B CG  1 
ATOM 5938  O OD1 . ASN B 2 367 ? 91.369  92.279  104.128 1.00 10.00 ? 466 ASN B OD1 1 
ATOM 5939  N ND2 . ASN B 2 367 ? 92.842  91.599  102.574 1.00 10.00 ? 466 ASN B ND2 1 
ATOM 5940  N N   . PRO B 2 368 ? 89.810  90.261  106.344 1.00 10.00 ? 467 PRO B N   1 
ATOM 5941  C CA  . PRO B 2 368 ? 89.199  90.790  107.568 1.00 10.00 ? 467 PRO B CA  1 
ATOM 5942  C C   . PRO B 2 368 ? 89.130  89.762  108.727 1.00 10.00 ? 467 PRO B C   1 
ATOM 5943  O O   . PRO B 2 368 ? 88.202  89.779  109.548 1.00 10.00 ? 467 PRO B O   1 
ATOM 5944  C CB  . PRO B 2 368 ? 87.826  91.308  107.081 1.00 10.00 ? 467 PRO B CB  1 
ATOM 5945  C CG  . PRO B 2 368 ? 87.537  90.490  105.834 1.00 10.00 ? 467 PRO B CG  1 
ATOM 5946  C CD  . PRO B 2 368 ? 88.885  90.323  105.190 1.00 10.00 ? 467 PRO B CD  1 
ATOM 5947  N N   . PHE B 2 369 ? 90.107  88.850  108.761 1.00 10.00 ? 468 PHE B N   1 
ATOM 5948  C CA  . PHE B 2 369 ? 90.213  87.829  109.823 1.00 10.00 ? 468 PHE B CA  1 
ATOM 5949  C C   . PHE B 2 369 ? 90.529  88.615  111.084 1.00 10.00 ? 468 PHE B C   1 
ATOM 5950  O O   . PHE B 2 369 ? 91.609  88.490  111.658 1.00 10.00 ? 468 PHE B O   1 
ATOM 5951  C CB  . PHE B 2 369 ? 91.375  86.851  109.565 1.00 10.00 ? 468 PHE B CB  1 
ATOM 5952  C CG  . PHE B 2 369 ? 91.121  85.871  108.484 1.00 10.00 ? 468 PHE B CG  1 
ATOM 5953  C CD1 . PHE B 2 369 ? 92.192  85.329  107.780 1.00 10.00 ? 468 PHE B CD1 1 
ATOM 5954  C CD2 . PHE B 2 369 ? 89.826  85.537  108.121 1.00 10.00 ? 468 PHE B CD2 1 
ATOM 5955  C CE1 . PHE B 2 369 ? 91.987  84.476  106.717 1.00 10.00 ? 468 PHE B CE1 1 
ATOM 5956  C CE2 . PHE B 2 369 ? 89.606  84.687  107.066 1.00 10.00 ? 468 PHE B CE2 1 
ATOM 5957  C CZ  . PHE B 2 369 ? 90.693  84.154  106.354 1.00 10.00 ? 468 PHE B CZ  1 
ATOM 5958  N N   . ALA B 2 370 ? 89.561  89.414  111.501 1.00 10.00 ? 469 ALA B N   1 
ATOM 5959  C CA  . ALA B 2 370 ? 89.671  90.306  112.643 1.00 10.00 ? 469 ALA B CA  1 
ATOM 5960  C C   . ALA B 2 370 ? 88.452  91.204  112.459 1.00 10.00 ? 469 ALA B C   1 
ATOM 5961  O O   . ALA B 2 370 ? 87.346  90.630  112.452 1.00 10.00 ? 469 ALA B O   1 
ATOM 5962  C CB  . ALA B 2 370 ? 90.978  91.139  112.568 1.00 10.00 ? 469 ALA B CB  1 
ATOM 5963  O OXT . ALA B 2 370 ? 88.607  92.437  112.289 1.00 10.00 ? 469 ALA B OXT 1 
ATOM 5964  N N   . VAL C 3 1   ? 70.338  37.971  164.416 1.00 10.00 ? 1   VAL C N   1 
ATOM 5965  C CA  . VAL C 3 1   ? 70.334  38.800  165.653 1.00 10.00 ? 1   VAL C CA  1 
ATOM 5966  C C   . VAL C 3 1   ? 71.771  38.994  166.145 1.00 10.00 ? 1   VAL C C   1 
ATOM 5967  O O   . VAL C 3 1   ? 72.055  39.953  166.856 1.00 10.00 ? 1   VAL C O   1 
ATOM 5968  C CB  . VAL C 3 1   ? 69.448  38.154  166.785 1.00 10.00 ? 1   VAL C CB  1 
ATOM 5969  C CG1 . VAL C 3 1   ? 69.222  39.158  167.941 1.00 10.00 ? 1   VAL C CG1 1 
ATOM 5970  C CG2 . VAL C 3 1   ? 68.097  37.710  166.202 1.00 10.00 ? 1   VAL C CG2 1 
ATOM 5971  N N   . ASN C 3 2   ? 72.652  38.077  165.741 1.00 10.00 ? 2   ASN C N   1 
ATOM 5972  C CA  . ASN C 3 2   ? 74.082  38.103  166.065 1.00 10.00 ? 2   ASN C CA  1 
ATOM 5973  C C   . ASN C 3 2   ? 74.588  39.543  165.936 1.00 10.00 ? 2   ASN C C   1 
ATOM 5974  O O   . ASN C 3 2   ? 75.326  39.849  165.007 1.00 10.00 ? 2   ASN C O   1 
ATOM 5975  C CB  . ASN C 3 2   ? 74.858  37.211  165.066 1.00 10.00 ? 2   ASN C CB  1 
ATOM 5976  C CG  . ASN C 3 2   ? 76.243  36.821  165.575 1.00 10.00 ? 2   ASN C CG  1 
ATOM 5977  O OD1 . ASN C 3 2   ? 76.355  35.979  166.448 1.00 10.00 ? 2   ASN C OD1 1 
ATOM 5978  N ND2 . ASN C 3 2   ? 77.293  37.445  165.046 1.00 10.00 ? 2   ASN C ND2 1 
ATOM 5979  N N   . GLU C 3 3   ? 74.200  40.425  166.854 1.00 10.00 ? 3   GLU C N   1 
ATOM 5980  C CA  . GLU C 3 3   ? 74.616  41.808  166.777 1.00 10.00 ? 3   GLU C CA  1 
ATOM 5981  C C   . GLU C 3 3   ? 74.128  42.395  165.439 1.00 10.00 ? 3   GLU C C   1 
ATOM 5982  O O   . GLU C 3 3   ? 74.557  43.473  165.033 1.00 10.00 ? 3   GLU C O   1 
ATOM 5983  C CB  . GLU C 3 3   ? 76.147  41.881  166.907 1.00 10.00 ? 3   GLU C CB  1 
ATOM 5984  C CG  . GLU C 3 3   ? 76.829  43.053  166.208 1.00 10.00 ? 3   GLU C CG  1 
ATOM 5985  C CD  . GLU C 3 3   ? 77.620  42.639  164.971 1.00 10.00 ? 3   GLU C CD  1 
ATOM 5986  O OE1 . GLU C 3 3   ? 78.846  42.879  164.931 1.00 10.00 ? 3   GLU C OE1 1 
ATOM 5987  O OE2 . GLU C 3 3   ? 77.020  42.074  164.035 1.00 10.00 ? 3   GLU C OE2 1 
ATOM 5988  N N   . GLU C 3 4   ? 73.186  41.769  164.741 1.00 10.00 ? 4   GLU C N   1 
ATOM 5989  C CA  . GLU C 3 4   ? 72.838  42.330  163.442 1.00 10.00 ? 4   GLU C CA  1 
ATOM 5990  C C   . GLU C 3 4   ? 72.187  43.699  163.592 1.00 10.00 ? 4   GLU C C   1 
ATOM 5991  O O   . GLU C 3 4   ? 72.690  44.626  162.943 1.00 10.00 ? 4   GLU C O   1 
ATOM 5992  C CB  . GLU C 3 4   ? 71.914  41.380  162.678 1.00 10.00 ? 4   GLU C CB  1 
ATOM 5993  C CG  . GLU C 3 4   ? 70.509  41.287  163.252 1.00 10.00 ? 4   GLU C CG  1 
ATOM 5994  C CD  . GLU C 3 4   ? 69.692  40.181  162.614 1.00 10.00 ? 4   GLU C CD  1 
ATOM 5995  O OE1 . GLU C 3 4   ? 70.218  39.498  161.712 1.00 10.00 ? 4   GLU C OE1 1 
ATOM 5996  O OE2 . GLU C 3 4   ? 68.522  40.000  163.016 1.00 10.00 ? 4   GLU C OE2 1 
ATOM 5997  N N   . GLU C 3 5   ? 71.069  43.849  164.285 1.00 10.00 ? 5   GLU C N   1 
ATOM 5998  C CA  . GLU C 3 5   ? 70.425  45.122  164.407 1.00 10.00 ? 5   GLU C CA  1 
ATOM 5999  C C   . GLU C 3 5   ? 71.536  46.132  164.731 1.00 10.00 ? 5   GLU C C   1 
ATOM 6000  O O   . GLU C 3 5   ? 71.777  47.091  163.993 1.00 10.00 ? 5   GLU C O   1 
ATOM 6001  C CB  . GLU C 3 5   ? 69.405  45.024  165.549 1.00 10.00 ? 5   GLU C CB  1 
ATOM 6002  C CG  . GLU C 3 5   ? 68.781  43.655  165.705 1.00 10.00 ? 5   GLU C CG  1 
ATOM 6003  C CD  . GLU C 3 5   ? 67.422  43.744  166.331 1.00 10.00 ? 5   GLU C CD  1 
ATOM 6004  O OE1 . GLU C 3 5   ? 67.285  44.484  167.323 1.00 10.00 ? 5   GLU C OE1 1 
ATOM 6005  O OE2 . GLU C 3 5   ? 66.490  43.073  165.842 1.00 10.00 ? 5   GLU C OE2 1 
ATOM 6006  N N   . ARG C 3 6   ? 72.212  45.882  165.848 1.00 10.00 ? 6   ARG C N   1 
ATOM 6007  C CA  . ARG C 3 6   ? 73.293  46.729  166.316 1.00 10.00 ? 6   ARG C CA  1 
ATOM 6008  C C   . ARG C 3 6   ? 74.352  46.997  165.252 1.00 10.00 ? 6   ARG C C   1 
ATOM 6009  O O   . ARG C 3 6   ? 74.739  48.144  165.058 1.00 10.00 ? 6   ARG C O   1 
ATOM 6010  C CB  . ARG C 3 6   ? 73.956  46.090  167.541 1.00 10.00 ? 6   ARG C CB  1 
ATOM 6011  C CG  . ARG C 3 6   ? 72.982  45.652  168.632 1.00 10.00 ? 6   ARG C CG  1 
ATOM 6012  C CD  . ARG C 3 6   ? 73.723  45.011  169.802 1.00 10.00 ? 6   ARG C CD  1 
ATOM 6013  N NE  . ARG C 3 6   ? 72.825  44.492  170.833 1.00 10.00 ? 6   ARG C NE  1 
ATOM 6014  C CZ  . ARG C 3 6   ? 71.987  43.474  170.659 1.00 10.00 ? 6   ARG C CZ  1 
ATOM 6015  N NH1 . ARG C 3 6   ? 71.924  42.854  169.488 1.00 10.00 ? 6   ARG C NH1 1 
ATOM 6016  N NH2 . ARG C 3 6   ? 71.215  43.070  171.659 1.00 10.00 ? 6   ARG C NH2 1 
ATOM 6017  N N   . LEU C 3 7   ? 74.829  45.955  164.573 1.00 10.00 ? 7   LEU C N   1 
ATOM 6018  C CA  . LEU C 3 7   ? 75.868  46.167  163.572 1.00 10.00 ? 7   LEU C CA  1 
ATOM 6019  C C   . LEU C 3 7   ? 75.454  46.984  162.362 1.00 10.00 ? 7   LEU C C   1 
ATOM 6020  O O   . LEU C 3 7   ? 76.178  47.884  161.978 1.00 10.00 ? 7   LEU C O   1 
ATOM 6021  C CB  . LEU C 3 7   ? 76.473  44.850  163.087 1.00 10.00 ? 7   LEU C CB  1 
ATOM 6022  C CG  . LEU C 3 7   ? 78.005  44.880  162.921 1.00 10.00 ? 7   LEU C CG  1 
ATOM 6023  C CD1 . LEU C 3 7   ? 78.425  43.671  162.109 1.00 10.00 ? 7   LEU C CD1 1 
ATOM 6024  C CD2 . LEU C 3 7   ? 78.480  46.159  162.238 1.00 10.00 ? 7   LEU C CD2 1 
ATOM 6025  N N   . ILE C 3 8   ? 74.332  46.685  161.715 1.00 10.00 ? 8   ILE C N   1 
ATOM 6026  C CA  . ILE C 3 8   ? 74.007  47.543  160.577 1.00 10.00 ? 8   ILE C CA  1 
ATOM 6027  C C   . ILE C 3 8   ? 73.670  48.916  161.145 1.00 10.00 ? 8   ILE C C   1 
ATOM 6028  O O   . ILE C 3 8   ? 73.521  49.887  160.407 1.00 10.00 ? 8   ILE C O   1 
ATOM 6029  C CB  . ILE C 3 8   ? 72.829  47.024  159.726 1.00 10.00 ? 8   ILE C CB  1 
ATOM 6030  C CG1 . ILE C 3 8   ? 73.133  47.246  158.234 1.00 10.00 ? 8   ILE C CG1 1 
ATOM 6031  C CG2 . ILE C 3 8   ? 71.538  47.763  160.114 1.00 10.00 ? 8   ILE C CG2 1 
ATOM 6032  C CD1 . ILE C 3 8   ? 74.334  46.497  157.697 1.00 10.00 ? 8   ILE C CD1 1 
ATOM 6033  N N   . ASN C 3 9   ? 73.529  48.992  162.465 1.00 10.00 ? 9   ASN C N   1 
ATOM 6034  C CA  . ASN C 3 9   ? 73.267  50.277  163.069 1.00 10.00 ? 9   ASN C CA  1 
ATOM 6035  C C   . ASN C 3 9   ? 74.701  50.803  163.178 1.00 10.00 ? 9   ASN C C   1 
ATOM 6036  O O   . ASN C 3 9   ? 74.945  52.005  163.132 1.00 10.00 ? 9   ASN C O   1 
ATOM 6037  C CB  . ASN C 3 9   ? 72.622  50.116  164.462 1.00 10.00 ? 9   ASN C CB  1 
ATOM 6038  C CG  . ASN C 3 9   ? 71.968  51.403  164.974 1.00 10.00 ? 9   ASN C CG  1 
ATOM 6039  O OD1 . ASN C 3 9   ? 72.620  52.440  165.121 1.00 10.00 ? 9   ASN C OD1 1 
ATOM 6040  N ND2 . ASN C 3 9   ? 70.672  51.329  165.255 1.00 10.00 ? 9   ASN C ND2 1 
ATOM 6041  N N   . ASP C 3 10  ? 75.651  49.885  163.339 1.00 10.00 ? 10  ASP C N   1 
ATOM 6042  C CA  . ASP C 3 10  ? 77.051  50.278  163.424 1.00 10.00 ? 10  ASP C CA  1 
ATOM 6043  C C   . ASP C 3 10  ? 77.446  50.883  162.081 1.00 10.00 ? 10  ASP C C   1 
ATOM 6044  O O   . ASP C 3 10  ? 78.083  51.934  162.030 1.00 10.00 ? 10  ASP C O   1 
ATOM 6045  C CB  . ASP C 3 10  ? 77.949  49.072  163.738 1.00 10.00 ? 10  ASP C CB  1 
ATOM 6046  C CG  . ASP C 3 10  ? 77.807  48.589  165.172 1.00 10.00 ? 10  ASP C CG  1 
ATOM 6047  O OD1 . ASP C 3 10  ? 77.965  49.414  166.097 1.00 10.00 ? 10  ASP C OD1 1 
ATOM 6048  O OD2 . ASP C 3 10  ? 77.549  47.386  165.379 1.00 10.00 ? 10  ASP C OD2 1 
ATOM 6049  N N   . LEU C 3 11  ? 77.054  50.221  160.993 1.00 10.00 ? 11  LEU C N   1 
ATOM 6050  C CA  . LEU C 3 11  ? 77.373  50.710  159.650 1.00 10.00 ? 11  LEU C CA  1 
ATOM 6051  C C   . LEU C 3 11  ? 76.401  51.816  159.256 1.00 10.00 ? 11  LEU C C   1 
ATOM 6052  O O   . LEU C 3 11  ? 76.801  52.815  158.669 1.00 10.00 ? 11  LEU C O   1 
ATOM 6053  C CB  . LEU C 3 11  ? 77.294  49.567  158.617 1.00 10.00 ? 11  LEU C CB  1 
ATOM 6054  C CG  . LEU C 3 11  ? 78.155  48.295  158.743 1.00 10.00 ? 11  LEU C CG  1 
ATOM 6055  C CD1 . LEU C 3 11  ? 77.758  47.317  157.650 1.00 10.00 ? 11  LEU C CD1 1 
ATOM 6056  C CD2 . LEU C 3 11  ? 79.634  48.620  158.633 1.00 10.00 ? 11  LEU C CD2 1 
ATOM 6057  N N   . LEU C 3 12  ? 75.120  51.629  159.577 1.00 10.00 ? 12  LEU C N   1 
ATOM 6058  C CA  . LEU C 3 12  ? 74.106  52.644  159.257 1.00 10.00 ? 12  LEU C CA  1 
ATOM 6059  C C   . LEU C 3 12  ? 74.365  53.235  157.896 1.00 10.00 ? 12  LEU C C   1 
ATOM 6060  O O   . LEU C 3 12  ? 73.926  54.344  157.615 1.00 10.00 ? 12  LEU C O   1 
ATOM 6061  C CB  . LEU C 3 12  ? 74.120  53.768  160.293 1.00 10.00 ? 12  LEU C CB  1 
ATOM 6062  C CG  . LEU C 3 12  ? 73.453  53.408  161.613 1.00 10.00 ? 12  LEU C CG  1 
ATOM 6063  C CD1 . LEU C 3 12  ? 73.600  54.544  162.591 1.00 10.00 ? 12  LEU C CD1 1 
ATOM 6064  C CD2 . LEU C 3 12  ? 71.987  53.087  161.383 1.00 10.00 ? 12  LEU C CD2 1 
ATOM 6065  N N   . ILE C 3 13  ? 75.083  52.482  157.061 1.00 10.00 ? 13  ILE C N   1 
ATOM 6066  C CA  . ILE C 3 13  ? 75.477  52.922  155.737 1.00 10.00 ? 13  ILE C CA  1 
ATOM 6067  C C   . ILE C 3 13  ? 75.525  54.480  155.680 1.00 10.00 ? 13  ILE C C   1 
ATOM 6068  O O   . ILE C 3 13  ? 76.533  55.088  155.982 1.00 10.00 ? 13  ILE C O   1 
ATOM 6069  C CB  . ILE C 3 13  ? 74.465  52.397  154.706 1.00 10.00 ? 13  ILE C CB  1 
ATOM 6070  C CG1 . ILE C 3 13  ? 73.762  51.155  155.270 1.00 10.00 ? 13  ILE C CG1 1 
ATOM 6071  C CG2 . ILE C 3 13  ? 75.181  52.049  153.411 1.00 10.00 ? 13  ILE C CG2 1 
ATOM 6072  C CD1 . ILE C 3 13  ? 72.497  50.773  154.548 1.00 10.00 ? 13  ILE C CD1 1 
ATOM 6073  N N   . VAL C 3 14  ? 74.379  55.089  155.345 1.00 10.00 ? 14  VAL C N   1 
ATOM 6074  C CA  . VAL C 3 14  ? 74.218  56.547  155.239 1.00 10.00 ? 14  VAL C CA  1 
ATOM 6075  C C   . VAL C 3 14  ? 74.542  57.385  156.489 1.00 10.00 ? 14  VAL C C   1 
ATOM 6076  O O   . VAL C 3 14  ? 75.151  58.454  156.393 1.00 10.00 ? 14  VAL C O   1 
ATOM 6077  C CB  . VAL C 3 14  ? 72.766  56.900  154.809 1.00 10.00 ? 14  VAL C CB  1 
ATOM 6078  C CG1 . VAL C 3 14  ? 71.777  56.313  155.804 1.00 10.00 ? 14  VAL C CG1 1 
ATOM 6079  C CG2 . VAL C 3 14  ? 72.585  58.411  154.725 1.00 10.00 ? 14  VAL C CG2 1 
ATOM 6080  N N   . ASN C 3 15  ? 74.136  56.891  157.655 1.00 10.00 ? 15  ASN C N   1 
ATOM 6081  C CA  . ASN C 3 15  ? 74.325  57.599  158.927 1.00 10.00 ? 15  ASN C CA  1 
ATOM 6082  C C   . ASN C 3 15  ? 75.686  57.385  159.591 1.00 10.00 ? 15  ASN C C   1 
ATOM 6083  O O   . ASN C 3 15  ? 76.330  58.338  160.043 1.00 10.00 ? 15  ASN C O   1 
ATOM 6084  C CB  . ASN C 3 15  ? 73.204  57.203  159.900 1.00 10.00 ? 15  ASN C CB  1 
ATOM 6085  C CG  . ASN C 3 15  ? 73.195  58.042  161.167 1.00 10.00 ? 15  ASN C CG  1 
ATOM 6086  O OD1 . ASN C 3 15  ? 72.349  57.851  162.042 1.00 10.00 ? 15  ASN C OD1 1 
ATOM 6087  N ND2 . ASN C 3 15  ? 74.133  58.975  161.271 1.00 10.00 ? 15  ASN C ND2 1 
ATOM 6088  N N   . LYS C 3 16  ? 76.126  56.139  159.679 1.00 10.00 ? 16  LYS C N   1 
ATOM 6089  C CA  . LYS C 3 16  ? 77.425  55.891  160.291 1.00 10.00 ? 16  LYS C CA  1 
ATOM 6090  C C   . LYS C 3 16  ? 78.548  55.972  159.273 1.00 10.00 ? 16  LYS C C   1 
ATOM 6091  O O   . LYS C 3 16  ? 79.578  56.574  159.543 1.00 10.00 ? 16  LYS C O   1 
ATOM 6092  C CB  . LYS C 3 16  ? 77.441  54.539  160.987 1.00 10.00 ? 16  LYS C CB  1 
ATOM 6093  C CG  . LYS C 3 16  ? 76.504  54.422  162.184 1.00 10.00 ? 16  LYS C CG  1 
ATOM 6094  C CD  . LYS C 3 16  ? 76.725  55.492  163.254 1.00 10.00 ? 16  LYS C CD  1 
ATOM 6095  C CE  . LYS C 3 16  ? 75.920  56.755  162.988 1.00 10.00 ? 16  LYS C CE  1 
ATOM 6096  N NZ  . LYS C 3 16  ? 76.017  57.715  164.124 1.00 10.00 ? 16  LYS C NZ  1 
ATOM 6097  N N   . TYR C 3 17  ? 78.346  55.356  158.104 1.00 10.00 ? 17  TYR C N   1 
ATOM 6098  C CA  . TYR C 3 17  ? 79.326  55.400  156.993 1.00 10.00 ? 17  TYR C CA  1 
ATOM 6099  C C   . TYR C 3 17  ? 79.264  56.785  156.392 1.00 10.00 ? 17  TYR C C   1 
ATOM 6100  O O   . TYR C 3 17  ? 78.186  57.389  156.339 1.00 10.00 ? 17  TYR C O   1 
ATOM 6101  C CB  . TYR C 3 17  ? 78.995  54.371  155.878 1.00 10.00 ? 17  TYR C CB  1 
ATOM 6102  C CG  . TYR C 3 17  ? 79.492  54.757  154.493 1.00 10.00 ? 17  TYR C CG  1 
ATOM 6103  C CD1 . TYR C 3 17  ? 80.834  55.092  154.258 1.00 10.00 ? 17  TYR C CD1 1 
ATOM 6104  C CD2 . TYR C 3 17  ? 78.613  54.829  153.422 1.00 10.00 ? 17  TYR C CD2 1 
ATOM 6105  C CE1 . TYR C 3 17  ? 81.281  55.495  152.989 1.00 10.00 ? 17  TYR C CE1 1 
ATOM 6106  C CE2 . TYR C 3 17  ? 79.062  55.242  152.150 1.00 10.00 ? 17  TYR C CE2 1 
ATOM 6107  C CZ  . TYR C 3 17  ? 80.383  55.571  151.963 1.00 10.00 ? 17  TYR C CZ  1 
ATOM 6108  O OH  . TYR C 3 17  ? 80.764  56.036  150.760 1.00 10.00 ? 17  TYR C OH  1 
ATOM 6109  N N   . ASN C 3 18  ? 80.407  57.303  155.967 1.00 10.00 ? 18  ASN C N   1 
ATOM 6110  C CA  . ASN C 3 18  ? 80.429  58.599  155.342 1.00 10.00 ? 18  ASN C CA  1 
ATOM 6111  C C   . ASN C 3 18  ? 80.258  58.376  153.831 1.00 10.00 ? 18  ASN C C   1 
ATOM 6112  O O   . ASN C 3 18  ? 81.213  58.027  153.114 1.00 10.00 ? 18  ASN C O   1 
ATOM 6113  C CB  . ASN C 3 18  ? 81.757  59.259  155.661 1.00 10.00 ? 18  ASN C CB  1 
ATOM 6114  C CG  . ASN C 3 18  ? 82.152  59.087  157.113 1.00 10.00 ? 18  ASN C CG  1 
ATOM 6115  O OD1 . ASN C 3 18  ? 81.502  59.619  158.013 1.00 10.00 ? 18  ASN C OD1 1 
ATOM 6116  N ND2 . ASN C 3 18  ? 83.218  58.331  157.349 1.00 10.00 ? 18  ASN C ND2 1 
ATOM 6117  N N   . LYS C 3 19  ? 79.036  58.518  153.324 1.00 10.00 ? 19  LYS C N   1 
ATOM 6118  C CA  . LYS C 3 19  ? 78.917  58.323  151.897 1.00 10.00 ? 19  LYS C CA  1 
ATOM 6119  C C   . LYS C 3 19  ? 79.369  59.573  151.212 1.00 10.00 ? 19  LYS C C   1 
ATOM 6120  O O   . LYS C 3 19  ? 79.789  59.517  150.069 1.00 10.00 ? 19  LYS C O   1 
ATOM 6121  C CB  . LYS C 3 19  ? 77.516  57.960  151.444 1.00 10.00 ? 19  LYS C CB  1 
ATOM 6122  C CG  . LYS C 3 19  ? 77.362  58.022  149.946 1.00 10.00 ? 19  LYS C CG  1 
ATOM 6123  C CD  . LYS C 3 19  ? 78.621  57.591  149.158 1.00 10.00 ? 19  LYS C CD  1 
ATOM 6124  C CE  . LYS C 3 19  ? 78.648  58.257  147.739 1.00 10.00 ? 19  LYS C CE  1 
ATOM 6125  N NZ  . LYS C 3 19  ? 79.826  57.942  146.869 1.00 10.00 ? 19  LYS C NZ  1 
ATOM 6126  N N   . HIS C 3 20  ? 79.255  60.712  151.882 1.00 10.00 ? 20  HIS C N   1 
ATOM 6127  C CA  . HIS C 3 20  ? 79.778  61.911  151.250 1.00 10.00 ? 20  HIS C CA  1 
ATOM 6128  C C   . HIS C 3 20  ? 81.289  61.931  151.507 1.00 10.00 ? 20  HIS C C   1 
ATOM 6129  O O   . HIS C 3 20  ? 81.994  62.817  151.027 1.00 10.00 ? 20  HIS C O   1 
ATOM 6130  C CB  . HIS C 3 20  ? 79.143  63.202  151.779 1.00 10.00 ? 20  HIS C CB  1 
ATOM 6131  C CG  . HIS C 3 20  ? 80.017  64.390  151.561 1.00 10.00 ? 20  HIS C CG  1 
ATOM 6132  N ND1 . HIS C 3 20  ? 80.326  64.848  150.298 1.00 10.00 ? 20  HIS C ND1 1 
ATOM 6133  C CD2 . HIS C 3 20  ? 80.837  65.055  152.410 1.00 10.00 ? 20  HIS C CD2 1 
ATOM 6134  C CE1 . HIS C 3 20  ? 81.307  65.730  150.378 1.00 10.00 ? 20  HIS C CE1 1 
ATOM 6135  N NE2 . HIS C 3 20  ? 81.636  65.872  151.647 1.00 10.00 ? 20  HIS C NE2 1 
ATOM 6136  N N   . VAL C 3 21  ? 81.782  60.949  152.260 1.00 10.00 ? 21  VAL C N   1 
ATOM 6137  C CA  . VAL C 3 21  ? 83.205  60.845  152.558 1.00 10.00 ? 21  VAL C CA  1 
ATOM 6138  C C   . VAL C 3 21  ? 83.744  59.565  151.968 1.00 10.00 ? 21  VAL C C   1 
ATOM 6139  O O   . VAL C 3 21  ? 83.295  58.473  152.308 1.00 10.00 ? 21  VAL C O   1 
ATOM 6140  C CB  . VAL C 3 21  ? 83.536  60.825  154.075 1.00 10.00 ? 21  VAL C CB  1 
ATOM 6141  C CG1 . VAL C 3 21  ? 84.955  60.205  154.283 1.00 10.00 ? 21  VAL C CG1 1 
ATOM 6142  C CG2 . VAL C 3 21  ? 83.497  62.255  154.675 1.00 10.00 ? 21  VAL C CG2 1 
ATOM 6143  N N   . ARG C 3 22  ? 84.705  59.710  151.078 1.00 10.00 ? 22  ARG C N   1 
ATOM 6144  C CA  . ARG C 3 22  ? 85.262  58.556  150.450 1.00 10.00 ? 22  ARG C CA  1 
ATOM 6145  C C   . ARG C 3 22  ? 86.377  57.944  151.284 1.00 10.00 ? 22  ARG C C   1 
ATOM 6146  O O   . ARG C 3 22  ? 87.435  58.543  151.566 1.00 10.00 ? 22  ARG C O   1 
ATOM 6147  C CB  . ARG C 3 22  ? 85.706  58.959  149.057 1.00 10.00 ? 22  ARG C CB  1 
ATOM 6148  C CG  . ARG C 3 22  ? 84.634  59.908  148.359 1.00 10.00 ? 22  ARG C CG  1 
ATOM 6149  C CD  . ARG C 3 22  ? 84.807  61.493  148.432 1.00 10.00 ? 22  ARG C CD  1 
ATOM 6150  N NE  . ARG C 3 22  ? 84.219  62.033  147.214 1.00 10.00 ? 22  ARG C NE  1 
ATOM 6151  C CZ  . ARG C 3 22  ? 82.913  62.105  146.981 1.00 10.00 ? 22  ARG C CZ  1 
ATOM 6152  N NH1 . ARG C 3 22  ? 82.040  61.714  147.901 1.00 10.00 ? 22  ARG C NH1 1 
ATOM 6153  N NH2 . ARG C 3 22  ? 82.480  62.453  145.776 1.00 10.00 ? 22  ARG C NH2 1 
ATOM 6154  N N   . PRO C 3 23  ? 86.138  56.701  151.723 1.00 10.00 ? 23  PRO C N   1 
ATOM 6155  C CA  . PRO C 3 23  ? 87.134  55.983  152.550 1.00 10.00 ? 23  PRO C CA  1 
ATOM 6156  C C   . PRO C 3 23  ? 88.456  55.694  151.887 1.00 10.00 ? 23  PRO C C   1 
ATOM 6157  O O   . PRO C 3 23  ? 88.696  54.574  151.475 1.00 10.00 ? 23  PRO C O   1 
ATOM 6158  C CB  . PRO C 3 23  ? 86.407  54.691  152.995 1.00 10.00 ? 23  PRO C CB  1 
ATOM 6159  C CG  . PRO C 3 23  ? 85.083  54.673  152.242 1.00 10.00 ? 23  PRO C CG  1 
ATOM 6160  C CD  . PRO C 3 23  ? 84.785  56.136  151.932 1.00 10.00 ? 23  PRO C CD  1 
ATOM 6161  N N   . VAL C 3 24  ? 89.310  56.710  151.793 1.00 10.00 ? 24  VAL C N   1 
ATOM 6162  C CA  . VAL C 3 24  ? 90.612  56.500  151.181 1.00 10.00 ? 24  VAL C CA  1 
ATOM 6163  C C   . VAL C 3 24  ? 91.645  56.457  152.299 1.00 10.00 ? 24  VAL C C   1 
ATOM 6164  O O   . VAL C 3 24  ? 92.801  56.884  152.146 1.00 10.00 ? 24  VAL C O   1 
ATOM 6165  C CB  . VAL C 3 24  ? 90.961  57.645  150.212 1.00 10.00 ? 24  VAL C CB  1 
ATOM 6166  C CG1 . VAL C 3 24  ? 92.100  57.218  149.287 1.00 10.00 ? 24  VAL C CG1 1 
ATOM 6167  C CG2 . VAL C 3 24  ? 89.720  58.052  149.420 1.00 10.00 ? 24  VAL C CG2 1 
ATOM 6168  N N   . LYS C 3 25  ? 91.211  55.914  153.426 1.00 10.00 ? 25  LYS C N   1 
ATOM 6169  C CA  . LYS C 3 25  ? 92.053  55.810  154.639 1.00 10.00 ? 25  LYS C CA  1 
ATOM 6170  C C   . LYS C 3 25  ? 92.692  57.150  154.896 1.00 10.00 ? 25  LYS C C   1 
ATOM 6171  O O   . LYS C 3 25  ? 93.828  57.221  155.364 1.00 10.00 ? 25  LYS C O   1 
ATOM 6172  C CB  . LYS C 3 25  ? 93.179  54.764  154.517 1.00 10.00 ? 25  LYS C CB  1 
ATOM 6173  C CG  . LYS C 3 25  ? 94.108  54.593  155.787 1.00 10.00 ? 25  LYS C CG  1 
ATOM 6174  C CD  . LYS C 3 25  ? 93.342  54.241  157.072 1.00 10.00 ? 25  LYS C CD  1 
ATOM 6175  C CE  . LYS C 3 25  ? 92.408  53.030  156.923 1.00 10.00 ? 25  LYS C CE  1 
ATOM 6176  N NZ  . LYS C 3 25  ? 91.049  53.261  156.307 1.00 10.00 ? 25  LYS C NZ  1 
ATOM 6177  N N   . HIS C 3 26  ? 91.951  58.201  154.557 1.00 10.00 ? 26  HIS C N   1 
ATOM 6178  C CA  . HIS C 3 26  ? 92.379  59.588  154.735 1.00 10.00 ? 26  HIS C CA  1 
ATOM 6179  C C   . HIS C 3 26  ? 93.412  60.002  153.674 1.00 10.00 ? 26  HIS C C   1 
ATOM 6180  O O   . HIS C 3 26  ? 93.669  59.233  152.753 1.00 10.00 ? 26  HIS C O   1 
ATOM 6181  C CB  . HIS C 3 26  ? 92.856  59.746  156.188 1.00 10.00 ? 26  HIS C CB  1 
ATOM 6182  C CG  . HIS C 3 26  ? 91.916  59.101  157.158 1.00 10.00 ? 26  HIS C CG  1 
ATOM 6183  N ND1 . HIS C 3 26  ? 90.611  58.802  156.816 1.00 10.00 ? 26  HIS C ND1 1 
ATOM 6184  C CD2 . HIS C 3 26  ? 92.094  58.627  158.413 1.00 10.00 ? 26  HIS C CD2 1 
ATOM 6185  C CE1 . HIS C 3 26  ? 90.027  58.169  157.816 1.00 10.00 ? 26  HIS C CE1 1 
ATOM 6186  N NE2 . HIS C 3 26  ? 90.905  58.048  158.798 1.00 10.00 ? 26  HIS C NE2 1 
ATOM 6187  N N   . ASN C 3 27  ? 93.974  61.205  153.770 1.00 10.00 ? 27  ASN C N   1 
ATOM 6188  C CA  . ASN C 3 27  ? 94.946  61.680  152.764 1.00 10.00 ? 27  ASN C CA  1 
ATOM 6189  C C   . ASN C 3 27  ? 96.187  60.819  152.599 1.00 10.00 ? 27  ASN C C   1 
ATOM 6190  O O   . ASN C 3 27  ? 97.068  60.813  153.454 1.00 10.00 ? 27  ASN C O   1 
ATOM 6191  C CB  . ASN C 3 27  ? 95.448  63.120  153.019 1.00 10.00 ? 27  ASN C CB  1 
ATOM 6192  C CG  . ASN C 3 27  ? 96.837  63.399  152.326 1.00 10.00 ? 27  ASN C CG  1 
ATOM 6193  O OD1 . ASN C 3 27  ? 97.914  63.283  152.945 1.00 10.00 ? 27  ASN C OD1 1 
ATOM 6194  N ND2 . ASN C 3 27  ? 96.798  63.735  151.037 1.00 10.00 ? 27  ASN C ND2 1 
ATOM 6195  N N   . ASN C 3 28  ? 96.292  60.154  151.452 1.00 10.00 ? 28  ASN C N   1 
ATOM 6196  C CA  . ASN C 3 28  ? 97.428  59.288  151.178 1.00 10.00 ? 28  ASN C CA  1 
ATOM 6197  C C   . ASN C 3 28  ? 97.644  59.176  149.685 1.00 10.00 ? 28  ASN C C   1 
ATOM 6198  O O   . ASN C 3 28  ? 97.540  60.163  148.955 1.00 10.00 ? 28  ASN C O   1 
ATOM 6199  C CB  . ASN C 3 28  ? 97.171  57.901  151.749 1.00 10.00 ? 28  ASN C CB  1 
ATOM 6200  C CG  . ASN C 3 28  ? 95.689  57.570  151.814 1.00 10.00 ? 28  ASN C CG  1 
ATOM 6201  O OD1 . ASN C 3 28  ? 94.898  58.036  150.983 1.00 10.00 ? 28  ASN C OD1 1 
ATOM 6202  N ND2 . ASN C 3 28  ? 95.305  56.754  152.797 1.00 10.00 ? 28  ASN C ND2 1 
ATOM 6203  N N   . GLU C 3 29  ? 97.939  57.963  149.233 1.00 10.00 ? 29  GLU C N   1 
ATOM 6204  C CA  . GLU C 3 29  ? 98.162  57.732  147.817 1.00 10.00 ? 29  GLU C CA  1 
ATOM 6205  C C   . GLU C 3 29  ? 96.839  57.626  147.080 1.00 10.00 ? 29  GLU C C   1 
ATOM 6206  O O   . GLU C 3 29  ? 96.629  58.380  146.148 1.00 10.00 ? 29  GLU C O   1 
ATOM 6207  C CB  . GLU C 3 29  ? 99.030  56.482  147.576 1.00 10.00 ? 29  GLU C CB  1 
ATOM 6208  C CG  . GLU C 3 29  ? 98.307  55.169  147.263 1.00 10.00 ? 29  GLU C CG  1 
ATOM 6209  C CD  . GLU C 3 29  ? 99.293  54.061  146.864 1.00 10.00 ? 29  GLU C CD  1 
ATOM 6210  O OE1 . GLU C 3 29  ? 100.144 53.677  147.698 1.00 10.00 ? 29  GLU C OE1 1 
ATOM 6211  O OE2 . GLU C 3 29  ? 99.223  53.580  145.712 1.00 10.00 ? 29  GLU C OE2 1 
ATOM 6212  N N   . VAL C 3 30  ? 95.913  56.697  147.520 1.00 10.00 ? 30  VAL C N   1 
ATOM 6213  C CA  . VAL C 3 30  ? 94.623  56.571  146.850 1.00 10.00 ? 30  VAL C CA  1 
ATOM 6214  C C   . VAL C 3 30  ? 93.921  55.276  147.268 1.00 10.00 ? 30  VAL C C   1 
ATOM 6215  O O   . VAL C 3 30  ? 94.462  54.343  147.832 1.00 10.00 ? 30  VAL C O   1 
ATOM 6216  C CB  . VAL C 3 30  ? 94.783  56.630  145.318 1.00 10.00 ? 30  VAL C CB  1 
ATOM 6217  C CG1 . VAL C 3 30  ? 93.972  55.526  144.654 1.00 10.00 ? 30  VAL C CG1 1 
ATOM 6218  C CG2 . VAL C 3 30  ? 94.373  57.995  144.787 1.00 10.00 ? 30  VAL C CG2 1 
ATOM 6219  N N   . VAL C 3 31  ? 92.591  55.211  146.917 1.00 10.00 ? 31  VAL C N   1 
ATOM 6220  C CA  . VAL C 3 31  ? 91.725  54.018  147.115 1.00 10.00 ? 31  VAL C CA  1 
ATOM 6221  C C   . VAL C 3 31  ? 91.976  53.219  145.831 1.00 10.00 ? 31  VAL C C   1 
ATOM 6222  O O   . VAL C 3 31  ? 91.795  53.757  144.742 1.00 10.00 ? 31  VAL C O   1 
ATOM 6223  C CB  . VAL C 3 31  ? 90.188  54.367  147.126 1.00 10.00 ? 31  VAL C CB  1 
ATOM 6224  C CG1 . VAL C 3 31  ? 89.854  55.255  145.981 1.00 10.00 ? 31  VAL C CG1 1 
ATOM 6225  C CG2 . VAL C 3 31  ? 89.342  53.125  146.942 1.00 10.00 ? 31  VAL C CG2 1 
ATOM 6226  N N   . ASN C 3 32  ? 92.393  51.960  145.933 1.00 10.00 ? 32  ASN C N   1 
ATOM 6227  C CA  . ASN C 3 32  ? 92.663  51.159  144.738 1.00 10.00 ? 32  ASN C CA  1 
ATOM 6228  C C   . ASN C 3 32  ? 91.382  50.833  143.942 1.00 10.00 ? 32  ASN C C   1 
ATOM 6229  O O   . ASN C 3 32  ? 90.758  49.791  144.150 1.00 10.00 ? 32  ASN C O   1 
ATOM 6230  C CB  . ASN C 3 32  ? 93.403  49.868  145.138 1.00 10.00 ? 32  ASN C CB  1 
ATOM 6231  C CG  . ASN C 3 32  ? 93.819  49.030  143.936 1.00 10.00 ? 32  ASN C CG  1 
ATOM 6232  O OD1 . ASN C 3 32  ? 94.812  49.321  143.268 1.00 10.00 ? 32  ASN C OD1 1 
ATOM 6233  N ND2 . ASN C 3 32  ? 93.046  47.987  143.651 1.00 10.00 ? 32  ASN C ND2 1 
ATOM 6234  N N   . ILE C 3 33  ? 90.991  51.728  143.032 1.00 10.00 ? 33  ILE C N   1 
ATOM 6235  C CA  . ILE C 3 33  ? 89.809  51.525  142.224 1.00 10.00 ? 33  ILE C CA  1 
ATOM 6236  C C   . ILE C 3 33  ? 90.180  50.984  140.826 1.00 10.00 ? 33  ILE C C   1 
ATOM 6237  O O   . ILE C 3 33  ? 91.204  51.352  140.256 1.00 10.00 ? 33  ILE C O   1 
ATOM 6238  C CB  . ILE C 3 33  ? 88.992  52.829  142.191 1.00 10.00 ? 33  ILE C CB  1 
ATOM 6239  C CG1 . ILE C 3 33  ? 88.595  53.158  143.650 1.00 10.00 ? 33  ILE C CG1 1 
ATOM 6240  C CG2 . ILE C 3 33  ? 87.767  52.693  141.300 1.00 10.00 ? 33  ILE C CG2 1 
ATOM 6241  C CD1 . ILE C 3 33  ? 87.584  54.295  143.862 1.00 10.00 ? 33  ILE C CD1 1 
ATOM 6242  N N   . ALA C 3 34  ? 89.372  50.045  140.306 1.00 10.00 ? 34  ALA C N   1 
ATOM 6243  C CA  . ALA C 3 34  ? 89.637  49.422  139.003 1.00 10.00 ? 34  ALA C CA  1 
ATOM 6244  C C   . ALA C 3 34  ? 88.393  49.439  138.119 1.00 10.00 ? 34  ALA C C   1 
ATOM 6245  O O   . ALA C 3 34  ? 87.294  49.140  138.578 1.00 10.00 ? 34  ALA C O   1 
ATOM 6246  C CB  . ALA C 3 34  ? 90.149  47.972  139.196 1.00 10.00 ? 34  ALA C CB  1 
ATOM 6247  N N   . LEU C 3 35  ? 88.558  49.820  136.848 1.00 10.00 ? 35  LEU C N   1 
ATOM 6248  C CA  . LEU C 3 35  ? 87.406  49.847  135.937 1.00 10.00 ? 35  LEU C CA  1 
ATOM 6249  C C   . LEU C 3 35  ? 87.552  48.776  134.854 1.00 10.00 ? 35  LEU C C   1 
ATOM 6250  O O   . LEU C 3 35  ? 88.666  48.431  134.418 1.00 10.00 ? 35  LEU C O   1 
ATOM 6251  C CB  . LEU C 3 35  ? 87.250  51.240  135.329 1.00 10.00 ? 35  LEU C CB  1 
ATOM 6252  C CG  . LEU C 3 35  ? 86.138  51.532  134.324 1.00 10.00 ? 35  LEU C CG  1 
ATOM 6253  C CD1 . LEU C 3 35  ? 85.857  53.028  134.303 1.00 10.00 ? 35  LEU C CD1 1 
ATOM 6254  C CD2 . LEU C 3 35  ? 86.560  51.070  132.929 1.00 10.00 ? 35  LEU C CD2 1 
ATOM 6255  N N   . SER C 3 36  ? 86.422  48.199  134.481 1.00 10.00 ? 36  SER C N   1 
ATOM 6256  C CA  . SER C 3 36  ? 86.380  47.164  133.478 1.00 10.00 ? 36  SER C CA  1 
ATOM 6257  C C   . SER C 3 36  ? 85.406  47.556  132.389 1.00 10.00 ? 36  SER C C   1 
ATOM 6258  O O   . SER C 3 36  ? 84.238  47.782  132.667 1.00 10.00 ? 36  SER C O   1 
ATOM 6259  C CB  . SER C 3 36  ? 85.956  45.837  134.111 1.00 10.00 ? 36  SER C CB  1 
ATOM 6260  O OG  . SER C 3 36  ? 85.884  44.804  133.142 1.00 10.00 ? 36  SER C OG  1 
ATOM 6261  N N   . LEU C 3 37  ? 85.892  47.603  131.147 1.00 10.00 ? 37  LEU C N   1 
ATOM 6262  C CA  . LEU C 3 37  ? 85.076  47.992  130.006 1.00 10.00 ? 37  LEU C CA  1 
ATOM 6263  C C   . LEU C 3 37  ? 84.685  46.861  129.071 1.00 10.00 ? 37  LEU C C   1 
ATOM 6264  O O   . LEU C 3 37  ? 85.546  46.201  128.496 1.00 10.00 ? 37  LEU C O   1 
ATOM 6265  C CB  . LEU C 3 37  ? 85.805  49.052  129.186 1.00 10.00 ? 37  LEU C CB  1 
ATOM 6266  C CG  . LEU C 3 37  ? 86.026  50.402  129.851 1.00 10.00 ? 37  LEU C CG  1 
ATOM 6267  C CD1 . LEU C 3 37  ? 86.664  51.343  128.853 1.00 10.00 ? 37  LEU C CD1 1 
ATOM 6268  C CD2 . LEU C 3 37  ? 84.694  50.951  130.332 1.00 10.00 ? 37  LEU C CD2 1 
ATOM 6269  N N   . THR C 3 38  ? 83.382  46.655  128.905 1.00 10.00 ? 38  THR C N   1 
ATOM 6270  C CA  . THR C 3 38  ? 82.907  45.635  128.007 1.00 10.00 ? 38  THR C CA  1 
ATOM 6271  C C   . THR C 3 38  ? 81.744  46.220  127.224 1.00 10.00 ? 38  THR C C   1 
ATOM 6272  O O   . THR C 3 38  ? 80.700  46.570  127.782 1.00 10.00 ? 38  THR C O   1 
ATOM 6273  C CB  . THR C 3 38  ? 82.475  44.386  128.770 1.00 10.00 ? 38  THR C CB  1 
ATOM 6274  O OG1 . THR C 3 38  ? 83.641  43.712  129.277 1.00 10.00 ? 38  THR C OG1 1 
ATOM 6275  C CG2 . THR C 3 38  ? 81.682  43.484  127.853 1.00 10.00 ? 38  THR C CG2 1 
ATOM 6276  N N   . LEU C 3 39  ? 81.942  46.362  125.921 1.00 10.00 ? 39  LEU C N   1 
ATOM 6277  C CA  . LEU C 3 39  ? 80.893  46.918  125.085 1.00 10.00 ? 39  LEU C CA  1 
ATOM 6278  C C   . LEU C 3 39  ? 79.826  45.849  124.934 1.00 10.00 ? 39  LEU C C   1 
ATOM 6279  O O   . LEU C 3 39  ? 80.129  44.685  124.677 1.00 10.00 ? 39  LEU C O   1 
ATOM 6280  C CB  . LEU C 3 39  ? 81.469  47.324  123.724 1.00 10.00 ? 39  LEU C CB  1 
ATOM 6281  C CG  . LEU C 3 39  ? 82.436  48.520  123.724 1.00 10.00 ? 39  LEU C CG  1 
ATOM 6282  C CD1 . LEU C 3 39  ? 83.596  48.282  124.682 1.00 10.00 ? 39  LEU C CD1 1 
ATOM 6283  C CD2 . LEU C 3 39  ? 82.960  48.745  122.317 1.00 10.00 ? 39  LEU C CD2 1 
ATOM 6284  N N   . SER C 3 40  ? 78.579  46.232  125.148 1.00 10.00 ? 40  SER C N   1 
ATOM 6285  C CA  . SER C 3 40  ? 77.499  45.265  125.010 1.00 10.00 ? 40  SER C CA  1 
ATOM 6286  C C   . SER C 3 40  ? 76.853  45.447  123.664 1.00 10.00 ? 40  SER C C   1 
ATOM 6287  O O   . SER C 3 40  ? 76.188  44.538  123.176 1.00 10.00 ? 40  SER C O   1 
ATOM 6288  C CB  . SER C 3 40  ? 76.436  45.408  126.089 1.00 10.00 ? 40  SER C CB  1 
ATOM 6289  O OG  . SER C 3 40  ? 75.324  44.591  125.775 1.00 10.00 ? 40  SER C OG  1 
ATOM 6290  N N   . ASN C 3 41  ? 77.060  46.606  123.037 1.00 10.00 ? 41  ASN C N   1 
ATOM 6291  C CA  . ASN C 3 41  ? 76.485  46.849  121.715 1.00 10.00 ? 41  ASN C CA  1 
ATOM 6292  C C   . ASN C 3 41  ? 76.808  48.227  121.164 1.00 10.00 ? 41  ASN C C   1 
ATOM 6293  O O   . ASN C 3 41  ? 77.015  49.190  121.912 1.00 10.00 ? 41  ASN C O   1 
ATOM 6294  C CB  . ASN C 3 41  ? 74.970  46.639  121.732 1.00 10.00 ? 41  ASN C CB  1 
ATOM 6295  C CG  . ASN C 3 41  ? 74.466  46.042  120.440 1.00 10.00 ? 41  ASN C CG  1 
ATOM 6296  O OD1 . ASN C 3 41  ? 73.277  45.799  120.265 1.00 10.00 ? 41  ASN C OD1 1 
ATOM 6297  N ND2 . ASN C 3 41  ? 75.374  45.794  119.528 1.00 10.00 ? 41  ASN C ND2 1 
ATOM 6298  N N   . LEU C 3 42  ? 76.865  48.309  119.842 1.00 10.00 ? 42  LEU C N   1 
ATOM 6299  C CA  . LEU C 3 42  ? 77.145  49.543  119.131 1.00 10.00 ? 42  LEU C CA  1 
ATOM 6300  C C   . LEU C 3 42  ? 75.928  49.754  118.241 1.00 10.00 ? 42  LEU C C   1 
ATOM 6301  O O   . LEU C 3 42  ? 75.759  49.032  117.269 1.00 10.00 ? 42  LEU C O   1 
ATOM 6302  C CB  . LEU C 3 42  ? 78.410  49.411  118.277 1.00 10.00 ? 42  LEU C CB  1 
ATOM 6303  C CG  . LEU C 3 42  ? 78.902  50.753  117.704 1.00 10.00 ? 42  LEU C CG  1 
ATOM 6304  C CD1 . LEU C 3 42  ? 80.389  50.695  117.372 1.00 10.00 ? 42  LEU C CD1 1 
ATOM 6305  C CD2 . LEU C 3 42  ? 78.064  51.147  116.488 1.00 10.00 ? 42  LEU C CD2 1 
ATOM 6306  N N   . ILE C 3 43  ? 75.081  50.735  118.553 1.00 10.00 ? 43  ILE C N   1 
ATOM 6307  C CA  . ILE C 3 43  ? 73.902  50.896  117.716 1.00 10.00 ? 43  ILE C CA  1 
ATOM 6308  C C   . ILE C 3 43  ? 74.002  51.860  116.547 1.00 10.00 ? 43  ILE C C   1 
ATOM 6309  O O   . ILE C 3 43  ? 73.358  51.631  115.531 1.00 10.00 ? 43  ILE C O   1 
ATOM 6310  C CB  . ILE C 3 43  ? 72.688  51.298  118.508 1.00 10.00 ? 43  ILE C CB  1 
ATOM 6311  C CG1 . ILE C 3 43  ? 72.735  50.637  119.886 1.00 10.00 ? 43  ILE C CG1 1 
ATOM 6312  C CG2 . ILE C 3 43  ? 71.430  50.967  117.704 1.00 10.00 ? 43  ILE C CG2 1 
ATOM 6313  C CD1 . ILE C 3 43  ? 73.675  51.354  120.894 1.00 10.00 ? 43  ILE C CD1 1 
ATOM 6314  N N   . SER C 3 44  ? 74.775  52.940  116.656 1.00 10.00 ? 44  SER C N   1 
ATOM 6315  C CA  . SER C 3 44  ? 74.872  53.837  115.500 1.00 10.00 ? 44  SER C CA  1 
ATOM 6316  C C   . SER C 3 44  ? 76.260  54.467  115.320 1.00 10.00 ? 44  SER C C   1 
ATOM 6317  O O   . SER C 3 44  ? 76.932  54.881  116.276 1.00 10.00 ? 44  SER C O   1 
ATOM 6318  C CB  . SER C 3 44  ? 73.767  54.906  115.547 1.00 10.00 ? 44  SER C CB  1 
ATOM 6319  O OG  . SER C 3 44  ? 73.729  55.668  114.353 1.00 10.00 ? 44  SER C OG  1 
ATOM 6320  N N   . LEU C 3 45  ? 76.652  54.538  114.052 1.00 10.00 ? 45  LEU C N   1 
ATOM 6321  C CA  . LEU C 3 45  ? 77.939  55.042  113.584 1.00 10.00 ? 45  LEU C CA  1 
ATOM 6322  C C   . LEU C 3 45  ? 77.709  56.259  112.679 1.00 10.00 ? 45  LEU C C   1 
ATOM 6323  O O   . LEU C 3 45  ? 76.829  56.235  111.826 1.00 10.00 ? 45  LEU C O   1 
ATOM 6324  C CB  . LEU C 3 45  ? 78.618  53.937  112.757 1.00 10.00 ? 45  LEU C CB  1 
ATOM 6325  C CG  . LEU C 3 45  ? 80.122  53.634  112.692 1.00 10.00 ? 45  LEU C CG  1 
ATOM 6326  C CD1 . LEU C 3 45  ? 80.403  53.135  111.272 1.00 10.00 ? 45  LEU C CD1 1 
ATOM 6327  C CD2 . LEU C 3 45  ? 80.997  54.855  113.025 1.00 10.00 ? 45  LEU C CD2 1 
ATOM 6328  N N   . LYS C 3 46  ? 78.490  57.319  112.863 1.00 10.00 ? 46  LYS C N   1 
ATOM 6329  C CA  . LYS C 3 46  ? 78.376  58.484  112.022 1.00 10.00 ? 46  LYS C CA  1 
ATOM 6330  C C   . LYS C 3 46  ? 79.855  58.779  111.747 1.00 10.00 ? 46  LYS C C   1 
ATOM 6331  O O   . LYS C 3 46  ? 80.571  59.357  112.583 1.00 10.00 ? 46  LYS C O   1 
ATOM 6332  C CB  . LYS C 3 46  ? 77.693  59.636  112.769 1.00 10.00 ? 46  LYS C CB  1 
ATOM 6333  C CG  . LYS C 3 46  ? 77.001  60.660  111.856 1.00 10.00 ? 46  LYS C CG  1 
ATOM 6334  C CD  . LYS C 3 46  ? 75.871  60.033  111.034 1.00 10.00 ? 46  LYS C CD  1 
ATOM 6335  C CE  . LYS C 3 46  ? 75.239  61.040  110.076 1.00 10.00 ? 46  LYS C CE  1 
ATOM 6336  N NZ  . LYS C 3 46  ? 74.206  60.417  109.195 1.00 10.00 ? 46  LYS C NZ  1 
ATOM 6337  N N   . GLU C 3 47  ? 80.313  58.331  110.581 1.00 10.00 ? 47  GLU C N   1 
ATOM 6338  C CA  . GLU C 3 47  ? 81.688  58.475  110.164 1.00 10.00 ? 47  GLU C CA  1 
ATOM 6339  C C   . GLU C 3 47  ? 82.033  59.918  109.909 1.00 10.00 ? 47  GLU C C   1 
ATOM 6340  O O   . GLU C 3 47  ? 83.095  60.374  110.313 1.00 10.00 ? 47  GLU C O   1 
ATOM 6341  C CB  . GLU C 3 47  ? 81.905  57.635  108.914 1.00 10.00 ? 47  GLU C CB  1 
ATOM 6342  C CG  . GLU C 3 47  ? 83.210  57.854  108.220 1.00 10.00 ? 47  GLU C CG  1 
ATOM 6343  C CD  . GLU C 3 47  ? 83.449  56.800  107.180 1.00 10.00 ? 47  GLU C CD  1 
ATOM 6344  O OE1 . GLU C 3 47  ? 82.564  55.936  107.013 1.00 10.00 ? 47  GLU C OE1 1 
ATOM 6345  O OE2 . GLU C 3 47  ? 84.508  56.837  106.526 1.00 10.00 ? 47  GLU C OE2 1 
ATOM 6346  N N   . THR C 3 48  ? 81.122  60.610  109.231 1.00 10.00 ? 48  THR C N   1 
ATOM 6347  C CA  . THR C 3 48  ? 81.252  62.047  108.885 1.00 10.00 ? 48  THR C CA  1 
ATOM 6348  C C   . THR C 3 48  ? 81.493  62.860  110.135 1.00 10.00 ? 48  THR C C   1 
ATOM 6349  O O   . THR C 3 48  ? 82.454  63.633  110.238 1.00 10.00 ? 48  THR C O   1 
ATOM 6350  C CB  . THR C 3 48  ? 79.968  62.502  108.106 1.00 10.00 ? 48  THR C CB  1 
ATOM 6351  O OG1 . THR C 3 48  ? 79.855  61.707  106.964 1.00 10.00 ? 48  THR C OG1 1 
ATOM 6352  C CG2 . THR C 3 48  ? 80.111  63.966  107.783 1.00 10.00 ? 48  THR C CG2 1 
ATOM 6353  N N   . ASP C 3 49  ? 80.615  62.824  111.132 1.00 10.00 ? 49  ASP C N   1 
ATOM 6354  C CA  . ASP C 3 49  ? 80.968  63.697  112.261 1.00 10.00 ? 49  ASP C CA  1 
ATOM 6355  C C   . ASP C 3 49  ? 81.693  63.122  113.465 1.00 10.00 ? 49  ASP C C   1 
ATOM 6356  O O   . ASP C 3 49  ? 81.767  63.777  114.495 1.00 10.00 ? 49  ASP C O   1 
ATOM 6357  C CB  . ASP C 3 49  ? 79.784  64.568  112.747 1.00 10.00 ? 49  ASP C CB  1 
ATOM 6358  C CG  . ASP C 3 49  ? 78.496  63.789  112.955 1.00 10.00 ? 49  ASP C CG  1 
ATOM 6359  O OD1 . ASP C 3 49  ? 77.833  63.444  111.948 1.00 10.00 ? 49  ASP C OD1 1 
ATOM 6360  O OD2 . ASP C 3 49  ? 78.140  63.533  114.126 1.00 10.00 ? 49  ASP C OD2 1 
ATOM 6361  N N   . GLU C 3 50  ? 82.255  61.919  113.363 1.00 10.00 ? 50  GLU C N   1 
ATOM 6362  C CA  . GLU C 3 50  ? 83.034  61.304  114.429 1.00 10.00 ? 50  GLU C CA  1 
ATOM 6363  C C   . GLU C 3 50  ? 82.211  61.167  115.705 1.00 10.00 ? 50  GLU C C   1 
ATOM 6364  O O   . GLU C 3 50  ? 82.719  61.475  116.801 1.00 10.00 ? 50  GLU C O   1 
ATOM 6365  C CB  . GLU C 3 50  ? 84.306  62.110  114.695 1.00 10.00 ? 50  GLU C CB  1 
ATOM 6366  C CG  . GLU C 3 50  ? 84.473  63.321  113.793 1.00 10.00 ? 50  GLU C CG  1 
ATOM 6367  C CD  . GLU C 3 50  ? 85.737  64.103  114.092 1.00 10.00 ? 50  GLU C CD  1 
ATOM 6368  O OE1 . GLU C 3 50  ? 86.250  63.990  115.226 1.00 10.00 ? 50  GLU C OE1 1 
ATOM 6369  O OE2 . GLU C 3 50  ? 86.215  64.827  113.194 1.00 10.00 ? 50  GLU C OE2 1 
ATOM 6370  N N   . THR C 3 51  ? 81.006  60.618  115.607 1.00 10.00 ? 51  THR C N   1 
ATOM 6371  C CA  . THR C 3 51  ? 80.107  60.403  116.735 1.00 10.00 ? 51  THR C CA  1 
ATOM 6372  C C   . THR C 3 51  ? 79.567  58.975  116.780 1.00 10.00 ? 51  THR C C   1 
ATOM 6373  O O   . THR C 3 51  ? 79.132  58.461  115.771 1.00 10.00 ? 51  THR C O   1 
ATOM 6374  C CB  . THR C 3 51  ? 78.908  61.381  116.689 1.00 10.00 ? 51  THR C CB  1 
ATOM 6375  O OG1 . THR C 3 51  ? 79.387  62.729  116.787 1.00 10.00 ? 51  THR C OG1 1 
ATOM 6376  C CG2 . THR C 3 51  ? 77.943  61.108  117.846 1.00 10.00 ? 51  THR C CG2 1 
ATOM 6377  N N   . LEU C 3 52  ? 79.595  58.347  117.964 1.00 10.00 ? 52  LEU C N   1 
ATOM 6378  C CA  . LEU C 3 52  ? 79.124  56.971  118.098 1.00 10.00 ? 52  LEU C CA  1 
ATOM 6379  C C   . LEU C 3 52  ? 78.261  56.747  119.359 1.00 10.00 ? 52  LEU C C   1 
ATOM 6380  O O   . LEU C 3 52  ? 78.599  57.225  120.440 1.00 10.00 ? 52  LEU C O   1 
ATOM 6381  C CB  . LEU C 3 52  ? 80.317  55.996  118.121 1.00 10.00 ? 52  LEU C CB  1 
ATOM 6382  C CG  . LEU C 3 52  ? 81.722  56.373  117.649 1.00 10.00 ? 52  LEU C CG  1 
ATOM 6383  C CD1 . LEU C 3 52  ? 81.674  56.793  116.212 1.00 10.00 ? 52  LEU C CD1 1 
ATOM 6384  C CD2 . LEU C 3 52  ? 82.296  57.446  118.525 1.00 10.00 ? 52  LEU C CD2 1 
ATOM 6385  N N   . THR C 3 53  ? 77.138  56.042  119.184 1.00 10.00 ? 53  THR C N   1 
ATOM 6386  C CA  . THR C 3 53  ? 76.213  55.706  120.288 1.00 10.00 ? 53  THR C CA  1 
ATOM 6387  C C   . THR C 3 53  ? 76.485  54.233  120.577 1.00 10.00 ? 53  THR C C   1 
ATOM 6388  O O   . THR C 3 53  ? 76.202  53.381  119.745 1.00 10.00 ? 53  THR C O   1 
ATOM 6389  C CB  . THR C 3 53  ? 74.715  55.899  119.864 1.00 10.00 ? 53  THR C CB  1 
ATOM 6390  O OG1 . THR C 3 53  ? 74.524  57.235  119.399 1.00 10.00 ? 53  THR C OG1 1 
ATOM 6391  C CG2 . THR C 3 53  ? 73.769  55.690  121.011 1.00 10.00 ? 53  THR C CG2 1 
ATOM 6392  N N   . THR C 3 54  ? 77.019  53.923  121.753 1.00 10.00 ? 54  THR C N   1 
ATOM 6393  C CA  . THR C 3 54  ? 77.361  52.546  122.055 1.00 10.00 ? 54  THR C CA  1 
ATOM 6394  C C   . THR C 3 54  ? 77.027  52.173  123.526 1.00 10.00 ? 54  THR C C   1 
ATOM 6395  O O   . THR C 3 54  ? 76.999  53.043  124.403 1.00 10.00 ? 54  THR C O   1 
ATOM 6396  C CB  . THR C 3 54  ? 78.870  52.368  121.696 1.00 10.00 ? 54  THR C CB  1 
ATOM 6397  O OG1 . THR C 3 54  ? 79.454  53.660  121.523 1.00 10.00 ? 54  THR C OG1 1 
ATOM 6398  C CG2 . THR C 3 54  ? 79.060  51.673  120.385 1.00 10.00 ? 54  THR C CG2 1 
ATOM 6399  N N   . ASN C 3 55  ? 76.733  50.894  123.786 1.00 10.00 ? 55  ASN C N   1 
ATOM 6400  C CA  . ASN C 3 55  ? 76.396  50.428  125.134 1.00 10.00 ? 55  ASN C CA  1 
ATOM 6401  C C   . ASN C 3 55  ? 77.612  49.766  125.825 1.00 10.00 ? 55  ASN C C   1 
ATOM 6402  O O   . ASN C 3 55  ? 78.362  49.011  125.201 1.00 10.00 ? 55  ASN C O   1 
ATOM 6403  C CB  . ASN C 3 55  ? 75.213  49.442  125.024 1.00 10.00 ? 55  ASN C CB  1 
ATOM 6404  C CG  . ASN C 3 55  ? 74.213  49.586  126.143 1.00 10.00 ? 55  ASN C CG  1 
ATOM 6405  O OD1 . ASN C 3 55  ? 73.058  49.154  126.028 1.00 10.00 ? 55  ASN C OD1 1 
ATOM 6406  N ND2 . ASN C 3 55  ? 74.653  50.192  127.244 1.00 10.00 ? 55  ASN C ND2 1 
ATOM 6407  N N   . VAL C 3 56  ? 77.841  50.076  127.096 1.00 10.00 ? 56  VAL C N   1 
ATOM 6408  C CA  . VAL C 3 56  ? 78.950  49.439  127.797 1.00 10.00 ? 56  VAL C CA  1 
ATOM 6409  C C   . VAL C 3 56  ? 78.572  48.962  129.188 1.00 10.00 ? 56  VAL C C   1 
ATOM 6410  O O   . VAL C 3 56  ? 77.745  49.574  129.870 1.00 10.00 ? 56  VAL C O   1 
ATOM 6411  C CB  . VAL C 3 56  ? 80.248  50.357  127.939 1.00 10.00 ? 56  VAL C CB  1 
ATOM 6412  C CG1 . VAL C 3 56  ? 80.852  50.630  126.564 1.00 10.00 ? 56  VAL C CG1 1 
ATOM 6413  C CG2 . VAL C 3 56  ? 79.953  51.662  128.721 1.00 10.00 ? 56  VAL C CG2 1 
ATOM 6414  N N   . TRP C 3 57  ? 79.182  47.855  129.598 1.00 10.00 ? 57  TRP C N   1 
ATOM 6415  C CA  . TRP C 3 57  ? 78.958  47.305  130.928 1.00 10.00 ? 57  TRP C CA  1 
ATOM 6416  C C   . TRP C 3 57  ? 80.045  47.991  131.737 1.00 10.00 ? 57  TRP C C   1 
ATOM 6417  O O   . TRP C 3 57  ? 81.231  47.690  131.576 1.00 10.00 ? 57  TRP C O   1 
ATOM 6418  C CB  . TRP C 3 57  ? 79.162  45.786  130.946 1.00 10.00 ? 57  TRP C CB  1 
ATOM 6419  C CG  . TRP C 3 57  ? 78.065  45.002  130.271 1.00 10.00 ? 57  TRP C CG  1 
ATOM 6420  C CD1 . TRP C 3 57  ? 76.717  45.141  130.459 1.00 10.00 ? 57  TRP C CD1 1 
ATOM 6421  C CD2 . TRP C 3 57  ? 78.229  43.919  129.342 1.00 10.00 ? 57  TRP C CD2 1 
ATOM 6422  N NE1 . TRP C 3 57  ? 76.034  44.213  129.708 1.00 10.00 ? 57  TRP C NE1 1 
ATOM 6423  C CE2 . TRP C 3 57  ? 76.937  43.449  129.014 1.00 10.00 ? 57  TRP C CE2 1 
ATOM 6424  C CE3 . TRP C 3 57  ? 79.343  43.300  128.758 1.00 10.00 ? 57  TRP C CE3 1 
ATOM 6425  C CZ2 . TRP C 3 57  ? 76.728  42.388  128.125 1.00 10.00 ? 57  TRP C CZ2 1 
ATOM 6426  C CZ3 . TRP C 3 57  ? 79.134  42.243  127.874 1.00 10.00 ? 57  TRP C CZ3 1 
ATOM 6427  C CH2 . TRP C 3 57  ? 77.835  41.799  127.568 1.00 10.00 ? 57  TRP C CH2 1 
ATOM 6428  N N   . MET C 3 58  ? 79.643  48.938  132.588 1.00 10.00 ? 58  MET C N   1 
ATOM 6429  C CA  . MET C 3 58  ? 80.571  49.733  133.418 1.00 10.00 ? 58  MET C CA  1 
ATOM 6430  C C   . MET C 3 58  ? 81.124  49.012  134.654 1.00 10.00 ? 58  MET C C   1 
ATOM 6431  O O   . MET C 3 58  ? 81.045  49.530  135.759 1.00 10.00 ? 58  MET C O   1 
ATOM 6432  C CB  . MET C 3 58  ? 79.886  51.062  133.841 1.00 10.00 ? 58  MET C CB  1 
ATOM 6433  C CG  . MET C 3 58  ? 80.615  51.918  134.907 1.00 10.00 ? 58  MET C CG  1 
ATOM 6434  S SD  . MET C 3 58  ? 79.724  53.475  135.483 1.00 10.00 ? 58  MET C SD  1 
ATOM 6435  C CE  . MET C 3 58  ? 78.194  52.762  136.069 1.00 10.00 ? 58  MET C CE  1 
ATOM 6436  N N   . ASP C 3 59  ? 81.708  47.832  134.462 1.00 10.00 ? 59  ASP C N   1 
ATOM 6437  C CA  . ASP C 3 59  ? 82.272  47.055  135.567 1.00 10.00 ? 59  ASP C CA  1 
ATOM 6438  C C   . ASP C 3 59  ? 83.271  47.846  136.436 1.00 10.00 ? 59  ASP C C   1 
ATOM 6439  O O   . ASP C 3 59  ? 84.372  48.205  135.991 1.00 10.00 ? 59  ASP C O   1 
ATOM 6440  C CB  . ASP C 3 59  ? 82.905  45.778  135.003 1.00 10.00 ? 59  ASP C CB  1 
ATOM 6441  C CG  . ASP C 3 59  ? 81.906  44.616  134.917 1.00 10.00 ? 59  ASP C CG  1 
ATOM 6442  O OD1 . ASP C 3 59  ? 80.734  44.891  134.575 1.00 10.00 ? 59  ASP C OD1 1 
ATOM 6443  O OD2 . ASP C 3 59  ? 82.292  43.446  135.187 1.00 10.00 ? 59  ASP C OD2 1 
ATOM 6444  N N   . HIS C 3 60  ? 82.871  48.089  137.688 1.00 10.00 ? 60  HIS C N   1 
ATOM 6445  C CA  . HIS C 3 60  ? 83.657  48.869  138.651 1.00 10.00 ? 60  HIS C CA  1 
ATOM 6446  C C   . HIS C 3 60  ? 83.970  48.171  139.971 1.00 10.00 ? 60  HIS C C   1 
ATOM 6447  O O   . HIS C 3 60  ? 83.128  47.468  140.519 1.00 10.00 ? 60  HIS C O   1 
ATOM 6448  C CB  . HIS C 3 60  ? 82.960  50.223  138.923 1.00 10.00 ? 60  HIS C CB  1 
ATOM 6449  C CG  . HIS C 3 60  ? 83.688  51.371  138.305 1.00 10.00 ? 60  HIS C CG  1 
ATOM 6450  N ND1 . HIS C 3 60  ? 84.757  51.970  138.928 1.00 10.00 ? 60  HIS C ND1 1 
ATOM 6451  C CD2 . HIS C 3 60  ? 83.677  51.847  137.039 1.00 10.00 ? 60  HIS C CD2 1 
ATOM 6452  C CE1 . HIS C 3 60  ? 85.381  52.753  138.071 1.00 10.00 ? 60  HIS C CE1 1 
ATOM 6453  N NE2 . HIS C 3 60  ? 84.748  52.693  136.915 1.00 10.00 ? 60  HIS C NE2 1 
ATOM 6454  N N   . ALA C 3 61  ? 85.188  48.375  140.478 1.00 10.00 ? 61  ALA C N   1 
ATOM 6455  C CA  . ALA C 3 61  ? 85.619  47.758  141.734 1.00 10.00 ? 61  ALA C CA  1 
ATOM 6456  C C   . ALA C 3 61  ? 86.490  48.664  142.622 1.00 10.00 ? 61  ALA C C   1 
ATOM 6457  O O   . ALA C 3 61  ? 87.358  49.377  142.126 1.00 10.00 ? 61  ALA C O   1 
ATOM 6458  C CB  . ALA C 3 61  ? 86.370  46.460  141.428 1.00 10.00 ? 61  ALA C CB  1 
ATOM 6459  N N   . TRP C 3 62  ? 86.241  48.623  143.933 1.00 10.00 ? 62  TRP C N   1 
ATOM 6460  C CA  . TRP C 3 62  ? 86.990  49.399  144.934 1.00 10.00 ? 62  TRP C CA  1 
ATOM 6461  C C   . TRP C 3 62  ? 86.646  48.846  146.310 1.00 10.00 ? 62  TRP C C   1 
ATOM 6462  O O   . TRP C 3 62  ? 85.522  48.381  146.533 1.00 10.00 ? 62  TRP C O   1 
ATOM 6463  C CB  . TRP C 3 62  ? 86.639  50.897  144.857 1.00 10.00 ? 62  TRP C CB  1 
ATOM 6464  C CG  . TRP C 3 62  ? 85.181  51.231  145.055 1.00 10.00 ? 62  TRP C CG  1 
ATOM 6465  C CD1 . TRP C 3 62  ? 84.567  51.629  146.217 1.00 10.00 ? 62  TRP C CD1 1 
ATOM 6466  C CD2 . TRP C 3 62  ? 84.150  51.120  144.078 1.00 10.00 ? 62  TRP C CD2 1 
ATOM 6467  N NE1 . TRP C 3 62  ? 83.218  51.763  146.014 1.00 10.00 ? 62  TRP C NE1 1 
ATOM 6468  C CE2 . TRP C 3 62  ? 82.936  51.452  144.708 1.00 10.00 ? 62  TRP C CE2 1 
ATOM 6469  C CE3 . TRP C 3 62  ? 84.133  50.761  142.729 1.00 10.00 ? 62  TRP C CE3 1 
ATOM 6470  C CZ2 . TRP C 3 62  ? 81.710  51.429  144.028 1.00 10.00 ? 62  TRP C CZ2 1 
ATOM 6471  C CZ3 . TRP C 3 62  ? 82.908  50.735  142.051 1.00 10.00 ? 62  TRP C CZ3 1 
ATOM 6472  C CH2 . TRP C 3 62  ? 81.717  51.066  142.704 1.00 10.00 ? 62  TRP C CH2 1 
ATOM 6473  N N   . TYR C 3 63  ? 87.608  48.859  147.225 1.00 10.00 ? 63  TYR C N   1 
ATOM 6474  C CA  . TYR C 3 63  ? 87.342  48.321  148.567 1.00 10.00 ? 63  TYR C CA  1 
ATOM 6475  C C   . TYR C 3 63  ? 86.871  49.425  149.515 1.00 10.00 ? 63  TYR C C   1 
ATOM 6476  O O   . TYR C 3 63  ? 87.512  50.475  149.668 1.00 10.00 ? 63  TYR C O   1 
ATOM 6477  C CB  . TYR C 3 63  ? 88.584  47.548  149.136 1.00 10.00 ? 63  TYR C CB  1 
ATOM 6478  C CG  . TYR C 3 63  ? 88.424  46.805  150.499 1.00 10.00 ? 63  TYR C CG  1 
ATOM 6479  C CD1 . TYR C 3 63  ? 89.445  45.977  150.991 1.00 10.00 ? 63  TYR C CD1 1 
ATOM 6480  C CD2 . TYR C 3 63  ? 87.344  47.056  151.343 1.00 10.00 ? 63  TYR C CD2 1 
ATOM 6481  C CE1 . TYR C 3 63  ? 89.395  45.455  152.273 1.00 10.00 ? 63  TYR C CE1 1 
ATOM 6482  C CE2 . TYR C 3 63  ? 87.294  46.543  152.624 1.00 10.00 ? 63  TYR C CE2 1 
ATOM 6483  C CZ  . TYR C 3 63  ? 88.316  45.751  153.089 1.00 10.00 ? 63  TYR C CZ  1 
ATOM 6484  O OH  . TYR C 3 63  ? 88.266  45.324  154.400 1.00 10.00 ? 63  TYR C OH  1 
ATOM 6485  N N   . ASP C 3 64  ? 85.689  49.185  150.077 1.00 10.00 ? 64  ASP C N   1 
ATOM 6486  C CA  . ASP C 3 64  ? 84.997  50.066  151.031 1.00 10.00 ? 64  ASP C CA  1 
ATOM 6487  C C   . ASP C 3 64  ? 85.359  49.588  152.411 1.00 10.00 ? 64  ASP C C   1 
ATOM 6488  O O   . ASP C 3 64  ? 84.635  48.795  152.988 1.00 10.00 ? 64  ASP C O   1 
ATOM 6489  C CB  . ASP C 3 64  ? 83.476  49.966  150.824 1.00 10.00 ? 64  ASP C CB  1 
ATOM 6490  C CG  . ASP C 3 64  ? 82.693  51.041  151.557 1.00 10.00 ? 64  ASP C CG  1 
ATOM 6491  O OD1 . ASP C 3 64  ? 82.725  51.098  152.795 1.00 10.00 ? 64  ASP C OD1 1 
ATOM 6492  O OD2 . ASP C 3 64  ? 82.007  51.827  150.880 1.00 10.00 ? 64  ASP C OD2 1 
ATOM 6493  N N   . HIS C 3 65  ? 86.460  50.101  152.943 1.00 10.00 ? 65  HIS C N   1 
ATOM 6494  C CA  . HIS C 3 65  ? 86.943  49.685  154.253 1.00 10.00 ? 65  HIS C CA  1 
ATOM 6495  C C   . HIS C 3 65  ? 85.943  49.814  155.391 1.00 10.00 ? 65  HIS C C   1 
ATOM 6496  O O   . HIS C 3 65  ? 86.024  49.079  156.369 1.00 10.00 ? 65  HIS C O   1 
ATOM 6497  C CB  . HIS C 3 65  ? 88.224  50.443  154.545 1.00 10.00 ? 65  HIS C CB  1 
ATOM 6498  C CG  . HIS C 3 65  ? 88.972  50.826  153.301 1.00 10.00 ? 65  HIS C CG  1 
ATOM 6499  N ND1 . HIS C 3 65  ? 90.320  51.116  153.304 1.00 10.00 ? 65  HIS C ND1 1 
ATOM 6500  C CD2 . HIS C 3 65  ? 88.551  50.987  152.023 1.00 10.00 ? 65  HIS C CD2 1 
ATOM 6501  C CE1 . HIS C 3 65  ? 90.695  51.437  152.080 1.00 10.00 ? 65  HIS C CE1 1 
ATOM 6502  N NE2 . HIS C 3 65  ? 89.640  51.366  151.286 1.00 10.00 ? 65  HIS C NE2 1 
ATOM 6503  N N   . ARG C 3 66  ? 84.996  50.746  155.266 1.00 10.00 ? 66  ARG C N   1 
ATOM 6504  C CA  . ARG C 3 66  ? 83.966  50.891  156.293 1.00 10.00 ? 66  ARG C CA  1 
ATOM 6505  C C   . ARG C 3 66  ? 82.836  49.891  156.044 1.00 10.00 ? 66  ARG C C   1 
ATOM 6506  O O   . ARG C 3 66  ? 81.978  49.692  156.902 1.00 10.00 ? 66  ARG C O   1 
ATOM 6507  C CB  . ARG C 3 66  ? 83.397  52.311  156.307 1.00 10.00 ? 66  ARG C CB  1 
ATOM 6508  C CG  . ARG C 3 66  ? 84.408  53.370  156.785 1.00 10.00 ? 66  ARG C CG  1 
ATOM 6509  C CD  . ARG C 3 66  ? 84.877  53.124  158.225 1.00 10.00 ? 66  ARG C CD  1 
ATOM 6510  N NE  . ARG C 3 66  ? 85.831  54.105  158.739 1.00 10.00 ? 66  ARG C NE  1 
ATOM 6511  C CZ  . ARG C 3 66  ? 86.766  54.705  158.011 1.00 10.00 ? 66  ARG C CZ  1 
ATOM 6512  N NH1 . ARG C 3 66  ? 86.873  54.453  156.716 1.00 10.00 ? 66  ARG C NH1 1 
ATOM 6513  N NH2 . ARG C 3 66  ? 87.638  55.522  158.593 1.00 10.00 ? 66  ARG C NH2 1 
ATOM 6514  N N   . LEU C 3 67  ? 82.854  49.276  154.861 1.00 10.00 ? 67  LEU C N   1 
ATOM 6515  C CA  . LEU C 3 67  ? 81.856  48.268  154.427 1.00 10.00 ? 67  LEU C CA  1 
ATOM 6516  C C   . LEU C 3 67  ? 82.099  46.915  155.062 1.00 10.00 ? 67  LEU C C   1 
ATOM 6517  O O   . LEU C 3 67  ? 81.185  46.094  155.133 1.00 10.00 ? 67  LEU C O   1 
ATOM 6518  C CB  . LEU C 3 67  ? 81.869  48.067  152.888 1.00 10.00 ? 67  LEU C CB  1 
ATOM 6519  C CG  . LEU C 3 67  ? 81.031  47.065  152.033 1.00 10.00 ? 67  LEU C CG  1 
ATOM 6520  C CD1 . LEU C 3 67  ? 81.473  45.625  152.211 1.00 10.00 ? 67  LEU C CD1 1 
ATOM 6521  C CD2 . LEU C 3 67  ? 79.560  47.207  152.368 1.00 10.00 ? 67  LEU C CD2 1 
ATOM 6522  N N   . THR C 3 68  ? 83.320  46.657  155.517 1.00 10.00 ? 68  THR C N   1 
ATOM 6523  C CA  . THR C 3 68  ? 83.562  45.347  156.099 1.00 10.00 ? 68  THR C CA  1 
ATOM 6524  C C   . THR C 3 68  ? 82.563  45.115  157.199 1.00 10.00 ? 68  THR C C   1 
ATOM 6525  O O   . THR C 3 68  ? 82.381  45.956  158.078 1.00 10.00 ? 68  THR C O   1 
ATOM 6526  C CB  . THR C 3 68  ? 84.923  45.175  156.742 1.00 10.00 ? 68  THR C CB  1 
ATOM 6527  O OG1 . THR C 3 68  ? 85.956  45.099  155.741 1.00 10.00 ? 68  THR C OG1 1 
ATOM 6528  C CG2 . THR C 3 68  ? 84.899  43.899  157.585 1.00 10.00 ? 68  THR C CG2 1 
ATOM 6529  N N   . TRP C 3 69  ? 81.946  43.947  157.151 1.00 10.00 ? 69  TRP C N   1 
ATOM 6530  C CA  . TRP C 3 69  ? 80.928  43.567  158.133 1.00 10.00 ? 69  TRP C CA  1 
ATOM 6531  C C   . TRP C 3 69  ? 81.473  42.545  159.093 1.00 10.00 ? 69  TRP C C   1 
ATOM 6532  O O   . TRP C 3 69  ? 82.644  42.169  159.035 1.00 10.00 ? 69  TRP C O   1 
ATOM 6533  C CB  . TRP C 3 69  ? 79.641  42.986  157.463 1.00 10.00 ? 69  TRP C CB  1 
ATOM 6534  C CG  . TRP C 3 69  ? 79.343  43.518  156.084 1.00 10.00 ? 69  TRP C CG  1 
ATOM 6535  C CD1 . TRP C 3 69  ? 80.106  43.347  154.978 1.00 10.00 ? 69  TRP C CD1 1 
ATOM 6536  C CD2 . TRP C 3 69  ? 78.171  44.208  155.642 1.00 10.00 ? 69  TRP C CD2 1 
ATOM 6537  N NE1 . TRP C 3 69  ? 79.497  43.867  153.867 1.00 10.00 ? 69  TRP C NE1 1 
ATOM 6538  C CE2 . TRP C 3 69  ? 78.302  44.402  154.242 1.00 10.00 ? 69  TRP C CE2 1 
ATOM 6539  C CE3 . TRP C 3 69  ? 77.024  44.673  156.281 1.00 10.00 ? 69  TRP C CE3 1 
ATOM 6540  C CZ2 . TRP C 3 69  ? 77.336  45.033  153.475 1.00 10.00 ? 69  TRP C CZ2 1 
ATOM 6541  C CZ3 . TRP C 3 69  ? 76.047  45.308  155.510 1.00 10.00 ? 69  TRP C CZ3 1 
ATOM 6542  C CH2 . TRP C 3 69  ? 76.216  45.480  154.115 1.00 10.00 ? 69  TRP C CH2 1 
ATOM 6543  N N   . ASN C 3 70  ? 80.610  42.124  160.010 1.00 10.00 ? 70  ASN C N   1 
ATOM 6544  C CA  . ASN C 3 70  ? 80.952  41.088  160.982 1.00 10.00 ? 70  ASN C CA  1 
ATOM 6545  C C   . ASN C 3 70  ? 79.997  39.946  160.740 1.00 10.00 ? 70  ASN C C   1 
ATOM 6546  O O   . ASN C 3 70  ? 79.355  39.893  159.708 1.00 10.00 ? 70  ASN C O   1 
ATOM 6547  C CB  . ASN C 3 70  ? 80.804  41.609  162.420 1.00 10.00 ? 70  ASN C CB  1 
ATOM 6548  C CG  . ASN C 3 70  ? 81.759  42.757  162.736 1.00 10.00 ? 70  ASN C CG  1 
ATOM 6549  O OD1 . ASN C 3 70  ? 82.976  42.624  162.595 1.00 10.00 ? 70  ASN C OD1 1 
ATOM 6550  N ND2 . ASN C 3 70  ? 81.208  43.886  163.170 1.00 10.00 ? 70  ASN C ND2 1 
ATOM 6551  N N   . ALA C 3 71  ? 79.905  39.037  161.699 1.00 10.00 ? 71  ALA C N   1 
ATOM 6552  C CA  . ALA C 3 71  ? 79.033  37.874  161.565 1.00 10.00 ? 71  ALA C CA  1 
ATOM 6553  C C   . ALA C 3 71  ? 77.628  38.138  161.024 1.00 10.00 ? 71  ALA C C   1 
ATOM 6554  O O   . ALA C 3 71  ? 77.243  37.581  159.998 1.00 10.00 ? 71  ALA C O   1 
ATOM 6555  C CB  . ALA C 3 71  ? 78.945  37.127  162.911 1.00 10.00 ? 71  ALA C CB  1 
ATOM 6556  N N   . SER C 3 72  ? 76.860  38.981  161.702 1.00 10.00 ? 72  SER C N   1 
ATOM 6557  C CA  . SER C 3 72  ? 75.491  39.228  161.259 1.00 10.00 ? 72  SER C CA  1 
ATOM 6558  C C   . SER C 3 72  ? 75.368  40.198  160.082 1.00 10.00 ? 72  SER C C   1 
ATOM 6559  O O   . SER C 3 72  ? 74.380  40.928  159.948 1.00 10.00 ? 72  SER C O   1 
ATOM 6560  C CB  . SER C 3 72  ? 74.662  39.754  162.418 1.00 10.00 ? 72  SER C CB  1 
ATOM 6561  O OG  . SER C 3 72  ? 75.187  40.986  162.872 1.00 10.00 ? 72  SER C OG  1 
ATOM 6562  N N   . GLU C 3 73  ? 76.394  40.232  159.241 1.00 10.00 ? 73  GLU C N   1 
ATOM 6563  C CA  . GLU C 3 73  ? 76.418  41.112  158.061 1.00 10.00 ? 73  GLU C CA  1 
ATOM 6564  C C   . GLU C 3 73  ? 77.316  40.423  157.047 1.00 10.00 ? 73  GLU C C   1 
ATOM 6565  O O   . GLU C 3 73  ? 76.882  40.038  155.962 1.00 10.00 ? 73  GLU C O   1 
ATOM 6566  C CB  . GLU C 3 73  ? 76.981  42.510  158.423 1.00 10.00 ? 73  GLU C CB  1 
ATOM 6567  C CG  . GLU C 3 73  ? 76.197  43.176  159.583 1.00 10.00 ? 73  GLU C CG  1 
ATOM 6568  C CD  . GLU C 3 73  ? 76.494  44.620  159.802 1.00 10.00 ? 73  GLU C CD  1 
ATOM 6569  O OE1 . GLU C 3 73  ? 77.685  44.975  159.877 1.00 10.00 ? 73  GLU C OE1 1 
ATOM 6570  O OE2 . GLU C 3 73  ? 75.519  45.389  159.907 1.00 10.00 ? 73  GLU C OE2 1 
ATOM 6571  N N   . TYR C 3 74  ? 78.571  40.276  157.450 1.00 10.00 ? 74  TYR C N   1 
ATOM 6572  C CA  . TYR C 3 74  ? 79.666  39.625  156.701 1.00 10.00 ? 74  TYR C CA  1 
ATOM 6573  C C   . TYR C 3 74  ? 79.407  38.173  156.434 1.00 10.00 ? 74  TYR C C   1 
ATOM 6574  O O   . TYR C 3 74  ? 79.164  37.733  155.306 1.00 10.00 ? 74  TYR C O   1 
ATOM 6575  C CB  . TYR C 3 74  ? 80.944  39.712  157.545 1.00 10.00 ? 74  TYR C CB  1 
ATOM 6576  C CG  . TYR C 3 74  ? 82.151  38.902  157.119 1.00 10.00 ? 74  TYR C CG  1 
ATOM 6577  C CD1 . TYR C 3 74  ? 82.652  38.982  155.821 1.00 10.00 ? 74  TYR C CD1 1 
ATOM 6578  C CD2 . TYR C 3 74  ? 82.923  38.234  158.079 1.00 10.00 ? 74  TYR C CD2 1 
ATOM 6579  C CE1 . TYR C 3 74  ? 83.914  38.443  155.489 1.00 10.00 ? 74  TYR C CE1 1 
ATOM 6580  C CE2 . TYR C 3 74  ? 84.180  37.687  157.760 1.00 10.00 ? 74  TYR C CE2 1 
ATOM 6581  C CZ  . TYR C 3 74  ? 84.677  37.802  156.470 1.00 10.00 ? 74  TYR C CZ  1 
ATOM 6582  O OH  . TYR C 3 74  ? 85.939  37.321  156.182 1.00 10.00 ? 74  TYR C OH  1 
ATOM 6583  N N   . SER C 3 75  ? 79.508  37.425  157.525 1.00 10.00 ? 75  SER C N   1 
ATOM 6584  C CA  . SER C 3 75  ? 79.328  35.970  157.458 1.00 10.00 ? 75  SER C CA  1 
ATOM 6585  C C   . SER C 3 75  ? 77.862  35.588  157.405 1.00 10.00 ? 75  SER C C   1 
ATOM 6586  O O   . SER C 3 75  ? 77.528  34.526  156.882 1.00 10.00 ? 75  SER C O   1 
ATOM 6587  C CB  . SER C 3 75  ? 80.028  35.227  158.632 1.00 10.00 ? 75  SER C CB  1 
ATOM 6588  O OG  . SER C 3 75  ? 79.222  35.140  159.795 1.00 10.00 ? 75  SER C OG  1 
ATOM 6589  N N   . ASP C 3 76  ? 76.980  36.445  157.919 1.00 10.00 ? 76  ASP C N   1 
ATOM 6590  C CA  . ASP C 3 76  ? 75.557  36.107  157.869 1.00 10.00 ? 76  ASP C CA  1 
ATOM 6591  C C   . ASP C 3 76  ? 75.320  35.795  156.396 1.00 10.00 ? 76  ASP C C   1 
ATOM 6592  O O   . ASP C 3 76  ? 74.641  34.827  156.058 1.00 10.00 ? 76  ASP C O   1 
ATOM 6593  C CB  . ASP C 3 76  ? 74.669  37.281  158.325 1.00 10.00 ? 76  ASP C CB  1 
ATOM 6594  C CG  . ASP C 3 76  ? 73.188  36.888  158.476 1.00 10.00 ? 76  ASP C CG  1 
ATOM 6595  O OD1 . ASP C 3 76  ? 72.801  36.266  159.506 1.00 10.00 ? 76  ASP C OD1 1 
ATOM 6596  O OD2 . ASP C 3 76  ? 72.416  37.211  157.546 1.00 10.00 ? 76  ASP C OD2 1 
ATOM 6597  N N   . ILE C 3 77  ? 75.890  36.591  155.556 1.00 10.00 ? 77  ILE C N   1 
ATOM 6598  C CA  . ILE C 3 77  ? 75.845  36.449  154.103 1.00 10.00 ? 77  ILE C CA  1 
ATOM 6599  C C   . ILE C 3 77  ? 77.035  37.136  153.438 1.00 10.00 ? 77  ILE C C   1 
ATOM 6600  O O   . ILE C 3 77  ? 77.078  38.367  153.375 1.00 10.00 ? 77  ILE C O   1 
ATOM 6601  C CB  . ILE C 3 77  ? 74.545  37.031  153.519 1.00 10.00 ? 77  ILE C CB  1 
ATOM 6602  C CG1 . ILE C 3 77  ? 74.553  38.558  153.617 1.00 10.00 ? 77  ILE C CG1 1 
ATOM 6603  C CG2 . ILE C 3 77  ? 73.334  36.450  154.232 1.00 10.00 ? 77  ILE C CG2 1 
ATOM 6604  C CD1 . ILE C 3 77  ? 73.331  39.216  153.015 1.00 10.00 ? 77  ILE C CD1 1 
ATOM 6605  N N   . SER C 3 78  ? 78.039  36.347  153.066 1.00 10.00 ? 78  SER C N   1 
ATOM 6606  C CA  . SER C 3 78  ? 79.275  36.892  152.517 1.00 10.00 ? 78  SER C CA  1 
ATOM 6607  C C   . SER C 3 78  ? 79.098  37.731  151.248 1.00 10.00 ? 78  SER C C   1 
ATOM 6608  O O   . SER C 3 78  ? 80.076  38.031  150.568 1.00 10.00 ? 78  SER C O   1 
ATOM 6609  C CB  . SER C 3 78  ? 80.291  35.752  152.282 1.00 10.00 ? 78  SER C CB  1 
ATOM 6610  O OG  . SER C 3 78  ? 79.944  34.953  151.184 1.00 10.00 ? 78  SER C OG  1 
ATOM 6611  N N   . ILE C 3 79  ? 77.858  38.136  150.966 1.00 10.00 ? 79  ILE C N   1 
ATOM 6612  C CA  . ILE C 3 79  ? 77.477  38.930  149.783 1.00 10.00 ? 79  ILE C CA  1 
ATOM 6613  C C   . ILE C 3 79  ? 76.059  39.462  149.937 1.00 10.00 ? 79  ILE C C   1 
ATOM 6614  O O   . ILE C 3 79  ? 75.159  38.678  150.153 1.00 10.00 ? 79  ILE C O   1 
ATOM 6615  C CB  . ILE C 3 79  ? 77.426  38.102  148.491 1.00 10.00 ? 79  ILE C CB  1 
ATOM 6616  C CG1 . ILE C 3 79  ? 78.839  37.773  148.000 1.00 10.00 ? 79  ILE C CG1 1 
ATOM 6617  C CG2 . ILE C 3 79  ? 76.596  38.857  147.454 1.00 10.00 ? 79  ILE C CG2 1 
ATOM 6618  C CD1 . ILE C 3 79  ? 79.470  36.510  148.610 1.00 10.00 ? 79  ILE C CD1 1 
ATOM 6619  N N   . LEU C 3 80  ? 75.861  40.765  149.794 1.00 10.00 ? 80  LEU C N   1 
ATOM 6620  C CA  . LEU C 3 80  ? 74.535  41.377  149.905 1.00 10.00 ? 80  LEU C CA  1 
ATOM 6621  C C   . LEU C 3 80  ? 74.450  42.653  149.070 1.00 10.00 ? 80  LEU C C   1 
ATOM 6622  O O   . LEU C 3 80  ? 75.483  43.154  148.621 1.00 10.00 ? 80  LEU C O   1 
ATOM 6623  C CB  . LEU C 3 80  ? 74.221  41.679  151.374 1.00 10.00 ? 80  LEU C CB  1 
ATOM 6624  C CG  . LEU C 3 80  ? 72.788  42.109  151.690 1.00 10.00 ? 80  LEU C CG  1 
ATOM 6625  C CD1 . LEU C 3 80  ? 71.832  40.937  151.536 1.00 10.00 ? 80  LEU C CD1 1 
ATOM 6626  C CD2 . LEU C 3 80  ? 72.699  42.692  153.093 1.00 10.00 ? 80  LEU C CD2 1 
ATOM 6627  N N   . ARG C 3 81  ? 73.238  43.142  148.836 1.00 10.00 ? 81  ARG C N   1 
ATOM 6628  C CA  . ARG C 3 81  ? 73.042  44.362  148.052 1.00 10.00 ? 81  ARG C CA  1 
ATOM 6629  C C   . ARG C 3 81  ? 72.824  45.641  148.853 1.00 10.00 ? 81  ARG C C   1 
ATOM 6630  O O   . ARG C 3 81  ? 72.387  45.610  149.999 1.00 10.00 ? 81  ARG C O   1 
ATOM 6631  C CB  . ARG C 3 81  ? 71.871  44.171  147.082 1.00 10.00 ? 81  ARG C CB  1 
ATOM 6632  C CG  . ARG C 3 81  ? 71.986  42.923  146.218 1.00 10.00 ? 81  ARG C CG  1 
ATOM 6633  C CD  . ARG C 3 81  ? 73.163  42.991  145.256 1.00 10.00 ? 81  ARG C CD  1 
ATOM 6634  N NE  . ARG C 3 81  ? 73.338  41.725  144.549 1.00 10.00 ? 81  ARG C NE  1 
ATOM 6635  C CZ  . ARG C 3 81  ? 74.182  41.543  143.541 1.00 10.00 ? 81  ARG C CZ  1 
ATOM 6636  N NH1 . ARG C 3 81  ? 74.932  42.547  143.115 1.00 10.00 ? 81  ARG C NH1 1 
ATOM 6637  N NH2 . ARG C 3 81  ? 74.280  40.356  142.961 1.00 10.00 ? 81  ARG C NH2 1 
ATOM 6638  N N   . LEU C 3 82  ? 73.124  46.763  148.202 1.00 10.00 ? 82  LEU C N   1 
ATOM 6639  C CA  . LEU C 3 82  ? 72.998  48.094  148.808 1.00 10.00 ? 82  LEU C CA  1 
ATOM 6640  C C   . LEU C 3 82  ? 73.013  49.113  147.651 1.00 10.00 ? 82  LEU C C   1 
ATOM 6641  O O   . LEU C 3 82  ? 73.964  49.166  146.879 1.00 10.00 ? 82  LEU C O   1 
ATOM 6642  C CB  . LEU C 3 82  ? 74.192  48.353  149.768 1.00 10.00 ? 82  LEU C CB  1 
ATOM 6643  C CG  . LEU C 3 82  ? 74.224  49.372  150.933 1.00 10.00 ? 82  LEU C CG  1 
ATOM 6644  C CD1 . LEU C 3 82  ? 73.218  49.013  152.013 1.00 10.00 ? 82  LEU C CD1 1 
ATOM 6645  C CD2 . LEU C 3 82  ? 75.618  49.392  151.530 1.00 10.00 ? 82  LEU C CD2 1 
ATOM 6646  N N   . ARG C 3 83  ? 71.951  49.906  147.537 1.00 10.00 ? 83  ARG C N   1 
ATOM 6647  C CA  . ARG C 3 83  ? 71.798  50.926  146.491 1.00 10.00 ? 83  ARG C CA  1 
ATOM 6648  C C   . ARG C 3 83  ? 73.027  51.845  146.329 1.00 10.00 ? 83  ARG C C   1 
ATOM 6649  O O   . ARG C 3 83  ? 73.969  51.777  147.123 1.00 10.00 ? 83  ARG C O   1 
ATOM 6650  C CB  . ARG C 3 83  ? 70.569  51.789  146.819 1.00 10.00 ? 83  ARG C CB  1 
ATOM 6651  C CG  . ARG C 3 83  ? 69.214  51.092  146.716 1.00 10.00 ? 83  ARG C CG  1 
ATOM 6652  C CD  . ARG C 3 83  ? 69.062  50.314  145.412 1.00 10.00 ? 83  ARG C CD  1 
ATOM 6653  N NE  . ARG C 3 83  ? 68.414  49.018  145.620 1.00 10.00 ? 83  ARG C NE  1 
ATOM 6654  C CZ  . ARG C 3 83  ? 68.059  48.188  144.643 1.00 10.00 ? 83  ARG C CZ  1 
ATOM 6655  N NH1 . ARG C 3 83  ? 68.288  48.512  143.378 1.00 10.00 ? 83  ARG C NH1 1 
ATOM 6656  N NH2 . ARG C 3 83  ? 67.474  47.034  144.930 1.00 10.00 ? 83  ARG C NH2 1 
ATOM 6657  N N   . PRO C 3 84  ? 73.031  52.711  145.287 1.00 10.00 ? 84  PRO C N   1 
ATOM 6658  C CA  . PRO C 3 84  ? 74.110  53.673  144.980 1.00 10.00 ? 84  PRO C CA  1 
ATOM 6659  C C   . PRO C 3 84  ? 74.294  54.736  146.068 1.00 10.00 ? 84  PRO C C   1 
ATOM 6660  O O   . PRO C 3 84  ? 75.417  55.122  146.431 1.00 10.00 ? 84  PRO C O   1 
ATOM 6661  C CB  . PRO C 3 84  ? 73.627  54.322  143.693 1.00 10.00 ? 84  PRO C CB  1 
ATOM 6662  C CG  . PRO C 3 84  ? 72.179  54.406  143.928 1.00 10.00 ? 84  PRO C CG  1 
ATOM 6663  C CD  . PRO C 3 84  ? 71.894  52.987  144.382 1.00 10.00 ? 84  PRO C CD  1 
ATOM 6664  N N   . GLU C 3 85  ? 73.177  55.198  146.611 1.00 10.00 ? 85  GLU C N   1 
ATOM 6665  C CA  . GLU C 3 85  ? 73.238  56.255  147.607 1.00 10.00 ? 85  GLU C CA  1 
ATOM 6666  C C   . GLU C 3 85  ? 73.769  55.718  148.927 1.00 10.00 ? 85  GLU C C   1 
ATOM 6667  O O   . GLU C 3 85  ? 74.036  56.477  149.856 1.00 10.00 ? 85  GLU C O   1 
ATOM 6668  C CB  . GLU C 3 85  ? 71.859  56.887  147.808 1.00 10.00 ? 85  GLU C CB  1 
ATOM 6669  C CG  . GLU C 3 85  ? 70.997  56.993  146.564 1.00 10.00 ? 85  GLU C CG  1 
ATOM 6670  C CD  . GLU C 3 85  ? 70.317  55.675  146.204 1.00 10.00 ? 85  GLU C CD  1 
ATOM 6671  O OE1 . GLU C 3 85  ? 69.126  55.691  145.812 1.00 10.00 ? 85  GLU C OE1 1 
ATOM 6672  O OE2 . GLU C 3 85  ? 70.971  54.623  146.309 1.00 10.00 ? 85  GLU C OE2 1 
ATOM 6673  N N   . LEU C 3 86  ? 73.931  54.401  148.995 1.00 10.00 ? 86  LEU C N   1 
ATOM 6674  C CA  . LEU C 3 86  ? 74.433  53.744  150.195 1.00 10.00 ? 86  LEU C CA  1 
ATOM 6675  C C   . LEU C 3 86  ? 75.737  52.980  149.879 1.00 10.00 ? 86  LEU C C   1 
ATOM 6676  O O   . LEU C 3 86  ? 76.244  52.209  150.697 1.00 10.00 ? 86  LEU C O   1 
ATOM 6677  C CB  . LEU C 3 86  ? 73.328  52.827  150.743 1.00 10.00 ? 86  LEU C CB  1 
ATOM 6678  C CG  . LEU C 3 86  ? 72.180  53.691  151.282 1.00 10.00 ? 86  LEU C CG  1 
ATOM 6679  C CD1 . LEU C 3 86  ? 70.849  52.934  151.470 1.00 10.00 ? 86  LEU C CD1 1 
ATOM 6680  C CD2 . LEU C 3 86  ? 72.721  54.312  152.569 1.00 10.00 ? 86  LEU C CD2 1 
ATOM 6681  N N   . ILE C 3 87  ? 76.279  53.244  148.689 1.00 10.00 ? 87  ILE C N   1 
ATOM 6682  C CA  . ILE C 3 87  ? 77.521  52.643  148.188 1.00 10.00 ? 87  ILE C CA  1 
ATOM 6683  C C   . ILE C 3 87  ? 78.365  53.729  147.560 1.00 10.00 ? 87  ILE C C   1 
ATOM 6684  O O   . ILE C 3 87  ? 77.831  54.545  146.804 1.00 10.00 ? 87  ILE C O   1 
ATOM 6685  C CB  . ILE C 3 87  ? 77.262  51.607  147.028 1.00 10.00 ? 87  ILE C CB  1 
ATOM 6686  C CG1 . ILE C 3 87  ? 76.312  50.493  147.486 1.00 10.00 ? 87  ILE C CG1 1 
ATOM 6687  C CG2 . ILE C 3 87  ? 78.613  51.047  146.495 1.00 10.00 ? 87  ILE C CG2 1 
ATOM 6688  C CD1 . ILE C 3 87  ? 76.623  49.134  146.903 1.00 10.00 ? 87  ILE C CD1 1 
ATOM 6689  N N   . TRP C 3 88  ? 79.650  53.794  147.881 1.00 10.00 ? 88  TRP C N   1 
ATOM 6690  C CA  . TRP C 3 88  ? 80.488  54.791  147.213 1.00 10.00 ? 88  TRP C CA  1 
ATOM 6691  C C   . TRP C 3 88  ? 80.554  54.389  145.748 1.00 10.00 ? 88  TRP C C   1 
ATOM 6692  O O   . TRP C 3 88  ? 80.816  53.229  145.420 1.00 10.00 ? 88  TRP C O   1 
ATOM 6693  C CB  . TRP C 3 88  ? 81.914  54.766  147.717 1.00 10.00 ? 88  TRP C CB  1 
ATOM 6694  C CG  . TRP C 3 88  ? 82.794  55.793  147.029 1.00 10.00 ? 88  TRP C CG  1 
ATOM 6695  C CD1 . TRP C 3 88  ? 82.390  56.935  146.477 1.00 10.00 ? 88  TRP C CD1 1 
ATOM 6696  C CD2 . TRP C 3 88  ? 84.200  55.683  146.867 1.00 10.00 ? 88  TRP C CD2 1 
ATOM 6697  N NE1 . TRP C 3 88  ? 83.551  57.579  145.964 1.00 10.00 ? 88  TRP C NE1 1 
ATOM 6698  C CE2 . TRP C 3 88  ? 84.604  56.833  146.206 1.00 10.00 ? 88  TRP C CE2 1 
ATOM 6699  C CE3 . TRP C 3 88  ? 85.165  54.726  147.223 1.00 10.00 ? 88  TRP C CE3 1 
ATOM 6700  C CZ2 . TRP C 3 88  ? 85.939  57.102  145.880 1.00 10.00 ? 88  TRP C CZ2 1 
ATOM 6701  C CZ3 . TRP C 3 88  ? 86.510  55.003  146.884 1.00 10.00 ? 88  TRP C CZ3 1 
ATOM 6702  C CH2 . TRP C 3 88  ? 86.876  56.137  146.244 1.00 10.00 ? 88  TRP C CH2 1 
ATOM 6703  N N   . ILE C 3 89  ? 80.316  55.322  144.864 1.00 10.00 ? 89  ILE C N   1 
ATOM 6704  C CA  . ILE C 3 89  ? 80.339  55.004  143.430 1.00 10.00 ? 89  ILE C CA  1 
ATOM 6705  C C   . ILE C 3 89  ? 81.332  55.923  142.708 1.00 10.00 ? 89  ILE C C   1 
ATOM 6706  O O   . ILE C 3 89  ? 81.262  57.154  142.820 1.00 10.00 ? 89  ILE C O   1 
ATOM 6707  C CB  . ILE C 3 89  ? 78.919  55.135  142.868 1.00 10.00 ? 89  ILE C CB  1 
ATOM 6708  C CG1 . ILE C 3 89  ? 78.274  56.487  143.185 1.00 10.00 ? 89  ILE C CG1 1 
ATOM 6709  C CG2 . ILE C 3 89  ? 77.965  54.072  143.432 1.00 10.00 ? 89  ILE C CG2 1 
ATOM 6710  C CD1 . ILE C 3 89  ? 76.865  56.635  142.605 1.00 10.00 ? 89  ILE C CD1 1 
ATOM 6711  N N   . PRO C 3 90  ? 82.308  55.389  141.934 1.00 10.00 ? 90  PRO C N   1 
ATOM 6712  C CA  . PRO C 3 90  ? 83.280  56.231  141.246 1.00 10.00 ? 90  PRO C CA  1 
ATOM 6713  C C   . PRO C 3 90  ? 82.551  57.110  140.267 1.00 10.00 ? 90  PRO C C   1 
ATOM 6714  O O   . PRO C 3 90  ? 81.525  56.656  139.675 1.00 10.00 ? 90  PRO C O   1 
ATOM 6715  C CB  . PRO C 3 90  ? 84.164  55.258  140.509 1.00 10.00 ? 90  PRO C CB  1 
ATOM 6716  C CG  . PRO C 3 90  ? 83.650  53.853  140.810 1.00 10.00 ? 90  PRO C CG  1 
ATOM 6717  C CD  . PRO C 3 90  ? 82.462  53.948  141.727 1.00 10.00 ? 90  PRO C CD  1 
ATOM 6718  N N   . ASP C 3 91  ? 83.051  58.318  140.089 1.00 10.00 ? 91  ASP C N   1 
ATOM 6719  C CA  . ASP C 3 91  ? 82.428  59.282  139.164 1.00 10.00 ? 91  ASP C CA  1 
ATOM 6720  C C   . ASP C 3 91  ? 82.998  59.111  137.756 1.00 10.00 ? 91  ASP C C   1 
ATOM 6721  O O   . ASP C 3 91  ? 83.518  60.058  137.151 1.00 10.00 ? 91  ASP C O   1 
ATOM 6722  C CB  . ASP C 3 91  ? 82.673  60.719  139.641 1.00 10.00 ? 91  ASP C CB  1 
ATOM 6723  C CG  . ASP C 3 91  ? 83.538  60.816  140.904 1.00 10.00 ? 91  ASP C CG  1 
ATOM 6724  O OD1 . ASP C 3 91  ? 83.015  60.612  142.064 1.00 10.00 ? 91  ASP C OD1 1 
ATOM 6725  O OD2 . ASP C 3 91  ? 84.792  61.109  140.805 1.00 10.00 ? 91  ASP C OD2 1 
ATOM 6726  N N   . ILE C 3 92  ? 82.877  57.899  137.248 1.00 10.00 ? 92  ILE C N   1 
ATOM 6727  C CA  . ILE C 3 92  ? 83.412  57.582  135.929 1.00 10.00 ? 92  ILE C CA  1 
ATOM 6728  C C   . ILE C 3 92  ? 82.715  58.426  134.872 1.00 10.00 ? 92  ILE C C   1 
ATOM 6729  O O   . ILE C 3 92  ? 81.459  58.403  134.784 1.00 10.00 ? 92  ILE C O   1 
ATOM 6730  C CB  . ILE C 3 92  ? 83.346  56.085  135.661 1.00 10.00 ? 92  ILE C CB  1 
ATOM 6731  C CG1 . ILE C 3 92  ? 82.187  55.457  136.446 1.00 10.00 ? 92  ILE C CG1 1 
ATOM 6732  C CG2 . ILE C 3 92  ? 84.623  55.349  136.096 1.00 10.00 ? 92  ILE C CG2 1 
ATOM 6733  C CD1 . ILE C 3 92  ? 82.124  53.941  136.344 1.00 10.00 ? 92  ILE C CD1 1 
ATOM 6734  N N   . VAL C 3 93  ? 83.661  59.106  134.221 1.00 10.00 ? 93  VAL C N   1 
ATOM 6735  C CA  . VAL C 3 93  ? 83.481  60.040  133.107 1.00 10.00 ? 93  VAL C CA  1 
ATOM 6736  C C   . VAL C 3 93  ? 84.109  59.444  131.855 1.00 10.00 ? 93  VAL C C   1 
ATOM 6737  O O   . VAL C 3 93  ? 85.218  58.904  131.879 1.00 10.00 ? 93  VAL C O   1 
ATOM 6738  C CB  . VAL C 3 93  ? 84.128  61.386  133.408 1.00 10.00 ? 93  VAL C CB  1 
ATOM 6739  C CG1 . VAL C 3 93  ? 85.653  61.331  133.360 1.00 10.00 ? 93  VAL C CG1 1 
ATOM 6740  C CG2 . VAL C 3 93  ? 83.706  62.471  132.413 1.00 10.00 ? 93  VAL C CG2 1 
ATOM 6741  N N   . LEU C 3 94  ? 83.397  59.558  130.753 1.00 10.00 ? 94  LEU C N   1 
ATOM 6742  C CA  . LEU C 3 94  ? 83.903  59.019  129.535 1.00 10.00 ? 94  LEU C CA  1 
ATOM 6743  C C   . LEU C 3 94  ? 84.709  60.228  129.006 1.00 10.00 ? 94  LEU C C   1 
ATOM 6744  O O   . LEU C 3 94  ? 84.185  61.136  128.356 1.00 10.00 ? 94  LEU C O   1 
ATOM 6745  C CB  . LEU C 3 94  ? 82.677  58.543  128.723 1.00 10.00 ? 94  LEU C CB  1 
ATOM 6746  C CG  . LEU C 3 94  ? 81.623  57.833  129.641 1.00 10.00 ? 94  LEU C CG  1 
ATOM 6747  C CD1 . LEU C 3 94  ? 80.612  57.066  128.853 1.00 10.00 ? 94  LEU C CD1 1 
ATOM 6748  C CD2 . LEU C 3 94  ? 82.266  56.868  130.586 1.00 10.00 ? 94  LEU C CD2 1 
ATOM 6749  N N   . GLN C 3 95  ? 85.993  60.228  129.389 1.00 10.00 ? 95  GLN C N   1 
ATOM 6750  C CA  . GLN C 3 95  ? 86.987  61.266  129.102 1.00 10.00 ? 95  GLN C CA  1 
ATOM 6751  C C   . GLN C 3 95  ? 86.901  62.015  127.765 1.00 10.00 ? 95  GLN C C   1 
ATOM 6752  O O   . GLN C 3 95  ? 86.899  63.258  127.739 1.00 10.00 ? 95  GLN C O   1 
ATOM 6753  C CB  . GLN C 3 95  ? 88.395  60.677  129.307 1.00 10.00 ? 95  GLN C CB  1 
ATOM 6754  C CG  . GLN C 3 95  ? 89.045  60.957  130.676 1.00 10.00 ? 95  GLN C CG  1 
ATOM 6755  C CD  . GLN C 3 95  ? 90.391  60.201  130.893 1.00 10.00 ? 95  GLN C CD  1 
ATOM 6756  O OE1 . GLN C 3 95  ? 90.392  58.990  131.106 1.00 10.00 ? 95  GLN C OE1 1 
ATOM 6757  N NE2 . GLN C 3 95  ? 91.523  60.922  130.834 1.00 10.00 ? 95  GLN C NE2 1 
ATOM 6758  N N   . ASN C 3 96  ? 86.872  61.300  126.655 1.00 10.00 ? 96  ASN C N   1 
ATOM 6759  C CA  . ASN C 3 96  ? 86.743  62.033  125.402 1.00 10.00 ? 96  ASN C CA  1 
ATOM 6760  C C   . ASN C 3 96  ? 85.466  61.647  124.667 1.00 10.00 ? 96  ASN C C   1 
ATOM 6761  O O   . ASN C 3 96  ? 85.165  62.206  123.624 1.00 10.00 ? 96  ASN C O   1 
ATOM 6762  C CB  . ASN C 3 96  ? 87.964  61.791  124.514 1.00 10.00 ? 96  ASN C CB  1 
ATOM 6763  C CG  . ASN C 3 96  ? 87.726  60.714  123.476 1.00 10.00 ? 96  ASN C CG  1 
ATOM 6764  O OD1 . ASN C 3 96  ? 87.796  59.522  123.777 1.00 10.00 ? 96  ASN C OD1 1 
ATOM 6765  N ND2 . ASN C 3 96  ? 87.441  61.130  122.247 1.00 10.00 ? 96  ASN C ND2 1 
ATOM 6766  N N   . ASN C 3 97  ? 84.691  60.712  125.264 1.00 10.00 ? 97  ASN C N   1 
ATOM 6767  C CA  . ASN C 3 97  ? 83.475  60.291  124.605 1.00 10.00 ? 97  ASN C CA  1 
ATOM 6768  C C   . ASN C 3 97  ? 82.272  60.530  125.494 1.00 10.00 ? 97  ASN C C   1 
ATOM 6769  O O   . ASN C 3 97  ? 81.175  59.943  125.206 1.00 10.00 ? 97  ASN C O   1 
ATOM 6770  C CB  . ASN C 3 97  ? 83.606  58.846  124.138 1.00 10.00 ? 97  ASN C CB  1 
ATOM 6771  C CG  . ASN C 3 97  ? 84.594  58.724  122.993 1.00 10.00 ? 97  ASN C CG  1 
ATOM 6772  O OD1 . ASN C 3 97  ? 84.276  59.055  121.848 1.00 10.00 ? 97  ASN C OD1 1 
ATOM 6773  N ND2 . ASN C 3 97  ? 85.797  58.253  123.294 1.00 10.00 ? 97  ASN C ND2 1 
ATOM 6774  N N   . ASN C 3 98  ? 82.315  61.321  126.559 1.00 10.00 ? 98  ASN C N   1 
ATOM 6775  C CA  . ASN C 3 98  ? 81.116  61.519  127.368 1.00 10.00 ? 98  ASN C CA  1 
ATOM 6776  C C   . ASN C 3 98  ? 80.421  62.839  127.061 1.00 10.00 ? 98  ASN C C   1 
ATOM 6777  O O   . ASN C 3 98  ? 79.684  63.378  127.893 1.00 10.00 ? 98  ASN C O   1 
ATOM 6778  C CB  . ASN C 3 98  ? 81.415  61.391  128.874 1.00 10.00 ? 98  ASN C CB  1 
ATOM 6779  C CG  . ASN C 3 98  ? 80.162  61.474  129.724 1.00 10.00 ? 98  ASN C CG  1 
ATOM 6780  O OD1 . ASN C 3 98  ? 79.121  60.899  129.395 1.00 10.00 ? 98  ASN C OD1 1 
ATOM 6781  N ND2 . ASN C 3 98  ? 80.260  62.191  130.833 1.00 10.00 ? 98  ASN C ND2 1 
ATOM 6782  N N   . ASP C 3 99  ? 80.656  63.364  125.861 1.00 10.00 ? 99  ASP C N   1 
ATOM 6783  C CA  . ASP C 3 99  ? 79.976  64.603  125.462 1.00 10.00 ? 99  ASP C CA  1 
ATOM 6784  C C   . ASP C 3 99  ? 78.547  64.165  125.114 1.00 10.00 ? 99  ASP C C   1 
ATOM 6785  O O   . ASP C 3 99  ? 78.075  64.346  123.985 1.00 10.00 ? 99  ASP C O   1 
ATOM 6786  C CB  . ASP C 3 99  ? 80.646  65.252  124.233 1.00 10.00 ? 99  ASP C CB  1 
ATOM 6787  C CG  . ASP C 3 99  ? 80.042  66.608  123.880 1.00 10.00 ? 99  ASP C CG  1 
ATOM 6788  O OD1 . ASP C 3 99  ? 80.158  67.593  124.701 1.00 10.00 ? 99  ASP C OD1 1 
ATOM 6789  O OD2 . ASP C 3 99  ? 79.416  66.762  122.764 1.00 10.00 ? 99  ASP C OD2 1 
ATOM 6790  N N   . GLY C 3 100 ? 77.956  63.559  126.123 1.00 10.00 ? 100 GLY C N   1 
ATOM 6791  C CA  . GLY C 3 100 ? 76.597  62.996  126.105 1.00 10.00 ? 100 GLY C CA  1 
ATOM 6792  C C   . GLY C 3 100 ? 76.467  62.157  127.369 1.00 10.00 ? 100 GLY C C   1 
ATOM 6793  O O   . GLY C 3 100 ? 76.866  60.987  127.413 1.00 10.00 ? 100 GLY C O   1 
ATOM 6794  N N   . GLN C 3 101 ? 75.914  62.758  128.410 1.00 10.00 ? 101 GLN C N   1 
ATOM 6795  C CA  . GLN C 3 101 ? 75.876  62.099  129.709 1.00 10.00 ? 101 GLN C CA  1 
ATOM 6796  C C   . GLN C 3 101 ? 75.401  60.657  129.579 1.00 10.00 ? 101 GLN C C   1 
ATOM 6797  O O   . GLN C 3 101 ? 74.563  60.320  128.727 1.00 10.00 ? 101 GLN C O   1 
ATOM 6798  C CB  . GLN C 3 101 ? 74.976  62.872  130.676 1.00 10.00 ? 101 GLN C CB  1 
ATOM 6799  C CG  . GLN C 3 101 ? 75.177  62.506  132.137 1.00 10.00 ? 101 GLN C CG  1 
ATOM 6800  C CD  . GLN C 3 101 ? 74.291  63.311  133.066 1.00 10.00 ? 101 GLN C CD  1 
ATOM 6801  O OE1 . GLN C 3 101 ? 73.067  63.180  133.041 1.00 10.00 ? 101 GLN C OE1 1 
ATOM 6802  N NE2 . GLN C 3 101 ? 74.696  64.202  133.965 1.00 10.00 ? 101 GLN C NE2 1 
ATOM 6803  N N   . TYR C 3 102 ? 75.990  59.878  130.478 1.00 10.00 ? 102 TYR C N   1 
ATOM 6804  C CA  . TYR C 3 102 ? 75.822  58.436  130.603 1.00 10.00 ? 102 TYR C CA  1 
ATOM 6805  C C   . TYR C 3 102 ? 74.405  58.084  131.039 1.00 10.00 ? 102 TYR C C   1 
ATOM 6806  O O   . TYR C 3 102 ? 73.811  58.715  131.912 1.00 10.00 ? 102 TYR C O   1 
ATOM 6807  C CB  . TYR C 3 102 ? 76.843  57.859  131.585 1.00 10.00 ? 102 TYR C CB  1 
ATOM 6808  C CG  . TYR C 3 102 ? 76.665  58.338  133.008 1.00 10.00 ? 102 TYR C CG  1 
ATOM 6809  C CD1 . TYR C 3 102 ? 75.399  58.540  133.541 1.00 10.00 ? 102 TYR C CD1 1 
ATOM 6810  C CD2 . TYR C 3 102 ? 77.765  58.587  133.819 1.00 10.00 ? 102 TYR C CD2 1 
ATOM 6811  C CE1 . TYR C 3 102 ? 75.233  58.977  134.841 1.00 10.00 ? 102 TYR C CE1 1 
ATOM 6812  C CE2 . TYR C 3 102 ? 77.609  59.023  135.120 1.00 10.00 ? 102 TYR C CE2 1 
ATOM 6813  C CZ  . TYR C 3 102 ? 76.342  59.216  135.626 1.00 10.00 ? 102 TYR C CZ  1 
ATOM 6814  O OH  . TYR C 3 102 ? 76.184  59.651  136.922 1.00 10.00 ? 102 TYR C OH  1 
ATOM 6815  N N   . ASN C 3 103 ? 73.794  56.997  130.467 1.00 10.00 ? 103 ASN C N   1 
ATOM 6816  C CA  . ASN C 3 103 ? 72.460  56.632  130.912 1.00 10.00 ? 103 ASN C CA  1 
ATOM 6817  C C   . ASN C 3 103 ? 72.419  55.174  131.349 1.00 10.00 ? 103 ASN C C   1 
ATOM 6818  O O   . ASN C 3 103 ? 72.935  54.258  130.679 1.00 10.00 ? 103 ASN C O   1 
ATOM 6819  C CB  . ASN C 3 103 ? 71.436  56.895  129.807 1.00 10.00 ? 103 ASN C CB  1 
ATOM 6820  C CG  . ASN C 3 103 ? 70.024  57.031  130.343 1.00 10.00 ? 103 ASN C CG  1 
ATOM 6821  O OD1 . ASN C 3 103 ? 69.072  56.536  129.740 1.00 10.00 ? 103 ASN C OD1 1 
ATOM 6822  N ND2 . ASN C 3 103 ? 69.887  57.704  131.478 1.00 10.00 ? 103 ASN C ND2 1 
ATOM 6823  N N   . VAL C 3 104 ? 71.693  55.074  132.497 1.00 10.00 ? 104 VAL C N   1 
ATOM 6824  C CA  . VAL C 3 104 ? 71.411  53.871  133.321 1.00 10.00 ? 104 VAL C CA  1 
ATOM 6825  C C   . VAL C 3 104 ? 72.677  53.072  133.558 1.00 10.00 ? 104 VAL C C   1 
ATOM 6826  O O   . VAL C 3 104 ? 72.664  51.833  133.507 1.00 10.00 ? 104 VAL C O   1 
ATOM 6827  C CB  . VAL C 3 104 ? 70.325  52.998  132.725 1.00 10.00 ? 104 VAL C CB  1 
ATOM 6828  C CG1 . VAL C 3 104 ? 68.983  53.169  133.451 1.00 10.00 ? 104 VAL C CG1 1 
ATOM 6829  C CG2 . VAL C 3 104 ? 70.063  53.294  131.259 1.00 10.00 ? 104 VAL C CG2 1 
ATOM 6830  N N   . ALA C 3 105 ? 73.663  53.871  133.793 1.00 10.00 ? 105 ALA C N   1 
ATOM 6831  C CA  . ALA C 3 105 ? 74.998  53.489  134.201 1.00 10.00 ? 105 ALA C CA  1 
ATOM 6832  C C   . ALA C 3 105 ? 75.274  54.461  135.316 1.00 10.00 ? 105 ALA C C   1 
ATOM 6833  O O   . ALA C 3 105 ? 76.430  54.685  135.698 1.00 10.00 ? 105 ALA C O   1 
ATOM 6834  C CB  . ALA C 3 105 ? 75.965  53.641  133.025 1.00 10.00 ? 105 ALA C CB  1 
ATOM 6835  N N   . TYR C 3 106 ? 74.127  54.987  135.742 1.00 10.00 ? 106 TYR C N   1 
ATOM 6836  C CA  . TYR C 3 106 ? 74.044  55.999  136.776 1.00 10.00 ? 106 TYR C CA  1 
ATOM 6837  C C   . TYR C 3 106 ? 73.329  55.493  138.023 1.00 10.00 ? 106 TYR C C   1 
ATOM 6838  O O   . TYR C 3 106 ? 72.399  54.704  137.939 1.00 10.00 ? 106 TYR C O   1 
ATOM 6839  C CB  . TYR C 3 106 ? 73.345  57.259  136.256 1.00 10.00 ? 106 TYR C CB  1 
ATOM 6840  C CG  . TYR C 3 106 ? 72.001  56.988  135.595 1.00 10.00 ? 106 TYR C CG  1 
ATOM 6841  C CD1 . TYR C 3 106 ? 71.552  57.824  134.567 1.00 10.00 ? 106 TYR C CD1 1 
ATOM 6842  C CD2 . TYR C 3 106 ? 71.222  55.912  136.019 1.00 10.00 ? 106 TYR C CD2 1 
ATOM 6843  C CE1 . TYR C 3 106 ? 70.315  57.581  133.964 1.00 10.00 ? 106 TYR C CE1 1 
ATOM 6844  C CE2 . TYR C 3 106 ? 69.984  55.669  135.417 1.00 10.00 ? 106 TYR C CE2 1 
ATOM 6845  C CZ  . TYR C 3 106 ? 69.531  56.504  134.390 1.00 10.00 ? 106 TYR C CZ  1 
ATOM 6846  O OH  . TYR C 3 106 ? 68.327  56.269  133.806 1.00 10.00 ? 106 TYR C OH  1 
ATOM 6847  N N   . PHE C 3 107 ? 73.807  55.944  139.196 1.00 10.00 ? 107 PHE C N   1 
ATOM 6848  C CA  . PHE C 3 107 ? 73.251  55.596  140.501 1.00 10.00 ? 107 PHE C CA  1 
ATOM 6849  C C   . PHE C 3 107 ? 72.406  54.318  140.499 1.00 10.00 ? 107 PHE C C   1 
ATOM 6850  O O   . PHE C 3 107 ? 71.231  54.341  140.865 1.00 10.00 ? 107 PHE C O   1 
ATOM 6851  C CB  . PHE C 3 107 ? 72.402  56.758  141.034 1.00 10.00 ? 107 PHE C CB  1 
ATOM 6852  C CG  . PHE C 3 107 ? 71.073  56.871  140.385 1.00 10.00 ? 107 PHE C CG  1 
ATOM 6853  C CD1 . PHE C 3 107 ? 69.939  57.064  141.154 1.00 10.00 ? 107 PHE C CD1 1 
ATOM 6854  C CD2 . PHE C 3 107 ? 70.943  56.697  139.024 1.00 10.00 ? 107 PHE C CD2 1 
ATOM 6855  C CE1 . PHE C 3 107 ? 68.690  57.073  140.580 1.00 10.00 ? 107 PHE C CE1 1 
ATOM 6856  C CE2 . PHE C 3 107 ? 69.716  56.701  138.443 1.00 10.00 ? 107 PHE C CE2 1 
ATOM 6857  C CZ  . PHE C 3 107 ? 68.570  56.889  139.222 1.00 10.00 ? 107 PHE C CZ  1 
ATOM 6858  N N   . CYS C 3 108 ? 73.014  53.200  140.115 1.00 10.00 ? 108 CYS C N   1 
ATOM 6859  C CA  . CYS C 3 108 ? 72.312  51.918  140.048 1.00 10.00 ? 108 CYS C CA  1 
ATOM 6860  C C   . CYS C 3 108 ? 72.717  50.934  141.149 1.00 10.00 ? 108 CYS C C   1 
ATOM 6861  O O   . CYS C 3 108 ? 73.739  51.116  141.803 1.00 10.00 ? 108 CYS C O   1 
ATOM 6862  C CB  . CYS C 3 108 ? 72.561  51.279  138.677 1.00 10.00 ? 108 CYS C CB  1 
ATOM 6863  S SG  . CYS C 3 108 ? 71.956  49.585  138.479 1.00 10.00 ? 108 CYS C SG  1 
ATOM 6864  N N   . ASN C 3 109 ? 71.896  49.904  141.354 1.00 10.00 ? 109 ASN C N   1 
ATOM 6865  C CA  . ASN C 3 109 ? 72.165  48.854  142.350 1.00 10.00 ? 109 ASN C CA  1 
ATOM 6866  C C   . ASN C 3 109 ? 73.590  48.354  142.229 1.00 10.00 ? 109 ASN C C   1 
ATOM 6867  O O   . ASN C 3 109 ? 74.056  48.063  141.135 1.00 10.00 ? 109 ASN C O   1 
ATOM 6868  C CB  . ASN C 3 109 ? 71.246  47.656  142.159 1.00 10.00 ? 109 ASN C CB  1 
ATOM 6869  C CG  . ASN C 3 109 ? 71.732  46.454  142.934 1.00 10.00 ? 109 ASN C CG  1 
ATOM 6870  O OD1 . ASN C 3 109 ? 72.897  46.090  142.825 1.00 10.00 ? 109 ASN C OD1 1 
ATOM 6871  N ND2 . ASN C 3 109 ? 70.856  45.837  143.733 1.00 10.00 ? 109 ASN C ND2 1 
ATOM 6872  N N   . VAL C 3 110 ? 74.274  48.270  143.362 1.00 10.00 ? 110 VAL C N   1 
ATOM 6873  C CA  . VAL C 3 110 ? 75.637  47.798  143.379 1.00 10.00 ? 110 VAL C CA  1 
ATOM 6874  C C   . VAL C 3 110 ? 75.766  46.500  144.203 1.00 10.00 ? 110 VAL C C   1 
ATOM 6875  O O   . VAL C 3 110 ? 74.874  46.157  144.969 1.00 10.00 ? 110 VAL C O   1 
ATOM 6876  C CB  . VAL C 3 110 ? 76.537  48.891  143.978 1.00 10.00 ? 110 VAL C CB  1 
ATOM 6877  C CG1 . VAL C 3 110 ? 77.984  48.463  143.957 1.00 10.00 ? 110 VAL C CG1 1 
ATOM 6878  C CG2 . VAL C 3 110 ? 76.324  50.194  143.233 1.00 10.00 ? 110 VAL C CG2 1 
ATOM 6879  N N   . LEU C 3 111 ? 76.897  45.809  144.055 1.00 10.00 ? 111 LEU C N   1 
ATOM 6880  C CA  . LEU C 3 111 ? 77.132  44.574  144.777 1.00 10.00 ? 111 LEU C CA  1 
ATOM 6881  C C   . LEU C 3 111 ? 78.138  44.761  145.921 1.00 10.00 ? 111 LEU C C   1 
ATOM 6882  O O   . LEU C 3 111 ? 79.240  45.228  145.722 1.00 10.00 ? 111 LEU C O   1 
ATOM 6883  C CB  . LEU C 3 111 ? 77.594  43.473  143.818 1.00 10.00 ? 111 LEU C CB  1 
ATOM 6884  C CG  . LEU C 3 111 ? 77.920  42.105  144.429 1.00 10.00 ? 111 LEU C CG  1 
ATOM 6885  C CD1 . LEU C 3 111 ? 76.770  41.629  145.308 1.00 10.00 ? 111 LEU C CD1 1 
ATOM 6886  C CD2 . LEU C 3 111 ? 78.197  41.106  143.315 1.00 10.00 ? 111 LEU C CD2 1 
ATOM 6887  N N   . VAL C 3 112 ? 77.682  44.395  147.117 1.00 10.00 ? 112 VAL C N   1 
ATOM 6888  C CA  . VAL C 3 112 ? 78.347  44.476  148.389 1.00 10.00 ? 112 VAL C CA  1 
ATOM 6889  C C   . VAL C 3 112 ? 79.172  43.255  148.756 1.00 10.00 ? 112 VAL C C   1 
ATOM 6890  O O   . VAL C 3 112 ? 78.542  42.335  149.210 1.00 10.00 ? 112 VAL C O   1 
ATOM 6891  C CB  . VAL C 3 112 ? 77.232  44.596  149.478 1.00 10.00 ? 112 VAL C CB  1 
ATOM 6892  C CG1 . VAL C 3 112 ? 77.828  44.977  150.829 1.00 10.00 ? 112 VAL C CG1 1 
ATOM 6893  C CG2 . VAL C 3 112 ? 76.147  45.578  149.012 1.00 10.00 ? 112 VAL C CG2 1 
ATOM 6894  N N   . ARG C 3 113 ? 80.515  43.232  148.647 1.00 10.00 ? 113 ARG C N   1 
ATOM 6895  C CA  . ARG C 3 113 ? 81.232  42.038  149.069 1.00 10.00 ? 113 ARG C CA  1 
ATOM 6896  C C   . ARG C 3 113 ? 81.230  42.079  150.619 1.00 10.00 ? 113 ARG C C   1 
ATOM 6897  O O   . ARG C 3 113 ? 80.756  43.054  151.206 1.00 10.00 ? 113 ARG C O   1 
ATOM 6898  C CB  . ARG C 3 113 ? 82.669  42.034  148.511 1.00 10.00 ? 113 ARG C CB  1 
ATOM 6899  C CG  . ARG C 3 113 ? 82.802  42.230  147.003 1.00 10.00 ? 113 ARG C CG  1 
ATOM 6900  C CD  . ARG C 3 113 ? 84.241  41.971  146.564 1.00 10.00 ? 113 ARG C CD  1 
ATOM 6901  N NE  . ARG C 3 113 ? 84.497  42.481  145.221 1.00 10.00 ? 113 ARG C NE  1 
ATOM 6902  C CZ  . ARG C 3 113 ? 85.685  42.462  144.628 1.00 10.00 ? 113 ARG C CZ  1 
ATOM 6903  N NH1 . ARG C 3 113 ? 86.736  41.951  145.263 1.00 10.00 ? 113 ARG C NH1 1 
ATOM 6904  N NH2 . ARG C 3 113 ? 85.822  42.971  143.409 1.00 10.00 ? 113 ARG C NH2 1 
ATOM 6905  N N   . PRO C 3 114 ? 81.825  41.069  151.286 1.00 10.00 ? 114 PRO C N   1 
ATOM 6906  C CA  . PRO C 3 114 ? 81.866  40.998  152.748 1.00 10.00 ? 114 PRO C CA  1 
ATOM 6907  C C   . PRO C 3 114 ? 82.948  41.809  153.430 1.00 10.00 ? 114 PRO C C   1 
ATOM 6908  O O   . PRO C 3 114 ? 82.757  42.324  154.525 1.00 10.00 ? 114 PRO C O   1 
ATOM 6909  C CB  . PRO C 3 114 ? 82.110  39.541  152.985 1.00 10.00 ? 114 PRO C CB  1 
ATOM 6910  C CG  . PRO C 3 114 ? 83.212  39.308  151.989 1.00 10.00 ? 114 PRO C CG  1 
ATOM 6911  C CD  . PRO C 3 114 ? 82.590  39.935  150.731 1.00 10.00 ? 114 PRO C CD  1 
ATOM 6912  N N   . ASN C 3 115 ? 84.117  41.879  152.823 1.00 10.00 ? 115 ASN C N   1 
ATOM 6913  C CA  . ASN C 3 115 ? 85.166  42.631  153.466 1.00 10.00 ? 115 ASN C CA  1 
ATOM 6914  C C   . ASN C 3 115 ? 85.354  43.950  152.727 1.00 10.00 ? 115 ASN C C   1 
ATOM 6915  O O   . ASN C 3 115 ? 86.379  44.186  152.106 1.00 10.00 ? 115 ASN C O   1 
ATOM 6916  C CB  . ASN C 3 115 ? 86.452  41.808  153.487 1.00 10.00 ? 115 ASN C CB  1 
ATOM 6917  C CG  . ASN C 3 115 ? 86.912  41.499  152.148 1.00 10.00 ? 115 ASN C CG  1 
ATOM 6918  O OD1 . ASN C 3 115 ? 88.103  41.306  151.904 1.00 10.00 ? 115 ASN C OD1 1 
ATOM 6919  N ND2 . ASN C 3 115 ? 85.964  41.448  151.226 1.00 10.00 ? 115 ASN C ND2 1 
ATOM 6920  N N   . GLY C 3 116 ? 84.325  44.791  152.766 1.00 10.00 ? 116 GLY C N   1 
ATOM 6921  C CA  . GLY C 3 116 ? 84.398  46.096  152.139 1.00 10.00 ? 116 GLY C CA  1 
ATOM 6922  C C   . GLY C 3 116 ? 84.458  46.189  150.619 1.00 10.00 ? 116 GLY C C   1 
ATOM 6923  O O   . GLY C 3 116 ? 83.883  47.116  150.046 1.00 10.00 ? 116 GLY C O   1 
ATOM 6924  N N   . TYR C 3 117 ? 85.135  45.250  149.953 1.00 10.00 ? 117 TYR C N   1 
ATOM 6925  C CA  . TYR C 3 117 ? 85.242  45.301  148.478 1.00 10.00 ? 117 TYR C CA  1 
ATOM 6926  C C   . TYR C 3 117 ? 83.835  45.447  147.898 1.00 10.00 ? 117 TYR C C   1 
ATOM 6927  O O   . TYR C 3 117 ? 82.899  44.732  148.281 1.00 10.00 ? 117 TYR C O   1 
ATOM 6928  C CB  . TYR C 3 117 ? 85.949  44.041  147.851 1.00 10.00 ? 117 TYR C CB  1 
ATOM 6929  C CG  . TYR C 3 117 ? 87.421  44.249  147.436 1.00 10.00 ? 117 TYR C CG  1 
ATOM 6930  C CD1 . TYR C 3 117 ? 88.460  44.004  148.330 1.00 10.00 ? 117 TYR C CD1 1 
ATOM 6931  C CD2 . TYR C 3 117 ? 87.755  44.833  146.209 1.00 10.00 ? 117 TYR C CD2 1 
ATOM 6932  C CE1 . TYR C 3 117 ? 89.781  44.346  148.032 1.00 10.00 ? 117 TYR C CE1 1 
ATOM 6933  C CE2 . TYR C 3 117 ? 89.079  45.190  145.900 1.00 10.00 ? 117 TYR C CE2 1 
ATOM 6934  C CZ  . TYR C 3 117 ? 90.086  44.946  146.824 1.00 10.00 ? 117 TYR C CZ  1 
ATOM 6935  O OH  . TYR C 3 117 ? 91.388  45.337  146.575 1.00 10.00 ? 117 TYR C OH  1 
ATOM 6936  N N   . VAL C 3 118 ? 83.652  46.409  147.008 1.00 10.00 ? 118 VAL C N   1 
ATOM 6937  C CA  . VAL C 3 118 ? 82.318  46.541  146.423 1.00 10.00 ? 118 VAL C CA  1 
ATOM 6938  C C   . VAL C 3 118 ? 82.406  46.444  144.895 1.00 10.00 ? 118 VAL C C   1 
ATOM 6939  O O   . VAL C 3 118 ? 83.469  46.606  144.281 1.00 10.00 ? 118 VAL C O   1 
ATOM 6940  C CB  . VAL C 3 118 ? 81.520  47.823  146.964 1.00 10.00 ? 118 VAL C CB  1 
ATOM 6941  C CG1 . VAL C 3 118 ? 80.186  47.990  146.299 1.00 10.00 ? 118 VAL C CG1 1 
ATOM 6942  C CG2 . VAL C 3 118 ? 81.161  47.621  148.398 1.00 10.00 ? 118 VAL C CG2 1 
ATOM 6943  N N   . THR C 3 119 ? 81.264  46.144  144.292 1.00 10.00 ? 119 THR C N   1 
ATOM 6944  C CA  . THR C 3 119 ? 81.160  45.912  142.861 1.00 10.00 ? 119 THR C CA  1 
ATOM 6945  C C   . THR C 3 119 ? 79.954  46.578  142.196 1.00 10.00 ? 119 THR C C   1 
ATOM 6946  O O   . THR C 3 119 ? 78.828  46.128  142.375 1.00 10.00 ? 119 THR C O   1 
ATOM 6947  C CB  . THR C 3 119 ? 81.044  44.413  142.652 1.00 10.00 ? 119 THR C CB  1 
ATOM 6948  O OG1 . THR C 3 119 ? 80.098  43.912  143.595 1.00 10.00 ? 119 THR C OG1 1 
ATOM 6949  C CG2 . THR C 3 119 ? 82.382  43.727  142.893 1.00 10.00 ? 119 THR C CG2 1 
ATOM 6950  N N   . TRP C 3 120 ? 80.174  47.626  141.410 1.00 10.00 ? 120 TRP C N   1 
ATOM 6951  C CA  . TRP C 3 120 ? 79.046  48.270  140.752 1.00 10.00 ? 120 TRP C CA  1 
ATOM 6952  C C   . TRP C 3 120 ? 79.311  48.236  139.231 1.00 10.00 ? 120 TRP C C   1 
ATOM 6953  O O   . TRP C 3 120 ? 80.363  48.656  138.735 1.00 10.00 ? 120 TRP C O   1 
ATOM 6954  C CB  . TRP C 3 120 ? 78.850  49.666  141.362 1.00 10.00 ? 120 TRP C CB  1 
ATOM 6955  C CG  . TRP C 3 120 ? 78.105  50.672  140.550 1.00 10.00 ? 120 TRP C CG  1 
ATOM 6956  C CD1 . TRP C 3 120 ? 76.926  50.507  139.880 1.00 10.00 ? 120 TRP C CD1 1 
ATOM 6957  C CD2 . TRP C 3 120 ? 78.560  51.997  140.253 1.00 10.00 ? 120 TRP C CD2 1 
ATOM 6958  N NE1 . TRP C 3 120 ? 76.628  51.645  139.165 1.00 10.00 ? 120 TRP C NE1 1 
ATOM 6959  C CE2 . TRP C 3 120 ? 77.619  52.571  139.376 1.00 10.00 ? 120 TRP C CE2 1 
ATOM 6960  C CE3 . TRP C 3 120 ? 79.688  52.759  140.648 1.00 10.00 ? 120 TRP C CE3 1 
ATOM 6961  C CZ2 . TRP C 3 120 ? 77.772  53.875  138.877 1.00 10.00 ? 120 TRP C CZ2 1 
ATOM 6962  C CZ3 . TRP C 3 120 ? 79.840  54.040  140.161 1.00 10.00 ? 120 TRP C CZ3 1 
ATOM 6963  C CH2 . TRP C 3 120 ? 78.890  54.587  139.283 1.00 10.00 ? 120 TRP C CH2 1 
ATOM 6964  N N   . LEU C 3 121 ? 78.360  47.670  138.483 1.00 10.00 ? 121 LEU C N   1 
ATOM 6965  C CA  . LEU C 3 121 ? 78.548  47.517  137.039 1.00 10.00 ? 121 LEU C CA  1 
ATOM 6966  C C   . LEU C 3 121 ? 77.321  47.592  136.120 1.00 10.00 ? 121 LEU C C   1 
ATOM 6967  O O   . LEU C 3 121 ? 77.014  46.641  135.394 1.00 10.00 ? 121 LEU C O   1 
ATOM 6968  C CB  . LEU C 3 121 ? 79.274  46.189  136.780 1.00 10.00 ? 121 LEU C CB  1 
ATOM 6969  C CG  . LEU C 3 121 ? 78.479  44.886  136.970 1.00 10.00 ? 121 LEU C CG  1 
ATOM 6970  C CD1 . LEU C 3 121 ? 78.623  44.031  135.722 1.00 10.00 ? 121 LEU C CD1 1 
ATOM 6971  C CD2 . LEU C 3 121 ? 78.970  44.111  138.189 1.00 10.00 ? 121 LEU C CD2 1 
ATOM 6972  N N   . PRO C 3 122 ? 76.609  48.725  136.107 1.00 10.00 ? 122 PRO C N   1 
ATOM 6973  C CA  . PRO C 3 122 ? 75.477  48.647  135.182 1.00 10.00 ? 122 PRO C CA  1 
ATOM 6974  C C   . PRO C 3 122 ? 75.808  49.154  133.755 1.00 10.00 ? 122 PRO C C   1 
ATOM 6975  O O   . PRO C 3 122 ? 76.902  49.716  133.479 1.00 10.00 ? 122 PRO C O   1 
ATOM 6976  C CB  . PRO C 3 122 ? 74.402  49.456  135.897 1.00 10.00 ? 122 PRO C CB  1 
ATOM 6977  C CG  . PRO C 3 122 ? 75.212  50.592  136.463 1.00 10.00 ? 122 PRO C CG  1 
ATOM 6978  C CD  . PRO C 3 122 ? 76.615  50.025  136.806 1.00 10.00 ? 122 PRO C CD  1 
ATOM 6979  N N   . PRO C 3 123 ? 74.833  48.989  132.839 1.00 10.00 ? 123 PRO C N   1 
ATOM 6980  C CA  . PRO C 3 123 ? 74.701  49.290  131.391 1.00 10.00 ? 123 PRO C CA  1 
ATOM 6981  C C   . PRO C 3 123 ? 74.848  50.735  131.003 1.00 10.00 ? 123 PRO C C   1 
ATOM 6982  O O   . PRO C 3 123 ? 74.238  51.547  131.649 1.00 10.00 ? 123 PRO C O   1 
ATOM 6983  C CB  . PRO C 3 123 ? 73.288  48.812  131.063 1.00 10.00 ? 123 PRO C CB  1 
ATOM 6984  C CG  . PRO C 3 123 ? 72.561  49.126  132.253 1.00 10.00 ? 123 PRO C CG  1 
ATOM 6985  C CD  . PRO C 3 123 ? 73.501  48.565  133.325 1.00 10.00 ? 123 PRO C CD  1 
ATOM 6986  N N   . ALA C 3 124 ? 75.624  51.062  129.966 1.00 10.00 ? 124 ALA C N   1 
ATOM 6987  C CA  . ALA C 3 124 ? 75.775  52.458  129.597 1.00 10.00 ? 124 ALA C CA  1 
ATOM 6988  C C   . ALA C 3 124 ? 75.445  52.791  128.135 1.00 10.00 ? 124 ALA C C   1 
ATOM 6989  O O   . ALA C 3 124 ? 76.211  52.449  127.246 1.00 10.00 ? 124 ALA C O   1 
ATOM 6990  C CB  . ALA C 3 124 ? 77.200  52.910  129.932 1.00 10.00 ? 124 ALA C CB  1 
ATOM 6991  N N   . ILE C 3 125 ? 74.293  53.427  127.895 1.00 10.00 ? 125 ILE C N   1 
ATOM 6992  C CA  . ILE C 3 125 ? 73.882  53.880  126.538 1.00 10.00 ? 125 ILE C CA  1 
ATOM 6993  C C   . ILE C 3 125 ? 74.643  55.186  126.417 1.00 10.00 ? 125 ILE C C   1 
ATOM 6994  O O   . ILE C 3 125 ? 74.323  56.145  127.135 1.00 10.00 ? 125 ILE C O   1 
ATOM 6995  C CB  . ILE C 3 125 ? 72.370  54.229  126.480 1.00 10.00 ? 125 ILE C CB  1 
ATOM 6996  C CG1 . ILE C 3 125 ? 71.538  53.002  126.137 1.00 10.00 ? 125 ILE C CG1 1 
ATOM 6997  C CG2 . ILE C 3 125 ? 72.136  55.321  125.518 1.00 10.00 ? 125 ILE C CG2 1 
ATOM 6998  C CD1 . ILE C 3 125 ? 70.192  52.931  126.860 1.00 10.00 ? 125 ILE C CD1 1 
ATOM 6999  N N   . PHE C 3 126 ? 75.679  55.239  125.599 1.00 10.00 ? 126 PHE C N   1 
ATOM 7000  C CA  . PHE C 3 126 ? 76.383  56.487  125.495 1.00 10.00 ? 126 PHE C CA  1 
ATOM 7001  C C   . PHE C 3 126 ? 76.667  56.985  124.081 1.00 10.00 ? 126 PHE C C   1 
ATOM 7002  O O   . PHE C 3 126 ? 76.584  56.232  123.117 1.00 10.00 ? 126 PHE C O   1 
ATOM 7003  C CB  . PHE C 3 126 ? 77.657  56.310  126.231 1.00 10.00 ? 126 PHE C CB  1 
ATOM 7004  C CG  . PHE C 3 126 ? 78.466  55.252  125.681 1.00 10.00 ? 126 PHE C CG  1 
ATOM 7005  C CD1 . PHE C 3 126 ? 79.194  55.459  124.522 1.00 10.00 ? 126 PHE C CD1 1 
ATOM 7006  C CD2 . PHE C 3 126 ? 78.518  54.038  126.305 1.00 10.00 ? 126 PHE C CD2 1 
ATOM 7007  C CE1 . PHE C 3 126 ? 79.975  54.460  123.993 1.00 10.00 ? 126 PHE C CE1 1 
ATOM 7008  C CE2 . PHE C 3 126 ? 79.302  53.018  125.780 1.00 10.00 ? 126 PHE C CE2 1 
ATOM 7009  C CZ  . PHE C 3 126 ? 80.036  53.228  124.620 1.00 10.00 ? 126 PHE C CZ  1 
ATOM 7010  N N   . ARG C 3 127 ? 77.052  58.257  123.979 1.00 10.00 ? 127 ARG C N   1 
ATOM 7011  C CA  . ARG C 3 127 ? 77.364  58.915  122.697 1.00 10.00 ? 127 ARG C CA  1 
ATOM 7012  C C   . ARG C 3 127 ? 78.799  59.392  122.803 1.00 10.00 ? 127 ARG C C   1 
ATOM 7013  O O   . ARG C 3 127 ? 79.179  59.934  123.829 1.00 10.00 ? 127 ARG C O   1 
ATOM 7014  C CB  . ARG C 3 127 ? 76.429  60.121  122.426 1.00 10.00 ? 127 ARG C CB  1 
ATOM 7015  C CG  . ARG C 3 127 ? 76.391  60.588  120.932 1.00 10.00 ? 127 ARG C CG  1 
ATOM 7016  C CD  . ARG C 3 127 ? 75.278  61.582  120.718 1.00 10.00 ? 127 ARG C CD  1 
ATOM 7017  N NE  . ARG C 3 127 ? 74.607  61.431  119.437 1.00 10.00 ? 127 ARG C NE  1 
ATOM 7018  C CZ  . ARG C 3 127 ? 73.341  61.792  119.231 1.00 10.00 ? 127 ARG C CZ  1 
ATOM 7019  N NH1 . ARG C 3 127 ? 72.643  62.314  120.233 1.00 10.00 ? 127 ARG C NH1 1 
ATOM 7020  N NH2 . ARG C 3 127 ? 72.773  61.641  118.032 1.00 10.00 ? 127 ARG C NH2 1 
ATOM 7021  N N   . SER C 3 128 ? 79.573  59.202  121.739 1.00 10.00 ? 128 SER C N   1 
ATOM 7022  C CA  . SER C 3 128 ? 80.975  59.589  121.748 1.00 10.00 ? 128 SER C CA  1 
ATOM 7023  C C   . SER C 3 128 ? 81.461  60.306  120.490 1.00 10.00 ? 128 SER C C   1 
ATOM 7024  O O   . SER C 3 128 ? 80.853  60.195  119.428 1.00 10.00 ? 128 SER C O   1 
ATOM 7025  C CB  . SER C 3 128 ? 81.814  58.336  121.963 1.00 10.00 ? 128 SER C CB  1 
ATOM 7026  O OG  . SER C 3 128 ? 81.344  57.271  121.156 1.00 10.00 ? 128 SER C OG  1 
ATOM 7027  N N   . SER C 3 129 ? 82.557  61.051  120.617 1.00 10.00 ? 129 SER C N   1 
ATOM 7028  C CA  . SER C 3 129 ? 83.127  61.729  119.463 1.00 10.00 ? 129 SER C CA  1 
ATOM 7029  C C   . SER C 3 129 ? 84.522  61.164  119.237 1.00 10.00 ? 129 SER C C   1 
ATOM 7030  O O   . SER C 3 129 ? 85.543  61.836  119.398 1.00 10.00 ? 129 SER C O   1 
ATOM 7031  C CB  . SER C 3 129 ? 83.194  63.242  119.651 1.00 10.00 ? 129 SER C CB  1 
ATOM 7032  O OG  . SER C 3 129 ? 83.973  63.790  118.609 1.00 10.00 ? 129 SER C OG  1 
ATOM 7033  N N   . CYS C 3 130 ? 84.487  59.846  118.745 1.00 10.00 ? 130 CYS C N   1 
ATOM 7034  C CA  . CYS C 3 130 ? 85.731  59.114  118.469 1.00 10.00 ? 130 CYS C CA  1 
ATOM 7035  C C   . CYS C 3 130 ? 86.515  59.581  117.233 1.00 10.00 ? 130 CYS C C   1 
ATOM 7036  O O   . CYS C 3 130 ? 85.957  60.204  116.329 1.00 10.00 ? 130 CYS C O   1 
ATOM 7037  C CB  . CYS C 3 130 ? 85.470  57.612  118.407 1.00 10.00 ? 130 CYS C CB  1 
ATOM 7038  S SG  . CYS C 3 130 ? 86.583  56.734  119.543 1.00 10.00 ? 130 CYS C SG  1 
ATOM 7039  N N   . PRO C 3 131 ? 87.964  59.614  117.327 1.00 10.00 ? 131 PRO C N   1 
ATOM 7040  C CA  . PRO C 3 131 ? 88.973  60.009  116.341 1.00 10.00 ? 131 PRO C CA  1 
ATOM 7041  C C   . PRO C 3 131 ? 88.743  59.640  114.889 1.00 10.00 ? 131 PRO C C   1 
ATOM 7042  O O   . PRO C 3 131 ? 89.637  59.104  114.237 1.00 10.00 ? 131 PRO C O   1 
ATOM 7043  C CB  . PRO C 3 131 ? 90.251  59.385  116.885 1.00 10.00 ? 131 PRO C CB  1 
ATOM 7044  C CG  . PRO C 3 131 ? 89.734  58.251  117.738 1.00 10.00 ? 131 PRO C CG  1 
ATOM 7045  C CD  . PRO C 3 131 ? 88.613  58.901  118.438 1.00 10.00 ? 131 PRO C CD  1 
ATOM 7046  N N   . ILE C 3 132 ? 87.557  59.946  114.379 1.00 10.00 ? 132 ILE C N   1 
ATOM 7047  C CA  . ILE C 3 132 ? 87.255  59.668  112.984 1.00 10.00 ? 132 ILE C CA  1 
ATOM 7048  C C   . ILE C 3 132 ? 88.207  60.469  112.112 1.00 10.00 ? 132 ILE C C   1 
ATOM 7049  O O   . ILE C 3 132 ? 89.058  59.906  111.431 1.00 10.00 ? 132 ILE C O   1 
ATOM 7050  C CB  . ILE C 3 132 ? 85.788  60.045  112.632 1.00 10.00 ? 132 ILE C CB  1 
ATOM 7051  C CG1 . ILE C 3 132 ? 84.879  58.877  113.016 1.00 10.00 ? 132 ILE C CG1 1 
ATOM 7052  C CG2 . ILE C 3 132 ? 85.657  60.456  111.150 1.00 10.00 ? 132 ILE C CG2 1 
ATOM 7053  C CD1 . ILE C 3 132 ? 84.817  58.552  114.482 1.00 10.00 ? 132 ILE C CD1 1 
ATOM 7054  N N   . ASN C 3 133 ? 88.084  61.791  112.156 1.00 10.00 ? 133 ASN C N   1 
ATOM 7055  C CA  . ASN C 3 133 ? 88.932  62.645  111.331 1.00 10.00 ? 133 ASN C CA  1 
ATOM 7056  C C   . ASN C 3 133 ? 88.667  62.237  109.885 1.00 10.00 ? 133 ASN C C   1 
ATOM 7057  O O   . ASN C 3 133 ? 87.934  61.279  109.639 1.00 10.00 ? 133 ASN C O   1 
ATOM 7058  C CB  . ASN C 3 133 ? 90.410  62.468  111.713 1.00 10.00 ? 133 ASN C CB  1 
ATOM 7059  C CG  . ASN C 3 133 ? 90.731  63.077  113.084 1.00 10.00 ? 133 ASN C CG  1 
ATOM 7060  O OD1 . ASN C 3 133 ? 89.871  63.126  113.968 1.00 10.00 ? 133 ASN C OD1 1 
ATOM 7061  N ND2 . ASN C 3 133 ? 91.970  63.531  113.266 1.00 10.00 ? 133 ASN C ND2 1 
ATOM 7062  N N   . VAL C 3 134 ? 89.210  62.971  108.929 1.00 10.00 ? 134 VAL C N   1 
ATOM 7063  C CA  . VAL C 3 134 ? 88.982  62.610  107.544 1.00 10.00 ? 134 VAL C CA  1 
ATOM 7064  C C   . VAL C 3 134 ? 89.941  61.489  107.148 1.00 10.00 ? 134 VAL C C   1 
ATOM 7065  O O   . VAL C 3 134 ? 90.116  61.195  105.968 1.00 10.00 ? 134 VAL C O   1 
ATOM 7066  C CB  . VAL C 3 134 ? 89.168  63.820  106.625 1.00 10.00 ? 134 VAL C CB  1 
ATOM 7067  C CG1 . VAL C 3 134 ? 88.671  63.483  105.226 1.00 10.00 ? 134 VAL C CG1 1 
ATOM 7068  C CG2 . VAL C 3 134 ? 88.400  65.020  107.184 1.00 10.00 ? 134 VAL C CG2 1 
ATOM 7069  N N   . LEU C 3 135 ? 90.546  60.867  108.160 1.00 10.00 ? 135 LEU C N   1 
ATOM 7070  C CA  . LEU C 3 135 ? 91.491  59.755  107.981 1.00 10.00 ? 135 LEU C CA  1 
ATOM 7071  C C   . LEU C 3 135 ? 90.923  58.438  108.500 1.00 10.00 ? 135 LEU C C   1 
ATOM 7072  O O   . LEU C 3 135 ? 91.633  57.440  108.580 1.00 10.00 ? 135 LEU C O   1 
ATOM 7073  C CB  . LEU C 3 135 ? 92.808  60.028  108.719 1.00 10.00 ? 135 LEU C CB  1 
ATOM 7074  C CG  . LEU C 3 135 ? 93.724  61.106  108.140 1.00 10.00 ? 135 LEU C CG  1 
ATOM 7075  C CD1 . LEU C 3 135 ? 94.189  60.691  106.739 1.00 10.00 ? 135 LEU C CD1 1 
ATOM 7076  C CD2 . LEU C 3 135 ? 92.973  62.442  108.115 1.00 10.00 ? 135 LEU C CD2 1 
ATOM 7077  N N   . TYR C 3 136 ? 89.646  58.459  108.864 1.00 10.00 ? 136 TYR C N   1 
ATOM 7078  C CA  . TYR C 3 136 ? 88.928  57.299  109.385 1.00 10.00 ? 136 TYR C CA  1 
ATOM 7079  C C   . TYR C 3 136 ? 88.235  56.700  108.176 1.00 10.00 ? 136 TYR C C   1 
ATOM 7080  O O   . TYR C 3 136 ? 87.242  55.975  108.296 1.00 10.00 ? 136 TYR C O   1 
ATOM 7081  C CB  . TYR C 3 136 ? 87.914  57.757  110.444 1.00 10.00 ? 136 TYR C CB  1 
ATOM 7082  C CG  . TYR C 3 136 ? 87.299  56.723  111.355 1.00 10.00 ? 136 TYR C CG  1 
ATOM 7083  C CD1 . TYR C 3 136 ? 88.004  56.217  112.438 1.00 10.00 ? 136 TYR C CD1 1 
ATOM 7084  C CD2 . TYR C 3 136 ? 85.949  56.373  111.220 1.00 10.00 ? 136 TYR C CD2 1 
ATOM 7085  C CE1 . TYR C 3 136 ? 87.374  55.399  113.385 1.00 10.00 ? 136 TYR C CE1 1 
ATOM 7086  C CE2 . TYR C 3 136 ? 85.306  55.564  112.154 1.00 10.00 ? 136 TYR C CE2 1 
ATOM 7087  C CZ  . TYR C 3 136 ? 86.019  55.085  113.240 1.00 10.00 ? 136 TYR C CZ  1 
ATOM 7088  O OH  . TYR C 3 136 ? 85.387  54.329  114.204 1.00 10.00 ? 136 TYR C OH  1 
ATOM 7089  N N   . PHE C 3 137 ? 88.775  57.007  107.002 1.00 10.00 ? 137 PHE C N   1 
ATOM 7090  C CA  . PHE C 3 137 ? 88.236  56.457  105.780 1.00 10.00 ? 137 PHE C CA  1 
ATOM 7091  C C   . PHE C 3 137 ? 89.244  55.693  104.933 1.00 10.00 ? 137 PHE C C   1 
ATOM 7092  O O   . PHE C 3 137 ? 88.865  54.738  104.262 1.00 10.00 ? 137 PHE C O   1 
ATOM 7093  C CB  . PHE C 3 137 ? 87.504  57.533  104.993 1.00 10.00 ? 137 PHE C CB  1 
ATOM 7094  C CG  . PHE C 3 137 ? 87.227  57.125  103.586 1.00 10.00 ? 137 PHE C CG  1 
ATOM 7095  C CD1 . PHE C 3 137 ? 85.948  56.739  103.216 1.00 10.00 ? 137 PHE C CD1 1 
ATOM 7096  C CD2 . PHE C 3 137 ? 88.236  57.111  102.628 1.00 10.00 ? 137 PHE C CD2 1 
ATOM 7097  C CE1 . PHE C 3 137 ? 85.675  56.345  101.914 1.00 10.00 ? 137 PHE C CE1 1 
ATOM 7098  C CE2 . PHE C 3 137 ? 87.971  56.721  101.317 1.00 10.00 ? 137 PHE C CE2 1 
ATOM 7099  C CZ  . PHE C 3 137 ? 86.690  56.337  100.965 1.00 10.00 ? 137 PHE C CZ  1 
ATOM 7100  N N   . PRO C 3 138 ? 90.522  56.123  104.916 1.00 10.00 ? 138 PRO C N   1 
ATOM 7101  C CA  . PRO C 3 138 ? 91.474  55.278  104.179 1.00 10.00 ? 138 PRO C CA  1 
ATOM 7102  C C   . PRO C 3 138 ? 91.281  53.860  104.696 1.00 10.00 ? 138 PRO C C   1 
ATOM 7103  O O   . PRO C 3 138 ? 90.648  53.662  105.730 1.00 10.00 ? 138 PRO C O   1 
ATOM 7104  C CB  . PRO C 3 138 ? 92.823  55.879  104.559 1.00 10.00 ? 138 PRO C CB  1 
ATOM 7105  C CG  . PRO C 3 138 ? 92.500  57.342  104.650 1.00 10.00 ? 138 PRO C CG  1 
ATOM 7106  C CD  . PRO C 3 138 ? 91.195  57.333  105.431 1.00 10.00 ? 138 PRO C CD  1 
ATOM 7107  N N   . PHE C 3 139 ? 91.857  52.860  104.066 1.00 10.00 ? 139 PHE C N   1 
ATOM 7108  C CA  . PHE C 3 139 ? 91.578  51.473  104.414 1.00 10.00 ? 139 PHE C CA  1 
ATOM 7109  C C   . PHE C 3 139 ? 91.932  51.201  105.867 1.00 10.00 ? 139 PHE C C   1 
ATOM 7110  O O   . PHE C 3 139 ? 91.250  50.297  106.454 1.00 10.00 ? 139 PHE C O   1 
ATOM 7111  C CB  . PHE C 3 139 ? 92.347  50.526  103.494 1.00 10.00 ? 139 PHE C CB  1 
ATOM 7112  C CG  . PHE C 3 139 ? 91.987  50.670  102.047 1.00 10.00 ? 139 PHE C CG  1 
ATOM 7113  C CD1 . PHE C 3 139 ? 92.680  51.551  101.234 1.00 10.00 ? 139 PHE C CD1 1 
ATOM 7114  C CD2 . PHE C 3 139 ? 90.956  49.927  101.504 1.00 10.00 ? 139 PHE C CD2 1 
ATOM 7115  C CE1 . PHE C 3 139 ? 92.349  51.687  99.899  1.00 10.00 ? 139 PHE C CE1 1 
ATOM 7116  C CE2 . PHE C 3 139 ? 90.619  50.058  100.170 1.00 10.00 ? 139 PHE C CE2 1 
ATOM 7117  C CZ  . PHE C 3 139 ? 91.317  50.938  99.366  1.00 10.00 ? 139 PHE C CZ  1 
ATOM 7118  N N   . ASP C 3 140 ? 92.761  51.850  106.537 1.00 10.00 ? 140 ASP C N   1 
ATOM 7119  C CA  . ASP C 3 140 ? 93.135  51.432  107.880 1.00 10.00 ? 140 ASP C CA  1 
ATOM 7120  C C   . ASP C 3 140 ? 91.935  51.796  108.739 1.00 10.00 ? 140 ASP C C   1 
ATOM 7121  O O   . ASP C 3 140 ? 91.650  51.142  109.738 1.00 10.00 ? 140 ASP C O   1 
ATOM 7122  C CB  . ASP C 3 140 ? 94.371  52.197  108.357 1.00 10.00 ? 140 ASP C CB  1 
ATOM 7123  C CG  . ASP C 3 140 ? 94.407  53.627  107.846 1.00 10.00 ? 140 ASP C CG  1 
ATOM 7124  O OD1 . ASP C 3 140 ? 94.083  53.844  106.659 1.00 10.00 ? 140 ASP C OD1 1 
ATOM 7125  O OD2 . ASP C 3 140 ? 94.758  54.534  108.629 1.00 10.00 ? 140 ASP C OD2 1 
ATOM 7126  N N   . TRP C 3 141 ? 91.241  52.860  108.330 1.00 10.00 ? 141 TRP C N   1 
ATOM 7127  C CA  . TRP C 3 141 ? 90.067  53.326  109.034 1.00 10.00 ? 141 TRP C CA  1 
ATOM 7128  C C   . TRP C 3 141 ? 90.394  53.658  110.466 1.00 10.00 ? 141 TRP C C   1 
ATOM 7129  O O   . TRP C 3 141 ? 89.648  53.338  111.385 1.00 10.00 ? 141 TRP C O   1 
ATOM 7130  C CB  . TRP C 3 141 ? 88.946  52.291  108.945 1.00 10.00 ? 141 TRP C CB  1 
ATOM 7131  C CG  . TRP C 3 141 ? 88.147  52.480  107.716 1.00 10.00 ? 141 TRP C CG  1 
ATOM 7132  C CD1 . TRP C 3 141 ? 88.564  52.309  106.423 1.00 10.00 ? 141 TRP C CD1 1 
ATOM 7133  C CD2 . TRP C 3 141 ? 86.792  52.917  107.648 1.00 10.00 ? 141 TRP C CD2 1 
ATOM 7134  N NE1 . TRP C 3 141 ? 87.546  52.608  105.554 1.00 10.00 ? 141 TRP C NE1 1 
ATOM 7135  C CE2 . TRP C 3 141 ? 86.444  52.985  106.279 1.00 10.00 ? 141 TRP C CE2 1 
ATOM 7136  C CE3 . TRP C 3 141 ? 85.838  53.264  108.607 1.00 10.00 ? 141 TRP C CE3 1 
ATOM 7137  C CZ2 . TRP C 3 141 ? 85.168  53.381  105.849 1.00 10.00 ? 141 TRP C CZ2 1 
ATOM 7138  C CZ3 . TRP C 3 141 ? 84.578  53.659  108.180 1.00 10.00 ? 141 TRP C CZ3 1 
ATOM 7139  C CH2 . TRP C 3 141 ? 84.255  53.711  106.811 1.00 10.00 ? 141 TRP C CH2 1 
ATOM 7140  N N   . GLN C 3 142 ? 91.525  54.271  110.672 1.00 10.00 ? 142 GLN C N   1 
ATOM 7141  C CA  . GLN C 3 142 ? 92.032  54.807  111.929 1.00 10.00 ? 142 GLN C CA  1 
ATOM 7142  C C   . GLN C 3 142 ? 91.839  53.812  113.067 1.00 10.00 ? 142 GLN C C   1 
ATOM 7143  O O   . GLN C 3 142 ? 91.647  52.614  113.029 1.00 10.00 ? 142 GLN C O   1 
ATOM 7144  C CB  . GLN C 3 142 ? 91.350  56.135  112.259 1.00 10.00 ? 142 GLN C CB  1 
ATOM 7145  C CG  . GLN C 3 142 ? 91.978  56.882  113.425 1.00 10.00 ? 142 GLN C CG  1 
ATOM 7146  C CD  . GLN C 3 142 ? 93.338  57.457  113.083 1.00 10.00 ? 142 GLN C CD  1 
ATOM 7147  O OE1 . GLN C 3 142 ? 93.822  57.306  111.961 1.00 10.00 ? 142 GLN C OE1 1 
ATOM 7148  N NE2 . GLN C 3 142 ? 94.128  58.150  113.896 1.00 10.00 ? 142 GLN C NE2 1 
ATOM 7149  N N   . ASN C 3 143 ? 91.980  54.488  114.253 1.00 10.00 ? 143 ASN C N   1 
ATOM 7150  C CA  . ASN C 3 143 ? 91.922  53.908  115.577 1.00 10.00 ? 143 ASN C CA  1 
ATOM 7151  C C   . ASN C 3 143 ? 91.147  54.804  116.521 1.00 10.00 ? 143 ASN C C   1 
ATOM 7152  O O   . ASN C 3 143 ? 91.625  55.880  116.859 1.00 10.00 ? 143 ASN C O   1 
ATOM 7153  C CB  . ASN C 3 143 ? 93.328  53.582  116.066 1.00 10.00 ? 143 ASN C CB  1 
ATOM 7154  C CG  . ASN C 3 143 ? 94.072  52.713  115.070 1.00 10.00 ? 143 ASN C CG  1 
ATOM 7155  O OD1 . ASN C 3 143 ? 93.498  51.788  114.489 1.00 10.00 ? 143 ASN C OD1 1 
ATOM 7156  N ND2 . ASN C 3 143 ? 95.349  53.006  114.863 1.00 10.00 ? 143 ASN C ND2 1 
ATOM 7157  N N   . CYS C 3 144 ? 89.956  54.378  116.905 1.00 10.00 ? 144 CYS C N   1 
ATOM 7158  C CA  . CYS C 3 144 ? 89.087  55.146  117.806 1.00 10.00 ? 144 CYS C CA  1 
ATOM 7159  C C   . CYS C 3 144 ? 89.554  55.028  119.264 1.00 10.00 ? 144 CYS C C   1 
ATOM 7160  O O   . CYS C 3 144 ? 89.481  53.958  119.863 1.00 10.00 ? 144 CYS C O   1 
ATOM 7161  C CB  . CYS C 3 144 ? 87.631  54.665  117.625 1.00 10.00 ? 144 CYS C CB  1 
ATOM 7162  S SG  . CYS C 3 144 ? 86.465  54.844  119.009 1.00 10.00 ? 144 CYS C SG  1 
ATOM 7163  N N   . SER C 3 145 ? 90.036  56.142  119.817 1.00 10.00 ? 145 SER C N   1 
ATOM 7164  C CA  . SER C 3 145 ? 90.562  56.206  121.178 1.00 10.00 ? 145 SER C CA  1 
ATOM 7165  C C   . SER C 3 145 ? 89.584  56.691  122.256 1.00 10.00 ? 145 SER C C   1 
ATOM 7166  O O   . SER C 3 145 ? 88.935  57.718  122.094 1.00 10.00 ? 145 SER C O   1 
ATOM 7167  C CB  . SER C 3 145 ? 91.825  57.093  121.197 1.00 10.00 ? 145 SER C CB  1 
ATOM 7168  O OG  . SER C 3 145 ? 91.546  58.456  120.912 1.00 10.00 ? 145 SER C OG  1 
ATOM 7169  N N   . LEU C 3 146 ? 89.505  55.945  123.371 1.00 10.00 ? 146 LEU C N   1 
ATOM 7170  C CA  . LEU C 3 146 ? 88.595  56.353  124.445 1.00 10.00 ? 146 LEU C CA  1 
ATOM 7171  C C   . LEU C 3 146 ? 89.191  56.076  125.828 1.00 10.00 ? 146 LEU C C   1 
ATOM 7172  O O   . LEU C 3 146 ? 89.765  55.029  126.097 1.00 10.00 ? 146 LEU C O   1 
ATOM 7173  C CB  . LEU C 3 146 ? 87.246  55.637  124.310 1.00 10.00 ? 146 LEU C CB  1 
ATOM 7174  C CG  . LEU C 3 146 ? 86.467  55.885  123.016 1.00 10.00 ? 146 LEU C CG  1 
ATOM 7175  C CD1 . LEU C 3 146 ? 87.189  55.268  121.827 1.00 10.00 ? 146 LEU C CD1 1 
ATOM 7176  C CD2 . LEU C 3 146 ? 85.054  55.334  123.127 1.00 10.00 ? 146 LEU C CD2 1 
ATOM 7177  N N   . LYS C 3 147 ? 88.964  57.028  126.744 1.00 10.00 ? 147 LYS C N   1 
ATOM 7178  C CA  . LYS C 3 147 ? 89.486  56.922  128.117 1.00 10.00 ? 147 LYS C CA  1 
ATOM 7179  C C   . LYS C 3 147 ? 88.354  56.982  129.154 1.00 10.00 ? 147 LYS C C   1 
ATOM 7180  O O   . LYS C 3 147 ? 87.477  57.851  129.085 1.00 10.00 ? 147 LYS C O   1 
ATOM 7181  C CB  . LYS C 3 147 ? 90.492  58.060  128.409 1.00 10.00 ? 147 LYS C CB  1 
ATOM 7182  C CG  . LYS C 3 147 ? 91.925  57.636  128.659 1.00 10.00 ? 147 LYS C CG  1 
ATOM 7183  C CD  . LYS C 3 147 ? 92.923  58.646  128.098 1.00 10.00 ? 147 LYS C CD  1 
ATOM 7184  C CE  . LYS C 3 147 ? 94.311  57.994  127.969 1.00 10.00 ? 147 LYS C CE  1 
ATOM 7185  N NZ  . LYS C 3 147 ? 94.988  57.609  129.243 1.00 10.00 ? 147 LYS C NZ  1 
ATOM 7186  N N   . PHE C 3 148 ? 88.358  56.048  130.099 1.00 10.00 ? 148 PHE C N   1 
ATOM 7187  C CA  . PHE C 3 148 ? 87.335  56.022  131.132 1.00 10.00 ? 148 PHE C CA  1 
ATOM 7188  C C   . PHE C 3 148 ? 87.973  56.152  132.525 1.00 10.00 ? 148 PHE C C   1 
ATOM 7189  O O   . PHE C 3 148 ? 89.088  55.682  132.747 1.00 10.00 ? 148 PHE C O   1 
ATOM 7190  C CB  . PHE C 3 148 ? 86.518  54.704  131.062 1.00 10.00 ? 148 PHE C CB  1 
ATOM 7191  C CG  . PHE C 3 148 ? 85.822  54.461  129.737 1.00 10.00 ? 148 PHE C CG  1 
ATOM 7192  C CD1 . PHE C 3 148 ? 84.512  54.004  129.709 1.00 10.00 ? 148 PHE C CD1 1 
ATOM 7193  C CD2 . PHE C 3 148 ? 86.509  54.597  128.529 1.00 10.00 ? 148 PHE C CD2 1 
ATOM 7194  C CE1 . PHE C 3 148 ? 83.905  53.678  128.513 1.00 10.00 ? 148 PHE C CE1 1 
ATOM 7195  C CE2 . PHE C 3 148 ? 85.915  54.277  127.328 1.00 10.00 ? 148 PHE C CE2 1 
ATOM 7196  C CZ  . PHE C 3 148 ? 84.609  53.812  127.319 1.00 10.00 ? 148 PHE C CZ  1 
ATOM 7197  N N   . THR C 3 149 ? 87.269  56.806  133.452 1.00 10.00 ? 149 THR C N   1 
ATOM 7198  C CA  . THR C 3 149 ? 87.749  56.959  134.827 1.00 10.00 ? 149 THR C CA  1 
ATOM 7199  C C   . THR C 3 149 ? 86.926  57.870  135.724 1.00 10.00 ? 149 THR C C   1 
ATOM 7200  O O   . THR C 3 149 ? 86.030  58.607  135.283 1.00 10.00 ? 149 THR C O   1 
ATOM 7201  C CB  . THR C 3 149 ? 89.241  57.421  134.889 1.00 10.00 ? 149 THR C CB  1 
ATOM 7202  O OG1 . THR C 3 149 ? 89.507  58.009  136.166 1.00 10.00 ? 149 THR C OG1 1 
ATOM 7203  C CG2 . THR C 3 149 ? 89.554  58.430  133.823 1.00 10.00 ? 149 THR C CG2 1 
ATOM 7204  N N   . ALA C 3 150 ? 87.235  57.779  137.012 1.00 10.00 ? 150 ALA C N   1 
ATOM 7205  C CA  . ALA C 3 150 ? 86.556  58.571  138.028 1.00 10.00 ? 150 ALA C CA  1 
ATOM 7206  C C   . ALA C 3 150 ? 87.039  60.006  137.995 1.00 10.00 ? 150 ALA C C   1 
ATOM 7207  O O   . ALA C 3 150 ? 88.058  60.361  138.582 1.00 10.00 ? 150 ALA C O   1 
ATOM 7208  C CB  . ALA C 3 150 ? 86.772  57.980  139.405 1.00 10.00 ? 150 ALA C CB  1 
ATOM 7209  N N   . LEU C 3 151 ? 86.252  60.794  137.280 1.00 10.00 ? 151 LEU C N   1 
ATOM 7210  C CA  . LEU C 3 151 ? 86.380  62.226  137.010 1.00 10.00 ? 151 LEU C CA  1 
ATOM 7211  C C   . LEU C 3 151 ? 86.827  63.144  138.182 1.00 10.00 ? 151 LEU C C   1 
ATOM 7212  O O   . LEU C 3 151 ? 87.834  63.870  138.106 1.00 10.00 ? 151 LEU C O   1 
ATOM 7213  C CB  . LEU C 3 151 ? 85.003  62.661  136.462 1.00 10.00 ? 151 LEU C CB  1 
ATOM 7214  C CG  . LEU C 3 151 ? 84.674  63.927  135.688 1.00 10.00 ? 151 LEU C CG  1 
ATOM 7215  C CD1 . LEU C 3 151 ? 85.524  63.986  134.442 1.00 10.00 ? 151 LEU C CD1 1 
ATOM 7216  C CD2 . LEU C 3 151 ? 83.181  63.934  135.354 1.00 10.00 ? 151 LEU C CD2 1 
ATOM 7217  N N   . ASN C 3 152 ? 86.071  63.083  139.271 1.00 10.00 ? 152 ASN C N   1 
ATOM 7218  C CA  . ASN C 3 152 ? 86.276  63.912  140.474 1.00 10.00 ? 152 ASN C CA  1 
ATOM 7219  C C   . ASN C 3 152 ? 87.573  63.731  141.274 1.00 10.00 ? 152 ASN C C   1 
ATOM 7220  O O   . ASN C 3 152 ? 88.257  64.703  141.598 1.00 10.00 ? 152 ASN C O   1 
ATOM 7221  C CB  . ASN C 3 152 ? 85.095  63.687  141.428 1.00 10.00 ? 152 ASN C CB  1 
ATOM 7222  C CG  . ASN C 3 152 ? 84.693  64.923  142.203 1.00 10.00 ? 152 ASN C CG  1 
ATOM 7223  O OD1 . ASN C 3 152 ? 84.694  64.932  143.432 1.00 10.00 ? 152 ASN C OD1 1 
ATOM 7224  N ND2 . ASN C 3 152 ? 84.320  65.962  141.486 1.00 10.00 ? 152 ASN C ND2 1 
ATOM 7225  N N   . TYR C 3 153 ? 87.902  62.488  141.606 1.00 10.00 ? 153 TYR C N   1 
ATOM 7226  C CA  . TYR C 3 153 ? 89.075  62.198  142.421 1.00 10.00 ? 153 TYR C CA  1 
ATOM 7227  C C   . TYR C 3 153 ? 90.427  62.242  141.696 1.00 10.00 ? 153 TYR C C   1 
ATOM 7228  O O   . TYR C 3 153 ? 90.510  61.968  140.491 1.00 10.00 ? 153 TYR C O   1 
ATOM 7229  C CB  . TYR C 3 153 ? 88.898  60.827  143.078 1.00 10.00 ? 153 TYR C CB  1 
ATOM 7230  C CG  . TYR C 3 153 ? 87.515  60.609  143.652 1.00 10.00 ? 153 TYR C CG  1 
ATOM 7231  C CD1 . TYR C 3 153 ? 86.438  60.283  142.825 1.00 10.00 ? 153 TYR C CD1 1 
ATOM 7232  C CD2 . TYR C 3 153 ? 87.274  60.758  145.015 1.00 10.00 ? 153 TYR C CD2 1 
ATOM 7233  C CE1 . TYR C 3 153 ? 85.159  60.115  143.340 1.00 10.00 ? 153 TYR C CE1 1 
ATOM 7234  C CE2 . TYR C 3 153 ? 85.998  60.592  145.538 1.00 10.00 ? 153 TYR C CE2 1 
ATOM 7235  C CZ  . TYR C 3 153 ? 84.946  60.272  144.695 1.00 10.00 ? 153 TYR C CZ  1 
ATOM 7236  O OH  . TYR C 3 153 ? 83.678  60.113  145.204 1.00 10.00 ? 153 TYR C OH  1 
ATOM 7237  N N   . ASN C 3 154 ? 91.494  62.566  142.429 1.00 10.00 ? 154 ASN C N   1 
ATOM 7238  C CA  . ASN C 3 154 ? 92.819  62.622  141.799 1.00 10.00 ? 154 ASN C CA  1 
ATOM 7239  C C   . ASN C 3 154 ? 93.704  61.413  142.133 1.00 10.00 ? 154 ASN C C   1 
ATOM 7240  O O   . ASN C 3 154 ? 93.184  60.370  142.501 1.00 10.00 ? 154 ASN C O   1 
ATOM 7241  C CB  . ASN C 3 154 ? 93.544  63.919  142.193 1.00 10.00 ? 154 ASN C CB  1 
ATOM 7242  C CG  . ASN C 3 154 ? 92.856  65.160  141.672 1.00 10.00 ? 154 ASN C CG  1 
ATOM 7243  O OD1 . ASN C 3 154 ? 92.454  65.234  140.505 1.00 10.00 ? 154 ASN C OD1 1 
ATOM 7244  N ND2 . ASN C 3 154 ? 92.730  66.158  142.541 1.00 10.00 ? 154 ASN C ND2 1 
ATOM 7245  N N   . ALA C 3 155 ? 95.033  61.589  142.076 1.00 10.00 ? 155 ALA C N   1 
ATOM 7246  C CA  . ALA C 3 155 ? 95.984  60.505  142.324 1.00 10.00 ? 155 ALA C CA  1 
ATOM 7247  C C   . ALA C 3 155 ? 96.209  60.224  143.789 1.00 10.00 ? 155 ALA C C   1 
ATOM 7248  O O   . ALA C 3 155 ? 96.999  59.350  144.138 1.00 10.00 ? 155 ALA C O   1 
ATOM 7249  C CB  . ALA C 3 155 ? 97.320  60.805  141.656 1.00 10.00 ? 155 ALA C CB  1 
ATOM 7250  N N   . ASN C 3 156 ? 95.542  60.985  144.644 1.00 10.00 ? 156 ASN C N   1 
ATOM 7251  C CA  . ASN C 3 156 ? 95.654  60.772  146.055 1.00 10.00 ? 156 ASN C CA  1 
ATOM 7252  C C   . ASN C 3 156 ? 94.269  60.641  146.657 1.00 10.00 ? 156 ASN C C   1 
ATOM 7253  O O   . ASN C 3 156 ? 94.074  60.654  147.879 1.00 10.00 ? 156 ASN C O   1 
ATOM 7254  C CB  . ASN C 3 156 ? 96.527  61.836  146.713 1.00 10.00 ? 156 ASN C CB  1 
ATOM 7255  C CG  . ASN C 3 156 ? 98.030  61.554  146.494 1.00 10.00 ? 156 ASN C CG  1 
ATOM 7256  O OD1 . ASN C 3 156 ? 98.439  60.401  146.333 1.00 10.00 ? 156 ASN C OD1 1 
ATOM 7257  N ND2 . ASN C 3 156 ? 98.846  62.603  146.501 1.00 10.00 ? 156 ASN C ND2 1 
ATOM 7258  N N   . GLU C 3 157 ? 93.303  60.430  145.767 1.00 10.00 ? 157 GLU C N   1 
ATOM 7259  C CA  . GLU C 3 157 ? 91.940  60.184  146.189 1.00 10.00 ? 157 GLU C CA  1 
ATOM 7260  C C   . GLU C 3 157 ? 91.348  59.074  145.288 1.00 10.00 ? 157 GLU C C   1 
ATOM 7261  O O   . GLU C 3 157 ? 90.321  58.490  145.620 1.00 10.00 ? 157 GLU C O   1 
ATOM 7262  C CB  . GLU C 3 157 ? 91.137  61.491  146.189 1.00 10.00 ? 157 GLU C CB  1 
ATOM 7263  C CG  . GLU C 3 157 ? 91.721  62.580  147.156 1.00 10.00 ? 157 GLU C CG  1 
ATOM 7264  C CD  . GLU C 3 157 ? 90.936  63.884  147.141 1.00 10.00 ? 157 GLU C CD  1 
ATOM 7265  O OE1 . GLU C 3 157 ? 89.865  63.960  147.780 1.00 10.00 ? 157 GLU C OE1 1 
ATOM 7266  O OE2 . GLU C 3 157 ? 91.394  64.829  146.467 1.00 10.00 ? 157 GLU C OE2 1 
ATOM 7267  N N   . ILE C 3 158 ? 92.025  58.763  144.170 1.00 10.00 ? 158 ILE C N   1 
ATOM 7268  C CA  . ILE C 3 158 ? 91.627  57.662  143.271 1.00 10.00 ? 158 ILE C CA  1 
ATOM 7269  C C   . ILE C 3 158 ? 92.731  57.138  142.339 1.00 10.00 ? 158 ILE C C   1 
ATOM 7270  O O   . ILE C 3 158 ? 93.558  57.902  141.831 1.00 10.00 ? 158 ILE C O   1 
ATOM 7271  C CB  . ILE C 3 158 ? 90.370  57.987  142.410 1.00 10.00 ? 158 ILE C CB  1 
ATOM 7272  C CG1 . ILE C 3 158 ? 89.178  57.255  143.008 1.00 10.00 ? 158 ILE C CG1 1 
ATOM 7273  C CG2 . ILE C 3 158 ? 90.569  57.556  140.949 1.00 10.00 ? 158 ILE C CG2 1 
ATOM 7274  C CD1 . ILE C 3 158 ? 88.044  57.085  142.084 1.00 10.00 ? 158 ILE C CD1 1 
ATOM 7275  N N   . SER C 3 159 ? 92.741  55.814  142.164 1.00 10.00 ? 159 SER C N   1 
ATOM 7276  C CA  . SER C 3 159 ? 93.684  55.112  141.301 1.00 10.00 ? 159 SER C CA  1 
ATOM 7277  C C   . SER C 3 159 ? 92.957  54.036  140.509 1.00 10.00 ? 159 SER C C   1 
ATOM 7278  O O   . SER C 3 159 ? 92.581  53.000  141.064 1.00 10.00 ? 159 SER C O   1 
ATOM 7279  C CB  . SER C 3 159 ? 94.792  54.446  142.110 1.00 10.00 ? 159 SER C CB  1 
ATOM 7280  O OG  . SER C 3 159 ? 95.615  53.649  141.275 1.00 10.00 ? 159 SER C OG  1 
ATOM 7281  N N   . MET C 3 160 ? 92.749  54.256  139.217 1.00 10.00 ? 160 MET C N   1 
ATOM 7282  C CA  . MET C 3 160 ? 92.054  53.233  138.457 1.00 10.00 ? 160 MET C CA  1 
ATOM 7283  C C   . MET C 3 160 ? 92.968  52.473  137.487 1.00 10.00 ? 160 MET C C   1 
ATOM 7284  O O   . MET C 3 160 ? 93.619  53.032  136.587 1.00 10.00 ? 160 MET C O   1 
ATOM 7285  C CB  . MET C 3 160 ? 90.810  53.835  137.768 1.00 10.00 ? 160 MET C CB  1 
ATOM 7286  C CG  . MET C 3 160 ? 89.952  54.685  138.743 1.00 10.00 ? 160 MET C CG  1 
ATOM 7287  S SD  . MET C 3 160 ? 88.209  54.323  139.002 1.00 10.00 ? 160 MET C SD  1 
ATOM 7288  C CE  . MET C 3 160 ? 87.619  54.652  137.391 1.00 10.00 ? 160 MET C CE  1 
ATOM 7289  N N   . ASP C 3 161 ? 93.059  51.174  137.731 1.00 10.00 ? 161 ASP C N   1 
ATOM 7290  C CA  . ASP C 3 161 ? 93.880  50.301  136.881 1.00 10.00 ? 161 ASP C CA  1 
ATOM 7291  C C   . ASP C 3 161 ? 92.962  49.517  135.972 1.00 10.00 ? 161 ASP C C   1 
ATOM 7292  O O   . ASP C 3 161 ? 91.743  49.474  136.186 1.00 10.00 ? 161 ASP C O   1 
ATOM 7293  C CB  . ASP C 3 161 ? 94.715  49.341  137.715 1.00 10.00 ? 161 ASP C CB  1 
ATOM 7294  C CG  . ASP C 3 161 ? 95.954  50.003  138.291 1.00 10.00 ? 161 ASP C CG  1 
ATOM 7295  O OD1 . ASP C 3 161 ? 96.511  49.489  139.291 1.00 10.00 ? 161 ASP C OD1 1 
ATOM 7296  O OD2 . ASP C 3 161 ? 96.385  51.035  137.727 1.00 10.00 ? 161 ASP C OD2 1 
ATOM 7297  N N   . LEU C 3 162 ? 93.548  48.882  134.974 1.00 10.00 ? 162 LEU C N   1 
ATOM 7298  C CA  . LEU C 3 162 ? 92.820  48.119  133.992 1.00 10.00 ? 162 LEU C CA  1 
ATOM 7299  C C   . LEU C 3 162 ? 92.979  46.629  134.285 1.00 10.00 ? 162 LEU C C   1 
ATOM 7300  O O   . LEU C 3 162 ? 92.754  46.185  135.424 1.00 10.00 ? 162 LEU C O   1 
ATOM 7301  C CB  . LEU C 3 162 ? 93.332  48.467  132.586 1.00 10.00 ? 162 LEU C CB  1 
ATOM 7302  C CG  . LEU C 3 162 ? 92.252  48.795  131.537 1.00 10.00 ? 162 LEU C CG  1 
ATOM 7303  C CD1 . LEU C 3 162 ? 92.872  49.190  130.216 1.00 10.00 ? 162 LEU C CD1 1 
ATOM 7304  C CD2 . LEU C 3 162 ? 91.343  47.575  131.354 1.00 10.00 ? 162 LEU C CD2 1 
ATOM 7305  N N   . ILE C 3 163 ? 89.842  43.335  126.952 1.00 10.00 ? 178 ILE C N   1 
ATOM 7306  C CA  . ILE C 3 163 ? 88.504  43.250  126.379 1.00 10.00 ? 178 ILE C CA  1 
ATOM 7307  C C   . ILE C 3 163 ? 88.500  43.793  124.947 1.00 10.00 ? 178 ILE C C   1 
ATOM 7308  O O   . ILE C 3 163 ? 88.936  44.911  124.703 1.00 10.00 ? 178 ILE C O   1 
ATOM 7309  C CB  . ILE C 3 163 ? 87.477  44.023  127.253 1.00 10.00 ? 178 ILE C CB  1 
ATOM 7310  C CG1 . ILE C 3 163 ? 87.319  43.307  128.597 1.00 10.00 ? 178 ILE C CG1 1 
ATOM 7311  C CG2 . ILE C 3 163 ? 86.135  44.122  126.544 1.00 10.00 ? 178 ILE C CG2 1 
ATOM 7312  C CD1 . ILE C 3 163 ? 86.236  43.861  129.489 1.00 10.00 ? 178 ILE C CD1 1 
ATOM 7313  N N   . ILE C 3 164 ? 88.015  42.992  124.001 1.00 10.00 ? 179 ILE C N   1 
ATOM 7314  C CA  . ILE C 3 164 ? 87.964  43.399  122.616 1.00 10.00 ? 179 ILE C CA  1 
ATOM 7315  C C   . ILE C 3 164 ? 86.698  44.244  122.341 1.00 10.00 ? 179 ILE C C   1 
ATOM 7316  O O   . ILE C 3 164 ? 85.690  44.108  123.037 1.00 10.00 ? 179 ILE C O   1 
ATOM 7317  C CB  . ILE C 3 164 ? 88.039  42.131  121.728 1.00 10.00 ? 179 ILE C CB  1 
ATOM 7318  C CG1 . ILE C 3 164 ? 88.945  42.413  120.526 1.00 10.00 ? 179 ILE C CG1 1 
ATOM 7319  C CG2 . ILE C 3 164 ? 86.629  41.624  121.383 1.00 10.00 ? 179 ILE C CG2 1 
ATOM 7320  C CD1 . ILE C 3 164 ? 90.401  42.685  120.923 1.00 10.00 ? 179 ILE C CD1 1 
ATOM 7321  N N   . ASP C 3 165 ? 86.777  45.132  121.350 1.00 10.00 ? 180 ASP C N   1 
ATOM 7322  C CA  . ASP C 3 165 ? 85.667  46.003  120.961 1.00 10.00 ? 180 ASP C CA  1 
ATOM 7323  C C   . ASP C 3 165 ? 84.660  45.171  120.169 1.00 10.00 ? 180 ASP C C   1 
ATOM 7324  O O   . ASP C 3 165 ? 83.440  45.374  120.281 1.00 10.00 ? 180 ASP C O   1 
ATOM 7325  C CB  . ASP C 3 165 ? 86.172  47.151  120.081 1.00 10.00 ? 180 ASP C CB  1 
ATOM 7326  C CG  . ASP C 3 165 ? 85.226  48.336  120.056 1.00 10.00 ? 180 ASP C CG  1 
ATOM 7327  O OD1 . ASP C 3 165 ? 85.214  49.108  121.038 1.00 10.00 ? 180 ASP C OD1 1 
ATOM 7328  O OD2 . ASP C 3 165 ? 84.492  48.494  119.056 1.00 10.00 ? 180 ASP C OD2 1 
ATOM 7329  N N   . PRO C 3 166 ? 85.164  44.243  119.327 1.00 10.00 ? 181 PRO C N   1 
ATOM 7330  C CA  . PRO C 3 166 ? 84.289  43.380  118.523 1.00 10.00 ? 181 PRO C CA  1 
ATOM 7331  C C   . PRO C 3 166 ? 83.607  42.296  119.366 1.00 10.00 ? 181 PRO C C   1 
ATOM 7332  O O   . PRO C 3 166 ? 82.921  41.432  118.823 1.00 10.00 ? 181 PRO C O   1 
ATOM 7333  C CB  . PRO C 3 166 ? 85.243  42.790  117.463 1.00 10.00 ? 181 PRO C CB  1 
ATOM 7334  C CG  . PRO C 3 166 ? 86.587  42.794  118.139 1.00 10.00 ? 181 PRO C CG  1 
ATOM 7335  C CD  . PRO C 3 166 ? 86.571  44.130  118.863 1.00 10.00 ? 181 PRO C CD  1 
ATOM 7336  N N   . GLU C 3 167 ? 83.783  42.361  120.689 1.00 10.00 ? 182 GLU C N   1 
ATOM 7337  C CA  . GLU C 3 167 ? 83.195  41.361  121.580 1.00 10.00 ? 182 GLU C CA  1 
ATOM 7338  C C   . GLU C 3 167 ? 81.684  41.564  121.556 1.00 10.00 ? 182 GLU C C   1 
ATOM 7339  O O   . GLU C 3 167 ? 80.915  40.623  121.747 1.00 10.00 ? 182 GLU C O   1 
ATOM 7340  C CB  . GLU C 3 167 ? 83.757  41.481  123.017 1.00 10.00 ? 182 GLU C CB  1 
ATOM 7341  C CG  . GLU C 3 167 ? 83.498  40.204  123.902 1.00 10.00 ? 182 GLU C CG  1 
ATOM 7342  C CD  . GLU C 3 167 ? 84.042  40.244  125.357 1.00 10.00 ? 182 GLU C CD  1 
ATOM 7343  O OE1 . GLU C 3 167 ? 85.284  40.281  125.565 1.00 10.00 ? 182 GLU C OE1 1 
ATOM 7344  O OE2 . GLU C 3 167 ? 83.205  40.212  126.287 1.00 10.00 ? 182 GLU C OE2 1 
ATOM 7345  N N   . ALA C 3 168 ? 81.264  42.801  121.308 1.00 10.00 ? 183 ALA C N   1 
ATOM 7346  C CA  . ALA C 3 168 ? 79.838  43.116  121.205 1.00 10.00 ? 183 ALA C CA  1 
ATOM 7347  C C   . ALA C 3 168 ? 79.672  44.171  120.126 1.00 10.00 ? 183 ALA C C   1 
ATOM 7348  O O   . ALA C 3 168 ? 78.837  45.070  120.232 1.00 10.00 ? 183 ALA C O   1 
ATOM 7349  C CB  . ALA C 3 168 ? 79.299  43.622  122.513 1.00 10.00 ? 183 ALA C CB  1 
ATOM 7350  N N   . PHE C 3 169 ? 80.573  44.082  119.141 1.00 10.00 ? 184 PHE C N   1 
ATOM 7351  C CA  . PHE C 3 169 ? 80.431  44.958  117.991 1.00 10.00 ? 184 PHE C CA  1 
ATOM 7352  C C   . PHE C 3 169 ? 79.101  44.770  117.273 1.00 10.00 ? 184 PHE C C   1 
ATOM 7353  O O   . PHE C 3 169 ? 78.675  43.593  117.261 1.00 10.00 ? 184 PHE C O   1 
ATOM 7354  C CB  . PHE C 3 169 ? 81.581  44.749  117.007 1.00 10.00 ? 184 PHE C CB  1 
ATOM 7355  C CG  . PHE C 3 169 ? 81.307  45.311  115.646 1.00 10.00 ? 184 PHE C CG  1 
ATOM 7356  C CD1 . PHE C 3 169 ? 80.898  46.625  115.497 1.00 10.00 ? 184 PHE C CD1 1 
ATOM 7357  C CD2 . PHE C 3 169 ? 81.453  44.524  114.518 1.00 10.00 ? 184 PHE C CD2 1 
ATOM 7358  C CE1 . PHE C 3 169 ? 80.641  47.146  114.244 1.00 10.00 ? 184 PHE C CE1 1 
ATOM 7359  C CE2 . PHE C 3 169 ? 81.197  45.039  113.261 1.00 10.00 ? 184 PHE C CE2 1 
ATOM 7360  C CZ  . PHE C 3 169 ? 80.790  46.351  113.124 1.00 10.00 ? 184 PHE C CZ  1 
ATOM 7361  N N   . THR C 3 170 ? 78.468  45.781  116.847 1.00 10.00 ? 185 THR C N   1 
ATOM 7362  C CA  . THR C 3 170 ? 77.174  45.554  116.225 1.00 10.00 ? 185 THR C CA  1 
ATOM 7363  C C   . THR C 3 170 ? 77.323  45.008  114.818 1.00 10.00 ? 185 THR C C   1 
ATOM 7364  O O   . THR C 3 170 ? 78.062  45.554  113.990 1.00 10.00 ? 185 THR C O   1 
ATOM 7365  C CB  . THR C 3 170 ? 76.294  46.834  116.198 1.00 10.00 ? 185 THR C CB  1 
ATOM 7366  O OG1 . THR C 3 170 ? 75.545  46.910  117.417 1.00 10.00 ? 185 THR C OG1 1 
ATOM 7367  C CG2 . THR C 3 170 ? 75.311  46.819  115.009 1.00 10.00 ? 185 THR C CG2 1 
ATOM 7368  N N   . GLU C 3 171 ? 76.580  43.945  114.543 1.00 10.00 ? 186 GLU C N   1 
ATOM 7369  C CA  . GLU C 3 171 ? 76.659  43.320  113.235 1.00 10.00 ? 186 GLU C CA  1 
ATOM 7370  C C   . GLU C 3 171 ? 75.858  44.066  112.184 1.00 10.00 ? 186 GLU C C   1 
ATOM 7371  O O   . GLU C 3 171 ? 75.916  43.725  111.004 1.00 10.00 ? 186 GLU C O   1 
ATOM 7372  C CB  . GLU C 3 171 ? 76.219  41.849  113.301 1.00 10.00 ? 186 GLU C CB  1 
ATOM 7373  C CG  . GLU C 3 171 ? 77.346  40.892  113.722 1.00 10.00 ? 186 GLU C CG  1 
ATOM 7374  C CD  . GLU C 3 171 ? 77.167  39.462  113.205 1.00 10.00 ? 186 GLU C CD  1 
ATOM 7375  O OE1 . GLU C 3 171 ? 78.191  38.748  113.080 1.00 10.00 ? 186 GLU C OE1 1 
ATOM 7376  O OE2 . GLU C 3 171 ? 76.013  39.056  112.935 1.00 10.00 ? 186 GLU C OE2 1 
ATOM 7377  N N   . ASN C 3 172 ? 75.117  45.088  112.602 1.00 10.00 ? 187 ASN C N   1 
ATOM 7378  C CA  . ASN C 3 172 ? 74.344  45.858  111.640 1.00 10.00 ? 187 ASN C CA  1 
ATOM 7379  C C   . ASN C 3 172 ? 75.066  47.174  111.336 1.00 10.00 ? 187 ASN C C   1 
ATOM 7380  O O   . ASN C 3 172 ? 74.479  48.142  110.850 1.00 10.00 ? 187 ASN C O   1 
ATOM 7381  C CB  . ASN C 3 172 ? 72.919  46.088  112.157 1.00 10.00 ? 187 ASN C CB  1 
ATOM 7382  C CG  . ASN C 3 172 ? 72.000  44.883  111.915 1.00 10.00 ? 187 ASN C CG  1 
ATOM 7383  O OD1 . ASN C 3 172 ? 71.734  44.505  110.772 1.00 10.00 ? 187 ASN C OD1 1 
ATOM 7384  N ND2 . ASN C 3 172 ? 71.515  44.282  112.993 1.00 10.00 ? 187 ASN C ND2 1 
ATOM 7385  N N   . GLY C 3 173 ? 76.365  47.192  111.608 1.00 10.00 ? 188 GLY C N   1 
ATOM 7386  C CA  . GLY C 3 173 ? 77.140  48.373  111.316 1.00 10.00 ? 188 GLY C CA  1 
ATOM 7387  C C   . GLY C 3 173 ? 77.689  48.269  109.908 1.00 10.00 ? 188 GLY C C   1 
ATOM 7388  O O   . GLY C 3 173 ? 78.002  47.178  109.430 1.00 10.00 ? 188 GLY C O   1 
ATOM 7389  N N   . GLU C 3 174 ? 77.963  49.434  109.312 1.00 10.00 ? 189 GLU C N   1 
ATOM 7390  C CA  . GLU C 3 174 ? 78.415  49.504  107.928 1.00 10.00 ? 189 GLU C CA  1 
ATOM 7391  C C   . GLU C 3 174 ? 79.932  49.400  107.838 1.00 10.00 ? 189 GLU C C   1 
ATOM 7392  O O   . GLU C 3 174 ? 80.553  49.672  106.811 1.00 10.00 ? 189 GLU C O   1 
ATOM 7393  C CB  . GLU C 3 174 ? 77.928  50.797  107.271 1.00 10.00 ? 189 GLU C CB  1 
ATOM 7394  C CG  . GLU C 3 174 ? 76.415  50.939  107.225 1.00 10.00 ? 189 GLU C CG  1 
ATOM 7395  C CD  . GLU C 3 174 ? 75.863  51.677  108.428 1.00 10.00 ? 189 GLU C CD  1 
ATOM 7396  O OE1 . GLU C 3 174 ? 76.287  52.828  108.666 1.00 10.00 ? 189 GLU C OE1 1 
ATOM 7397  O OE2 . GLU C 3 174 ? 75.006  51.105  109.134 1.00 10.00 ? 189 GLU C OE2 1 
ATOM 7398  N N   . TRP C 3 175 ? 80.469  49.002  108.985 1.00 10.00 ? 190 TRP C N   1 
ATOM 7399  C CA  . TRP C 3 175 ? 81.911  48.849  109.163 1.00 10.00 ? 190 TRP C CA  1 
ATOM 7400  C C   . TRP C 3 175 ? 82.224  47.489  109.782 1.00 10.00 ? 190 TRP C C   1 
ATOM 7401  O O   . TRP C 3 175 ? 81.322  46.747  110.166 1.00 10.00 ? 190 TRP C O   1 
ATOM 7402  C CB  . TRP C 3 175 ? 82.452  50.006  110.042 1.00 10.00 ? 190 TRP C CB  1 
ATOM 7403  C CG  . TRP C 3 175 ? 82.087  49.979  111.555 1.00 10.00 ? 190 TRP C CG  1 
ATOM 7404  C CD1 . TRP C 3 175 ? 82.924  49.737  112.581 1.00 10.00 ? 190 TRP C CD1 1 
ATOM 7405  C CD2 . TRP C 3 175 ? 80.796  50.232  112.126 1.00 10.00 ? 190 TRP C CD2 1 
ATOM 7406  N NE1 . TRP C 3 175 ? 82.175  49.865  113.796 1.00 10.00 ? 190 TRP C NE1 1 
ATOM 7407  C CE2 . TRP C 3 175 ? 80.934  50.165  113.509 1.00 10.00 ? 190 TRP C CE2 1 
ATOM 7408  C CE3 . TRP C 3 175 ? 79.536  50.521  111.583 1.00 10.00 ? 190 TRP C CE3 1 
ATOM 7409  C CZ2 . TRP C 3 175 ? 79.874  50.397  114.400 1.00 10.00 ? 190 TRP C CZ2 1 
ATOM 7410  C CZ3 . TRP C 3 175 ? 78.472  50.740  112.488 1.00 10.00 ? 190 TRP C CZ3 1 
ATOM 7411  C CH2 . TRP C 3 175 ? 78.636  50.684  113.830 1.00 10.00 ? 190 TRP C CH2 1 
ATOM 7412  N N   . GLU C 3 176 ? 83.623  47.435  109.909 1.00 10.00 ? 191 GLU C N   1 
ATOM 7413  C CA  . GLU C 3 176 ? 84.232  46.196  110.357 1.00 10.00 ? 191 GLU C CA  1 
ATOM 7414  C C   . GLU C 3 176 ? 85.215  46.499  111.494 1.00 10.00 ? 191 GLU C C   1 
ATOM 7415  O O   . GLU C 3 176 ? 86.039  47.420  111.401 1.00 10.00 ? 191 GLU C O   1 
ATOM 7416  C CB  . GLU C 3 176 ? 84.963  45.501  109.204 1.00 10.00 ? 191 GLU C CB  1 
ATOM 7417  C CG  . GLU C 3 176 ? 86.120  46.292  108.642 1.00 10.00 ? 191 GLU C CG  1 
ATOM 7418  C CD  . GLU C 3 176 ? 86.921  45.517  107.618 1.00 10.00 ? 191 GLU C CD  1 
ATOM 7419  O OE1 . GLU C 3 176 ? 86.325  45.022  106.638 1.00 10.00 ? 191 GLU C OE1 1 
ATOM 7420  O OE2 . GLU C 3 176 ? 88.151  45.404  107.792 1.00 10.00 ? 191 GLU C OE2 1 
ATOM 7421  N N   . ILE C 3 177 ? 85.096  45.742  112.570 1.00 10.00 ? 192 ILE C N   1 
ATOM 7422  C CA  . ILE C 3 177 ? 86.005  45.900  113.712 1.00 10.00 ? 192 ILE C CA  1 
ATOM 7423  C C   . ILE C 3 177 ? 87.190  44.940  113.625 1.00 10.00 ? 192 ILE C C   1 
ATOM 7424  O O   . ILE C 3 177 ? 87.008  43.710  113.650 1.00 10.00 ? 192 ILE C O   1 
ATOM 7425  C CB  . ILE C 3 177 ? 85.286  45.663  115.057 1.00 10.00 ? 192 ILE C CB  1 
ATOM 7426  C CG1 . ILE C 3 177 ? 84.153  46.674  115.244 1.00 10.00 ? 192 ILE C CG1 1 
ATOM 7427  C CG2 . ILE C 3 177 ? 86.275  45.740  116.212 1.00 10.00 ? 192 ILE C CG2 1 
ATOM 7428  C CD1 . ILE C 3 177 ? 84.615  48.115  115.257 1.00 10.00 ? 192 ILE C CD1 1 
ATOM 7429  N N   . ILE C 3 178 ? 88.407  45.481  113.463 1.00 10.00 ? 193 ILE C N   1 
ATOM 7430  C CA  . ILE C 3 178 ? 89.618  44.704  113.237 1.00 10.00 ? 193 ILE C CA  1 
ATOM 7431  C C   . ILE C 3 178 ? 90.333  44.444  114.571 1.00 10.00 ? 193 ILE C C   1 
ATOM 7432  O O   . ILE C 3 178 ? 90.925  43.336  114.737 1.00 10.00 ? 193 ILE C O   1 
ATOM 7433  C CB  . ILE C 3 178 ? 90.567  45.384  112.244 1.00 10.00 ? 193 ILE C CB  1 
ATOM 7434  C CG1 . ILE C 3 178 ? 89.881  45.551  110.886 1.00 10.00 ? 193 ILE C CG1 1 
ATOM 7435  C CG2 . ILE C 3 178 ? 91.850  44.579  112.106 1.00 10.00 ? 193 ILE C CG2 1 
ATOM 7436  C CD1 . ILE C 3 178 ? 90.656  46.408  109.911 1.00 10.00 ? 193 ILE C CD1 1 
ATOM 7437  N N   . HIS C 3 179 ? 90.386  45.380  115.512 1.00 10.00 ? 194 HIS C N   1 
ATOM 7438  C CA  . HIS C 3 179 ? 91.052  45.169  116.788 1.00 10.00 ? 194 HIS C CA  1 
ATOM 7439  C C   . HIS C 3 179 ? 90.613  46.116  117.895 1.00 10.00 ? 194 HIS C C   1 
ATOM 7440  O O   . HIS C 3 179 ? 89.995  47.136  117.631 1.00 10.00 ? 194 HIS C O   1 
ATOM 7441  C CB  . HIS C 3 179 ? 92.578  45.204  116.656 1.00 10.00 ? 194 HIS C CB  1 
ATOM 7442  C CG  . HIS C 3 179 ? 93.283  44.706  117.886 1.00 10.00 ? 194 HIS C CG  1 
ATOM 7443  N ND1 . HIS C 3 179 ? 92.647  43.939  118.842 1.00 10.00 ? 194 HIS C ND1 1 
ATOM 7444  C CD2 . HIS C 3 179 ? 94.546  44.894  118.338 1.00 10.00 ? 194 HIS C CD2 1 
ATOM 7445  C CE1 . HIS C 3 179 ? 93.485  43.688  119.831 1.00 10.00 ? 194 HIS C CE1 1 
ATOM 7446  N NE2 . HIS C 3 179 ? 94.644  44.255  119.552 1.00 10.00 ? 194 HIS C NE2 1 
ATOM 7447  N N   . LYS C 3 180 ? 90.940  45.754  119.170 1.00 10.00 ? 195 LYS C N   1 
ATOM 7448  C CA  . LYS C 3 180 ? 90.527  46.559  120.309 1.00 10.00 ? 195 LYS C CA  1 
ATOM 7449  C C   . LYS C 3 180 ? 91.414  46.294  121.524 1.00 10.00 ? 195 LYS C C   1 
ATOM 7450  O O   . LYS C 3 180 ? 91.106  45.454  122.394 1.00 10.00 ? 195 LYS C O   1 
ATOM 7451  C CB  . LYS C 3 180 ? 89.059  46.298  120.652 1.00 10.00 ? 195 LYS C CB  1 
ATOM 7452  C CG  . LYS C 3 180 ? 88.647  46.796  122.029 1.00 10.00 ? 195 LYS C CG  1 
ATOM 7453  C CD  . LYS C 3 180 ? 88.694  48.315  122.106 1.00 10.00 ? 195 LYS C CD  1 
ATOM 7454  C CE  . LYS C 3 180 ? 88.177  48.817  123.446 1.00 10.00 ? 195 LYS C CE  1 
ATOM 7455  N NZ  . LYS C 3 180 ? 86.691  48.905  123.469 1.00 10.00 ? 195 LYS C NZ  1 
ATOM 7456  N N   . PRO C 3 181 ? 92.520  47.053  121.683 1.00 10.00 ? 196 PRO C N   1 
ATOM 7457  C CA  . PRO C 3 181 ? 93.453  46.931  122.821 1.00 10.00 ? 196 PRO C CA  1 
ATOM 7458  C C   . PRO C 3 181 ? 93.016  47.730  124.058 1.00 10.00 ? 196 PRO C C   1 
ATOM 7459  O O   . PRO C 3 181 ? 92.388  48.779  123.922 1.00 10.00 ? 196 PRO C O   1 
ATOM 7460  C CB  . PRO C 3 181 ? 94.772  47.472  122.254 1.00 10.00 ? 196 PRO C CB  1 
ATOM 7461  C CG  . PRO C 3 181 ? 94.598  47.382  120.750 1.00 10.00 ? 196 PRO C CG  1 
ATOM 7462  C CD  . PRO C 3 181 ? 93.162  47.776  120.572 1.00 10.00 ? 196 PRO C CD  1 
ATOM 7463  N N   . ALA C 3 182 ? 93.417  47.269  125.240 1.00 10.00 ? 197 ALA C N   1 
ATOM 7464  C CA  . ALA C 3 182 ? 93.059  47.899  126.505 1.00 10.00 ? 197 ALA C CA  1 
ATOM 7465  C C   . ALA C 3 182 ? 94.234  48.059  127.483 1.00 10.00 ? 197 ALA C C   1 
ATOM 7466  O O   . ALA C 3 182 ? 94.809  47.063  127.892 1.00 10.00 ? 197 ALA C O   1 
ATOM 7467  C CB  . ALA C 3 182 ? 91.962  47.083  127.172 1.00 10.00 ? 197 ALA C CB  1 
ATOM 7468  N N   . LYS C 3 183 ? 94.575  49.297  127.871 1.00 10.00 ? 198 LYS C N   1 
ATOM 7469  C CA  . LYS C 3 183 ? 95.662  49.527  128.833 1.00 10.00 ? 198 LYS C CA  1 
ATOM 7470  C C   . LYS C 3 183 ? 95.416  50.802  129.655 1.00 10.00 ? 198 LYS C C   1 
ATOM 7471  O O   . LYS C 3 183 ? 95.242  51.894  129.096 1.00 10.00 ? 198 LYS C O   1 
ATOM 7472  C CB  . LYS C 3 183 ? 97.045  49.586  128.138 1.00 10.00 ? 198 LYS C CB  1 
ATOM 7473  C CG  . LYS C 3 183 ? 97.374  50.803  127.237 1.00 10.00 ? 198 LYS C CG  1 
ATOM 7474  C CD  . LYS C 3 183 ? 98.910  50.851  126.895 1.00 10.00 ? 198 LYS C CD  1 
ATOM 7475  C CE  . LYS C 3 183 ? 99.276  51.894  125.807 1.00 10.00 ? 198 LYS C CE  1 
ATOM 7476  N NZ  . LYS C 3 183 ? 100.686 51.851  125.285 1.00 10.00 ? 198 LYS C NZ  1 
ATOM 7477  N N   . LYS C 3 184 ? 95.373  50.664  130.982 1.00 10.00 ? 199 LYS C N   1 
ATOM 7478  C CA  . LYS C 3 184 ? 95.148  51.799  131.877 1.00 10.00 ? 199 LYS C CA  1 
ATOM 7479  C C   . LYS C 3 184 ? 96.393  52.665  131.990 1.00 10.00 ? 199 LYS C C   1 
ATOM 7480  O O   . LYS C 3 184 ? 97.409  52.407  131.346 1.00 10.00 ? 199 LYS C O   1 
ATOM 7481  C CB  . LYS C 3 184 ? 94.692  51.320  133.276 1.00 10.00 ? 199 LYS C CB  1 
ATOM 7482  C CG  . LYS C 3 184 ? 95.759  50.705  134.184 1.00 10.00 ? 199 LYS C CG  1 
ATOM 7483  C CD  . LYS C 3 184 ? 96.556  51.778  134.893 1.00 10.00 ? 199 LYS C CD  1 
ATOM 7484  C CE  . LYS C 3 184 ? 98.049  51.614  134.664 1.00 10.00 ? 199 LYS C CE  1 
ATOM 7485  N NZ  . LYS C 3 184 ? 98.469  51.790  133.248 1.00 10.00 ? 199 LYS C NZ  1 
ATOM 7486  N N   . ASN C 3 185 ? 96.274  53.735  132.768 1.00 10.00 ? 200 ASN C N   1 
ATOM 7487  C CA  . ASN C 3 185 ? 97.383  54.647  132.986 1.00 10.00 ? 200 ASN C CA  1 
ATOM 7488  C C   . ASN C 3 185 ? 96.954  55.692  134.005 1.00 10.00 ? 200 ASN C C   1 
ATOM 7489  O O   . ASN C 3 185 ? 95.869  55.620  134.584 1.00 10.00 ? 200 ASN C O   1 
ATOM 7490  C CB  . ASN C 3 185 ? 97.781  55.335  131.671 1.00 10.00 ? 200 ASN C CB  1 
ATOM 7491  C CG  . ASN C 3 185 ? 99.138  56.026  131.751 1.00 10.00 ? 200 ASN C CG  1 
ATOM 7492  O OD1 . ASN C 3 185 ? 99.522  56.768  130.845 1.00 10.00 ? 200 ASN C OD1 1 
ATOM 7493  N ND2 . ASN C 3 185 ? 99.872  55.776  132.830 1.00 10.00 ? 200 ASN C ND2 1 
ATOM 7494  N N   . ILE C 3 186 ? 97.828  56.656  134.232 1.00 10.00 ? 201 ILE C N   1 
ATOM 7495  C CA  . ILE C 3 186 ? 97.558  57.738  135.157 1.00 10.00 ? 201 ILE C CA  1 
ATOM 7496  C C   . ILE C 3 186 ? 98.338  58.897  134.551 1.00 10.00 ? 201 ILE C C   1 
ATOM 7497  O O   . ILE C 3 186 ? 99.366  58.682  133.897 1.00 10.00 ? 201 ILE C O   1 
ATOM 7498  C CB  . ILE C 3 186 ? 98.140  57.429  136.566 1.00 10.00 ? 201 ILE C CB  1 
ATOM 7499  C CG1 . ILE C 3 186 ? 98.106  58.682  137.452 1.00 10.00 ? 201 ILE C CG1 1 
ATOM 7500  C CG2 . ILE C 3 186 ? 99.570  56.915  136.432 1.00 10.00 ? 201 ILE C CG2 1 
ATOM 7501  C CD1 . ILE C 3 186 ? 98.789  58.512  138.814 1.00 10.00 ? 201 ILE C CD1 1 
ATOM 7502  N N   . TYR C 3 187 ? 97.854  60.117  134.710 1.00 10.00 ? 202 TYR C N   1 
ATOM 7503  C CA  . TYR C 3 187 ? 98.639  61.195  134.185 1.00 10.00 ? 202 TYR C CA  1 
ATOM 7504  C C   . TYR C 3 187 ? 98.371  62.613  134.611 1.00 10.00 ? 202 TYR C C   1 
ATOM 7505  O O   . TYR C 3 187 ? 97.230  63.102  134.676 1.00 10.00 ? 202 TYR C O   1 
ATOM 7506  C CB  . TYR C 3 187 ? 98.688  61.112  132.675 1.00 10.00 ? 202 TYR C CB  1 
ATOM 7507  C CG  . TYR C 3 187 ? 99.908  60.360  132.233 1.00 10.00 ? 202 TYR C CG  1 
ATOM 7508  C CD1 . TYR C 3 187 ? 99.976  59.770  130.966 1.00 10.00 ? 202 TYR C CD1 1 
ATOM 7509  C CD2 . TYR C 3 187 ? 101.030 60.273  133.062 1.00 10.00 ? 202 TYR C CD2 1 
ATOM 7510  C CE1 . TYR C 3 187 ? 101.139 59.112  130.526 1.00 10.00 ? 202 TYR C CE1 1 
ATOM 7511  C CE2 . TYR C 3 187 ? 102.198 59.621  132.627 1.00 10.00 ? 202 TYR C CE2 1 
ATOM 7512  C CZ  . TYR C 3 187 ? 102.242 59.043  131.359 1.00 10.00 ? 202 TYR C CZ  1 
ATOM 7513  O OH  . TYR C 3 187 ? 103.377 58.398  130.938 1.00 10.00 ? 202 TYR C OH  1 
ATOM 7514  N N   . GLY C 3 188 ? 99.474  63.279  134.915 1.00 10.00 ? 203 GLY C N   1 
ATOM 7515  C CA  . GLY C 3 188 ? 99.374  64.661  135.331 1.00 10.00 ? 203 GLY C CA  1 
ATOM 7516  C C   . GLY C 3 188 ? 99.522  65.488  134.077 1.00 10.00 ? 203 GLY C C   1 
ATOM 7517  O O   . GLY C 3 188 ? 99.589  64.944  132.973 1.00 10.00 ? 203 GLY C O   1 
ATOM 7518  N N   . ASP C 3 189 ? 99.541  66.801  134.217 1.00 10.00 ? 204 ASP C N   1 
ATOM 7519  C CA  . ASP C 3 189 ? 99.738  67.611  133.024 1.00 10.00 ? 204 ASP C CA  1 
ATOM 7520  C C   . ASP C 3 189 ? 100.532 68.855  133.362 1.00 10.00 ? 204 ASP C C   1 
ATOM 7521  O O   . ASP C 3 189 ? 100.917 69.051  134.508 1.00 10.00 ? 204 ASP C O   1 
ATOM 7522  C CB  . ASP C 3 189 ? 98.415  67.999  132.339 1.00 10.00 ? 204 ASP C CB  1 
ATOM 7523  C CG  . ASP C 3 189 ? 98.638  68.499  130.881 1.00 10.00 ? 204 ASP C CG  1 
ATOM 7524  O OD1 . ASP C 3 189 ? 99.772  68.335  130.396 1.00 10.00 ? 204 ASP C OD1 1 
ATOM 7525  O OD2 . ASP C 3 189 ? 97.704  69.026  130.226 1.00 10.00 ? 204 ASP C OD2 1 
ATOM 7526  N N   . LYS C 3 190 ? 100.728 69.713  132.370 1.00 10.00 ? 205 LYS C N   1 
ATOM 7527  C CA  . LYS C 3 190 ? 101.532 70.919  132.543 1.00 10.00 ? 205 LYS C CA  1 
ATOM 7528  C C   . LYS C 3 190 ? 100.976 71.935  133.523 1.00 10.00 ? 205 LYS C C   1 
ATOM 7529  O O   . LYS C 3 190 ? 101.676 72.390  134.431 1.00 10.00 ? 205 LYS C O   1 
ATOM 7530  C CB  . LYS C 3 190 ? 101.767 71.619  131.194 1.00 10.00 ? 205 LYS C CB  1 
ATOM 7531  C CG  . LYS C 3 190 ? 102.620 70.861  130.196 1.00 10.00 ? 205 LYS C CG  1 
ATOM 7532  C CD  . LYS C 3 190 ? 101.832 69.706  129.577 1.00 10.00 ? 205 LYS C CD  1 
ATOM 7533  C CE  . LYS C 3 190 ? 100.631 70.190  128.764 1.00 10.00 ? 205 LYS C CE  1 
ATOM 7534  N NZ  . LYS C 3 190 ? 99.726  69.071  128.343 1.00 10.00 ? 205 LYS C NZ  1 
ATOM 7535  N N   . PHE C 3 191 ? 99.718  72.310  133.356 1.00 10.00 ? 206 PHE C N   1 
ATOM 7536  C CA  . PHE C 3 191 ? 99.190  73.309  134.263 1.00 10.00 ? 206 PHE C CA  1 
ATOM 7537  C C   . PHE C 3 191 ? 98.958  72.736  135.670 1.00 10.00 ? 206 PHE C C   1 
ATOM 7538  O O   . PHE C 3 191 ? 98.916  73.490  136.644 1.00 10.00 ? 206 PHE C O   1 
ATOM 7539  C CB  . PHE C 3 191 ? 97.934  73.961  133.669 1.00 10.00 ? 206 PHE C CB  1 
ATOM 7540  C CG  . PHE C 3 191 ? 96.701  73.708  134.454 1.00 10.00 ? 206 PHE C CG  1 
ATOM 7541  C CD1 . PHE C 3 191 ? 96.611  74.144  135.771 1.00 10.00 ? 206 PHE C CD1 1 
ATOM 7542  C CD2 . PHE C 3 191 ? 95.686  72.921  133.921 1.00 10.00 ? 206 PHE C CD2 1 
ATOM 7543  C CE1 . PHE C 3 191 ? 95.556  73.788  136.549 1.00 10.00 ? 206 PHE C CE1 1 
ATOM 7544  C CE2 . PHE C 3 191 ? 94.605  72.552  134.683 1.00 10.00 ? 206 PHE C CE2 1 
ATOM 7545  C CZ  . PHE C 3 191 ? 94.533  72.977  136.006 1.00 10.00 ? 206 PHE C CZ  1 
ATOM 7546  N N   . PRO C 3 192 ? 98.748  71.407  135.792 1.00 10.00 ? 207 PRO C N   1 
ATOM 7547  C CA  . PRO C 3 192 ? 98.540  70.779  137.106 1.00 10.00 ? 207 PRO C CA  1 
ATOM 7548  C C   . PRO C 3 192 ? 99.913  70.550  137.739 1.00 10.00 ? 207 PRO C C   1 
ATOM 7549  O O   . PRO C 3 192 ? 100.827 70.149  137.049 1.00 10.00 ? 207 PRO C O   1 
ATOM 7550  C CB  . PRO C 3 192 ? 97.791  69.465  136.766 1.00 10.00 ? 207 PRO C CB  1 
ATOM 7551  C CG  . PRO C 3 192 ? 98.284  69.119  135.457 1.00 10.00 ? 207 PRO C CG  1 
ATOM 7552  C CD  . PRO C 3 192 ? 98.349  70.452  134.726 1.00 10.00 ? 207 PRO C CD  1 
ATOM 7553  N N   . ASN C 3 193 ? 100.054 70.829  139.046 1.00 10.00 ? 208 ASN C N   1 
ATOM 7554  C CA  . ASN C 3 193 ? 101.310 70.661  139.744 1.00 10.00 ? 208 ASN C CA  1 
ATOM 7555  C C   . ASN C 3 193 ? 101.325 69.357  140.514 1.00 10.00 ? 208 ASN C C   1 
ATOM 7556  O O   . ASN C 3 193 ? 102.145 69.165  141.433 1.00 10.00 ? 208 ASN C O   1 
ATOM 7557  C CB  . ASN C 3 193 ? 101.592 71.882  140.611 1.00 10.00 ? 208 ASN C CB  1 
ATOM 7558  C CG  . ASN C 3 193 ? 101.700 73.141  139.773 1.00 10.00 ? 208 ASN C CG  1 
ATOM 7559  O OD1 . ASN C 3 193 ? 102.290 73.128  138.689 1.00 10.00 ? 208 ASN C OD1 1 
ATOM 7560  N ND2 . ASN C 3 193 ? 101.131 74.234  140.265 1.00 10.00 ? 208 ASN C ND2 1 
ATOM 7561  N N   . GLY C 3 194 ? 100.442 68.419  140.162 1.00 10.00 ? 209 GLY C N   1 
ATOM 7562  C CA  . GLY C 3 194 ? 100.381 67.143  140.848 1.00 10.00 ? 209 GLY C CA  1 
ATOM 7563  C C   . GLY C 3 194 ? 99.722  66.103  139.967 1.00 10.00 ? 209 GLY C C   1 
ATOM 7564  O O   . GLY C 3 194 ? 98.926  66.431  139.080 1.00 10.00 ? 209 GLY C O   1 
ATOM 7565  N N   . THR C 3 195 ? 100.018 64.835  140.225 1.00 10.00 ? 210 THR C N   1 
ATOM 7566  C CA  . THR C 3 195 ? 99.432  63.769  139.418 1.00 10.00 ? 210 THR C CA  1 
ATOM 7567  C C   . THR C 3 195 ? 98.047  63.424  139.962 1.00 10.00 ? 210 THR C C   1 
ATOM 7568  O O   . THR C 3 195 ? 97.704  63.762  141.105 1.00 10.00 ? 210 THR C O   1 
ATOM 7569  C CB  . THR C 3 195 ? 100.319 62.506  139.429 1.00 10.00 ? 210 THR C CB  1 
ATOM 7570  O OG1 . THR C 3 195 ? 101.689 62.878  139.231 1.00 10.00 ? 210 THR C OG1 1 
ATOM 7571  C CG2 . THR C 3 195 ? 99.909  61.567  138.308 1.00 10.00 ? 210 THR C CG2 1 
ATOM 7572  N N   . ASN C 3 196 ? 97.247  62.764  139.136 1.00 10.00 ? 211 ASN C N   1 
ATOM 7573  C CA  . ASN C 3 196 ? 95.912  62.399  139.550 1.00 10.00 ? 211 ASN C CA  1 
ATOM 7574  C C   . ASN C 3 196 ? 95.164  61.417  138.635 1.00 10.00 ? 211 ASN C C   1 
ATOM 7575  O O   . ASN C 3 196 ? 95.762  60.794  137.755 1.00 10.00 ? 211 ASN C O   1 
ATOM 7576  C CB  . ASN C 3 196 ? 95.079  63.668  139.848 1.00 10.00 ? 211 ASN C CB  1 
ATOM 7577  C CG  . ASN C 3 196 ? 95.367  64.833  138.907 1.00 10.00 ? 211 ASN C CG  1 
ATOM 7578  O OD1 . ASN C 3 196 ? 96.130  65.735  139.247 1.00 10.00 ? 211 ASN C OD1 1 
ATOM 7579  N ND2 . ASN C 3 196 ? 94.743  64.826  137.724 1.00 10.00 ? 211 ASN C ND2 1 
ATOM 7580  N N   . TYR C 3 197 ? 93.880  61.229  138.843 1.00 10.00 ? 212 TYR C N   1 
ATOM 7581  C CA  . TYR C 3 197 ? 92.943  60.345  138.162 1.00 10.00 ? 212 TYR C CA  1 
ATOM 7582  C C   . TYR C 3 197 ? 93.657  59.462  137.147 1.00 10.00 ? 212 TYR C C   1 
ATOM 7583  O O   . TYR C 3 197 ? 94.214  59.843  136.109 1.00 10.00 ? 212 TYR C O   1 
ATOM 7584  C CB  . TYR C 3 197 ? 91.838  61.156  137.482 1.00 10.00 ? 212 TYR C CB  1 
ATOM 7585  C CG  . TYR C 3 197 ? 92.322  62.008  136.329 1.00 10.00 ? 212 TYR C CG  1 
ATOM 7586  C CD1 . TYR C 3 197 ? 92.435  61.482  135.050 1.00 10.00 ? 212 TYR C CD1 1 
ATOM 7587  C CD2 . TYR C 3 197 ? 92.665  63.339  136.523 1.00 10.00 ? 212 TYR C CD2 1 
ATOM 7588  C CE1 . TYR C 3 197 ? 92.876  62.257  133.995 1.00 10.00 ? 212 TYR C CE1 1 
ATOM 7589  C CE2 . TYR C 3 197 ? 93.105  64.123  135.475 1.00 10.00 ? 212 TYR C CE2 1 
ATOM 7590  C CZ  . TYR C 3 197 ? 93.209  63.578  134.214 1.00 10.00 ? 212 TYR C CZ  1 
ATOM 7591  O OH  . TYR C 3 197 ? 93.649  64.357  133.167 1.00 10.00 ? 212 TYR C OH  1 
ATOM 7592  N N   . GLN C 3 198 ? 93.536  58.130  137.413 1.00 10.00 ? 213 GLN C N   1 
ATOM 7593  C CA  . GLN C 3 198 ? 94.042  57.024  136.600 1.00 10.00 ? 213 GLN C CA  1 
ATOM 7594  C C   . GLN C 3 198 ? 92.876  56.696  135.673 1.00 10.00 ? 213 GLN C C   1 
ATOM 7595  O O   . GLN C 3 198 ? 91.739  56.932  136.060 1.00 10.00 ? 213 GLN C O   1 
ATOM 7596  C CB  . GLN C 3 198 ? 94.327  55.840  137.517 1.00 10.00 ? 213 GLN C CB  1 
ATOM 7597  C CG  . GLN C 3 198 ? 94.563  56.262  138.948 1.00 10.00 ? 213 GLN C CG  1 
ATOM 7598  C CD  . GLN C 3 198 ? 95.840  57.059  139.136 1.00 10.00 ? 213 GLN C CD  1 
ATOM 7599  O OE1 . GLN C 3 198 ? 96.936  56.548  138.925 1.00 10.00 ? 213 GLN C OE1 1 
ATOM 7600  N NE2 . GLN C 3 198 ? 95.704  58.317  139.544 1.00 10.00 ? 213 GLN C NE2 1 
ATOM 7601  N N   . ASP C 3 199 ? 93.133  56.121  134.495 1.00 10.00 ? 214 ASP C N   1 
ATOM 7602  C CA  . ASP C 3 199 ? 92.058  55.847  133.539 1.00 10.00 ? 214 ASP C CA  1 
ATOM 7603  C C   . ASP C 3 199 ? 92.193  54.639  132.604 1.00 10.00 ? 214 ASP C C   1 
ATOM 7604  O O   . ASP C 3 199 ? 93.288  54.152  132.351 1.00 10.00 ? 214 ASP C O   1 
ATOM 7605  C CB  . ASP C 3 199 ? 91.847  57.092  132.683 1.00 10.00 ? 214 ASP C CB  1 
ATOM 7606  C CG  . ASP C 3 199 ? 93.140  57.840  132.411 1.00 10.00 ? 214 ASP C CG  1 
ATOM 7607  O OD1 . ASP C 3 199 ? 93.773  58.311  133.381 1.00 10.00 ? 214 ASP C OD1 1 
ATOM 7608  O OD2 . ASP C 3 199 ? 93.524  57.959  131.228 1.00 10.00 ? 214 ASP C OD2 1 
ATOM 7609  N N   . VAL C 3 200 ? 91.043  54.178  132.108 1.00 10.00 ? 215 VAL C N   1 
ATOM 7610  C CA  . VAL C 3 200 ? 90.947  53.079  131.155 1.00 10.00 ? 215 VAL C CA  1 
ATOM 7611  C C   . VAL C 3 200 ? 90.998  53.579  129.714 1.00 10.00 ? 215 VAL C C   1 
ATOM 7612  O O   . VAL C 3 200 ? 89.999  54.085  129.204 1.00 10.00 ? 215 VAL C O   1 
ATOM 7613  C CB  . VAL C 3 200 ? 89.665  52.253  131.376 1.00 10.00 ? 215 VAL C CB  1 
ATOM 7614  C CG1 . VAL C 3 200 ? 89.684  51.599  132.749 1.00 10.00 ? 215 VAL C CG1 1 
ATOM 7615  C CG2 . VAL C 3 200 ? 88.432  53.127  131.210 1.00 10.00 ? 215 VAL C CG2 1 
ATOM 7616  N N   . THR C 3 201 ? 92.154  53.437  129.068 1.00 10.00 ? 216 THR C N   1 
ATOM 7617  C CA  . THR C 3 201 ? 92.367  53.871  127.695 1.00 10.00 ? 216 THR C CA  1 
ATOM 7618  C C   . THR C 3 201 ? 92.056  52.695  126.769 1.00 10.00 ? 216 THR C C   1 
ATOM 7619  O O   . THR C 3 201 ? 92.743  51.672  126.806 1.00 10.00 ? 216 THR C O   1 
ATOM 7620  C CB  . THR C 3 201 ? 93.838  54.293  127.492 1.00 10.00 ? 216 THR C CB  1 
ATOM 7621  O OG1 . THR C 3 201 ? 94.283  55.043  128.630 1.00 10.00 ? 216 THR C OG1 1 
ATOM 7622  C CG2 . THR C 3 201 ? 93.980  55.155  126.250 1.00 10.00 ? 216 THR C CG2 1 
ATOM 7623  N N   . PHE C 3 202 ? 91.023  52.816  125.941 1.00 10.00 ? 217 PHE C N   1 
ATOM 7624  C CA  . PHE C 3 202 ? 90.709  51.698  125.052 1.00 10.00 ? 217 PHE C CA  1 
ATOM 7625  C C   . PHE C 3 202 ? 90.650  52.149  123.574 1.00 10.00 ? 217 PHE C C   1 
ATOM 7626  O O   . PHE C 3 202 ? 89.742  52.880  123.134 1.00 10.00 ? 217 PHE C O   1 
ATOM 7627  C CB  . PHE C 3 202 ? 89.388  51.031  125.550 1.00 10.00 ? 217 PHE C CB  1 
ATOM 7628  C CG  . PHE C 3 202 ? 89.503  50.310  126.886 1.00 10.00 ? 217 PHE C CG  1 
ATOM 7629  C CD1 . PHE C 3 202 ? 88.505  49.433  127.314 1.00 10.00 ? 217 PHE C CD1 1 
ATOM 7630  C CD2 . PHE C 3 202 ? 90.599  50.539  127.727 1.00 10.00 ? 217 PHE C CD2 1 
ATOM 7631  C CE1 . PHE C 3 202 ? 88.571  48.805  128.548 1.00 10.00 ? 217 PHE C CE1 1 
ATOM 7632  C CE2 . PHE C 3 202 ? 90.680  49.905  128.985 1.00 10.00 ? 217 PHE C CE2 1 
ATOM 7633  C CZ  . PHE C 3 202 ? 89.663  49.042  129.392 1.00 10.00 ? 217 PHE C CZ  1 
ATOM 7634  N N   . TYR C 3 203 ? 91.646  51.732  122.805 1.00 10.00 ? 218 TYR C N   1 
ATOM 7635  C CA  . TYR C 3 203 ? 91.694  52.097  121.390 1.00 10.00 ? 218 TYR C CA  1 
ATOM 7636  C C   . TYR C 3 203 ? 90.935  51.065  120.548 1.00 10.00 ? 218 TYR C C   1 
ATOM 7637  O O   . TYR C 3 203 ? 91.079  49.848  120.726 1.00 10.00 ? 218 TYR C O   1 
ATOM 7638  C CB  . TYR C 3 203 ? 93.145  52.195  120.869 1.00 10.00 ? 218 TYR C CB  1 
ATOM 7639  C CG  . TYR C 3 203 ? 94.033  53.315  121.414 1.00 10.00 ? 218 TYR C CG  1 
ATOM 7640  C CD1 . TYR C 3 203 ? 95.416  53.310  121.148 1.00 10.00 ? 218 TYR C CD1 1 
ATOM 7641  C CD2 . TYR C 3 203 ? 93.541  54.293  122.269 1.00 10.00 ? 218 TYR C CD2 1 
ATOM 7642  C CE1 . TYR C 3 203 ? 96.291  54.234  121.734 1.00 10.00 ? 218 TYR C CE1 1 
ATOM 7643  C CE2 . TYR C 3 203 ? 94.414  55.229  122.866 1.00 10.00 ? 218 TYR C CE2 1 
ATOM 7644  C CZ  . TYR C 3 203 ? 95.790  55.181  122.592 1.00 10.00 ? 218 TYR C CZ  1 
ATOM 7645  O OH  . TYR C 3 203 ? 96.667  56.046  123.204 1.00 10.00 ? 218 TYR C OH  1 
ATOM 7646  N N   . LEU C 3 204 ? 90.108  51.561  119.638 1.00 10.00 ? 219 LEU C N   1 
ATOM 7647  C CA  . LEU C 3 204 ? 89.341  50.695  118.754 1.00 10.00 ? 219 LEU C CA  1 
ATOM 7648  C C   . LEU C 3 204 ? 89.796  51.033  117.357 1.00 10.00 ? 219 LEU C C   1 
ATOM 7649  O O   . LEU C 3 204 ? 89.547  52.116  116.863 1.00 10.00 ? 219 LEU C O   1 
ATOM 7650  C CB  . LEU C 3 204 ? 87.819  50.924  118.879 1.00 10.00 ? 219 LEU C CB  1 
ATOM 7651  C CG  . LEU C 3 204 ? 86.880  50.445  117.749 1.00 10.00 ? 219 LEU C CG  1 
ATOM 7652  C CD1 . LEU C 3 204 ? 87.049  48.978  117.516 1.00 10.00 ? 219 LEU C CD1 1 
ATOM 7653  C CD2 . LEU C 3 204 ? 85.439  50.730  118.098 1.00 10.00 ? 219 LEU C CD2 1 
ATOM 7654  N N   . ILE C 3 205 ? 90.508  50.113  116.770 1.00 10.00 ? 220 ILE C N   1 
ATOM 7655  C CA  . ILE C 3 205 ? 90.921  50.259  115.378 1.00 10.00 ? 220 ILE C CA  1 
ATOM 7656  C C   . ILE C 3 205 ? 89.995  49.492  114.437 1.00 10.00 ? 220 ILE C C   1 
ATOM 7657  O O   . ILE C 3 205 ? 89.867  48.275  114.645 1.00 10.00 ? 220 ILE C O   1 
ATOM 7658  C CB  . ILE C 3 205 ? 92.364  49.768  115.164 1.00 10.00 ? 220 ILE C CB  1 
ATOM 7659  C CG1 . ILE C 3 205 ? 92.374  48.280  114.807 1.00 10.00 ? 220 ILE C CG1 1 
ATOM 7660  C CG2 . ILE C 3 205 ? 93.206  50.034  116.401 1.00 10.00 ? 220 ILE C CG2 1 
ATOM 7661  C CD1 . ILE C 3 205 ? 93.724  47.769  114.353 1.00 10.00 ? 220 ILE C CD1 1 
ATOM 7662  N N   . ILE C 3 206 ? 89.241  50.204  113.649 1.00 10.00 ? 221 ILE C N   1 
ATOM 7663  C CA  . ILE C 3 206 ? 88.263  49.544  112.777 1.00 10.00 ? 221 ILE C CA  1 
ATOM 7664  C C   . ILE C 3 206 ? 88.441  49.852  111.293 1.00 10.00 ? 221 ILE C C   1 
ATOM 7665  O O   . ILE C 3 206 ? 89.391  50.524  110.878 1.00 10.00 ? 221 ILE C O   1 
ATOM 7666  C CB  . ILE C 3 206 ? 86.805  49.913  113.143 1.00 10.00 ? 221 ILE C CB  1 
ATOM 7667  C CG1 . ILE C 3 206 ? 86.403  51.217  112.458 1.00 10.00 ? 221 ILE C CG1 1 
ATOM 7668  C CG2 . ILE C 3 206 ? 86.656  50.017  114.641 1.00 10.00 ? 221 ILE C CG2 1 
ATOM 7669  C CD1 . ILE C 3 206 ? 84.956  51.591  112.680 1.00 10.00 ? 221 ILE C CD1 1 
ATOM 7670  N N   . ARG C 3 207 ? 87.477  49.396  110.507 1.00 10.00 ? 222 ARG C N   1 
ATOM 7671  C CA  . ARG C 3 207 ? 87.500  49.568  109.063 1.00 10.00 ? 222 ARG C CA  1 
ATOM 7672  C C   . ARG C 3 207 ? 86.042  49.470  108.578 1.00 10.00 ? 222 ARG C C   1 
ATOM 7673  O O   . ARG C 3 207 ? 85.205  48.890  109.262 1.00 10.00 ? 222 ARG C O   1 
ATOM 7674  C CB  . ARG C 3 207 ? 88.382  48.455  108.451 1.00 10.00 ? 222 ARG C CB  1 
ATOM 7675  C CG  . ARG C 3 207 ? 89.282  48.860  107.246 1.00 10.00 ? 222 ARG C CG  1 
ATOM 7676  C CD  . ARG C 3 207 ? 88.813  48.234  105.866 1.00 10.00 ? 222 ARG C CD  1 
ATOM 7677  N NE  . ARG C 3 207 ? 87.351  48.345  105.626 1.00 10.00 ? 222 ARG C NE  1 
ATOM 7678  C CZ  . ARG C 3 207 ? 86.702  48.128  104.474 1.00 10.00 ? 222 ARG C CZ  1 
ATOM 7679  N NH1 . ARG C 3 207 ? 87.319  47.780  103.359 1.00 10.00 ? 222 ARG C NH1 1 
ATOM 7680  N NH2 . ARG C 3 207 ? 85.389  48.233  104.457 1.00 10.00 ? 222 ARG C NH2 1 
ATOM 7681  N N   . ARG C 3 208 ? 85.724  50.077  107.437 1.00 10.00 ? 223 ARG C N   1 
ATOM 7682  C CA  . ARG C 3 208 ? 84.379  50.010  106.874 1.00 10.00 ? 223 ARG C CA  1 
ATOM 7683  C C   . ARG C 3 208 ? 84.375  50.395  105.413 1.00 10.00 ? 223 ARG C C   1 
ATOM 7684  O O   . ARG C 3 208 ? 85.323  50.982  104.924 1.00 10.00 ? 223 ARG C O   1 
ATOM 7685  C CB  . ARG C 3 208 ? 83.420  50.958  107.588 1.00 10.00 ? 223 ARG C CB  1 
ATOM 7686  C CG  . ARG C 3 208 ? 82.209  51.338  106.739 1.00 10.00 ? 223 ARG C CG  1 
ATOM 7687  C CD  . ARG C 3 208 ? 81.426  52.513  107.278 1.00 10.00 ? 223 ARG C CD  1 
ATOM 7688  N NE  . ARG C 3 208 ? 80.281  52.793  106.416 1.00 10.00 ? 223 ARG C NE  1 
ATOM 7689  C CZ  . ARG C 3 208 ? 79.515  53.875  106.504 1.00 10.00 ? 223 ARG C CZ  1 
ATOM 7690  N NH1 . ARG C 3 208 ? 79.766  54.798  107.424 1.00 10.00 ? 223 ARG C NH1 1 
ATOM 7691  N NH2 . ARG C 3 208 ? 78.499  54.036  105.669 1.00 10.00 ? 223 ARG C NH2 1 
ATOM 7692  N N   . LYS C 3 209 ? 83.290  50.031  104.741 1.00 10.00 ? 224 LYS C N   1 
ATOM 7693  C CA  . LYS C 3 209 ? 83.010  50.338  103.333 1.00 10.00 ? 224 LYS C CA  1 
ATOM 7694  C C   . LYS C 3 209 ? 82.206  49.188  102.775 1.00 10.00 ? 224 LYS C C   1 
ATOM 7695  O O   . LYS C 3 209 ? 82.476  48.007  103.031 1.00 10.00 ? 224 LYS C O   1 
ATOM 7696  C CB  . LYS C 3 209 ? 84.275  50.620  102.484 1.00 10.00 ? 224 LYS C CB  1 
ATOM 7697  C CG  . LYS C 3 209 ? 84.776  52.086  102.566 1.00 10.00 ? 224 LYS C CG  1 
ATOM 7698  C CD  . LYS C 3 209 ? 85.757  52.441  101.459 1.00 10.00 ? 224 LYS C CD  1 
ATOM 7699  C CE  . LYS C 3 209 ? 86.976  51.526  101.489 1.00 10.00 ? 224 LYS C CE  1 
ATOM 7700  N NZ  . LYS C 3 209 ? 87.984  51.754  100.394 1.00 10.00 ? 224 LYS C NZ  1 
ATOM 7701  N N   . PRO C 3 210 ? 81.176  49.527  102.016 1.00 10.00 ? 225 PRO C N   1 
ATOM 7702  C CA  . PRO C 3 210 ? 80.294  48.535  101.421 1.00 10.00 ? 225 PRO C CA  1 
ATOM 7703  C C   . PRO C 3 210 ? 80.867  47.820  100.227 1.00 10.00 ? 225 PRO C C   1 
ATOM 7704  O O   . PRO C 3 210 ? 81.802  48.276  99.587  1.00 10.00 ? 225 PRO C O   1 
ATOM 7705  C CB  . PRO C 3 210 ? 79.065  49.342  101.044 1.00 10.00 ? 225 PRO C CB  1 
ATOM 7706  C CG  . PRO C 3 210 ? 79.685  50.543  100.538 1.00 10.00 ? 225 PRO C CG  1 
ATOM 7707  C CD  . PRO C 3 210 ? 80.773  50.864  101.581 1.00 10.00 ? 225 PRO C CD  1 
ATOM 7708  N N   . LEU C 3 211 ? 80.299  46.652  99.970  1.00 10.00 ? 226 LEU C N   1 
ATOM 7709  C CA  . LEU C 3 211 ? 80.710  45.877  98.816  1.00 10.00 ? 226 LEU C CA  1 
ATOM 7710  C C   . LEU C 3 211 ? 79.426  45.832  98.042  1.00 10.00 ? 226 LEU C C   1 
ATOM 7711  O O   . LEU C 3 211 ? 79.155  44.908  97.278  1.00 10.00 ? 226 LEU C O   1 
ATOM 7712  C CB  . LEU C 3 211 ? 81.163  44.469  99.206  1.00 10.00 ? 226 LEU C CB  1 
ATOM 7713  C CG  . LEU C 3 211 ? 82.581  44.386  99.779  1.00 10.00 ? 226 LEU C CG  1 
ATOM 7714  C CD1 . LEU C 3 211 ? 83.151  43.010  99.460  1.00 10.00 ? 226 LEU C CD1 1 
ATOM 7715  C CD2 . LEU C 3 211 ? 83.476  45.475  99.176  1.00 10.00 ? 226 LEU C CD2 1 
ATOM 7716  N N   . PHE C 3 212 ? 78.683  46.839  98.185  1.00 10.00 ? 227 PHE C N   1 
ATOM 7717  C CA  . PHE C 3 212 ? 77.348  46.900  97.607  1.00 10.00 ? 227 PHE C CA  1 
ATOM 7718  C C   . PHE C 3 212 ? 77.191  48.143  96.745  1.00 10.00 ? 227 PHE C C   1 
ATOM 7719  O O   . PHE C 3 212 ? 76.605  48.095  95.653  1.00 10.00 ? 227 PHE C O   1 
ATOM 7720  C CB  . PHE C 3 212 ? 76.288  46.881  98.707  1.00 10.00 ? 227 PHE C CB  1 
ATOM 7721  C CG  . PHE C 3 212 ? 76.329  45.650  99.559  1.00 10.00 ? 227 PHE C CG  1 
ATOM 7722  C CD1 . PHE C 3 212 ? 77.409  45.405  100.390 1.00 10.00 ? 227 PHE C CD1 1 
ATOM 7723  C CD2 . PHE C 3 212 ? 75.289  44.739  99.526  1.00 10.00 ? 227 PHE C CD2 1 
ATOM 7724  C CE1 . PHE C 3 212 ? 77.451  44.269  101.176 1.00 10.00 ? 227 PHE C CE1 1 
ATOM 7725  C CE2 . PHE C 3 212 ? 75.324  43.601  100.309 1.00 10.00 ? 227 PHE C CE2 1 
ATOM 7726  C CZ  . PHE C 3 212 ? 76.406  43.366  101.136 1.00 10.00 ? 227 PHE C CZ  1 
ATOM 7727  N N   . TYR C 3 213 ? 77.802  49.311  97.300  1.00 10.00 ? 228 TYR C N   1 
ATOM 7728  C CA  . TYR C 3 213 ? 77.680  50.528  96.483  1.00 10.00 ? 228 TYR C CA  1 
ATOM 7729  C C   . TYR C 3 213 ? 78.400  50.212  95.165  1.00 10.00 ? 228 TYR C C   1 
ATOM 7730  O O   . TYR C 3 213 ? 77.905  50.535  94.092  1.00 10.00 ? 228 TYR C O   1 
ATOM 7731  C CB  . TYR C 3 213 ? 78.279  51.765  97.187  1.00 10.00 ? 228 TYR C CB  1 
ATOM 7732  C CG  . TYR C 3 213 ? 79.790  51.834  97.349  1.00 10.00 ? 228 TYR C CG  1 
ATOM 7733  C CD1 . TYR C 3 213 ? 80.433  53.071  97.430  1.00 10.00 ? 228 TYR C CD1 1 
ATOM 7734  C CD2 . TYR C 3 213 ? 80.572  50.684  97.444  1.00 10.00 ? 228 TYR C CD2 1 
ATOM 7735  C CE1 . TYR C 3 213 ? 81.811  53.162  97.597  1.00 10.00 ? 228 TYR C CE1 1 
ATOM 7736  C CE2 . TYR C 3 213 ? 81.955  50.764  97.611  1.00 10.00 ? 228 TYR C CE2 1 
ATOM 7737  C CZ  . TYR C 3 213 ? 82.567  52.006  97.686  1.00 10.00 ? 228 TYR C CZ  1 
ATOM 7738  O OH  . TYR C 3 213 ? 83.931  52.092  97.842  1.00 10.00 ? 228 TYR C OH  1 
ATOM 7739  N N   . VAL C 3 214 ? 79.565  49.556  95.269  1.00 10.00 ? 229 VAL C N   1 
ATOM 7740  C CA  . VAL C 3 214 ? 80.385  49.075  94.134  1.00 10.00 ? 229 VAL C CA  1 
ATOM 7741  C C   . VAL C 3 214 ? 79.546  48.332  93.111  1.00 10.00 ? 229 VAL C C   1 
ATOM 7742  O O   . VAL C 3 214 ? 79.699  48.502  91.901  1.00 10.00 ? 229 VAL C O   1 
ATOM 7743  C CB  . VAL C 3 214 ? 81.438  48.057  94.609  1.00 10.00 ? 229 VAL C CB  1 
ATOM 7744  C CG1 . VAL C 3 214 ? 82.835  48.617  94.454  1.00 10.00 ? 229 VAL C CG1 1 
ATOM 7745  C CG2 . VAL C 3 214 ? 81.179  47.705  96.055  1.00 10.00 ? 229 VAL C CG2 1 
ATOM 7746  N N   . ILE C 3 215 ? 78.608  47.548  93.617  1.00 10.00 ? 230 ILE C N   1 
ATOM 7747  C CA  . ILE C 3 215 ? 77.771  46.717  92.756  1.00 10.00 ? 230 ILE C CA  1 
ATOM 7748  C C   . ILE C 3 215 ? 76.897  47.518  91.794  1.00 10.00 ? 230 ILE C C   1 
ATOM 7749  O O   . ILE C 3 215 ? 77.189  47.570  90.602  1.00 10.00 ? 230 ILE C O   1 
ATOM 7750  C CB  . ILE C 3 215 ? 76.887  45.703  93.590  1.00 10.00 ? 230 ILE C CB  1 
ATOM 7751  C CG1 . ILE C 3 215 ? 75.635  46.389  94.133  1.00 10.00 ? 230 ILE C CG1 1 
ATOM 7752  C CG2 . ILE C 3 215 ? 77.721  45.089  94.722  1.00 10.00 ? 230 ILE C CG2 1 
ATOM 7753  C CD1 . ILE C 3 215 ? 74.815  45.526  95.002  1.00 10.00 ? 230 ILE C CD1 1 
ATOM 7754  N N   . ASN C 3 216 ? 75.868  48.179  92.310  1.00 10.00 ? 231 ASN C N   1 
ATOM 7755  C CA  . ASN C 3 216 ? 74.947  48.964  91.476  1.00 10.00 ? 231 ASN C CA  1 
ATOM 7756  C C   . ASN C 3 216 ? 75.571  50.276  90.945  1.00 10.00 ? 231 ASN C C   1 
ATOM 7757  O O   . ASN C 3 216 ? 74.973  50.921  90.086  1.00 10.00 ? 231 ASN C O   1 
ATOM 7758  C CB  . ASN C 3 216 ? 73.621  49.323  92.222  1.00 10.00 ? 231 ASN C CB  1 
ATOM 7759  C CG  . ASN C 3 216 ? 72.689  48.090  92.535  1.00 10.00 ? 231 ASN C CG  1 
ATOM 7760  O OD1 . ASN C 3 216 ? 71.501  48.065  92.157  1.00 10.00 ? 231 ASN C OD1 1 
ATOM 7761  N ND2 . ASN C 3 216 ? 73.221  47.113  93.256  1.00 10.00 ? 231 ASN C ND2 1 
ATOM 7762  N N   . PHE C 3 217 ? 76.749  50.684  91.432  1.00 10.00 ? 232 PHE C N   1 
ATOM 7763  C CA  . PHE C 3 217 ? 77.354  51.927  90.945  1.00 10.00 ? 232 PHE C CA  1 
ATOM 7764  C C   . PHE C 3 217 ? 78.371  51.789  89.804  1.00 10.00 ? 232 PHE C C   1 
ATOM 7765  O O   . PHE C 3 217 ? 78.440  52.667  88.947  1.00 10.00 ? 232 PHE C O   1 
ATOM 7766  C CB  . PHE C 3 217 ? 77.970  52.728  92.102  1.00 10.00 ? 232 PHE C CB  1 
ATOM 7767  C CG  . PHE C 3 217 ? 77.083  53.838  92.612  1.00 10.00 ? 232 PHE C CG  1 
ATOM 7768  C CD1 . PHE C 3 217 ? 75.898  53.556  93.282  1.00 10.00 ? 232 PHE C CD1 1 
ATOM 7769  C CD2 . PHE C 3 217 ? 77.430  55.167  92.417  1.00 10.00 ? 232 PHE C CD2 1 
ATOM 7770  C CE1 . PHE C 3 217 ? 75.073  54.591  93.752  1.00 10.00 ? 232 PHE C CE1 1 
ATOM 7771  C CE2 . PHE C 3 217 ? 76.613  56.199  92.881  1.00 10.00 ? 232 PHE C CE2 1 
ATOM 7772  C CZ  . PHE C 3 217 ? 75.435  55.911  93.549  1.00 10.00 ? 232 PHE C CZ  1 
ATOM 7773  N N   . ILE C 3 218 ? 79.160  50.716  89.784  1.00 10.00 ? 233 ILE C N   1 
ATOM 7774  C CA  . ILE C 3 218 ? 80.122  50.518  88.695  1.00 10.00 ? 233 ILE C CA  1 
ATOM 7775  C C   . ILE C 3 218 ? 79.336  49.842  87.594  1.00 10.00 ? 233 ILE C C   1 
ATOM 7776  O O   . ILE C 3 218 ? 79.703  49.899  86.416  1.00 10.00 ? 233 ILE C O   1 
ATOM 7777  C CB  . ILE C 3 218 ? 81.305  49.522  89.034  1.00 10.00 ? 233 ILE C CB  1 
ATOM 7778  C CG1 . ILE C 3 218 ? 81.656  49.533  90.527  1.00 10.00 ? 233 ILE C CG1 1 
ATOM 7779  C CG2 . ILE C 3 218 ? 82.522  49.810  88.141  1.00 10.00 ? 233 ILE C CG2 1 
ATOM 7780  C CD1 . ILE C 3 218 ? 81.563  50.871  91.208  1.00 10.00 ? 233 ILE C CD1 1 
ATOM 7781  N N   . THR C 3 219 ? 78.314  49.095  88.007  1.00 10.00 ? 234 THR C N   1 
ATOM 7782  C CA  . THR C 3 219 ? 77.419  48.362  87.099  1.00 10.00 ? 234 THR C CA  1 
ATOM 7783  C C   . THR C 3 219 ? 76.973  49.252  85.954  1.00 10.00 ? 234 THR C C   1 
ATOM 7784  O O   . THR C 3 219 ? 77.115  48.893  84.789  1.00 10.00 ? 234 THR C O   1 
ATOM 7785  C CB  . THR C 3 219 ? 76.128  47.848  87.823  1.00 10.00 ? 234 THR C CB  1 
ATOM 7786  O OG1 . THR C 3 219 ? 76.420  46.648  88.546  1.00 10.00 ? 234 THR C OG1 1 
ATOM 7787  C CG2 . THR C 3 219 ? 75.001  47.581  86.824  1.00 10.00 ? 234 THR C CG2 1 
ATOM 7788  N N   . PRO C 3 220 ? 76.415  50.427  86.280  1.00 10.00 ? 235 PRO C N   1 
ATOM 7789  C CA  . PRO C 3 220 ? 75.944  51.371  85.261  1.00 10.00 ? 235 PRO C CA  1 
ATOM 7790  C C   . PRO C 3 220 ? 77.082  51.952  84.458  1.00 10.00 ? 235 PRO C C   1 
ATOM 7791  O O   . PRO C 3 220 ? 76.894  52.378  83.328  1.00 10.00 ? 235 PRO C O   1 
ATOM 7792  C CB  . PRO C 3 220 ? 75.219  52.428  86.093  1.00 10.00 ? 235 PRO C CB  1 
ATOM 7793  C CG  . PRO C 3 220 ? 76.110  52.541  87.287  1.00 10.00 ? 235 PRO C CG  1 
ATOM 7794  C CD  . PRO C 3 220 ? 76.450  51.080  87.606  1.00 10.00 ? 235 PRO C CD  1 
ATOM 7795  N N   . CYS C 3 221 ? 78.265  51.969  85.052  1.00 10.00 ? 236 CYS C N   1 
ATOM 7796  C CA  . CYS C 3 221 ? 79.382  52.544  84.345  1.00 10.00 ? 236 CYS C CA  1 
ATOM 7797  C C   . CYS C 3 221 ? 79.794  51.696  83.154  1.00 10.00 ? 236 CYS C C   1 
ATOM 7798  O O   . CYS C 3 221 ? 80.024  52.237  82.080  1.00 10.00 ? 236 CYS C O   1 
ATOM 7799  C CB  . CYS C 3 221 ? 80.570  52.786  85.287  1.00 10.00 ? 236 CYS C CB  1 
ATOM 7800  S SG  . CYS C 3 221 ? 80.602  54.408  86.066  1.00 10.00 ? 236 CYS C SG  1 
ATOM 7801  N N   . VAL C 3 222 ? 79.914  50.384  83.321  1.00 10.00 ? 237 VAL C N   1 
ATOM 7802  C CA  . VAL C 3 222 ? 80.283  49.583  82.176  1.00 10.00 ? 237 VAL C CA  1 
ATOM 7803  C C   . VAL C 3 222 ? 79.060  49.496  81.255  1.00 10.00 ? 237 VAL C C   1 
ATOM 7804  O O   . VAL C 3 222 ? 79.197  49.353  80.031  1.00 10.00 ? 237 VAL C O   1 
ATOM 7805  C CB  . VAL C 3 222 ? 80.777  48.204  82.614  1.00 10.00 ? 237 VAL C CB  1 
ATOM 7806  C CG1 . VAL C 3 222 ? 81.729  48.373  83.773  1.00 10.00 ? 237 VAL C CG1 1 
ATOM 7807  C CG2 . VAL C 3 222 ? 79.615  47.313  82.981  1.00 10.00 ? 237 VAL C CG2 1 
ATOM 7808  N N   . LEU C 3 223 ? 77.861  49.603  81.830  1.00 10.00 ? 238 LEU C N   1 
ATOM 7809  C CA  . LEU C 3 223 ? 76.668  49.581  80.996  1.00 10.00 ? 238 LEU C CA  1 
ATOM 7810  C C   . LEU C 3 223 ? 76.616  50.916  80.274  1.00 10.00 ? 238 LEU C C   1 
ATOM 7811  O O   . LEU C 3 223 ? 76.550  50.933  79.059  1.00 10.00 ? 238 LEU C O   1 
ATOM 7812  C CB  . LEU C 3 223 ? 75.392  49.384  81.814  1.00 10.00 ? 238 LEU C CB  1 
ATOM 7813  C CG  . LEU C 3 223 ? 74.923  47.937  81.874  1.00 10.00 ? 238 LEU C CG  1 
ATOM 7814  C CD1 . LEU C 3 223 ? 76.016  47.077  82.526  1.00 10.00 ? 238 LEU C CD1 1 
ATOM 7815  C CD2 . LEU C 3 223 ? 73.599  47.871  82.617  1.00 10.00 ? 238 LEU C CD2 1 
ATOM 7816  N N   . ILE C 3 224 ? 76.633  52.024  81.023  1.00 10.00 ? 239 ILE C N   1 
ATOM 7817  C CA  . ILE C 3 224 ? 76.630  53.358  80.439  1.00 10.00 ? 239 ILE C CA  1 
ATOM 7818  C C   . ILE C 3 224 ? 77.829  53.478  79.479  1.00 10.00 ? 239 ILE C C   1 
ATOM 7819  O O   . ILE C 3 224 ? 77.669  53.853  78.317  1.00 10.00 ? 239 ILE C O   1 
ATOM 7820  C CB  . ILE C 3 224 ? 76.709  54.442  81.564  1.00 10.00 ? 239 ILE C CB  1 
ATOM 7821  C CG1 . ILE C 3 224 ? 75.302  54.718  82.142  1.00 10.00 ? 239 ILE C CG1 1 
ATOM 7822  C CG2 . ILE C 3 224 ? 77.406  55.692  81.047  1.00 10.00 ? 239 ILE C CG2 1 
ATOM 7823  C CD1 . ILE C 3 224 ? 74.314  55.481  81.214  1.00 10.00 ? 239 ILE C CD1 1 
ATOM 7824  N N   . SER C 3 225 ? 79.025  53.139  79.953  1.00 10.00 ? 240 SER C N   1 
ATOM 7825  C CA  . SER C 3 225 ? 80.215  53.218  79.114  1.00 10.00 ? 240 SER C CA  1 
ATOM 7826  C C   . SER C 3 225 ? 80.007  52.481  77.802  1.00 10.00 ? 240 SER C C   1 
ATOM 7827  O O   . SER C 3 225 ? 80.432  52.962  76.755  1.00 10.00 ? 240 SER C O   1 
ATOM 7828  C CB  . SER C 3 225 ? 81.444  52.636  79.818  1.00 10.00 ? 240 SER C CB  1 
ATOM 7829  O OG  . SER C 3 225 ? 81.961  53.502  80.814  1.00 10.00 ? 240 SER C OG  1 
ATOM 7830  N N   . PHE C 3 226 ? 79.363  51.319  77.823  1.00 10.00 ? 241 PHE C N   1 
ATOM 7831  C CA  . PHE C 3 226 ? 79.196  50.667  76.533  1.00 10.00 ? 241 PHE C CA  1 
ATOM 7832  C C   . PHE C 3 226 ? 78.321  51.541  75.633  1.00 10.00 ? 241 PHE C C   1 
ATOM 7833  O O   . PHE C 3 226 ? 78.512  51.552  74.439  1.00 10.00 ? 241 PHE C O   1 
ATOM 7834  C CB  . PHE C 3 226 ? 78.661  49.226  76.674  1.00 10.00 ? 241 PHE C CB  1 
ATOM 7835  C CG  . PHE C 3 226 ? 77.186  49.116  76.897  1.00 10.00 ? 241 PHE C CG  1 
ATOM 7836  C CD1 . PHE C 3 226 ? 76.287  49.721  76.041  1.00 10.00 ? 241 PHE C CD1 1 
ATOM 7837  C CD2 . PHE C 3 226 ? 76.702  48.322  77.926  1.00 10.00 ? 241 PHE C CD2 1 
ATOM 7838  C CE1 . PHE C 3 226 ? 74.943  49.531  76.210  1.00 10.00 ? 241 PHE C CE1 1 
ATOM 7839  C CE2 . PHE C 3 226 ? 75.356  48.128  78.097  1.00 10.00 ? 241 PHE C CE2 1 
ATOM 7840  C CZ  . PHE C 3 226 ? 74.480  48.728  77.243  1.00 10.00 ? 241 PHE C CZ  1 
ATOM 7841  N N   . LEU C 3 227 ? 77.393  52.308  76.213  1.00 10.00 ? 242 LEU C N   1 
ATOM 7842  C CA  . LEU C 3 227 ? 76.544  53.207  75.387  1.00 10.00 ? 242 LEU C CA  1 
ATOM 7843  C C   . LEU C 3 227 ? 77.478  54.233  74.714  1.00 10.00 ? 242 LEU C C   1 
ATOM 7844  O O   . LEU C 3 227 ? 77.440  54.430  73.493  1.00 10.00 ? 242 LEU C O   1 
ATOM 7845  C CB  . LEU C 3 227 ? 75.443  53.955  76.220  1.00 10.00 ? 242 LEU C CB  1 
ATOM 7846  C CG  . LEU C 3 227 ? 74.059  54.158  75.527  1.00 10.00 ? 242 LEU C CG  1 
ATOM 7847  C CD1 . LEU C 3 227 ? 72.897  53.652  76.349  1.00 10.00 ? 242 LEU C CD1 1 
ATOM 7848  C CD2 . LEU C 3 227 ? 73.843  55.585  75.227  1.00 10.00 ? 242 LEU C CD2 1 
ATOM 7849  N N   . ALA C 3 228 ? 78.337  54.870  75.506  1.00 10.00 ? 243 ALA C N   1 
ATOM 7850  C CA  . ALA C 3 228 ? 79.272  55.855  74.962  1.00 10.00 ? 243 ALA C CA  1 
ATOM 7851  C C   . ALA C 3 228 ? 80.316  55.093  74.159  1.00 10.00 ? 243 ALA C C   1 
ATOM 7852  O O   . ALA C 3 228 ? 80.872  55.604  73.185  1.00 10.00 ? 243 ALA C O   1 
ATOM 7853  C CB  . ALA C 3 228 ? 79.948  56.670  76.095  1.00 10.00 ? 243 ALA C CB  1 
ATOM 7854  N N   . ALA C 3 229 ? 80.556  53.850  74.558  1.00 10.00 ? 244 ALA C N   1 
ATOM 7855  C CA  . ALA C 3 229 ? 81.523  53.036  73.883  1.00 10.00 ? 244 ALA C CA  1 
ATOM 7856  C C   . ALA C 3 229 ? 80.881  52.678  72.527  1.00 10.00 ? 244 ALA C C   1 
ATOM 7857  O O   . ALA C 3 229 ? 81.494  52.820  71.460  1.00 10.00 ? 244 ALA C O   1 
ATOM 7858  C CB  . ALA C 3 229 ? 81.791  51.801  74.728  1.00 10.00 ? 244 ALA C CB  1 
ATOM 7859  N N   . LEU C 3 230 ? 79.623  52.225  72.580  1.00 10.00 ? 245 LEU C N   1 
ATOM 7860  C CA  . LEU C 3 230 ? 78.866  51.866  71.396  1.00 10.00 ? 245 LEU C CA  1 
ATOM 7861  C C   . LEU C 3 230 ? 78.632  53.180  70.663  1.00 10.00 ? 245 LEU C C   1 
ATOM 7862  O O   . LEU C 3 230 ? 78.549  53.208  69.442  1.00 10.00 ? 245 LEU C O   1 
ATOM 7863  C CB  . LEU C 3 230 ? 77.521  51.224  71.783  1.00 10.00 ? 245 LEU C CB  1 
ATOM 7864  C CG  . LEU C 3 230 ? 77.465  50.075  72.805  1.00 10.00 ? 245 LEU C CG  1 
ATOM 7865  C CD1 . LEU C 3 230 ? 76.053  49.521  72.864  1.00 10.00 ? 245 LEU C CD1 1 
ATOM 7866  C CD2 . LEU C 3 230 ? 78.467  48.993  72.444  1.00 10.00 ? 245 LEU C CD2 1 
ATOM 7867  N N   . ALA C 3 231 ? 78.533  54.268  71.427  1.00 10.00 ? 246 ALA C N   1 
ATOM 7868  C CA  . ALA C 3 231 ? 78.330  55.599  70.866  1.00 10.00 ? 246 ALA C CA  1 
ATOM 7869  C C   . ALA C 3 231 ? 79.229  55.731  69.666  1.00 10.00 ? 246 ALA C C   1 
ATOM 7870  O O   . ALA C 3 231 ? 78.788  56.114  68.585  1.00 10.00 ? 246 ALA C O   1 
ATOM 7871  C CB  . ALA C 3 231 ? 78.700  56.664  71.876  1.00 10.00 ? 246 ALA C CB  1 
ATOM 7872  N N   . PHE C 3 232 ? 80.501  55.409  69.870  1.00 10.00 ? 247 PHE C N   1 
ATOM 7873  C CA  . PHE C 3 232 ? 81.473  55.498  68.774  1.00 10.00 ? 247 PHE C CA  1 
ATOM 7874  C C   . PHE C 3 232 ? 81.474  54.342  67.780  1.00 10.00 ? 247 PHE C C   1 
ATOM 7875  O O   . PHE C 3 232 ? 82.028  54.465  66.703  1.00 10.00 ? 247 PHE C O   1 
ATOM 7876  C CB  . PHE C 3 232 ? 82.891  55.728  69.311  1.00 10.00 ? 247 PHE C CB  1 
ATOM 7877  C CG  . PHE C 3 232 ? 83.268  57.173  69.357  1.00 10.00 ? 247 PHE C CG  1 
ATOM 7878  C CD1 . PHE C 3 232 ? 82.671  58.023  70.279  1.00 10.00 ? 247 PHE C CD1 1 
ATOM 7879  C CD2 . PHE C 3 232 ? 84.132  57.707  68.410  1.00 10.00 ? 247 PHE C CD2 1 
ATOM 7880  C CE1 . PHE C 3 232 ? 82.921  59.384  70.252  1.00 10.00 ? 247 PHE C CE1 1 
ATOM 7881  C CE2 . PHE C 3 232 ? 84.388  59.068  68.374  1.00 10.00 ? 247 PHE C CE2 1 
ATOM 7882  C CZ  . PHE C 3 232 ? 83.780  59.907  69.295  1.00 10.00 ? 247 PHE C CZ  1 
ATOM 7883  N N   . TYR C 3 233 ? 80.885  53.228  68.186  1.00 10.00 ? 248 TYR C N   1 
ATOM 7884  C CA  . TYR C 3 233 ? 80.689  52.099  67.285  1.00 10.00 ? 248 TYR C CA  1 
ATOM 7885  C C   . TYR C 3 233 ? 79.446  52.301  66.428  1.00 10.00 ? 248 TYR C C   1 
ATOM 7886  O O   . TYR C 3 233 ? 79.335  51.891  65.295  1.00 10.00 ? 248 TYR C O   1 
ATOM 7887  C CB  . TYR C 3 233 ? 80.601  50.791  68.074  1.00 10.00 ? 248 TYR C CB  1 
ATOM 7888  C CG  . TYR C 3 233 ? 81.845  50.474  68.877  1.00 10.00 ? 248 TYR C CG  1 
ATOM 7889  C CD1 . TYR C 3 233 ? 81.973  50.900  70.191  1.00 10.00 ? 248 TYR C CD1 1 
ATOM 7890  C CD2 . TYR C 3 233 ? 82.891  49.750  68.318  1.00 10.00 ? 248 TYR C CD2 1 
ATOM 7891  C CE1 . TYR C 3 233 ? 83.104  50.613  70.928  1.00 10.00 ? 248 TYR C CE1 1 
ATOM 7892  C CE2 . TYR C 3 233 ? 84.027  49.456  69.048  1.00 10.00 ? 248 TYR C CE2 1 
ATOM 7893  C CZ  . TYR C 3 233 ? 84.128  49.890  70.353  1.00 10.00 ? 248 TYR C CZ  1 
ATOM 7894  O OH  . TYR C 3 233 ? 85.258  49.600  71.083  1.00 10.00 ? 248 TYR C OH  1 
ATOM 7895  N N   . LEU C 3 234 ? 78.524  53.044  67.059  1.00 10.00 ? 249 LEU C N   1 
ATOM 7896  C CA  . LEU C 3 234 ? 77.216  53.348  66.457  1.00 10.00 ? 249 LEU C CA  1 
ATOM 7897  C C   . LEU C 3 234 ? 77.231  54.439  65.374  1.00 10.00 ? 249 LEU C C   1 
ATOM 7898  O O   . LEU C 3 234 ? 76.344  54.471  64.515  1.00 10.00 ? 249 LEU C O   1 
ATOM 7899  C CB  . LEU C 3 234 ? 76.165  53.677  67.558  1.00 10.00 ? 249 LEU C CB  1 
ATOM 7900  C CG  . LEU C 3 234 ? 75.633  52.561  68.474  1.00 10.00 ? 249 LEU C CG  1 
ATOM 7901  C CD1 . LEU C 3 234 ? 76.757  51.565  68.626  1.00 10.00 ? 249 LEU C CD1 1 
ATOM 7902  C CD2 . LEU C 3 234 ? 75.145  53.087  69.844  1.00 10.00 ? 249 LEU C CD2 1 
ATOM 7903  N N   . PRO C 3 235 ? 78.243  55.339  65.400  1.00 10.00 ? 250 PRO C N   1 
ATOM 7904  C CA  . PRO C 3 235 ? 78.443  56.438  64.449  1.00 10.00 ? 250 PRO C CA  1 
ATOM 7905  C C   . PRO C 3 235 ? 78.747  55.812  63.078  1.00 10.00 ? 250 PRO C C   1 
ATOM 7906  O O   . PRO C 3 235 ? 78.624  56.439  62.023  1.00 10.00 ? 250 PRO C O   1 
ATOM 7907  C CB  . PRO C 3 235 ? 79.681  57.140  65.018  1.00 10.00 ? 250 PRO C CB  1 
ATOM 7908  C CG  . PRO C 3 235 ? 80.460  55.988  65.547  1.00 10.00 ? 250 PRO C CG  1 
ATOM 7909  C CD  . PRO C 3 235 ? 79.399  55.256  66.306  1.00 10.00 ? 250 PRO C CD  1 
ATOM 7910  N N   . ALA C 3 236 ? 79.154  54.551  63.144  1.00 10.00 ? 251 ALA C N   1 
ATOM 7911  C CA  . ALA C 3 236 ? 79.521  53.806  61.951  1.00 10.00 ? 251 ALA C CA  1 
ATOM 7912  C C   . ALA C 3 236 ? 78.348  52.998  61.478  1.00 10.00 ? 251 ALA C C   1 
ATOM 7913  O O   . ALA C 3 236 ? 77.874  53.198  60.370  1.00 10.00 ? 251 ALA C O   1 
ATOM 7914  C CB  . ALA C 3 236 ? 80.683  52.886  62.238  1.00 10.00 ? 251 ALA C CB  1 
ATOM 7915  N N   . GLU C 3 237 ? 77.893  52.078  62.323  1.00 10.00 ? 252 GLU C N   1 
ATOM 7916  C CA  . GLU C 3 237 ? 76.760  51.236  61.981  1.00 10.00 ? 252 GLU C CA  1 
ATOM 7917  C C   . GLU C 3 237 ? 75.594  52.049  61.454  1.00 10.00 ? 252 GLU C C   1 
ATOM 7918  O O   . GLU C 3 237 ? 74.775  51.540  60.689  1.00 10.00 ? 252 GLU C O   1 
ATOM 7919  C CB  . GLU C 3 237 ? 76.298  50.430  63.196  1.00 10.00 ? 252 GLU C CB  1 
ATOM 7920  C CG  . GLU C 3 237 ? 75.255  49.364  62.872  1.00 10.00 ? 252 GLU C CG  1 
ATOM 7921  C CD  . GLU C 3 237 ? 75.823  48.217  62.052  1.00 10.00 ? 252 GLU C CD  1 
ATOM 7922  O OE1 . GLU C 3 237 ? 76.268  48.452  60.909  1.00 10.00 ? 252 GLU C OE1 1 
ATOM 7923  O OE2 . GLU C 3 237 ? 75.827  47.075  62.554  1.00 10.00 ? 252 GLU C OE2 1 
ATOM 7924  N N   . SER C 3 238 ? 75.541  53.314  61.842  1.00 10.00 ? 253 SER C N   1 
ATOM 7925  C CA  . SER C 3 238 ? 74.451  54.177  61.403  1.00 10.00 ? 253 SER C CA  1 
ATOM 7926  C C   . SER C 3 238 ? 74.546  55.559  62.062  1.00 10.00 ? 253 SER C C   1 
ATOM 7927  O O   . SER C 3 238 ? 73.836  55.838  63.030  1.00 10.00 ? 253 SER C O   1 
ATOM 7928  C CB  . SER C 3 238 ? 73.108  53.501  61.741  1.00 10.00 ? 253 SER C CB  1 
ATOM 7929  O OG  . SER C 3 238 ? 72.001  54.367  61.548  1.00 10.00 ? 253 SER C OG  1 
ATOM 7930  N N   . GLY C 3 239 ? 75.425  56.423  61.551  1.00 10.00 ? 254 GLY C N   1 
ATOM 7931  C CA  . GLY C 3 239 ? 75.550  57.743  62.140  1.00 10.00 ? 254 GLY C CA  1 
ATOM 7932  C C   . GLY C 3 239 ? 74.377  58.618  61.765  1.00 10.00 ? 254 GLY C C   1 
ATOM 7933  O O   . GLY C 3 239 ? 74.256  59.729  62.281  1.00 10.00 ? 254 GLY C O   1 
ATOM 7934  N N   . GLU C 3 240 ? 73.558  58.154  60.828  1.00 10.00 ? 255 GLU C N   1 
ATOM 7935  C CA  . GLU C 3 240 ? 72.408  58.911  60.387  1.00 10.00 ? 255 GLU C CA  1 
ATOM 7936  C C   . GLU C 3 240 ? 71.359  59.131  61.473  1.00 10.00 ? 255 GLU C C   1 
ATOM 7937  O O   . GLU C 3 240 ? 70.398  59.880  61.270  1.00 10.00 ? 255 GLU C O   1 
ATOM 7938  C CB  . GLU C 3 240 ? 71.744  58.232  59.182  1.00 10.00 ? 255 GLU C CB  1 
ATOM 7939  C CG  . GLU C 3 240 ? 72.479  58.304  57.852  1.00 10.00 ? 255 GLU C CG  1 
ATOM 7940  C CD  . GLU C 3 240 ? 71.513  58.416  56.666  1.00 10.00 ? 255 GLU C CD  1 
ATOM 7941  O OE1 . GLU C 3 240 ? 71.985  58.362  55.508  1.00 10.00 ? 255 GLU C OE1 1 
ATOM 7942  O OE2 . GLU C 3 240 ? 70.288  58.562  56.894  1.00 10.00 ? 255 GLU C OE2 1 
ATOM 7943  N N   . LYS C 3 241 ? 71.506  58.442  62.596  1.00 10.00 ? 256 LYS C N   1 
ATOM 7944  C CA  . LYS C 3 241 ? 70.552  58.613  63.682  1.00 10.00 ? 256 LYS C CA  1 
ATOM 7945  C C   . LYS C 3 241 ? 71.012  59.898  64.399  1.00 10.00 ? 256 LYS C C   1 
ATOM 7946  O O   . LYS C 3 241 ? 71.135  59.912  65.616  1.00 10.00 ? 256 LYS C O   1 
ATOM 7947  C CB  . LYS C 3 241 ? 70.573  57.397  64.658  1.00 10.00 ? 256 LYS C CB  1 
ATOM 7948  C CG  . LYS C 3 241 ? 71.101  56.045  64.124  1.00 10.00 ? 256 LYS C CG  1 
ATOM 7949  C CD  . LYS C 3 241 ? 71.216  55.010  65.254  1.00 10.00 ? 256 LYS C CD  1 
ATOM 7950  C CE  . LYS C 3 241 ? 72.133  55.433  66.418  1.00 10.00 ? 256 LYS C CE  1 
ATOM 7951  N NZ  . LYS C 3 241 ? 73.605  55.267  66.187  1.00 10.00 ? 256 LYS C NZ  1 
ATOM 7952  N N   . MET C 3 242 ? 71.260  60.970  63.634  1.00 10.00 ? 257 MET C N   1 
ATOM 7953  C CA  . MET C 3 242 ? 71.742  62.243  64.186  1.00 10.00 ? 257 MET C CA  1 
ATOM 7954  C C   . MET C 3 242 ? 70.948  62.716  65.425  1.00 10.00 ? 257 MET C C   1 
ATOM 7955  O O   . MET C 3 242 ? 71.432  62.622  66.553  1.00 10.00 ? 257 MET C O   1 
ATOM 7956  C CB  . MET C 3 242 ? 71.732  63.350  63.098  1.00 10.00 ? 257 MET C CB  1 
ATOM 7957  C CG  . MET C 3 242 ? 72.728  63.232  61.936  1.00 10.00 ? 257 MET C CG  1 
ATOM 7958  S SD  . MET C 3 242 ? 74.497  63.235  62.356  1.00 10.00 ? 257 MET C SD  1 
ATOM 7959  C CE  . MET C 3 242 ? 74.878  64.875  63.047  1.00 10.00 ? 257 MET C CE  1 
ATOM 7960  N N   . SER C 3 243 ? 69.747  63.242  65.196  1.00 10.00 ? 258 SER C N   1 
ATOM 7961  C CA  . SER C 3 243 ? 68.834  63.736  66.249  1.00 10.00 ? 258 SER C CA  1 
ATOM 7962  C C   . SER C 3 243 ? 68.614  62.745  67.375  1.00 10.00 ? 258 SER C C   1 
ATOM 7963  O O   . SER C 3 243 ? 68.630  63.095  68.562  1.00 10.00 ? 258 SER C O   1 
ATOM 7964  C CB  . SER C 3 243 ? 67.459  64.087  65.640  1.00 10.00 ? 258 SER C CB  1 
ATOM 7965  O OG  . SER C 3 243 ? 66.568  64.692  66.574  1.00 10.00 ? 258 SER C OG  1 
ATOM 7966  N N   . THR C 3 244 ? 68.379  61.495  66.991  1.00 10.00 ? 259 THR C N   1 
ATOM 7967  C CA  . THR C 3 244 ? 68.118  60.413  67.946  1.00 10.00 ? 259 THR C CA  1 
ATOM 7968  C C   . THR C 3 244 ? 69.377  60.110  68.754  1.00 10.00 ? 259 THR C C   1 
ATOM 7969  O O   . THR C 3 244 ? 69.313  59.748  69.922  1.00 10.00 ? 259 THR C O   1 
ATOM 7970  C CB  . THR C 3 244 ? 67.566  59.128  67.213  1.00 10.00 ? 259 THR C CB  1 
ATOM 7971  O OG1 . THR C 3 244 ? 66.573  58.508  68.034  1.00 10.00 ? 259 THR C OG1 1 
ATOM 7972  C CG2 . THR C 3 244 ? 68.649  58.124  66.939  1.00 10.00 ? 259 THR C CG2 1 
ATOM 7973  N N   . ALA C 3 245 ? 70.526  60.326  68.133  1.00 10.00 ? 260 ALA C N   1 
ATOM 7974  C CA  . ALA C 3 245 ? 71.801  60.087  68.772  1.00 10.00 ? 260 ALA C CA  1 
ATOM 7975  C C   . ALA C 3 245 ? 71.965  61.216  69.818  1.00 10.00 ? 260 ALA C C   1 
ATOM 7976  O O   . ALA C 3 245 ? 72.476  61.018  70.931  1.00 10.00 ? 260 ALA C O   1 
ATOM 7977  C CB  . ALA C 3 245 ? 72.887  60.117  67.737  1.00 10.00 ? 260 ALA C CB  1 
ATOM 7978  N N   . ILE C 3 246 ? 71.491  62.393  69.424  1.00 10.00 ? 261 ILE C N   1 
ATOM 7979  C CA  . ILE C 3 246 ? 71.469  63.629  70.191  1.00 10.00 ? 261 ILE C CA  1 
ATOM 7980  C C   . ILE C 3 246 ? 70.543  63.417  71.400  1.00 10.00 ? 261 ILE C C   1 
ATOM 7981  O O   . ILE C 3 246 ? 70.854  63.778  72.552  1.00 10.00 ? 261 ILE C O   1 
ATOM 7982  C CB  . ILE C 3 246 ? 70.964  64.757  69.244  1.00 10.00 ? 261 ILE C CB  1 
ATOM 7983  C CG1 . ILE C 3 246 ? 72.011  64.977  68.144  1.00 10.00 ? 261 ILE C CG1 1 
ATOM 7984  C CG2 . ILE C 3 246 ? 70.610  65.999  70.020  1.00 10.00 ? 261 ILE C CG2 1 
ATOM 7985  C CD1 . ILE C 3 246 ? 73.473  64.829  68.618  1.00 10.00 ? 261 ILE C CD1 1 
ATOM 7986  N N   . CYS C 3 247 ? 69.385  62.833  71.132  1.00 10.00 ? 262 CYS C N   1 
ATOM 7987  C CA  . CYS C 3 247 ? 68.473  62.511  72.222  1.00 10.00 ? 262 CYS C CA  1 
ATOM 7988  C C   . CYS C 3 247 ? 69.187  61.745  73.329  1.00 10.00 ? 262 CYS C C   1 
ATOM 7989  O O   . CYS C 3 247 ? 69.037  62.057  74.486  1.00 10.00 ? 262 CYS C O   1 
ATOM 7990  C CB  . CYS C 3 247 ? 67.279  61.708  71.701  1.00 10.00 ? 262 CYS C CB  1 
ATOM 7991  S SG  . CYS C 3 247 ? 67.563  59.926  71.602  1.00 10.00 ? 262 CYS C SG  1 
ATOM 7992  N N   . VAL C 3 248 ? 69.925  60.724  72.925  1.00 10.00 ? 263 VAL C N   1 
ATOM 7993  C CA  . VAL C 3 248 ? 70.626  59.913  73.883  1.00 10.00 ? 263 VAL C CA  1 
ATOM 7994  C C   . VAL C 3 248 ? 71.607  60.751  74.693  1.00 10.00 ? 263 VAL C C   1 
ATOM 7995  O O   . VAL C 3 248 ? 71.802  60.465  75.864  1.00 10.00 ? 263 VAL C O   1 
ATOM 7996  C CB  . VAL C 3 248 ? 71.285  58.713  73.181  1.00 10.00 ? 263 VAL C CB  1 
ATOM 7997  C CG1 . VAL C 3 248 ? 71.624  57.625  74.200  1.00 10.00 ? 263 VAL C CG1 1 
ATOM 7998  C CG2 . VAL C 3 248 ? 70.326  58.199  72.096  1.00 10.00 ? 263 VAL C CG2 1 
ATOM 7999  N N   . LEU C 3 249 ? 72.202  61.800  74.118  1.00 10.00 ? 264 LEU C N   1 
ATOM 8000  C CA  . LEU C 3 249 ? 73.101  62.605  74.935  1.00 10.00 ? 264 LEU C CA  1 
ATOM 8001  C C   . LEU C 3 249 ? 72.269  63.262  76.036  1.00 10.00 ? 264 LEU C C   1 
ATOM 8002  O O   . LEU C 3 249 ? 72.633  63.176  77.211  1.00 10.00 ? 264 LEU C O   1 
ATOM 8003  C CB  . LEU C 3 249 ? 73.877  63.682  74.133  1.00 10.00 ? 264 LEU C CB  1 
ATOM 8004  C CG  . LEU C 3 249 ? 75.213  64.180  74.770  1.00 10.00 ? 264 LEU C CG  1 
ATOM 8005  C CD1 . LEU C 3 249 ? 76.411  63.738  73.909  1.00 10.00 ? 264 LEU C CD1 1 
ATOM 8006  C CD2 . LEU C 3 249 ? 75.192  65.692  74.941  1.00 10.00 ? 264 LEU C CD2 1 
ATOM 8007  N N   . LEU C 3 250 ? 71.184  63.938  75.680  1.00 10.00 ? 265 LEU C N   1 
ATOM 8008  C CA  . LEU C 3 250 ? 70.339  64.521  76.727  1.00 10.00 ? 265 LEU C CA  1 
ATOM 8009  C C   . LEU C 3 250 ? 70.070  63.524  77.857  1.00 10.00 ? 265 LEU C C   1 
ATOM 8010  O O   . LEU C 3 250 ? 70.234  63.804  79.044  1.00 10.00 ? 265 LEU C O   1 
ATOM 8011  C CB  . LEU C 3 250 ? 69.011  65.009  76.139  1.00 10.00 ? 265 LEU C CB  1 
ATOM 8012  C CG  . LEU C 3 250 ? 69.090  66.152  75.125  1.00 10.00 ? 265 LEU C CG  1 
ATOM 8013  C CD1 . LEU C 3 250 ? 67.733  66.818  74.957  1.00 10.00 ? 265 LEU C CD1 1 
ATOM 8014  C CD2 . LEU C 3 250 ? 70.137  67.172  75.546  1.00 10.00 ? 265 LEU C CD2 1 
ATOM 8015  N N   . ALA C 3 251 ? 69.600  62.252  77.269  1.00 10.00 ? 266 ALA C N   1 
ATOM 8016  C CA  . ALA C 3 251 ? 69.239  61.183  78.115  1.00 10.00 ? 266 ALA C CA  1 
ATOM 8017  C C   . ALA C 3 251 ? 70.474  60.615  78.897  1.00 10.00 ? 266 ALA C C   1 
ATOM 8018  O O   . ALA C 3 251 ? 70.323  60.472  80.160  1.00 10.00 ? 266 ALA C O   1 
ATOM 8019  C CB  . ALA C 3 251 ? 68.375  59.921  77.663  1.00 10.00 ? 266 ALA C CB  1 
ATOM 8020  N N   . GLN C 3 252 ? 71.600  60.306  78.264  1.00 10.00 ? 267 GLN C N   1 
ATOM 8021  C CA  . GLN C 3 252 ? 72.728  59.808  79.040  1.00 10.00 ? 267 GLN C CA  1 
ATOM 8022  C C   . GLN C 3 252 ? 73.267  60.945  79.919  1.00 10.00 ? 267 GLN C C   1 
ATOM 8023  O O   . GLN C 3 252 ? 73.953  60.703  80.914  1.00 10.00 ? 267 GLN C O   1 
ATOM 8024  C CB  . GLN C 3 252 ? 73.832  59.238  78.125  1.00 10.00 ? 267 GLN C CB  1 
ATOM 8025  C CG  . GLN C 3 252 ? 73.946  59.861  76.784  1.00 10.00 ? 267 GLN C CG  1 
ATOM 8026  C CD  . GLN C 3 252 ? 75.307  59.728  76.253  1.00 10.00 ? 267 GLN C CD  1 
ATOM 8027  O OE1 . GLN C 3 252 ? 75.535  59.873  75.062  1.00 10.00 ? 267 GLN C OE1 1 
ATOM 8028  N NE2 . GLN C 3 252 ? 76.251  59.459  77.134  1.00 10.00 ? 267 GLN C NE2 1 
ATOM 8029  N N   . ALA C 3 253 ? 72.924  62.185  79.571  1.00 10.00 ? 268 ALA C N   1 
ATOM 8030  C CA  . ALA C 3 253 ? 73.384  63.334  80.351  1.00 10.00 ? 268 ALA C CA  1 
ATOM 8031  C C   . ALA C 3 253 ? 72.577  63.481  81.634  1.00 10.00 ? 268 ALA C C   1 
ATOM 8032  O O   . ALA C 3 253 ? 73.161  63.506  82.707  1.00 10.00 ? 268 ALA C O   1 
ATOM 8033  C CB  . ALA C 3 253 ? 73.321  64.632  79.530  1.00 10.00 ? 268 ALA C CB  1 
ATOM 8034  N N   . VAL C 3 254 ? 71.249  63.580  81.532  1.00 10.00 ? 269 VAL C N   1 
ATOM 8035  C CA  . VAL C 3 254 ? 70.404  63.704  82.742  1.00 10.00 ? 269 VAL C CA  1 
ATOM 8036  C C   . VAL C 3 254 ? 70.661  62.552  83.704  1.00 10.00 ? 269 VAL C C   1 
ATOM 8037  O O   . VAL C 3 254 ? 70.581  62.711  84.921  1.00 10.00 ? 269 VAL C O   1 
ATOM 8038  C CB  . VAL C 3 254 ? 68.874  63.777  82.408  1.00 10.00 ? 269 VAL C CB  1 
ATOM 8039  C CG1 . VAL C 3 254 ? 68.463  62.636  81.529  1.00 10.00 ? 269 VAL C CG1 1 
ATOM 8040  C CG2 . VAL C 3 254 ? 68.066  63.786  83.679  1.00 10.00 ? 269 VAL C CG2 1 
ATOM 8041  N N   . PHE C 3 255 ? 70.993  61.390  83.147  1.00 10.00 ? 270 PHE C N   1 
ATOM 8042  C CA  . PHE C 3 255 ? 71.302  60.181  83.917  1.00 10.00 ? 270 PHE C CA  1 
ATOM 8043  C C   . PHE C 3 255 ? 72.552  60.371  84.786  1.00 10.00 ? 270 PHE C C   1 
ATOM 8044  O O   . PHE C 3 255 ? 72.552  60.055  85.984  1.00 10.00 ? 270 PHE C O   1 
ATOM 8045  C CB  . PHE C 3 255 ? 71.554  59.001  82.991  1.00 10.00 ? 270 PHE C CB  1 
ATOM 8046  C CG  . PHE C 3 255 ? 70.413  58.753  82.010  1.00 10.00 ? 270 PHE C CG  1 
ATOM 8047  C CD1 . PHE C 3 255 ? 70.411  57.601  81.220  1.00 10.00 ? 270 PHE C CD1 1 
ATOM 8048  C CD2 . PHE C 3 255 ? 69.371  59.681  81.906  1.00 10.00 ? 270 PHE C CD2 1 
ATOM 8049  C CE1 . PHE C 3 255 ? 69.365  57.372  80.323  1.00 10.00 ? 270 PHE C CE1 1 
ATOM 8050  C CE2 . PHE C 3 255 ? 68.324  59.453  81.008  1.00 10.00 ? 270 PHE C CE2 1 
ATOM 8051  C CZ  . PHE C 3 255 ? 68.321  58.296  80.216  1.00 10.00 ? 270 PHE C CZ  1 
ATOM 8052  N N   . LEU C 3 256 ? 73.564  60.934  84.141  1.00 10.00 ? 271 LEU C N   1 
ATOM 8053  C CA  . LEU C 3 256 ? 74.866  61.252  84.681  1.00 10.00 ? 271 LEU C CA  1 
ATOM 8054  C C   . LEU C 3 256 ? 74.799  62.259  85.819  1.00 10.00 ? 271 LEU C C   1 
ATOM 8055  O O   . LEU C 3 256 ? 75.361  62.053  86.903  1.00 10.00 ? 271 LEU C O   1 
ATOM 8056  C CB  . LEU C 3 256 ? 75.697  61.850  83.563  1.00 10.00 ? 271 LEU C CB  1 
ATOM 8057  C CG  . LEU C 3 256 ? 77.162  62.248  83.785  1.00 10.00 ? 271 LEU C CG  1 
ATOM 8058  C CD1 . LEU C 3 256 ? 77.555  63.010  82.564  1.00 10.00 ? 271 LEU C CD1 1 
ATOM 8059  C CD2 . LEU C 3 256 ? 77.413  63.115  85.011  1.00 10.00 ? 271 LEU C CD2 1 
ATOM 8060  N N   . LEU C 3 257 ? 74.121  63.368  85.557  1.00 10.00 ? 272 LEU C N   1 
ATOM 8061  C CA  . LEU C 3 257 ? 74.015  64.436  86.543  1.00 10.00 ? 272 LEU C CA  1 
ATOM 8062  C C   . LEU C 3 257 ? 73.416  63.983  87.873  1.00 10.00 ? 272 LEU C C   1 
ATOM 8063  O O   . LEU C 3 257 ? 74.116  63.994  88.891  1.00 10.00 ? 272 LEU C O   1 
ATOM 8064  C CB  . LEU C 3 257 ? 73.235  65.645  85.980  1.00 10.00 ? 272 LEU C CB  1 
ATOM 8065  C CG  . LEU C 3 257 ? 72.548  65.537  84.617  1.00 10.00 ? 272 LEU C CG  1 
ATOM 8066  C CD1 . LEU C 3 257 ? 71.164  66.165  84.695  1.00 10.00 ? 272 LEU C CD1 1 
ATOM 8067  C CD2 . LEU C 3 257 ? 73.443  66.159  83.541  1.00 10.00 ? 272 LEU C CD2 1 
ATOM 8068  N N   . LEU C 3 258 ? 72.159  63.538  87.907  1.00 10.00 ? 273 LEU C N   1 
ATOM 8069  C CA  . LEU C 3 258 ? 71.611  63.164  89.214  1.00 10.00 ? 273 LEU C CA  1 
ATOM 8070  C C   . LEU C 3 258 ? 72.279  61.904  89.769  1.00 10.00 ? 273 LEU C C   1 
ATOM 8071  O O   . LEU C 3 258 ? 72.138  61.646  90.970  1.00 10.00 ? 273 LEU C O   1 
ATOM 8072  C CB  . LEU C 3 258 ? 70.096  62.950  89.123  1.00 10.00 ? 273 LEU C CB  1 
ATOM 8073  C CG  . LEU C 3 258 ? 69.212  64.056  89.704  1.00 10.00 ? 273 LEU C CG  1 
ATOM 8074  C CD1 . LEU C 3 258 ? 67.740  63.712  89.538  1.00 10.00 ? 273 LEU C CD1 1 
ATOM 8075  C CD2 . LEU C 3 258 ? 69.542  64.292  91.171  1.00 10.00 ? 273 LEU C CD2 1 
ATOM 8076  N N   . THR C 3 259 ? 72.941  61.096  88.928  1.00 10.00 ? 274 THR C N   1 
ATOM 8077  C CA  . THR C 3 259 ? 73.674  59.990  89.525  1.00 10.00 ? 274 THR C CA  1 
ATOM 8078  C C   . THR C 3 259 ? 74.730  60.497  90.492  1.00 10.00 ? 274 THR C C   1 
ATOM 8079  O O   . THR C 3 259 ? 74.890  60.053  91.592  1.00 10.00 ? 274 THR C O   1 
ATOM 8080  C CB  . THR C 3 259 ? 74.357  59.121  88.470  1.00 10.00 ? 274 THR C CB  1 
ATOM 8081  O OG1 . THR C 3 259 ? 73.989  57.751  88.662  1.00 10.00 ? 274 THR C OG1 1 
ATOM 8082  C CG2 . THR C 3 259 ? 75.869  59.265  88.561  1.00 10.00 ? 274 THR C CG2 1 
ATOM 8083  N N   . SER C 3 260 ? 75.380  61.598  89.957  1.00 10.00 ? 275 SER C N   1 
ATOM 8084  C CA  . SER C 3 260 ? 76.299  62.317  90.831  1.00 10.00 ? 275 SER C CA  1 
ATOM 8085  C C   . SER C 3 260 ? 75.554  62.984  91.982  1.00 10.00 ? 275 SER C C   1 
ATOM 8086  O O   . SER C 3 260 ? 76.089  63.209  93.070  1.00 10.00 ? 275 SER C O   1 
ATOM 8087  C CB  . SER C 3 260 ? 77.092  63.356  90.035  1.00 10.00 ? 275 SER C CB  1 
ATOM 8088  O OG  . SER C 3 260 ? 76.237  64.347  89.494  1.00 10.00 ? 275 SER C OG  1 
ATOM 8089  N N   . GLN C 3 261 ? 74.354  63.260  91.881  1.00 10.00 ? 276 GLN C N   1 
ATOM 8090  C CA  . GLN C 3 261 ? 73.592  63.941  92.894  1.00 10.00 ? 276 GLN C CA  1 
ATOM 8091  C C   . GLN C 3 261 ? 73.335  63.037  94.101  1.00 10.00 ? 276 GLN C C   1 
ATOM 8092  O O   . GLN C 3 261 ? 73.385  63.469  95.262  1.00 10.00 ? 276 GLN C O   1 
ATOM 8093  C CB  . GLN C 3 261 ? 72.303  64.424  92.228  1.00 10.00 ? 276 GLN C CB  1 
ATOM 8094  C CG  . GLN C 3 261 ? 72.594  65.235  90.935  1.00 10.00 ? 276 GLN C CG  1 
ATOM 8095  C CD  . GLN C 3 261 ? 73.907  66.021  91.021  1.00 10.00 ? 276 GLN C CD  1 
ATOM 8096  O OE1 . GLN C 3 261 ? 74.994  65.440  90.973  1.00 10.00 ? 276 GLN C OE1 1 
ATOM 8097  N NE2 . GLN C 3 261 ? 73.805  67.342  91.164  1.00 10.00 ? 276 GLN C NE2 1 
ATOM 8098  N N   . ARG C 3 262 ? 72.979  61.795  93.787  1.00 10.00 ? 277 ARG C N   1 
ATOM 8099  C CA  . ARG C 3 262 ? 72.875  60.786  94.831  1.00 10.00 ? 277 ARG C CA  1 
ATOM 8100  C C   . ARG C 3 262 ? 74.206  60.576  95.538  1.00 10.00 ? 277 ARG C C   1 
ATOM 8101  O O   . ARG C 3 262 ? 74.257  60.266  96.725  1.00 10.00 ? 277 ARG C O   1 
ATOM 8102  C CB  . ARG C 3 262 ? 72.393  59.457  94.253  1.00 10.00 ? 277 ARG C CB  1 
ATOM 8103  C CG  . ARG C 3 262 ? 71.089  59.545  93.481  1.00 10.00 ? 277 ARG C CG  1 
ATOM 8104  C CD  . ARG C 3 262 ? 71.276  59.072  92.050  1.00 10.00 ? 277 ARG C CD  1 
ATOM 8105  N NE  . ARG C 3 262 ? 70.054  59.195  91.265  1.00 10.00 ? 277 ARG C NE  1 
ATOM 8106  C CZ  . ARG C 3 262 ? 69.957  58.859  89.985  1.00 10.00 ? 277 ARG C CZ  1 
ATOM 8107  N NH1 . ARG C 3 262 ? 71.014  58.378  89.344  1.00 10.00 ? 277 ARG C NH1 1 
ATOM 8108  N NH2 . ARG C 3 262 ? 68.804  59.002  89.346  1.00 10.00 ? 277 ARG C NH2 1 
ATOM 8109  N N   . LEU C 3 263 ? 75.272  60.939  94.921  1.00 10.00 ? 278 LEU C N   1 
ATOM 8110  C CA  . LEU C 3 263 ? 76.602  60.681  95.415  1.00 10.00 ? 278 LEU C CA  1 
ATOM 8111  C C   . LEU C 3 263 ? 76.977  61.525  96.634  1.00 10.00 ? 278 LEU C C   1 
ATOM 8112  O O   . LEU C 3 263 ? 77.476  61.000  97.641  1.00 10.00 ? 278 LEU C O   1 
ATOM 8113  C CB  . LEU C 3 263 ? 77.597  60.898  94.299  1.00 10.00 ? 278 LEU C CB  1 
ATOM 8114  C CG  . LEU C 3 263 ? 79.071  60.877  94.646  1.00 10.00 ? 278 LEU C CG  1 
ATOM 8115  C CD1 . LEU C 3 263 ? 79.284  60.788  96.120  1.00 10.00 ? 278 LEU C CD1 1 
ATOM 8116  C CD2 . LEU C 3 263 ? 79.688  59.697  93.961  1.00 10.00 ? 278 LEU C CD2 1 
ATOM 8117  N N   . PRO C 3 264 ? 76.713  62.841  96.602  1.00 10.00 ? 279 PRO C N   1 
ATOM 8118  C CA  . PRO C 3 264 ? 77.063  63.682  97.749  1.00 10.00 ? 279 PRO C CA  1 
ATOM 8119  C C   . PRO C 3 264 ? 76.102  63.476  98.921  1.00 10.00 ? 279 PRO C C   1 
ATOM 8120  O O   . PRO C 3 264 ? 76.503  63.574  100.073 1.00 10.00 ? 279 PRO C O   1 
ATOM 8121  C CB  . PRO C 3 264 ? 76.964  65.058  97.165  1.00 10.00 ? 279 PRO C CB  1 
ATOM 8122  C CG  . PRO C 3 264 ? 75.713  64.932  96.396  1.00 10.00 ? 279 PRO C CG  1 
ATOM 8123  C CD  . PRO C 3 264 ? 75.969  63.641  95.620  1.00 10.00 ? 279 PRO C CD  1 
ATOM 8124  N N   . GLU C 3 265 ? 74.833  63.237  98.594  1.00 10.00 ? 280 GLU C N   1 
ATOM 8125  C CA  . GLU C 3 265 ? 73.769  62.948  99.530  1.00 10.00 ? 280 GLU C CA  1 
ATOM 8126  C C   . GLU C 3 265 ? 74.262  61.927  100.554 1.00 10.00 ? 280 GLU C C   1 
ATOM 8127  O O   . GLU C 3 265 ? 74.230  62.168  101.769 1.00 10.00 ? 280 GLU C O   1 
ATOM 8128  C CB  . GLU C 3 265 ? 72.602  62.389  98.722  1.00 10.00 ? 280 GLU C CB  1 
ATOM 8129  C CG  . GLU C 3 265 ? 72.046  61.099  99.278  1.00 10.00 ? 280 GLU C CG  1 
ATOM 8130  C CD  . GLU C 3 265 ? 71.000  61.375  100.326 1.00 10.00 ? 280 GLU C CD  1 
ATOM 8131  O OE1 . GLU C 3 265 ? 71.168  62.367  101.129 1.00 10.00 ? 280 GLU C OE1 1 
ATOM 8132  O OE2 . GLU C 3 265 ? 69.960  60.631  100.400 1.00 10.00 ? 280 GLU C OE2 1 
ATOM 8133  N N   . THR C 3 266 ? 74.713  60.801  100.031 1.00 10.00 ? 281 THR C N   1 
ATOM 8134  C CA  . THR C 3 266 ? 75.237  59.716  100.866 1.00 10.00 ? 281 THR C CA  1 
ATOM 8135  C C   . THR C 3 266 ? 76.628  60.070  101.373 1.00 10.00 ? 281 THR C C   1 
ATOM 8136  O O   . THR C 3 266 ? 77.060  59.598  102.429 1.00 10.00 ? 281 THR C O   1 
ATOM 8137  C CB  . THR C 3 266 ? 75.342  58.411  100.082 1.00 10.00 ? 281 THR C CB  1 
ATOM 8138  O OG1 . THR C 3 266 ? 76.253  58.565  99.006  1.00 10.00 ? 281 THR C OG1 1 
ATOM 8139  C CG2 . THR C 3 266 ? 74.004  57.948  99.510  1.00 10.00 ? 281 THR C CG2 1 
ATOM 8140  N N   . ALA C 3 267 ? 77.107  61.022  100.561 1.00 10.00 ? 282 ALA C N   1 
ATOM 8141  C CA  . ALA C 3 267 ? 78.418  61.561  100.878 1.00 10.00 ? 282 ALA C CA  1 
ATOM 8142  C C   . ALA C 3 267 ? 78.327  62.302  102.200 1.00 10.00 ? 282 ALA C C   1 
ATOM 8143  O O   . ALA C 3 267 ? 78.901  61.871  103.188 1.00 10.00 ? 282 ALA C O   1 
ATOM 8144  C CB  . ALA C 3 267 ? 78.885  62.515  99.784  1.00 10.00 ? 282 ALA C CB  1 
ATOM 8145  N N   . LEU C 3 268 ? 77.588  63.416  102.227 1.00 10.00 ? 283 LEU C N   1 
ATOM 8146  C CA  . LEU C 3 268 ? 77.483  64.170  103.481 1.00 10.00 ? 283 LEU C CA  1 
ATOM 8147  C C   . LEU C 3 268 ? 77.237  63.248  104.677 1.00 10.00 ? 283 LEU C C   1 
ATOM 8148  O O   . LEU C 3 268 ? 77.828  63.436  105.708 1.00 10.00 ? 283 LEU C O   1 
ATOM 8149  C CB  . LEU C 3 268 ? 76.364  65.213  103.391 1.00 10.00 ? 283 LEU C CB  1 
ATOM 8150  C CG  . LEU C 3 268 ? 76.649  66.451  102.538 1.00 10.00 ? 283 LEU C CG  1 
ATOM 8151  C CD1 . LEU C 3 268 ? 75.459  67.398  102.550 1.00 10.00 ? 283 LEU C CD1 1 
ATOM 8152  C CD2 . LEU C 3 268 ? 77.902  67.162  103.025 1.00 10.00 ? 283 LEU C CD2 1 
ATOM 8153  N N   . ALA C 3 269 ? 76.376  62.239  104.483 1.00 10.00 ? 284 ALA C N   1 
ATOM 8154  C CA  . ALA C 3 269 ? 76.100  61.284  105.543 1.00 10.00 ? 284 ALA C CA  1 
ATOM 8155  C C   . ALA C 3 269 ? 77.350  60.464  105.846 1.00 10.00 ? 284 ALA C C   1 
ATOM 8156  O O   . ALA C 3 269 ? 77.400  59.766  106.856 1.00 10.00 ? 284 ALA C O   1 
ATOM 8157  C CB  . ALA C 3 269 ? 74.967  60.390  105.139 1.00 10.00 ? 284 ALA C CB  1 
ATOM 8158  N N   . VAL C 3 270 ? 78.366  60.593  104.993 1.00 10.00 ? 285 VAL C N   1 
ATOM 8159  C CA  . VAL C 3 270 ? 79.646  59.869  105.107 1.00 10.00 ? 285 VAL C CA  1 
ATOM 8160  C C   . VAL C 3 270 ? 80.821  60.756  104.674 1.00 10.00 ? 285 VAL C C   1 
ATOM 8161  O O   . VAL C 3 270 ? 80.852  61.229  103.546 1.00 10.00 ? 285 VAL C O   1 
ATOM 8162  C CB  . VAL C 3 270 ? 79.691  58.634  104.183 1.00 10.00 ? 285 VAL C CB  1 
ATOM 8163  C CG1 . VAL C 3 270 ? 80.979  57.854  104.417 1.00 10.00 ? 285 VAL C CG1 1 
ATOM 8164  C CG2 . VAL C 3 270 ? 78.472  57.768  104.401 1.00 10.00 ? 285 VAL C CG2 1 
ATOM 8165  N N   . PRO C 3 271 ? 81.816  60.970  105.549 1.00 10.00 ? 286 PRO C N   1 
ATOM 8166  C CA  . PRO C 3 271 ? 82.929  61.817  105.119 1.00 10.00 ? 286 PRO C CA  1 
ATOM 8167  C C   . PRO C 3 271 ? 83.758  61.032  104.115 1.00 10.00 ? 286 PRO C C   1 
ATOM 8168  O O   . PRO C 3 271 ? 84.564  60.188  104.491 1.00 10.00 ? 286 PRO C O   1 
ATOM 8169  C CB  . PRO C 3 271 ? 83.680  62.060  106.415 1.00 10.00 ? 286 PRO C CB  1 
ATOM 8170  C CG  . PRO C 3 271 ? 83.614  60.711  107.053 1.00 10.00 ? 286 PRO C CG  1 
ATOM 8171  C CD  . PRO C 3 271 ? 82.182  60.224  106.763 1.00 10.00 ? 286 PRO C CD  1 
ATOM 8172  N N   . LEU C 3 272 ? 83.549  61.291  102.834 1.00 10.00 ? 287 LEU C N   1 
ATOM 8173  C CA  . LEU C 3 272 ? 84.295  60.572  101.825 1.00 10.00 ? 287 LEU C CA  1 
ATOM 8174  C C   . LEU C 3 272 ? 85.601  61.276  101.490 1.00 10.00 ? 287 LEU C C   1 
ATOM 8175  O O   . LEU C 3 272 ? 85.673  62.509  101.466 1.00 10.00 ? 287 LEU C O   1 
ATOM 8176  C CB  . LEU C 3 272 ? 83.438  60.403  100.564 1.00 10.00 ? 287 LEU C CB  1 
ATOM 8177  C CG  . LEU C 3 272 ? 82.304  59.366  100.587 1.00 10.00 ? 287 LEU C CG  1 
ATOM 8178  C CD1 . LEU C 3 272 ? 81.245  59.723  99.554  1.00 10.00 ? 287 LEU C CD1 1 
ATOM 8179  C CD2 . LEU C 3 272 ? 82.867  57.978  100.313 1.00 10.00 ? 287 LEU C CD2 1 
ATOM 8180  N N   . ILE C 3 273 ? 86.624  60.481  101.222 1.00 10.00 ? 288 ILE C N   1 
ATOM 8181  C CA  . ILE C 3 273 ? 87.929  61.033  100.876 1.00 10.00 ? 288 ILE C CA  1 
ATOM 8182  C C   . ILE C 3 273 ? 87.917  61.608  99.461  1.00 10.00 ? 288 ILE C C   1 
ATOM 8183  O O   . ILE C 3 273 ? 87.008  61.331  98.667  1.00 10.00 ? 288 ILE C O   1 
ATOM 8184  C CB  . ILE C 3 273 ? 89.041  59.973  100.976 1.00 10.00 ? 288 ILE C CB  1 
ATOM 8185  C CG1 . ILE C 3 273 ? 90.427  60.617  101.065 1.00 10.00 ? 288 ILE C CG1 1 
ATOM 8186  C CG2 . ILE C 3 273 ? 89.069  59.031  99.771  1.00 10.00 ? 288 ILE C CG2 1 
ATOM 8187  C CD1 . ILE C 3 273 ? 91.527  59.637  101.456 1.00 10.00 ? 288 ILE C CD1 1 
ATOM 8188  N N   . GLY C 3 274 ? 88.945  62.397  99.204  1.00 10.00 ? 289 GLY C N   1 
ATOM 8189  C CA  . GLY C 3 274 ? 89.133  63.081  97.918  1.00 10.00 ? 289 GLY C CA  1 
ATOM 8190  C C   . GLY C 3 274 ? 89.730  62.132  96.872  1.00 10.00 ? 289 GLY C C   1 
ATOM 8191  O O   . GLY C 3 274 ? 89.536  62.310  95.664  1.00 10.00 ? 289 GLY C O   1 
ATOM 8192  N N   . LYS C 3 275 ? 90.445  61.133  97.353  1.00 10.00 ? 290 LYS C N   1 
ATOM 8193  C CA  . LYS C 3 275 ? 91.114  60.157  96.478  1.00 10.00 ? 290 LYS C CA  1 
ATOM 8194  C C   . LYS C 3 275 ? 90.098  59.343  95.662  1.00 10.00 ? 290 LYS C C   1 
ATOM 8195  O O   . LYS C 3 275 ? 90.237  59.170  94.446  1.00 10.00 ? 290 LYS C O   1 
ATOM 8196  C CB  . LYS C 3 275 ? 91.961  59.197  97.310  1.00 10.00 ? 290 LYS C CB  1 
ATOM 8197  C CG  . LYS C 3 275 ? 92.930  59.927  98.236  1.00 10.00 ? 290 LYS C CG  1 
ATOM 8198  C CD  . LYS C 3 275 ? 93.647  58.986  99.197  1.00 10.00 ? 290 LYS C CD  1 
ATOM 8199  C CE  . LYS C 3 275 ? 94.508  59.725  100.216 1.00 10.00 ? 290 LYS C CE  1 
ATOM 8200  N NZ  . LYS C 3 275 ? 95.079  58.833  101.232 1.00 10.00 ? 290 LYS C NZ  1 
ATOM 8201  N N   . TYR C 3 276 ? 89.049  58.866  96.319  1.00 10.00 ? 291 TYR C N   1 
ATOM 8202  C CA  . TYR C 3 276 ? 88.075  57.975  95.700  1.00 10.00 ? 291 TYR C CA  1 
ATOM 8203  C C   . TYR C 3 276 ? 87.021  58.770  94.942  1.00 10.00 ? 291 TYR C C   1 
ATOM 8204  O O   . TYR C 3 276 ? 86.578  58.355  93.836  1.00 10.00 ? 291 TYR C O   1 
ATOM 8205  C CB  . TYR C 3 276 ? 87.427  57.073  96.751  1.00 10.00 ? 291 TYR C CB  1 
ATOM 8206  C CG  . TYR C 3 276 ? 88.415  56.231  97.530  1.00 10.00 ? 291 TYR C CG  1 
ATOM 8207  C CD1 . TYR C 3 276 ? 89.751  56.596  97.616  1.00 10.00 ? 291 TYR C CD1 1 
ATOM 8208  C CD2 . TYR C 3 276 ? 88.011  55.071  98.179  1.00 10.00 ? 291 TYR C CD2 1 
ATOM 8209  C CE1 . TYR C 3 276 ? 90.657  55.833  98.326  1.00 10.00 ? 291 TYR C CE1 1 
ATOM 8210  C CE2 . TYR C 3 276 ? 88.909  54.301  98.893  1.00 10.00 ? 291 TYR C CE2 1 
ATOM 8211  C CZ  . TYR C 3 276 ? 90.231  54.687  98.963  1.00 10.00 ? 291 TYR C CZ  1 
ATOM 8212  O OH  . TYR C 3 276 ? 91.129  53.922  99.673  1.00 10.00 ? 291 TYR C OH  1 
ATOM 8213  N N   . LEU C 3 277 ? 86.568  59.863  95.490  1.00 10.00 ? 292 LEU C N   1 
ATOM 8214  C CA  . LEU C 3 277 ? 85.454  60.634  94.923  1.00 10.00 ? 292 LEU C CA  1 
ATOM 8215  C C   . LEU C 3 277 ? 85.766  61.186  93.556  1.00 10.00 ? 292 LEU C C   1 
ATOM 8216  O O   . LEU C 3 277 ? 84.873  61.362  92.723  1.00 10.00 ? 292 LEU C O   1 
ATOM 8217  C CB  . LEU C 3 277 ? 85.055  61.716  95.883  1.00 10.00 ? 292 LEU C CB  1 
ATOM 8218  C CG  . LEU C 3 277 ? 83.953  61.198  96.779  1.00 10.00 ? 292 LEU C CG  1 
ATOM 8219  C CD1 . LEU C 3 277 ? 83.516  62.204  97.825  1.00 10.00 ? 292 LEU C CD1 1 
ATOM 8220  C CD2 . LEU C 3 277 ? 82.707  60.803  95.981  1.00 10.00 ? 292 LEU C CD2 1 
ATOM 8221  N N   . MET C 3 278 ? 87.100  61.235  93.275  1.00 10.00 ? 293 MET C N   1 
ATOM 8222  C CA  . MET C 3 278 ? 87.491  61.829  92.010  1.00 10.00 ? 293 MET C CA  1 
ATOM 8223  C C   . MET C 3 278 ? 87.397  60.728  90.934  1.00 10.00 ? 293 MET C C   1 
ATOM 8224  O O   . MET C 3 278 ? 86.797  60.937  89.886  1.00 10.00 ? 293 MET C O   1 
ATOM 8225  C CB  . MET C 3 278 ? 88.911  62.434  92.131  1.00 10.00 ? 293 MET C CB  1 
ATOM 8226  C CG  . MET C 3 278 ? 88.990  63.913  92.701  1.00 10.00 ? 293 MET C CG  1 
ATOM 8227  S SD  . MET C 3 278 ? 88.245  64.298  94.375  1.00 10.00 ? 293 MET C SD  1 
ATOM 8228  C CE  . MET C 3 278 ? 89.711  64.722  95.482  1.00 10.00 ? 293 MET C CE  1 
ATOM 8229  N N   . PHE C 3 279 ? 87.938  59.535  91.185  1.00 10.00 ? 294 PHE C N   1 
ATOM 8230  C CA  . PHE C 3 279 ? 87.856  58.445  90.222  1.00 10.00 ? 294 PHE C CA  1 
ATOM 8231  C C   . PHE C 3 279 ? 86.423  58.248  89.754  1.00 10.00 ? 294 PHE C C   1 
ATOM 8232  O O   . PHE C 3 279 ? 86.191  57.905  88.572  1.00 10.00 ? 294 PHE C O   1 
ATOM 8233  C CB  . PHE C 3 279 ? 88.397  57.152  90.831  1.00 10.00 ? 294 PHE C CB  1 
ATOM 8234  C CG  . PHE C 3 279 ? 89.725  57.316  91.504  1.00 10.00 ? 294 PHE C CG  1 
ATOM 8235  C CD1 . PHE C 3 279 ? 89.963  56.743  92.742  1.00 10.00 ? 294 PHE C CD1 1 
ATOM 8236  C CD2 . PHE C 3 279 ? 90.733  58.043  90.898  1.00 10.00 ? 294 PHE C CD2 1 
ATOM 8237  C CE1 . PHE C 3 279 ? 91.187  56.893  93.365  1.00 10.00 ? 294 PHE C CE1 1 
ATOM 8238  C CE2 . PHE C 3 279 ? 91.960  58.198  91.516  1.00 10.00 ? 294 PHE C CE2 1 
ATOM 8239  C CZ  . PHE C 3 279 ? 92.187  57.622  92.750  1.00 10.00 ? 294 PHE C CZ  1 
ATOM 8240  N N   . ILE C 3 280 ? 85.445  58.419  90.629  1.00 10.00 ? 295 ILE C N   1 
ATOM 8241  C CA  . ILE C 3 280 ? 84.076  58.271  90.258  1.00 10.00 ? 295 ILE C CA  1 
ATOM 8242  C C   . ILE C 3 280 ? 83.722  59.364  89.276  1.00 10.00 ? 295 ILE C C   1 
ATOM 8243  O O   . ILE C 3 280 ? 83.553  59.141  88.069  1.00 10.00 ? 295 ILE C O   1 
ATOM 8244  C CB  . ILE C 3 280 ? 83.175  58.441  91.434  1.00 10.00 ? 295 ILE C CB  1 
ATOM 8245  C CG1 . ILE C 3 280 ? 83.723  57.646  92.617  1.00 10.00 ? 295 ILE C CG1 1 
ATOM 8246  C CG2 . ILE C 3 280 ? 81.757  58.029  91.041  1.00 10.00 ? 295 ILE C CG2 1 
ATOM 8247  C CD1 . ILE C 3 280 ? 82.788  57.621  93.876  1.00 10.00 ? 295 ILE C CD1 1 
ATOM 8248  N N   . MET C 3 281 ? 83.637  60.579  89.797  1.00 10.00 ? 296 MET C N   1 
ATOM 8249  C CA  . MET C 3 281 ? 83.265  61.760  88.989  1.00 10.00 ? 296 MET C CA  1 
ATOM 8250  C C   . MET C 3 281 ? 84.247  62.144  87.895  1.00 10.00 ? 296 MET C C   1 
ATOM 8251  O O   . MET C 3 281 ? 83.862  62.801  86.948  1.00 10.00 ? 296 MET C O   1 
ATOM 8252  C CB  . MET C 3 281 ? 82.992  62.935  89.916  1.00 10.00 ? 296 MET C CB  1 
ATOM 8253  C CG  . MET C 3 281 ? 82.001  62.571  91.043  1.00 10.00 ? 296 MET C CG  1 
ATOM 8254  S SD  . MET C 3 281 ? 80.347  62.380  90.468  1.00 10.00 ? 296 MET C SD  1 
ATOM 8255  C CE  . MET C 3 281 ? 80.494  61.086  89.355  1.00 10.00 ? 296 MET C CE  1 
ATOM 8256  N N   . SER C 3 282 ? 85.495  61.688  88.006  1.00 10.00 ? 297 SER C N   1 
ATOM 8257  C CA  . SER C 3 282 ? 86.510  61.949  86.996  1.00 10.00 ? 297 SER C CA  1 
ATOM 8258  C C   . SER C 3 282 ? 86.155  61.157  85.729  1.00 10.00 ? 297 SER C C   1 
ATOM 8259  O O   . SER C 3 282 ? 86.149  61.680  84.617  1.00 10.00 ? 297 SER C O   1 
ATOM 8260  C CB  . SER C 3 282 ? 87.877  61.480  87.502  1.00 10.00 ? 297 SER C CB  1 
ATOM 8261  O OG  . SER C 3 282 ? 88.637  60.906  86.447  1.00 10.00 ? 297 SER C OG  1 
ATOM 8262  N N   . LEU C 3 283 ? 85.846  59.880  85.927  1.00 10.00 ? 298 LEU C N   1 
ATOM 8263  C CA  . LEU C 3 283 ? 85.514  58.979  84.833  1.00 10.00 ? 298 LEU C CA  1 
ATOM 8264  C C   . LEU C 3 283 ? 84.132  59.178  84.239  1.00 10.00 ? 298 LEU C C   1 
ATOM 8265  O O   . LEU C 3 283 ? 83.942  58.963  83.039  1.00 10.00 ? 298 LEU C O   1 
ATOM 8266  C CB  . LEU C 3 283 ? 85.682  57.523  85.283  1.00 10.00 ? 298 LEU C CB  1 
ATOM 8267  C CG  . LEU C 3 283 ? 87.140  57.017  85.278  1.00 10.00 ? 298 LEU C CG  1 
ATOM 8268  C CD1 . LEU C 3 283 ? 87.200  55.697  86.014  1.00 10.00 ? 298 LEU C CD1 1 
ATOM 8269  C CD2 . LEU C 3 283 ? 87.695  56.867  83.834  1.00 10.00 ? 298 LEU C CD2 1 
ATOM 8270  N N   . VAL C 3 284 ? 83.161  59.597  85.045  1.00 10.00 ? 299 VAL C N   1 
ATOM 8271  C CA  . VAL C 3 284 ? 81.844  59.776  84.460  1.00 10.00 ? 299 VAL C CA  1 
ATOM 8272  C C   . VAL C 3 284 ? 82.020  61.025  83.602  1.00 10.00 ? 299 VAL C C   1 
ATOM 8273  O O   . VAL C 3 284 ? 81.334  61.202  82.602  1.00 10.00 ? 299 VAL C O   1 
ATOM 8274  C CB  . VAL C 3 284 ? 80.771  60.034  85.495  1.00 10.00 ? 299 VAL C CB  1 
ATOM 8275  C CG1 . VAL C 3 284 ? 79.462  59.461  85.035  1.00 10.00 ? 299 VAL C CG1 1 
ATOM 8276  C CG2 . VAL C 3 284 ? 81.218  59.526  86.804  1.00 10.00 ? 299 VAL C CG2 1 
ATOM 8277  N N   . THR C 3 285 ? 82.934  61.906  84.026  1.00 10.00 ? 300 THR C N   1 
ATOM 8278  C CA  . THR C 3 285 ? 83.235  63.121  83.275  1.00 10.00 ? 300 THR C CA  1 
ATOM 8279  C C   . THR C 3 285 ? 83.961  62.696  82.010  1.00 10.00 ? 300 THR C C   1 
ATOM 8280  O O   . THR C 3 285 ? 83.817  63.321  80.964  1.00 10.00 ? 300 THR C O   1 
ATOM 8281  C CB  . THR C 3 285 ? 84.132  64.086  84.071  1.00 10.00 ? 300 THR C CB  1 
ATOM 8282  O OG1 . THR C 3 285 ? 83.394  64.623  85.176  1.00 10.00 ? 300 THR C OG1 1 
ATOM 8283  C CG2 . THR C 3 285 ? 84.605  65.231  83.183  1.00 10.00 ? 300 THR C CG2 1 
ATOM 8284  N N   . GLY C 3 286 ? 84.750  61.632  82.127  1.00 10.00 ? 301 GLY C N   1 
ATOM 8285  C CA  . GLY C 3 286 ? 85.471  61.097  80.984  1.00 10.00 ? 301 GLY C CA  1 
ATOM 8286  C C   . GLY C 3 286 ? 84.473  60.833  79.876  1.00 10.00 ? 301 GLY C C   1 
ATOM 8287  O O   . GLY C 3 286 ? 84.734  61.104  78.699  1.00 10.00 ? 301 GLY C O   1 
ATOM 8288  N N   . VAL C 3 287 ? 83.312  60.325  80.259  1.00 10.00 ? 302 VAL C N   1 
ATOM 8289  C CA  . VAL C 3 287 ? 82.273  60.066  79.288  1.00 10.00 ? 302 VAL C CA  1 
ATOM 8290  C C   . VAL C 3 287 ? 81.578  61.406  79.012  1.00 10.00 ? 302 VAL C C   1 
ATOM 8291  O O   . VAL C 3 287 ? 81.279  61.717  77.864  1.00 10.00 ? 302 VAL C O   1 
ATOM 8292  C CB  . VAL C 3 287 ? 81.202  59.023  79.791  1.00 10.00 ? 302 VAL C CB  1 
ATOM 8293  C CG1 . VAL C 3 287 ? 81.229  57.763  78.907  1.00 10.00 ? 302 VAL C CG1 1 
ATOM 8294  C CG2 . VAL C 3 287 ? 81.444  58.675  81.248  1.00 10.00 ? 302 VAL C CG2 1 
ATOM 8295  N N   . VAL C 3 288 ? 81.350  62.197  80.060  1.00 10.00 ? 303 VAL C N   1 
ATOM 8296  C CA  . VAL C 3 288 ? 80.679  63.499  79.900  1.00 10.00 ? 303 VAL C CA  1 
ATOM 8297  C C   . VAL C 3 288 ? 81.433  64.248  78.786  1.00 10.00 ? 303 VAL C C   1 
ATOM 8298  O O   . VAL C 3 288 ? 80.826  64.712  77.813  1.00 10.00 ? 303 VAL C O   1 
ATOM 8299  C CB  . VAL C 3 288 ? 80.659  64.366  81.244  1.00 10.00 ? 303 VAL C CB  1 
ATOM 8300  C CG1 . VAL C 3 288 ? 79.603  65.511  81.131  1.00 10.00 ? 303 VAL C CG1 1 
ATOM 8301  C CG2 . VAL C 3 288 ? 80.329  63.511  82.453  1.00 10.00 ? 303 VAL C CG2 1 
ATOM 8302  N N   . VAL C 3 289 ? 82.759  64.320  78.930  1.00 10.00 ? 304 VAL C N   1 
ATOM 8303  C CA  . VAL C 3 289 ? 83.662  64.957  77.969  1.00 10.00 ? 304 VAL C CA  1 
ATOM 8304  C C   . VAL C 3 289 ? 83.404  64.302  76.613  1.00 10.00 ? 304 VAL C C   1 
ATOM 8305  O O   . VAL C 3 289 ? 83.027  64.959  75.624  1.00 10.00 ? 304 VAL C O   1 
ATOM 8306  C CB  . VAL C 3 289 ? 85.160  64.742  78.361  1.00 10.00 ? 304 VAL C CB  1 
ATOM 8307  C CG1 . VAL C 3 289 ? 86.086  65.171  77.232  1.00 10.00 ? 304 VAL C CG1 1 
ATOM 8308  C CG2 . VAL C 3 289 ? 85.470  65.509  79.621  1.00 10.00 ? 304 VAL C CG2 1 
ATOM 8309  N N   . ASN C 3 290 ? 83.518  62.981  76.573  1.00 10.00 ? 305 ASN C N   1 
ATOM 8310  C CA  . ASN C 3 290 ? 83.325  62.337  75.301  1.00 10.00 ? 305 ASN C CA  1 
ATOM 8311  C C   . ASN C 3 290 ? 81.862  62.419  74.833  1.00 10.00 ? 305 ASN C C   1 
ATOM 8312  O O   . ASN C 3 290 ? 81.581  62.156  73.679  1.00 10.00 ? 305 ASN C O   1 
ATOM 8313  C CB  . ASN C 3 290 ? 83.935  60.913  75.323  1.00 10.00 ? 305 ASN C CB  1 
ATOM 8314  C CG  . ASN C 3 290 ? 85.384  60.885  74.760  1.00 10.00 ? 305 ASN C CG  1 
ATOM 8315  O OD1 . ASN C 3 290 ? 85.575  60.890  73.555  1.00 10.00 ? 305 ASN C OD1 1 
ATOM 8316  N ND2 . ASN C 3 290 ? 86.386  60.872  75.635  1.00 10.00 ? 305 ASN C ND2 1 
ATOM 8317  N N   . CYS C 3 291 ? 80.934  62.835  75.700  1.00 10.00 ? 306 CYS C N   1 
ATOM 8318  C CA  . CYS C 3 291 ? 79.565  62.996  75.249  1.00 10.00 ? 306 CYS C CA  1 
ATOM 8319  C C   . CYS C 3 291 ? 79.622  64.327  74.482  1.00 10.00 ? 306 CYS C C   1 
ATOM 8320  O O   . CYS C 3 291 ? 79.065  64.469  73.387  1.00 10.00 ? 306 CYS C O   1 
ATOM 8321  C CB  . CYS C 3 291 ? 78.637  63.105  76.437  1.00 10.00 ? 306 CYS C CB  1 
ATOM 8322  S SG  . CYS C 3 291 ? 78.981  61.972  77.724  1.00 10.00 ? 306 CYS C SG  1 
ATOM 8323  N N   . GLY C 3 292 ? 80.296  65.312  75.074  1.00 10.00 ? 307 GLY C N   1 
ATOM 8324  C CA  . GLY C 3 292 ? 80.472  66.587  74.414  1.00 10.00 ? 307 GLY C CA  1 
ATOM 8325  C C   . GLY C 3 292 ? 81.276  66.277  73.165  1.00 10.00 ? 307 GLY C C   1 
ATOM 8326  O O   . GLY C 3 292 ? 81.049  66.856  72.103  1.00 10.00 ? 307 GLY C O   1 
ATOM 8327  N N   . ILE C 3 293 ? 82.215  65.341  73.297  1.00 10.00 ? 308 ILE C N   1 
ATOM 8328  C CA  . ILE C 3 293 ? 83.062  64.919  72.160  1.00 10.00 ? 308 ILE C CA  1 
ATOM 8329  C C   . ILE C 3 293 ? 82.083  64.286  71.203  1.00 10.00 ? 308 ILE C C   1 
ATOM 8330  O O   . ILE C 3 293 ? 82.106  64.550  70.001  1.00 10.00 ? 308 ILE C O   1 
ATOM 8331  C CB  . ILE C 3 293 ? 84.161  63.818  72.520  1.00 10.00 ? 308 ILE C CB  1 
ATOM 8332  C CG1 . ILE C 3 293 ? 85.473  64.109  71.770  1.00 10.00 ? 308 ILE C CG1 1 
ATOM 8333  C CG2 . ILE C 3 293 ? 83.724  62.426  72.021  1.00 10.00 ? 308 ILE C CG2 1 
ATOM 8334  C CD1 . ILE C 3 293 ? 86.711  63.469  72.341  1.00 10.00 ? 308 ILE C CD1 1 
ATOM 8335  N N   . VAL C 3 294 ? 81.226  63.448  71.781  1.00 10.00 ? 309 VAL C N   1 
ATOM 8336  C CA  . VAL C 3 294 ? 80.182  62.724  71.064  1.00 10.00 ? 309 VAL C CA  1 
ATOM 8337  C C   . VAL C 3 294 ? 79.546  63.778  70.184  1.00 10.00 ? 309 VAL C C   1 
ATOM 8338  O O   . VAL C 3 294 ? 79.460  63.631  68.972  1.00 10.00 ? 309 VAL C O   1 
ATOM 8339  C CB  . VAL C 3 294 ? 79.141  62.109  72.076  1.00 10.00 ? 309 VAL C CB  1 
ATOM 8340  C CG1 . VAL C 3 294 ? 77.756  62.018  71.471  1.00 10.00 ? 309 VAL C CG1 1 
ATOM 8341  C CG2 . VAL C 3 294 ? 79.597  60.739  72.502  1.00 10.00 ? 309 VAL C CG2 1 
ATOM 8342  N N   . LEU C 3 295 ? 79.144  64.870  70.817  1.00 10.00 ? 310 LEU C N   1 
ATOM 8343  C CA  . LEU C 3 295 ? 78.533  65.992  70.116  1.00 10.00 ? 310 LEU C CA  1 
ATOM 8344  C C   . LEU C 3 295 ? 79.258  66.266  68.824  1.00 10.00 ? 310 LEU C C   1 
ATOM 8345  O O   . LEU C 3 295 ? 78.878  65.787  67.749  1.00 10.00 ? 310 LEU C O   1 
ATOM 8346  C CB  . LEU C 3 295 ? 78.604  67.282  70.938  1.00 10.00 ? 310 LEU C CB  1 
ATOM 8347  C CG  . LEU C 3 295 ? 77.453  67.723  71.839  1.00 10.00 ? 310 LEU C CG  1 
ATOM 8348  C CD1 . LEU C 3 295 ? 76.118  67.357  71.235  1.00 10.00 ? 310 LEU C CD1 1 
ATOM 8349  C CD2 . LEU C 3 295 ? 77.600  67.086  73.179  1.00 10.00 ? 310 LEU C CD2 1 
ATOM 8350  N N   . ASN C 3 296 ? 80.212  67.069  68.868  1.00 10.00 ? 311 ASN C N   1 
ATOM 8351  C CA  . ASN C 3 296 ? 81.067  67.445  67.754  1.00 10.00 ? 311 ASN C CA  1 
ATOM 8352  C C   . ASN C 3 296 ? 81.494  66.214  66.966  1.00 10.00 ? 311 ASN C C   1 
ATOM 8353  O O   . ASN C 3 296 ? 81.475  66.319  65.738  1.00 10.00 ? 311 ASN C O   1 
ATOM 8354  C CB  . ASN C 3 296 ? 82.288  68.218  68.253  1.00 10.00 ? 311 ASN C CB  1 
ATOM 8355  C CG  . ASN C 3 296 ? 82.354  69.625  67.695  1.00 10.00 ? 311 ASN C CG  1 
ATOM 8356  O OD1 . ASN C 3 296 ? 82.771  69.831  66.555  1.00 10.00 ? 311 ASN C OD1 1 
ATOM 8357  N ND2 . ASN C 3 296 ? 81.942  70.598  68.498  1.00 10.00 ? 311 ASN C ND2 1 
ATOM 8358  N N   . PHE C 3 297 ? 82.102  65.175  67.626  1.00 10.00 ? 312 PHE C N   1 
ATOM 8359  C CA  . PHE C 3 297 ? 82.675  64.093  66.842  1.00 10.00 ? 312 PHE C CA  1 
ATOM 8360  C C   . PHE C 3 297 ? 81.632  63.364  66.006  1.00 10.00 ? 312 PHE C C   1 
ATOM 8361  O O   . PHE C 3 297 ? 81.815  62.770  64.995  1.00 10.00 ? 312 PHE C O   1 
ATOM 8362  C CB  . PHE C 3 297 ? 83.401  63.098  67.744  1.00 10.00 ? 312 PHE C CB  1 
ATOM 8363  C CG  . PHE C 3 297 ? 84.641  62.531  67.125  1.00 10.00 ? 312 PHE C CG  1 
ATOM 8364  C CD1 . PHE C 3 297 ? 85.887  62.826  67.650  1.00 10.00 ? 312 PHE C CD1 1 
ATOM 8365  C CD2 . PHE C 3 297 ? 84.561  61.709  66.016  1.00 10.00 ? 312 PHE C CD2 1 
ATOM 8366  C CE1 . PHE C 3 297 ? 87.034  62.308  67.080  1.00 10.00 ? 312 PHE C CE1 1 
ATOM 8367  C CE2 . PHE C 3 297 ? 85.704  61.188  65.440  1.00 10.00 ? 312 PHE C CE2 1 
ATOM 8368  C CZ  . PHE C 3 297 ? 86.942  61.488  65.973  1.00 10.00 ? 312 PHE C CZ  1 
ATOM 8369  N N   . HIS C 3 298 ? 80.362  63.439  66.684  1.00 10.00 ? 313 HIS C N   1 
ATOM 8370  C CA  . HIS C 3 298 ? 79.165  62.890  66.099  1.00 10.00 ? 313 HIS C CA  1 
ATOM 8371  C C   . HIS C 3 298 ? 78.509  63.856  65.068  1.00 10.00 ? 313 HIS C C   1 
ATOM 8372  O O   . HIS C 3 298 ? 77.862  63.415  64.104  1.00 10.00 ? 313 HIS C O   1 
ATOM 8373  C CB  . HIS C 3 298 ? 78.326  62.491  67.318  1.00 10.00 ? 313 HIS C CB  1 
ATOM 8374  C CG  . HIS C 3 298 ? 76.876  62.320  67.079  1.00 10.00 ? 313 HIS C CG  1 
ATOM 8375  N ND1 . HIS C 3 298 ? 76.367  61.321  66.284  1.00 10.00 ? 313 HIS C ND1 1 
ATOM 8376  C CD2 . HIS C 3 298 ? 75.814  62.937  67.645  1.00 10.00 ? 313 HIS C CD2 1 
ATOM 8377  C CE1 . HIS C 3 298 ? 75.049  61.321  66.376  1.00 10.00 ? 313 HIS C CE1 1 
ATOM 8378  N NE2 . HIS C 3 298 ? 74.688  62.291  67.197  1.00 10.00 ? 313 HIS C NE2 1 
ATOM 8379  N N   . PHE C 3 299 ? 78.732  65.229  65.151  1.00 10.00 ? 314 PHE C N   1 
ATOM 8380  C CA  . PHE C 3 299 ? 78.147  66.112  64.151  1.00 10.00 ? 314 PHE C CA  1 
ATOM 8381  C C   . PHE C 3 299 ? 79.206  67.050  63.583  1.00 10.00 ? 314 PHE C C   1 
ATOM 8382  O O   . PHE C 3 299 ? 78.889  68.055  62.902  1.00 10.00 ? 314 PHE C O   1 
ATOM 8383  C CB  . PHE C 3 299 ? 77.000  66.942  64.739  1.00 10.00 ? 314 PHE C CB  1 
ATOM 8384  C CG  . PHE C 3 299 ? 77.423  68.012  65.705  1.00 10.00 ? 314 PHE C CG  1 
ATOM 8385  C CD1 . PHE C 3 299 ? 77.861  69.240  65.239  1.00 10.00 ? 314 PHE C CD1 1 
ATOM 8386  C CD2 . PHE C 3 299 ? 77.384  67.795  67.071  1.00 10.00 ? 314 PHE C CD2 1 
ATOM 8387  C CE1 . PHE C 3 299 ? 78.256  70.232  66.117  1.00 10.00 ? 314 PHE C CE1 1 
ATOM 8388  C CE2 . PHE C 3 299 ? 77.779  68.782  67.955  1.00 10.00 ? 314 PHE C CE2 1 
ATOM 8389  C CZ  . PHE C 3 299 ? 78.214  70.002  67.477  1.00 10.00 ? 314 PHE C CZ  1 
ATOM 8390  N N   . ARG C 3 300 ? 80.474  66.707  63.813  1.00 10.00 ? 315 ARG C N   1 
ATOM 8391  C CA  . ARG C 3 300 ? 81.672  67.558  63.529  1.00 10.00 ? 315 ARG C CA  1 
ATOM 8392  C C   . ARG C 3 300 ? 82.044  67.857  62.033  1.00 10.00 ? 315 ARG C C   1 
ATOM 8393  O O   . ARG C 3 300 ? 82.798  68.791  61.734  1.00 10.00 ? 315 ARG C O   1 
ATOM 8394  C CB  . ARG C 3 300 ? 82.927  66.929  64.141  1.00 10.00 ? 315 ARG C CB  1 
ATOM 8395  C CG  . ARG C 3 300 ? 83.523  65.819  63.283  1.00 10.00 ? 315 ARG C CG  1 
ATOM 8396  C CD  . ARG C 3 300 ? 82.538  64.685  63.017  1.00 10.00 ? 315 ARG C CD  1 
ATOM 8397  N NE  . ARG C 3 300 ? 83.163  63.533  62.362  1.00 10.00 ? 315 ARG C NE  1 
ATOM 8398  C CZ  . ARG C 3 300 ? 82.496  62.440  61.983  1.00 10.00 ? 315 ARG C CZ  1 
ATOM 8399  N NH1 . ARG C 3 300 ? 81.177  62.334  62.188  1.00 10.00 ? 315 ARG C NH1 1 
ATOM 8400  N NH2 . ARG C 3 300 ? 83.067  61.388  61.384  1.00 10.00 ? 315 ARG C NH2 1 
ATOM 8401  N N   . THR C 3 301 ? 81.577  67.137  60.993  1.00 10.00 ? 316 THR C N   1 
ATOM 8402  C CA  . THR C 3 301 ? 82.001  67.431  59.634  1.00 10.00 ? 316 THR C CA  1 
ATOM 8403  C C   . THR C 3 301 ? 81.104  68.480  58.999  1.00 10.00 ? 316 THR C C   1 
ATOM 8404  O O   . THR C 3 301 ? 79.889  68.552  59.221  1.00 10.00 ? 316 THR C O   1 
ATOM 8405  C CB  . THR C 3 301 ? 81.992  66.184  58.749  1.00 10.00 ? 316 THR C CB  1 
ATOM 8406  O OG1 . THR C 3 301 ? 82.890  65.207  59.285  1.00 10.00 ? 316 THR C OG1 1 
ATOM 8407  C CG2 . THR C 3 301 ? 82.405  66.538  57.328  1.00 10.00 ? 316 THR C CG2 1 
ATOM 8408  N N   . PRO C 3 302 ? 81.660  69.314  58.054  1.00 10.00 ? 317 PRO C N   1 
ATOM 8409  C CA  . PRO C 3 302 ? 80.976  70.493  57.518  1.00 10.00 ? 317 PRO C CA  1 
ATOM 8410  C C   . PRO C 3 302 ? 79.693  70.135  56.756  1.00 10.00 ? 317 PRO C C   1 
ATOM 8411  O O   . PRO C 3 302 ? 78.734  70.905  56.802  1.00 10.00 ? 317 PRO C O   1 
ATOM 8412  C CB  . PRO C 3 302 ? 81.963  71.043  56.482  1.00 10.00 ? 317 PRO C CB  1 
ATOM 8413  C CG  . PRO C 3 302 ? 82.688  69.852  55.992  1.00 10.00 ? 317 PRO C CG  1 
ATOM 8414  C CD  . PRO C 3 302 ? 82.706  68.879  57.137  1.00 10.00 ? 317 PRO C CD  1 
ATOM 8415  N N   . SER C 3 303 ? 79.782  68.981  56.124  1.00 10.00 ? 318 SER C N   1 
ATOM 8416  C CA  . SER C 3 303 ? 78.660  68.557  55.296  1.00 10.00 ? 318 SER C CA  1 
ATOM 8417  C C   . SER C 3 303 ? 78.083  67.235  55.790  1.00 10.00 ? 318 SER C C   1 
ATOM 8418  O O   . SER C 3 303 ? 76.852  67.035  55.770  1.00 10.00 ? 318 SER C O   1 
ATOM 8419  C CB  . SER C 3 303 ? 79.088  68.441  53.832  1.00 10.00 ? 318 SER C CB  1 
ATOM 8420  O OG  . SER C 3 303 ? 79.481  69.700  53.314  1.00 10.00 ? 318 SER C OG  1 
ATOM 8421  N N   . THR C 3 304 ? 78.929  66.302  56.209  1.00 10.00 ? 319 THR C N   1 
ATOM 8422  C CA  . THR C 3 304 ? 78.469  64.980  56.719  1.00 10.00 ? 319 THR C CA  1 
ATOM 8423  C C   . THR C 3 304 ? 77.657  65.211  57.998  1.00 10.00 ? 319 THR C C   1 
ATOM 8424  O O   . THR C 3 304 ? 76.587  64.634  58.195  1.00 10.00 ? 319 THR C O   1 
ATOM 8425  C CB  . THR C 3 304 ? 79.677  64.079  56.989  1.00 10.00 ? 319 THR C CB  1 
ATOM 8426  O OG1 . THR C 3 304 ? 79.724  63.030  56.030  1.00 10.00 ? 319 THR C OG1 1 
ATOM 8427  C CG2 . THR C 3 304 ? 79.646  63.434  58.374  1.00 10.00 ? 319 THR C CG2 1 
ATOM 8428  N N   . HIS C 3 305 ? 78.196  66.055  58.867  1.00 10.00 ? 320 HIS C N   1 
ATOM 8429  C CA  . HIS C 3 305 ? 77.540  66.405  60.124  1.00 10.00 ? 320 HIS C CA  1 
ATOM 8430  C C   . HIS C 3 305 ? 76.684  65.313  60.792  1.00 10.00 ? 320 HIS C C   1 
ATOM 8431  O O   . HIS C 3 305 ? 77.137  64.602  61.705  1.00 10.00 ? 320 HIS C O   1 
ATOM 8432  C CB  . HIS C 3 305 ? 76.720  67.702  59.936  1.00 10.00 ? 320 HIS C CB  1 
ATOM 8433  C CG  . HIS C 3 305 ? 75.279  67.495  59.567  1.00 10.00 ? 320 HIS C CG  1 
ATOM 8434  N ND1 . HIS C 3 305 ? 74.882  67.005  58.339  1.00 10.00 ? 320 HIS C ND1 1 
ATOM 8435  C CD2 . HIS C 3 305 ? 74.140  67.800  60.239  1.00 10.00 ? 320 HIS C CD2 1 
ATOM 8436  C CE1 . HIS C 3 305 ? 73.560  67.027  58.270  1.00 10.00 ? 320 HIS C CE1 1 
ATOM 8437  N NE2 . HIS C 3 305 ? 73.086  67.503  59.410  1.00 10.00 ? 320 HIS C NE2 1 
ATOM 8438  N N   . SER C 3 306 ? 70.576  69.432  16.347  1.00 10.00 ? 421 SER C N   1 
ATOM 8439  C CA  . SER C 3 306 ? 71.551  69.556  17.427  1.00 10.00 ? 421 SER C CA  1 
ATOM 8440  C C   . SER C 3 306 ? 70.904  70.214  18.649  1.00 10.00 ? 421 SER C C   1 
ATOM 8441  O O   . SER C 3 306 ? 71.563  70.438  19.669  1.00 10.00 ? 421 SER C O   1 
ATOM 8442  C CB  . SER C 3 306 ? 72.770  70.360  16.935  1.00 10.00 ? 421 SER C CB  1 
ATOM 8443  O OG  . SER C 3 306 ? 73.584  70.843  17.998  1.00 10.00 ? 421 SER C OG  1 
ATOM 8444  N N   . GLY C 3 307 ? 69.611  70.509  18.545  1.00 10.00 ? 422 GLY C N   1 
ATOM 8445  C CA  . GLY C 3 307 ? 68.906  71.117  19.647  1.00 10.00 ? 422 GLY C CA  1 
ATOM 8446  C C   . GLY C 3 307 ? 68.604  70.115  20.761  1.00 10.00 ? 422 GLY C C   1 
ATOM 8447  O O   . GLY C 3 307 ? 68.795  70.400  21.950  1.00 10.00 ? 422 GLY C O   1 
ATOM 8448  N N   . ILE C 3 308 ? 68.113  68.943  20.375  1.00 10.00 ? 423 ILE C N   1 
ATOM 8449  C CA  . ILE C 3 308 ? 67.784  67.893  21.329  1.00 10.00 ? 423 ILE C CA  1 
ATOM 8450  C C   . ILE C 3 308 ? 69.031  67.525  22.147  1.00 10.00 ? 423 ILE C C   1 
ATOM 8451  O O   . ILE C 3 308 ? 68.936  67.241  23.345  1.00 10.00 ? 423 ILE C O   1 
ATOM 8452  C CB  . ILE C 3 308 ? 67.243  66.668  20.568  1.00 10.00 ? 423 ILE C CB  1 
ATOM 8453  C CG1 . ILE C 3 308 ? 67.683  66.790  19.112  1.00 10.00 ? 423 ILE C CG1 1 
ATOM 8454  C CG2 . ILE C 3 308 ? 65.708  66.584  20.658  1.00 10.00 ? 423 ILE C CG2 1 
ATOM 8455  C CD1 . ILE C 3 308 ? 67.322  65.633  18.247  1.00 10.00 ? 423 ILE C CD1 1 
ATOM 8456  N N   . ASP C 3 309 ? 70.194  67.517  21.496  1.00 10.00 ? 424 ASP C N   1 
ATOM 8457  C CA  . ASP C 3 309 ? 71.449  67.191  22.177  1.00 10.00 ? 424 ASP C CA  1 
ATOM 8458  C C   . ASP C 3 309 ? 71.707  68.282  23.196  1.00 10.00 ? 424 ASP C C   1 
ATOM 8459  O O   . ASP C 3 309 ? 72.165  68.022  24.312  1.00 10.00 ? 424 ASP C O   1 
ATOM 8460  C CB  . ASP C 3 309 ? 72.649  67.125  21.204  1.00 10.00 ? 424 ASP C CB  1 
ATOM 8461  C CG  . ASP C 3 309 ? 73.960  66.701  21.907  1.00 10.00 ? 424 ASP C CG  1 
ATOM 8462  O OD1 . ASP C 3 309 ? 73.955  65.624  22.535  1.00 10.00 ? 424 ASP C OD1 1 
ATOM 8463  O OD2 . ASP C 3 309 ? 74.986  67.417  21.844  1.00 10.00 ? 424 ASP C OD2 1 
ATOM 8464  N N   . SER C 3 310 ? 71.435  69.514  22.778  1.00 10.00 ? 425 SER C N   1 
ATOM 8465  C CA  . SER C 3 310 ? 71.605  70.701  23.621  1.00 10.00 ? 425 SER C CA  1 
ATOM 8466  C C   . SER C 3 310 ? 70.849  70.529  24.938  1.00 10.00 ? 425 SER C C   1 
ATOM 8467  O O   . SER C 3 310 ? 71.395  70.751  26.019  1.00 10.00 ? 425 SER C O   1 
ATOM 8468  C CB  . SER C 3 310 ? 71.085  71.967  22.900  1.00 10.00 ? 425 SER C CB  1 
ATOM 8469  O OG  . SER C 3 310 ? 71.834  72.256  21.733  1.00 10.00 ? 425 SER C OG  1 
ATOM 8470  N N   . THR C 3 311 ? 69.589  70.120  24.838  1.00 10.00 ? 426 THR C N   1 
ATOM 8471  C CA  . THR C 3 311 ? 68.741  69.934  26.010  1.00 10.00 ? 426 THR C CA  1 
ATOM 8472  C C   . THR C 3 311 ? 69.188  68.851  26.942  1.00 10.00 ? 426 THR C C   1 
ATOM 8473  O O   . THR C 3 311 ? 69.181  69.003  28.148  1.00 10.00 ? 426 THR C O   1 
ATOM 8474  C CB  . THR C 3 311 ? 67.343  69.505  25.679  1.00 10.00 ? 426 THR C CB  1 
ATOM 8475  O OG1 . THR C 3 311 ? 66.915  70.129  24.470  1.00 10.00 ? 426 THR C OG1 1 
ATOM 8476  C CG2 . THR C 3 311 ? 66.435  69.851  26.836  1.00 10.00 ? 426 THR C CG2 1 
ATOM 8477  N N   . ASN C 3 312 ? 69.537  67.708  26.400  1.00 10.00 ? 427 ASN C N   1 
ATOM 8478  C CA  . ASN C 3 312 ? 69.913  66.665  27.338  1.00 10.00 ? 427 ASN C CA  1 
ATOM 8479  C C   . ASN C 3 312 ? 71.279  66.903  27.902  1.00 10.00 ? 427 ASN C C   1 
ATOM 8480  O O   . ASN C 3 312 ? 71.583  66.441  28.993  1.00 10.00 ? 427 ASN C O   1 
ATOM 8481  C CB  . ASN C 3 312 ? 69.753  65.295  26.717  1.00 10.00 ? 427 ASN C CB  1 
ATOM 8482  C CG  . ASN C 3 312 ? 68.369  64.729  26.972  1.00 10.00 ? 427 ASN C CG  1 
ATOM 8483  O OD1 . ASN C 3 312 ? 67.971  64.566  28.121  1.00 10.00 ? 427 ASN C OD1 1 
ATOM 8484  N ND2 . ASN C 3 312 ? 67.622  64.454  25.906  1.00 10.00 ? 427 ASN C ND2 1 
ATOM 8485  N N   . TYR C 3 313 ? 72.069  67.712  27.203  1.00 10.00 ? 428 TYR C N   1 
ATOM 8486  C CA  . TYR C 3 313 ? 73.389  68.012  27.679  1.00 10.00 ? 428 TYR C CA  1 
ATOM 8487  C C   . TYR C 3 313 ? 73.125  68.890  28.924  1.00 10.00 ? 428 TYR C C   1 
ATOM 8488  O O   . TYR C 3 313 ? 73.861  68.830  29.910  1.00 10.00 ? 428 TYR C O   1 
ATOM 8489  C CB  . TYR C 3 313 ? 74.152  68.749  26.576  1.00 10.00 ? 428 TYR C CB  1 
ATOM 8490  C CG  . TYR C 3 313 ? 75.650  68.693  26.706  1.00 10.00 ? 428 TYR C CG  1 
ATOM 8491  C CD1 . TYR C 3 313 ? 76.450  68.729  25.576  1.00 10.00 ? 428 TYR C CD1 1 
ATOM 8492  C CD2 . TYR C 3 313 ? 76.274  68.628  27.953  1.00 10.00 ? 428 TYR C CD2 1 
ATOM 8493  C CE1 . TYR C 3 313 ? 77.829  68.700  25.675  1.00 10.00 ? 428 TYR C CE1 1 
ATOM 8494  C CE2 . TYR C 3 313 ? 77.650  68.602  28.057  1.00 10.00 ? 428 TYR C CE2 1 
ATOM 8495  C CZ  . TYR C 3 313 ? 78.420  68.635  26.910  1.00 10.00 ? 428 TYR C CZ  1 
ATOM 8496  O OH  . TYR C 3 313 ? 79.786  68.582  26.982  1.00 10.00 ? 428 TYR C OH  1 
ATOM 8497  N N   . ILE C 3 314 ? 72.051  69.679  28.869  1.00 10.00 ? 429 ILE C N   1 
ATOM 8498  C CA  . ILE C 3 314 ? 71.656  70.527  29.958  1.00 10.00 ? 429 ILE C CA  1 
ATOM 8499  C C   . ILE C 3 314 ? 71.537  69.641  31.190  1.00 10.00 ? 429 ILE C C   1 
ATOM 8500  O O   . ILE C 3 314 ? 72.007  69.981  32.291  1.00 10.00 ? 429 ILE C O   1 
ATOM 8501  C CB  . ILE C 3 314 ? 70.262  71.205  29.662  1.00 10.00 ? 429 ILE C CB  1 
ATOM 8502  C CG1 . ILE C 3 314 ? 69.100  70.310  30.141  1.00 10.00 ? 429 ILE C CG1 1 
ATOM 8503  C CG2 . ILE C 3 314 ? 70.132  71.546  28.154  1.00 10.00 ? 429 ILE C CG2 1 
ATOM 8504  C CD1 . ILE C 3 314 ? 68.761  70.362  31.643  1.00 10.00 ? 429 ILE C CD1 1 
ATOM 8505  N N   . VAL C 3 315 ? 70.896  68.500  30.990  1.00 10.00 ? 430 VAL C N   1 
ATOM 8506  C CA  . VAL C 3 315 ? 70.654  67.556  32.072  1.00 10.00 ? 430 VAL C CA  1 
ATOM 8507  C C   . VAL C 3 315 ? 71.969  66.882  32.481  1.00 10.00 ? 430 VAL C C   1 
ATOM 8508  O O   . VAL C 3 315 ? 72.263  66.792  33.670  1.00 10.00 ? 430 VAL C O   1 
ATOM 8509  C CB  . VAL C 3 315 ? 69.571  66.479  31.673  1.00 10.00 ? 430 VAL C CB  1 
ATOM 8510  C CG1 . VAL C 3 315 ? 68.556  66.257  32.829  1.00 10.00 ? 430 VAL C CG1 1 
ATOM 8511  C CG2 . VAL C 3 315 ? 68.868  66.890  30.386  1.00 10.00 ? 430 VAL C CG2 1 
ATOM 8512  N N   . LYS C 3 316 ? 72.775  66.446  31.507  1.00 10.00 ? 431 LYS C N   1 
ATOM 8513  C CA  . LYS C 3 316 ? 74.042  65.808  31.860  1.00 10.00 ? 431 LYS C CA  1 
ATOM 8514  C C   . LYS C 3 316 ? 74.829  66.880  32.649  1.00 10.00 ? 431 LYS C C   1 
ATOM 8515  O O   . LYS C 3 316 ? 75.655  66.554  33.496  1.00 10.00 ? 431 LYS C O   1 
ATOM 8516  C CB  . LYS C 3 316 ? 74.865  65.345  30.621  1.00 10.00 ? 431 LYS C CB  1 
ATOM 8517  C CG  . LYS C 3 316 ? 74.153  64.759  29.393  1.00 10.00 ? 431 LYS C CG  1 
ATOM 8518  C CD  . LYS C 3 316 ? 75.218  64.676  28.293  1.00 10.00 ? 431 LYS C CD  1 
ATOM 8519  C CE  . LYS C 3 316 ? 74.838  63.815  27.075  1.00 10.00 ? 431 LYS C CE  1 
ATOM 8520  N NZ  . LYS C 3 316 ? 75.966  63.529  26.082  1.00 10.00 ? 431 LYS C NZ  1 
ATOM 8521  N N   . GLN C 3 317 ? 74.557  68.160  32.381  1.00 10.00 ? 432 GLN C N   1 
ATOM 8522  C CA  . GLN C 3 317 ? 75.218  69.231  33.078  1.00 10.00 ? 432 GLN C CA  1 
ATOM 8523  C C   . GLN C 3 317 ? 74.682  69.231  34.497  1.00 10.00 ? 432 GLN C C   1 
ATOM 8524  O O   . GLN C 3 317 ? 75.443  69.119  35.466  1.00 10.00 ? 432 GLN C O   1 
ATOM 8525  C CB  . GLN C 3 317 ? 74.909  70.549  32.394  1.00 10.00 ? 432 GLN C CB  1 
ATOM 8526  C CG  . GLN C 3 317 ? 76.026  71.565  32.506  1.00 10.00 ? 432 GLN C CG  1 
ATOM 8527  C CD  . GLN C 3 317 ? 76.765  71.740  31.204  1.00 10.00 ? 432 GLN C CD  1 
ATOM 8528  O OE1 . GLN C 3 317 ? 76.160  72.020  30.168  1.00 10.00 ? 432 GLN C OE1 1 
ATOM 8529  N NE2 . GLN C 3 317 ? 78.078  71.585  31.248  1.00 10.00 ? 432 GLN C NE2 1 
ATOM 8530  N N   . ILE C 3 318 ? 73.368  69.353  34.633  1.00 10.00 ? 433 ILE C N   1 
ATOM 8531  C CA  . ILE C 3 318 ? 72.761  69.346  35.955  1.00 10.00 ? 433 ILE C CA  1 
ATOM 8532  C C   . ILE C 3 318 ? 73.186  68.028  36.637  1.00 10.00 ? 433 ILE C C   1 
ATOM 8533  O O   . ILE C 3 318 ? 73.375  67.970  37.852  1.00 10.00 ? 433 ILE C O   1 
ATOM 8534  C CB  . ILE C 3 318 ? 71.224  69.446  35.857  1.00 10.00 ? 433 ILE C CB  1 
ATOM 8535  C CG1 . ILE C 3 318 ? 70.831  70.668  35.057  1.00 10.00 ? 433 ILE C CG1 1 
ATOM 8536  C CG2 . ILE C 3 318 ? 70.625  69.609  37.215  1.00 10.00 ? 433 ILE C CG2 1 
ATOM 8537  C CD1 . ILE C 3 318 ? 69.394  70.756  34.836  1.00 10.00 ? 433 ILE C CD1 1 
ATOM 8538  N N   . LYS C 3 319 ? 73.355  66.985  35.812  1.00 10.00 ? 434 LYS C N   1 
ATOM 8539  C CA  . LYS C 3 319 ? 73.794  65.631  36.247  1.00 10.00 ? 434 LYS C CA  1 
ATOM 8540  C C   . LYS C 3 319 ? 75.040  65.708  37.121  1.00 10.00 ? 434 LYS C C   1 
ATOM 8541  O O   . LYS C 3 319 ? 74.985  65.624  38.343  1.00 10.00 ? 434 LYS C O   1 
ATOM 8542  C CB  . LYS C 3 319 ? 74.173  64.744  35.032  1.00 10.00 ? 434 LYS C CB  1 
ATOM 8543  C CG  . LYS C 3 319 ? 75.164  63.593  35.388  1.00 10.00 ? 434 LYS C CG  1 
ATOM 8544  C CD  . LYS C 3 319 ? 76.418  63.585  34.517  1.00 10.00 ? 434 LYS C CD  1 
ATOM 8545  C CE  . LYS C 3 319 ? 77.447  62.621  35.100  1.00 10.00 ? 434 LYS C CE  1 
ATOM 8546  N NZ  . LYS C 3 319 ? 78.651  62.324  34.237  1.00 10.00 ? 434 LYS C NZ  1 
ATOM 8547  N N   . GLU C 3 320 ? 76.148  65.849  36.413  1.00 10.00 ? 435 GLU C N   1 
ATOM 8548  C CA  . GLU C 3 320 ? 77.501  65.935  36.946  1.00 10.00 ? 435 GLU C CA  1 
ATOM 8549  C C   . GLU C 3 320 ? 77.587  66.969  38.064  1.00 10.00 ? 435 GLU C C   1 
ATOM 8550  O O   . GLU C 3 320 ? 78.096  66.685  39.159  1.00 10.00 ? 435 GLU C O   1 
ATOM 8551  C CB  . GLU C 3 320 ? 78.495  66.266  35.832  1.00 10.00 ? 435 GLU C CB  1 
ATOM 8552  C CG  . GLU C 3 320 ? 78.540  65.236  34.716  1.00 10.00 ? 435 GLU C CG  1 
ATOM 8553  C CD  . GLU C 3 320 ? 79.527  65.601  33.624  1.00 10.00 ? 435 GLU C CD  1 
ATOM 8554  O OE1 . GLU C 3 320 ? 80.181  66.658  33.745  1.00 10.00 ? 435 GLU C OE1 1 
ATOM 8555  O OE2 . GLU C 3 320 ? 79.646  64.831  32.649  1.00 10.00 ? 435 GLU C OE2 1 
ATOM 8556  N N   . LYS C 3 321 ? 77.077  68.157  37.777  1.00 10.00 ? 436 LYS C N   1 
ATOM 8557  C CA  . LYS C 3 321 ? 77.076  69.303  38.696  1.00 10.00 ? 436 LYS C CA  1 
ATOM 8558  C C   . LYS C 3 321 ? 76.734  68.996  40.154  1.00 10.00 ? 436 LYS C C   1 
ATOM 8559  O O   . LYS C 3 321 ? 77.529  69.247  41.070  1.00 10.00 ? 436 LYS C O   1 
ATOM 8560  C CB  . LYS C 3 321 ? 76.108  70.381  38.181  1.00 10.00 ? 436 LYS C CB  1 
ATOM 8561  C CG  . LYS C 3 321 ? 76.786  71.613  37.508  1.00 10.00 ? 436 LYS C CG  1 
ATOM 8562  C CD  . LYS C 3 321 ? 75.767  72.514  36.734  1.00 10.00 ? 436 LYS C CD  1 
ATOM 8563  C CE  . LYS C 3 321 ? 74.956  73.424  37.642  1.00 10.00 ? 436 LYS C CE  1 
ATOM 8564  N NZ  . LYS C 3 321 ? 73.705  73.865  36.998  1.00 10.00 ? 436 LYS C NZ  1 
ATOM 8565  N N   . ASN C 3 322 ? 75.543  68.463  40.385  1.00 10.00 ? 437 ASN C N   1 
ATOM 8566  C CA  . ASN C 3 322 ? 75.154  68.172  41.752  1.00 10.00 ? 437 ASN C CA  1 
ATOM 8567  C C   . ASN C 3 322 ? 75.788  66.845  42.206  1.00 10.00 ? 437 ASN C C   1 
ATOM 8568  O O   . ASN C 3 322 ? 75.647  66.428  43.362  1.00 10.00 ? 437 ASN C O   1 
ATOM 8569  C CB  . ASN C 3 322 ? 73.612  68.184  41.873  1.00 10.00 ? 437 ASN C CB  1 
ATOM 8570  C CG  . ASN C 3 322 ? 73.058  69.551  42.334  1.00 10.00 ? 437 ASN C CG  1 
ATOM 8571  O OD1 . ASN C 3 322 ? 72.777  69.757  43.524  1.00 10.00 ? 437 ASN C OD1 1 
ATOM 8572  N ND2 . ASN C 3 322 ? 72.912  70.480  41.390  1.00 10.00 ? 437 ASN C ND2 1 
ATOM 8573  N N   . ALA C 3 323 ? 76.494  66.190  41.285  1.00 10.00 ? 438 ALA C N   1 
ATOM 8574  C CA  . ALA C 3 323 ? 77.180  64.958  41.623  1.00 10.00 ? 438 ALA C CA  1 
ATOM 8575  C C   . ALA C 3 323 ? 78.385  65.478  42.384  1.00 10.00 ? 438 ALA C C   1 
ATOM 8576  O O   . ALA C 3 323 ? 78.965  64.781  43.221  1.00 10.00 ? 438 ALA C O   1 
ATOM 8577  C CB  . ALA C 3 323 ? 77.619  64.231  40.382  1.00 10.00 ? 438 ALA C CB  1 
ATOM 8578  N N   . TYR C 3 324 ? 78.774  66.719  42.081  1.00 10.00 ? 439 TYR C N   1 
ATOM 8579  C CA  . TYR C 3 324 ? 79.875  67.350  42.780  1.00 10.00 ? 439 TYR C CA  1 
ATOM 8580  C C   . TYR C 3 324 ? 79.408  67.694  44.192  1.00 10.00 ? 439 TYR C C   1 
ATOM 8581  O O   . TYR C 3 324 ? 80.163  67.532  45.140  1.00 10.00 ? 439 TYR C O   1 
ATOM 8582  C CB  . TYR C 3 324 ? 80.366  68.581  42.007  1.00 10.00 ? 439 TYR C CB  1 
ATOM 8583  C CG  . TYR C 3 324 ? 81.379  68.232  40.917  1.00 10.00 ? 439 TYR C CG  1 
ATOM 8584  C CD1 . TYR C 3 324 ? 81.007  67.452  39.801  1.00 10.00 ? 439 TYR C CD1 1 
ATOM 8585  C CD2 . TYR C 3 324 ? 82.731  68.653  41.022  1.00 10.00 ? 439 TYR C CD2 1 
ATOM 8586  C CE1 . TYR C 3 324 ? 81.960  67.098  38.819  1.00 10.00 ? 439 TYR C CE1 1 
ATOM 8587  C CE2 . TYR C 3 324 ? 83.690  68.307  40.048  1.00 10.00 ? 439 TYR C CE2 1 
ATOM 8588  C CZ  . TYR C 3 324 ? 83.295  67.530  38.951  1.00 10.00 ? 439 TYR C CZ  1 
ATOM 8589  O OH  . TYR C 3 324 ? 84.223  67.187  37.994  1.00 10.00 ? 439 TYR C OH  1 
ATOM 8590  N N   . ASP C 3 325 ? 78.156  68.132  44.316  1.00 10.00 ? 440 ASP C N   1 
ATOM 8591  C CA  . ASP C 3 325 ? 77.549  68.453  45.618  1.00 10.00 ? 440 ASP C CA  1 
ATOM 8592  C C   . ASP C 3 325 ? 77.570  67.168  46.436  1.00 10.00 ? 440 ASP C C   1 
ATOM 8593  O O   . ASP C 3 325 ? 78.193  67.077  47.497  1.00 10.00 ? 440 ASP C O   1 
ATOM 8594  C CB  . ASP C 3 325 ? 76.078  68.875  45.450  1.00 10.00 ? 440 ASP C CB  1 
ATOM 8595  C CG  . ASP C 3 325 ? 75.903  70.350  45.068  1.00 10.00 ? 440 ASP C CG  1 
ATOM 8596  O OD1 . ASP C 3 325 ? 76.307  71.227  45.861  1.00 10.00 ? 440 ASP C OD1 1 
ATOM 8597  O OD2 . ASP C 3 325 ? 75.347  70.635  43.982  1.00 10.00 ? 440 ASP C OD2 1 
ATOM 8598  N N   . GLU C 3 326 ? 76.839  66.183  45.914  1.00 10.00 ? 441 GLU C N   1 
ATOM 8599  C CA  . GLU C 3 326 ? 76.707  64.835  46.471  1.00 10.00 ? 441 GLU C CA  1 
ATOM 8600  C C   . GLU C 3 326 ? 78.018  64.353  47.090  1.00 10.00 ? 441 GLU C C   1 
ATOM 8601  O O   . GLU C 3 326 ? 78.055  63.863  48.219  1.00 10.00 ? 441 GLU C O   1 
ATOM 8602  C CB  . GLU C 3 326 ? 76.317  63.853  45.348  1.00 10.00 ? 441 GLU C CB  1 
ATOM 8603  C CG  . GLU C 3 326 ? 74.979  64.126  44.649  1.00 10.00 ? 441 GLU C CG  1 
ATOM 8604  C CD  . GLU C 3 326 ? 74.999  63.797  43.156  1.00 10.00 ? 441 GLU C CD  1 
ATOM 8605  O OE1 . GLU C 3 326 ? 75.710  62.852  42.761  1.00 10.00 ? 441 GLU C OE1 1 
ATOM 8606  O OE2 . GLU C 3 326 ? 74.296  64.479  42.381  1.00 10.00 ? 441 GLU C OE2 1 
ATOM 8607  N N   . GLU C 3 327 ? 79.086  64.493  46.314  1.00 10.00 ? 442 GLU C N   1 
ATOM 8608  C CA  . GLU C 3 327 ? 80.441  64.068  46.695  1.00 10.00 ? 442 GLU C CA  1 
ATOM 8609  C C   . GLU C 3 327 ? 81.161  65.028  47.629  1.00 10.00 ? 442 GLU C C   1 
ATOM 8610  O O   . GLU C 3 327 ? 82.041  64.615  48.395  1.00 10.00 ? 442 GLU C O   1 
ATOM 8611  C CB  . GLU C 3 327 ? 81.325  63.808  45.435  1.00 10.00 ? 442 GLU C CB  1 
ATOM 8612  C CG  . GLU C 3 327 ? 81.670  62.291  45.134  1.00 10.00 ? 442 GLU C CG  1 
ATOM 8613  C CD  . GLU C 3 327 ? 83.183  61.931  45.213  1.00 10.00 ? 442 GLU C CD  1 
ATOM 8614  O OE1 . GLU C 3 327 ? 83.894  62.441  46.099  1.00 10.00 ? 442 GLU C OE1 1 
ATOM 8615  O OE2 . GLU C 3 327 ? 83.665  61.106  44.409  1.00 10.00 ? 442 GLU C OE2 1 
ATOM 8616  N N   . VAL C 3 328 ? 80.811  66.310  47.569  1.00 10.00 ? 443 VAL C N   1 
ATOM 8617  C CA  . VAL C 3 328 ? 81.441  67.312  48.438  1.00 10.00 ? 443 VAL C CA  1 
ATOM 8618  C C   . VAL C 3 328 ? 81.188  66.814  49.848  1.00 10.00 ? 443 VAL C C   1 
ATOM 8619  O O   . VAL C 3 328 ? 81.955  67.095  50.762  1.00 10.00 ? 443 VAL C O   1 
ATOM 8620  C CB  . VAL C 3 328 ? 80.805  68.759  48.315  1.00 10.00 ? 443 VAL C CB  1 
ATOM 8621  C CG1 . VAL C 3 328 ? 81.415  69.695  49.371  1.00 10.00 ? 443 VAL C CG1 1 
ATOM 8622  C CG2 . VAL C 3 328 ? 81.038  69.349  46.922  1.00 10.00 ? 443 VAL C CG2 1 
ATOM 8623  N N   . GLY C 3 329 ? 80.110  66.044  49.979  1.00 10.00 ? 444 GLY C N   1 
ATOM 8624  C CA  . GLY C 3 329 ? 79.682  65.491  51.251  1.00 10.00 ? 444 GLY C CA  1 
ATOM 8625  C C   . GLY C 3 329 ? 80.448  64.269  51.714  1.00 10.00 ? 444 GLY C C   1 
ATOM 8626  O O   . GLY C 3 329 ? 80.823  64.169  52.877  1.00 10.00 ? 444 GLY C O   1 
ATOM 8627  N N   . ASN C 3 330 ? 80.684  63.323  50.818  1.00 10.00 ? 445 ASN C N   1 
ATOM 8628  C CA  . ASN C 3 330 ? 81.435  62.125  51.215  1.00 10.00 ? 445 ASN C CA  1 
ATOM 8629  C C   . ASN C 3 330 ? 82.890  62.513  51.446  1.00 10.00 ? 445 ASN C C   1 
ATOM 8630  O O   . ASN C 3 330 ? 83.639  61.780  52.082  1.00 10.00 ? 445 ASN C O   1 
ATOM 8631  C CB  . ASN C 3 330 ? 81.332  61.008  50.164  1.00 10.00 ? 445 ASN C CB  1 
ATOM 8632  C CG  . ASN C 3 330 ? 79.947  60.342  50.127  1.00 10.00 ? 445 ASN C CG  1 
ATOM 8633  O OD1 . ASN C 3 330 ? 79.228  60.322  51.119  1.00 10.00 ? 445 ASN C OD1 1 
ATOM 8634  N ND2 . ASN C 3 330 ? 79.590  59.773  48.975  1.00 10.00 ? 445 ASN C ND2 1 
ATOM 8635  N N   . TRP C 3 331 ? 83.271  63.685  50.933  1.00 10.00 ? 446 TRP C N   1 
ATOM 8636  C CA  . TRP C 3 331 ? 84.616  64.223  51.117  1.00 10.00 ? 446 TRP C CA  1 
ATOM 8637  C C   . TRP C 3 331 ? 84.785  64.400  52.624  1.00 10.00 ? 446 TRP C C   1 
ATOM 8638  O O   . TRP C 3 331 ? 85.829  64.103  53.200  1.00 10.00 ? 446 TRP C O   1 
ATOM 8639  C CB  . TRP C 3 331 ? 84.746  65.598  50.444  1.00 10.00 ? 446 TRP C CB  1 
ATOM 8640  C CG  . TRP C 3 331 ? 84.901  65.629  48.931  1.00 10.00 ? 446 TRP C CG  1 
ATOM 8641  C CD1 . TRP C 3 331 ? 84.533  66.652  48.103  1.00 10.00 ? 446 TRP C CD1 1 
ATOM 8642  C CD2 . TRP C 3 331 ? 85.541  64.652  48.092  1.00 10.00 ? 446 TRP C CD2 1 
ATOM 8643  N NE1 . TRP C 3 331 ? 84.902  66.381  46.809  1.00 10.00 ? 446 TRP C NE1 1 
ATOM 8644  C CE2 . TRP C 3 331 ? 85.523  65.161  46.771  1.00 10.00 ? 446 TRP C CE2 1 
ATOM 8645  C CE3 . TRP C 3 331 ? 86.129  63.402  48.326  1.00 10.00 ? 446 TRP C CE3 1 
ATOM 8646  C CZ2 . TRP C 3 331 ? 86.071  64.464  45.689  1.00 10.00 ? 446 TRP C CZ2 1 
ATOM 8647  C CZ3 . TRP C 3 331 ? 86.676  62.707  47.245  1.00 10.00 ? 446 TRP C CZ3 1 
ATOM 8648  C CH2 . TRP C 3 331 ? 86.642  63.243  45.945  1.00 10.00 ? 446 TRP C CH2 1 
ATOM 8649  N N   . ASN C 3 332 ? 83.694  64.847  53.257  1.00 10.00 ? 447 ASN C N   1 
ATOM 8650  C CA  . ASN C 3 332 ? 83.550  65.157  54.662  1.00 10.00 ? 447 ASN C CA  1 
ATOM 8651  C C   . ASN C 3 332 ? 83.346  63.892  55.471  1.00 10.00 ? 447 ASN C C   1 
ATOM 8652  O O   . ASN C 3 332 ? 83.894  63.738  56.583  1.00 10.00 ? 447 ASN C O   1 
ATOM 8653  C CB  . ASN C 3 332 ? 82.446  66.189  54.860  1.00 10.00 ? 447 ASN C CB  1 
ATOM 8654  C CG  . ASN C 3 332 ? 82.766  67.483  54.137  1.00 10.00 ? 447 ASN C CG  1 
ATOM 8655  O OD1 . ASN C 3 332 ? 83.911  67.942  54.144  1.00 10.00 ? 447 ASN C OD1 1 
ATOM 8656  N ND2 . ASN C 3 332 ? 81.760  68.078  53.508  1.00 10.00 ? 447 ASN C ND2 1 
ATOM 8657  N N   . LEU C 3 333 ? 82.552  62.958  54.963  1.00 10.00 ? 448 LEU C N   1 
ATOM 8658  C CA  . LEU C 3 333 ? 82.253  61.684  55.638  1.00 10.00 ? 448 LEU C CA  1 
ATOM 8659  C C   . LEU C 3 333 ? 83.393  61.250  56.545  1.00 10.00 ? 448 LEU C C   1 
ATOM 8660  O O   . LEU C 3 333 ? 83.205  60.959  57.730  1.00 10.00 ? 448 LEU C O   1 
ATOM 8661  C CB  . LEU C 3 333 ? 82.038  60.564  54.618  1.00 10.00 ? 448 LEU C CB  1 
ATOM 8662  C CG  . LEU C 3 333 ? 80.824  60.475  53.698  1.00 10.00 ? 448 LEU C CG  1 
ATOM 8663  C CD1 . LEU C 3 333 ? 80.945  59.182  52.898  1.00 10.00 ? 448 LEU C CD1 1 
ATOM 8664  C CD2 . LEU C 3 333 ? 79.529  60.487  54.496  1.00 10.00 ? 448 LEU C CD2 1 
ATOM 8665  N N   . VAL C 3 334 ? 84.583  61.150  55.971  1.00 10.00 ? 449 VAL C N   1 
ATOM 8666  C CA  . VAL C 3 334 ? 85.746  60.742  56.786  1.00 10.00 ? 449 VAL C CA  1 
ATOM 8667  C C   . VAL C 3 334 ? 85.462  59.314  57.295  1.00 10.00 ? 449 VAL C C   1 
ATOM 8668  O O   . VAL C 3 334 ? 85.129  59.167  58.461  1.00 10.00 ? 449 VAL C O   1 
ATOM 8669  C CB  . VAL C 3 334 ? 85.938  61.681  58.078  1.00 10.00 ? 449 VAL C CB  1 
ATOM 8670  C CG1 . VAL C 3 334 ? 87.298  61.470  58.701  1.00 10.00 ? 449 VAL C CG1 1 
ATOM 8671  C CG2 . VAL C 3 334 ? 85.826  63.122  57.732  1.00 10.00 ? 449 VAL C CG2 1 
ATOM 8672  N N   . GLY C 3 335 ? 85.596  58.281  56.452  1.00 10.00 ? 450 GLY C N   1 
ATOM 8673  C CA  . GLY C 3 335 ? 85.296  56.924  56.879  1.00 10.00 ? 450 GLY C CA  1 
ATOM 8674  C C   . GLY C 3 335 ? 86.486  56.028  57.144  1.00 10.00 ? 450 GLY C C   1 
ATOM 8675  O O   . GLY C 3 335 ? 86.374  55.038  57.859  1.00 10.00 ? 450 GLY C O   1 
ATOM 8676  N N   . GLN C 3 336 ? 87.630  56.362  56.565  1.00 10.00 ? 451 GLN C N   1 
ATOM 8677  C CA  . GLN C 3 336 ? 88.825  55.569  56.765  1.00 10.00 ? 451 GLN C CA  1 
ATOM 8678  C C   . GLN C 3 336 ? 89.447  55.973  58.087  1.00 10.00 ? 451 GLN C C   1 
ATOM 8679  O O   . GLN C 3 336 ? 90.475  55.455  58.492  1.00 10.00 ? 451 GLN C O   1 
ATOM 8680  C CB  . GLN C 3 336 ? 89.789  55.749  55.594  1.00 10.00 ? 451 GLN C CB  1 
ATOM 8681  C CG  . GLN C 3 336 ? 89.477  54.840  54.389  1.00 10.00 ? 451 GLN C CG  1 
ATOM 8682  C CD  . GLN C 3 336 ? 88.427  55.391  53.417  1.00 10.00 ? 451 GLN C CD  1 
ATOM 8683  O OE1 . GLN C 3 336 ? 88.769  55.958  52.378  1.00 10.00 ? 451 GLN C OE1 1 
ATOM 8684  N NE2 . GLN C 3 336 ? 87.149  55.215  53.748  1.00 10.00 ? 451 GLN C NE2 1 
ATOM 8685  N N   . THR C 3 337 ? 88.736  56.872  58.768  1.00 10.00 ? 452 THR C N   1 
ATOM 8686  C CA  . THR C 3 337 ? 89.095  57.425  60.063  1.00 10.00 ? 452 THR C CA  1 
ATOM 8687  C C   . THR C 3 337 ? 88.246  56.693  61.105  1.00 10.00 ? 452 THR C C   1 
ATOM 8688  O O   . THR C 3 337 ? 88.541  56.688  62.305  1.00 10.00 ? 452 THR C O   1 
ATOM 8689  C CB  . THR C 3 337 ? 88.654  58.849  60.126  1.00 10.00 ? 452 THR C CB  1 
ATOM 8690  O OG1 . THR C 3 337 ? 89.294  59.523  61.224  1.00 10.00 ? 452 THR C OG1 1 
ATOM 8691  C CG2 . THR C 3 337 ? 87.117  58.842  60.285  1.00 10.00 ? 452 THR C CG2 1 
ATOM 8692  N N   . ILE C 3 338 ? 87.170  56.097  60.613  1.00 10.00 ? 453 ILE C N   1 
ATOM 8693  C CA  . ILE C 3 338 ? 86.185  55.386  61.452  1.00 10.00 ? 453 ILE C CA  1 
ATOM 8694  C C   . ILE C 3 338 ? 86.791  54.465  62.499  1.00 10.00 ? 453 ILE C C   1 
ATOM 8695  O O   . ILE C 3 338 ? 86.728  54.749  63.695  1.00 10.00 ? 453 ILE C O   1 
ATOM 8696  C CB  . ILE C 3 338 ? 85.156  54.554  60.594  1.00 10.00 ? 453 ILE C CB  1 
ATOM 8697  C CG1 . ILE C 3 338 ? 83.923  54.203  61.421  1.00 10.00 ? 453 ILE C CG1 1 
ATOM 8698  C CG2 . ILE C 3 338 ? 85.787  53.258  60.108  1.00 10.00 ? 453 ILE C CG2 1 
ATOM 8699  C CD1 . ILE C 3 338 ? 82.880  53.562  60.598  1.00 10.00 ? 453 ILE C CD1 1 
ATOM 8700  N N   . ASP C 3 339 ? 87.371  53.360  62.047  1.00 10.00 ? 454 ASP C N   1 
ATOM 8701  C CA  . ASP C 3 339 ? 87.978  52.400  62.945  1.00 10.00 ? 454 ASP C CA  1 
ATOM 8702  C C   . ASP C 3 339 ? 88.959  53.065  63.884  1.00 10.00 ? 454 ASP C C   1 
ATOM 8703  O O   . ASP C 3 339 ? 88.913  52.834  65.090  1.00 10.00 ? 454 ASP C O   1 
ATOM 8704  C CB  . ASP C 3 339 ? 88.689  51.289  62.173  1.00 10.00 ? 454 ASP C CB  1 
ATOM 8705  C CG  . ASP C 3 339 ? 89.758  51.798  61.250  1.00 10.00 ? 454 ASP C CG  1 
ATOM 8706  O OD1 . ASP C 3 339 ? 89.397  52.183  60.130  1.00 10.00 ? 454 ASP C OD1 1 
ATOM 8707  O OD2 . ASP C 3 339 ? 90.946  51.802  61.643  1.00 10.00 ? 454 ASP C OD2 1 
ATOM 8708  N N   . ARG C 3 340 ? 89.849  53.897  63.353  1.00 10.00 ? 455 ARG C N   1 
ATOM 8709  C CA  . ARG C 3 340 ? 90.802  54.548  64.260  1.00 10.00 ? 455 ARG C CA  1 
ATOM 8710  C C   . ARG C 3 340 ? 90.070  55.272  65.381  1.00 10.00 ? 455 ARG C C   1 
ATOM 8711  O O   . ARG C 3 340 ? 90.500  55.231  66.523  1.00 10.00 ? 455 ARG C O   1 
ATOM 8712  C CB  . ARG C 3 340 ? 91.742  55.524  63.534  1.00 10.00 ? 455 ARG C CB  1 
ATOM 8713  C CG  . ARG C 3 340 ? 91.161  56.189  62.328  1.00 10.00 ? 455 ARG C CG  1 
ATOM 8714  C CD  . ARG C 3 340 ? 91.179  55.284  61.111  1.00 10.00 ? 455 ARG C CD  1 
ATOM 8715  N NE  . ARG C 3 340 ? 92.423  55.365  60.354  1.00 10.00 ? 455 ARG C NE  1 
ATOM 8716  C CZ  . ARG C 3 340 ? 92.739  54.591  59.323  1.00 10.00 ? 455 ARG C CZ  1 
ATOM 8717  N NH1 . ARG C 3 340 ? 91.910  53.650  58.897  1.00 10.00 ? 455 ARG C NH1 1 
ATOM 8718  N NH2 . ARG C 3 340 ? 93.897  54.779  58.706  1.00 10.00 ? 455 ARG C NH2 1 
ATOM 8719  N N   . LEU C 3 341 ? 88.952  55.921  65.071  1.00 10.00 ? 456 LEU C N   1 
ATOM 8720  C CA  . LEU C 3 341 ? 88.224  56.607  66.110  1.00 10.00 ? 456 LEU C CA  1 
ATOM 8721  C C   . LEU C 3 341 ? 87.829  55.594  67.174  1.00 10.00 ? 456 LEU C C   1 
ATOM 8722  O O   . LEU C 3 341 ? 88.284  55.664  68.323  1.00 10.00 ? 456 LEU C O   1 
ATOM 8723  C CB  . LEU C 3 341 ? 86.973  57.281  65.533  1.00 10.00 ? 456 LEU C CB  1 
ATOM 8724  C CG  . LEU C 3 341 ? 87.179  58.239  64.352  1.00 10.00 ? 456 LEU C CG  1 
ATOM 8725  C CD1 . LEU C 3 341 ? 85.849  58.874  63.975  1.00 10.00 ? 456 LEU C CD1 1 
ATOM 8726  C CD2 . LEU C 3 341 ? 88.196  59.309  64.716  1.00 10.00 ? 456 LEU C CD2 1 
ATOM 8727  N N   . SER C 3 342 ? 87.014  54.627  66.786  1.00 10.00 ? 457 SER C N   1 
ATOM 8728  C CA  . SER C 3 342 ? 86.599  53.683  67.751  1.00 10.00 ? 457 SER C CA  1 
ATOM 8729  C C   . SER C 3 342 ? 87.780  52.795  68.205  1.00 10.00 ? 457 SER C C   1 
ATOM 8730  O O   . SER C 3 342 ? 87.687  52.120  69.229  1.00 10.00 ? 457 SER C O   1 
ATOM 8731  C CB  . SER C 3 342 ? 85.377  52.950  67.202  1.00 10.00 ? 457 SER C CB  1 
ATOM 8732  O OG  . SER C 3 342 ? 84.365  53.923  66.945  1.00 10.00 ? 457 SER C OG  1 
ATOM 8733  N N   . MET C 3 343 ? 88.904  52.823  67.485  1.00 10.00 ? 458 MET C N   1 
ATOM 8734  C CA  . MET C 3 343 ? 90.074  52.058  67.929  1.00 10.00 ? 458 MET C CA  1 
ATOM 8735  C C   . MET C 3 343 ? 90.764  52.918  68.994  1.00 10.00 ? 458 MET C C   1 
ATOM 8736  O O   . MET C 3 343 ? 91.203  52.409  70.031  1.00 10.00 ? 458 MET C O   1 
ATOM 8737  C CB  . MET C 3 343 ? 91.086  51.766  66.802  1.00 10.00 ? 458 MET C CB  1 
ATOM 8738  C CG  . MET C 3 343 ? 92.044  50.620  67.183  1.00 10.00 ? 458 MET C CG  1 
ATOM 8739  S SD  . MET C 3 343 ? 93.669  50.581  66.400  1.00 10.00 ? 458 MET C SD  1 
ATOM 8740  C CE  . MET C 3 343 ? 94.791  50.538  67.788  1.00 10.00 ? 458 MET C CE  1 
ATOM 8741  N N   . PHE C 3 344 ? 90.840  54.225  68.750  1.00 10.00 ? 459 PHE C N   1 
ATOM 8742  C CA  . PHE C 3 344 ? 91.478  55.124  69.708  1.00 10.00 ? 459 PHE C CA  1 
ATOM 8743  C C   . PHE C 3 344 ? 90.501  55.558  70.803  1.00 10.00 ? 459 PHE C C   1 
ATOM 8744  O O   . PHE C 3 344 ? 90.725  56.561  71.483  1.00 10.00 ? 459 PHE C O   1 
ATOM 8745  C CB  . PHE C 3 344 ? 92.058  56.351  69.002  1.00 10.00 ? 459 PHE C CB  1 
ATOM 8746  C CG  . PHE C 3 344 ? 93.245  56.055  68.153  1.00 10.00 ? 459 PHE C CG  1 
ATOM 8747  C CD1 . PHE C 3 344 ? 94.520  56.341  68.613  1.00 10.00 ? 459 PHE C CD1 1 
ATOM 8748  C CD2 . PHE C 3 344 ? 93.084  55.485  66.900  1.00 10.00 ? 459 PHE C CD2 1 
ATOM 8749  C CE1 . PHE C 3 344 ? 95.618  56.061  67.839  1.00 10.00 ? 459 PHE C CE1 1 
ATOM 8750  C CE2 . PHE C 3 344 ? 94.168  55.202  66.121  1.00 10.00 ? 459 PHE C CE2 1 
ATOM 8751  C CZ  . PHE C 3 344 ? 95.448  55.489  66.589  1.00 10.00 ? 459 PHE C CZ  1 
ATOM 8752  N N   . ILE C 3 345 ? 89.388  54.829  70.898  1.00 10.00 ? 460 ILE C N   1 
ATOM 8753  C CA  . ILE C 3 345 ? 88.386  55.030  71.946  1.00 10.00 ? 460 ILE C CA  1 
ATOM 8754  C C   . ILE C 3 345 ? 88.627  53.821  72.808  1.00 10.00 ? 460 ILE C C   1 
ATOM 8755  O O   . ILE C 3 345 ? 88.614  53.885  74.034  1.00 10.00 ? 460 ILE C O   1 
ATOM 8756  C CB  . ILE C 3 345 ? 86.907  54.968  71.446  1.00 10.00 ? 460 ILE C CB  1 
ATOM 8757  C CG1 . ILE C 3 345 ? 86.259  56.382  71.495  1.00 10.00 ? 460 ILE C CG1 1 
ATOM 8758  C CG2 . ILE C 3 345 ? 86.084  53.987  72.335  1.00 10.00 ? 460 ILE C CG2 1 
ATOM 8759  C CD1 . ILE C 3 345 ? 86.792  57.408  70.477  1.00 10.00 ? 460 ILE C CD1 1 
ATOM 8760  N N   . ILE C 3 346 ? 88.863  52.712  72.122  1.00 10.00 ? 461 ILE C N   1 
ATOM 8761  C CA  . ILE C 3 346 ? 89.125  51.448  72.780  1.00 10.00 ? 461 ILE C CA  1 
ATOM 8762  C C   . ILE C 3 346 ? 90.431  51.568  73.554  1.00 10.00 ? 461 ILE C C   1 
ATOM 8763  O O   . ILE C 3 346 ? 90.495  51.264  74.749  1.00 10.00 ? 461 ILE C O   1 
ATOM 8764  C CB  . ILE C 3 346 ? 89.247  50.289  71.749  1.00 10.00 ? 461 ILE C CB  1 
ATOM 8765  C CG1 . ILE C 3 346 ? 87.914  50.100  71.019  1.00 10.00 ? 461 ILE C CG1 1 
ATOM 8766  C CG2 . ILE C 3 346 ? 89.656  48.990  72.457  1.00 10.00 ? 461 ILE C CG2 1 
ATOM 8767  C CD1 . ILE C 3 346 ? 88.002  49.226  69.779  1.00 10.00 ? 461 ILE C CD1 1 
ATOM 8768  N N   . THR C 3 347 ? 91.458  52.022  72.858  1.00 10.00 ? 462 THR C N   1 
ATOM 8769  C CA  . THR C 3 347 ? 92.749  52.164  73.448  1.00 10.00 ? 462 THR C CA  1 
ATOM 8770  C C   . THR C 3 347 ? 92.632  52.993  74.755  1.00 10.00 ? 462 THR C C   1 
ATOM 8771  O O   . THR C 3 347 ? 93.009  52.509  75.821  1.00 10.00 ? 462 THR C O   1 
ATOM 8772  C CB  . THR C 3 347 ? 93.690  52.766  72.404  1.00 10.00 ? 462 THR C CB  1 
ATOM 8773  O OG1 . THR C 3 347 ? 93.526  52.032  71.187  1.00 10.00 ? 462 THR C OG1 1 
ATOM 8774  C CG2 . THR C 3 347 ? 95.138  52.676  72.847  1.00 10.00 ? 462 THR C CG2 1 
ATOM 8775  N N   . PRO C 3 348 ? 92.111  54.238  74.697  1.00 10.00 ? 463 PRO C N   1 
ATOM 8776  C CA  . PRO C 3 348 ? 91.965  55.070  75.903  1.00 10.00 ? 463 PRO C CA  1 
ATOM 8777  C C   . PRO C 3 348 ? 91.088  54.444  76.994  1.00 10.00 ? 463 PRO C C   1 
ATOM 8778  O O   . PRO C 3 348 ? 91.472  54.453  78.160  1.00 10.00 ? 463 PRO C O   1 
ATOM 8779  C CB  . PRO C 3 348 ? 91.397  56.379  75.357  1.00 10.00 ? 463 PRO C CB  1 
ATOM 8780  C CG  . PRO C 3 348 ? 90.626  55.939  74.180  1.00 10.00 ? 463 PRO C CG  1 
ATOM 8781  C CD  . PRO C 3 348 ? 91.554  54.936  73.530  1.00 10.00 ? 463 PRO C CD  1 
ATOM 8782  N N   . VAL C 3 349 ? 89.903  53.941  76.636  1.00 10.00 ? 464 VAL C N   1 
ATOM 8783  C CA  . VAL C 3 349 ? 89.029  53.258  77.635  1.00 10.00 ? 464 VAL C CA  1 
ATOM 8784  C C   . VAL C 3 349 ? 89.872  52.250  78.346  1.00 10.00 ? 464 VAL C C   1 
ATOM 8785  O O   . VAL C 3 349 ? 89.756  52.040  79.551  1.00 10.00 ? 464 VAL C O   1 
ATOM 8786  C CB  . VAL C 3 349 ? 87.863  52.393  77.055  1.00 10.00 ? 464 VAL C CB  1 
ATOM 8787  C CG1 . VAL C 3 349 ? 88.381  51.120  76.401  1.00 10.00 ? 464 VAL C CG1 1 
ATOM 8788  C CG2 . VAL C 3 349 ? 86.937  51.996  78.186  1.00 10.00 ? 464 VAL C CG2 1 
ATOM 8789  N N   . MET C 3 350 ? 90.723  51.616  77.553  1.00 10.00 ? 465 MET C N   1 
ATOM 8790  C CA  . MET C 3 350 ? 91.629  50.599  78.082  1.00 10.00 ? 465 MET C CA  1 
ATOM 8791  C C   . MET C 3 350 ? 92.639  51.287  78.944  1.00 10.00 ? 465 MET C C   1 
ATOM 8792  O O   . MET C 3 350 ? 92.956  50.819  80.025  1.00 10.00 ? 465 MET C O   1 
ATOM 8793  C CB  . MET C 3 350 ? 92.411  49.865  77.005  1.00 10.00 ? 465 MET C CB  1 
ATOM 8794  C CG  . MET C 3 350 ? 93.603  49.144  77.604  1.00 10.00 ? 465 MET C CG  1 
ATOM 8795  S SD  . MET C 3 350 ? 95.161  49.479  76.785  1.00 10.00 ? 465 MET C SD  1 
ATOM 8796  C CE  . MET C 3 350 ? 96.191  50.052  78.112  1.00 10.00 ? 465 MET C CE  1 
ATOM 8797  N N   . VAL C 3 351 ? 93.127  52.421  78.459  1.00 10.00 ? 466 VAL C N   1 
ATOM 8798  C CA  . VAL C 3 351 ? 94.137  53.157  79.206  1.00 10.00 ? 466 VAL C CA  1 
ATOM 8799  C C   . VAL C 3 351 ? 93.548  53.625  80.531  1.00 10.00 ? 466 VAL C C   1 
ATOM 8800  O O   . VAL C 3 351 ? 93.990  53.199  81.598  1.00 10.00 ? 466 VAL C O   1 
ATOM 8801  C CB  . VAL C 3 351 ? 94.688  54.397  78.434  1.00 10.00 ? 466 VAL C CB  1 
ATOM 8802  C CG1 . VAL C 3 351 ? 96.118  54.654  78.862  1.00 10.00 ? 466 VAL C CG1 1 
ATOM 8803  C CG2 . VAL C 3 351 ? 94.650  54.193  76.958  1.00 10.00 ? 466 VAL C CG2 1 
ATOM 8804  N N   . LEU C 3 352 ? 92.530  54.479  80.460  1.00 10.00 ? 467 LEU C N   1 
ATOM 8805  C CA  . LEU C 3 352 ? 91.901  55.007  81.673  1.00 10.00 ? 467 LEU C CA  1 
ATOM 8806  C C   . LEU C 3 352 ? 91.202  53.932  82.503  1.00 10.00 ? 467 LEU C C   1 
ATOM 8807  O O   . LEU C 3 352 ? 91.453  53.808  83.704  1.00 10.00 ? 467 LEU C O   1 
ATOM 8808  C CB  . LEU C 3 352 ? 90.909  56.159  81.345  1.00 10.00 ? 467 LEU C CB  1 
ATOM 8809  C CG  . LEU C 3 352 ? 89.802  56.141  80.272  1.00 10.00 ? 467 LEU C CG  1 
ATOM 8810  C CD1 . LEU C 3 352 ? 88.603  56.924  80.771  1.00 10.00 ? 467 LEU C CD1 1 
ATOM 8811  C CD2 . LEU C 3 352 ? 90.297  56.748  78.974  1.00 10.00 ? 467 LEU C CD2 1 
ATOM 8812  N N   . GLY C 3 353 ? 90.319  53.167  81.864  1.00 10.00 ? 468 GLY C N   1 
ATOM 8813  C CA  . GLY C 3 353 ? 89.610  52.108  82.571  1.00 10.00 ? 468 GLY C CA  1 
ATOM 8814  C C   . GLY C 3 353 ? 90.623  51.274  83.336  1.00 10.00 ? 468 GLY C C   1 
ATOM 8815  O O   . GLY C 3 353 ? 90.395  50.869  84.468  1.00 10.00 ? 468 GLY C O   1 
ATOM 8816  N N   . THR C 3 354 ? 91.754  51.012  82.687  1.00 10.00 ? 469 THR C N   1 
ATOM 8817  C CA  . THR C 3 354 ? 92.805  50.248  83.323  1.00 10.00 ? 469 THR C CA  1 
ATOM 8818  C C   . THR C 3 354 ? 93.467  51.145  84.340  1.00 10.00 ? 469 THR C C   1 
ATOM 8819  O O   . THR C 3 354 ? 93.722  50.725  85.459  1.00 10.00 ? 469 THR C O   1 
ATOM 8820  C CB  . THR C 3 354 ? 93.870  49.786  82.312  1.00 10.00 ? 469 THR C CB  1 
ATOM 8821  O OG1 . THR C 3 354 ? 93.314  48.778  81.458  1.00 10.00 ? 469 THR C OG1 1 
ATOM 8822  C CG2 . THR C 3 354 ? 95.088  49.230  83.033  1.00 10.00 ? 469 THR C CG2 1 
ATOM 8823  N N   . ILE C 3 355 ? 93.734  52.395  83.962  1.00 10.00 ? 470 ILE C N   1 
ATOM 8824  C CA  . ILE C 3 355 ? 94.381  53.336  84.874  1.00 10.00 ? 470 ILE C CA  1 
ATOM 8825  C C   . ILE C 3 355 ? 93.739  53.319  86.252  1.00 10.00 ? 470 ILE C C   1 
ATOM 8826  O O   . ILE C 3 355 ? 94.443  53.351  87.256  1.00 10.00 ? 470 ILE C O   1 
ATOM 8827  C CB  . ILE C 3 355 ? 94.362  54.784  84.323  1.00 10.00 ? 470 ILE C CB  1 
ATOM 8828  C CG1 . ILE C 3 355 ? 95.522  54.971  83.341  1.00 10.00 ? 470 ILE C CG1 1 
ATOM 8829  C CG2 . ILE C 3 355 ? 94.458  55.794  85.467  1.00 10.00 ? 470 ILE C CG2 1 
ATOM 8830  C CD1 . ILE C 3 355 ? 96.892  54.655  83.934  1.00 10.00 ? 470 ILE C CD1 1 
ATOM 8831  N N   . PHE C 3 356 ? 92.408  53.264  86.289  1.00 10.00 ? 471 PHE C N   1 
ATOM 8832  C CA  . PHE C 3 356 ? 91.664  53.227  87.543  1.00 10.00 ? 471 PHE C CA  1 
ATOM 8833  C C   . PHE C 3 356 ? 91.964  51.911  88.285  1.00 10.00 ? 471 PHE C C   1 
ATOM 8834  O O   . PHE C 3 356 ? 92.719  51.898  89.258  1.00 10.00 ? 471 PHE C O   1 
ATOM 8835  C CB  . PHE C 3 356 ? 90.163  53.396  87.237  1.00 10.00 ? 471 PHE C CB  1 
ATOM 8836  C CG  . PHE C 3 356 ? 89.239  52.928  88.338  1.00 10.00 ? 471 PHE C CG  1 
ATOM 8837  C CD1 . PHE C 3 356 ? 87.860  53.065  88.188  1.00 10.00 ? 471 PHE C CD1 1 
ATOM 8838  C CD2 . PHE C 3 356 ? 89.731  52.296  89.482  1.00 10.00 ? 471 PHE C CD2 1 
ATOM 8839  C CE1 . PHE C 3 356 ? 86.977  52.582  89.139  1.00 10.00 ? 471 PHE C CE1 1 
ATOM 8840  C CE2 . PHE C 3 356 ? 88.859  51.812  90.438  1.00 10.00 ? 471 PHE C CE2 1 
ATOM 8841  C CZ  . PHE C 3 356 ? 87.466  51.957  90.262  1.00 10.00 ? 471 PHE C CZ  1 
ATOM 8842  N N   . ILE C 3 357 ? 91.439  50.796  87.786  1.00 10.00 ? 472 ILE C N   1 
ATOM 8843  C CA  . ILE C 3 357 ? 91.700  49.549  88.514  1.00 10.00 ? 472 ILE C CA  1 
ATOM 8844  C C   . ILE C 3 357 ? 93.203  49.282  88.539  1.00 10.00 ? 472 ILE C C   1 
ATOM 8845  O O   . ILE C 3 357 ? 93.660  48.371  89.223  1.00 10.00 ? 472 ILE C O   1 
ATOM 8846  C CB  . ILE C 3 357 ? 90.899  48.256  87.993  1.00 10.00 ? 472 ILE C CB  1 
ATOM 8847  C CG1 . ILE C 3 357 ? 91.698  47.500  86.927  1.00 10.00 ? 472 ILE C CG1 1 
ATOM 8848  C CG2 . ILE C 3 357 ? 89.458  48.639  87.539  1.00 10.00 ? 472 ILE C CG2 1 
ATOM 8849  C CD1 . ILE C 3 357 ? 91.090  46.151  86.556  1.00 10.00 ? 472 ILE C CD1 1 
ATOM 8850  N N   . PHE C 3 358 ? 93.966  50.082  87.790  1.00 10.00 ? 473 PHE C N   1 
ATOM 8851  C CA  . PHE C 3 358 ? 95.422  49.978  87.788  1.00 10.00 ? 473 PHE C CA  1 
ATOM 8852  C C   . PHE C 3 358 ? 95.765  50.695  89.094  1.00 10.00 ? 473 PHE C C   1 
ATOM 8853  O O   . PHE C 3 358 ? 96.512  50.178  89.925  1.00 10.00 ? 473 PHE C O   1 
ATOM 8854  C CB  . PHE C 3 358 ? 96.039  50.727  86.588  1.00 10.00 ? 473 PHE C CB  1 
ATOM 8855  C CG  . PHE C 3 358 ? 97.479  50.368  86.311  1.00 10.00 ? 473 PHE C CG  1 
ATOM 8856  C CD1 . PHE C 3 358 ? 97.834  49.692  85.147  1.00 10.00 ? 473 PHE C CD1 1 
ATOM 8857  C CD2 . PHE C 3 358 ? 98.485  50.701  87.217  1.00 10.00 ? 473 PHE C CD2 1 
ATOM 8858  C CE1 . PHE C 3 358 ? 99.178  49.354  84.896  1.00 10.00 ? 473 PHE C CE1 1 
ATOM 8859  C CE2 . PHE C 3 358 ? 99.824  50.367  86.972  1.00 10.00 ? 473 PHE C CE2 1 
ATOM 8860  C CZ  . PHE C 3 358 ? 100.167 49.698  85.818  1.00 10.00 ? 473 PHE C CZ  1 
ATOM 8861  N N   . VAL C 3 359 ? 95.186  51.881  89.276  1.00 10.00 ? 474 VAL C N   1 
ATOM 8862  C CA  . VAL C 3 359 ? 95.411  52.646  90.486  1.00 10.00 ? 474 VAL C CA  1 
ATOM 8863  C C   . VAL C 3 359 ? 94.736  51.913  91.634  1.00 10.00 ? 474 VAL C C   1 
ATOM 8864  O O   . VAL C 3 359 ? 95.235  51.913  92.761  1.00 10.00 ? 474 VAL C O   1 
ATOM 8865  C CB  . VAL C 3 359 ? 94.830  54.077  90.387  1.00 10.00 ? 474 VAL C CB  1 
ATOM 8866  C CG1 . VAL C 3 359 ? 95.013  54.805  91.709  1.00 10.00 ? 474 VAL C CG1 1 
ATOM 8867  C CG2 . VAL C 3 359 ? 95.527  54.849  89.284  1.00 10.00 ? 474 VAL C CG2 1 
ATOM 8868  N N   . MET C 3 360 ? 93.565  51.333  91.365  1.00 10.00 ? 475 MET C N   1 
ATOM 8869  C CA  . MET C 3 360 ? 92.839  50.549  92.378  1.00 10.00 ? 475 MET C CA  1 
ATOM 8870  C C   . MET C 3 360 ? 93.884  49.673  93.029  1.00 10.00 ? 475 MET C C   1 
ATOM 8871  O O   . MET C 3 360 ? 94.028  49.645  94.240  1.00 10.00 ? 475 MET C O   1 
ATOM 8872  C CB  . MET C 3 360 ? 91.818  49.624  91.720  1.00 10.00 ? 475 MET C CB  1 
ATOM 8873  C CG  . MET C 3 360 ? 92.029  48.141  92.038  1.00 10.00 ? 475 MET C CG  1 
ATOM 8874  S SD  . MET C 3 360 ? 91.468  47.137  90.709  1.00 10.00 ? 475 MET C SD  1 
ATOM 8875  C CE  . MET C 3 360 ? 89.680  46.823  91.267  1.00 10.00 ? 475 MET C CE  1 
ATOM 8876  N N   . GLY C 3 361 ? 94.582  48.955  92.159  1.00 10.00 ? 476 GLY C N   1 
ATOM 8877  C CA  . GLY C 3 361 ? 95.621  48.054  92.572  1.00 10.00 ? 476 GLY C CA  1 
ATOM 8878  C C   . GLY C 3 361 ? 96.851  48.704  93.143  1.00 10.00 ? 476 GLY C C   1 
ATOM 8879  O O   . GLY C 3 361 ? 97.308  48.304  94.224  1.00 10.00 ? 476 GLY C O   1 
ATOM 8880  N N   . ASN C 3 362 ? 97.385  49.719  92.480  1.00 10.00 ? 477 ASN C N   1 
ATOM 8881  C CA  . ASN C 3 362 ? 98.616  50.287  93.011  1.00 10.00 ? 477 ASN C CA  1 
ATOM 8882  C C   . ASN C 3 362 ? 98.459  50.818  94.458  1.00 10.00 ? 477 ASN C C   1 
ATOM 8883  O O   . ASN C 3 362 ? 99.447  51.136  95.110  1.00 10.00 ? 477 ASN C O   1 
ATOM 8884  C CB  . ASN C 3 362 ? 99.295  51.325  92.044  1.00 10.00 ? 477 ASN C CB  1 
ATOM 8885  C CG  . ASN C 3 362 ? 98.330  52.406  91.470  1.00 10.00 ? 477 ASN C CG  1 
ATOM 8886  O OD1 . ASN C 3 362 ? 97.443  52.904  92.164  1.00 10.00 ? 477 ASN C OD1 1 
ATOM 8887  N ND2 . ASN C 3 362 ? 98.552  52.788  90.207  1.00 10.00 ? 477 ASN C ND2 1 
ATOM 8888  N N   . PHE C 3 363 ? 97.220  50.851  94.964  1.00 10.00 ? 478 PHE C N   1 
ATOM 8889  C CA  . PHE C 3 363 ? 96.951  51.271  96.339  1.00 10.00 ? 478 PHE C CA  1 
ATOM 8890  C C   . PHE C 3 363 ? 96.383  50.046  97.066  1.00 10.00 ? 478 PHE C C   1 
ATOM 8891  O O   . PHE C 3 363 ? 96.307  50.010  98.293  1.00 10.00 ? 478 PHE C O   1 
ATOM 8892  C CB  . PHE C 3 363 ? 95.948  52.439  96.377  1.00 10.00 ? 478 PHE C CB  1 
ATOM 8893  C CG  . PHE C 3 363 ? 94.547  52.076  95.939  1.00 10.00 ? 478 PHE C CG  1 
ATOM 8894  C CD1 . PHE C 3 363 ? 94.000  50.830  96.246  1.00 10.00 ? 478 PHE C CD1 1 
ATOM 8895  C CD2 . PHE C 3 363 ? 93.767  52.988  95.238  1.00 10.00 ? 478 PHE C CD2 1 
ATOM 8896  C CE1 . PHE C 3 363 ? 92.702  50.500  95.860  1.00 10.00 ? 478 PHE C CE1 1 
ATOM 8897  C CE2 . PHE C 3 363 ? 92.467  52.666  94.848  1.00 10.00 ? 478 PHE C CE2 1 
ATOM 8898  C CZ  . PHE C 3 363 ? 91.934  51.420  95.161  1.00 10.00 ? 478 PHE C CZ  1 
ATOM 8899  N N   . ASN C 3 364 ? 95.980  49.051  96.278  1.00 10.00 ? 479 ASN C N   1 
ATOM 8900  C CA  . ASN C 3 364 ? 95.416  47.791  96.773  1.00 10.00 ? 479 ASN C CA  1 
ATOM 8901  C C   . ASN C 3 364 ? 96.538  46.864  97.178  1.00 10.00 ? 479 ASN C C   1 
ATOM 8902  O O   . ASN C 3 364 ? 96.354  45.965  97.999  1.00 10.00 ? 479 ASN C O   1 
ATOM 8903  C CB  . ASN C 3 364 ? 94.591  47.104  95.670  1.00 10.00 ? 479 ASN C CB  1 
ATOM 8904  C CG  . ASN C 3 364 ? 94.613  45.577  95.768  1.00 10.00 ? 479 ASN C CG  1 
ATOM 8905  O OD1 . ASN C 3 364 ? 93.610  44.944  96.119  1.00 10.00 ? 479 ASN C OD1 1 
ATOM 8906  N ND2 . ASN C 3 364 ? 95.763  44.985  95.454  1.00 10.00 ? 479 ASN C ND2 1 
ATOM 8907  N N   . ARG C 3 365 ? 97.697  47.088  96.577  1.00 10.00 ? 480 ARG C N   1 
ATOM 8908  C CA  . ARG C 3 365 ? 98.867  46.274  96.838  1.00 10.00 ? 480 ARG C CA  1 
ATOM 8909  C C   . ARG C 3 365 ? 99.579  46.686  98.140  1.00 10.00 ? 480 ARG C C   1 
ATOM 8910  O O   . ARG C 3 365 ? 99.877  45.839  98.985  1.00 10.00 ? 480 ARG C O   1 
ATOM 8911  C CB  . ARG C 3 365 ? 99.799  46.364  95.632  1.00 10.00 ? 480 ARG C CB  1 
ATOM 8912  C CG  . ARG C 3 365 ? 99.012  46.313  94.352  1.00 10.00 ? 480 ARG C CG  1 
ATOM 8913  C CD  . ARG C 3 365 ? 99.580  45.316  93.343  1.00 10.00 ? 480 ARG C CD  1 
ATOM 8914  N NE  . ARG C 3 365 ? 98.498  44.716  92.549  1.00 10.00 ? 480 ARG C NE  1 
ATOM 8915  C CZ  . ARG C 3 365 ? 98.654  43.822  91.573  1.00 10.00 ? 480 ARG C CZ  1 
ATOM 8916  N NH1 . ARG C 3 365 ? 99.862  43.390  91.228  1.00 10.00 ? 480 ARG C NH1 1 
ATOM 8917  N NH2 . ARG C 3 365 ? 97.580  43.346  90.954  1.00 10.00 ? 480 ARG C NH2 1 
ATOM 8918  N N   . PRO C 3 366 ? 99.844  47.999  98.323  1.00 10.00 ? 481 PRO C N   1 
ATOM 8919  C CA  . PRO C 3 366 ? 100.515 48.556  99.517  1.00 10.00 ? 481 PRO C CA  1 
ATOM 8920  C C   . PRO C 3 366 ? 99.797  48.453  100.876 1.00 10.00 ? 481 PRO C C   1 
ATOM 8921  O O   . PRO C 3 366 ? 100.441 48.552  101.915 1.00 10.00 ? 481 PRO C O   1 
ATOM 8922  C CB  . PRO C 3 366 ? 100.772 50.009  99.121  1.00 10.00 ? 481 PRO C CB  1 
ATOM 8923  C CG  . PRO C 3 366 ? 99.616  50.314  98.223  1.00 10.00 ? 481 PRO C CG  1 
ATOM 8924  C CD  . PRO C 3 366 ? 99.559  49.075  97.354  1.00 10.00 ? 481 PRO C CD  1 
ATOM 8925  N N   . PRO C 3 367 ? 98.460  48.276  100.889 1.00 10.00 ? 482 PRO C N   1 
ATOM 8926  C CA  . PRO C 3 367 ? 97.734  48.162  102.162 1.00 10.00 ? 482 PRO C CA  1 
ATOM 8927  C C   . PRO C 3 367 ? 97.818  46.696  102.558 1.00 10.00 ? 482 PRO C C   1 
ATOM 8928  O O   . PRO C 3 367 ? 97.840  46.335  103.732 1.00 10.00 ? 482 PRO C O   1 
ATOM 8929  C CB  . PRO C 3 367 ? 96.320  48.552  101.778 1.00 10.00 ? 482 PRO C CB  1 
ATOM 8930  C CG  . PRO C 3 367 ? 96.206  47.938  100.391 1.00 10.00 ? 482 PRO C CG  1 
ATOM 8931  C CD  . PRO C 3 367 ? 97.517  48.312  99.752  1.00 10.00 ? 482 PRO C CD  1 
ATOM 8932  N N   . ALA C 3 368 ? 97.835  45.862  101.519 1.00 10.00 ? 483 ALA C N   1 
ATOM 8933  C CA  . ALA C 3 368 ? 97.937  44.426  101.634 1.00 10.00 ? 483 ALA C CA  1 
ATOM 8934  C C   . ALA C 3 368 ? 99.418  44.146  101.872 1.00 10.00 ? 483 ALA C C   1 
ATOM 8935  O O   . ALA C 3 368 ? 99.836  43.002  102.042 1.00 10.00 ? 483 ALA C O   1 
ATOM 8936  C CB  . ALA C 3 368 ? 97.471  43.797  100.340 1.00 10.00 ? 483 ALA C CB  1 
ATOM 8937  N N   . LYS C 3 369 ? 100.196 45.226  101.879 1.00 10.00 ? 484 LYS C N   1 
ATOM 8938  C CA  . LYS C 3 369 ? 101.645 45.194  102.097 1.00 10.00 ? 484 LYS C CA  1 
ATOM 8939  C C   . LYS C 3 369 ? 101.961 45.146  103.594 1.00 10.00 ? 484 LYS C C   1 
ATOM 8940  O O   . LYS C 3 369 ? 102.732 44.237  104.008 1.00 10.00 ? 484 LYS C O   1 
ATOM 8941  C CB  . LYS C 3 369 ? 102.309 46.439  101.471 1.00 10.00 ? 484 LYS C CB  1 
ATOM 8942  C CG  . LYS C 3 369 ? 103.799 46.634  101.837 1.00 10.00 ? 484 LYS C CG  1 
ATOM 8943  C CD  . LYS C 3 369 ? 104.383 47.995  101.368 1.00 10.00 ? 484 LYS C CD  1 
ATOM 8944  C CE  . LYS C 3 369 ? 104.666 48.109  99.852  1.00 10.00 ? 484 LYS C CE  1 
ATOM 8945  N NZ  . LYS C 3 369 ? 103.465 48.379  98.987  1.00 10.00 ? 484 LYS C NZ  1 
ATOM 8946  O OXT . LYS C 3 369 ? 101.437 46.027  104.323 1.00 10.00 ? 484 LYS C OXT 1 
ATOM 8947  N N   . SER D 1 1   ? 39.478  49.629  165.707 1.00 10.00 ? 1   SER D N   1 
ATOM 8948  C CA  . SER D 1 1   ? 39.132  48.806  166.904 1.00 10.00 ? 1   SER D CA  1 
ATOM 8949  C C   . SER D 1 1   ? 39.999  47.552  166.981 1.00 10.00 ? 1   SER D C   1 
ATOM 8950  O O   . SER D 1 1   ? 41.087  47.565  167.559 1.00 10.00 ? 1   SER D O   1 
ATOM 8951  C CB  . SER D 1 1   ? 37.652  48.409  166.848 1.00 10.00 ? 1   SER D CB  1 
ATOM 8952  O OG  . SER D 1 1   ? 37.333  47.810  165.602 1.00 10.00 ? 1   SER D OG  1 
ATOM 8953  N N   . GLU D 1 2   ? 39.484  46.456  166.403 1.00 10.00 ? 2   GLU D N   1 
ATOM 8954  C CA  . GLU D 1 2   ? 40.184  45.179  166.355 1.00 10.00 ? 2   GLU D CA  1 
ATOM 8955  C C   . GLU D 1 2   ? 41.690  45.381  166.223 1.00 10.00 ? 2   GLU D C   1 
ATOM 8956  O O   . GLU D 1 2   ? 42.233  45.346  165.119 1.00 10.00 ? 2   GLU D O   1 
ATOM 8957  C CB  . GLU D 1 2   ? 39.655  44.321  165.205 1.00 10.00 ? 2   GLU D CB  1 
ATOM 8958  C CG  . GLU D 1 2   ? 38.175  43.994  165.305 1.00 10.00 ? 2   GLU D CG  1 
ATOM 8959  C CD  . GLU D 1 2   ? 37.683  43.153  164.144 1.00 10.00 ? 2   GLU D CD  1 
ATOM 8960  O OE1 . GLU D 1 2   ? 38.504  42.820  163.262 1.00 10.00 ? 2   GLU D OE1 1 
ATOM 8961  O OE2 . GLU D 1 2   ? 36.478  42.827  164.114 1.00 10.00 ? 2   GLU D OE2 1 
ATOM 8962  N N   . HIS D 1 3   ? 42.358  45.639  167.358 1.00 10.00 ? 3   HIS D N   1 
ATOM 8963  C CA  . HIS D 1 3   ? 43.781  45.958  167.411 1.00 10.00 ? 3   HIS D CA  1 
ATOM 8964  C C   . HIS D 1 3   ? 44.177  46.918  166.295 1.00 10.00 ? 3   HIS D C   1 
ATOM 8965  O O   . HIS D 1 3   ? 45.326  46.952  165.859 1.00 10.00 ? 3   HIS D O   1 
ATOM 8966  C CB  . HIS D 1 3   ? 44.630  44.690  167.390 1.00 10.00 ? 3   HIS D CB  1 
ATOM 8967  C CG  . HIS D 1 3   ? 45.375  44.461  168.669 1.00 10.00 ? 3   HIS D CG  1 
ATOM 8968  N ND1 . HIS D 1 3   ? 44.791  44.626  169.907 1.00 10.00 ? 3   HIS D ND1 1 
ATOM 8969  C CD2 . HIS D 1 3   ? 46.657  44.093  168.905 1.00 10.00 ? 3   HIS D CD2 1 
ATOM 8970  C CE1 . HIS D 1 3   ? 45.680  44.372  170.850 1.00 10.00 ? 3   HIS D CE1 1 
ATOM 8971  N NE2 . HIS D 1 3   ? 46.821  44.046  170.269 1.00 10.00 ? 3   HIS D NE2 1 
ATOM 8972  N N   . GLU D 1 4   ? 43.184  47.706  165.883 1.00 10.00 ? 4   GLU D N   1 
ATOM 8973  C CA  . GLU D 1 4   ? 43.259  48.735  164.845 1.00 10.00 ? 4   GLU D CA  1 
ATOM 8974  C C   . GLU D 1 4   ? 44.620  49.374  164.614 1.00 10.00 ? 4   GLU D C   1 
ATOM 8975  O O   . GLU D 1 4   ? 45.257  49.136  163.588 1.00 10.00 ? 4   GLU D O   1 
ATOM 8976  C CB  . GLU D 1 4   ? 42.244  49.840  165.168 1.00 10.00 ? 4   GLU D CB  1 
ATOM 8977  C CG  . GLU D 1 4   ? 42.374  51.124  164.351 1.00 10.00 ? 4   GLU D CG  1 
ATOM 8978  C CD  . GLU D 1 4   ? 41.902  50.970  162.921 1.00 10.00 ? 4   GLU D CD  1 
ATOM 8979  O OE1 . GLU D 1 4   ? 40.726  50.600  162.720 1.00 10.00 ? 4   GLU D OE1 1 
ATOM 8980  O OE2 . GLU D 1 4   ? 42.704  51.225  161.998 1.00 10.00 ? 4   GLU D OE2 1 
ATOM 8981  N N   . THR D 1 5   ? 45.035  50.225  165.545 1.00 10.00 ? 5   THR D N   1 
ATOM 8982  C CA  . THR D 1 5   ? 46.318  50.911  165.434 1.00 10.00 ? 5   THR D CA  1 
ATOM 8983  C C   . THR D 1 5   ? 47.457  49.937  165.684 1.00 10.00 ? 5   THR D C   1 
ATOM 8984  O O   . THR D 1 5   ? 48.519  49.994  165.047 1.00 10.00 ? 5   THR D O   1 
ATOM 8985  C CB  . THR D 1 5   ? 46.426  52.060  166.454 1.00 10.00 ? 5   THR D CB  1 
ATOM 8986  O OG1 . THR D 1 5   ? 45.373  53.004  166.224 1.00 10.00 ? 5   THR D OG1 1 
ATOM 8987  C CG2 . THR D 1 5   ? 47.771  52.762  166.323 1.00 10.00 ? 5   THR D CG2 1 
ATOM 8988  N N   . ARG D 1 6   ? 47.244  49.033  166.625 1.00 10.00 ? 6   ARG D N   1 
ATOM 8989  C CA  . ARG D 1 6   ? 48.297  48.057  166.923 1.00 10.00 ? 6   ARG D CA  1 
ATOM 8990  C C   . ARG D 1 6   ? 48.585  47.195  165.683 1.00 10.00 ? 6   ARG D C   1 
ATOM 8991  O O   . ARG D 1 6   ? 49.729  46.837  165.437 1.00 10.00 ? 6   ARG D O   1 
ATOM 8992  C CB  . ARG D 1 6   ? 47.909  47.184  168.125 1.00 10.00 ? 6   ARG D CB  1 
ATOM 8993  C CG  . ARG D 1 6   ? 47.360  47.973  169.321 1.00 10.00 ? 6   ARG D CG  1 
ATOM 8994  C CD  . ARG D 1 6   ? 48.367  48.237  170.434 1.00 10.00 ? 6   ARG D CD  1 
ATOM 8995  N NE  . ARG D 1 6   ? 47.691  48.109  171.727 1.00 10.00 ? 6   ARG D NE  1 
ATOM 8996  C CZ  . ARG D 1 6   ? 48.281  48.243  172.907 1.00 10.00 ? 6   ARG D CZ  1 
ATOM 8997  N NH1 . ARG D 1 6   ? 49.573  48.523  172.974 1.00 10.00 ? 6   ARG D NH1 1 
ATOM 8998  N NH2 . ARG D 1 6   ? 47.588  48.063  174.018 1.00 10.00 ? 6   ARG D NH2 1 
ATOM 8999  N N   . LEU D 1 7   ? 47.570  46.914  164.875 1.00 10.00 ? 7   LEU D N   1 
ATOM 9000  C CA  . LEU D 1 7   ? 47.843  46.068  163.709 1.00 10.00 ? 7   LEU D CA  1 
ATOM 9001  C C   . LEU D 1 7   ? 48.539  46.850  162.592 1.00 10.00 ? 7   LEU D C   1 
ATOM 9002  O O   . LEU D 1 7   ? 49.556  46.358  162.121 1.00 10.00 ? 7   LEU D O   1 
ATOM 9003  C CB  . LEU D 1 7   ? 46.547  45.446  163.177 1.00 10.00 ? 7   LEU D CB  1 
ATOM 9004  C CG  . LEU D 1 7   ? 45.676  44.706  164.194 1.00 10.00 ? 7   LEU D CG  1 
ATOM 9005  C CD1 . LEU D 1 7   ? 44.425  44.152  163.528 1.00 10.00 ? 7   LEU D CD1 1 
ATOM 9006  C CD2 . LEU D 1 7   ? 46.462  43.591  164.865 1.00 10.00 ? 7   LEU D CD2 1 
ATOM 9007  N N   . VAL D 1 8   ? 48.084  48.011  162.132 1.00 10.00 ? 8   VAL D N   1 
ATOM 9008  C CA  . VAL D 1 8   ? 48.837  48.640  161.038 1.00 10.00 ? 8   VAL D CA  1 
ATOM 9009  C C   . VAL D 1 8   ? 50.208  49.209  161.421 1.00 10.00 ? 8   VAL D C   1 
ATOM 9010  O O   . VAL D 1 8   ? 51.097  49.233  160.585 1.00 10.00 ? 8   VAL D O   1 
ATOM 9011  C CB  . VAL D 1 8   ? 48.072  49.763  160.310 1.00 10.00 ? 8   VAL D CB  1 
ATOM 9012  C CG1 . VAL D 1 8   ? 48.725  50.018  158.972 1.00 10.00 ? 8   VAL D CG1 1 
ATOM 9013  C CG2 . VAL D 1 8   ? 46.625  49.391  160.091 1.00 10.00 ? 8   VAL D CG2 1 
ATOM 9014  N N   . ALA D 1 9   ? 50.384  49.663  162.661 1.00 10.00 ? 9   ALA D N   1 
ATOM 9015  C CA  . ALA D 1 9   ? 51.651  50.202  163.121 1.00 10.00 ? 9   ALA D CA  1 
ATOM 9016  C C   . ALA D 1 9   ? 52.731  49.098  163.158 1.00 10.00 ? 9   ALA D C   1 
ATOM 9017  O O   . ALA D 1 9   ? 53.823  49.232  162.586 1.00 10.00 ? 9   ALA D O   1 
ATOM 9018  C CB  . ALA D 1 9   ? 51.477  50.815  164.508 1.00 10.00 ? 9   ALA D CB  1 
ATOM 9019  N N   . ASN D 1 10  ? 52.404  47.984  163.800 1.00 10.00 ? 10  ASN D N   1 
ATOM 9020  C CA  . ASN D 1 10  ? 53.368  46.905  163.904 1.00 10.00 ? 10  ASN D CA  1 
ATOM 9021  C C   . ASN D 1 10  ? 53.822  46.505  162.501 1.00 10.00 ? 10  ASN D C   1 
ATOM 9022  O O   . ASN D 1 10  ? 55.013  46.338  162.262 1.00 10.00 ? 10  ASN D O   1 
ATOM 9023  C CB  . ASN D 1 10  ? 52.780  45.716  164.703 1.00 10.00 ? 10  ASN D CB  1 
ATOM 9024  C CG  . ASN D 1 10  ? 51.796  44.866  163.903 1.00 10.00 ? 10  ASN D CG  1 
ATOM 9025  O OD1 . ASN D 1 10  ? 52.197  43.997  163.128 1.00 10.00 ? 10  ASN D OD1 1 
ATOM 9026  N ND2 . ASN D 1 10  ? 50.505  45.108  164.097 1.00 10.00 ? 10  ASN D ND2 1 
ATOM 9027  N N   . LEU D 1 11  ? 52.881  46.424  161.564 1.00 10.00 ? 11  LEU D N   1 
ATOM 9028  C CA  . LEU D 1 11  ? 53.187  46.053  160.203 1.00 10.00 ? 11  LEU D CA  1 
ATOM 9029  C C   . LEU D 1 11  ? 54.253  46.954  159.563 1.00 10.00 ? 11  LEU D C   1 
ATOM 9030  O O   . LEU D 1 11  ? 55.171  46.459  158.918 1.00 10.00 ? 11  LEU D O   1 
ATOM 9031  C CB  . LEU D 1 11  ? 51.892  46.058  159.392 1.00 10.00 ? 11  LEU D CB  1 
ATOM 9032  C CG  . LEU D 1 11  ? 50.664  45.326  160.001 1.00 10.00 ? 11  LEU D CG  1 
ATOM 9033  C CD1 . LEU D 1 11  ? 49.546  45.091  158.933 1.00 10.00 ? 11  LEU D CD1 1 
ATOM 9034  C CD2 . LEU D 1 11  ? 51.088  43.997  160.627 1.00 10.00 ? 11  LEU D CD2 1 
ATOM 9035  N N   . LEU D 1 12  ? 54.148  48.269  159.739 1.00 10.00 ? 12  LEU D N   1 
ATOM 9036  C CA  . LEU D 1 12  ? 55.133  49.190  159.166 1.00 10.00 ? 12  LEU D CA  1 
ATOM 9037  C C   . LEU D 1 12  ? 56.515  49.113  159.817 1.00 10.00 ? 12  LEU D C   1 
ATOM 9038  O O   . LEU D 1 12  ? 57.530  49.118  159.122 1.00 10.00 ? 12  LEU D O   1 
ATOM 9039  C CB  . LEU D 1 12  ? 54.590  50.630  159.202 1.00 10.00 ? 12  LEU D CB  1 
ATOM 9040  C CG  . LEU D 1 12  ? 53.592  51.048  158.104 1.00 10.00 ? 12  LEU D CG  1 
ATOM 9041  C CD1 . LEU D 1 12  ? 52.417  50.085  158.040 1.00 10.00 ? 12  LEU D CD1 1 
ATOM 9042  C CD2 . LEU D 1 12  ? 53.098  52.455  158.379 1.00 10.00 ? 12  LEU D CD2 1 
ATOM 9043  N N   . GLU D 1 13  ? 56.558  49.006  161.142 1.00 10.00 ? 13  GLU D N   1 
ATOM 9044  C CA  . GLU D 1 13  ? 57.862  48.928  161.805 1.00 10.00 ? 13  GLU D CA  1 
ATOM 9045  C C   . GLU D 1 13  ? 58.693  47.727  161.349 1.00 10.00 ? 13  GLU D C   1 
ATOM 9046  O O   . GLU D 1 13  ? 59.668  47.913  160.627 1.00 10.00 ? 13  GLU D O   1 
ATOM 9047  C CB  . GLU D 1 13  ? 57.714  48.931  163.334 1.00 10.00 ? 13  GLU D CB  1 
ATOM 9048  C CG  . GLU D 1 13  ? 57.575  50.333  163.930 1.00 10.00 ? 13  GLU D CG  1 
ATOM 9049  C CD  . GLU D 1 13  ? 57.908  50.387  165.409 1.00 10.00 ? 13  GLU D CD  1 
ATOM 9050  O OE1 . GLU D 1 13  ? 59.050  50.045  165.780 1.00 10.00 ? 13  GLU D OE1 1 
ATOM 9051  O OE2 . GLU D 1 13  ? 57.029  50.777  166.201 1.00 10.00 ? 13  GLU D OE2 1 
ATOM 9052  N N   . ASN D 1 14  ? 58.307  46.494  161.704 1.00 10.00 ? 14  ASN D N   1 
ATOM 9053  C CA  . ASN D 1 14  ? 59.100  45.349  161.290 1.00 10.00 ? 14  ASN D CA  1 
ATOM 9054  C C   . ASN D 1 14  ? 58.731  44.755  159.931 1.00 10.00 ? 14  ASN D C   1 
ATOM 9055  O O   . ASN D 1 14  ? 58.415  43.573  159.808 1.00 10.00 ? 14  ASN D O   1 
ATOM 9056  C CB  . ASN D 1 14  ? 59.086  44.266  162.372 1.00 10.00 ? 14  ASN D CB  1 
ATOM 9057  C CG  . ASN D 1 14  ? 60.483  44.031  162.974 1.00 10.00 ? 14  ASN D CG  1 
ATOM 9058  O OD1 . ASN D 1 14  ? 61.496  44.058  162.258 1.00 10.00 ? 14  ASN D OD1 1 
ATOM 9059  N ND2 . ASN D 1 14  ? 60.536  43.787  164.288 1.00 10.00 ? 14  ASN D ND2 1 
ATOM 9060  N N   . TYR D 1 15  ? 58.773  45.606  158.913 1.00 10.00 ? 15  TYR D N   1 
ATOM 9061  C CA  . TYR D 1 15  ? 58.505  45.213  157.537 1.00 10.00 ? 15  TYR D CA  1 
ATOM 9062  C C   . TYR D 1 15  ? 59.495  46.001  156.709 1.00 10.00 ? 15  TYR D C   1 
ATOM 9063  O O   . TYR D 1 15  ? 59.793  47.157  157.018 1.00 10.00 ? 15  TYR D O   1 
ATOM 9064  C CB  . TYR D 1 15  ? 57.083  45.561  157.107 1.00 10.00 ? 15  TYR D CB  1 
ATOM 9065  C CG  . TYR D 1 15  ? 56.821  45.188  155.669 1.00 10.00 ? 15  TYR D CG  1 
ATOM 9066  C CD1 . TYR D 1 15  ? 57.054  43.889  155.217 1.00 10.00 ? 15  TYR D CD1 1 
ATOM 9067  C CD2 . TYR D 1 15  ? 56.378  46.137  154.749 1.00 10.00 ? 15  TYR D CD2 1 
ATOM 9068  C CE1 . TYR D 1 15  ? 56.857  43.543  153.883 1.00 10.00 ? 15  TYR D CE1 1 
ATOM 9069  C CE2 . TYR D 1 15  ? 56.176  45.800  153.411 1.00 10.00 ? 15  TYR D CE2 1 
ATOM 9070  C CZ  . TYR D 1 15  ? 56.419  44.501  152.986 1.00 10.00 ? 15  TYR D CZ  1 
ATOM 9071  O OH  . TYR D 1 15  ? 56.229  44.159  151.667 1.00 10.00 ? 15  TYR D OH  1 
ATOM 9072  N N   . ASN D 1 16  ? 60.017  45.375  155.668 1.00 10.00 ? 16  ASN D N   1 
ATOM 9073  C CA  . ASN D 1 16  ? 60.989  46.006  154.823 1.00 10.00 ? 16  ASN D CA  1 
ATOM 9074  C C   . ASN D 1 16  ? 60.718  45.660  153.364 1.00 10.00 ? 16  ASN D C   1 
ATOM 9075  O O   . ASN D 1 16  ? 60.282  44.551  153.058 1.00 10.00 ? 16  ASN D O   1 
ATOM 9076  C CB  . ASN D 1 16  ? 62.350  45.530  155.280 1.00 10.00 ? 16  ASN D CB  1 
ATOM 9077  C CG  . ASN D 1 16  ? 62.577  45.808  156.713 1.00 10.00 ? 16  ASN D CG  1 
ATOM 9078  O OD1 . ASN D 1 16  ? 63.554  46.460  157.071 1.00 10.00 ? 16  ASN D OD1 1 
ATOM 9079  N ND2 . ASN D 1 16  ? 61.687  45.337  157.555 1.00 10.00 ? 16  ASN D ND2 1 
ATOM 9080  N N   . LYS D 1 17  ? 60.954  46.612  152.466 1.00 10.00 ? 17  LYS D N   1 
ATOM 9081  C CA  . LYS D 1 17  ? 60.711  46.368  151.069 1.00 10.00 ? 17  LYS D CA  1 
ATOM 9082  C C   . LYS D 1 17  ? 61.995  46.186  150.245 1.00 10.00 ? 17  LYS D C   1 
ATOM 9083  O O   . LYS D 1 17  ? 61.988  45.450  149.259 1.00 10.00 ? 17  LYS D O   1 
ATOM 9084  C CB  . LYS D 1 17  ? 59.815  47.484  150.542 1.00 10.00 ? 17  LYS D CB  1 
ATOM 9085  C CG  . LYS D 1 17  ? 58.548  47.571  151.350 1.00 10.00 ? 17  LYS D CG  1 
ATOM 9086  C CD  . LYS D 1 17  ? 58.134  48.996  151.633 1.00 10.00 ? 17  LYS D CD  1 
ATOM 9087  C CE  . LYS D 1 17  ? 57.736  49.781  150.387 1.00 10.00 ? 17  LYS D CE  1 
ATOM 9088  N NZ  . LYS D 1 17  ? 56.377  50.423  150.547 1.00 10.00 ? 17  LYS D NZ  1 
ATOM 9089  N N   . VAL D 1 18  ? 63.083  46.852  150.634 1.00 10.00 ? 18  VAL D N   1 
ATOM 9090  C CA  . VAL D 1 18  ? 64.382  46.695  149.927 1.00 10.00 ? 18  VAL D CA  1 
ATOM 9091  C C   . VAL D 1 18  ? 64.725  45.221  149.832 1.00 10.00 ? 18  VAL D C   1 
ATOM 9092  O O   . VAL D 1 18  ? 65.271  44.771  148.832 1.00 10.00 ? 18  VAL D O   1 
ATOM 9093  C CB  . VAL D 1 18  ? 65.645  47.302  150.662 1.00 10.00 ? 18  VAL D CB  1 
ATOM 9094  C CG1 . VAL D 1 18  ? 66.899  47.007  149.836 1.00 10.00 ? 18  VAL D CG1 1 
ATOM 9095  C CG2 . VAL D 1 18  ? 65.510  48.797  150.868 1.00 10.00 ? 18  VAL D CG2 1 
ATOM 9096  N N   . ILE D 1 19  ? 64.428  44.499  150.909 1.00 10.00 ? 19  ILE D N   1 
ATOM 9097  C CA  . ILE D 1 19  ? 64.701  43.070  151.038 1.00 10.00 ? 19  ILE D CA  1 
ATOM 9098  C C   . ILE D 1 19  ? 63.822  42.196  150.158 1.00 10.00 ? 19  ILE D C   1 
ATOM 9099  O O   . ILE D 1 19  ? 62.727  42.591  149.776 1.00 10.00 ? 19  ILE D O   1 
ATOM 9100  C CB  . ILE D 1 19  ? 64.502  42.610  152.502 1.00 10.00 ? 19  ILE D CB  1 
ATOM 9101  C CG1 . ILE D 1 19  ? 65.261  43.538  153.453 1.00 10.00 ? 19  ILE D CG1 1 
ATOM 9102  C CG2 . ILE D 1 19  ? 64.988  41.178  152.671 1.00 10.00 ? 19  ILE D CG2 1 
ATOM 9103  C CD1 . ILE D 1 19  ? 65.033  43.229  154.925 1.00 10.00 ? 19  ILE D CD1 1 
ATOM 9104  N N   . ARG D 1 20  ? 64.321  41.002  149.840 1.00 10.00 ? 20  ARG D N   1 
ATOM 9105  C CA  . ARG D 1 20  ? 63.596  40.035  149.026 1.00 10.00 ? 20  ARG D CA  1 
ATOM 9106  C C   . ARG D 1 20  ? 63.258  38.847  149.928 1.00 10.00 ? 20  ARG D C   1 
ATOM 9107  O O   . ARG D 1 20  ? 64.050  38.480  150.795 1.00 10.00 ? 20  ARG D O   1 
ATOM 9108  C CB  . ARG D 1 20  ? 64.465  39.572  147.851 1.00 10.00 ? 20  ARG D CB  1 
ATOM 9109  C CG  . ARG D 1 20  ? 65.793  38.920  148.241 1.00 10.00 ? 20  ARG D CG  1 
ATOM 9110  C CD  . ARG D 1 20  ? 66.718  38.692  147.050 1.00 10.00 ? 20  ARG D CD  1 
ATOM 9111  N NE  . ARG D 1 20  ? 68.121  38.659  147.458 1.00 10.00 ? 20  ARG D NE  1 
ATOM 9112  C CZ  . ARG D 1 20  ? 68.553  38.915  148.689 1.00 10.00 ? 20  ARG D CZ  1 
ATOM 9113  N NH1 . ARG D 1 20  ? 67.692  39.227  149.646 1.00 10.00 ? 20  ARG D NH1 1 
ATOM 9114  N NH2 . ARG D 1 20  ? 69.849  38.856  148.963 1.00 10.00 ? 20  ARG D NH2 1 
ATOM 9115  N N   . PRO D 1 21  ? 62.083  38.226  149.735 1.00 10.00 ? 21  PRO D N   1 
ATOM 9116  C CA  . PRO D 1 21  ? 61.730  37.088  150.586 1.00 10.00 ? 21  PRO D CA  1 
ATOM 9117  C C   . PRO D 1 21  ? 62.601  35.866  150.357 1.00 10.00 ? 21  PRO D C   1 
ATOM 9118  O O   . PRO D 1 21  ? 62.152  34.832  149.842 1.00 10.00 ? 21  PRO D O   1 
ATOM 9119  C CB  . PRO D 1 21  ? 60.263  36.842  150.243 1.00 10.00 ? 21  PRO D CB  1 
ATOM 9120  C CG  . PRO D 1 21  ? 60.175  37.288  148.829 1.00 10.00 ? 21  PRO D CG  1 
ATOM 9121  C CD  . PRO D 1 21  ? 60.968  38.571  148.840 1.00 10.00 ? 21  PRO D CD  1 
ATOM 9122  N N   . VAL D 1 22  ? 63.860  35.995  150.730 1.00 10.00 ? 22  VAL D N   1 
ATOM 9123  C CA  . VAL D 1 22  ? 64.778  34.887  150.584 1.00 10.00 ? 22  VAL D CA  1 
ATOM 9124  C C   . VAL D 1 22  ? 64.478  33.853  151.641 1.00 10.00 ? 22  VAL D C   1 
ATOM 9125  O O   . VAL D 1 22  ? 64.360  34.159  152.835 1.00 10.00 ? 22  VAL D O   1 
ATOM 9126  C CB  . VAL D 1 22  ? 66.247  35.321  150.732 1.00 10.00 ? 22  VAL D CB  1 
ATOM 9127  C CG1 . VAL D 1 22  ? 67.128  34.155  151.272 1.00 10.00 ? 22  VAL D CG1 1 
ATOM 9128  C CG2 . VAL D 1 22  ? 66.752  35.784  149.373 1.00 10.00 ? 22  VAL D CG2 1 
ATOM 9129  N N   . GLU D 1 23  ? 64.395  32.606  151.199 1.00 10.00 ? 23  GLU D N   1 
ATOM 9130  C CA  . GLU D 1 23  ? 64.102  31.501  152.099 1.00 10.00 ? 23  GLU D CA  1 
ATOM 9131  C C   . GLU D 1 23  ? 65.200  30.438  152.018 1.00 10.00 ? 23  GLU D C   1 
ATOM 9132  O O   . GLU D 1 23  ? 65.231  29.617  151.103 1.00 10.00 ? 23  GLU D O   1 
ATOM 9133  C CB  . GLU D 1 23  ? 62.697  30.908  151.810 1.00 10.00 ? 23  GLU D CB  1 
ATOM 9134  C CG  . GLU D 1 23  ? 62.307  30.739  150.349 1.00 10.00 ? 23  GLU D CG  1 
ATOM 9135  C CD  . GLU D 1 23  ? 61.469  31.886  149.784 1.00 10.00 ? 23  GLU D CD  1 
ATOM 9136  O OE1 . GLU D 1 23  ? 60.465  32.270  150.411 1.00 10.00 ? 23  GLU D OE1 1 
ATOM 9137  O OE2 . GLU D 1 23  ? 61.810  32.385  148.692 1.00 10.00 ? 23  GLU D OE2 1 
ATOM 9138  N N   . HIS D 1 24  ? 66.123  30.515  152.979 1.00 10.00 ? 24  HIS D N   1 
ATOM 9139  C CA  . HIS D 1 24  ? 67.249  29.608  153.109 1.00 10.00 ? 24  HIS D CA  1 
ATOM 9140  C C   . HIS D 1 24  ? 68.096  29.575  151.802 1.00 10.00 ? 24  HIS D C   1 
ATOM 9141  O O   . HIS D 1 24  ? 67.774  30.262  150.833 1.00 10.00 ? 24  HIS D O   1 
ATOM 9142  C CB  . HIS D 1 24  ? 66.720  28.220  153.559 1.00 10.00 ? 24  HIS D CB  1 
ATOM 9143  C CG  . HIS D 1 24  ? 65.638  28.286  154.619 1.00 10.00 ? 24  HIS D CG  1 
ATOM 9144  N ND1 . HIS D 1 24  ? 65.810  28.926  155.831 1.00 10.00 ? 24  HIS D ND1 1 
ATOM 9145  C CD2 . HIS D 1 24  ? 64.359  27.825  154.623 1.00 10.00 ? 24  HIS D CD2 1 
ATOM 9146  C CE1 . HIS D 1 24  ? 64.686  28.859  156.528 1.00 10.00 ? 24  HIS D CE1 1 
ATOM 9147  N NE2 . HIS D 1 24  ? 63.789  28.200  155.818 1.00 10.00 ? 24  HIS D NE2 1 
ATOM 9148  N N   . HIS D 1 25  ? 69.199  28.825  151.815 1.00 10.00 ? 25  HIS D N   1 
ATOM 9149  C CA  . HIS D 1 25  ? 70.147  28.684  150.702 1.00 10.00 ? 25  HIS D CA  1 
ATOM 9150  C C   . HIS D 1 25  ? 69.583  27.761  149.612 1.00 10.00 ? 25  HIS D C   1 
ATOM 9151  O O   . HIS D 1 25  ? 70.140  26.688  149.423 1.00 10.00 ? 25  HIS D O   1 
ATOM 9152  C CB  . HIS D 1 25  ? 71.420  28.042  151.285 1.00 10.00 ? 25  HIS D CB  1 
ATOM 9153  C CG  . HIS D 1 25  ? 72.698  28.783  151.023 1.00 10.00 ? 25  HIS D CG  1 
ATOM 9154  N ND1 . HIS D 1 25  ? 73.919  28.311  151.462 1.00 10.00 ? 25  HIS D ND1 1 
ATOM 9155  C CD2 . HIS D 1 25  ? 72.961  29.930  150.349 1.00 10.00 ? 25  HIS D CD2 1 
ATOM 9156  C CE1 . HIS D 1 25  ? 74.879  29.129  151.067 1.00 10.00 ? 25  HIS D CE1 1 
ATOM 9157  N NE2 . HIS D 1 25  ? 74.325  30.119  150.390 1.00 10.00 ? 25  HIS D NE2 1 
ATOM 9158  N N   . THR D 1 26  ? 68.536  28.145  148.876 1.00 10.00 ? 26  THR D N   1 
ATOM 9159  C CA  . THR D 1 26  ? 67.989  27.212  147.890 1.00 10.00 ? 26  THR D CA  1 
ATOM 9160  C C   . THR D 1 26  ? 67.479  27.790  146.563 1.00 10.00 ? 26  THR D C   1 
ATOM 9161  O O   . THR D 1 26  ? 68.132  28.621  145.926 1.00 10.00 ? 26  THR D O   1 
ATOM 9162  C CB  . THR D 1 26  ? 66.846  26.355  148.533 1.00 10.00 ? 26  THR D CB  1 
ATOM 9163  O OG1 . THR D 1 26  ? 67.203  26.023  149.880 1.00 10.00 ? 26  THR D OG1 1 
ATOM 9164  C CG2 . THR D 1 26  ? 66.611  25.053  147.742 1.00 10.00 ? 26  THR D CG2 1 
ATOM 9165  N N   . HIS D 1 27  ? 66.295  27.331  146.166 1.00 10.00 ? 27  HIS D N   1 
ATOM 9166  C CA  . HIS D 1 27  ? 65.656  27.703  144.908 1.00 10.00 ? 27  HIS D CA  1 
ATOM 9167  C C   . HIS D 1 27  ? 65.498  29.168  144.533 1.00 10.00 ? 27  HIS D C   1 
ATOM 9168  O O   . HIS D 1 27  ? 64.835  29.480  143.540 1.00 10.00 ? 27  HIS D O   1 
ATOM 9169  C CB  . HIS D 1 27  ? 64.308  26.996  144.802 1.00 10.00 ? 27  HIS D CB  1 
ATOM 9170  C CG  . HIS D 1 27  ? 63.452  27.190  145.993 1.00 10.00 ? 27  HIS D CG  1 
ATOM 9171  N ND1 . HIS D 1 27  ? 63.973  27.245  147.263 1.00 10.00 ? 27  HIS D ND1 1 
ATOM 9172  C CD2 . HIS D 1 27  ? 62.111  27.290  146.121 1.00 10.00 ? 27  HIS D CD2 1 
ATOM 9173  C CE1 . HIS D 1 27  ? 62.989  27.367  148.130 1.00 10.00 ? 27  HIS D CE1 1 
ATOM 9174  N NE2 . HIS D 1 27  ? 61.846  27.395  147.463 1.00 10.00 ? 27  HIS D NE2 1 
ATOM 9175  N N   . PHE D 1 28  ? 66.090  30.080  145.291 1.00 10.00 ? 28  PHE D N   1 
ATOM 9176  C CA  . PHE D 1 28  ? 65.968  31.470  144.892 1.00 10.00 ? 28  PHE D CA  1 
ATOM 9177  C C   . PHE D 1 28  ? 64.555  31.928  145.213 1.00 10.00 ? 28  PHE D C   1 
ATOM 9178  O O   . PHE D 1 28  ? 63.780  31.210  145.840 1.00 10.00 ? 28  PHE D O   1 
ATOM 9179  C CB  . PHE D 1 28  ? 66.143  31.609  143.368 1.00 10.00 ? 28  PHE D CB  1 
ATOM 9180  C CG  . PHE D 1 28  ? 67.308  30.842  142.778 1.00 10.00 ? 28  PHE D CG  1 
ATOM 9181  C CD1 . PHE D 1 28  ? 68.260  30.237  143.591 1.00 10.00 ? 28  PHE D CD1 1 
ATOM 9182  C CD2 . PHE D 1 28  ? 67.537  30.905  141.396 1.00 10.00 ? 28  PHE D CD2 1 
ATOM 9183  C CE1 . PHE D 1 28  ? 69.423  29.733  143.042 1.00 10.00 ? 28  PHE D CE1 1 
ATOM 9184  C CE2 . PHE D 1 28  ? 68.694  30.409  140.833 1.00 10.00 ? 28  PHE D CE2 1 
ATOM 9185  C CZ  . PHE D 1 28  ? 69.653  29.822  141.647 1.00 10.00 ? 28  PHE D CZ  1 
ATOM 9186  N N   . VAL D 1 29  ? 64.221  33.130  144.767 1.00 10.00 ? 29  VAL D N   1 
ATOM 9187  C CA  . VAL D 1 29  ? 62.878  33.642  144.958 1.00 10.00 ? 29  VAL D CA  1 
ATOM 9188  C C   . VAL D 1 29  ? 62.054  33.186  143.747 1.00 10.00 ? 29  VAL D C   1 
ATOM 9189  O O   . VAL D 1 29  ? 62.311  33.596  142.621 1.00 10.00 ? 29  VAL D O   1 
ATOM 9190  C CB  . VAL D 1 29  ? 62.866  35.175  145.035 1.00 10.00 ? 29  VAL D CB  1 
ATOM 9191  C CG1 . VAL D 1 29  ? 61.573  35.651  145.569 1.00 10.00 ? 29  VAL D CG1 1 
ATOM 9192  C CG2 . VAL D 1 29  ? 64.001  35.656  145.914 1.00 10.00 ? 29  VAL D CG2 1 
ATOM 9193  N N   . ASP D 1 30  ? 61.102  32.296  144.009 1.00 10.00 ? 30  ASP D N   1 
ATOM 9194  C CA  . ASP D 1 30  ? 60.162  31.719  143.077 1.00 10.00 ? 30  ASP D CA  1 
ATOM 9195  C C   . ASP D 1 30  ? 59.363  32.742  142.242 1.00 10.00 ? 30  ASP D C   1 
ATOM 9196  O O   . ASP D 1 30  ? 58.210  32.964  142.561 1.00 10.00 ? 30  ASP D O   1 
ATOM 9197  C CB  . ASP D 1 30  ? 59.186  30.874  143.906 1.00 10.00 ? 30  ASP D CB  1 
ATOM 9198  C CG  . ASP D 1 30  ? 59.666  30.656  145.359 1.00 10.00 ? 30  ASP D CG  1 
ATOM 9199  O OD1 . ASP D 1 30  ? 58.973  29.928  146.090 1.00 10.00 ? 30  ASP D OD1 1 
ATOM 9200  O OD2 . ASP D 1 30  ? 60.719  31.188  145.781 1.00 10.00 ? 30  ASP D OD2 1 
ATOM 9201  N N   . ILE D 1 31  ? 59.955  33.327  141.187 1.00 10.00 ? 31  ILE D N   1 
ATOM 9202  C CA  . ILE D 1 31  ? 59.287  34.306  140.333 1.00 10.00 ? 31  ILE D CA  1 
ATOM 9203  C C   . ILE D 1 31  ? 58.544  33.664  139.170 1.00 10.00 ? 31  ILE D C   1 
ATOM 9204  O O   . ILE D 1 31  ? 59.137  32.946  138.386 1.00 10.00 ? 31  ILE D O   1 
ATOM 9205  C CB  . ILE D 1 31  ? 60.316  35.332  139.758 1.00 10.00 ? 31  ILE D CB  1 
ATOM 9206  C CG1 . ILE D 1 31  ? 60.927  36.158  140.891 1.00 10.00 ? 31  ILE D CG1 1 
ATOM 9207  C CG2 . ILE D 1 31  ? 59.653  36.253  138.759 1.00 10.00 ? 31  ILE D CG2 1 
ATOM 9208  C CD1 . ILE D 1 31  ? 61.935  37.192  140.422 1.00 10.00 ? 31  ILE D CD1 1 
ATOM 9209  N N   . THR D 1 32  ? 57.261  33.991  139.049 1.00 10.00 ? 32  THR D N   1 
ATOM 9210  C CA  . THR D 1 32  ? 56.386  33.454  138.009 1.00 10.00 ? 32  THR D CA  1 
ATOM 9211  C C   . THR D 1 32  ? 56.094  34.636  137.041 1.00 10.00 ? 32  THR D C   1 
ATOM 9212  O O   . THR D 1 32  ? 55.434  35.608  137.426 1.00 10.00 ? 32  THR D O   1 
ATOM 9213  C CB  . THR D 1 32  ? 55.031  32.918  138.677 1.00 10.00 ? 32  THR D CB  1 
ATOM 9214  O OG1 . THR D 1 32  ? 55.339  31.971  139.703 1.00 10.00 ? 32  THR D OG1 1 
ATOM 9215  C CG2 . THR D 1 32  ? 54.073  32.283  137.649 1.00 10.00 ? 32  THR D CG2 1 
ATOM 9216  N N   . VAL D 1 33  ? 56.572  34.555  135.796 1.00 10.00 ? 33  VAL D N   1 
ATOM 9217  C CA  . VAL D 1 33  ? 56.369  35.635  134.829 1.00 10.00 ? 33  VAL D CA  1 
ATOM 9218  C C   . VAL D 1 33  ? 55.658  35.167  133.562 1.00 10.00 ? 33  VAL D C   1 
ATOM 9219  O O   . VAL D 1 33  ? 55.662  33.982  133.229 1.00 10.00 ? 33  VAL D O   1 
ATOM 9220  C CB  . VAL D 1 33  ? 57.710  36.271  134.405 1.00 10.00 ? 33  VAL D CB  1 
ATOM 9221  C CG1 . VAL D 1 33  ? 58.452  35.339  133.473 1.00 10.00 ? 33  VAL D CG1 1 
ATOM 9222  C CG2 . VAL D 1 33  ? 57.464  37.604  133.728 1.00 10.00 ? 33  VAL D CG2 1 
ATOM 9223  N N   . GLY D 1 34  ? 55.033  36.111  132.872 1.00 10.00 ? 34  GLY D N   1 
ATOM 9224  C CA  . GLY D 1 34  ? 54.340  35.771  131.645 1.00 10.00 ? 34  GLY D CA  1 
ATOM 9225  C C   . GLY D 1 34  ? 53.924  36.995  130.850 1.00 10.00 ? 34  GLY D C   1 
ATOM 9226  O O   . GLY D 1 34  ? 53.785  38.092  131.382 1.00 10.00 ? 34  GLY D O   1 
ATOM 9227  N N   . LEU D 1 35  ? 53.750  36.752  129.575 1.00 10.00 ? 35  LEU D N   1 
ATOM 9228  C CA  . LEU D 1 35  ? 53.312  37.755  128.601 1.00 10.00 ? 35  LEU D CA  1 
ATOM 9229  C C   . LEU D 1 35  ? 51.798  37.703  128.406 1.00 10.00 ? 35  LEU D C   1 
ATOM 9230  O O   . LEU D 1 35  ? 51.275  36.606  128.262 1.00 10.00 ? 35  LEU D O   1 
ATOM 9231  C CB  . LEU D 1 35  ? 54.029  37.534  127.265 1.00 10.00 ? 35  LEU D CB  1 
ATOM 9232  C CG  . LEU D 1 35  ? 53.993  38.695  126.271 1.00 10.00 ? 35  LEU D CG  1 
ATOM 9233  C CD1 . LEU D 1 35  ? 54.863  39.843  126.758 1.00 10.00 ? 35  LEU D CD1 1 
ATOM 9234  C CD2 . LEU D 1 35  ? 54.437  38.235  124.891 1.00 10.00 ? 35  LEU D CD2 1 
ATOM 9235  N N   . GLN D 1 36  ? 51.132  38.837  128.506 1.00 10.00 ? 36  GLN D N   1 
ATOM 9236  C CA  . GLN D 1 36  ? 49.702  38.923  128.263 1.00 10.00 ? 36  GLN D CA  1 
ATOM 9237  C C   . GLN D 1 36  ? 49.727  40.086  127.290 1.00 10.00 ? 36  GLN D C   1 
ATOM 9238  O O   . GLN D 1 36  ? 49.678  41.244  127.699 1.00 10.00 ? 36  GLN D O   1 
ATOM 9239  C CB  . GLN D 1 36  ? 48.923  39.290  129.526 1.00 10.00 ? 36  GLN D CB  1 
ATOM 9240  C CG  . GLN D 1 36  ? 47.484  39.608  129.210 1.00 10.00 ? 36  GLN D CG  1 
ATOM 9241  C CD  . GLN D 1 36  ? 46.977  38.775  128.051 1.00 10.00 ? 36  GLN D CD  1 
ATOM 9242  O OE1 . GLN D 1 36  ? 46.661  37.596  128.210 1.00 10.00 ? 36  GLN D OE1 1 
ATOM 9243  N NE2 . GLN D 1 36  ? 46.925  39.378  126.868 1.00 10.00 ? 36  GLN D NE2 1 
ATOM 9244  N N   . LEU D 1 37  ? 49.861  39.771  126.007 1.00 10.00 ? 37  LEU D N   1 
ATOM 9245  C CA  . LEU D 1 37  ? 49.945  40.795  124.977 1.00 10.00 ? 37  LEU D CA  1 
ATOM 9246  C C   . LEU D 1 37  ? 48.596  41.015  124.282 1.00 10.00 ? 37  LEU D C   1 
ATOM 9247  O O   . LEU D 1 37  ? 48.082  40.112  123.623 1.00 10.00 ? 37  LEU D O   1 
ATOM 9248  C CB  . LEU D 1 37  ? 51.011  40.375  123.950 1.00 10.00 ? 37  LEU D CB  1 
ATOM 9249  C CG  . LEU D 1 37  ? 51.721  41.387  123.039 1.00 10.00 ? 37  LEU D CG  1 
ATOM 9250  C CD1 . LEU D 1 37  ? 52.432  42.421  123.872 1.00 10.00 ? 37  LEU D CD1 1 
ATOM 9251  C CD2 . LEU D 1 37  ? 52.739  40.670  122.162 1.00 10.00 ? 37  LEU D CD2 1 
ATOM 9252  N N   . ILE D 1 38  ? 48.051  42.223  124.395 1.00 10.00 ? 38  ILE D N   1 
ATOM 9253  C CA  . ILE D 1 38  ? 46.768  42.513  123.750 1.00 10.00 ? 38  ILE D CA  1 
ATOM 9254  C C   . ILE D 1 38  ? 46.763  43.644  122.686 1.00 10.00 ? 38  ILE D C   1 
ATOM 9255  O O   . ILE D 1 38  ? 45.739  43.913  122.049 1.00 10.00 ? 38  ILE D O   1 
ATOM 9256  C CB  . ILE D 1 38  ? 45.675  42.789  124.815 1.00 10.00 ? 38  ILE D CB  1 
ATOM 9257  C CG1 . ILE D 1 38  ? 45.579  41.582  125.791 1.00 10.00 ? 38  ILE D CG1 1 
ATOM 9258  C CG2 . ILE D 1 38  ? 44.338  43.154  124.096 1.00 10.00 ? 38  ILE D CG2 1 
ATOM 9259  C CD1 . ILE D 1 38  ? 44.328  41.554  126.680 1.00 10.00 ? 38  ILE D CD1 1 
ATOM 9260  N N   . GLN D 1 39  ? 47.893  44.313  122.484 1.00 10.00 ? 39  GLN D N   1 
ATOM 9261  C CA  . GLN D 1 39  ? 47.951  45.362  121.464 1.00 10.00 ? 39  GLN D CA  1 
ATOM 9262  C C   . GLN D 1 39  ? 49.389  45.627  121.046 1.00 10.00 ? 39  GLN D C   1 
ATOM 9263  O O   . GLN D 1 39  ? 50.324  45.532  121.842 1.00 10.00 ? 39  GLN D O   1 
ATOM 9264  C CB  . GLN D 1 39  ? 47.284  46.674  121.940 1.00 10.00 ? 39  GLN D CB  1 
ATOM 9265  C CG  . GLN D 1 39  ? 45.777  46.561  122.272 1.00 10.00 ? 39  GLN D CG  1 
ATOM 9266  C CD  . GLN D 1 39  ? 45.231  47.805  122.930 1.00 10.00 ? 39  GLN D CD  1 
ATOM 9267  O OE1 . GLN D 1 39  ? 45.920  48.813  123.022 1.00 10.00 ? 39  GLN D OE1 1 
ATOM 9268  N NE2 . GLN D 1 39  ? 43.988  47.750  123.376 1.00 10.00 ? 39  GLN D NE2 1 
ATOM 9269  N N   . LEU D 1 40  ? 49.552  45.931  119.769 1.00 10.00 ? 40  LEU D N   1 
ATOM 9270  C CA  . LEU D 1 40  ? 50.843  46.220  119.194 1.00 10.00 ? 40  LEU D CA  1 
ATOM 9271  C C   . LEU D 1 40  ? 50.571  47.506  118.426 1.00 10.00 ? 40  LEU D C   1 
ATOM 9272  O O   . LEU D 1 40  ? 50.200  47.477  117.251 1.00 10.00 ? 40  LEU D O   1 
ATOM 9273  C CB  . LEU D 1 40  ? 51.247  45.071  118.263 1.00 10.00 ? 40  LEU D CB  1 
ATOM 9274  C CG  . LEU D 1 40  ? 52.430  44.190  118.668 1.00 10.00 ? 40  LEU D CG  1 
ATOM 9275  C CD1 . LEU D 1 40  ? 53.739  45.005  118.745 1.00 10.00 ? 40  LEU D CD1 1 
ATOM 9276  C CD2 . LEU D 1 40  ? 52.101  43.546  119.989 1.00 10.00 ? 40  LEU D CD2 1 
ATOM 9277  N N   . ILE D 1 41  ? 50.729  48.643  119.098 1.00 10.00 ? 41  ILE D N   1 
ATOM 9278  C CA  . ILE D 1 41  ? 50.442  49.910  118.426 1.00 10.00 ? 41  ILE D CA  1 
ATOM 9279  C C   . ILE D 1 41  ? 51.418  50.285  117.345 1.00 10.00 ? 41  ILE D C   1 
ATOM 9280  O O   . ILE D 1 41  ? 50.993  50.730  116.297 1.00 10.00 ? 41  ILE D O   1 
ATOM 9281  C CB  . ILE D 1 41  ? 50.332  51.114  119.405 1.00 10.00 ? 41  ILE D CB  1 
ATOM 9282  C CG1 . ILE D 1 41  ? 50.558  50.640  120.847 1.00 10.00 ? 41  ILE D CG1 1 
ATOM 9283  C CG2 . ILE D 1 41  ? 48.972  51.828  119.201 1.00 10.00 ? 41  ILE D CG2 1 
ATOM 9284  C CD1 . ILE D 1 41  ? 52.008  50.674  121.312 1.00 10.00 ? 41  ILE D CD1 1 
ATOM 9285  N N   . ASN D 1 42  ? 52.722  50.147  117.575 1.00 10.00 ? 42  ASN D N   1 
ATOM 9286  C CA  . ASN D 1 42  ? 53.645  50.522  116.515 1.00 10.00 ? 42  ASN D CA  1 
ATOM 9287  C C   . ASN D 1 42  ? 54.903  49.675  116.417 1.00 10.00 ? 42  ASN D C   1 
ATOM 9288  O O   . ASN D 1 42  ? 55.507  49.305  117.423 1.00 10.00 ? 42  ASN D O   1 
ATOM 9289  C CB  . ASN D 1 42  ? 54.026  52.007  116.641 1.00 10.00 ? 42  ASN D CB  1 
ATOM 9290  C CG  . ASN D 1 42  ? 54.168  52.675  115.288 1.00 10.00 ? 42  ASN D CG  1 
ATOM 9291  O OD1 . ASN D 1 42  ? 55.269  52.804  114.752 1.00 10.00 ? 42  ASN D OD1 1 
ATOM 9292  N ND2 . ASN D 1 42  ? 53.039  53.072  114.711 1.00 10.00 ? 42  ASN D ND2 1 
ATOM 9293  N N   . VAL D 1 43  ? 55.272  49.336  115.187 1.00 10.00 ? 43  VAL D N   1 
ATOM 9294  C CA  . VAL D 1 43  ? 56.488  48.561  114.945 1.00 10.00 ? 43  VAL D CA  1 
ATOM 9295  C C   . VAL D 1 43  ? 56.959  48.855  113.533 1.00 10.00 ? 43  VAL D C   1 
ATOM 9296  O O   . VAL D 1 43  ? 56.178  49.152  112.613 1.00 10.00 ? 43  VAL D O   1 
ATOM 9297  C CB  . VAL D 1 43  ? 56.339  46.991  115.116 1.00 10.00 ? 43  VAL D CB  1 
ATOM 9298  C CG1 . VAL D 1 43  ? 57.711  46.294  114.812 1.00 10.00 ? 43  VAL D CG1 1 
ATOM 9299  C CG2 . VAL D 1 43  ? 55.887  46.617  116.542 1.00 10.00 ? 43  VAL D CG2 1 
ATOM 9300  N N   . ASP D 1 44  ? 58.267  48.750  113.390 1.00 10.00 ? 44  ASP D N   1 
ATOM 9301  C CA  . ASP D 1 44  ? 58.961  49.033  112.157 1.00 10.00 ? 44  ASP D CA  1 
ATOM 9302  C C   . ASP D 1 44  ? 59.869  47.865  111.801 1.00 10.00 ? 44  ASP D C   1 
ATOM 9303  O O   . ASP D 1 44  ? 60.846  47.592  112.492 1.00 10.00 ? 44  ASP D O   1 
ATOM 9304  C CB  . ASP D 1 44  ? 59.784  50.316  112.328 1.00 10.00 ? 44  ASP D CB  1 
ATOM 9305  C CG  . ASP D 1 44  ? 60.585  50.640  111.118 1.00 10.00 ? 44  ASP D CG  1 
ATOM 9306  O OD1 . ASP D 1 44  ? 59.972  50.777  110.047 1.00 10.00 ? 44  ASP D OD1 1 
ATOM 9307  O OD2 . ASP D 1 44  ? 61.813  50.754  111.233 1.00 10.00 ? 44  ASP D OD2 1 
ATOM 9308  N N   . GLU D 1 45  ? 59.509  47.177  110.724 1.00 10.00 ? 45  GLU D N   1 
ATOM 9309  C CA  . GLU D 1 45  ? 60.242  46.039  110.197 1.00 10.00 ? 45  GLU D CA  1 
ATOM 9310  C C   . GLU D 1 45  ? 61.671  46.422  109.841 1.00 10.00 ? 45  GLU D C   1 
ATOM 9311  O O   . GLU D 1 45  ? 62.612  45.646  110.030 1.00 10.00 ? 45  GLU D O   1 
ATOM 9312  C CB  . GLU D 1 45  ? 59.514  45.520  108.960 1.00 10.00 ? 45  GLU D CB  1 
ATOM 9313  C CG  . GLU D 1 45  ? 60.351  44.676  108.040 1.00 10.00 ? 45  GLU D CG  1 
ATOM 9314  C CD  . GLU D 1 45  ? 59.585  44.254  106.809 1.00 10.00 ? 45  GLU D CD  1 
ATOM 9315  O OE1 . GLU D 1 45  ? 58.368  44.513  106.755 1.00 10.00 ? 45  GLU D OE1 1 
ATOM 9316  O OE2 . GLU D 1 45  ? 60.196  43.671  105.893 1.00 10.00 ? 45  GLU D OE2 1 
ATOM 9317  N N   . VAL D 1 46  ? 61.818  47.650  109.375 1.00 10.00 ? 46  VAL D N   1 
ATOM 9318  C CA  . VAL D 1 46  ? 63.103  48.175  108.930 1.00 10.00 ? 46  VAL D CA  1 
ATOM 9319  C C   . VAL D 1 46  ? 64.067  48.318  110.103 1.00 10.00 ? 46  VAL D C   1 
ATOM 9320  O O   . VAL D 1 46  ? 65.238  47.948  110.016 1.00 10.00 ? 46  VAL D O   1 
ATOM 9321  C CB  . VAL D 1 46  ? 62.941  49.526  108.209 1.00 10.00 ? 46  VAL D CB  1 
ATOM 9322  C CG1 . VAL D 1 46  ? 63.929  49.638  107.059 1.00 10.00 ? 46  VAL D CG1 1 
ATOM 9323  C CG2 . VAL D 1 46  ? 61.513  49.695  107.713 1.00 10.00 ? 46  VAL D CG2 1 
ATOM 9324  N N   . ASN D 1 47  ? 63.629  48.959  111.179 1.00 10.00 ? 47  ASN D N   1 
ATOM 9325  C CA  . ASN D 1 47  ? 64.515  49.173  112.323 1.00 10.00 ? 47  ASN D CA  1 
ATOM 9326  C C   . ASN D 1 47  ? 64.311  48.093  113.361 1.00 10.00 ? 47  ASN D C   1 
ATOM 9327  O O   . ASN D 1 47  ? 64.991  48.072  114.377 1.00 10.00 ? 47  ASN D O   1 
ATOM 9328  C CB  . ASN D 1 47  ? 64.272  50.562  112.933 1.00 10.00 ? 47  ASN D CB  1 
ATOM 9329  C CG  . ASN D 1 47  ? 64.611  51.696  111.968 1.00 10.00 ? 47  ASN D CG  1 
ATOM 9330  O OD1 . ASN D 1 47  ? 65.730  51.783  111.462 1.00 10.00 ? 47  ASN D OD1 1 
ATOM 9331  N ND2 . ASN D 1 47  ? 63.642  52.571  111.716 1.00 10.00 ? 47  ASN D ND2 1 
ATOM 9332  N N   . GLN D 1 48  ? 63.396  47.173  113.056 1.00 10.00 ? 48  GLN D N   1 
ATOM 9333  C CA  . GLN D 1 48  ? 63.052  46.042  113.937 1.00 10.00 ? 48  GLN D CA  1 
ATOM 9334  C C   . GLN D 1 48  ? 62.630  46.499  115.317 1.00 10.00 ? 48  GLN D C   1 
ATOM 9335  O O   . GLN D 1 48  ? 62.992  45.889  116.324 1.00 10.00 ? 48  GLN D O   1 
ATOM 9336  C CB  . GLN D 1 48  ? 64.227  45.085  114.107 1.00 10.00 ? 48  GLN D CB  1 
ATOM 9337  C CG  . GLN D 1 48  ? 65.399  45.690  114.874 1.00 10.00 ? 48  GLN D CG  1 
ATOM 9338  C CD  . GLN D 1 48  ? 66.625  44.818  114.892 1.00 10.00 ? 48  GLN D CD  1 
ATOM 9339  O OE1 . GLN D 1 48  ? 66.615  43.728  114.335 1.00 10.00 ? 48  GLN D OE1 1 
ATOM 9340  N NE2 . GLN D 1 48  ? 67.688  45.286  115.542 1.00 10.00 ? 48  GLN D NE2 1 
ATOM 9341  N N   . ILE D 1 49  ? 61.879  47.586  115.353 1.00 10.00 ? 49  ILE D N   1 
ATOM 9342  C CA  . ILE D 1 49  ? 61.383  48.151  116.597 1.00 10.00 ? 49  ILE D CA  1 
ATOM 9343  C C   . ILE D 1 49  ? 59.930  47.766  116.854 1.00 10.00 ? 49  ILE D C   1 
ATOM 9344  O O   . ILE D 1 49  ? 59.115  47.800  115.942 1.00 10.00 ? 49  ILE D O   1 
ATOM 9345  C CB  . ILE D 1 49  ? 61.447  49.688  116.552 1.00 10.00 ? 49  ILE D CB  1 
ATOM 9346  C CG1 . ILE D 1 49  ? 62.896  50.163  116.689 1.00 10.00 ? 49  ILE D CG1 1 
ATOM 9347  C CG2 . ILE D 1 49  ? 60.522  50.267  117.597 1.00 10.00 ? 49  ILE D CG2 1 
ATOM 9348  C CD1 . ILE D 1 49  ? 63.584  49.688  117.945 1.00 10.00 ? 49  ILE D CD1 1 
ATOM 9349  N N   . VAL D 1 50  ? 59.609  47.494  118.114 1.00 10.00 ? 50  VAL D N   1 
ATOM 9350  C CA  . VAL D 1 50  ? 58.279  47.093  118.505 1.00 10.00 ? 50  VAL D CA  1 
ATOM 9351  C C   . VAL D 1 50  ? 57.791  47.772  119.801 1.00 10.00 ? 50  VAL D C   1 
ATOM 9352  O O   . VAL D 1 50  ? 58.294  47.459  120.870 1.00 10.00 ? 50  VAL D O   1 
ATOM 9353  C CB  . VAL D 1 50  ? 58.241  45.546  118.732 1.00 10.00 ? 50  VAL D CB  1 
ATOM 9354  C CG1 . VAL D 1 50  ? 56.863  45.102  119.186 1.00 10.00 ? 50  VAL D CG1 1 
ATOM 9355  C CG2 . VAL D 1 50  ? 58.652  44.814  117.464 1.00 10.00 ? 50  VAL D CG2 1 
ATOM 9356  N N   . GLU D 1 51  ? 56.788  48.655  119.721 1.00 10.00 ? 51  GLU D N   1 
ATOM 9357  C CA  . GLU D 1 51  ? 56.255  49.279  120.935 1.00 10.00 ? 51  GLU D CA  1 
ATOM 9358  C C   . GLU D 1 51  ? 54.881  48.627  121.184 1.00 10.00 ? 51  GLU D C   1 
ATOM 9359  O O   . GLU D 1 51  ? 53.867  49.016  120.598 1.00 10.00 ? 51  GLU D O   1 
ATOM 9360  C CB  . GLU D 1 51  ? 56.091  50.805  120.770 1.00 10.00 ? 51  GLU D CB  1 
ATOM 9361  C CG  . GLU D 1 51  ? 57.188  51.701  121.424 1.00 10.00 ? 51  GLU D CG  1 
ATOM 9362  C CD  . GLU D 1 51  ? 56.678  53.118  121.736 1.00 10.00 ? 51  GLU D CD  1 
ATOM 9363  O OE1 . GLU D 1 51  ? 55.704  53.218  122.510 1.00 10.00 ? 51  GLU D OE1 1 
ATOM 9364  O OE2 . GLU D 1 51  ? 57.242  54.108  121.207 1.00 10.00 ? 51  GLU D OE2 1 
ATOM 9365  N N   . THR D 1 52  ? 54.860  47.608  122.034 1.00 10.00 ? 52  THR D N   1 
ATOM 9366  C CA  . THR D 1 52  ? 53.600  46.929  122.311 1.00 10.00 ? 52  THR D CA  1 
ATOM 9367  C C   . THR D 1 52  ? 53.193  46.977  123.780 1.00 10.00 ? 52  THR D C   1 
ATOM 9368  O O   . THR D 1 52  ? 53.817  47.670  124.589 1.00 10.00 ? 52  THR D O   1 
ATOM 9369  C CB  . THR D 1 52  ? 53.689  45.456  121.862 1.00 10.00 ? 52  THR D CB  1 
ATOM 9370  O OG1 . THR D 1 52  ? 52.573  44.729  122.380 1.00 10.00 ? 52  THR D OG1 1 
ATOM 9371  C CG2 . THR D 1 52  ? 54.985  44.818  122.345 1.00 10.00 ? 52  THR D CG2 1 
ATOM 9372  N N   . ASN D 1 53  ? 52.097  46.303  124.117 1.00 10.00 ? 53  ASN D N   1 
ATOM 9373  C CA  . ASN D 1 53  ? 51.720  46.229  125.519 1.00 10.00 ? 53  ASN D CA  1 
ATOM 9374  C C   . ASN D 1 53  ? 51.499  44.830  125.973 1.00 10.00 ? 53  ASN D C   1 
ATOM 9375  O O   . ASN D 1 53  ? 50.822  44.022  125.335 1.00 10.00 ? 53  ASN D O   1 
ATOM 9376  C CB  . ASN D 1 53  ? 50.457  47.000  125.871 1.00 10.00 ? 53  ASN D CB  1 
ATOM 9377  C CG  . ASN D 1 53  ? 49.997  46.733  127.314 1.00 10.00 ? 53  ASN D CG  1 
ATOM 9378  O OD1 . ASN D 1 53  ? 49.408  45.692  127.601 1.00 10.00 ? 53  ASN D OD1 1 
ATOM 9379  N ND2 . ASN D 1 53  ? 50.285  47.666  128.220 1.00 10.00 ? 53  ASN D ND2 1 
ATOM 9380  N N   . VAL D 1 54  ? 52.068  44.543  127.126 1.00 10.00 ? 54  VAL D N   1 
ATOM 9381  C CA  . VAL D 1 54  ? 51.930  43.197  127.713 1.00 10.00 ? 54  VAL D CA  1 
ATOM 9382  C C   . VAL D 1 54  ? 51.852  43.425  129.205 1.00 10.00 ? 54  VAL D C   1 
ATOM 9383  O O   . VAL D 1 54  ? 52.674  44.136  129.796 1.00 10.00 ? 54  VAL D O   1 
ATOM 9384  C CB  . VAL D 1 54  ? 53.123  42.204  127.367 1.00 10.00 ? 54  VAL D CB  1 
ATOM 9385  C CG1 . VAL D 1 54  ? 52.565  40.998  126.641 1.00 10.00 ? 54  VAL D CG1 1 
ATOM 9386  C CG2 . VAL D 1 54  ? 54.240  42.897  126.510 1.00 10.00 ? 54  VAL D CG2 1 
ATOM 9387  N N   . ARG D 1 55  ? 50.806  42.884  129.800 1.00 10.00 ? 55  ARG D N   1 
ATOM 9388  C CA  . ARG D 1 55  ? 50.596  43.054  131.219 1.00 10.00 ? 55  ARG D CA  1 
ATOM 9389  C C   . ARG D 1 55  ? 51.601  42.049  131.769 1.00 10.00 ? 55  ARG D C   1 
ATOM 9390  O O   . ARG D 1 55  ? 51.619  40.890  131.346 1.00 10.00 ? 55  ARG D O   1 
ATOM 9391  C CB  . ARG D 1 55  ? 49.114  42.755  131.550 1.00 10.00 ? 55  ARG D CB  1 
ATOM 9392  C CG  . ARG D 1 55  ? 48.194  42.963  130.315 1.00 10.00 ? 55  ARG D CG  1 
ATOM 9393  C CD  . ARG D 1 55  ? 46.996  43.931  130.425 1.00 10.00 ? 55  ARG D CD  1 
ATOM 9394  N NE  . ARG D 1 55  ? 46.587  44.365  129.074 1.00 10.00 ? 55  ARG D NE  1 
ATOM 9395  C CZ  . ARG D 1 55  ? 45.455  45.004  128.747 1.00 10.00 ? 55  ARG D CZ  1 
ATOM 9396  N NH1 . ARG D 1 55  ? 44.544  45.312  129.670 1.00 10.00 ? 55  ARG D NH1 1 
ATOM 9397  N NH2 . ARG D 1 55  ? 45.233  45.350  127.479 1.00 10.00 ? 55  ARG D NH2 1 
ATOM 9398  N N   . LEU D 1 56  ? 52.503  42.496  132.633 1.00 10.00 ? 56  LEU D N   1 
ATOM 9399  C CA  . LEU D 1 56  ? 53.517  41.632  133.199 1.00 10.00 ? 56  LEU D CA  1 
ATOM 9400  C C   . LEU D 1 56  ? 52.960  40.825  134.329 1.00 10.00 ? 56  LEU D C   1 
ATOM 9401  O O   . LEU D 1 56  ? 53.014  41.245  135.475 1.00 10.00 ? 56  LEU D O   1 
ATOM 9402  C CB  . LEU D 1 56  ? 54.689  42.471  133.687 1.00 10.00 ? 56  LEU D CB  1 
ATOM 9403  C CG  . LEU D 1 56  ? 55.188  43.321  132.522 1.00 10.00 ? 56  LEU D CG  1 
ATOM 9404  C CD1 . LEU D 1 56  ? 56.708  43.410  132.636 1.00 10.00 ? 56  LEU D CD1 1 
ATOM 9405  C CD2 . LEU D 1 56  ? 54.773  42.727  131.151 1.00 10.00 ? 56  LEU D CD2 1 
ATOM 9406  N N   . ARG D 1 57  ? 52.414  39.665  134.005 1.00 10.00 ? 57  ARG D N   1 
ATOM 9407  C CA  . ARG D 1 57  ? 51.863  38.824  135.023 1.00 10.00 ? 57  ARG D CA  1 
ATOM 9408  C C   . ARG D 1 57  ? 52.986  38.246  135.873 1.00 10.00 ? 57  ARG D C   1 
ATOM 9409  O O   . ARG D 1 57  ? 53.668  37.333  135.438 1.00 10.00 ? 57  ARG D O   1 
ATOM 9410  C CB  . ARG D 1 57  ? 51.061  37.675  134.405 1.00 10.00 ? 57  ARG D CB  1 
ATOM 9411  C CG  . ARG D 1 57  ? 50.849  36.504  135.371 1.00 10.00 ? 57  ARG D CG  1 
ATOM 9412  C CD  . ARG D 1 57  ? 50.121  35.350  134.753 1.00 10.00 ? 57  ARG D CD  1 
ATOM 9413  N NE  . ARG D 1 57  ? 48.716  35.654  134.600 1.00 10.00 ? 57  ARG D NE  1 
ATOM 9414  C CZ  . ARG D 1 57  ? 47.786  34.735  134.402 1.00 10.00 ? 57  ARG D CZ  1 
ATOM 9415  N NH1 . ARG D 1 57  ? 48.124  33.456  134.335 1.00 10.00 ? 57  ARG D NH1 1 
ATOM 9416  N NH2 . ARG D 1 57  ? 46.518  35.094  134.278 1.00 10.00 ? 57  ARG D NH2 1 
ATOM 9417  N N   . GLN D 1 58  ? 53.197  38.794  137.056 1.00 10.00 ? 58  GLN D N   1 
ATOM 9418  C CA  . GLN D 1 58  ? 54.183  38.228  137.966 1.00 10.00 ? 58  GLN D CA  1 
ATOM 9419  C C   . GLN D 1 58  ? 53.515  37.416  139.069 1.00 10.00 ? 58  GLN D C   1 
ATOM 9420  O O   . GLN D 1 58  ? 52.359  37.749  139.389 1.00 10.00 ? 58  GLN D O   1 
ATOM 9421  C CB  . GLN D 1 58  ? 55.053  39.334  138.567 1.00 10.00 ? 58  GLN D CB  1 
ATOM 9422  C CG  . GLN D 1 58  ? 55.989  39.995  137.569 1.00 10.00 ? 58  GLN D CG  1 
ATOM 9423  C CD  . GLN D 1 58  ? 56.679  41.218  138.139 1.00 10.00 ? 58  GLN D CD  1 
ATOM 9424  O OE1 . GLN D 1 58  ? 56.035  42.221  138.444 1.00 10.00 ? 58  GLN D OE1 1 
ATOM 9425  N NE2 . GLN D 1 58  ? 57.981  41.353  138.368 1.00 10.00 ? 58  GLN D NE2 1 
ATOM 9426  N N   . GLN D 1 59  ? 54.155  36.416  139.556 1.00 10.00 ? 59  GLN D N   1 
ATOM 9427  C CA  . GLN D 1 59  ? 53.540  35.571  140.595 1.00 10.00 ? 59  GLN D CA  1 
ATOM 9428  C C   . GLN D 1 59  ? 54.670  34.943  141.430 1.00 10.00 ? 59  GLN D C   1 
ATOM 9429  O O   . GLN D 1 59  ? 55.561  34.276  140.898 1.00 10.00 ? 59  GLN D O   1 
ATOM 9430  C CB  . GLN D 1 59  ? 52.665  34.461  139.930 1.00 10.00 ? 59  GLN D CB  1 
ATOM 9431  C CG  . GLN D 1 59  ? 51.555  33.788  140.790 1.00 10.00 ? 59  GLN D CG  1 
ATOM 9432  C CD  . GLN D 1 59  ? 50.616  32.852  139.994 1.00 10.00 ? 59  GLN D CD  1 
ATOM 9433  O OE1 . GLN D 1 59  ? 49.518  32.481  140.458 1.00 10.00 ? 59  GLN D OE1 1 
ATOM 9434  N NE2 . GLN D 1 59  ? 51.053  32.471  138.802 1.00 10.00 ? 59  GLN D NE2 1 
ATOM 9435  N N   . TRP D 1 60  ? 54.671  35.196  142.731 1.00 10.00 ? 60  TRP D N   1 
ATOM 9436  C CA  . TRP D 1 60  ? 55.677  34.607  143.593 1.00 10.00 ? 60  TRP D CA  1 
ATOM 9437  C C   . TRP D 1 60  ? 55.163  34.714  145.017 1.00 10.00 ? 60  TRP D C   1 
ATOM 9438  O O   . TRP D 1 60  ? 54.007  35.108  145.203 1.00 10.00 ? 60  TRP D O   1 
ATOM 9439  C CB  . TRP D 1 60  ? 57.040  35.249  143.314 1.00 10.00 ? 60  TRP D CB  1 
ATOM 9440  C CG  . TRP D 1 60  ? 57.730  35.940  144.415 1.00 10.00 ? 60  TRP D CG  1 
ATOM 9441  C CD1 . TRP D 1 60  ? 58.979  35.666  144.899 1.00 10.00 ? 60  TRP D CD1 1 
ATOM 9442  C CD2 . TRP D 1 60  ? 57.266  37.083  145.122 1.00 10.00 ? 60  TRP D CD2 1 
ATOM 9443  N NE1 . TRP D 1 60  ? 59.319  36.574  145.867 1.00 10.00 ? 60  TRP D NE1 1 
ATOM 9444  C CE2 . TRP D 1 60  ? 58.281  37.456  146.023 1.00 10.00 ? 60  TRP D CE2 1 
ATOM 9445  C CE3 . TRP D 1 60  ? 56.093  37.836  145.073 1.00 10.00 ? 60  TRP D CE3 1 
ATOM 9446  C CZ2 . TRP D 1 60  ? 58.149  38.540  146.867 1.00 10.00 ? 60  TRP D CZ2 1 
ATOM 9447  C CZ3 . TRP D 1 60  ? 55.968  38.902  145.898 1.00 10.00 ? 60  TRP D CZ3 1 
ATOM 9448  C CH2 . TRP D 1 60  ? 56.984  39.250  146.789 1.00 10.00 ? 60  TRP D CH2 1 
ATOM 9449  N N   . ILE D 1 61  ? 55.924  34.283  146.013 1.00 10.00 ? 61  ILE D N   1 
ATOM 9450  C CA  . ILE D 1 61  ? 55.406  34.329  147.366 1.00 10.00 ? 61  ILE D CA  1 
ATOM 9451  C C   . ILE D 1 61  ? 56.343  34.865  148.426 1.00 10.00 ? 61  ILE D C   1 
ATOM 9452  O O   . ILE D 1 61  ? 57.565  34.744  148.334 1.00 10.00 ? 61  ILE D O   1 
ATOM 9453  C CB  . ILE D 1 61  ? 54.915  32.930  147.809 1.00 10.00 ? 61  ILE D CB  1 
ATOM 9454  C CG1 . ILE D 1 61  ? 56.052  31.912  147.683 1.00 10.00 ? 61  ILE D CG1 1 
ATOM 9455  C CG2 . ILE D 1 61  ? 53.724  32.505  146.958 1.00 10.00 ? 61  ILE D CG2 1 
ATOM 9456  C CD1 . ILE D 1 61  ? 55.672  30.506  148.110 1.00 10.00 ? 61  ILE D CD1 1 
ATOM 9457  N N   . ASP D 1 62  ? 55.735  35.452  149.448 1.00 10.00 ? 62  ASP D N   1 
ATOM 9458  C CA  . ASP D 1 62  ? 56.473  36.023  150.568 1.00 10.00 ? 62  ASP D CA  1 
ATOM 9459  C C   . ASP D 1 62  ? 55.678  35.664  151.809 1.00 10.00 ? 62  ASP D C   1 
ATOM 9460  O O   . ASP D 1 62  ? 54.598  36.211  152.054 1.00 10.00 ? 62  ASP D O   1 
ATOM 9461  C CB  . ASP D 1 62  ? 56.543  37.538  150.407 1.00 10.00 ? 62  ASP D CB  1 
ATOM 9462  C CG  . ASP D 1 62  ? 57.606  38.156  151.248 1.00 10.00 ? 62  ASP D CG  1 
ATOM 9463  O OD1 . ASP D 1 62  ? 57.626  37.855  152.456 1.00 10.00 ? 62  ASP D OD1 1 
ATOM 9464  O OD2 . ASP D 1 62  ? 58.412  38.940  150.698 1.00 10.00 ? 62  ASP D OD2 1 
ATOM 9465  N N   . VAL D 1 63  ? 56.206  34.731  152.587 1.00 10.00 ? 63  VAL D N   1 
ATOM 9466  C CA  . VAL D 1 63  ? 55.494  34.319  153.786 1.00 10.00 ? 63  VAL D CA  1 
ATOM 9467  C C   . VAL D 1 63  ? 55.201  35.482  154.705 1.00 10.00 ? 63  VAL D C   1 
ATOM 9468  O O   . VAL D 1 63  ? 54.118  35.546  155.259 1.00 10.00 ? 63  VAL D O   1 
ATOM 9469  C CB  . VAL D 1 63  ? 56.235  33.232  154.611 1.00 10.00 ? 63  VAL D CB  1 
ATOM 9470  C CG1 . VAL D 1 63  ? 57.681  33.680  154.965 1.00 10.00 ? 63  VAL D CG1 1 
ATOM 9471  C CG2 . VAL D 1 63  ? 55.391  32.913  155.871 1.00 10.00 ? 63  VAL D CG2 1 
ATOM 9472  N N   . ARG D 1 64  ? 56.157  36.398  154.859 1.00 10.00 ? 64  ARG D N   1 
ATOM 9473  C CA  . ARG D 1 64  ? 55.966  37.566  155.731 1.00 10.00 ? 64  ARG D CA  1 
ATOM 9474  C C   . ARG D 1 64  ? 54.615  38.266  155.539 1.00 10.00 ? 64  ARG D C   1 
ATOM 9475  O O   . ARG D 1 64  ? 54.197  39.053  156.392 1.00 10.00 ? 64  ARG D O   1 
ATOM 9476  C CB  . ARG D 1 64  ? 57.085  38.605  155.539 1.00 10.00 ? 64  ARG D CB  1 
ATOM 9477  C CG  . ARG D 1 64  ? 58.474  38.238  156.050 1.00 10.00 ? 64  ARG D CG  1 
ATOM 9478  C CD  . ARG D 1 64  ? 59.530  38.835  155.124 1.00 10.00 ? 64  ARG D CD  1 
ATOM 9479  N NE  . ARG D 1 64  ? 60.899  38.588  155.561 1.00 10.00 ? 64  ARG D NE  1 
ATOM 9480  C CZ  . ARG D 1 64  ? 61.545  37.440  155.413 1.00 10.00 ? 64  ARG D CZ  1 
ATOM 9481  N NH1 . ARG D 1 64  ? 60.952  36.417  154.831 1.00 10.00 ? 64  ARG D NH1 1 
ATOM 9482  N NH2 . ARG D 1 64  ? 62.784  37.307  155.864 1.00 10.00 ? 64  ARG D NH2 1 
ATOM 9483  N N   . LEU D 1 65  ? 53.940  37.992  154.421 1.00 10.00 ? 65  LEU D N   1 
ATOM 9484  C CA  . LEU D 1 65  ? 52.633  38.603  154.131 1.00 10.00 ? 65  LEU D CA  1 
ATOM 9485  C C   . LEU D 1 65  ? 51.466  37.786  154.695 1.00 10.00 ? 65  LEU D C   1 
ATOM 9486  O O   . LEU D 1 65  ? 50.318  38.211  154.606 1.00 10.00 ? 65  LEU D O   1 
ATOM 9487  C CB  . LEU D 1 65  ? 52.404  38.810  152.610 1.00 10.00 ? 65  LEU D CB  1 
ATOM 9488  C CG  . LEU D 1 65  ? 53.075  39.919  151.770 1.00 10.00 ? 65  LEU D CG  1 
ATOM 9489  C CD1 . LEU D 1 65  ? 54.514  39.549  151.418 1.00 10.00 ? 65  LEU D CD1 1 
ATOM 9490  C CD2 . LEU D 1 65  ? 52.288  40.132  150.488 1.00 10.00 ? 65  LEU D CD2 1 
ATOM 9491  N N   . ARG D 1 66  ? 51.761  36.615  155.258 1.00 10.00 ? 66  ARG D N   1 
ATOM 9492  C CA  . ARG D 1 66  ? 50.745  35.746  155.856 1.00 10.00 ? 66  ARG D CA  1 
ATOM 9493  C C   . ARG D 1 66  ? 50.136  36.486  157.041 1.00 10.00 ? 66  ARG D C   1 
ATOM 9494  O O   . ARG D 1 66  ? 50.825  37.270  157.672 1.00 10.00 ? 66  ARG D O   1 
ATOM 9495  C CB  . ARG D 1 66  ? 51.396  34.476  156.374 1.00 10.00 ? 66  ARG D CB  1 
ATOM 9496  C CG  . ARG D 1 66  ? 52.145  34.687  157.682 1.00 10.00 ? 66  ARG D CG  1 
ATOM 9497  C CD  . ARG D 1 66  ? 53.411  35.545  157.541 1.00 10.00 ? 66  ARG D CD  1 
ATOM 9498  N NE  . ARG D 1 66  ? 53.781  36.271  158.760 1.00 10.00 ? 66  ARG D NE  1 
ATOM 9499  C CZ  . ARG D 1 66  ? 54.982  36.809  158.991 1.00 10.00 ? 66  ARG D CZ  1 
ATOM 9500  N NH1 . ARG D 1 66  ? 55.961  36.721  158.100 1.00 10.00 ? 66  ARG D NH1 1 
ATOM 9501  N NH2 . ARG D 1 66  ? 55.209  37.438  160.135 1.00 10.00 ? 66  ARG D NH2 1 
ATOM 9502  N N   . TRP D 1 67  ? 48.876  36.215  157.377 1.00 10.00 ? 67  TRP D N   1 
ATOM 9503  C CA  . TRP D 1 67  ? 48.248  36.928  158.490 1.00 10.00 ? 67  TRP D CA  1 
ATOM 9504  C C   . TRP D 1 67  ? 47.247  36.079  159.284 1.00 10.00 ? 67  TRP D C   1 
ATOM 9505  O O   . TRP D 1 67  ? 47.044  34.896  158.996 1.00 10.00 ? 67  TRP D O   1 
ATOM 9506  C CB  . TRP D 1 67  ? 47.521  38.191  157.957 1.00 10.00 ? 67  TRP D CB  1 
ATOM 9507  C CG  . TRP D 1 67  ? 48.420  39.374  157.565 1.00 10.00 ? 67  TRP D CG  1 
ATOM 9508  C CD1 . TRP D 1 67  ? 48.171  40.290  156.599 1.00 10.00 ? 67  TRP D CD1 1 
ATOM 9509  C CD2 . TRP D 1 67  ? 49.674  39.737  158.144 1.00 10.00 ? 67  TRP D CD2 1 
ATOM 9510  N NE1 . TRP D 1 67  ? 49.185  41.197  156.534 1.00 10.00 ? 67  TRP D NE1 1 
ATOM 9511  C CE2 . TRP D 1 67  ? 50.124  40.880  157.474 1.00 10.00 ? 67  TRP D CE2 1 
ATOM 9512  C CE3 . TRP D 1 67  ? 50.459  39.199  159.161 1.00 10.00 ? 67  TRP D CE3 1 
ATOM 9513  C CZ2 . TRP D 1 67  ? 51.332  41.508  157.786 1.00 10.00 ? 67  TRP D CZ2 1 
ATOM 9514  C CZ3 . TRP D 1 67  ? 51.659  39.819  159.474 1.00 10.00 ? 67  TRP D CZ3 1 
ATOM 9515  C CH2 . TRP D 1 67  ? 52.087  40.964  158.789 1.00 10.00 ? 67  TRP D CH2 1 
ATOM 9516  N N   . ASN D 1 68  ? 46.648  36.686  160.305 1.00 10.00 ? 68  ASN D N   1 
ATOM 9517  C CA  . ASN D 1 68  ? 45.631  35.986  161.084 1.00 10.00 ? 68  ASN D CA  1 
ATOM 9518  C C   . ASN D 1 68  ? 44.302  36.779  161.010 1.00 10.00 ? 68  ASN D C   1 
ATOM 9519  O O   . ASN D 1 68  ? 44.117  37.579  160.091 1.00 10.00 ? 68  ASN D O   1 
ATOM 9520  C CB  . ASN D 1 68  ? 46.119  35.725  162.536 1.00 10.00 ? 68  ASN D CB  1 
ATOM 9521  C CG  . ASN D 1 68  ? 46.285  36.988  163.372 1.00 10.00 ? 68  ASN D CG  1 
ATOM 9522  O OD1 . ASN D 1 68  ? 45.463  37.915  163.290 1.00 10.00 ? 68  ASN D OD1 1 
ATOM 9523  N ND2 . ASN D 1 68  ? 47.363  37.044  164.160 1.00 10.00 ? 68  ASN D ND2 1 
ATOM 9524  N N   . PRO D 1 69  ? 43.350  36.534  161.931 1.00 10.00 ? 69  PRO D N   1 
ATOM 9525  C CA  . PRO D 1 69  ? 42.049  37.209  161.980 1.00 10.00 ? 69  PRO D CA  1 
ATOM 9526  C C   . PRO D 1 69  ? 42.084  38.761  161.924 1.00 10.00 ? 69  PRO D C   1 
ATOM 9527  O O   . PRO D 1 69  ? 41.035  39.403  161.796 1.00 10.00 ? 69  PRO D O   1 
ATOM 9528  C CB  . PRO D 1 69  ? 41.454  36.667  163.289 1.00 10.00 ? 69  PRO D CB  1 
ATOM 9529  C CG  . PRO D 1 69  ? 42.053  35.266  163.360 1.00 10.00 ? 69  PRO D CG  1 
ATOM 9530  C CD  . PRO D 1 69  ? 43.456  35.524  163.008 1.00 10.00 ? 69  PRO D CD  1 
ATOM 9531  N N   . ALA D 1 70  ? 43.280  39.354  161.960 1.00 10.00 ? 70  ALA D N   1 
ATOM 9532  C CA  . ALA D 1 70  ? 43.428  40.811  161.981 1.00 10.00 ? 70  ALA D CA  1 
ATOM 9533  C C   . ALA D 1 70  ? 43.936  41.444  160.694 1.00 10.00 ? 70  ALA D C   1 
ATOM 9534  O O   . ALA D 1 70  ? 44.394  42.587  160.697 1.00 10.00 ? 70  ALA D O   1 
ATOM 9535  C CB  . ALA D 1 70  ? 44.325  41.223  163.141 1.00 10.00 ? 70  ALA D CB  1 
ATOM 9536  N N   . ASP D 1 71  ? 43.879  40.681  159.610 1.00 10.00 ? 71  ASP D N   1 
ATOM 9537  C CA  . ASP D 1 71  ? 44.274  41.142  158.272 1.00 10.00 ? 71  ASP D CA  1 
ATOM 9538  C C   . ASP D 1 71  ? 43.657  40.185  157.281 1.00 10.00 ? 71  ASP D C   1 
ATOM 9539  O O   . ASP D 1 71  ? 43.127  40.613  156.262 1.00 10.00 ? 71  ASP D O   1 
ATOM 9540  C CB  . ASP D 1 71  ? 45.777  41.137  158.058 1.00 10.00 ? 71  ASP D CB  1 
ATOM 9541  C CG  . ASP D 1 71  ? 46.203  42.156  157.041 1.00 10.00 ? 71  ASP D CG  1 
ATOM 9542  O OD1 . ASP D 1 71  ? 45.708  42.108  155.905 1.00 10.00 ? 71  ASP D OD1 1 
ATOM 9543  O OD2 . ASP D 1 71  ? 47.048  43.002  157.376 1.00 10.00 ? 71  ASP D OD2 1 
ATOM 9544  N N   . TYR D 1 72  ? 43.770  38.885  157.557 1.00 10.00 ? 72  TYR D N   1 
ATOM 9545  C CA  . TYR D 1 72  ? 43.130  37.886  156.676 1.00 10.00 ? 72  TYR D CA  1 
ATOM 9546  C C   . TYR D 1 72  ? 41.678  37.971  157.100 1.00 10.00 ? 72  TYR D C   1 
ATOM 9547  O O   . TYR D 1 72  ? 40.790  38.113  156.270 1.00 10.00 ? 72  TYR D O   1 
ATOM 9548  C CB  . TYR D 1 72  ? 43.633  36.417  156.887 1.00 10.00 ? 72  TYR D CB  1 
ATOM 9549  C CG  . TYR D 1 72  ? 42.503  35.379  157.060 1.00 10.00 ? 72  TYR D CG  1 
ATOM 9550  C CD1 . TYR D 1 72  ? 41.326  35.460  156.293 1.00 10.00 ? 72  TYR D CD1 1 
ATOM 9551  C CD2 . TYR D 1 72  ? 42.534  34.455  158.110 1.00 10.00 ? 72  TYR D CD2 1 
ATOM 9552  C CE1 . TYR D 1 72  ? 40.209  34.688  156.583 1.00 10.00 ? 72  TYR D CE1 1 
ATOM 9553  C CE2 . TYR D 1 72  ? 41.409  33.663  158.412 1.00 10.00 ? 72  TYR D CE2 1 
ATOM 9554  C CZ  . TYR D 1 72  ? 40.249  33.793  157.650 1.00 10.00 ? 72  TYR D CZ  1 
ATOM 9555  O OH  . TYR D 1 72  ? 39.120  33.068  157.980 1.00 10.00 ? 72  TYR D OH  1 
ATOM 9556  N N   . GLY D 1 73  ? 41.463  37.847  158.407 1.00 10.00 ? 73  GLY D N   1 
ATOM 9557  C CA  . GLY D 1 73  ? 40.138  37.913  158.993 1.00 10.00 ? 73  GLY D CA  1 
ATOM 9558  C C   . GLY D 1 73  ? 39.369  39.140  158.572 1.00 10.00 ? 73  GLY D C   1 
ATOM 9559  O O   . GLY D 1 73  ? 38.138  39.117  158.449 1.00 10.00 ? 73  GLY D O   1 
ATOM 9560  N N   . GLY D 1 74  ? 40.094  40.222  158.328 1.00 10.00 ? 74  GLY D N   1 
ATOM 9561  C CA  . GLY D 1 74  ? 39.458  41.465  157.933 1.00 10.00 ? 74  GLY D CA  1 
ATOM 9562  C C   . GLY D 1 74  ? 38.722  41.317  156.622 1.00 10.00 ? 74  GLY D C   1 
ATOM 9563  O O   . GLY D 1 74  ? 37.525  41.585  156.530 1.00 10.00 ? 74  GLY D O   1 
ATOM 9564  N N   . ILE D 1 75  ? 39.449  40.877  155.603 1.00 10.00 ? 75  ILE D N   1 
ATOM 9565  C CA  . ILE D 1 75  ? 38.876  40.685  154.280 1.00 10.00 ? 75  ILE D CA  1 
ATOM 9566  C C   . ILE D 1 75  ? 39.729  39.782  153.389 1.00 10.00 ? 75  ILE D C   1 
ATOM 9567  O O   . ILE D 1 75  ? 40.507  40.260  152.563 1.00 10.00 ? 75  ILE D O   1 
ATOM 9568  C CB  . ILE D 1 75  ? 38.670  42.040  153.548 1.00 10.00 ? 75  ILE D CB  1 
ATOM 9569  C CG1 . ILE D 1 75  ? 39.866  42.962  153.804 1.00 10.00 ? 75  ILE D CG1 1 
ATOM 9570  C CG2 . ILE D 1 75  ? 37.365  42.687  153.993 1.00 10.00 ? 75  ILE D CG2 1 
ATOM 9571  C CD1 . ILE D 1 75  ? 39.802  44.289  153.060 1.00 10.00 ? 75  ILE D CD1 1 
ATOM 9572  N N   . LYS D 1 76  ? 39.583  38.474  153.582 1.00 10.00 ? 76  LYS D N   1 
ATOM 9573  C CA  . LYS D 1 76  ? 40.289  37.472  152.791 1.00 10.00 ? 76  LYS D CA  1 
ATOM 9574  C C   . LYS D 1 76  ? 41.479  38.022  152.031 1.00 10.00 ? 76  LYS D C   1 
ATOM 9575  O O   . LYS D 1 76  ? 42.572  38.207  152.575 1.00 10.00 ? 76  LYS D O   1 
ATOM 9576  C CB  . LYS D 1 76  ? 39.310  36.832  151.791 1.00 10.00 ? 76  LYS D CB  1 
ATOM 9577  C CG  . LYS D 1 76  ? 38.996  35.383  152.064 1.00 10.00 ? 76  LYS D CG  1 
ATOM 9578  C CD  . LYS D 1 76  ? 38.675  34.732  150.779 1.00 10.00 ? 76  LYS D CD  1 
ATOM 9579  C CE  . LYS D 1 76  ? 39.836  34.910  149.793 1.00 10.00 ? 76  LYS D CE  1 
ATOM 9580  N NZ  . LYS D 1 76  ? 39.490  34.660  148.336 1.00 10.00 ? 76  LYS D NZ  1 
ATOM 9581  N N   . LYS D 1 77  ? 41.230  38.265  150.746 1.00 10.00 ? 77  LYS D N   1 
ATOM 9582  C CA  . LYS D 1 77  ? 42.236  38.785  149.833 1.00 10.00 ? 77  LYS D CA  1 
ATOM 9583  C C   . LYS D 1 77  ? 42.241  40.313  149.891 1.00 10.00 ? 77  LYS D C   1 
ATOM 9584  O O   . LYS D 1 77  ? 41.217  40.964  149.698 1.00 10.00 ? 77  LYS D O   1 
ATOM 9585  C CB  . LYS D 1 77  ? 41.952  38.319  148.396 1.00 10.00 ? 77  LYS D CB  1 
ATOM 9586  C CG  . LYS D 1 77  ? 40.624  38.806  147.826 1.00 10.00 ? 77  LYS D CG  1 
ATOM 9587  C CD  . LYS D 1 77  ? 40.473  38.379  146.367 1.00 10.00 ? 77  LYS D CD  1 
ATOM 9588  C CE  . LYS D 1 77  ? 41.591  38.991  145.485 1.00 10.00 ? 77  LYS D CE  1 
ATOM 9589  N NZ  . LYS D 1 77  ? 41.572  38.545  144.059 1.00 10.00 ? 77  LYS D NZ  1 
ATOM 9590  N N   . ILE D 1 78  ? 43.415  40.863  150.166 1.00 10.00 ? 78  ILE D N   1 
ATOM 9591  C CA  . ILE D 1 78  ? 43.603  42.292  150.245 1.00 10.00 ? 78  ILE D CA  1 
ATOM 9592  C C   . ILE D 1 78  ? 44.685  42.654  149.262 1.00 10.00 ? 78  ILE D C   1 
ATOM 9593  O O   . ILE D 1 78  ? 45.648  41.917  149.076 1.00 10.00 ? 78  ILE D O   1 
ATOM 9594  C CB  . ILE D 1 78  ? 44.049  42.698  151.615 1.00 10.00 ? 78  ILE D CB  1 
ATOM 9595  C CG1 . ILE D 1 78  ? 45.091  41.691  152.121 1.00 10.00 ? 78  ILE D CG1 1 
ATOM 9596  C CG2 . ILE D 1 78  ? 42.833  42.836  152.509 1.00 10.00 ? 78  ILE D CG2 1 
ATOM 9597  C CD1 . ILE D 1 78  ? 46.434  41.784  151.517 1.00 10.00 ? 78  ILE D CD1 1 
ATOM 9598  N N   . ARG D 1 79  ? 44.516  43.807  148.632 1.00 10.00 ? 79  ARG D N   1 
ATOM 9599  C CA  . ARG D 1 79  ? 45.476  44.241  147.640 1.00 10.00 ? 79  ARG D CA  1 
ATOM 9600  C C   . ARG D 1 79  ? 46.306  45.373  148.231 1.00 10.00 ? 79  ARG D C   1 
ATOM 9601  O O   . ARG D 1 79  ? 45.783  46.425  148.611 1.00 10.00 ? 79  ARG D O   1 
ATOM 9602  C CB  . ARG D 1 79  ? 44.729  44.677  146.380 1.00 10.00 ? 79  ARG D CB  1 
ATOM 9603  C CG  . ARG D 1 79  ? 43.558  43.783  146.053 1.00 10.00 ? 79  ARG D CG  1 
ATOM 9604  C CD  . ARG D 1 79  ? 42.320  44.582  146.160 1.00 10.00 ? 79  ARG D CD  1 
ATOM 9605  N NE  . ARG D 1 79  ? 41.992  45.161  144.854 1.00 10.00 ? 79  ARG D NE  1 
ATOM 9606  C CZ  . ARG D 1 79  ? 41.067  46.103  144.659 1.00 10.00 ? 79  ARG D CZ  1 
ATOM 9607  N NH1 . ARG D 1 79  ? 40.370  46.571  145.702 1.00 10.00 ? 79  ARG D NH1 1 
ATOM 9608  N NH2 . ARG D 1 79  ? 40.843  46.582  143.434 1.00 10.00 ? 79  ARG D NH2 1 
ATOM 9609  N N   . LEU D 1 80  ? 47.607  45.131  148.335 1.00 10.00 ? 80  LEU D N   1 
ATOM 9610  C CA  . LEU D 1 80  ? 48.527  46.118  148.900 1.00 10.00 ? 80  LEU D CA  1 
ATOM 9611  C C   . LEU D 1 80  ? 49.216  46.952  147.839 1.00 10.00 ? 80  LEU D C   1 
ATOM 9612  O O   . LEU D 1 80  ? 49.409  46.512  146.704 1.00 10.00 ? 80  LEU D O   1 
ATOM 9613  C CB  . LEU D 1 80  ? 49.601  45.434  149.757 1.00 10.00 ? 80  LEU D CB  1 
ATOM 9614  C CG  . LEU D 1 80  ? 49.541  45.523  151.266 1.00 10.00 ? 80  LEU D CG  1 
ATOM 9615  C CD1 . LEU D 1 80  ? 48.084  45.569  151.723 1.00 10.00 ? 80  LEU D CD1 1 
ATOM 9616  C CD2 . LEU D 1 80  ? 50.326  44.326  151.828 1.00 10.00 ? 80  LEU D CD2 1 
ATOM 9617  N N   . PRO D 1 81  ? 49.609  48.179  148.201 1.00 10.00 ? 81  PRO D N   1 
ATOM 9618  C CA  . PRO D 1 81  ? 50.285  49.030  147.217 1.00 10.00 ? 81  PRO D CA  1 
ATOM 9619  C C   . PRO D 1 81  ? 51.604  48.359  146.864 1.00 10.00 ? 81  PRO D C   1 
ATOM 9620  O O   . PRO D 1 81  ? 52.290  47.823  147.736 1.00 10.00 ? 81  PRO D O   1 
ATOM 9621  C CB  . PRO D 1 81  ? 50.467  50.345  147.969 1.00 10.00 ? 81  PRO D CB  1 
ATOM 9622  C CG  . PRO D 1 81  ? 50.650  49.892  149.391 1.00 10.00 ? 81  PRO D CG  1 
ATOM 9623  C CD  . PRO D 1 81  ? 49.590  48.818  149.531 1.00 10.00 ? 81  PRO D CD  1 
ATOM 9624  N N   . SER D 1 82  ? 51.953  48.374  145.589 1.00 10.00 ? 82  SER D N   1 
ATOM 9625  C CA  . SER D 1 82  ? 53.183  47.730  145.157 1.00 10.00 ? 82  SER D CA  1 
ATOM 9626  C C   . SER D 1 82  ? 54.473  48.105  145.850 1.00 10.00 ? 82  SER D C   1 
ATOM 9627  O O   . SER D 1 82  ? 55.408  47.313  145.889 1.00 10.00 ? 82  SER D O   1 
ATOM 9628  C CB  . SER D 1 82  ? 53.377  47.959  143.665 1.00 10.00 ? 82  SER D CB  1 
ATOM 9629  O OG  . SER D 1 82  ? 52.264  47.511  142.908 1.00 10.00 ? 82  SER D OG  1 
ATOM 9630  N N   . ASP D 1 83  ? 54.542  49.344  146.335 1.00 10.00 ? 83  ASP D N   1 
ATOM 9631  C CA  . ASP D 1 83  ? 55.762  49.863  147.006 1.00 10.00 ? 83  ASP D CA  1 
ATOM 9632  C C   . ASP D 1 83  ? 56.451  48.792  147.900 1.00 10.00 ? 83  ASP D C   1 
ATOM 9633  O O   . ASP D 1 83  ? 57.654  48.552  147.768 1.00 10.00 ? 83  ASP D O   1 
ATOM 9634  C CB  . ASP D 1 83  ? 55.483  51.182  147.842 1.00 10.00 ? 83  ASP D CB  1 
ATOM 9635  C CG  . ASP D 1 83  ? 54.767  52.264  147.043 1.00 10.00 ? 83  ASP D CG  1 
ATOM 9636  O OD1 . ASP D 1 83  ? 55.323  52.767  146.029 1.00 10.00 ? 83  ASP D OD1 1 
ATOM 9637  O OD2 . ASP D 1 83  ? 53.635  52.608  147.447 1.00 10.00 ? 83  ASP D OD2 1 
ATOM 9638  N N   . ASP D 1 84  ? 55.682  48.140  148.778 1.00 10.00 ? 84  ASP D N   1 
ATOM 9639  C CA  . ASP D 1 84  ? 56.166  47.129  149.704 1.00 10.00 ? 84  ASP D CA  1 
ATOM 9640  C C   . ASP D 1 84  ? 56.931  45.994  149.029 1.00 10.00 ? 84  ASP D C   1 
ATOM 9641  O O   . ASP D 1 84  ? 57.608  45.208  149.695 1.00 10.00 ? 84  ASP D O   1 
ATOM 9642  C CB  . ASP D 1 84  ? 54.973  46.565  150.489 1.00 10.00 ? 84  ASP D CB  1 
ATOM 9643  C CG  . ASP D 1 84  ? 53.969  47.646  150.888 1.00 10.00 ? 84  ASP D CG  1 
ATOM 9644  O OD1 . ASP D 1 84  ? 54.365  48.636  151.550 1.00 10.00 ? 84  ASP D OD1 1 
ATOM 9645  O OD2 . ASP D 1 84  ? 52.778  47.503  150.536 1.00 10.00 ? 84  ASP D OD2 1 
ATOM 9646  N N   . VAL D 1 85  ? 56.848  45.951  147.703 1.00 10.00 ? 85  VAL D N   1 
ATOM 9647  C CA  . VAL D 1 85  ? 57.472  44.883  146.883 1.00 10.00 ? 85  VAL D CA  1 
ATOM 9648  C C   . VAL D 1 85  ? 58.849  45.156  146.317 1.00 10.00 ? 85  VAL D C   1 
ATOM 9649  O O   . VAL D 1 85  ? 59.162  46.262  145.884 1.00 10.00 ? 85  VAL D O   1 
ATOM 9650  C CB  . VAL D 1 85  ? 56.590  44.452  145.621 1.00 10.00 ? 85  VAL D CB  1 
ATOM 9651  C CG1 . VAL D 1 85  ? 57.497  44.262  144.364 1.00 10.00 ? 85  VAL D CG1 1 
ATOM 9652  C CG2 . VAL D 1 85  ? 55.814  43.137  145.904 1.00 10.00 ? 85  VAL D CG2 1 
ATOM 9653  N N   . TRP D 1 86  ? 59.647  44.098  146.291 1.00 10.00 ? 86  TRP D N   1 
ATOM 9654  C CA  . TRP D 1 86  ? 60.988  44.138  145.731 1.00 10.00 ? 86  TRP D CA  1 
ATOM 9655  C C   . TRP D 1 86  ? 60.762  43.966  144.200 1.00 10.00 ? 86  TRP D C   1 
ATOM 9656  O O   . TRP D 1 86  ? 60.506  42.883  143.711 1.00 10.00 ? 86  TRP D O   1 
ATOM 9657  C CB  . TRP D 1 86  ? 61.825  42.987  146.357 1.00 10.00 ? 86  TRP D CB  1 
ATOM 9658  C CG  . TRP D 1 86  ? 61.802  41.723  145.599 1.00 10.00 ? 86  TRP D CG  1 
ATOM 9659  C CD1 . TRP D 1 86  ? 62.867  41.115  145.023 1.00 10.00 ? 86  TRP D CD1 1 
ATOM 9660  C CD2 . TRP D 1 86  ? 60.638  41.056  145.107 1.00 10.00 ? 86  TRP D CD2 1 
ATOM 9661  N NE1 . TRP D 1 86  ? 62.438  40.124  144.170 1.00 10.00 ? 86  TRP D NE1 1 
ATOM 9662  C CE2 . TRP D 1 86  ? 61.070  40.071  144.206 1.00 10.00 ? 86  TRP D CE2 1 
ATOM 9663  C CE3 . TRP D 1 86  ? 59.269  41.212  145.325 1.00 10.00 ? 86  TRP D CE3 1 
ATOM 9664  C CZ2 . TRP D 1 86  ? 60.174  39.242  143.523 1.00 10.00 ? 86  TRP D CZ2 1 
ATOM 9665  C CZ3 . TRP D 1 86  ? 58.384  40.391  144.640 1.00 10.00 ? 86  TRP D CZ3 1 
ATOM 9666  C CH2 . TRP D 1 86  ? 58.836  39.424  143.757 1.00 10.00 ? 86  TRP D CH2 1 
ATOM 9667  N N   . LEU D 1 87  ? 60.826  45.033  143.420 1.00 10.00 ? 87  LEU D N   1 
ATOM 9668  C CA  . LEU D 1 87  ? 60.567  44.869  141.991 1.00 10.00 ? 87  LEU D CA  1 
ATOM 9669  C C   . LEU D 1 87  ? 61.808  44.542  141.163 1.00 10.00 ? 87  LEU D C   1 
ATOM 9670  O O   . LEU D 1 87  ? 62.774  45.301  141.173 1.00 10.00 ? 87  LEU D O   1 
ATOM 9671  C CB  . LEU D 1 87  ? 59.884  46.123  141.435 1.00 10.00 ? 87  LEU D CB  1 
ATOM 9672  C CG  . LEU D 1 87  ? 59.308  46.015  140.019 1.00 10.00 ? 87  LEU D CG  1 
ATOM 9673  C CD1 . LEU D 1 87  ? 58.278  44.892  139.957 1.00 10.00 ? 87  LEU D CD1 1 
ATOM 9674  C CD2 . LEU D 1 87  ? 58.672  47.341  139.627 1.00 10.00 ? 87  LEU D CD2 1 
ATOM 9675  N N   . PRO D 1 88  ? 61.791  43.404  140.434 1.00 10.00 ? 88  PRO D N   1 
ATOM 9676  C CA  . PRO D 1 88  ? 62.915  42.985  139.600 1.00 10.00 ? 88  PRO D CA  1 
ATOM 9677  C C   . PRO D 1 88  ? 63.143  43.923  138.418 1.00 10.00 ? 88  PRO D C   1 
ATOM 9678  O O   . PRO D 1 88  ? 62.204  44.482  137.836 1.00 10.00 ? 88  PRO D O   1 
ATOM 9679  C CB  . PRO D 1 88  ? 62.506  41.584  139.160 1.00 10.00 ? 88  PRO D CB  1 
ATOM 9680  C CG  . PRO D 1 88  ? 61.019  41.703  139.049 1.00 10.00 ? 88  PRO D CG  1 
ATOM 9681  C CD  . PRO D 1 88  ? 60.669  42.456  140.312 1.00 10.00 ? 88  PRO D CD  1 
ATOM 9682  N N   . ASP D 1 89  ? 64.407  44.108  138.112 1.00 10.00 ? 89  ASP D N   1 
ATOM 9683  C CA  . ASP D 1 89  ? 64.740  44.892  136.943 1.00 10.00 ? 89  ASP D CA  1 
ATOM 9684  C C   . ASP D 1 89  ? 64.650  44.055  135.688 1.00 10.00 ? 89  ASP D C   1 
ATOM 9685  O O   . ASP D 1 89  ? 65.643  43.599  135.179 1.00 10.00 ? 89  ASP D O   1 
ATOM 9686  C CB  . ASP D 1 89  ? 66.167  45.402  137.009 1.00 10.00 ? 89  ASP D CB  1 
ATOM 9687  C CG  . ASP D 1 89  ? 67.078  44.322  137.549 1.00 10.00 ? 89  ASP D CG  1 
ATOM 9688  O OD1 . ASP D 1 89  ? 66.736  43.128  137.390 1.00 10.00 ? 89  ASP D OD1 1 
ATOM 9689  O OD2 . ASP D 1 89  ? 68.136  44.660  138.113 1.00 10.00 ? 89  ASP D OD2 1 
ATOM 9690  N N   . LEU D 1 90  ? 63.420  43.710  135.342 1.00 10.00 ? 90  LEU D N   1 
ATOM 9691  C CA  . LEU D 1 90  ? 63.283  42.819  134.195 1.00 10.00 ? 90  LEU D CA  1 
ATOM 9692  C C   . LEU D 1 90  ? 63.660  43.552  132.909 1.00 10.00 ? 90  LEU D C   1 
ATOM 9693  O O   . LEU D 1 90  ? 63.626  44.786  132.838 1.00 10.00 ? 90  LEU D O   1 
ATOM 9694  C CB  . LEU D 1 90  ? 61.860  42.210  134.124 1.00 10.00 ? 90  LEU D CB  1 
ATOM 9695  C CG  . LEU D 1 90  ? 61.630  41.094  135.170 1.00 10.00 ? 90  LEU D CG  1 
ATOM 9696  C CD1 . LEU D 1 90  ? 60.145  40.597  135.291 1.00 10.00 ? 90  LEU D CD1 1 
ATOM 9697  C CD2 . LEU D 1 90  ? 62.580  39.968  134.783 1.00 10.00 ? 90  LEU D CD2 1 
ATOM 9698  N N   . VAL D 1 91  ? 64.086  42.796  131.907 1.00 10.00 ? 91  VAL D N   1 
ATOM 9699  C CA  . VAL D 1 91  ? 64.455  43.416  130.650 1.00 10.00 ? 91  VAL D CA  1 
ATOM 9700  C C   . VAL D 1 91  ? 64.741  42.458  129.504 1.00 10.00 ? 91  VAL D C   1 
ATOM 9701  O O   . VAL D 1 91  ? 65.272  41.357  129.687 1.00 10.00 ? 91  VAL D O   1 
ATOM 9702  C CB  . VAL D 1 91  ? 65.655  44.397  130.837 1.00 10.00 ? 91  VAL D CB  1 
ATOM 9703  C CG1 . VAL D 1 91  ? 67.025  43.684  130.650 1.00 10.00 ? 91  VAL D CG1 1 
ATOM 9704  C CG2 . VAL D 1 91  ? 65.491  45.565  129.888 1.00 10.00 ? 91  VAL D CG2 1 
ATOM 9705  N N   . LEU D 1 92  ? 64.336  42.921  128.327 1.00 10.00 ? 92  LEU D N   1 
ATOM 9706  C CA  . LEU D 1 92  ? 64.465  42.265  127.031 1.00 10.00 ? 92  LEU D CA  1 
ATOM 9707  C C   . LEU D 1 92  ? 65.915  42.146  126.651 1.00 10.00 ? 92  LEU D C   1 
ATOM 9708  O O   . LEU D 1 92  ? 66.477  43.117  126.242 1.00 10.00 ? 92  LEU D O   1 
ATOM 9709  C CB  . LEU D 1 92  ? 63.754  43.093  125.994 1.00 10.00 ? 92  LEU D CB  1 
ATOM 9710  C CG  . LEU D 1 92  ? 62.269  43.354  126.267 1.00 10.00 ? 92  LEU D CG  1 
ATOM 9711  C CD1 . LEU D 1 92  ? 61.470  42.097  125.945 1.00 10.00 ? 92  LEU D CD1 1 
ATOM 9712  C CD2 . LEU D 1 92  ? 62.040  43.796  127.712 1.00 10.00 ? 92  LEU D CD2 1 
ATOM 9713  N N   . TYR D 1 93  ? 66.509  40.944  126.771 1.00 10.00 ? 93  TYR D N   1 
ATOM 9714  C CA  . TYR D 1 93  ? 67.935  40.796  126.467 1.00 10.00 ? 93  TYR D CA  1 
ATOM 9715  C C   . TYR D 1 93  ? 68.379  41.487  125.166 1.00 10.00 ? 93  TYR D C   1 
ATOM 9716  O O   . TYR D 1 93  ? 68.948  42.565  125.246 1.00 10.00 ? 93  TYR D O   1 
ATOM 9717  C CB  . TYR D 1 93  ? 68.322  39.316  126.517 1.00 10.00 ? 93  TYR D CB  1 
ATOM 9718  C CG  . TYR D 1 93  ? 68.096  38.711  127.899 1.00 10.00 ? 93  TYR D CG  1 
ATOM 9719  C CD1 . TYR D 1 93  ? 68.325  37.358  128.134 1.00 10.00 ? 93  TYR D CD1 1 
ATOM 9720  C CD2 . TYR D 1 93  ? 67.626  39.491  128.966 1.00 10.00 ? 93  TYR D CD2 1 
ATOM 9721  C CE1 . TYR D 1 93  ? 68.091  36.789  129.390 1.00 10.00 ? 93  TYR D CE1 1 
ATOM 9722  C CE2 . TYR D 1 93  ? 67.388  38.933  130.225 1.00 10.00 ? 93  TYR D CE2 1 
ATOM 9723  C CZ  . TYR D 1 93  ? 67.622  37.580  130.428 1.00 10.00 ? 93  TYR D CZ  1 
ATOM 9724  O OH  . TYR D 1 93  ? 67.382  37.012  131.659 1.00 10.00 ? 93  TYR D OH  1 
ATOM 9725  N N   . ASN D 1 94  ? 68.099  40.929  123.982 1.00 10.00 ? 94  ASN D N   1 
ATOM 9726  C CA  . ASN D 1 94  ? 68.515  41.566  122.740 1.00 10.00 ? 94  ASN D CA  1 
ATOM 9727  C C   . ASN D 1 94  ? 67.508  42.618  122.296 1.00 10.00 ? 94  ASN D C   1 
ATOM 9728  O O   . ASN D 1 94  ? 67.593  43.169  121.195 1.00 10.00 ? 94  ASN D O   1 
ATOM 9729  C CB  . ASN D 1 94  ? 68.713  40.519  121.643 1.00 10.00 ? 94  ASN D CB  1 
ATOM 9730  C CG  . ASN D 1 94  ? 67.403  39.953  121.135 1.00 10.00 ? 94  ASN D CG  1 
ATOM 9731  O OD1 . ASN D 1 94  ? 67.371  38.880  120.532 1.00 10.00 ? 94  ASN D OD1 1 
ATOM 9732  N ND2 . ASN D 1 94  ? 66.314  40.674  121.377 1.00 10.00 ? 94  ASN D ND2 1 
ATOM 9733  N N   . ASN D 1 95  ? 66.541  42.893  123.170 1.00 10.00 ? 95  ASN D N   1 
ATOM 9734  C CA  . ASN D 1 95  ? 65.501  43.889  122.916 1.00 10.00 ? 95  ASN D CA  1 
ATOM 9735  C C   . ASN D 1 95  ? 65.676  44.989  123.952 1.00 10.00 ? 95  ASN D C   1 
ATOM 9736  O O   . ASN D 1 95  ? 66.775  45.505  124.130 1.00 10.00 ? 95  ASN D O   1 
ATOM 9737  C CB  . ASN D 1 95  ? 64.103  43.277  123.073 1.00 10.00 ? 95  ASN D CB  1 
ATOM 9738  C CG  . ASN D 1 95  ? 63.779  42.255  122.006 1.00 10.00 ? 95  ASN D CG  1 
ATOM 9739  O OD1 . ASN D 1 95  ? 63.933  41.051  122.210 1.00 10.00 ? 95  ASN D OD1 1 
ATOM 9740  N ND2 . ASN D 1 95  ? 63.320  42.734  120.854 1.00 10.00 ? 95  ASN D ND2 1 
ATOM 9741  N N   . ALA D 1 96  ? 64.581  45.343  124.622 1.00 10.00 ? 96  ALA D N   1 
ATOM 9742  C CA  . ALA D 1 96  ? 64.599  46.362  125.683 1.00 10.00 ? 96  ALA D CA  1 
ATOM 9743  C C   . ALA D 1 96  ? 64.801  47.798  125.223 1.00 10.00 ? 96  ALA D C   1 
ATOM 9744  O O   . ALA D 1 96  ? 65.076  48.665  126.041 1.00 10.00 ? 96  ALA D O   1 
ATOM 9745  C CB  . ALA D 1 96  ? 65.665  46.011  126.721 1.00 10.00 ? 96  ALA D CB  1 
ATOM 9746  N N   . ASP D 1 97  ? 64.645  48.097  123.938 1.00 10.00 ? 97  ASP D N   1 
ATOM 9747  C CA  . ASP D 1 97  ? 64.864  49.412  123.389 1.00 10.00 ? 97  ASP D CA  1 
ATOM 9748  C C   . ASP D 1 97  ? 64.127  50.469  124.188 1.00 10.00 ? 97  ASP D C   1 
ATOM 9749  O O   . ASP D 1 97  ? 64.423  51.694  123.994 1.00 10.00 ? 97  ASP D O   1 
ATOM 9750  C CB  . ASP D 1 97  ? 64.431  49.470  121.928 1.00 10.00 ? 97  ASP D CB  1 
ATOM 9751  C CG  . ASP D 1 97  ? 64.853  50.763  121.259 1.00 10.00 ? 97  ASP D CG  1 
ATOM 9752  O OD1 . ASP D 1 97  ? 65.125  51.744  121.983 1.00 10.00 ? 97  ASP D OD1 1 
ATOM 9753  O OD2 . ASP D 1 97  ? 64.911  50.797  120.013 1.00 10.00 ? 97  ASP D OD2 1 
ATOM 9754  N N   . GLY D 1 98  ? 63.194  50.148  125.071 1.00 10.00 ? 98  GLY D N   1 
ATOM 9755  C CA  . GLY D 1 98  ? 62.472  51.162  125.835 1.00 10.00 ? 98  GLY D CA  1 
ATOM 9756  C C   . GLY D 1 98  ? 62.038  50.816  127.239 1.00 10.00 ? 98  GLY D C   1 
ATOM 9757  O O   . GLY D 1 98  ? 61.908  49.647  127.562 1.00 10.00 ? 98  GLY D O   1 
ATOM 9758  N N   . ASP D 1 99  ? 61.850  51.845  128.069 1.00 10.00 ? 99  ASP D N   1 
ATOM 9759  C CA  . ASP D 1 99  ? 61.393  51.664  129.468 1.00 10.00 ? 99  ASP D CA  1 
ATOM 9760  C C   . ASP D 1 99  ? 60.024  51.003  129.400 1.00 10.00 ? 99  ASP D C   1 
ATOM 9761  O O   . ASP D 1 99  ? 59.274  51.220  128.446 1.00 10.00 ? 99  ASP D O   1 
ATOM 9762  C CB  . ASP D 1 99  ? 61.151  52.999  130.257 1.00 10.00 ? 99  ASP D CB  1 
ATOM 9763  C CG  . ASP D 1 99  ? 62.423  53.832  130.495 1.00 10.00 ? 99  ASP D CG  1 
ATOM 9764  O OD1 . ASP D 1 99  ? 63.482  53.251  130.822 1.00 10.00 ? 99  ASP D OD1 1 
ATOM 9765  O OD2 . ASP D 1 99  ? 62.350  55.081  130.374 1.00 10.00 ? 99  ASP D OD2 1 
ATOM 9766  N N   . PHE D 1 100 ? 59.698  50.189  130.399 1.00 10.00 ? 100 PHE D N   1 
ATOM 9767  C CA  . PHE D 1 100 ? 58.368  49.607  130.450 1.00 10.00 ? 100 PHE D CA  1 
ATOM 9768  C C   . PHE D 1 100 ? 57.584  50.813  130.952 1.00 10.00 ? 100 PHE D C   1 
ATOM 9769  O O   . PHE D 1 100 ? 58.098  51.580  131.762 1.00 10.00 ? 100 PHE D O   1 
ATOM 9770  C CB  . PHE D 1 100 ? 58.292  48.469  131.474 1.00 10.00 ? 100 PHE D CB  1 
ATOM 9771  C CG  . PHE D 1 100 ? 58.947  47.191  131.023 1.00 10.00 ? 100 PHE D CG  1 
ATOM 9772  C CD1 . PHE D 1 100 ? 60.308  47.149  130.732 1.00 10.00 ? 100 PHE D CD1 1 
ATOM 9773  C CD2 . PHE D 1 100 ? 58.202  46.021  130.906 1.00 10.00 ? 100 PHE D CD2 1 
ATOM 9774  C CE1 . PHE D 1 100 ? 60.918  45.959  130.333 1.00 10.00 ? 100 PHE D CE1 1 
ATOM 9775  C CE2 . PHE D 1 100 ? 58.803  44.828  130.508 1.00 10.00 ? 100 PHE D CE2 1 
ATOM 9776  C CZ  . PHE D 1 100 ? 60.163  44.797  130.222 1.00 10.00 ? 100 PHE D CZ  1 
ATOM 9777  N N   . ALA D 1 101 ? 56.378  51.027  130.449 1.00 10.00 ? 101 ALA D N   1 
ATOM 9778  C CA  . ALA D 1 101 ? 55.625  52.174  130.920 1.00 10.00 ? 101 ALA D CA  1 
ATOM 9779  C C   . ALA D 1 101 ? 54.293  51.783  131.513 1.00 10.00 ? 101 ALA D C   1 
ATOM 9780  O O   . ALA D 1 101 ? 53.538  51.003  130.925 1.00 10.00 ? 101 ALA D O   1 
ATOM 9781  C CB  . ALA D 1 101 ? 55.430  53.191  129.786 1.00 10.00 ? 101 ALA D CB  1 
ATOM 9782  N N   . ILE D 1 102 ? 54.013  52.372  132.666 1.00 10.00 ? 102 ILE D N   1 
ATOM 9783  C CA  . ILE D 1 102 ? 52.790  52.144  133.436 1.00 10.00 ? 102 ILE D CA  1 
ATOM 9784  C C   . ILE D 1 102 ? 52.954  51.127  134.568 1.00 10.00 ? 102 ILE D C   1 
ATOM 9785  O O   . ILE D 1 102 ? 51.968  50.707  135.186 1.00 10.00 ? 102 ILE D O   1 
ATOM 9786  C CB  . ILE D 1 102 ? 51.595  51.679  132.555 1.00 10.00 ? 102 ILE D CB  1 
ATOM 9787  C CG1 . ILE D 1 102 ? 51.154  52.717  131.523 1.00 10.00 ? 102 ILE D CG1 1 
ATOM 9788  C CG2 . ILE D 1 102 ? 50.373  51.632  133.406 1.00 10.00 ? 102 ILE D CG2 1 
ATOM 9789  C CD1 . ILE D 1 102 ? 52.096  53.108  130.434 1.00 10.00 ? 102 ILE D CD1 1 
ATOM 9790  N N   . VAL D 1 103 ? 54.178  50.668  134.832 1.00 10.00 ? 103 VAL D N   1 
ATOM 9791  C CA  . VAL D 1 103 ? 54.373  49.661  135.893 1.00 10.00 ? 103 VAL D CA  1 
ATOM 9792  C C   . VAL D 1 103 ? 54.495  50.285  137.271 1.00 10.00 ? 103 VAL D C   1 
ATOM 9793  O O   . VAL D 1 103 ? 54.080  49.686  138.259 1.00 10.00 ? 103 VAL D O   1 
ATOM 9794  C CB  . VAL D 1 103 ? 55.645  48.748  135.677 1.00 10.00 ? 103 VAL D CB  1 
ATOM 9795  C CG1 . VAL D 1 103 ? 55.849  47.868  136.867 1.00 10.00 ? 103 VAL D CG1 1 
ATOM 9796  C CG2 . VAL D 1 103 ? 55.490  47.878  134.448 1.00 10.00 ? 103 VAL D CG2 1 
ATOM 9797  N N   . HIS D 1 104 ? 55.059  51.489  137.358 1.00 10.00 ? 104 HIS D N   1 
ATOM 9798  C CA  . HIS D 1 104 ? 55.271  52.162  138.636 1.00 10.00 ? 104 HIS D CA  1 
ATOM 9799  C C   . HIS D 1 104 ? 53.939  52.468  139.308 1.00 10.00 ? 104 HIS D C   1 
ATOM 9800  O O   . HIS D 1 104 ? 52.863  52.287  138.766 1.00 10.00 ? 104 HIS D O   1 
ATOM 9801  C CB  . HIS D 1 104 ? 56.033  53.491  138.445 1.00 10.00 ? 104 HIS D CB  1 
ATOM 9802  C CG  . HIS D 1 104 ? 57.435  53.325  137.807 1.00 10.00 ? 104 HIS D CG  1 
ATOM 9803  N ND1 . HIS D 1 104 ? 58.496  52.757  138.479 1.00 10.00 ? 104 HIS D ND1 1 
ATOM 9804  C CD2 . HIS D 1 104 ? 57.900  53.658  136.580 1.00 10.00 ? 104 HIS D CD2 1 
ATOM 9805  C CE1 . HIS D 1 104 ? 59.558  52.748  137.692 1.00 10.00 ? 104 HIS D CE1 1 
ATOM 9806  N NE2 . HIS D 1 104 ? 59.223  53.290  136.535 1.00 10.00 ? 104 HIS D NE2 1 
ATOM 9807  N N   . MET D 1 105 ? 54.021  52.889  140.573 1.00 10.00 ? 105 MET D N   1 
ATOM 9808  C CA  . MET D 1 105 ? 52.860  53.396  141.295 1.00 10.00 ? 105 MET D CA  1 
ATOM 9809  C C   . MET D 1 105 ? 51.647  52.496  141.089 1.00 10.00 ? 105 MET D C   1 
ATOM 9810  O O   . MET D 1 105 ? 50.560  53.066  140.884 1.00 10.00 ? 105 MET D O   1 
ATOM 9811  C CB  . MET D 1 105 ? 52.544  54.828  140.861 1.00 10.00 ? 105 MET D CB  1 
ATOM 9812  C CG  . MET D 1 105 ? 51.931  54.934  139.474 1.00 10.00 ? 105 MET D CG  1 
ATOM 9813  S SD  . MET D 1 105 ? 53.043  54.356  138.177 1.00 10.00 ? 105 MET D SD  1 
ATOM 9814  C CE  . MET D 1 105 ? 52.677  55.525  136.871 1.00 10.00 ? 105 MET D CE  1 
ATOM 9815  N N   . THR D 1 106 ? 51.685  51.156  141.215 1.00 10.00 ? 106 THR D N   1 
ATOM 9816  C CA  . THR D 1 106 ? 50.507  50.326  140.986 1.00 10.00 ? 106 THR D CA  1 
ATOM 9817  C C   . THR D 1 106 ? 50.035  49.463  142.159 1.00 10.00 ? 106 THR D C   1 
ATOM 9818  O O   . THR D 1 106 ? 50.570  49.556  143.258 1.00 10.00 ? 106 THR D O   1 
ATOM 9819  C CB  . THR D 1 106 ? 50.744  49.429  139.774 1.00 10.00 ? 106 THR D CB  1 
ATOM 9820  O OG1 . THR D 1 106 ? 51.460  50.169  138.769 1.00 10.00 ? 106 THR D OG1 1 
ATOM 9821  C CG2 . THR D 1 106 ? 49.427  48.964  139.207 1.00 10.00 ? 106 THR D CG2 1 
ATOM 9822  N N   . LYS D 1 107 ? 49.028  48.627  141.897 1.00 10.00 ? 107 LYS D N   1 
ATOM 9823  C CA  . LYS D 1 107 ? 48.419  47.738  142.884 1.00 10.00 ? 107 LYS D CA  1 
ATOM 9824  C C   . LYS D 1 107 ? 49.084  46.360  142.993 1.00 10.00 ? 107 LYS D C   1 
ATOM 9825  O O   . LYS D 1 107 ? 49.550  45.808  141.999 1.00 10.00 ? 107 LYS D O   1 
ATOM 9826  C CB  . LYS D 1 107 ? 46.931  47.568  142.544 1.00 10.00 ? 107 LYS D CB  1 
ATOM 9827  C CG  . LYS D 1 107 ? 46.563  47.965  141.100 1.00 10.00 ? 107 LYS D CG  1 
ATOM 9828  C CD  . LYS D 1 107 ? 46.643  49.482  140.897 1.00 10.00 ? 107 LYS D CD  1 
ATOM 9829  C CE  . LYS D 1 107 ? 46.453  49.870  139.446 1.00 10.00 ? 107 LYS D CE  1 
ATOM 9830  N NZ  . LYS D 1 107 ? 46.722  51.316  139.234 1.00 10.00 ? 107 LYS D NZ  1 
ATOM 9831  N N   . LEU D 1 108 ? 49.120  45.807  144.206 1.00 10.00 ? 108 LEU D N   1 
ATOM 9832  C CA  . LEU D 1 108 ? 49.710  44.498  144.434 1.00 10.00 ? 108 LEU D CA  1 
ATOM 9833  C C   . LEU D 1 108 ? 48.706  43.557  145.102 1.00 10.00 ? 108 LEU D C   1 
ATOM 9834  O O   . LEU D 1 108 ? 47.957  43.958  145.993 1.00 10.00 ? 108 LEU D O   1 
ATOM 9835  C CB  . LEU D 1 108 ? 50.967  44.649  145.271 1.00 10.00 ? 108 LEU D CB  1 
ATOM 9836  C CG  . LEU D 1 108 ? 51.362  43.457  146.103 1.00 10.00 ? 108 LEU D CG  1 
ATOM 9837  C CD1 . LEU D 1 108 ? 52.868  43.254  146.187 1.00 10.00 ? 108 LEU D CD1 1 
ATOM 9838  C CD2 . LEU D 1 108 ? 50.738  43.677  147.435 1.00 10.00 ? 108 LEU D CD2 1 
ATOM 9839  N N   . LEU D 1 109 ? 48.692  42.298  144.664 1.00 10.00 ? 109 LEU D N   1 
ATOM 9840  C CA  . LEU D 1 109 ? 47.733  41.311  145.171 1.00 10.00 ? 109 LEU D CA  1 
ATOM 9841  C C   . LEU D 1 109 ? 48.298  40.532  146.361 1.00 10.00 ? 109 LEU D C   1 
ATOM 9842  O O   . LEU D 1 109 ? 49.292  39.827  146.239 1.00 10.00 ? 109 LEU D O   1 
ATOM 9843  C CB  . LEU D 1 109 ? 47.324  40.337  144.061 1.00 10.00 ? 109 LEU D CB  1 
ATOM 9844  C CG  . LEU D 1 109 ? 46.650  40.947  142.829 1.00 10.00 ? 109 LEU D CG  1 
ATOM 9845  C CD1 . LEU D 1 109 ? 46.308  39.868  141.813 1.00 10.00 ? 109 LEU D CD1 1 
ATOM 9846  C CD2 . LEU D 1 109 ? 45.402  41.720  143.227 1.00 10.00 ? 109 LEU D CD2 1 
ATOM 9847  N N   . LEU D 1 110 ? 47.642  40.652  147.511 1.00 10.00 ? 110 LEU D N   1 
ATOM 9848  C CA  . LEU D 1 110 ? 48.101  39.873  148.659 1.00 10.00 ? 110 LEU D CA  1 
ATOM 9849  C C   . LEU D 1 110 ? 47.005  38.901  149.071 1.00 10.00 ? 110 LEU D C   1 
ATOM 9850  O O   . LEU D 1 110 ? 45.805  39.165  148.892 1.00 10.00 ? 110 LEU D O   1 
ATOM 9851  C CB  . LEU D 1 110 ? 48.517  40.772  149.841 1.00 10.00 ? 110 LEU D CB  1 
ATOM 9852  C CG  . LEU D 1 110 ? 48.850  40.136  151.215 1.00 10.00 ? 110 LEU D CG  1 
ATOM 9853  C CD1 . LEU D 1 110 ? 49.473  38.731  151.101 1.00 10.00 ? 110 LEU D CD1 1 
ATOM 9854  C CD2 . LEU D 1 110 ? 49.783  41.098  151.951 1.00 10.00 ? 110 LEU D CD2 1 
ATOM 9855  N N   . ASP D 1 111 ? 47.419  37.751  149.587 1.00 10.00 ? 111 ASP D N   1 
ATOM 9856  C CA  . ASP D 1 111 ? 46.446  36.765  150.007 1.00 10.00 ? 111 ASP D CA  1 
ATOM 9857  C C   . ASP D 1 111 ? 46.546  36.418  151.487 1.00 10.00 ? 111 ASP D C   1 
ATOM 9858  O O   . ASP D 1 111 ? 47.508  36.797  152.164 1.00 10.00 ? 111 ASP D O   1 
ATOM 9859  C CB  . ASP D 1 111 ? 46.552  35.550  149.087 1.00 10.00 ? 111 ASP D CB  1 
ATOM 9860  C CG  . ASP D 1 111 ? 46.264  35.910  147.617 1.00 10.00 ? 111 ASP D CG  1 
ATOM 9861  O OD1 . ASP D 1 111 ? 45.493  36.868  147.362 1.00 10.00 ? 111 ASP D OD1 1 
ATOM 9862  O OD2 . ASP D 1 111 ? 46.794  35.231  146.719 1.00 10.00 ? 111 ASP D OD2 1 
ATOM 9863  N N   . TYR D 1 112 ? 45.534  35.731  152.007 1.00 10.00 ? 112 TYR D N   1 
ATOM 9864  C CA  . TYR D 1 112 ? 45.539  35.394  153.428 1.00 10.00 ? 112 TYR D CA  1 
ATOM 9865  C C   . TYR D 1 112 ? 46.805  34.627  153.699 1.00 10.00 ? 112 TYR D C   1 
ATOM 9866  O O   . TYR D 1 112 ? 47.477  34.839  154.711 1.00 10.00 ? 112 TYR D O   1 
ATOM 9867  C CB  . TYR D 1 112 ? 44.314  34.557  153.833 1.00 10.00 ? 112 TYR D CB  1 
ATOM 9868  C CG  . TYR D 1 112 ? 43.674  33.731  152.740 1.00 10.00 ? 112 TYR D CG  1 
ATOM 9869  C CD1 . TYR D 1 112 ? 44.437  32.922  151.905 1.00 10.00 ? 112 TYR D CD1 1 
ATOM 9870  C CD2 . TYR D 1 112 ? 42.292  33.745  152.560 1.00 10.00 ? 112 TYR D CD2 1 
ATOM 9871  C CE1 . TYR D 1 112 ? 43.840  32.150  150.915 1.00 10.00 ? 112 TYR D CE1 1 
ATOM 9872  C CE2 . TYR D 1 112 ? 41.686  32.978  151.579 1.00 10.00 ? 112 TYR D CE2 1 
ATOM 9873  C CZ  . TYR D 1 112 ? 42.464  32.184  150.758 1.00 10.00 ? 112 TYR D CZ  1 
ATOM 9874  O OH  . TYR D 1 112 ? 41.868  31.431  149.774 1.00 10.00 ? 112 TYR D OH  1 
ATOM 9875  N N   . THR D 1 113 ? 47.112  33.761  152.741 1.00 10.00 ? 113 THR D N   1 
ATOM 9876  C CA  . THR D 1 113 ? 48.299  32.884  152.719 1.00 10.00 ? 113 THR D CA  1 
ATOM 9877  C C   . THR D 1 113 ? 49.524  33.773  152.569 1.00 10.00 ? 113 THR D C   1 
ATOM 9878  O O   . THR D 1 113 ? 50.297  34.002  153.503 1.00 10.00 ? 113 THR D O   1 
ATOM 9879  C CB  . THR D 1 113 ? 48.291  31.986  151.468 1.00 10.00 ? 113 THR D CB  1 
ATOM 9880  O OG1 . THR D 1 113 ? 47.216  31.048  151.554 1.00 10.00 ? 113 THR D OG1 1 
ATOM 9881  C CG2 . THR D 1 113 ? 49.614  31.272  151.315 1.00 10.00 ? 113 THR D CG2 1 
ATOM 9882  N N   . GLY D 1 114 ? 49.663  34.263  151.343 1.00 10.00 ? 114 GLY D N   1 
ATOM 9883  C CA  . GLY D 1 114 ? 50.753  35.127  150.965 1.00 10.00 ? 114 GLY D CA  1 
ATOM 9884  C C   . GLY D 1 114 ? 50.779  35.259  149.453 1.00 10.00 ? 114 GLY D C   1 
ATOM 9885  O O   . GLY D 1 114 ? 51.389  36.191  148.935 1.00 10.00 ? 114 GLY D O   1 
ATOM 9886  N N   . LYS D 1 115 ? 50.103  34.359  148.730 1.00 10.00 ? 115 LYS D N   1 
ATOM 9887  C CA  . LYS D 1 115 ? 50.135  34.443  147.280 1.00 10.00 ? 115 LYS D CA  1 
ATOM 9888  C C   . LYS D 1 115 ? 50.010  35.876  146.805 1.00 10.00 ? 115 LYS D C   1 
ATOM 9889  O O   . LYS D 1 115 ? 49.266  36.685  147.366 1.00 10.00 ? 115 LYS D O   1 
ATOM 9890  C CB  . LYS D 1 115 ? 49.024  33.629  146.643 1.00 10.00 ? 115 LYS D CB  1 
ATOM 9891  C CG  . LYS D 1 115 ? 48.978  33.811  145.154 1.00 10.00 ? 115 LYS D CG  1 
ATOM 9892  C CD  . LYS D 1 115 ? 47.567  33.755  144.639 1.00 10.00 ? 115 LYS D CD  1 
ATOM 9893  C CE  . LYS D 1 115 ? 47.345  34.835  143.611 1.00 10.00 ? 115 LYS D CE  1 
ATOM 9894  N NZ  . LYS D 1 115 ? 45.928  34.880  143.183 1.00 10.00 ? 115 LYS D NZ  1 
ATOM 9895  N N   . ILE D 1 116 ? 50.764  36.192  145.768 1.00 10.00 ? 116 ILE D N   1 
ATOM 9896  C CA  . ILE D 1 116 ? 50.718  37.525  145.212 1.00 10.00 ? 116 ILE D CA  1 
ATOM 9897  C C   . ILE D 1 116 ? 51.015  37.572  143.739 1.00 10.00 ? 116 ILE D C   1 
ATOM 9898  O O   . ILE D 1 116 ? 51.875  36.852  143.220 1.00 10.00 ? 116 ILE D O   1 
ATOM 9899  C CB  . ILE D 1 116 ? 51.684  38.440  145.897 1.00 10.00 ? 116 ILE D CB  1 
ATOM 9900  C CG1 . ILE D 1 116 ? 53.071  37.809  145.880 1.00 10.00 ? 116 ILE D CG1 1 
ATOM 9901  C CG2 . ILE D 1 116 ? 51.215  38.694  147.309 1.00 10.00 ? 116 ILE D CG2 1 
ATOM 9902  C CD1 . ILE D 1 116 ? 53.376  36.906  147.063 1.00 10.00 ? 116 ILE D CD1 1 
ATOM 9903  N N   . MET D 1 117 ? 50.288  38.462  143.086 1.00 10.00 ? 117 MET D N   1 
ATOM 9904  C CA  . MET D 1 117 ? 50.375  38.682  141.658 1.00 10.00 ? 117 MET D CA  1 
ATOM 9905  C C   . MET D 1 117 ? 50.175  40.171  141.429 1.00 10.00 ? 117 MET D C   1 
ATOM 9906  O O   . MET D 1 117 ? 49.650  40.876  142.292 1.00 10.00 ? 117 MET D O   1 
ATOM 9907  C CB  . MET D 1 117 ? 49.277  37.884  140.916 1.00 10.00 ? 117 MET D CB  1 
ATOM 9908  C CG  . MET D 1 117 ? 49.197  38.087  139.354 1.00 10.00 ? 117 MET D CG  1 
ATOM 9909  S SD  . MET D 1 117 ? 48.749  36.697  138.139 1.00 10.00 ? 117 MET D SD  1 
ATOM 9910  C CE  . MET D 1 117 ? 47.161  37.185  137.542 1.00 10.00 ? 117 MET D CE  1 
ATOM 9911  N N   . TRP D 1 118 ? 50.634  40.640  140.276 1.00 10.00 ? 118 TRP D N   1 
ATOM 9912  C CA  . TRP D 1 118 ? 50.484  42.019  139.866 1.00 10.00 ? 118 TRP D CA  1 
ATOM 9913  C C   . TRP D 1 118 ? 50.757  42.025  138.380 1.00 10.00 ? 118 TRP D C   1 
ATOM 9914  O O   . TRP D 1 118 ? 51.911  41.969  137.937 1.00 10.00 ? 118 TRP D O   1 
ATOM 9915  C CB  . TRP D 1 118 ? 51.455  42.932  140.648 1.00 10.00 ? 118 TRP D CB  1 
ATOM 9916  C CG  . TRP D 1 118 ? 51.975  44.203  139.950 1.00 10.00 ? 118 TRP D CG  1 
ATOM 9917  C CD1 . TRP D 1 118 ? 51.582  44.711  138.747 1.00 10.00 ? 118 TRP D CD1 1 
ATOM 9918  C CD2 . TRP D 1 118 ? 53.073  45.020  140.379 1.00 10.00 ? 118 TRP D CD2 1 
ATOM 9919  N NE1 . TRP D 1 118 ? 52.372  45.762  138.396 1.00 10.00 ? 118 TRP D NE1 1 
ATOM 9920  C CE2 . TRP D 1 118 ? 53.295  45.973  139.384 1.00 10.00 ? 118 TRP D CE2 1 
ATOM 9921  C CE3 . TRP D 1 118 ? 53.892  45.029  141.512 1.00 10.00 ? 118 TRP D CE3 1 
ATOM 9922  C CZ2 . TRP D 1 118 ? 54.307  46.926  139.481 1.00 10.00 ? 118 TRP D CZ2 1 
ATOM 9923  C CZ3 . TRP D 1 118 ? 54.889  45.966  141.610 1.00 10.00 ? 118 TRP D CZ3 1 
ATOM 9924  C CH2 . TRP D 1 118 ? 55.092  46.907  140.603 1.00 10.00 ? 118 TRP D CH2 1 
ATOM 9925  N N   . THR D 1 119 ? 49.682  42.103  137.602 1.00 10.00 ? 119 THR D N   1 
ATOM 9926  C CA  . THR D 1 119 ? 49.791  42.129  136.146 1.00 10.00 ? 119 THR D CA  1 
ATOM 9927  C C   . THR D 1 119 ? 49.744  43.593  135.706 1.00 10.00 ? 119 THR D C   1 
ATOM 9928  O O   . THR D 1 119 ? 48.673  44.217  135.676 1.00 10.00 ? 119 THR D O   1 
ATOM 9929  C CB  . THR D 1 119 ? 48.626  41.361  135.474 1.00 10.00 ? 119 THR D CB  1 
ATOM 9930  O OG1 . THR D 1 119 ? 47.374  41.927  135.884 1.00 10.00 ? 119 THR D OG1 1 
ATOM 9931  C CG2 . THR D 1 119 ? 48.660  39.893  135.861 1.00 10.00 ? 119 THR D CG2 1 
ATOM 9932  N N   . PRO D 1 120 ? 50.911  44.169  135.380 1.00 10.00 ? 120 PRO D N   1 
ATOM 9933  C CA  . PRO D 1 120 ? 50.956  45.564  134.948 1.00 10.00 ? 120 PRO D CA  1 
ATOM 9934  C C   . PRO D 1 120 ? 50.810  45.721  133.441 1.00 10.00 ? 120 PRO D C   1 
ATOM 9935  O O   . PRO D 1 120 ? 51.491  45.056  132.647 1.00 10.00 ? 120 PRO D O   1 
ATOM 9936  C CB  . PRO D 1 120 ? 52.319  45.991  135.388 1.00 10.00 ? 120 PRO D CB  1 
ATOM 9937  C CG  . PRO D 1 120 ? 53.123  44.727  134.928 1.00 10.00 ? 120 PRO D CG  1 
ATOM 9938  C CD  . PRO D 1 120 ? 52.235  43.551  135.258 1.00 10.00 ? 120 PRO D CD  1 
ATOM 9939  N N   . PRO D 1 121 ? 49.905  46.608  133.028 1.00 10.00 ? 121 PRO D N   1 
ATOM 9940  C CA  . PRO D 1 121 ? 49.636  46.901  131.617 1.00 10.00 ? 121 PRO D CA  1 
ATOM 9941  C C   . PRO D 1 121 ? 50.815  47.621  131.008 1.00 10.00 ? 121 PRO D C   1 
ATOM 9942  O O   . PRO D 1 121 ? 50.668  48.700  130.459 1.00 10.00 ? 121 PRO D O   1 
ATOM 9943  C CB  . PRO D 1 121 ? 48.395  47.787  131.677 1.00 10.00 ? 121 PRO D CB  1 
ATOM 9944  C CG  . PRO D 1 121 ? 48.577  48.513  132.926 1.00 10.00 ? 121 PRO D CG  1 
ATOM 9945  C CD  . PRO D 1 121 ? 49.095  47.485  133.896 1.00 10.00 ? 121 PRO D CD  1 
ATOM 9946  N N   . ALA D 1 122 ? 51.976  46.981  131.073 1.00 10.00 ? 122 ALA D N   1 
ATOM 9947  C CA  . ALA D 1 122 ? 53.208  47.568  130.587 1.00 10.00 ? 122 ALA D CA  1 
ATOM 9948  C C   . ALA D 1 122 ? 53.281  47.715  129.056 1.00 10.00 ? 122 ALA D C   1 
ATOM 9949  O O   . ALA D 1 122 ? 52.991  46.791  128.293 1.00 10.00 ? 122 ALA D O   1 
ATOM 9950  C CB  . ALA D 1 122 ? 54.426  46.775  131.142 1.00 10.00 ? 122 ALA D CB  1 
ATOM 9951  N N   . ILE D 1 123 ? 53.646  48.918  128.626 1.00 10.00 ? 123 ILE D N   1 
ATOM 9952  C CA  . ILE D 1 123 ? 53.791  49.255  127.223 1.00 10.00 ? 123 ILE D CA  1 
ATOM 9953  C C   . ILE D 1 123 ? 55.252  49.685  127.079 1.00 10.00 ? 123 ILE D C   1 
ATOM 9954  O O   . ILE D 1 123 ? 55.736  50.469  127.887 1.00 10.00 ? 123 ILE D O   1 
ATOM 9955  C CB  . ILE D 1 123 ? 52.874  50.457  126.839 1.00 10.00 ? 123 ILE D CB  1 
ATOM 9956  C CG1 . ILE D 1 123 ? 51.429  50.014  126.623 1.00 10.00 ? 123 ILE D CG1 1 
ATOM 9957  C CG2 . ILE D 1 123 ? 53.383  51.104  125.597 1.00 10.00 ? 123 ILE D CG2 1 
ATOM 9958  C CD1 . ILE D 1 123 ? 50.631  50.843  125.621 1.00 10.00 ? 123 ILE D CD1 1 
ATOM 9959  N N   . PHE D 1 124 ? 55.972  49.161  126.090 1.00 10.00 ? 124 PHE D N   1 
ATOM 9960  C CA  . PHE D 1 124 ? 57.362  49.589  125.912 1.00 10.00 ? 124 PHE D CA  1 
ATOM 9961  C C   . PHE D 1 124 ? 57.885  49.347  124.505 1.00 10.00 ? 124 PHE D C   1 
ATOM 9962  O O   . PHE D 1 124 ? 57.247  48.655  123.703 1.00 10.00 ? 124 PHE D O   1 
ATOM 9963  C CB  . PHE D 1 124 ? 58.303  48.984  127.007 1.00 10.00 ? 124 PHE D CB  1 
ATOM 9964  C CG  . PHE D 1 124 ? 58.746  47.542  126.785 1.00 10.00 ? 124 PHE D CG  1 
ATOM 9965  C CD1 . PHE D 1 124 ? 59.896  47.242  126.044 1.00 10.00 ? 124 PHE D CD1 1 
ATOM 9966  C CD2 . PHE D 1 124 ? 58.049  46.501  127.362 1.00 10.00 ? 124 PHE D CD2 1 
ATOM 9967  C CE1 . PHE D 1 124 ? 60.330  45.956  125.889 1.00 10.00 ? 124 PHE D CE1 1 
ATOM 9968  C CE2 . PHE D 1 124 ? 58.487  45.213  127.203 1.00 10.00 ? 124 PHE D CE2 1 
ATOM 9969  C CZ  . PHE D 1 124 ? 59.627  44.953  126.464 1.00 10.00 ? 124 PHE D CZ  1 
ATOM 9970  N N   . LYS D 1 125 ? 59.004  49.992  124.188 1.00 10.00 ? 125 LYS D N   1 
ATOM 9971  C CA  . LYS D 1 125 ? 59.634  49.848  122.877 1.00 10.00 ? 125 LYS D CA  1 
ATOM 9972  C C   . LYS D 1 125 ? 60.663  48.729  122.939 1.00 10.00 ? 125 LYS D C   1 
ATOM 9973  O O   . LYS D 1 125 ? 61.461  48.682  123.868 1.00 10.00 ? 125 LYS D O   1 
ATOM 9974  C CB  . LYS D 1 125 ? 60.345  51.136  122.476 1.00 10.00 ? 125 LYS D CB  1 
ATOM 9975  C CG  . LYS D 1 125 ? 60.646  51.225  120.997 1.00 10.00 ? 125 LYS D CG  1 
ATOM 9976  C CD  . LYS D 1 125 ? 61.748  52.257  120.655 1.00 10.00 ? 125 LYS D CD  1 
ATOM 9977  C CE  . LYS D 1 125 ? 62.061  52.356  119.124 1.00 10.00 ? 125 LYS D CE  1 
ATOM 9978  N NZ  . LYS D 1 125 ? 60.928  52.872  118.276 1.00 10.00 ? 125 LYS D NZ  1 
ATOM 9979  N N   . SER D 1 126 ? 60.651  47.859  121.930 1.00 10.00 ? 126 SER D N   1 
ATOM 9980  C CA  . SER D 1 126 ? 61.562  46.694  121.835 1.00 10.00 ? 126 SER D CA  1 
ATOM 9981  C C   . SER D 1 126 ? 62.397  46.698  120.598 1.00 10.00 ? 126 SER D C   1 
ATOM 9982  O O   . SER D 1 126 ? 62.010  47.242  119.588 1.00 10.00 ? 126 SER D O   1 
ATOM 9983  C CB  . SER D 1 126 ? 60.786  45.382  121.781 1.00 10.00 ? 126 SER D CB  1 
ATOM 9984  O OG  . SER D 1 126 ? 60.852  44.865  120.460 1.00 10.00 ? 126 SER D OG  1 
ATOM 9985  N N   . TYR D 1 127 ? 63.324  45.800  120.632 1.00 10.00 ? 127 TYR D N   1 
ATOM 9986  C CA  . TYR D 1 127 ? 64.370  45.725  119.634 1.00 10.00 ? 127 TYR D CA  1 
ATOM 9987  C C   . TYR D 1 127 ? 64.779  44.280  119.346 1.00 10.00 ? 127 TYR D C   1 
ATOM 9988  O O   . TYR D 1 127 ? 65.675  43.791  120.012 1.00 10.00 ? 127 TYR D O   1 
ATOM 9989  C CB  . TYR D 1 127 ? 65.591  46.483  120.151 1.00 10.00 ? 127 TYR D CB  1 
ATOM 9990  C CG  . TYR D 1 127 ? 66.777  46.582  119.214 1.00 10.00 ? 127 TYR D CG  1 
ATOM 9991  C CD1 . TYR D 1 127 ? 66.724  47.367  118.064 1.00 10.00 ? 127 TYR D CD1 1 
ATOM 9992  C CD2 . TYR D 1 127 ? 67.978  45.936  119.512 1.00 10.00 ? 127 TYR D CD2 1 
ATOM 9993  C CE1 . TYR D 1 127 ? 67.839  47.514  117.237 1.00 10.00 ? 127 TYR D CE1 1 
ATOM 9994  C CE2 . TYR D 1 127 ? 69.097  46.074  118.692 1.00 10.00 ? 127 TYR D CE2 1 
ATOM 9995  C CZ  . TYR D 1 127 ? 69.021  46.866  117.558 1.00 10.00 ? 127 TYR D CZ  1 
ATOM 9996  O OH  . TYR D 1 127 ? 70.126  47.014  116.749 1.00 10.00 ? 127 TYR D OH  1 
ATOM 9997  N N   . CYS D 1 128 ? 64.142  43.598  118.382 1.00 10.00 ? 128 CYS D N   1 
ATOM 9998  C CA  . CYS D 1 128 ? 64.564  42.237  118.070 1.00 10.00 ? 128 CYS D CA  1 
ATOM 9999  C C   . CYS D 1 128 ? 64.794  42.071  116.589 1.00 10.00 ? 128 CYS D C   1 
ATOM 10000 O O   . CYS D 1 128 ? 64.268  42.824  115.771 1.00 10.00 ? 128 CYS D O   1 
ATOM 10001 C CB  . CYS D 1 128 ? 63.597  41.139  118.600 1.00 10.00 ? 128 CYS D CB  1 
ATOM 10002 S SG  . CYS D 1 128 ? 61.856  40.958  118.045 1.00 10.00 ? 128 CYS D SG  1 
ATOM 10003 N N   . GLU D 1 129 ? 65.640  41.100  116.261 1.00 10.00 ? 129 GLU D N   1 
ATOM 10004 C CA  . GLU D 1 129 ? 65.962  40.806  114.871 1.00 10.00 ? 129 GLU D CA  1 
ATOM 10005 C C   . GLU D 1 129 ? 64.703  40.773  114.010 1.00 10.00 ? 129 GLU D C   1 
ATOM 10006 O O   . GLU D 1 129 ? 63.609  40.498  114.506 1.00 10.00 ? 129 GLU D O   1 
ATOM 10007 C CB  . GLU D 1 129 ? 66.716  39.480  114.764 1.00 10.00 ? 129 GLU D CB  1 
ATOM 10008 C CG  . GLU D 1 129 ? 68.036  39.455  115.517 1.00 10.00 ? 129 GLU D CG  1 
ATOM 10009 C CD  . GLU D 1 129 ? 69.014  40.500  115.014 1.00 10.00 ? 129 GLU D CD  1 
ATOM 10010 O OE1 . GLU D 1 129 ? 68.663  41.234  114.066 1.00 10.00 ? 129 GLU D OE1 1 
ATOM 10011 O OE2 . GLU D 1 129 ? 70.130  40.583  115.568 1.00 10.00 ? 129 GLU D OE2 1 
ATOM 10012 N N   . ILE D 1 130 ? 64.884  41.213  112.770 1.00 10.00 ? 130 ILE D N   1 
ATOM 10013 C CA  . ILE D 1 130 ? 63.878  41.001  111.754 1.00 10.00 ? 130 ILE D CA  1 
ATOM 10014 C C   . ILE D 1 130 ? 64.761  40.800  110.565 1.00 10.00 ? 130 ILE D C   1 
ATOM 10015 O O   . ILE D 1 130 ? 64.433  40.055  109.659 1.00 10.00 ? 130 ILE D O   1 
ATOM 10016 C CB  . ILE D 1 130 ? 62.998  42.259  111.486 1.00 10.00 ? 130 ILE D CB  1 
ATOM 10017 C CG1 . ILE D 1 130 ? 63.812  43.360  110.777 1.00 10.00 ? 130 ILE D CG1 1 
ATOM 10018 C CG2 . ILE D 1 130 ? 62.347  42.723  112.768 1.00 10.00 ? 130 ILE D CG2 1 
ATOM 10019 C CD1 . ILE D 1 130 ? 64.975  43.947  111.545 1.00 10.00 ? 130 ILE D CD1 1 
ATOM 10020 N N   . ILE D 1 131 ? 65.906  41.476  110.614 1.00 10.00 ? 131 ILE D N   1 
ATOM 10021 C CA  . ILE D 1 131 ? 66.902  41.433  109.558 1.00 10.00 ? 131 ILE D CA  1 
ATOM 10022 C C   . ILE D 1 131 ? 66.241  41.551  108.206 1.00 10.00 ? 131 ILE D C   1 
ATOM 10023 O O   . ILE D 1 131 ? 65.048  41.826  108.095 1.00 10.00 ? 131 ILE D O   1 
ATOM 10024 C CB  . ILE D 1 131 ? 67.701  40.104  109.591 1.00 10.00 ? 131 ILE D CB  1 
ATOM 10025 C CG1 . ILE D 1 131 ? 66.793  38.928  109.163 1.00 10.00 ? 131 ILE D CG1 1 
ATOM 10026 C CG2 . ILE D 1 131 ? 68.273  39.892  111.003 1.00 10.00 ? 131 ILE D CG2 1 
ATOM 10027 C CD1 . ILE D 1 131 ? 67.547  37.656  108.827 1.00 10.00 ? 131 ILE D CD1 1 
ATOM 10028 N N   . VAL D 1 132 ? 67.029  41.298  107.176 1.00 10.00 ? 132 VAL D N   1 
ATOM 10029 C CA  . VAL D 1 132 ? 66.521  41.346  105.825 1.00 10.00 ? 132 VAL D CA  1 
ATOM 10030 C C   . VAL D 1 132 ? 65.665  40.098  105.576 1.00 10.00 ? 132 VAL D C   1 
ATOM 10031 O O   . VAL D 1 132 ? 64.968  40.012  104.571 1.00 10.00 ? 132 VAL D O   1 
ATOM 10032 C CB  . VAL D 1 132 ? 67.687  41.435  104.803 1.00 10.00 ? 132 VAL D CB  1 
ATOM 10033 C CG1 . VAL D 1 132 ? 68.158  42.875  104.673 1.00 10.00 ? 132 VAL D CG1 1 
ATOM 10034 C CG2 . VAL D 1 132 ? 68.861  40.568  105.264 1.00 10.00 ? 132 VAL D CG2 1 
ATOM 10035 N N   . THR D 1 133 ? 65.700  39.139  106.502 1.00 10.00 ? 133 THR D N   1 
ATOM 10036 C CA  . THR D 1 133 ? 64.912  37.904  106.349 1.00 10.00 ? 133 THR D CA  1 
ATOM 10037 C C   . THR D 1 133 ? 63.623  37.933  107.184 1.00 10.00 ? 133 THR D C   1 
ATOM 10038 O O   . THR D 1 133 ? 63.021  36.892  107.439 1.00 10.00 ? 133 THR D O   1 
ATOM 10039 C CB  . THR D 1 133 ? 65.730  36.622  106.751 1.00 10.00 ? 133 THR D CB  1 
ATOM 10040 O OG1 . THR D 1 133 ? 67.074  36.735  106.263 1.00 10.00 ? 133 THR D OG1 1 
ATOM 10041 C CG2 . THR D 1 133 ? 65.084  35.335  106.161 1.00 10.00 ? 133 THR D CG2 1 
ATOM 10042 N N   . HIS D 1 134 ? 63.210  39.129  107.600 1.00 10.00 ? 134 HIS D N   1 
ATOM 10043 C CA  . HIS D 1 134 ? 62.000  39.330  108.392 1.00 10.00 ? 134 HIS D CA  1 
ATOM 10044 C C   . HIS D 1 134 ? 60.727  39.148  107.584 1.00 10.00 ? 134 HIS D C   1 
ATOM 10045 O O   . HIS D 1 134 ? 59.856  38.322  107.895 1.00 10.00 ? 134 HIS D O   1 
ATOM 10046 C CB  . HIS D 1 134 ? 61.957  40.758  108.983 1.00 10.00 ? 134 HIS D CB  1 
ATOM 10047 C CG  . HIS D 1 134 ? 60.626  41.126  109.561 1.00 10.00 ? 134 HIS D CG  1 
ATOM 10048 N ND1 . HIS D 1 134 ? 59.499  41.278  108.780 1.00 10.00 ? 134 HIS D ND1 1 
ATOM 10049 C CD2 . HIS D 1 134 ? 60.216  41.264  110.842 1.00 10.00 ? 134 HIS D CD2 1 
ATOM 10050 C CE1 . HIS D 1 134 ? 58.452  41.485  109.554 1.00 10.00 ? 134 HIS D CE1 1 
ATOM 10051 N NE2 . HIS D 1 134 ? 58.860  41.482  110.811 1.00 10.00 ? 134 HIS D NE2 1 
ATOM 10052 N N   . PHE D 1 135 ? 60.612  39.928  106.524 1.00 10.00 ? 135 PHE D N   1 
ATOM 10053 C CA  . PHE D 1 135 ? 59.367  39.866  105.783 1.00 10.00 ? 135 PHE D CA  1 
ATOM 10054 C C   . PHE D 1 135 ? 59.207  38.868  104.663 1.00 10.00 ? 135 PHE D C   1 
ATOM 10055 O O   . PHE D 1 135 ? 58.149  38.789  104.064 1.00 10.00 ? 135 PHE D O   1 
ATOM 10056 C CB  . PHE D 1 135 ? 58.965  41.286  105.339 1.00 10.00 ? 135 PHE D CB  1 
ATOM 10057 C CG  . PHE D 1 135 ? 59.528  41.733  104.013 1.00 10.00 ? 135 PHE D CG  1 
ATOM 10058 C CD1 . PHE D 1 135 ? 59.178  42.987  103.513 1.00 10.00 ? 135 PHE D CD1 1 
ATOM 10059 C CD2 . PHE D 1 135 ? 60.300  40.890  103.217 1.00 10.00 ? 135 PHE D CD2 1 
ATOM 10060 C CE1 . PHE D 1 135 ? 59.570  43.389  102.249 1.00 10.00 ? 135 PHE D CE1 1 
ATOM 10061 C CE2 . PHE D 1 135 ? 60.695  41.286  101.948 1.00 10.00 ? 135 PHE D CE2 1 
ATOM 10062 C CZ  . PHE D 1 135 ? 60.324  42.541  101.465 1.00 10.00 ? 135 PHE D CZ  1 
ATOM 10063 N N   . PRO D 1 136 ? 60.188  37.957  104.290 1.00 10.00 ? 136 PRO D N   1 
ATOM 10064 C CA  . PRO D 1 136 ? 59.809  36.959  103.292 1.00 10.00 ? 136 PRO D CA  1 
ATOM 10065 C C   . PRO D 1 136 ? 58.522  36.205  103.526 1.00 10.00 ? 136 PRO D C   1 
ATOM 10066 O O   . PRO D 1 136 ? 57.772  36.462  104.468 1.00 10.00 ? 136 PRO D O   1 
ATOM 10067 C CB  . PRO D 1 136 ? 61.045  36.121  103.108 1.00 10.00 ? 136 PRO D CB  1 
ATOM 10068 C CG  . PRO D 1 136 ? 62.142  36.725  103.961 1.00 10.00 ? 136 PRO D CG  1 
ATOM 10069 C CD  . PRO D 1 136 ? 61.570  37.864  104.770 1.00 10.00 ? 136 PRO D CD  1 
ATOM 10070 N N   . PHE D 1 137 ? 58.309  35.255  102.638 1.00 10.00 ? 137 PHE D N   1 
ATOM 10071 C CA  . PHE D 1 137 ? 57.156  34.430  102.577 1.00 10.00 ? 137 PHE D CA  1 
ATOM 10072 C C   . PHE D 1 137 ? 57.387  33.252  103.527 1.00 10.00 ? 137 PHE D C   1 
ATOM 10073 O O   . PHE D 1 137 ? 56.445  32.649  104.069 1.00 10.00 ? 137 PHE D O   1 
ATOM 10074 C CB  . PHE D 1 137 ? 57.027  34.049  101.109 1.00 10.00 ? 137 PHE D CB  1 
ATOM 10075 C CG  . PHE D 1 137 ? 56.893  35.237  100.188 1.00 10.00 ? 137 PHE D CG  1 
ATOM 10076 C CD1 . PHE D 1 137 ? 57.466  35.219  98.921  1.00 10.00 ? 137 PHE D CD1 1 
ATOM 10077 C CD2 . PHE D 1 137 ? 56.182  36.368  100.582 1.00 10.00 ? 137 PHE D CD2 1 
ATOM 10078 C CE1 . PHE D 1 137 ? 57.334  36.309  98.060  1.00 10.00 ? 137 PHE D CE1 1 
ATOM 10079 C CE2 . PHE D 1 137 ? 56.044  37.461  99.730  1.00 10.00 ? 137 PHE D CE2 1 
ATOM 10080 C CZ  . PHE D 1 137 ? 56.621  37.431  98.466  1.00 10.00 ? 137 PHE D CZ  1 
ATOM 10081 N N   . ASP D 1 138 ? 58.667  32.997  103.783 1.00 10.00 ? 138 ASP D N   1 
ATOM 10082 C CA  . ASP D 1 138 ? 59.116  31.916  104.648 1.00 10.00 ? 138 ASP D CA  1 
ATOM 10083 C C   . ASP D 1 138 ? 59.499  32.400  106.050 1.00 10.00 ? 138 ASP D C   1 
ATOM 10084 O O   . ASP D 1 138 ? 60.110  31.663  106.822 1.00 10.00 ? 138 ASP D O   1 
ATOM 10085 C CB  . ASP D 1 138 ? 60.281  31.152  103.992 1.00 10.00 ? 138 ASP D CB  1 
ATOM 10086 C CG  . ASP D 1 138 ? 61.311  32.089  103.356 1.00 10.00 ? 138 ASP D CG  1 
ATOM 10087 O OD1 . ASP D 1 138 ? 60.937  32.968  102.533 1.00 10.00 ? 138 ASP D OD1 1 
ATOM 10088 O OD2 . ASP D 1 138 ? 62.503  31.931  103.693 1.00 10.00 ? 138 ASP D OD2 1 
ATOM 10089 N N   . GLN D 1 139 ? 59.163  33.647  106.375 1.00 10.00 ? 139 GLN D N   1 
ATOM 10090 C CA  . GLN D 1 139 ? 59.396  34.138  107.726 1.00 10.00 ? 139 GLN D CA  1 
ATOM 10091 C C   . GLN D 1 139 ? 60.773  33.969  108.382 1.00 10.00 ? 139 GLN D C   1 
ATOM 10092 O O   . GLN D 1 139 ? 61.690  33.380  107.819 1.00 10.00 ? 139 GLN D O   1 
ATOM 10093 C CB  . GLN D 1 139 ? 58.328  33.512  108.666 1.00 10.00 ? 139 GLN D CB  1 
ATOM 10094 C CG  . GLN D 1 139 ? 58.137  31.974  108.575 1.00 10.00 ? 139 GLN D CG  1 
ATOM 10095 C CD  . GLN D 1 139 ? 56.983  31.562  107.666 1.00 10.00 ? 139 GLN D CD  1 
ATOM 10096 O OE1 . GLN D 1 139 ? 56.862  32.062  106.552 1.00 10.00 ? 139 GLN D OE1 1 
ATOM 10097 N NE2 . GLN D 1 139 ? 56.137  30.648  108.135 1.00 10.00 ? 139 GLN D NE2 1 
ATOM 10098 N N   . GLN D 1 140 ? 60.888  34.535  109.518 1.00 10.00 ? 140 GLN D N   1 
ATOM 10099 C CA  . GLN D 1 140 ? 61.962  34.453  110.499 1.00 10.00 ? 140 GLN D CA  1 
ATOM 10100 C C   . GLN D 1 140 ? 61.408  34.442  111.919 1.00 10.00 ? 140 GLN D C   1 
ATOM 10101 O O   . GLN D 1 140 ? 60.339  35.098  112.050 1.00 10.00 ? 140 GLN D O   1 
ATOM 10102 C CB  . GLN D 1 140 ? 62.944  35.611  110.318 1.00 10.00 ? 140 GLN D CB  1 
ATOM 10103 C CG  . GLN D 1 140 ? 64.217  35.480  111.139 1.00 10.00 ? 140 GLN D CG  1 
ATOM 10104 C CD  . GLN D 1 140 ? 65.130  34.385  110.625 1.00 10.00 ? 140 GLN D CD  1 
ATOM 10105 O OE1 . GLN D 1 140 ? 64.820  33.716  109.640 1.00 10.00 ? 140 GLN D OE1 1 
ATOM 10106 N NE2 . GLN D 1 140 ? 66.304  34.032  111.139 1.00 10.00 ? 140 GLN D NE2 1 
ATOM 10107 N N   . ASN D 1 141 ? 61.904  33.837  112.853 1.00 10.00 ? 141 ASN D N   1 
ATOM 10108 C CA  . ASN D 1 141 ? 61.384  33.856  114.218 1.00 10.00 ? 141 ASN D CA  1 
ATOM 10109 C C   . ASN D 1 141 ? 62.144  34.813  115.138 1.00 10.00 ? 141 ASN D C   1 
ATOM 10110 O O   . ASN D 1 141 ? 63.204  34.455  115.673 1.00 10.00 ? 141 ASN D O   1 
ATOM 10111 C CB  . ASN D 1 141 ? 61.454  32.453  114.816 1.00 10.00 ? 141 ASN D CB  1 
ATOM 10112 C CG  . ASN D 1 141 ? 62.836  31.845  114.706 1.00 10.00 ? 141 ASN D CG  1 
ATOM 10113 O OD1 . ASN D 1 141 ? 63.363  31.669  113.607 1.00 10.00 ? 141 ASN D OD1 1 
ATOM 10114 N ND2 . ASN D 1 141 ? 63.433  31.524  115.847 1.00 10.00 ? 141 ASN D ND2 1 
ATOM 10115 N N   . CYS D 1 142 ? 61.610  36.017  115.345 1.00 10.00 ? 142 CYS D N   1 
ATOM 10116 C CA  . CYS D 1 142 ? 62.283  36.970  116.233 1.00 10.00 ? 142 CYS D CA  1 
ATOM 10117 C C   . CYS D 1 142 ? 62.456  36.367  117.596 1.00 10.00 ? 142 CYS D C   1 
ATOM 10118 O O   . CYS D 1 142 ? 61.487  36.032  118.285 1.00 10.00 ? 142 CYS D O   1 
ATOM 10119 C CB  . CYS D 1 142 ? 61.519  38.288  116.413 1.00 10.00 ? 142 CYS D CB  1 
ATOM 10120 S SG  . CYS D 1 142 ? 61.452  38.948  118.144 1.00 10.00 ? 142 CYS D SG  1 
ATOM 10121 N N   . THR D 1 143 ? 63.721  36.252  117.958 1.00 10.00 ? 143 THR D N   1 
ATOM 10122 C CA  . THR D 1 143 ? 64.169  35.716  119.252 1.00 10.00 ? 143 THR D CA  1 
ATOM 10123 C C   . THR D 1 143 ? 64.072  36.809  120.284 1.00 10.00 ? 143 THR D C   1 
ATOM 10124 O O   . THR D 1 143 ? 64.801  37.796  120.215 1.00 10.00 ? 143 THR D O   1 
ATOM 10125 C CB  . THR D 1 143 ? 65.669  35.246  119.256 1.00 10.00 ? 143 THR D CB  1 
ATOM 10126 O OG1 . THR D 1 143 ? 66.155  35.234  120.614 1.00 10.00 ? 143 THR D OG1 1 
ATOM 10127 C CG2 . THR D 1 143 ? 66.557  36.161  118.380 1.00 10.00 ? 143 THR D CG2 1 
ATOM 10128 N N   . MET D 1 144 ? 63.085  36.588  121.177 1.00 10.00 ? 144 MET D N   1 
ATOM 10129 C CA  . MET D 1 144 ? 62.968  37.581  122.233 1.00 10.00 ? 144 MET D CA  1 
ATOM 10130 C C   . MET D 1 144 ? 63.125  36.959  123.629 1.00 10.00 ? 144 MET D C   1 
ATOM 10131 O O   . MET D 1 144 ? 62.228  36.265  124.136 1.00 10.00 ? 144 MET D O   1 
ATOM 10132 C CB  . MET D 1 144 ? 61.617  38.304  122.157 1.00 10.00 ? 144 MET D CB  1 
ATOM 10133 C CG  . MET D 1 144 ? 61.616  39.570  121.326 1.00 10.00 ? 144 MET D CG  1 
ATOM 10134 S SD  . MET D 1 144 ? 60.184  40.607  121.668 1.00 10.00 ? 144 MET D SD  1 
ATOM 10135 C CE  . MET D 1 144 ? 59.203  40.335  120.180 1.00 10.00 ? 144 MET D CE  1 
ATOM 10136 N N   . LYS D 1 145 ? 64.269  37.221  124.254 1.00 10.00 ? 145 LYS D N   1 
ATOM 10137 C CA  . LYS D 1 145 ? 64.530  36.687  125.600 1.00 10.00 ? 145 LYS D CA  1 
ATOM 10138 C C   . LYS D 1 145 ? 64.280  37.721  126.657 1.00 10.00 ? 145 LYS D C   1 
ATOM 10139 O O   . LYS D 1 145 ? 64.610  38.899  126.512 1.00 10.00 ? 145 LYS D O   1 
ATOM 10140 C CB  . LYS D 1 145 ? 65.971  36.226  125.724 1.00 10.00 ? 145 LYS D CB  1 
ATOM 10141 C CG  . LYS D 1 145 ? 66.174  34.805  126.095 1.00 10.00 ? 145 LYS D CG  1 
ATOM 10142 C CD  . LYS D 1 145 ? 67.546  34.414  125.596 1.00 10.00 ? 145 LYS D CD  1 
ATOM 10143 C CE  . LYS D 1 145 ? 68.165  33.314  126.390 1.00 10.00 ? 145 LYS D CE  1 
ATOM 10144 N NZ  . LYS D 1 145 ? 67.186  32.861  127.371 1.00 10.00 ? 145 LYS D NZ  1 
ATOM 10145 N N   . LEU D 1 146 ? 63.690  37.274  127.748 1.00 10.00 ? 146 LEU D N   1 
ATOM 10146 C CA  . LEU D 1 146 ? 63.408  38.188  128.819 1.00 10.00 ? 146 LEU D CA  1 
ATOM 10147 C C   . LEU D 1 146 ? 63.745  37.509  130.144 1.00 10.00 ? 146 LEU D C   1 
ATOM 10148 O O   . LEU D 1 146 ? 63.612  36.292  130.292 1.00 10.00 ? 146 LEU D O   1 
ATOM 10149 C CB  . LEU D 1 146 ? 61.941  38.634  128.712 1.00 10.00 ? 146 LEU D CB  1 
ATOM 10150 C CG  . LEU D 1 146 ? 61.582  39.415  127.413 1.00 10.00 ? 146 LEU D CG  1 
ATOM 10151 C CD1 . LEU D 1 146 ? 61.836  38.633  126.154 1.00 10.00 ? 146 LEU D CD1 1 
ATOM 10152 C CD2 . LEU D 1 146 ? 60.106  39.796  127.428 1.00 10.00 ? 146 LEU D CD2 1 
ATOM 10153 N N   . GLY D 1 147 ? 64.255  38.300  131.079 1.00 10.00 ? 147 GLY D N   1 
ATOM 10154 C CA  . GLY D 1 147 ? 64.615  37.786  132.387 1.00 10.00 ? 147 GLY D CA  1 
ATOM 10155 C C   . GLY D 1 147 ? 65.270  38.849  133.242 1.00 10.00 ? 147 GLY D C   1 
ATOM 10156 O O   . GLY D 1 147 ? 65.639  39.915  132.748 1.00 10.00 ? 147 GLY D O   1 
ATOM 10157 N N   . ILE D 1 148 ? 65.427  38.547  134.525 1.00 10.00 ? 148 ILE D N   1 
ATOM 10158 C CA  . ILE D 1 148 ? 66.011  39.484  135.487 1.00 10.00 ? 148 ILE D CA  1 
ATOM 10159 C C   . ILE D 1 148 ? 67.243  40.188  134.915 1.00 10.00 ? 148 ILE D C   1 
ATOM 10160 O O   . ILE D 1 148 ? 68.030  39.573  134.207 1.00 10.00 ? 148 ILE D O   1 
ATOM 10161 C CB  . ILE D 1 148 ? 66.397  38.742  136.800 1.00 10.00 ? 148 ILE D CB  1 
ATOM 10162 C CG1 . ILE D 1 148 ? 66.725  39.747  137.914 1.00 10.00 ? 148 ILE D CG1 1 
ATOM 10163 C CG2 . ILE D 1 148 ? 67.553  37.776  136.526 1.00 10.00 ? 148 ILE D CG2 1 
ATOM 10164 C CD1 . ILE D 1 148 ? 65.504  40.375  138.549 1.00 10.00 ? 148 ILE D CD1 1 
ATOM 10165 N N   . TRP D 1 149 ? 67.391  41.478  135.215 1.00 10.00 ? 149 TRP D N   1 
ATOM 10166 C CA  . TRP D 1 149 ? 68.528  42.273  134.740 1.00 10.00 ? 149 TRP D CA  1 
ATOM 10167 C C   . TRP D 1 149 ? 69.824  42.080  135.517 1.00 10.00 ? 149 TRP D C   1 
ATOM 10168 O O   . TRP D 1 149 ? 70.709  41.318  135.115 1.00 10.00 ? 149 TRP D O   1 
ATOM 10169 C CB  . TRP D 1 149 ? 68.147  43.772  134.728 1.00 10.00 ? 149 TRP D CB  1 
ATOM 10170 C CG  . TRP D 1 149 ? 69.194  44.805  135.203 1.00 10.00 ? 149 TRP D CG  1 
ATOM 10171 C CD1 . TRP D 1 149 ? 68.967  45.855  136.035 1.00 10.00 ? 149 TRP D CD1 1 
ATOM 10172 C CD2 . TRP D 1 149 ? 70.582  44.886  134.840 1.00 10.00 ? 149 TRP D CD2 1 
ATOM 10173 N NE1 . TRP D 1 149 ? 70.107  46.587  136.219 1.00 10.00 ? 149 TRP D NE1 1 
ATOM 10174 C CE2 . TRP D 1 149 ? 71.118  46.016  135.499 1.00 10.00 ? 149 TRP D CE2 1 
ATOM 10175 C CE3 . TRP D 1 149 ? 71.423  44.111  134.033 1.00 10.00 ? 149 TRP D CE3 1 
ATOM 10176 C CZ2 . TRP D 1 149 ? 72.457  46.392  135.377 1.00 10.00 ? 149 TRP D CZ2 1 
ATOM 10177 C CZ3 . TRP D 1 149 ? 72.752  44.474  133.916 1.00 10.00 ? 149 TRP D CZ3 1 
ATOM 10178 C CH2 . TRP D 1 149 ? 73.257  45.608  134.585 1.00 10.00 ? 149 TRP D CH2 1 
ATOM 10179 N N   . THR D 1 150 ? 69.931  42.781  136.637 1.00 10.00 ? 150 THR D N   1 
ATOM 10180 C CA  . THR D 1 150 ? 71.168  42.755  137.441 1.00 10.00 ? 150 THR D CA  1 
ATOM 10181 C C   . THR D 1 150 ? 71.268  41.778  138.583 1.00 10.00 ? 150 THR D C   1 
ATOM 10182 O O   . THR D 1 150 ? 72.193  41.871  139.379 1.00 10.00 ? 150 THR D O   1 
ATOM 10183 C CB  . THR D 1 150 ? 71.488  44.148  138.024 1.00 10.00 ? 150 THR D CB  1 
ATOM 10184 O OG1 . THR D 1 150 ? 72.783  44.131  138.636 1.00 10.00 ? 150 THR D OG1 1 
ATOM 10185 C CG2 . THR D 1 150 ? 70.451  44.544  139.056 1.00 10.00 ? 150 THR D CG2 1 
ATOM 10186 N N   . TYR D 1 151 ? 70.334  40.836  138.654 1.00 10.00 ? 151 TYR D N   1 
ATOM 10187 C CA  . TYR D 1 151 ? 70.338  39.840  139.726 1.00 10.00 ? 151 TYR D CA  1 
ATOM 10188 C C   . TYR D 1 151 ? 70.666  38.444  139.192 1.00 10.00 ? 151 TYR D C   1 
ATOM 10189 O O   . TYR D 1 151 ? 70.099  38.027  138.194 1.00 10.00 ? 151 TYR D O   1 
ATOM 10190 C CB  . TYR D 1 151 ? 68.969  39.792  140.411 1.00 10.00 ? 151 TYR D CB  1 
ATOM 10191 C CG  . TYR D 1 151 ? 68.528  41.071  141.098 1.00 10.00 ? 151 TYR D CG  1 
ATOM 10192 C CD1 . TYR D 1 151 ? 68.341  42.251  140.380 1.00 10.00 ? 151 TYR D CD1 1 
ATOM 10193 C CD2 . TYR D 1 151 ? 68.261  41.087  142.468 1.00 10.00 ? 151 TYR D CD2 1 
ATOM 10194 C CE1 . TYR D 1 151 ? 67.897  43.417  141.010 1.00 10.00 ? 151 TYR D CE1 1 
ATOM 10195 C CE2 . TYR D 1 151 ? 67.816  42.245  143.106 1.00 10.00 ? 151 TYR D CE2 1 
ATOM 10196 C CZ  . TYR D 1 151 ? 67.636  43.404  142.373 1.00 10.00 ? 151 TYR D CZ  1 
ATOM 10197 O OH  . TYR D 1 151 ? 67.191  44.544  143.004 1.00 10.00 ? 151 TYR D OH  1 
ATOM 10198 N N   . ASP D 1 152 ? 71.574  37.728  139.853 1.00 10.00 ? 152 ASP D N   1 
ATOM 10199 C CA  . ASP D 1 152 ? 71.935  36.383  139.429 1.00 10.00 ? 152 ASP D CA  1 
ATOM 10200 C C   . ASP D 1 152 ? 71.067  35.326  140.123 1.00 10.00 ? 152 ASP D C   1 
ATOM 10201 O O   . ASP D 1 152 ? 70.347  35.613  141.086 1.00 10.00 ? 152 ASP D O   1 
ATOM 10202 C CB  . ASP D 1 152 ? 73.408  36.120  139.737 1.00 10.00 ? 152 ASP D CB  1 
ATOM 10203 C CG  . ASP D 1 152 ? 74.201  37.397  139.902 1.00 10.00 ? 152 ASP D CG  1 
ATOM 10204 O OD1 . ASP D 1 152 ? 75.033  37.698  139.021 1.00 10.00 ? 152 ASP D OD1 1 
ATOM 10205 O OD2 . ASP D 1 152 ? 73.990  38.100  140.911 1.00 10.00 ? 152 ASP D OD2 1 
ATOM 10206 N N   . GLY D 1 153 ? 71.152  34.093  139.636 1.00 10.00 ? 153 GLY D N   1 
ATOM 10207 C CA  . GLY D 1 153 ? 70.373  33.012  140.210 1.00 10.00 ? 153 GLY D CA  1 
ATOM 10208 C C   . GLY D 1 153 ? 70.450  32.886  141.722 1.00 10.00 ? 153 GLY D C   1 
ATOM 10209 O O   . GLY D 1 153 ? 69.463  32.584  142.378 1.00 10.00 ? 153 GLY D O   1 
ATOM 10210 N N   . THR D 1 154 ? 71.620  33.108  142.297 1.00 10.00 ? 154 THR D N   1 
ATOM 10211 C CA  . THR D 1 154 ? 71.753  32.991  143.745 1.00 10.00 ? 154 THR D CA  1 
ATOM 10212 C C   . THR D 1 154 ? 70.771  33.841  144.556 1.00 10.00 ? 154 THR D C   1 
ATOM 10213 O O   . THR D 1 154 ? 70.743  33.742  145.787 1.00 10.00 ? 154 THR D O   1 
ATOM 10214 C CB  . THR D 1 154 ? 73.212  33.281  144.209 1.00 10.00 ? 154 THR D CB  1 
ATOM 10215 O OG1 . THR D 1 154 ? 74.041  33.559  143.071 1.00 10.00 ? 154 THR D OG1 1 
ATOM 10216 C CG2 . THR D 1 154 ? 73.782  32.052  144.953 1.00 10.00 ? 154 THR D CG2 1 
ATOM 10217 N N   . LYS D 1 155 ? 69.974  34.669  143.888 1.00 10.00 ? 155 LYS D N   1 
ATOM 10218 C CA  . LYS D 1 155 ? 69.009  35.465  144.594 1.00 10.00 ? 155 LYS D CA  1 
ATOM 10219 C C   . LYS D 1 155 ? 67.563  35.521  144.088 1.00 10.00 ? 155 LYS D C   1 
ATOM 10220 O O   . LYS D 1 155 ? 66.638  35.741  144.878 1.00 10.00 ? 155 LYS D O   1 
ATOM 10221 C CB  . LYS D 1 155 ? 69.541  36.898  144.750 1.00 10.00 ? 155 LYS D CB  1 
ATOM 10222 C CG  . LYS D 1 155 ? 70.738  37.068  145.692 1.00 10.00 ? 155 LYS D CG  1 
ATOM 10223 C CD  . LYS D 1 155 ? 70.554  36.279  146.984 1.00 10.00 ? 155 LYS D CD  1 
ATOM 10224 C CE  . LYS D 1 155 ? 71.887  35.881  147.590 1.00 10.00 ? 155 LYS D CE  1 
ATOM 10225 N NZ  . LYS D 1 155 ? 71.727  35.268  148.934 1.00 10.00 ? 155 LYS D NZ  1 
ATOM 10226 N N   . VAL D 1 156 ? 67.359  35.411  142.784 1.00 10.00 ? 156 VAL D N   1 
ATOM 10227 C CA  . VAL D 1 156 ? 65.996  35.456  142.231 1.00 10.00 ? 156 VAL D CA  1 
ATOM 10228 C C   . VAL D 1 156 ? 65.894  34.494  141.019 1.00 10.00 ? 156 VAL D C   1 
ATOM 10229 O O   . VAL D 1 156 ? 66.858  34.319  140.265 1.00 10.00 ? 156 VAL D O   1 
ATOM 10230 C CB  . VAL D 1 156 ? 65.532  36.970  141.850 1.00 10.00 ? 156 VAL D CB  1 
ATOM 10231 C CG1 . VAL D 1 156 ? 64.977  37.712  143.090 1.00 10.00 ? 156 VAL D CG1 1 
ATOM 10232 C CG2 . VAL D 1 156 ? 66.706  37.769  141.228 1.00 10.00 ? 156 VAL D CG2 1 
ATOM 10233 N N   . SER D 1 157 ? 64.746  33.829  140.869 1.00 10.00 ? 157 SER D N   1 
ATOM 10234 C CA  . SER D 1 157 ? 64.522  32.886  139.771 1.00 10.00 ? 157 SER D CA  1 
ATOM 10235 C C   . SER D 1 157 ? 63.145  33.058  139.123 1.00 10.00 ? 157 SER D C   1 
ATOM 10236 O O   . SER D 1 157 ? 62.143  33.198  139.821 1.00 10.00 ? 157 SER D O   1 
ATOM 10237 C CB  . SER D 1 157 ? 64.650  31.451  140.286 1.00 10.00 ? 157 SER D CB  1 
ATOM 10238 O OG  . SER D 1 157 ? 63.709  31.190  141.314 1.00 10.00 ? 157 SER D OG  1 
ATOM 10239 N N   . ILE D 1 158 ? 63.083  33.029  137.793 1.00 10.00 ? 158 ILE D N   1 
ATOM 10240 C CA  . ILE D 1 158 ? 61.779  33.189  137.114 1.00 10.00 ? 158 ILE D CA  1 
ATOM 10241 C C   . ILE D 1 158 ? 61.550  31.917  136.264 1.00 10.00 ? 158 ILE D C   1 
ATOM 10242 O O   . ILE D 1 158 ? 62.485  31.148  136.000 1.00 10.00 ? 158 ILE D O   1 
ATOM 10243 C CB  . ILE D 1 158 ? 61.656  34.534  136.166 1.00 10.00 ? 158 ILE D CB  1 
ATOM 10244 C CG1 . ILE D 1 158 ? 62.308  35.794  136.815 1.00 10.00 ? 158 ILE D CG1 1 
ATOM 10245 C CG2 . ILE D 1 158 ? 60.147  34.846  135.905 1.00 10.00 ? 158 ILE D CG2 1 
ATOM 10246 C CD1 . ILE D 1 158 ? 63.448  36.422  135.981 1.00 10.00 ? 158 ILE D CD1 1 
ATOM 10247 N N   . SER D 1 159 ? 60.303  31.656  135.887 1.00 10.00 ? 159 SER D N   1 
ATOM 10248 C CA  . SER D 1 159 ? 60.001  30.493  135.053 1.00 10.00 ? 159 SER D CA  1 
ATOM 10249 C C   . SER D 1 159 ? 58.701  30.774  134.276 1.00 10.00 ? 159 SER D C   1 
ATOM 10250 O O   . SER D 1 159 ? 57.821  31.520  134.736 1.00 10.00 ? 159 SER D O   1 
ATOM 10251 C CB  . SER D 1 159 ? 59.873  29.205  135.920 1.00 10.00 ? 159 SER D CB  1 
ATOM 10252 O OG  . SER D 1 159 ? 61.083  28.868  136.594 1.00 10.00 ? 159 SER D OG  1 
ATOM 10253 N N   . PRO D 1 160 ? 58.560  30.163  133.092 1.00 10.00 ? 160 PRO D N   1 
ATOM 10254 C CA  . PRO D 1 160 ? 57.380  30.345  132.249 1.00 10.00 ? 160 PRO D CA  1 
ATOM 10255 C C   . PRO D 1 160 ? 56.173  29.899  133.042 1.00 10.00 ? 160 PRO D C   1 
ATOM 10256 O O   . PRO D 1 160 ? 56.310  29.419  134.159 1.00 10.00 ? 160 PRO D O   1 
ATOM 10257 C CB  . PRO D 1 160 ? 57.669  29.437  131.061 1.00 10.00 ? 160 PRO D CB  1 
ATOM 10258 C CG  . PRO D 1 160 ? 58.368  28.294  131.704 1.00 10.00 ? 160 PRO D CG  1 
ATOM 10259 C CD  . PRO D 1 160 ? 59.330  28.988  132.649 1.00 10.00 ? 160 PRO D CD  1 
ATOM 10260 N N   . GLU D 1 161 ? 55.011  30.059  132.481 1.00 10.00 ? 161 GLU D N   1 
ATOM 10261 C CA  . GLU D 1 161 ? 53.809  29.645  133.195 1.00 10.00 ? 161 GLU D CA  1 
ATOM 10262 C C   . GLU D 1 161 ? 52.868  28.924  132.285 1.00 10.00 ? 161 GLU D C   1 
ATOM 10263 O O   . GLU D 1 161 ? 52.277  27.901  132.650 1.00 10.00 ? 161 GLU D O   1 
ATOM 10264 C CB  . GLU D 1 161 ? 53.119  30.855  133.827 1.00 10.00 ? 161 GLU D CB  1 
ATOM 10265 C CG  . GLU D 1 161 ? 52.478  31.788  132.808 1.00 10.00 ? 161 GLU D CG  1 
ATOM 10266 C CD  . GLU D 1 161 ? 51.579  32.826  133.467 1.00 10.00 ? 161 GLU D CD  1 
ATOM 10267 O OE1 . GLU D 1 161 ? 52.014  33.504  134.473 1.00 10.00 ? 161 GLU D OE1 1 
ATOM 10268 O OE2 . GLU D 1 161 ? 50.389  33.018  133.020 1.00 10.00 ? 161 GLU D OE2 1 
ATOM 10269 N N   . SER D 1 162 ? 52.746  29.456  131.118 1.00 10.00 ? 162 SER D N   1 
ATOM 10270 C CA  . SER D 1 162 ? 51.860  28.869  130.157 1.00 10.00 ? 162 SER D CA  1 
ATOM 10271 C C   . SER D 1 162 ? 52.215  29.301  128.770 1.00 10.00 ? 162 SER D C   1 
ATOM 10272 O O   . SER D 1 162 ? 52.835  30.357  128.559 1.00 10.00 ? 162 SER D O   1 
ATOM 10273 C CB  . SER D 1 162 ? 50.424  29.310  130.443 1.00 10.00 ? 162 SER D CB  1 
ATOM 10274 O OG  . SER D 1 162 ? 49.544  28.766  129.471 1.00 10.00 ? 162 SER D OG  1 
ATOM 10275 N N   . ASP D 1 163 ? 51.815  28.445  127.888 1.00 10.00 ? 163 ASP D N   1 
ATOM 10276 C CA  . ASP D 1 163 ? 51.939  28.719  126.501 1.00 10.00 ? 163 ASP D CA  1 
ATOM 10277 C C   . ASP D 1 163 ? 50.703  29.495  126.090 1.00 10.00 ? 163 ASP D C   1 
ATOM 10278 O O   . ASP D 1 163 ? 49.652  29.240  126.727 1.00 10.00 ? 163 ASP D O   1 
ATOM 10279 C CB  . ASP D 1 163 ? 52.046  27.441  125.683 1.00 10.00 ? 163 ASP D CB  1 
ATOM 10280 C CG  . ASP D 1 163 ? 52.312  27.741  124.210 1.00 10.00 ? 163 ASP D CG  1 
ATOM 10281 O OD1 . ASP D 1 163 ? 52.029  28.907  123.734 1.00 10.00 ? 163 ASP D OD1 1 
ATOM 10282 O OD2 . ASP D 1 163 ? 52.820  26.837  123.450 1.00 10.00 ? 163 ASP D OD2 1 
ATOM 10283 N N   . ARG D 1 164 ? 50.932  30.406  125.273 1.00 10.00 ? 164 ARG D N   1 
ATOM 10284 C CA  . ARG D 1 164 ? 49.880  31.310  124.792 1.00 10.00 ? 164 ARG D CA  1 
ATOM 10285 C C   . ARG D 1 164 ? 50.366  31.796  123.436 1.00 10.00 ? 164 ARG D C   1 
ATOM 10286 O O   . ARG D 1 164 ? 51.557  32.001  123.245 1.00 10.00 ? 164 ARG D O   1 
ATOM 10287 C CB  . ARG D 1 164 ? 49.684  32.474  125.780 1.00 10.00 ? 164 ARG D CB  1 
ATOM 10288 C CG  . ARG D 1 164 ? 50.896  32.779  126.668 1.00 10.00 ? 164 ARG D CG  1 
ATOM 10289 C CD  . ARG D 1 164 ? 51.737  33.910  126.105 1.00 10.00 ? 164 ARG D CD  1 
ATOM 10290 N NE  . ARG D 1 164 ? 50.977  35.155  126.085 1.00 10.00 ? 164 ARG D NE  1 
ATOM 10291 C CZ  . ARG D 1 164 ? 51.396  36.291  125.538 1.00 10.00 ? 164 ARG D CZ  1 
ATOM 10292 N NH1 . ARG D 1 164 ? 52.580  36.362  124.954 1.00 10.00 ? 164 ARG D NH1 1 
ATOM 10293 N NH2 . ARG D 1 164 ? 50.619  37.361  125.572 1.00 10.00 ? 164 ARG D NH2 1 
ATOM 10294 N N   . PRO D 1 165 ? 49.462  31.924  122.456 1.00 10.00 ? 165 PRO D N   1 
ATOM 10295 C CA  . PRO D 1 165 ? 50.015  32.387  121.186 1.00 10.00 ? 165 PRO D CA  1 
ATOM 10296 C C   . PRO D 1 165 ? 50.342  33.873  121.127 1.00 10.00 ? 165 PRO D C   1 
ATOM 10297 O O   . PRO D 1 165 ? 50.082  34.639  122.067 1.00 10.00 ? 165 PRO D O   1 
ATOM 10298 C CB  . PRO D 1 165 ? 48.953  31.961  120.169 1.00 10.00 ? 165 PRO D CB  1 
ATOM 10299 C CG  . PRO D 1 165 ? 47.706  32.071  120.933 1.00 10.00 ? 165 PRO D CG  1 
ATOM 10300 C CD  . PRO D 1 165 ? 48.074  31.473  122.288 1.00 10.00 ? 165 PRO D CD  1 
ATOM 10301 N N   . ASP D 1 166 ? 50.950  34.249  120.010 1.00 10.00 ? 166 ASP D N   1 
ATOM 10302 C CA  . ASP D 1 166 ? 51.361  35.603  119.733 1.00 10.00 ? 166 ASP D CA  1 
ATOM 10303 C C   . ASP D 1 166 ? 50.218  36.197  118.944 1.00 10.00 ? 166 ASP D C   1 
ATOM 10304 O O   . ASP D 1 166 ? 50.021  37.414  118.914 1.00 10.00 ? 166 ASP D O   1 
ATOM 10305 C CB  . ASP D 1 166 ? 52.608  35.574  118.877 1.00 10.00 ? 166 ASP D CB  1 
ATOM 10306 C CG  . ASP D 1 166 ? 53.448  36.782  119.064 1.00 10.00 ? 166 ASP D CG  1 
ATOM 10307 O OD1 . ASP D 1 166 ? 54.082  36.888  120.133 1.00 10.00 ? 166 ASP D OD1 1 
ATOM 10308 O OD2 . ASP D 1 166 ? 53.459  37.629  118.149 1.00 10.00 ? 166 ASP D OD2 1 
ATOM 10309 N N   . LEU D 1 167 ? 49.487  35.312  118.277 1.00 10.00 ? 167 LEU D N   1 
ATOM 10310 C CA  . LEU D 1 167 ? 48.331  35.711  117.470 1.00 10.00 ? 167 LEU D CA  1 
ATOM 10311 C C   . LEU D 1 167 ? 47.085  35.778  118.292 1.00 10.00 ? 167 LEU D C   1 
ATOM 10312 O O   . LEU D 1 167 ? 46.022  36.105  117.765 1.00 10.00 ? 167 LEU D O   1 
ATOM 10313 C CB  . LEU D 1 167 ? 48.043  34.753  116.309 1.00 10.00 ? 167 LEU D CB  1 
ATOM 10314 C CG  . LEU D 1 167 ? 49.021  34.702  115.159 1.00 10.00 ? 167 LEU D CG  1 
ATOM 10315 C CD1 . LEU D 1 167 ? 50.353  34.220  115.702 1.00 10.00 ? 167 LEU D CD1 1 
ATOM 10316 C CD2 . LEU D 1 167 ? 48.484  33.773  114.095 1.00 10.00 ? 167 LEU D CD2 1 
ATOM 10317 N N   . SER D 1 168 ? 47.212  35.428  119.563 1.00 10.00 ? 168 SER D N   1 
ATOM 10318 C CA  . SER D 1 168 ? 46.072  35.467  120.463 1.00 10.00 ? 168 SER D CA  1 
ATOM 10319 C C   . SER D 1 168 ? 45.492  36.883  120.428 1.00 10.00 ? 168 SER D C   1 
ATOM 10320 O O   . SER D 1 168 ? 44.281  37.103  120.582 1.00 10.00 ? 168 SER D O   1 
ATOM 10321 C CB  . SER D 1 168 ? 46.499  35.086  121.890 1.00 10.00 ? 168 SER D CB  1 
ATOM 10322 O OG  . SER D 1 168 ? 47.628  35.828  122.315 1.00 10.00 ? 168 SER D OG  1 
ATOM 10323 N N   . THR D 1 169 ? 46.372  37.832  120.236 1.00 10.00 ? 169 THR D N   1 
ATOM 10324 C CA  . THR D 1 169 ? 45.967  39.225  120.139 1.00 10.00 ? 169 THR D CA  1 
ATOM 10325 C C   . THR D 1 169 ? 46.832  39.975  119.140 1.00 10.00 ? 169 THR D C   1 
ATOM 10326 O O   . THR D 1 169 ? 47.197  41.127  119.311 1.00 10.00 ? 169 THR D O   1 
ATOM 10327 C CB  . THR D 1 169 ? 46.049  39.940  121.487 1.00 10.00 ? 169 THR D CB  1 
ATOM 10328 O OG1 . THR D 1 169 ? 45.182  39.297  122.427 1.00 10.00 ? 169 THR D OG1 1 
ATOM 10329 C CG2 . THR D 1 169 ? 45.653  41.402  121.338 1.00 10.00 ? 169 THR D CG2 1 
ATOM 10330 N N   . PHE D 1 170 ? 47.194  39.255  118.082 1.00 10.00 ? 170 PHE D N   1 
ATOM 10331 C CA  . PHE D 1 170 ? 48.016  39.901  117.084 1.00 10.00 ? 170 PHE D CA  1 
ATOM 10332 C C   . PHE D 1 170 ? 47.215  40.932  116.291 1.00 10.00 ? 170 PHE D C   1 
ATOM 10333 O O   . PHE D 1 170 ? 46.005  40.793  116.085 1.00 10.00 ? 170 PHE D O   1 
ATOM 10334 C CB  . PHE D 1 170 ? 48.622  38.870  116.137 1.00 10.00 ? 170 PHE D CB  1 
ATOM 10335 C CG  . PHE D 1 170 ? 48.684  39.325  114.719 1.00 10.00 ? 170 PHE D CG  1 
ATOM 10336 C CD1 . PHE D 1 170 ? 49.864  39.809  114.195 1.00 10.00 ? 170 PHE D CD1 1 
ATOM 10337 C CD2 . PHE D 1 170 ? 47.546  39.311  113.921 1.00 10.00 ? 170 PHE D CD2 1 
ATOM 10338 C CE1 . PHE D 1 170 ? 49.912  40.281  112.901 1.00 10.00 ? 170 PHE D CE1 1 
ATOM 10339 C CE2 . PHE D 1 170 ? 47.590  39.785  112.613 1.00 10.00 ? 170 PHE D CE2 1 
ATOM 10340 C CZ  . PHE D 1 170 ? 48.770  40.271  112.112 1.00 10.00 ? 170 PHE D CZ  1 
ATOM 10341 N N   . MET D 1 171 ? 47.929  41.975  115.875 1.00 10.00 ? 171 MET D N   1 
ATOM 10342 C CA  . MET D 1 171 ? 47.439  43.111  115.071 1.00 10.00 ? 171 MET D CA  1 
ATOM 10343 C C   . MET D 1 171 ? 46.838  42.680  113.752 1.00 10.00 ? 171 MET D C   1 
ATOM 10344 O O   . MET D 1 171 ? 47.574  42.190  112.919 1.00 10.00 ? 171 MET D O   1 
ATOM 10345 C CB  . MET D 1 171 ? 48.618  44.046  114.732 1.00 10.00 ? 171 MET D CB  1 
ATOM 10346 C CG  . MET D 1 171 ? 48.321  45.121  113.677 1.00 10.00 ? 171 MET D CG  1 
ATOM 10347 S SD  . MET D 1 171 ? 49.781  46.043  113.059 1.00 10.00 ? 171 MET D SD  1 
ATOM 10348 C CE  . MET D 1 171 ? 50.602  46.577  114.576 1.00 10.00 ? 171 MET D CE  1 
ATOM 10349 N N   . GLU D 1 172 ? 45.534  42.848  113.573 1.00 10.00 ? 172 GLU D N   1 
ATOM 10350 C CA  . GLU D 1 172 ? 44.929  42.509  112.292 1.00 10.00 ? 172 GLU D CA  1 
ATOM 10351 C C   . GLU D 1 172 ? 45.205  43.587  111.250 1.00 10.00 ? 172 GLU D C   1 
ATOM 10352 O O   . GLU D 1 172 ? 44.931  43.438  110.061 1.00 10.00 ? 172 GLU D O   1 
ATOM 10353 C CB  . GLU D 1 172 ? 43.424  42.291  112.452 1.00 10.00 ? 172 GLU D CB  1 
ATOM 10354 C CG  . GLU D 1 172 ? 43.059  41.168  113.408 1.00 10.00 ? 172 GLU D CG  1 
ATOM 10355 C CD  . GLU D 1 172 ? 41.560  40.987  113.551 1.00 10.00 ? 172 GLU D CD  1 
ATOM 10356 O OE1 . GLU D 1 172 ? 40.806  41.737  112.896 1.00 10.00 ? 172 GLU D OE1 1 
ATOM 10357 O OE2 . GLU D 1 172 ? 41.139  40.096  114.318 1.00 10.00 ? 172 GLU D OE2 1 
ATOM 10358 N N   . SER D 1 173 ? 45.757  44.711  111.723 1.00 10.00 ? 173 SER D N   1 
ATOM 10359 C CA  . SER D 1 173 ? 46.092  45.831  110.845 1.00 10.00 ? 173 SER D CA  1 
ATOM 10360 C C   . SER D 1 173 ? 47.583  45.782  110.526 1.00 10.00 ? 173 SER D C   1 
ATOM 10361 O O   . SER D 1 173 ? 48.155  46.751  110.025 1.00 10.00 ? 173 SER D O   1 
ATOM 10362 C CB  . SER D 1 173 ? 45.751  47.176  111.515 1.00 10.00 ? 173 SER D CB  1 
ATOM 10363 O OG  . SER D 1 173 ? 44.354  47.329  111.720 1.00 10.00 ? 173 SER D OG  1 
ATOM 10364 N N   . GLY D 1 174 ? 48.210  44.648  110.828 1.00 10.00 ? 174 GLY D N   1 
ATOM 10365 C CA  . GLY D 1 174 ? 49.630  44.502  110.561 1.00 10.00 ? 174 GLY D CA  1 
ATOM 10366 C C   . GLY D 1 174 ? 49.928  44.222  109.101 1.00 10.00 ? 174 GLY D C   1 
ATOM 10367 O O   . GLY D 1 174 ? 49.113  43.620  108.397 1.00 10.00 ? 174 GLY D O   1 
ATOM 10368 N N   . GLU D 1 175 ? 51.025  44.678  108.611 1.00 10.00 ? 175 GLU D N   1 
ATOM 10369 C CA  . GLU D 1 175 ? 51.568  44.533  107.259 1.00 10.00 ? 175 GLU D CA  1 
ATOM 10370 C C   . GLU D 1 175 ? 52.257  43.176  107.161 1.00 10.00 ? 175 GLU D C   1 
ATOM 10371 O O   . GLU D 1 175 ? 53.035  42.914  106.231 1.00 10.00 ? 175 GLU D O   1 
ATOM 10372 C CB  . GLU D 1 175 ? 52.605  45.641  107.016 1.00 10.00 ? 175 GLU D CB  1 
ATOM 10373 C CG  . GLU D 1 175 ? 52.153  47.003  107.547 1.00 10.00 ? 175 GLU D CG  1 
ATOM 10374 C CD  . GLU D 1 175 ? 50.896  47.501  106.847 1.00 10.00 ? 175 GLU D CD  1 
ATOM 10375 O OE1 . GLU D 1 175 ? 50.358  46.785  105.920 1.00 10.00 ? 175 GLU D OE1 1 
ATOM 10376 O OE2 . GLU D 1 175 ? 50.378  48.630  107.181 1.00 10.00 ? 175 GLU D OE2 1 
ATOM 10377 N N   . TRP D 1 176 ? 51.941  42.360  108.151 1.00 10.00 ? 176 TRP D N   1 
ATOM 10378 C CA  . TRP D 1 176 ? 52.482  41.006  108.265 1.00 10.00 ? 176 TRP D CA  1 
ATOM 10379 C C   . TRP D 1 176 ? 51.307  39.999  108.647 1.00 10.00 ? 176 TRP D C   1 
ATOM 10380 O O   . TRP D 1 176 ? 50.132  40.384  108.708 1.00 10.00 ? 176 TRP D O   1 
ATOM 10381 C CB  . TRP D 1 176 ? 53.521  40.942  109.415 1.00 10.00 ? 176 TRP D CB  1 
ATOM 10382 C CG  . TRP D 1 176 ? 53.000  41.211  110.851 1.00 10.00 ? 176 TRP D CG  1 
ATOM 10383 C CD1 . TRP D 1 176 ? 52.521  40.307  111.721 1.00 10.00 ? 176 TRP D CD1 1 
ATOM 10384 C CD2 . TRP D 1 176 ? 52.961  42.485  111.507 1.00 10.00 ? 176 TRP D CD2 1 
ATOM 10385 N NE1 . TRP D 1 176 ? 52.203  41.000  112.936 1.00 10.00 ? 176 TRP D NE1 1 
ATOM 10386 C CE2 . TRP D 1 176 ? 52.477  42.272  112.794 1.00 10.00 ? 176 TRP D CE2 1 
ATOM 10387 C CE3 . TRP D 1 176 ? 53.303  43.787  111.120 1.00 10.00 ? 176 TRP D CE3 1 
ATOM 10388 C CZ2 . TRP D 1 176 ? 52.334  43.295  113.743 1.00 10.00 ? 176 TRP D CZ2 1 
ATOM 10389 C CZ3 . TRP D 1 176 ? 53.142  44.814  112.078 1.00 10.00 ? 176 TRP D CZ3 1 
ATOM 10390 C CH2 . TRP D 1 176 ? 52.683  44.577  113.328 1.00 10.00 ? 176 TRP D CH2 1 
ATOM 10391 N N   . VAL D 1 177 ? 51.627  38.669  108.894 1.00 10.00 ? 177 VAL D N   1 
ATOM 10392 C CA  . VAL D 1 177 ? 50.737  37.642  109.426 1.00 10.00 ? 177 VAL D CA  1 
ATOM 10393 C C   . VAL D 1 177 ? 51.531  36.593  110.209 1.00 10.00 ? 177 VAL D C   1 
ATOM 10394 O O   . VAL D 1 177 ? 52.674  36.283  109.847 1.00 10.00 ? 177 VAL D O   1 
ATOM 10395 C CB  . VAL D 1 177 ? 49.921  36.975  108.301 1.00 10.00 ? 177 VAL D CB  1 
ATOM 10396 C CG1 . VAL D 1 177 ? 50.551  35.650  107.899 1.00 10.00 ? 177 VAL D CG1 1 
ATOM 10397 C CG2 . VAL D 1 177 ? 48.476  36.778  108.731 1.00 10.00 ? 177 VAL D CG2 1 
ATOM 10398 N N   . MET D 1 178 ? 50.944  36.063  111.262 1.00 10.00 ? 178 MET D N   1 
ATOM 10399 C CA  . MET D 1 178 ? 51.643  35.116  112.138 1.00 10.00 ? 178 MET D CA  1 
ATOM 10400 C C   . MET D 1 178 ? 51.378  33.670  111.736 1.00 10.00 ? 178 MET D C   1 
ATOM 10401 O O   . MET D 1 178 ? 50.401  33.331  111.073 1.00 10.00 ? 178 MET D O   1 
ATOM 10402 C CB  . MET D 1 178 ? 51.203  35.339  113.584 1.00 10.00 ? 178 MET D CB  1 
ATOM 10403 C CG  . MET D 1 178 ? 51.409  36.786  114.042 1.00 10.00 ? 178 MET D CG  1 
ATOM 10404 S SD  . MET D 1 178 ? 53.125  37.211  114.246 1.00 10.00 ? 178 MET D SD  1 
ATOM 10405 C CE  . MET D 1 178 ? 53.872  36.093  115.409 1.00 10.00 ? 178 MET D CE  1 
ATOM 10406 N N   . LYS D 1 179 ? 52.306  32.780  112.140 1.00 10.00 ? 179 LYS D N   1 
ATOM 10407 C CA  . LYS D 1 179 ? 52.143  31.366  111.879 1.00 10.00 ? 179 LYS D CA  1 
ATOM 10408 C C   . LYS D 1 179 ? 52.136  30.595  113.194 1.00 10.00 ? 179 LYS D C   1 
ATOM 10409 O O   . LYS D 1 179 ? 51.319  29.697  113.372 1.00 10.00 ? 179 LYS D O   1 
ATOM 10410 C CB  . LYS D 1 179 ? 53.262  30.834  110.972 1.00 10.00 ? 179 LYS D CB  1 
ATOM 10411 C CG  . LYS D 1 179 ? 53.204  31.343  109.534 1.00 10.00 ? 179 LYS D CG  1 
ATOM 10412 C CD  . LYS D 1 179 ? 52.094  30.666  108.736 1.00 10.00 ? 179 LYS D CD  1 
ATOM 10413 C CE  . LYS D 1 179 ? 51.898  31.321  107.373 1.00 10.00 ? 179 LYS D CE  1 
ATOM 10414 N NZ  . LYS D 1 179 ? 50.840  30.652  106.567 1.00 10.00 ? 179 LYS D NZ  1 
ATOM 10415 N N   . ASP D 1 180 ? 53.008  30.992  114.122 1.00 10.00 ? 180 ASP D N   1 
ATOM 10416 C CA  . ASP D 1 180 ? 53.177  30.313  115.396 1.00 10.00 ? 180 ASP D CA  1 
ATOM 10417 C C   . ASP D 1 180 ? 54.016  31.144  116.372 1.00 10.00 ? 180 ASP D C   1 
ATOM 10418 O O   . ASP D 1 180 ? 54.808  31.961  115.928 1.00 10.00 ? 180 ASP D O   1 
ATOM 10419 C CB  . ASP D 1 180 ? 53.867  28.933  115.153 1.00 10.00 ? 180 ASP D CB  1 
ATOM 10420 C CG  . ASP D 1 180 ? 54.951  28.966  114.028 1.00 10.00 ? 180 ASP D CG  1 
ATOM 10421 O OD1 . ASP D 1 180 ? 54.634  29.307  112.873 1.00 10.00 ? 180 ASP D OD1 1 
ATOM 10422 O OD2 . ASP D 1 180 ? 56.116  28.626  114.293 1.00 10.00 ? 180 ASP D OD2 1 
ATOM 10423 N N   . TYR D 1 181 ? 53.829  30.929  117.682 1.00 10.00 ? 181 TYR D N   1 
ATOM 10424 C CA  . TYR D 1 181 ? 54.599  31.611  118.734 1.00 10.00 ? 181 TYR D CA  1 
ATOM 10425 C C   . TYR D 1 181 ? 54.787  30.683  119.946 1.00 10.00 ? 181 TYR D C   1 
ATOM 10426 O O   . TYR D 1 181 ? 53.812  30.344  120.624 1.00 10.00 ? 181 TYR D O   1 
ATOM 10427 C CB  . TYR D 1 181 ? 53.874  32.880  119.184 1.00 10.00 ? 181 TYR D CB  1 
ATOM 10428 C CG  . TYR D 1 181 ? 54.344  33.426  120.516 1.00 10.00 ? 181 TYR D CG  1 
ATOM 10429 C CD1 . TYR D 1 181 ? 55.644  33.902  120.681 1.00 10.00 ? 181 TYR D CD1 1 
ATOM 10430 C CD2 . TYR D 1 181 ? 53.489  33.453  121.618 1.00 10.00 ? 181 TYR D CD2 1 
ATOM 10431 C CE1 . TYR D 1 181 ? 56.082  34.391  121.912 1.00 10.00 ? 181 TYR D CE1 1 
ATOM 10432 C CE2 . TYR D 1 181 ? 53.916  33.939  122.852 1.00 10.00 ? 181 TYR D CE2 1 
ATOM 10433 C CZ  . TYR D 1 181 ? 55.213  34.405  122.992 1.00 10.00 ? 181 TYR D CZ  1 
ATOM 10434 O OH  . TYR D 1 181 ? 55.640  34.880  124.211 1.00 10.00 ? 181 TYR D OH  1 
ATOM 10435 N N   . ARG D 1 182 ? 56.041  30.347  120.230 1.00 10.00 ? 182 ARG D N   1 
ATOM 10436 C CA  . ARG D 1 182 ? 56.453  29.436  121.292 1.00 10.00 ? 182 ARG D CA  1 
ATOM 10437 C C   . ARG D 1 182 ? 57.305  30.114  122.369 1.00 10.00 ? 182 ARG D C   1 
ATOM 10438 O O   . ARG D 1 182 ? 58.109  30.999  122.070 1.00 10.00 ? 182 ARG D O   1 
ATOM 10439 C CB  . ARG D 1 182 ? 57.302  28.320  120.668 1.00 10.00 ? 182 ARG D CB  1 
ATOM 10440 C CG  . ARG D 1 182 ? 58.508  28.855  119.839 1.00 10.00 ? 182 ARG D CG  1 
ATOM 10441 C CD  . ARG D 1 182 ? 59.641  27.837  119.626 1.00 10.00 ? 182 ARG D CD  1 
ATOM 10442 N NE  . ARG D 1 182 ? 60.855  28.478  119.105 1.00 10.00 ? 182 ARG D NE  1 
ATOM 10443 C CZ  . ARG D 1 182 ? 61.002  28.977  117.872 1.00 10.00 ? 182 ARG D CZ  1 
ATOM 10444 N NH1 . ARG D 1 182 ? 60.009  28.914  116.997 1.00 10.00 ? 182 ARG D NH1 1 
ATOM 10445 N NH2 . ARG D 1 182 ? 62.149  29.551  117.516 1.00 10.00 ? 182 ARG D NH2 1 
ATOM 10446 N N   . GLY D 1 183 ? 57.159  29.703  123.621 1.00 10.00 ? 183 GLY D N   1 
ATOM 10447 C CA  . GLY D 1 183 ? 57.994  30.287  124.650 1.00 10.00 ? 183 GLY D CA  1 
ATOM 10448 C C   . GLY D 1 183 ? 58.470  29.276  125.663 1.00 10.00 ? 183 GLY D C   1 
ATOM 10449 O O   . GLY D 1 183 ? 57.665  28.759  126.440 1.00 10.00 ? 183 GLY D O   1 
ATOM 10450 N N   . TRP D 1 184 ? 59.754  28.933  125.656 1.00 10.00 ? 184 TRP D N   1 
ATOM 10451 C CA  . TRP D 1 184 ? 60.185  28.000  126.688 1.00 10.00 ? 184 TRP D CA  1 
ATOM 10452 C C   . TRP D 1 184 ? 61.242  28.643  127.603 1.00 10.00 ? 184 TRP D C   1 
ATOM 10453 O O   . TRP D 1 184 ? 61.893  29.638  127.246 1.00 10.00 ? 184 TRP D O   1 
ATOM 10454 C CB  . TRP D 1 184 ? 60.639  26.631  126.108 1.00 10.00 ? 184 TRP D CB  1 
ATOM 10455 C CG  . TRP D 1 184 ? 61.778  26.569  125.111 1.00 10.00 ? 184 TRP D CG  1 
ATOM 10456 C CD1 . TRP D 1 184 ? 61.668  26.513  123.761 1.00 10.00 ? 184 TRP D CD1 1 
ATOM 10457 C CD2 . TRP D 1 184 ? 63.159  26.388  125.405 1.00 10.00 ? 184 TRP D CD2 1 
ATOM 10458 N NE1 . TRP D 1 184 ? 62.893  26.293  123.189 1.00 10.00 ? 184 TRP D NE1 1 
ATOM 10459 C CE2 . TRP D 1 184 ? 63.829  26.211  124.178 1.00 10.00 ? 184 TRP D CE2 1 
ATOM 10460 C CE3 . TRP D 1 184 ? 63.893  26.348  126.588 1.00 10.00 ? 184 TRP D CE3 1 
ATOM 10461 C CZ2 . TRP D 1 184 ? 65.204  25.996  124.094 1.00 10.00 ? 184 TRP D CZ2 1 
ATOM 10462 C CZ3 . TRP D 1 184 ? 65.269  26.131  126.517 1.00 10.00 ? 184 TRP D CZ3 1 
ATOM 10463 C CH2 . TRP D 1 184 ? 65.911  25.956  125.271 1.00 10.00 ? 184 TRP D CH2 1 
ATOM 10464 N N   . LYS D 1 185 ? 61.392  28.081  128.797 1.00 10.00 ? 185 LYS D N   1 
ATOM 10465 C CA  . LYS D 1 185 ? 62.325  28.649  129.768 1.00 10.00 ? 185 LYS D CA  1 
ATOM 10466 C C   . LYS D 1 185 ? 63.699  28.032  129.759 1.00 10.00 ? 185 LYS D C   1 
ATOM 10467 O O   . LYS D 1 185 ? 63.938  27.035  129.098 1.00 10.00 ? 185 LYS D O   1 
ATOM 10468 C CB  . LYS D 1 185 ? 61.782  28.494  131.186 1.00 10.00 ? 185 LYS D CB  1 
ATOM 10469 C CG  . LYS D 1 185 ? 62.197  27.193  131.860 1.00 10.00 ? 185 LYS D CG  1 
ATOM 10470 C CD  . LYS D 1 185 ? 63.104  27.432  133.073 1.00 10.00 ? 185 LYS D CD  1 
ATOM 10471 C CE  . LYS D 1 185 ? 62.283  27.489  134.367 1.00 10.00 ? 185 LYS D CE  1 
ATOM 10472 N NZ  . LYS D 1 185 ? 63.116  27.437  135.614 1.00 10.00 ? 185 LYS D NZ  1 
ATOM 10473 N N   . HIS D 1 186 ? 64.596  28.662  130.510 1.00 10.00 ? 186 HIS D N   1 
ATOM 10474 C CA  . HIS D 1 186 ? 65.957  28.168  130.707 1.00 10.00 ? 186 HIS D CA  1 
ATOM 10475 C C   . HIS D 1 186 ? 66.727  29.085  131.599 1.00 10.00 ? 186 HIS D C   1 
ATOM 10476 O O   . HIS D 1 186 ? 66.359  30.235  131.807 1.00 10.00 ? 186 HIS D O   1 
ATOM 10477 C CB  . HIS D 1 186 ? 66.764  27.937  129.396 1.00 10.00 ? 186 HIS D CB  1 
ATOM 10478 C CG  . HIS D 1 186 ? 68.134  27.361  129.625 1.00 10.00 ? 186 HIS D CG  1 
ATOM 10479 N ND1 . HIS D 1 186 ? 68.410  26.485  130.650 1.00 10.00 ? 186 HIS D ND1 1 
ATOM 10480 C CD2 . HIS D 1 186 ? 69.304  27.556  128.977 1.00 10.00 ? 186 HIS D CD2 1 
ATOM 10481 C CE1 . HIS D 1 186 ? 69.690  26.170  130.623 1.00 10.00 ? 186 HIS D CE1 1 
ATOM 10482 N NE2 . HIS D 1 186 ? 70.259  26.810  129.621 1.00 10.00 ? 186 HIS D NE2 1 
ATOM 10483 N N   . TRP D 1 187 ? 67.784  28.534  132.076 1.00 10.00 ? 187 TRP D N   1 
ATOM 10484 C CA  . TRP D 1 187 ? 68.752  29.163  132.960 1.00 10.00 ? 187 TRP D CA  1 
ATOM 10485 C C   . TRP D 1 187 ? 70.133  29.225  132.325 1.00 10.00 ? 187 TRP D C   1 
ATOM 10486 O O   . TRP D 1 187 ? 70.571  28.180  131.877 1.00 10.00 ? 187 TRP D O   1 
ATOM 10487 C CB  . TRP D 1 187 ? 68.825  28.431  134.298 1.00 10.00 ? 187 TRP D CB  1 
ATOM 10488 C CG  . TRP D 1 187 ? 70.124  28.637  135.010 1.00 10.00 ? 187 TRP D CG  1 
ATOM 10489 C CD1 . TRP D 1 187 ? 70.480  29.714  135.768 1.00 10.00 ? 187 TRP D CD1 1 
ATOM 10490 C CD2 . TRP D 1 187 ? 71.243  27.744  135.029 1.00 10.00 ? 187 TRP D CD2 1 
ATOM 10491 N NE1 . TRP D 1 187 ? 71.752  29.547  136.260 1.00 10.00 ? 187 TRP D NE1 1 
ATOM 10492 C CE2 . TRP D 1 187 ? 72.242  28.345  135.821 1.00 10.00 ? 187 TRP D CE2 1 
ATOM 10493 C CE3 . TRP D 1 187 ? 71.497  26.496  134.456 1.00 10.00 ? 187 TRP D CE3 1 
ATOM 10494 C CZ2 . TRP D 1 187 ? 73.474  27.739  136.053 1.00 10.00 ? 187 TRP D CZ2 1 
ATOM 10495 C CZ3 . TRP D 1 187 ? 72.721  25.896  134.688 1.00 10.00 ? 187 TRP D CZ3 1 
ATOM 10496 C CH2 . TRP D 1 187 ? 73.694  26.518  135.479 1.00 10.00 ? 187 TRP D CH2 1 
ATOM 10497 N N   . VAL D 1 188 ? 70.729  30.359  132.221 1.00 10.00 ? 188 VAL D N   1 
ATOM 10498 C CA  . VAL D 1 188 ? 71.972  30.387  131.473 1.00 10.00 ? 188 VAL D CA  1 
ATOM 10499 C C   . VAL D 1 188 ? 73.239  30.516  132.333 1.00 10.00 ? 188 VAL D C   1 
ATOM 10500 O O   . VAL D 1 188 ? 73.494  31.565  132.913 1.00 10.00 ? 188 VAL D O   1 
ATOM 10501 C CB  . VAL D 1 188 ? 71.892  31.524  130.386 1.00 10.00 ? 188 VAL D CB  1 
ATOM 10502 C CG1 . VAL D 1 188 ? 72.577  31.080  129.072 1.00 10.00 ? 188 VAL D CG1 1 
ATOM 10503 C CG2 . VAL D 1 188 ? 70.408  31.908  130.134 1.00 10.00 ? 188 VAL D CG2 1 
ATOM 10504 N N   . TYR D 1 189 ? 74.003  29.428  132.459 1.00 10.00 ? 189 TYR D N   1 
ATOM 10505 C CA  . TYR D 1 189 ? 75.255  29.480  133.202 1.00 10.00 ? 189 TYR D CA  1 
ATOM 10506 C C   . TYR D 1 189 ? 76.318  29.651  132.137 1.00 10.00 ? 189 TYR D C   1 
ATOM 10507 O O   . TYR D 1 189 ? 76.202  29.078  131.059 1.00 10.00 ? 189 TYR D O   1 
ATOM 10508 C CB  . TYR D 1 189 ? 75.489  28.201  134.023 1.00 10.00 ? 189 TYR D CB  1 
ATOM 10509 C CG  . TYR D 1 189 ? 75.660  26.925  133.228 1.00 10.00 ? 189 TYR D CG  1 
ATOM 10510 C CD1 . TYR D 1 189 ? 76.916  26.503  132.801 1.00 10.00 ? 189 TYR D CD1 1 
ATOM 10511 C CD2 . TYR D 1 189 ? 74.557  26.128  132.921 1.00 10.00 ? 189 TYR D CD2 1 
ATOM 10512 C CE1 . TYR D 1 189 ? 77.070  25.318  132.087 1.00 10.00 ? 189 TYR D CE1 1 
ATOM 10513 C CE2 . TYR D 1 189 ? 74.699  24.943  132.210 1.00 10.00 ? 189 TYR D CE2 1 
ATOM 10514 C CZ  . TYR D 1 189 ? 75.956  24.543  131.796 1.00 10.00 ? 189 TYR D CZ  1 
ATOM 10515 O OH  . TYR D 1 189 ? 76.100  23.370  131.090 1.00 10.00 ? 189 TYR D OH  1 
ATOM 10516 N N   . TYR D 1 190 ? 77.339  30.456  132.403 1.00 10.00 ? 190 TYR D N   1 
ATOM 10517 C CA  . TYR D 1 190 ? 78.350  30.649  131.374 1.00 10.00 ? 190 TYR D CA  1 
ATOM 10518 C C   . TYR D 1 190 ? 79.737  30.104  131.663 1.00 10.00 ? 190 TYR D C   1 
ATOM 10519 O O   . TYR D 1 190 ? 80.248  30.184  132.778 1.00 10.00 ? 190 TYR D O   1 
ATOM 10520 C CB  . TYR D 1 190 ? 78.433  32.125  130.980 1.00 10.00 ? 190 TYR D CB  1 
ATOM 10521 C CG  . TYR D 1 190 ? 77.250  32.582  130.151 1.00 10.00 ? 190 TYR D CG  1 
ATOM 10522 C CD1 . TYR D 1 190 ? 76.000  32.789  130.735 1.00 10.00 ? 190 TYR D CD1 1 
ATOM 10523 C CD2 . TYR D 1 190 ? 77.374  32.782  128.775 1.00 10.00 ? 190 TYR D CD2 1 
ATOM 10524 C CE1 . TYR D 1 190 ? 74.903  33.185  129.970 1.00 10.00 ? 190 TYR D CE1 1 
ATOM 10525 C CE2 . TYR D 1 190 ? 76.281  33.175  128.000 1.00 10.00 ? 190 TYR D CE2 1 
ATOM 10526 C CZ  . TYR D 1 190 ? 75.050  33.375  128.604 1.00 10.00 ? 190 TYR D CZ  1 
ATOM 10527 O OH  . TYR D 1 190 ? 73.969  33.762  127.845 1.00 10.00 ? 190 TYR D OH  1 
ATOM 10528 N N   . THR D 1 191 ? 80.310  29.520  130.620 1.00 10.00 ? 191 THR D N   1 
ATOM 10529 C CA  . THR D 1 191 ? 81.638  28.948  130.682 1.00 10.00 ? 191 THR D CA  1 
ATOM 10530 C C   . THR D 1 191 ? 82.607  29.903  131.340 1.00 10.00 ? 191 THR D C   1 
ATOM 10531 O O   . THR D 1 191 ? 83.652  29.491  131.864 1.00 10.00 ? 191 THR D O   1 
ATOM 10532 C CB  . THR D 1 191 ? 82.163  28.615  129.271 1.00 10.00 ? 191 THR D CB  1 
ATOM 10533 O OG1 . THR D 1 191 ? 81.241  27.738  128.613 1.00 10.00 ? 191 THR D OG1 1 
ATOM 10534 C CG2 . THR D 1 191 ? 83.525  27.939  129.354 1.00 10.00 ? 191 THR D CG2 1 
ATOM 10535 N N   . CYS D 1 192 ? 82.273  31.187  131.313 1.00 10.00 ? 192 CYS D N   1 
ATOM 10536 C CA  . CYS D 1 192 ? 83.143  32.206  131.923 1.00 10.00 ? 192 CYS D CA  1 
ATOM 10537 C C   . CYS D 1 192 ? 83.397  31.905  133.367 1.00 10.00 ? 192 CYS D C   1 
ATOM 10538 O O   . CYS D 1 192 ? 84.507  31.614  133.808 1.00 10.00 ? 192 CYS D O   1 
ATOM 10539 C CB  . CYS D 1 192 ? 82.508  33.613  131.928 1.00 10.00 ? 192 CYS D CB  1 
ATOM 10540 S SG  . CYS D 1 192 ? 80.893  33.801  132.802 1.00 10.00 ? 192 CYS D SG  1 
ATOM 10541 N N   . CYS D 1 193 ? 82.289  31.989  134.074 1.00 10.00 ? 193 CYS D N   1 
ATOM 10542 C CA  . CYS D 1 193 ? 82.198  31.871  135.497 1.00 10.00 ? 193 CYS D CA  1 
ATOM 10543 C C   . CYS D 1 193 ? 81.584  30.522  135.904 1.00 10.00 ? 193 CYS D C   1 
ATOM 10544 O O   . CYS D 1 193 ? 80.672  30.004  135.241 1.00 10.00 ? 193 CYS D O   1 
ATOM 10545 C CB  . CYS D 1 193 ? 81.307  33.032  135.923 1.00 10.00 ? 193 CYS D CB  1 
ATOM 10546 S SG  . CYS D 1 193 ? 81.250  34.451  134.724 1.00 10.00 ? 193 CYS D SG  1 
ATOM 10547 N N   . PRO D 1 194 ? 82.103  29.916  136.985 1.00 10.00 ? 194 PRO D N   1 
ATOM 10548 C CA  . PRO D 1 194 ? 81.639  28.629  137.522 1.00 10.00 ? 194 PRO D CA  1 
ATOM 10549 C C   . PRO D 1 194 ? 80.262  28.752  138.193 1.00 10.00 ? 194 PRO D C   1 
ATOM 10550 O O   . PRO D 1 194 ? 79.668  27.757  138.598 1.00 10.00 ? 194 PRO D O   1 
ATOM 10551 C CB  . PRO D 1 194 ? 82.722  28.284  138.532 1.00 10.00 ? 194 PRO D CB  1 
ATOM 10552 C CG  . PRO D 1 194 ? 83.032  29.669  139.122 1.00 10.00 ? 194 PRO D CG  1 
ATOM 10553 C CD  . PRO D 1 194 ? 83.075  30.562  137.894 1.00 10.00 ? 194 PRO D CD  1 
ATOM 10554 N N   . ASP D 1 195 ? 79.781  29.987  138.288 1.00 10.00 ? 195 ASP D N   1 
ATOM 10555 C CA  . ASP D 1 195 ? 78.520  30.365  138.923 1.00 10.00 ? 195 ASP D CA  1 
ATOM 10556 C C   . ASP D 1 195 ? 77.260  29.999  138.110 1.00 10.00 ? 195 ASP D C   1 
ATOM 10557 O O   . ASP D 1 195 ? 77.337  29.709  136.914 1.00 10.00 ? 195 ASP D O   1 
ATOM 10558 C CB  . ASP D 1 195 ? 78.577  31.881  139.240 1.00 10.00 ? 195 ASP D CB  1 
ATOM 10559 C CG  . ASP D 1 195 ? 77.370  32.403  140.087 1.00 10.00 ? 195 ASP D CG  1 
ATOM 10560 O OD1 . ASP D 1 195 ? 77.487  33.534  140.622 1.00 10.00 ? 195 ASP D OD1 1 
ATOM 10561 O OD2 . ASP D 1 195 ? 76.330  31.724  140.214 1.00 10.00 ? 195 ASP D OD2 1 
ATOM 10562 N N   . THR D 1 196 ? 76.135  29.988  138.818 1.00 10.00 ? 196 THR D N   1 
ATOM 10563 C CA  . THR D 1 196 ? 74.788  29.680  138.347 1.00 10.00 ? 196 THR D CA  1 
ATOM 10564 C C   . THR D 1 196 ? 74.040  31.031  138.080 1.00 10.00 ? 196 THR D C   1 
ATOM 10565 O O   . THR D 1 196 ? 73.508  31.629  139.007 1.00 10.00 ? 196 THR D O   1 
ATOM 10566 C CB  . THR D 1 196 ? 74.129  28.818  139.494 1.00 10.00 ? 196 THR D CB  1 
ATOM 10567 O OG1 . THR D 1 196 ? 74.931  27.650  139.703 1.00 10.00 ? 196 THR D OG1 1 
ATOM 10568 C CG2 . THR D 1 196 ? 72.667  28.430  139.196 1.00 10.00 ? 196 THR D CG2 1 
ATOM 10569 N N   . PRO D 1 197 ? 74.025  31.533  136.813 1.00 10.00 ? 197 PRO D N   1 
ATOM 10570 C CA  . PRO D 1 197 ? 73.390  32.785  136.341 1.00 10.00 ? 197 PRO D CA  1 
ATOM 10571 C C   . PRO D 1 197 ? 71.870  32.836  136.116 1.00 10.00 ? 197 PRO D C   1 
ATOM 10572 O O   . PRO D 1 197 ? 71.187  31.819  136.056 1.00 10.00 ? 197 PRO D O   1 
ATOM 10573 C CB  . PRO D 1 197 ? 74.132  33.104  135.028 1.00 10.00 ? 197 PRO D CB  1 
ATOM 10574 C CG  . PRO D 1 197 ? 75.406  32.281  135.121 1.00 10.00 ? 197 PRO D CG  1 
ATOM 10575 C CD  . PRO D 1 197 ? 74.955  31.013  135.800 1.00 10.00 ? 197 PRO D CD  1 
ATOM 10576 N N   . TYR D 1 198 ? 71.384  34.066  135.970 1.00 10.00 ? 198 TYR D N   1 
ATOM 10577 C CA  . TYR D 1 198 ? 69.990  34.418  135.723 1.00 10.00 ? 198 TYR D CA  1 
ATOM 10578 C C   . TYR D 1 198 ? 69.158  33.430  134.899 1.00 10.00 ? 198 TYR D C   1 
ATOM 10579 O O   . TYR D 1 198 ? 69.692  32.618  134.141 1.00 10.00 ? 198 TYR D O   1 
ATOM 10580 C CB  . TYR D 1 198 ? 69.955  35.759  134.993 1.00 10.00 ? 198 TYR D CB  1 
ATOM 10581 C CG  . TYR D 1 198 ? 70.633  35.714  133.626 1.00 10.00 ? 198 TYR D CG  1 
ATOM 10582 C CD1 . TYR D 1 198 ? 70.175  36.508  132.573 1.00 10.00 ? 198 TYR D CD1 1 
ATOM 10583 C CD2 . TYR D 1 198 ? 71.726  34.873  133.383 1.00 10.00 ? 198 TYR D CD2 1 
ATOM 10584 C CE1 . TYR D 1 198 ? 70.782  36.467  131.316 1.00 10.00 ? 198 TYR D CE1 1 
ATOM 10585 C CE2 . TYR D 1 198 ? 72.338  34.827  132.133 1.00 10.00 ? 198 TYR D CE2 1 
ATOM 10586 C CZ  . TYR D 1 198 ? 71.859  35.627  131.104 1.00 10.00 ? 198 TYR D CZ  1 
ATOM 10587 O OH  . TYR D 1 198 ? 72.454  35.596  129.863 1.00 10.00 ? 198 TYR D OH  1 
ATOM 10588 N N   . LEU D 1 199 ? 67.864  33.531  135.067 1.00 10.00 ? 199 LEU D N   1 
ATOM 10589 C CA  . LEU D 1 199 ? 66.903  32.753  134.279 1.00 10.00 ? 199 LEU D CA  1 
ATOM 10590 C C   . LEU D 1 199 ? 66.214  33.612  133.217 1.00 10.00 ? 199 LEU D C   1 
ATOM 10591 O O   . LEU D 1 199 ? 66.306  34.837  133.378 1.00 10.00 ? 199 LEU D O   1 
ATOM 10592 C CB  . LEU D 1 199 ? 65.850  32.113  135.190 1.00 10.00 ? 199 LEU D CB  1 
ATOM 10593 C CG  . LEU D 1 199 ? 66.355  31.076  136.196 1.00 10.00 ? 199 LEU D CG  1 
ATOM 10594 C CD1 . LEU D 1 199 ? 65.465  31.044  137.429 1.00 10.00 ? 199 LEU D CD1 1 
ATOM 10595 C CD2 . LEU D 1 199 ? 66.430  29.698  135.556 1.00 10.00 ? 199 LEU D CD2 1 
ATOM 10596 N N   . ASP D 1 200 ? 65.620  33.038  132.235 1.00 10.00 ? 200 ASP D N   1 
ATOM 10597 C CA  . ASP D 1 200 ? 64.959  33.878  131.240 1.00 10.00 ? 200 ASP D CA  1 
ATOM 10598 C C   . ASP D 1 200 ? 63.904  33.204  130.376 1.00 10.00 ? 200 ASP D C   1 
ATOM 10599 O O   . ASP D 1 200 ? 63.918  31.985  130.158 1.00 10.00 ? 200 ASP D O   1 
ATOM 10600 C CB  . ASP D 1 200 ? 65.997  34.588  130.358 1.00 10.00 ? 200 ASP D CB  1 
ATOM 10601 C CG  . ASP D 1 200 ? 67.401  34.052  130.547 1.00 10.00 ? 200 ASP D CG  1 
ATOM 10602 O OD1 . ASP D 1 200 ? 67.941  34.160  131.666 1.00 10.00 ? 200 ASP D OD1 1 
ATOM 10603 O OD2 . ASP D 1 200 ? 67.971  33.532  129.567 1.00 10.00 ? 200 ASP D OD2 1 
ATOM 10604 N N   . ILE D 1 201 ? 62.965  34.018  129.910 1.00 10.00 ? 201 ILE D N   1 
ATOM 10605 C CA  . ILE D 1 201 ? 61.885  33.539  129.058 1.00 10.00 ? 201 ILE D CA  1 
ATOM 10606 C C   . ILE D 1 201 ? 62.217  33.962  127.624 1.00 10.00 ? 201 ILE D C   1 
ATOM 10607 O O   . ILE D 1 201 ? 62.391  35.152  127.320 1.00 10.00 ? 201 ILE D O   1 
ATOM 10608 C CB  . ILE D 1 201 ? 60.513  34.130  129.413 1.00 10.00 ? 201 ILE D CB  1 
ATOM 10609 C CG1 . ILE D 1 201 ? 60.011  33.574  130.737 1.00 10.00 ? 201 ILE D CG1 1 
ATOM 10610 C CG2 . ILE D 1 201 ? 59.510  33.752  128.339 1.00 10.00 ? 201 ILE D CG2 1 
ATOM 10611 C CD1 . ILE D 1 201 ? 58.458  33.670  130.902 1.00 10.00 ? 201 ILE D CD1 1 
ATOM 10612 N N   . THR D 1 202 ? 62.297  32.983  126.735 1.00 10.00 ? 202 THR D N   1 
ATOM 10613 C CA  . THR D 1 202 ? 62.634  33.266  125.355 1.00 10.00 ? 202 THR D CA  1 
ATOM 10614 C C   . THR D 1 202 ? 61.422  33.074  124.442 1.00 10.00 ? 202 THR D C   1 
ATOM 10615 O O   . THR D 1 202 ? 60.867  31.974  124.311 1.00 10.00 ? 202 THR D O   1 
ATOM 10616 C CB  . THR D 1 202 ? 63.761  32.377  124.891 1.00 10.00 ? 202 THR D CB  1 
ATOM 10617 O OG1 . THR D 1 202 ? 64.277  31.636  126.003 1.00 10.00 ? 202 THR D OG1 1 
ATOM 10618 C CG2 . THR D 1 202 ? 64.846  33.226  124.307 1.00 10.00 ? 202 THR D CG2 1 
ATOM 10619 N N   . TYR D 1 203 ? 61.003  34.169  123.823 1.00 10.00 ? 203 TYR D N   1 
ATOM 10620 C CA  . TYR D 1 203 ? 59.877  34.142  122.941 1.00 10.00 ? 203 TYR D CA  1 
ATOM 10621 C C   . TYR D 1 203 ? 60.398  33.999  121.525 1.00 10.00 ? 203 TYR D C   1 
ATOM 10622 O O   . TYR D 1 203 ? 61.548  34.316  121.241 1.00 10.00 ? 203 TYR D O   1 
ATOM 10623 C CB  . TYR D 1 203 ? 59.119  35.440  123.127 1.00 10.00 ? 203 TYR D CB  1 
ATOM 10624 C CG  . TYR D 1 203 ? 59.112  35.914  124.584 1.00 10.00 ? 203 TYR D CG  1 
ATOM 10625 C CD1 . TYR D 1 203 ? 58.021  36.623  125.125 1.00 10.00 ? 203 TYR D CD1 1 
ATOM 10626 C CD2 . TYR D 1 203 ? 60.196  35.670  125.427 1.00 10.00 ? 203 TYR D CD2 1 
ATOM 10627 C CE1 . TYR D 1 203 ? 58.044  37.060  126.480 1.00 10.00 ? 203 TYR D CE1 1 
ATOM 10628 C CE2 . TYR D 1 203 ? 60.221  36.093  126.726 1.00 10.00 ? 203 TYR D CE2 1 
ATOM 10629 C CZ  . TYR D 1 203 ? 59.171  36.775  127.261 1.00 10.00 ? 203 TYR D CZ  1 
ATOM 10630 O OH  . TYR D 1 203 ? 59.267  37.162  128.580 1.00 10.00 ? 203 TYR D OH  1 
ATOM 10631 N N   . HIS D 1 204 ? 59.594  33.423  120.649 1.00 10.00 ? 204 HIS D N   1 
ATOM 10632 C CA  . HIS D 1 204 ? 60.018  33.356  119.276 1.00 10.00 ? 204 HIS D CA  1 
ATOM 10633 C C   . HIS D 1 204 ? 58.745  33.609  118.520 1.00 10.00 ? 204 HIS D C   1 
ATOM 10634 O O   . HIS D 1 204 ? 57.672  32.984  118.716 1.00 10.00 ? 204 HIS D O   1 
ATOM 10635 C CB  . HIS D 1 204 ? 60.661  32.019  118.944 1.00 10.00 ? 204 HIS D CB  1 
ATOM 10636 C CG  . HIS D 1 204 ? 61.991  31.810  119.608 1.00 10.00 ? 204 HIS D CG  1 
ATOM 10637 N ND1 . HIS D 1 204 ? 63.175  32.268  119.071 1.00 10.00 ? 204 HIS D ND1 1 
ATOM 10638 C CD2 . HIS D 1 204 ? 62.318  31.207  120.779 1.00 10.00 ? 204 HIS D CD2 1 
ATOM 10639 C CE1 . HIS D 1 204 ? 64.172  31.955  119.881 1.00 10.00 ? 204 HIS D CE1 1 
ATOM 10640 N NE2 . HIS D 1 204 ? 63.679  31.311  120.924 1.00 10.00 ? 204 HIS D NE2 1 
ATOM 10641 N N   . PHE D 1 205 ? 58.857  34.630  117.700 1.00 10.00 ? 205 PHE D N   1 
ATOM 10642 C CA  . PHE D 1 205 ? 57.766  35.088  116.911 1.00 10.00 ? 205 PHE D CA  1 
ATOM 10643 C C   . PHE D 1 205 ? 57.949  34.563  115.485 1.00 10.00 ? 205 PHE D C   1 
ATOM 10644 O O   . PHE D 1 205 ? 58.905  34.900  114.792 1.00 10.00 ? 205 PHE D O   1 
ATOM 10645 C CB  . PHE D 1 205 ? 57.779  36.614  117.014 1.00 10.00 ? 205 PHE D CB  1 
ATOM 10646 C CG  . PHE D 1 205 ? 57.328  37.143  118.340 1.00 10.00 ? 205 PHE D CG  1 
ATOM 10647 C CD1 . PHE D 1 205 ? 58.186  37.112  119.437 1.00 10.00 ? 205 PHE D CD1 1 
ATOM 10648 C CD2 . PHE D 1 205 ? 56.126  37.826  118.449 1.00 10.00 ? 205 PHE D CD2 1 
ATOM 10649 C CE1 . PHE D 1 205 ? 57.864  37.779  120.617 1.00 10.00 ? 205 PHE D CE1 1 
ATOM 10650 C CE2 . PHE D 1 205 ? 55.797  38.493  119.621 1.00 10.00 ? 205 PHE D CE2 1 
ATOM 10651 C CZ  . PHE D 1 205 ? 56.673  38.475  120.709 1.00 10.00 ? 205 PHE D CZ  1 
ATOM 10652 N N   . ILE D 1 206 ? 57.064  33.672  115.060 1.00 10.00 ? 206 ILE D N   1 
ATOM 10653 C CA  . ILE D 1 206 ? 57.177  33.168  113.699 1.00 10.00 ? 206 ILE D CA  1 
ATOM 10654 C C   . ILE D 1 206 ? 56.006  33.707  112.902 1.00 10.00 ? 206 ILE D C   1 
ATOM 10655 O O   . ILE D 1 206 ? 54.858  33.305  113.105 1.00 10.00 ? 206 ILE D O   1 
ATOM 10656 C CB  . ILE D 1 206 ? 57.164  31.612  113.637 1.00 10.00 ? 206 ILE D CB  1 
ATOM 10657 C CG1 . ILE D 1 206 ? 58.576  31.058  113.843 1.00 10.00 ? 206 ILE D CG1 1 
ATOM 10658 C CG2 . ILE D 1 206 ? 56.647  31.142  112.275 1.00 10.00 ? 206 ILE D CG2 1 
ATOM 10659 C CD1 . ILE D 1 206 ? 59.488  31.235  112.635 1.00 10.00 ? 206 ILE D CD1 1 
ATOM 10660 N N   . MET D 1 207 ? 56.322  34.611  111.989 1.00 10.00 ? 207 MET D N   1 
ATOM 10661 C CA  . MET D 1 207 ? 55.301  35.225  111.146 1.00 10.00 ? 207 MET D CA  1 
ATOM 10662 C C   . MET D 1 207 ? 55.842  35.810  109.841 1.00 10.00 ? 207 MET D C   1 
ATOM 10663 O O   . MET D 1 207 ? 56.858  36.505  109.832 1.00 10.00 ? 207 MET D O   1 
ATOM 10664 C CB  . MET D 1 207 ? 54.560  36.320  111.924 1.00 10.00 ? 207 MET D CB  1 
ATOM 10665 C CG  . MET D 1 207 ? 55.364  37.579  112.196 1.00 10.00 ? 207 MET D CG  1 
ATOM 10666 S SD  . MET D 1 207 ? 56.525  37.345  113.560 1.00 10.00 ? 207 MET D SD  1 
ATOM 10667 C CE  . MET D 1 207 ? 58.083  37.367  112.688 1.00 10.00 ? 207 MET D CE  1 
ATOM 10668 N N   . GLN D 1 208 ? 55.144  35.518  108.742 1.00 10.00 ? 208 GLN D N   1 
ATOM 10669 C CA  . GLN D 1 208 ? 55.498  36.005  107.415 1.00 10.00 ? 208 GLN D CA  1 
ATOM 10670 C C   . GLN D 1 208 ? 54.965  37.412  107.185 1.00 10.00 ? 208 GLN D C   1 
ATOM 10671 O O   . GLN D 1 208 ? 53.913  37.755  107.722 1.00 10.00 ? 208 GLN D O   1 
ATOM 10672 C CB  . GLN D 1 208 ? 54.982  35.050  106.337 1.00 10.00 ? 208 GLN D CB  1 
ATOM 10673 C CG  . GLN D 1 208 ? 53.472  35.058  106.171 1.00 10.00 ? 208 GLN D CG  1 
ATOM 10674 C CD  . GLN D 1 208 ? 52.982  33.941  105.271 1.00 10.00 ? 208 GLN D CD  1 
ATOM 10675 O OE1 . GLN D 1 208 ? 53.776  33.150  104.761 1.00 10.00 ? 208 GLN D OE1 1 
ATOM 10676 N NE2 . GLN D 1 208 ? 51.722  33.691  104.941 1.00 10.00 ? 208 GLN D NE2 1 
ATOM 10677 N N   . ARG D 1 209 ? 55.815  38.298  106.306 1.00 10.00 ? 209 ARG D N   1 
ATOM 10678 C CA  . ARG D 1 209 ? 55.370  39.674  106.166 1.00 10.00 ? 209 ARG D CA  1 
ATOM 10679 C C   . ARG D 1 209 ? 54.957  40.009  104.720 1.00 10.00 ? 209 ARG D C   1 
ATOM 10680 O O   . ARG D 1 209 ? 54.492  39.133  103.971 1.00 10.00 ? 209 ARG D O   1 
ATOM 10681 C CB  . ARG D 1 209 ? 56.465  40.646  106.600 1.00 10.00 ? 209 ARG D CB  1 
ATOM 10682 C CG  . ARG D 1 209 ? 55.955  42.057  106.826 1.00 10.00 ? 209 ARG D CG  1 
ATOM 10683 C CD  . ARG D 1 209 ? 56.341  42.595  108.194 1.00 10.00 ? 209 ARG D CD  1 
ATOM 10684 N NE  . ARG D 1 209 ? 55.859  43.953  108.414 1.00 10.00 ? 209 ARG D NE  1 
ATOM 10685 C CZ  . ARG D 1 209 ? 55.876  44.564  109.596 1.00 10.00 ? 209 ARG D CZ  1 
ATOM 10686 N NH1 . ARG D 1 209 ? 56.353  43.944  110.682 1.00 10.00 ? 209 ARG D NH1 1 
ATOM 10687 N NH2 . ARG D 1 209 ? 55.432  45.810  109.789 1.00 10.00 ? 209 ARG D NH2 1 
ATOM 10688 N N   . ILE D 1 210 ? 55.080  41.304  104.424 1.00 10.00 ? 210 ILE D N   1 
ATOM 10689 C CA  . ILE D 1 210 ? 54.965  41.961  103.130 1.00 10.00 ? 210 ILE D CA  1 
ATOM 10690 C C   . ILE D 1 210 ? 53.540  42.079  102.627 1.00 10.00 ? 210 ILE D C   1 
ATOM 10691 O O   . ILE D 1 210 ? 52.934  41.087  102.192 1.00 10.00 ? 210 ILE D O   1 
ATOM 10692 C CB  . ILE D 1 210 ? 55.812  41.272  102.053 1.00 10.00 ? 210 ILE D CB  1 
ATOM 10693 C CG1 . ILE D 1 210 ? 57.130  40.730  102.613 1.00 10.00 ? 210 ILE D CG1 1 
ATOM 10694 C CG2 . ILE D 1 210 ? 56.191  42.207  100.903 1.00 10.00 ? 210 ILE D CG2 1 
ATOM 10695 C CD1 . ILE D 1 210 ? 57.849  39.784  101.654 1.00 10.00 ? 210 ILE D CD1 1 
ATOM 10696 N N   . PRO D 1 211 ? 52.961  43.296  102.776 1.00 10.00 ? 211 PRO D N   1 
ATOM 10697 C CA  . PRO D 1 211 ? 51.715  43.504  102.035 1.00 10.00 ? 211 PRO D CA  1 
ATOM 10698 C C   . PRO D 1 211 ? 51.893  43.324  100.521 1.00 10.00 ? 211 PRO D C   1 
ATOM 10699 O O   . PRO D 1 211 ? 53.120  42.976  100.241 1.00 10.00 ? 211 PRO D O   1 
ATOM 10700 C CB  . PRO D 1 211 ? 51.401  44.986  102.267 1.00 10.00 ? 211 PRO D CB  1 
ATOM 10701 C CG  . PRO D 1 211 ? 52.724  45.625  102.433 1.00 10.00 ? 211 PRO D CG  1 
ATOM 10702 C CD  . PRO D 1 211 ? 53.619  44.572  103.024 1.00 10.00 ? 211 PRO D CD  1 
ATOM 10703 N N   . LEU D 1 212 ? 50.978  43.553  99.740  1.00 10.00 ? 212 LEU D N   1 
ATOM 10704 C CA  . LEU D 1 212 ? 51.190  43.329  98.307  1.00 10.00 ? 212 LEU D CA  1 
ATOM 10705 C C   . LEU D 1 212 ? 51.277  44.648  97.535  1.00 10.00 ? 212 LEU D C   1 
ATOM 10706 O O   . LEU D 1 212 ? 51.359  44.655  96.283  1.00 10.00 ? 212 LEU D O   1 
ATOM 10707 C CB  . LEU D 1 212 ? 50.070  42.460  97.724  1.00 10.00 ? 212 LEU D CB  1 
ATOM 10708 C CG  . LEU D 1 212 ? 49.908  41.061  98.323  1.00 10.00 ? 212 LEU D CG  1 
ATOM 10709 C CD1 . LEU D 1 212 ? 48.760  40.320  97.656  1.00 10.00 ? 212 LEU D CD1 1 
ATOM 10710 C CD2 . LEU D 1 212 ? 51.201  40.269  98.195  1.00 10.00 ? 212 LEU D CD2 1 
ATOM 10711 N N   . TYR D 1 213 ? 51.286  45.816  98.184  1.00 10.00 ? 213 TYR D N   1 
ATOM 10712 C CA  . TYR D 1 213 ? 51.323  47.105  97.504  1.00 10.00 ? 213 TYR D CA  1 
ATOM 10713 C C   . TYR D 1 213 ? 52.545  47.204  96.600  1.00 10.00 ? 213 TYR D C   1 
ATOM 10714 O O   . TYR D 1 213 ? 52.441  47.357  95.357  1.00 10.00 ? 213 TYR D O   1 
ATOM 10715 C CB  . TYR D 1 213 ? 51.301  48.249  98.518  1.00 10.00 ? 213 TYR D CB  1 
ATOM 10716 C CG  . TYR D 1 213 ? 50.063  48.272  99.390  1.00 10.00 ? 213 TYR D CG  1 
ATOM 10717 C CD1 . TYR D 1 213 ? 50.035  47.604  100.605 1.00 10.00 ? 213 TYR D CD1 1 
ATOM 10718 C CD2 . TYR D 1 213 ? 48.924  48.963  98.996  1.00 10.00 ? 213 TYR D CD2 1 
ATOM 10719 C CE1 . TYR D 1 213 ? 48.910  47.623  101.406 1.00 10.00 ? 213 TYR D CE1 1 
ATOM 10720 C CE2 . TYR D 1 213 ? 47.793  48.988  99.790  1.00 10.00 ? 213 TYR D CE2 1 
ATOM 10721 C CZ  . TYR D 1 213 ? 47.792  48.317  100.994 1.00 10.00 ? 213 TYR D CZ  1 
ATOM 10722 O OH  . TYR D 1 213 ? 46.667  48.339  101.787 1.00 10.00 ? 213 TYR D OH  1 
ATOM 10723 N N   . PHE D 1 214 ? 53.726  47.139  97.203  1.00 10.00 ? 214 PHE D N   1 
ATOM 10724 C CA  . PHE D 1 214 ? 55.036  47.214  96.506  1.00 10.00 ? 214 PHE D CA  1 
ATOM 10725 C C   . PHE D 1 214 ? 55.090  46.198  95.351  1.00 10.00 ? 214 PHE D C   1 
ATOM 10726 O O   . PHE D 1 214 ? 55.707  46.448  94.304  1.00 10.00 ? 214 PHE D O   1 
ATOM 10727 C CB  . PHE D 1 214 ? 56.146  46.886  97.514  1.00 10.00 ? 214 PHE D CB  1 
ATOM 10728 C CG  . PHE D 1 214 ? 57.553  47.251  97.036  1.00 10.00 ? 214 PHE D CG  1 
ATOM 10729 C CD1 . PHE D 1 214 ? 57.844  48.562  96.636  1.00 10.00 ? 214 PHE D CD1 1 
ATOM 10730 C CD2 . PHE D 1 214 ? 58.555  46.274  97.006  1.00 10.00 ? 214 PHE D CD2 1 
ATOM 10731 C CE1 . PHE D 1 214 ? 59.135  48.894  96.207  1.00 10.00 ? 214 PHE D CE1 1 
ATOM 10732 C CE2 . PHE D 1 214 ? 59.845  46.606  96.578  1.00 10.00 ? 214 PHE D CE2 1 
ATOM 10733 C CZ  . PHE D 1 214 ? 60.136  47.916  96.179  1.00 10.00 ? 214 PHE D CZ  1 
ATOM 10734 N N   . VAL D 1 215 ? 54.428  45.074  95.574  1.00 10.00 ? 215 VAL D N   1 
ATOM 10735 C CA  . VAL D 1 215 ? 54.385  43.956  94.610  1.00 10.00 ? 215 VAL D CA  1 
ATOM 10736 C C   . VAL D 1 215 ? 53.664  44.345  93.329  1.00 10.00 ? 215 VAL D C   1 
ATOM 10737 O O   . VAL D 1 215 ? 54.169  44.132  92.227  1.00 10.00 ? 215 VAL D O   1 
ATOM 10738 C CB  . VAL D 1 215 ? 53.663  42.758  95.218  1.00 10.00 ? 215 VAL D CB  1 
ATOM 10739 C CG1 . VAL D 1 215 ? 53.321  41.687  94.181  1.00 10.00 ? 215 VAL D CG1 1 
ATOM 10740 C CG2 . VAL D 1 215 ? 54.491  42.058  96.295  1.00 10.00 ? 215 VAL D CG2 1 
ATOM 10741 N N   . VAL D 1 216 ? 52.472  44.904  93.492  1.00 10.00 ? 216 VAL D N   1 
ATOM 10742 C CA  . VAL D 1 216 ? 51.654  45.323  92.376  1.00 10.00 ? 216 VAL D CA  1 
ATOM 10743 C C   . VAL D 1 216 ? 52.377  46.350  91.518  1.00 10.00 ? 216 VAL D C   1 
ATOM 10744 O O   . VAL D 1 216 ? 52.374  46.259  90.300  1.00 10.00 ? 216 VAL D O   1 
ATOM 10745 C CB  . VAL D 1 216 ? 50.346  45.885  92.895  1.00 10.00 ? 216 VAL D CB  1 
ATOM 10746 C CG1 . VAL D 1 216 ? 49.201  45.325  92.101  1.00 10.00 ? 216 VAL D CG1 1 
ATOM 10747 C CG2 . VAL D 1 216 ? 50.183  45.534  94.359  1.00 10.00 ? 216 VAL D CG2 1 
ATOM 10748 N N   . ASN D 1 217 ? 53.058  47.300  92.145  1.00 10.00 ? 217 ASN D N   1 
ATOM 10749 C CA  . ASN D 1 217 ? 53.746  48.294  91.341  1.00 10.00 ? 217 ASN D CA  1 
ATOM 10750 C C   . ASN D 1 217 ? 55.131  47.883  90.830  1.00 10.00 ? 217 ASN D C   1 
ATOM 10751 O O   . ASN D 1 217 ? 55.705  48.598  90.012  1.00 10.00 ? 217 ASN D O   1 
ATOM 10752 C CB  . ASN D 1 217 ? 53.852  49.628  92.097  1.00 10.00 ? 217 ASN D CB  1 
ATOM 10753 C CG  . ASN D 1 217 ? 54.814  49.568  93.270  1.00 10.00 ? 217 ASN D CG  1 
ATOM 10754 O OD1 . ASN D 1 217 ? 54.588  48.840  94.235  1.00 10.00 ? 217 ASN D OD1 1 
ATOM 10755 N ND2 . ASN D 1 217 ? 55.894  50.339  93.191  1.00 10.00 ? 217 ASN D ND2 1 
ATOM 10756 N N   . VAL D 1 218 ? 55.692  46.778  91.309  1.00 10.00 ? 218 VAL D N   1 
ATOM 10757 C CA  . VAL D 1 218 ? 57.007  46.350  90.774  1.00 10.00 ? 218 VAL D CA  1 
ATOM 10758 C C   . VAL D 1 218 ? 56.760  45.705  89.415  1.00 10.00 ? 218 VAL D C   1 
ATOM 10759 O O   . VAL D 1 218 ? 57.457  45.980  88.439  1.00 10.00 ? 218 VAL D O   1 
ATOM 10760 C CB  . VAL D 1 218 ? 57.752  45.214  91.578  1.00 10.00 ? 218 VAL D CB  1 
ATOM 10761 C CG1 . VAL D 1 218 ? 59.138  44.962  90.958  1.00 10.00 ? 218 VAL D CG1 1 
ATOM 10762 C CG2 . VAL D 1 218 ? 57.909  45.552  92.997  1.00 10.00 ? 218 VAL D CG2 1 
ATOM 10763 N N   . ILE D 1 219 ? 55.751  44.838  89.382  1.00 10.00 ? 219 ILE D N   1 
ATOM 10764 C CA  . ILE D 1 219 ? 55.386  44.065  88.207  1.00 10.00 ? 219 ILE D CA  1 
ATOM 10765 C C   . ILE D 1 219 ? 54.569  44.794  87.139  1.00 10.00 ? 219 ILE D C   1 
ATOM 10766 O O   . ILE D 1 219 ? 54.587  44.405  85.975  1.00 10.00 ? 219 ILE D O   1 
ATOM 10767 C CB  . ILE D 1 219 ? 54.658  42.762  88.669  1.00 10.00 ? 219 ILE D CB  1 
ATOM 10768 C CG1 . ILE D 1 219 ? 53.135  42.929  88.640  1.00 10.00 ? 219 ILE D CG1 1 
ATOM 10769 C CG2 . ILE D 1 219 ? 55.129  42.408  90.095  1.00 10.00 ? 219 ILE D CG2 1 
ATOM 10770 C CD1 . ILE D 1 219 ? 52.506  42.646  87.309  1.00 10.00 ? 219 ILE D CD1 1 
ATOM 10771 N N   . ILE D 1 220 ? 53.856  45.850  87.509  1.00 10.00 ? 220 ILE D N   1 
ATOM 10772 C CA  . ILE D 1 220 ? 53.061  46.560  86.498  1.00 10.00 ? 220 ILE D CA  1 
ATOM 10773 C C   . ILE D 1 220 ? 53.986  47.256  85.521  1.00 10.00 ? 220 ILE D C   1 
ATOM 10774 O O   . ILE D 1 220 ? 53.848  47.086  84.313  1.00 10.00 ? 220 ILE D O   1 
ATOM 10775 C CB  . ILE D 1 220 ? 52.046  47.609  87.113  1.00 10.00 ? 220 ILE D CB  1 
ATOM 10776 C CG1 . ILE D 1 220 ? 51.185  46.959  88.206  1.00 10.00 ? 220 ILE D CG1 1 
ATOM 10777 C CG2 . ILE D 1 220 ? 51.027  48.048  86.044  1.00 10.00 ? 220 ILE D CG2 1 
ATOM 10778 C CD1 . ILE D 1 220 ? 50.213  47.884  88.867  1.00 10.00 ? 220 ILE D CD1 1 
ATOM 10779 N N   . PRO D 1 221 ? 54.957  48.029  86.026  1.00 10.00 ? 221 PRO D N   1 
ATOM 10780 C CA  . PRO D 1 221 ? 55.879  48.721  85.128  1.00 10.00 ? 221 PRO D CA  1 
ATOM 10781 C C   . PRO D 1 221 ? 56.740  47.701  84.401  1.00 10.00 ? 221 PRO D C   1 
ATOM 10782 O O   . PRO D 1 221 ? 57.278  47.979  83.329  1.00 10.00 ? 221 PRO D O   1 
ATOM 10783 C CB  . PRO D 1 221 ? 56.687  49.595  86.079  1.00 10.00 ? 221 PRO D CB  1 
ATOM 10784 C CG  . PRO D 1 221 ? 56.771  48.738  87.299  1.00 10.00 ? 221 PRO D CG  1 
ATOM 10785 C CD  . PRO D 1 221 ? 55.350  48.228  87.429  1.00 10.00 ? 221 PRO D CD  1 
ATOM 10786 N N   . CYS D 1 222 ? 56.860  46.512  84.988  1.00 10.00 ? 222 CYS D N   1 
ATOM 10787 C CA  . CYS D 1 222 ? 57.664  45.476  84.372  1.00 10.00 ? 222 CYS D CA  1 
ATOM 10788 C C   . CYS D 1 222 ? 56.925  44.988  83.129  1.00 10.00 ? 222 CYS D C   1 
ATOM 10789 O O   . CYS D 1 222 ? 57.458  45.055  82.039  1.00 10.00 ? 222 CYS D O   1 
ATOM 10790 C CB  . CYS D 1 222 ? 57.929  44.333  85.354  1.00 10.00 ? 222 CYS D CB  1 
ATOM 10791 S SG  . CYS D 1 222 ? 59.337  43.378  84.854  1.00 10.00 ? 222 CYS D SG  1 
ATOM 10792 N N   . LEU D 1 223 ? 55.685  44.537  83.283  1.00 10.00 ? 223 LEU D N   1 
ATOM 10793 C CA  . LEU D 1 223 ? 54.904  44.082  82.125  1.00 10.00 ? 223 LEU D CA  1 
ATOM 10794 C C   . LEU D 1 223 ? 54.712  45.256  81.158  1.00 10.00 ? 223 LEU D C   1 
ATOM 10795 O O   . LEU D 1 223 ? 54.795  45.101  79.935  1.00 10.00 ? 223 LEU D O   1 
ATOM 10796 C CB  . LEU D 1 223 ? 53.536  43.573  82.583  1.00 10.00 ? 223 LEU D CB  1 
ATOM 10797 C CG  . LEU D 1 223 ? 52.608  43.010  81.504  1.00 10.00 ? 223 LEU D CG  1 
ATOM 10798 C CD1 . LEU D 1 223 ? 51.473  42.204  82.149  1.00 10.00 ? 223 LEU D CD1 1 
ATOM 10799 C CD2 . LEU D 1 223 ? 52.065  44.140  80.651  1.00 10.00 ? 223 LEU D CD2 1 
ATOM 10800 N N   . LEU D 1 224 ? 54.460  46.442  81.717  1.00 10.00 ? 224 LEU D N   1 
ATOM 10801 C CA  . LEU D 1 224 ? 54.248  47.629  80.896  1.00 10.00 ? 224 LEU D CA  1 
ATOM 10802 C C   . LEU D 1 224 ? 55.553  47.985  80.182  1.00 10.00 ? 224 LEU D C   1 
ATOM 10803 O O   . LEU D 1 224 ? 55.538  48.331  79.004  1.00 10.00 ? 224 LEU D O   1 
ATOM 10804 C CB  . LEU D 1 224 ? 53.748  48.806  81.756  1.00 10.00 ? 224 LEU D CB  1 
ATOM 10805 C CG  . LEU D 1 224 ? 52.964  49.916  81.051  1.00 10.00 ? 224 LEU D CG  1 
ATOM 10806 C CD1 . LEU D 1 224 ? 51.732  49.319  80.392  1.00 10.00 ? 224 LEU D CD1 1 
ATOM 10807 C CD2 . LEU D 1 224 ? 52.577  50.994  82.062  1.00 10.00 ? 224 LEU D CD2 1 
ATOM 10808 N N   . PHE D 1 225 ? 56.678  47.885  80.889  1.00 10.00 ? 225 PHE D N   1 
ATOM 10809 C CA  . PHE D 1 225 ? 57.967  48.169  80.299  1.00 10.00 ? 225 PHE D CA  1 
ATOM 10810 C C   . PHE D 1 225 ? 58.368  47.045  79.345  1.00 10.00 ? 225 PHE D C   1 
ATOM 10811 O O   . PHE D 1 225 ? 59.201  47.202  78.433  1.00 10.00 ? 225 PHE D O   1 
ATOM 10812 C CB  . PHE D 1 225 ? 59.031  48.521  81.402  1.00 10.00 ? 225 PHE D CB  1 
ATOM 10813 C CG  . PHE D 1 225 ? 59.693  47.352  82.156  1.00 10.00 ? 225 PHE D CG  1 
ATOM 10814 C CD1 . PHE D 1 225 ? 60.507  47.643  83.266  1.00 10.00 ? 225 PHE D CD1 1 
ATOM 10815 C CD2 . PHE D 1 225 ? 59.588  46.028  81.769  1.00 10.00 ? 225 PHE D CD2 1 
ATOM 10816 C CE1 . PHE D 1 225 ? 61.201  46.643  83.964  1.00 10.00 ? 225 PHE D CE1 1 
ATOM 10817 C CE2 . PHE D 1 225 ? 60.271  45.025  82.461  1.00 10.00 ? 225 PHE D CE2 1 
ATOM 10818 C CZ  . PHE D 1 225 ? 61.081  45.341  83.561  1.00 10.00 ? 225 PHE D CZ  1 
ATOM 10819 N N   . SER D 1 226 ? 57.713  45.901  79.526  1.00 10.00 ? 226 SER D N   1 
ATOM 10820 C CA  . SER D 1 226 ? 57.982  44.747  78.673  1.00 10.00 ? 226 SER D CA  1 
ATOM 10821 C C   . SER D 1 226 ? 57.065  44.913  77.472  1.00 10.00 ? 226 SER D C   1 
ATOM 10822 O O   . SER D 1 226 ? 57.250  44.265  76.447  1.00 10.00 ? 226 SER D O   1 
ATOM 10823 C CB  . SER D 1 226 ? 57.717  43.406  79.397  1.00 10.00 ? 226 SER D CB  1 
ATOM 10824 O OG  . SER D 1 226 ? 58.719  42.461  79.056  1.00 10.00 ? 226 SER D OG  1 
ATOM 10825 N N   . PHE D 1 227 ? 56.069  45.791  77.609  1.00 10.00 ? 227 PHE D N   1 
ATOM 10826 C CA  . PHE D 1 227 ? 55.155  46.065  76.486  1.00 10.00 ? 227 PHE D CA  1 
ATOM 10827 C C   . PHE D 1 227 ? 55.940  46.953  75.547  1.00 10.00 ? 227 PHE D C   1 
ATOM 10828 O O   . PHE D 1 227 ? 55.946  46.727  74.344  1.00 10.00 ? 227 PHE D O   1 
ATOM 10829 C CB  . PHE D 1 227 ? 53.866  46.810  76.915  1.00 10.00 ? 227 PHE D CB  1 
ATOM 10830 C CG  . PHE D 1 227 ? 52.903  47.130  75.764  1.00 10.00 ? 227 PHE D CG  1 
ATOM 10831 C CD1 . PHE D 1 227 ? 51.530  46.954  75.933  1.00 10.00 ? 227 PHE D CD1 1 
ATOM 10832 C CD2 . PHE D 1 227 ? 53.368  47.591  74.529  1.00 10.00 ? 227 PHE D CD2 1 
ATOM 10833 C CE1 . PHE D 1 227 ? 50.638  47.223  74.889  1.00 10.00 ? 227 PHE D CE1 1 
ATOM 10834 C CE2 . PHE D 1 227 ? 52.503  47.862  73.484  1.00 10.00 ? 227 PHE D CE2 1 
ATOM 10835 C CZ  . PHE D 1 227 ? 51.125  47.677  73.658  1.00 10.00 ? 227 PHE D CZ  1 
ATOM 10836 N N   . LEU D 1 228 ? 56.595  47.973  76.096  1.00 10.00 ? 228 LEU D N   1 
ATOM 10837 C CA  . LEU D 1 228 ? 57.376  48.864  75.255  1.00 10.00 ? 228 LEU D CA  1 
ATOM 10838 C C   . LEU D 1 228 ? 58.590  48.141  74.694  1.00 10.00 ? 228 LEU D C   1 
ATOM 10839 O O   . LEU D 1 228 ? 59.062  48.485  73.615  1.00 10.00 ? 228 LEU D O   1 
ATOM 10840 C CB  . LEU D 1 228 ? 57.778  50.127  76.017  1.00 10.00 ? 228 LEU D CB  1 
ATOM 10841 C CG  . LEU D 1 228 ? 56.596  51.116  76.092  1.00 10.00 ? 228 LEU D CG  1 
ATOM 10842 C CD1 . LEU D 1 228 ? 55.578  50.707  77.185  1.00 10.00 ? 228 LEU D CD1 1 
ATOM 10843 C CD2 . LEU D 1 228 ? 57.153  52.523  76.352  1.00 10.00 ? 228 LEU D CD2 1 
ATOM 10844 N N   . THR D 1 229 ? 59.095  47.149  75.428  1.00 10.00 ? 229 THR D N   1 
ATOM 10845 C CA  . THR D 1 229 ? 60.209  46.342  74.936  1.00 10.00 ? 229 THR D CA  1 
ATOM 10846 C C   . THR D 1 229 ? 59.612  45.442  73.883  1.00 10.00 ? 229 THR D C   1 
ATOM 10847 O O   . THR D 1 229 ? 60.211  45.193  72.844  1.00 10.00 ? 229 THR D O   1 
ATOM 10848 C CB  . THR D 1 229 ? 60.802  45.399  75.978  1.00 10.00 ? 229 THR D CB  1 
ATOM 10849 O OG1 . THR D 1 229 ? 59.760  44.583  76.532  1.00 10.00 ? 229 THR D OG1 1 
ATOM 10850 C CG2 . THR D 1 229 ? 61.540  46.185  77.042  1.00 10.00 ? 229 THR D CG2 1 
ATOM 10851 N N   . VAL D 1 230 ? 58.424  44.930  74.174  1.00 10.00 ? 230 VAL D N   1 
ATOM 10852 C CA  . VAL D 1 230 ? 57.755  44.060  73.223  1.00 10.00 ? 230 VAL D CA  1 
ATOM 10853 C C   . VAL D 1 230 ? 57.573  44.953  71.998  1.00 10.00 ? 230 VAL D C   1 
ATOM 10854 O O   . VAL D 1 230 ? 57.837  44.539  70.871  1.00 10.00 ? 230 VAL D O   1 
ATOM 10855 C CB  . VAL D 1 230 ? 56.407  43.493  73.808  1.00 10.00 ? 230 VAL D CB  1 
ATOM 10856 C CG1 . VAL D 1 230 ? 55.203  44.326  73.402  1.00 10.00 ? 230 VAL D CG1 1 
ATOM 10857 C CG2 . VAL D 1 230 ? 56.228  42.049  73.368  1.00 10.00 ? 230 VAL D CG2 1 
ATOM 10858 N N   . LEU D 1 231 ? 57.168  46.199  72.226  1.00 10.00 ? 231 LEU D N   1 
ATOM 10859 C CA  . LEU D 1 231 ? 57.028  47.149  71.127  1.00 10.00 ? 231 LEU D CA  1 
ATOM 10860 C C   . LEU D 1 231 ? 58.431  47.227  70.546  1.00 10.00 ? 231 LEU D C   1 
ATOM 10861 O O   . LEU D 1 231 ? 58.623  47.144  69.334  1.00 10.00 ? 231 LEU D O   1 
ATOM 10862 C CB  . LEU D 1 231 ? 56.605  48.529  71.638  1.00 10.00 ? 231 LEU D CB  1 
ATOM 10863 C CG  . LEU D 1 231 ? 55.135  48.719  72.008  1.00 10.00 ? 231 LEU D CG  1 
ATOM 10864 C CD1 . LEU D 1 231 ? 54.927  50.104  72.600  1.00 10.00 ? 231 LEU D CD1 1 
ATOM 10865 C CD2 . LEU D 1 231 ? 54.270  48.525  70.773  1.00 10.00 ? 231 LEU D CD2 1 
ATOM 10866 N N   . VAL D 1 232 ? 59.407  47.383  71.436  1.00 10.00 ? 232 VAL D N   1 
ATOM 10867 C CA  . VAL D 1 232 ? 60.830  47.432  71.054  1.00 10.00 ? 232 VAL D CA  1 
ATOM 10868 C C   . VAL D 1 232 ? 61.116  46.431  69.955  1.00 10.00 ? 232 VAL D C   1 
ATOM 10869 O O   . VAL D 1 232 ? 61.737  46.755  68.939  1.00 10.00 ? 232 VAL D O   1 
ATOM 10870 C CB  . VAL D 1 232 ? 61.785  47.044  72.229  1.00 10.00 ? 232 VAL D CB  1 
ATOM 10871 C CG1 . VAL D 1 232 ? 63.189  46.680  71.700  1.00 10.00 ? 232 VAL D CG1 1 
ATOM 10872 C CG2 . VAL D 1 232 ? 61.824  48.164  73.240  1.00 10.00 ? 232 VAL D CG2 1 
ATOM 10873 N N   . PHE D 1 233 ? 60.663  45.202  70.167  1.00 10.00 ? 233 PHE D N   1 
ATOM 10874 C CA  . PHE D 1 233 ? 60.928  44.165  69.186  1.00 10.00 ? 233 PHE D CA  1 
ATOM 10875 C C   . PHE D 1 233 ? 59.963  44.214  67.989  1.00 10.00 ? 233 PHE D C   1 
ATOM 10876 O O   . PHE D 1 233 ? 60.416  44.209  66.856  1.00 10.00 ? 233 PHE D O   1 
ATOM 10877 C CB  . PHE D 1 233 ? 60.872  42.763  69.805  1.00 10.00 ? 233 PHE D CB  1 
ATOM 10878 C CG  . PHE D 1 233 ? 61.526  42.609  71.189  1.00 10.00 ? 233 PHE D CG  1 
ATOM 10879 C CD1 . PHE D 1 233 ? 60.740  42.639  72.355  1.00 10.00 ? 233 PHE D CD1 1 
ATOM 10880 C CD2 . PHE D 1 233 ? 62.862  42.237  71.316  1.00 10.00 ? 233 PHE D CD2 1 
ATOM 10881 C CE1 . PHE D 1 233 ? 61.264  42.293  73.592  1.00 10.00 ? 233 PHE D CE1 1 
ATOM 10882 C CE2 . PHE D 1 233 ? 63.399  41.882  72.569  1.00 10.00 ? 233 PHE D CE2 1 
ATOM 10883 C CZ  . PHE D 1 233 ? 62.596  41.909  73.700  1.00 10.00 ? 233 PHE D CZ  1 
ATOM 10884 N N   . TYR D 1 234 ? 58.648  44.269  68.236  1.00 10.00 ? 234 TYR D N   1 
ATOM 10885 C CA  . TYR D 1 234 ? 57.642  44.308  67.166  1.00 10.00 ? 234 TYR D CA  1 
ATOM 10886 C C   . TYR D 1 234 ? 57.711  45.521  66.221  1.00 10.00 ? 234 TYR D C   1 
ATOM 10887 O O   . TYR D 1 234 ? 57.442  45.398  65.026  1.00 10.00 ? 234 TYR D O   1 
ATOM 10888 C CB  . TYR D 1 234 ? 56.225  44.268  67.754  1.00 10.00 ? 234 TYR D CB  1 
ATOM 10889 C CG  . TYR D 1 234 ? 55.802  42.956  68.379  1.00 10.00 ? 234 TYR D CG  1 
ATOM 10890 C CD1 . TYR D 1 234 ? 56.357  42.516  69.579  1.00 10.00 ? 234 TYR D CD1 1 
ATOM 10891 C CD2 . TYR D 1 234 ? 54.817  42.169  67.782  1.00 10.00 ? 234 TYR D CD2 1 
ATOM 10892 C CE1 . TYR D 1 234 ? 55.939  41.325  70.174  1.00 10.00 ? 234 TYR D CE1 1 
ATOM 10893 C CE2 . TYR D 1 234 ? 54.392  40.976  68.367  1.00 10.00 ? 234 TYR D CE2 1 
ATOM 10894 C CZ  . TYR D 1 234 ? 54.957  40.561  69.563  1.00 10.00 ? 234 TYR D CZ  1 
ATOM 10895 O OH  . TYR D 1 234 ? 54.542  39.386  70.148  1.00 10.00 ? 234 TYR D OH  1 
ATOM 10896 N N   . LEU D 1 235 ? 58.058  46.699  66.749  1.00 10.00 ? 235 LEU D N   1 
ATOM 10897 C CA  . LEU D 1 235 ? 58.086  47.899  65.917  1.00 10.00 ? 235 LEU D CA  1 
ATOM 10898 C C   . LEU D 1 235 ? 58.896  47.764  64.616  1.00 10.00 ? 235 LEU D C   1 
ATOM 10899 O O   . LEU D 1 235 ? 58.374  48.049  63.544  1.00 10.00 ? 235 LEU D O   1 
ATOM 10900 C CB  . LEU D 1 235 ? 58.517  49.108  66.760  1.00 10.00 ? 235 LEU D CB  1 
ATOM 10901 C CG  . LEU D 1 235 ? 57.650  49.317  67.995  1.00 10.00 ? 235 LEU D CG  1 
ATOM 10902 C CD1 . LEU D 1 235 ? 57.913  50.679  68.501  1.00 10.00 ? 235 LEU D CD1 1 
ATOM 10903 C CD2 . LEU D 1 235 ? 56.219  49.163  67.720  1.00 10.00 ? 235 LEU D CD2 1 
ATOM 10904 N N   . PRO D 1 236 ? 60.174  47.346  64.683  1.00 10.00 ? 236 PRO D N   1 
ATOM 10905 C CA  . PRO D 1 236 ? 60.926  47.203  63.431  1.00 10.00 ? 236 PRO D CA  1 
ATOM 10906 C C   . PRO D 1 236 ? 60.221  46.389  62.323  1.00 10.00 ? 236 PRO D C   1 
ATOM 10907 O O   . PRO D 1 236 ? 60.623  46.449  61.167  1.00 10.00 ? 236 PRO D O   1 
ATOM 10908 C CB  . PRO D 1 236 ? 62.235  46.545  63.892  1.00 10.00 ? 236 PRO D CB  1 
ATOM 10909 C CG  . PRO D 1 236 ? 61.944  46.035  65.368  1.00 10.00 ? 236 PRO D CG  1 
ATOM 10910 C CD  . PRO D 1 236 ? 61.017  47.098  65.872  1.00 10.00 ? 236 PRO D CD  1 
ATOM 10911 N N   . THR D 1 237 ? 59.224  45.592  62.705  1.00 10.00 ? 237 THR D N   1 
ATOM 10912 C CA  . THR D 1 237 ? 58.444  44.744  61.756  1.00 10.00 ? 237 THR D CA  1 
ATOM 10913 C C   . THR D 1 237 ? 57.246  45.556  61.239  1.00 10.00 ? 237 THR D C   1 
ATOM 10914 O O   . THR D 1 237 ? 56.986  45.636  60.035  1.00 10.00 ? 237 THR D O   1 
ATOM 10915 C CB  . THR D 1 237 ? 57.834  43.369  62.425  1.00 10.00 ? 237 THR D CB  1 
ATOM 10916 O OG1 . THR D 1 237 ? 58.667  42.222  62.149  1.00 10.00 ? 237 THR D OG1 1 
ATOM 10917 C CG2 . THR D 1 237 ? 56.401  43.074  61.866  1.00 10.00 ? 237 THR D CG2 1 
ATOM 10918 N N   . ASP D 1 238 ? 56.541  46.176  62.179  1.00 10.00 ? 238 ASP D N   1 
ATOM 10919 C CA  . ASP D 1 238 ? 55.318  46.941  61.913  1.00 10.00 ? 238 ASP D CA  1 
ATOM 10920 C C   . ASP D 1 238 ? 55.576  48.425  61.711  1.00 10.00 ? 238 ASP D C   1 
ATOM 10921 O O   . ASP D 1 238 ? 54.728  49.132  61.165  1.00 10.00 ? 238 ASP D O   1 
ATOM 10922 C CB  . ASP D 1 238 ? 54.317  46.749  63.065  1.00 10.00 ? 238 ASP D CB  1 
ATOM 10923 C CG  . ASP D 1 238 ? 52.915  46.386  62.583  1.00 10.00 ? 238 ASP D CG  1 
ATOM 10924 O OD1 . ASP D 1 238 ? 52.449  46.943  61.586  1.00 10.00 ? 238 ASP D OD1 1 
ATOM 10925 O OD2 . ASP D 1 238 ? 52.248  45.537  63.199  1.00 10.00 ? 238 ASP D OD2 1 
ATOM 10926 N N   . SER D 1 239 ? 56.757  48.875  62.118  1.00 10.00 ? 239 SER D N   1 
ATOM 10927 C CA  . SER D 1 239 ? 57.114  50.278  62.022  1.00 10.00 ? 239 SER D CA  1 
ATOM 10928 C C   . SER D 1 239 ? 58.601  50.488  62.296  1.00 10.00 ? 239 SER D C   1 
ATOM 10929 O O   . SER D 1 239 ? 58.990  51.299  63.145  1.00 10.00 ? 239 SER D O   1 
ATOM 10930 C CB  . SER D 1 239 ? 56.294  51.083  63.042  1.00 10.00 ? 239 SER D CB  1 
ATOM 10931 O OG  . SER D 1 239 ? 54.885  50.827  62.961  1.00 10.00 ? 239 SER D OG  1 
ATOM 10932 N N   . GLY D 1 240 ? 59.463  49.781  61.570  1.00 10.00 ? 240 GLY D N   1 
ATOM 10933 C CA  . GLY D 1 240 ? 60.883  49.968  61.830  1.00 10.00 ? 240 GLY D CA  1 
ATOM 10934 C C   . GLY D 1 240 ? 61.240  51.397  61.480  1.00 10.00 ? 240 GLY D C   1 
ATOM 10935 O O   . GLY D 1 240 ? 62.247  51.921  61.926  1.00 10.00 ? 240 GLY D O   1 
ATOM 10936 N N   . GLU D 1 241 ? 60.380  51.977  60.645  1.00 10.00 ? 241 GLU D N   1 
ATOM 10937 C CA  . GLU D 1 241 ? 60.523  53.370  60.237  1.00 10.00 ? 241 GLU D CA  1 
ATOM 10938 C C   . GLU D 1 241 ? 60.565  54.296  61.446  1.00 10.00 ? 241 GLU D C   1 
ATOM 10939 O O   . GLU D 1 241 ? 60.611  55.514  61.351  1.00 10.00 ? 241 GLU D O   1 
ATOM 10940 C CB  . GLU D 1 241 ? 59.386  53.771  59.297  1.00 10.00 ? 241 GLU D CB  1 
ATOM 10941 C CG  . GLU D 1 241 ? 59.332  52.966  58.007  1.00 10.00 ? 241 GLU D CG  1 
ATOM 10942 C CD  . GLU D 1 241 ? 58.466  51.729  58.130  1.00 10.00 ? 241 GLU D CD  1 
ATOM 10943 O OE1 . GLU D 1 241 ? 57.897  51.506  59.220  1.00 10.00 ? 241 GLU D OE1 1 
ATOM 10944 O OE2 . GLU D 1 241 ? 58.356  50.980  57.137  1.00 10.00 ? 241 GLU D OE2 1 
ATOM 10945 N N   . LYS D 1 242 ? 60.577  53.672  62.648  1.00 10.00 ? 242 LYS D N   1 
ATOM 10946 C CA  . LYS D 1 242 ? 60.625  54.401  63.901  1.00 10.00 ? 242 LYS D CA  1 
ATOM 10947 C C   . LYS D 1 242 ? 61.609  53.749  64.889  1.00 10.00 ? 242 LYS D C   1 
ATOM 10948 O O   . LYS D 1 242 ? 61.351  53.649  66.087  1.00 10.00 ? 242 LYS D O   1 
ATOM 10949 C CB  . LYS D 1 242 ? 59.218  54.496  64.498  1.00 10.00 ? 242 LYS D CB  1 
ATOM 10950 C CG  . LYS D 1 242 ? 58.641  53.195  65.015  1.00 10.00 ? 242 LYS D CG  1 
ATOM 10951 C CD  . LYS D 1 242 ? 57.151  53.333  65.276  1.00 10.00 ? 242 LYS D CD  1 
ATOM 10952 C CE  . LYS D 1 242 ? 56.592  52.106  65.965  1.00 10.00 ? 242 LYS D CE  1 
ATOM 10953 N NZ  . LYS D 1 242 ? 55.117  52.184  66.117  1.00 10.00 ? 242 LYS D NZ  1 
ATOM 10954 N N   . MET D 1 243 ? 62.740  53.313  64.340  1.00 10.00 ? 243 MET D N   1 
ATOM 10955 C CA  . MET D 1 243 ? 63.841  52.699  65.075  1.00 10.00 ? 243 MET D CA  1 
ATOM 10956 C C   . MET D 1 243 ? 64.391  53.733  66.066  1.00 10.00 ? 243 MET D C   1 
ATOM 10957 O O   . MET D 1 243 ? 64.741  53.435  67.208  1.00 10.00 ? 243 MET D O   1 
ATOM 10958 C CB  . MET D 1 243 ? 64.947  52.267  64.080  1.00 10.00 ? 243 MET D CB  1 
ATOM 10959 C CG  . MET D 1 243 ? 65.274  53.256  62.942  1.00 10.00 ? 243 MET D CG  1 
ATOM 10960 S SD  . MET D 1 243 ? 64.175  53.241  61.501  1.00 10.00 ? 243 MET D SD  1 
ATOM 10961 C CE  . MET D 1 243 ? 63.297  54.637  61.715  1.00 10.00 ? 243 MET D CE  1 
ATOM 10962 N N   . THR D 1 244 ? 64.479  54.966  65.571  1.00 10.00 ? 244 THR D N   1 
ATOM 10963 C CA  . THR D 1 244 ? 64.962  56.105  66.355  1.00 10.00 ? 244 THR D CA  1 
ATOM 10964 C C   . THR D 1 244 ? 63.957  56.316  67.450  1.00 10.00 ? 244 THR D C   1 
ATOM 10965 O O   . THR D 1 244 ? 64.290  56.611  68.599  1.00 10.00 ? 244 THR D O   1 
ATOM 10966 C CB  . THR D 1 244 ? 64.946  57.404  65.563  1.00 10.00 ? 244 THR D CB  1 
ATOM 10967 O OG1 . THR D 1 244 ? 65.090  58.498  66.470  1.00 10.00 ? 244 THR D OG1 1 
ATOM 10968 C CG2 . THR D 1 244 ? 63.612  57.580  64.870  1.00 10.00 ? 244 THR D CG2 1 
ATOM 10969 N N   . LEU D 1 245 ? 62.703  56.209  67.038  1.00 10.00 ? 245 LEU D N   1 
ATOM 10970 C CA  . LEU D 1 245 ? 61.589  56.360  67.937  1.00 10.00 ? 245 LEU D CA  1 
ATOM 10971 C C   . LEU D 1 245 ? 61.902  55.390  69.053  1.00 10.00 ? 245 LEU D C   1 
ATOM 10972 O O   . LEU D 1 245 ? 61.810  55.725  70.234  1.00 10.00 ? 245 LEU D O   1 
ATOM 10973 C CB  . LEU D 1 245 ? 60.316  55.951  67.230  1.00 10.00 ? 245 LEU D CB  1 
ATOM 10974 C CG  . LEU D 1 245 ? 58.998  56.285  67.899  1.00 10.00 ? 245 LEU D CG  1 
ATOM 10975 C CD1 . LEU D 1 245 ? 57.907  55.847  66.978  1.00 10.00 ? 245 LEU D CD1 1 
ATOM 10976 C CD2 . LEU D 1 245 ? 58.874  55.598  69.217  1.00 10.00 ? 245 LEU D CD2 1 
ATOM 10977 N N   . SER D 1 246 ? 62.300  54.188  68.655  1.00 10.00 ? 246 SER D N   1 
ATOM 10978 C CA  . SER D 1 246 ? 62.659  53.135  69.596  1.00 10.00 ? 246 SER D CA  1 
ATOM 10979 C C   . SER D 1 246 ? 63.736  53.675  70.530  1.00 10.00 ? 246 SER D C   1 
ATOM 10980 O O   . SER D 1 246 ? 63.668  53.475  71.745  1.00 10.00 ? 246 SER D O   1 
ATOM 10981 C CB  . SER D 1 246 ? 63.172  51.903  68.844  1.00 10.00 ? 246 SER D CB  1 
ATOM 10982 O OG  . SER D 1 246 ? 63.586  50.889  69.743  1.00 10.00 ? 246 SER D OG  1 
ATOM 10983 N N   . ILE D 1 247 ? 64.733  54.344  69.954  1.00 10.00 ? 247 ILE D N   1 
ATOM 10984 C CA  . ILE D 1 247 ? 65.794  54.952  70.729  1.00 10.00 ? 247 ILE D CA  1 
ATOM 10985 C C   . ILE D 1 247 ? 65.188  55.854  71.786  1.00 10.00 ? 247 ILE D C   1 
ATOM 10986 O O   . ILE D 1 247 ? 65.527  55.759  72.974  1.00 10.00 ? 247 ILE D O   1 
ATOM 10987 C CB  . ILE D 1 247 ? 66.729  55.770  69.837  1.00 10.00 ? 247 ILE D CB  1 
ATOM 10988 C CG1 . ILE D 1 247 ? 68.071  55.043  69.657  1.00 10.00 ? 247 ILE D CG1 1 
ATOM 10989 C CG2 . ILE D 1 247 ? 66.950  57.129  70.429  1.00 10.00 ? 247 ILE D CG2 1 
ATOM 10990 C CD1 . ILE D 1 247 ? 68.728  54.493  70.938  1.00 10.00 ? 247 ILE D CD1 1 
ATOM 10991 N N   . SER D 1 248 ? 64.305  56.744  71.361  1.00 10.00 ? 248 SER D N   1 
ATOM 10992 C CA  . SER D 1 248 ? 63.689  57.629  72.341  1.00 10.00 ? 248 SER D CA  1 
ATOM 10993 C C   . SER D 1 248 ? 63.096  56.839  73.501  1.00 10.00 ? 248 SER D C   1 
ATOM 10994 O O   . SER D 1 248 ? 63.083  57.324  74.662  1.00 10.00 ? 248 SER D O   1 
ATOM 10995 C CB  . SER D 1 248 ? 62.613  58.493  71.679  1.00 10.00 ? 248 SER D CB  1 
ATOM 10996 O OG  . SER D 1 248 ? 61.371  57.813  71.630  1.00 10.00 ? 248 SER D OG  1 
ATOM 10997 N N   . VAL D 1 249 ? 62.433  55.735  73.196  1.00 10.00 ? 249 VAL D N   1 
ATOM 10998 C CA  . VAL D 1 249 ? 61.772  55.039  74.283  1.00 10.00 ? 249 VAL D CA  1 
ATOM 10999 C C   . VAL D 1 249 ? 62.745  54.284  75.163  1.00 10.00 ? 249 VAL D C   1 
ATOM 11000 O O   . VAL D 1 249 ? 62.433  53.929  76.295  1.00 10.00 ? 249 VAL D O   1 
ATOM 11001 C CB  . VAL D 1 249 ? 60.612  54.180  73.752  1.00 10.00 ? 249 VAL D CB  1 
ATOM 11002 C CG1 . VAL D 1 249 ? 59.514  54.059  74.833  1.00 10.00 ? 249 VAL D CG1 1 
ATOM 11003 C CG2 . VAL D 1 249 ? 60.046  54.830  72.491  1.00 10.00 ? 249 VAL D CG2 1 
ATOM 11004 N N   . LEU D 1 250 ? 63.957  54.084  74.660  1.00 10.00 ? 250 LEU D N   1 
ATOM 11005 C CA  . LEU D 1 250 ? 64.922  53.415  75.487  1.00 10.00 ? 250 LEU D CA  1 
ATOM 11006 C C   . LEU D 1 250 ? 65.472  54.506  76.447  1.00 10.00 ? 250 LEU D C   1 
ATOM 11007 O O   . LEU D 1 250 ? 65.547  54.248  77.642  1.00 10.00 ? 250 LEU D O   1 
ATOM 11008 C CB  . LEU D 1 250 ? 65.911  52.629  74.595  1.00 10.00 ? 250 LEU D CB  1 
ATOM 11009 C CG  . LEU D 1 250 ? 65.160  51.309  74.248  1.00 10.00 ? 250 LEU D CG  1 
ATOM 11010 C CD1 . LEU D 1 250 ? 65.033  51.007  72.753  1.00 10.00 ? 250 LEU D CD1 1 
ATOM 11011 C CD2 . LEU D 1 250 ? 65.878  50.229  74.998  1.00 10.00 ? 250 LEU D CD2 1 
ATOM 11012 N N   . LEU D 1 251 ? 65.807  55.716  75.973  1.00 10.00 ? 251 LEU D N   1 
ATOM 11013 C CA  . LEU D 1 251 ? 66.166  56.793  76.901  1.00 10.00 ? 251 LEU D CA  1 
ATOM 11014 C C   . LEU D 1 251 ? 65.008  56.876  77.939  1.00 10.00 ? 251 LEU D C   1 
ATOM 11015 O O   . LEU D 1 251 ? 65.267  57.010  79.150  1.00 10.00 ? 251 LEU D O   1 
ATOM 11016 C CB  . LEU D 1 251 ? 66.292  58.127  76.157  1.00 10.00 ? 251 LEU D CB  1 
ATOM 11017 C CG  . LEU D 1 251 ? 67.359  58.164  75.069  1.00 10.00 ? 251 LEU D CG  1 
ATOM 11018 C CD1 . LEU D 1 251 ? 67.740  59.598  74.677  1.00 10.00 ? 251 LEU D CD1 1 
ATOM 11019 C CD2 . LEU D 1 251 ? 68.656  57.478  75.482  1.00 10.00 ? 251 LEU D CD2 1 
ATOM 11020 N N   . SER D 1 252 ? 63.749  56.763  77.392  1.00 10.00 ? 252 SER D N   1 
ATOM 11021 C CA  . SER D 1 252 ? 62.465  56.809  78.190  1.00 10.00 ? 252 SER D CA  1 
ATOM 11022 C C   . SER D 1 252 ? 62.531  55.721  79.261  1.00 10.00 ? 252 SER D C   1 
ATOM 11023 O O   . SER D 1 252 ? 62.900  55.981  80.415  1.00 10.00 ? 252 SER D O   1 
ATOM 11024 C CB  . SER D 1 252 ? 61.229  56.561  77.323  1.00 10.00 ? 252 SER D CB  1 
ATOM 11025 O OG  . SER D 1 252 ? 60.314  55.714  78.019  1.00 10.00 ? 252 SER D OG  1 
ATOM 11026 N N   . LEU D 1 253 ? 62.336  54.493  78.775  1.00 10.00 ? 253 LEU D N   1 
ATOM 11027 C CA  . LEU D 1 253 ? 62.420  53.210  79.481  1.00 10.00 ? 253 LEU D CA  1 
ATOM 11028 C C   . LEU D 1 253 ? 63.506  53.204  80.546  1.00 10.00 ? 253 LEU D C   1 
ATOM 11029 O O   . LEU D 1 253 ? 63.279  53.059  81.760  1.00 10.00 ? 253 LEU D O   1 
ATOM 11030 C CB  . LEU D 1 253 ? 62.762  52.113  78.433  1.00 10.00 ? 253 LEU D CB  1 
ATOM 11031 C CG  . LEU D 1 253 ? 63.967  51.124  78.397  1.00 10.00 ? 253 LEU D CG  1 
ATOM 11032 C CD1 . LEU D 1 253 ? 63.752  50.172  77.243  1.00 10.00 ? 253 LEU D CD1 1 
ATOM 11033 C CD2 . LEU D 1 253 ? 65.296  51.762  78.180  1.00 10.00 ? 253 LEU D CD2 1 
ATOM 11034 N N   . THR D 1 254 ? 64.713  53.359  80.040  1.00 10.00 ? 254 THR D N   1 
ATOM 11035 C CA  . THR D 1 254 ? 65.920  53.330  80.857  1.00 10.00 ? 254 THR D CA  1 
ATOM 11036 C C   . THR D 1 254 ? 65.825  54.278  82.017  1.00 10.00 ? 254 THR D C   1 
ATOM 11037 O O   . THR D 1 254 ? 65.929  53.867  83.169  1.00 10.00 ? 254 THR D O   1 
ATOM 11038 C CB  . THR D 1 254 ? 67.231  53.617  80.026  1.00 10.00 ? 254 THR D CB  1 
ATOM 11039 O OG1 . THR D 1 254 ? 68.377  53.456  80.867  1.00 10.00 ? 254 THR D OG1 1 
ATOM 11040 C CG2 . THR D 1 254 ? 67.258  55.008  79.489  1.00 10.00 ? 254 THR D CG2 1 
ATOM 11041 N N   . VAL D 1 255 ? 65.584  55.540  81.717  1.00 10.00 ? 255 VAL D N   1 
ATOM 11042 C CA  . VAL D 1 255 ? 65.475  56.527  82.781  1.00 10.00 ? 255 VAL D CA  1 
ATOM 11043 C C   . VAL D 1 255 ? 64.356  56.079  83.732  1.00 10.00 ? 255 VAL D C   1 
ATOM 11044 O O   . VAL D 1 255 ? 64.529  56.089  84.946  1.00 10.00 ? 255 VAL D O   1 
ATOM 11045 C CB  . VAL D 1 255 ? 65.195  57.987  82.213  1.00 10.00 ? 255 VAL D CB  1 
ATOM 11046 C CG1 . VAL D 1 255 ? 63.656  58.208  81.991  1.00 10.00 ? 255 VAL D CG1 1 
ATOM 11047 C CG2 . VAL D 1 255 ? 65.830  59.070  83.167  1.00 10.00 ? 255 VAL D CG2 1 
ATOM 11048 N N   . PHE D 1 256 ? 63.246  55.594  83.182  1.00 10.00 ? 256 PHE D N   1 
ATOM 11049 C CA  . PHE D 1 256 ? 62.112  55.207  84.016  1.00 10.00 ? 256 PHE D CA  1 
ATOM 11050 C C   . PHE D 1 256 ? 62.473  54.160  85.044  1.00 10.00 ? 256 PHE D C   1 
ATOM 11051 O O   . PHE D 1 256 ? 62.098  54.276  86.209  1.00 10.00 ? 256 PHE D O   1 
ATOM 11052 C CB  . PHE D 1 256 ? 60.974  54.649  83.185  1.00 10.00 ? 256 PHE D CB  1 
ATOM 11053 C CG  . PHE D 1 256 ? 60.009  55.687  82.687  1.00 10.00 ? 256 PHE D CG  1 
ATOM 11054 C CD1 . PHE D 1 256 ? 58.678  55.648  83.082  1.00 10.00 ? 256 PHE D CD1 1 
ATOM 11055 C CD2 . PHE D 1 256 ? 60.395  56.632  81.751  1.00 10.00 ? 256 PHE D CD2 1 
ATOM 11056 C CE1 . PHE D 1 256 ? 57.763  56.509  82.551  1.00 10.00 ? 256 PHE D CE1 1 
ATOM 11057 C CE2 . PHE D 1 256 ? 59.482  57.492  81.219  1.00 10.00 ? 256 PHE D CE2 1 
ATOM 11058 C CZ  . PHE D 1 256 ? 58.172  57.432  81.611  1.00 10.00 ? 256 PHE D CZ  1 
ATOM 11059 N N   . LEU D 1 257 ? 63.111  53.086  84.593  1.00 10.00 ? 257 LEU D N   1 
ATOM 11060 C CA  . LEU D 1 257 ? 63.454  52.007  85.511  1.00 10.00 ? 257 LEU D CA  1 
ATOM 11061 C C   . LEU D 1 257 ? 64.716  52.310  86.287  1.00 10.00 ? 257 LEU D C   1 
ATOM 11062 O O   . LEU D 1 257 ? 64.895  51.811  87.406  1.00 10.00 ? 257 LEU D O   1 
ATOM 11063 C CB  . LEU D 1 257 ? 63.603  50.678  84.764  1.00 10.00 ? 257 LEU D CB  1 
ATOM 11064 C CG  . LEU D 1 257 ? 64.737  50.645  83.758  1.00 10.00 ? 257 LEU D CG  1 
ATOM 11065 C CD1 . LEU D 1 257 ? 66.053  50.598  84.490  1.00 10.00 ? 257 LEU D CD1 1 
ATOM 11066 C CD2 . LEU D 1 257 ? 64.578  49.449  82.831  1.00 10.00 ? 257 LEU D CD2 1 
ATOM 11067 N N   . LEU D 1 258 ? 65.605  53.108  85.697  1.00 10.00 ? 258 LEU D N   1 
ATOM 11068 C CA  . LEU D 1 258 ? 66.821  53.445  86.423  1.00 10.00 ? 258 LEU D CA  1 
ATOM 11069 C C   . LEU D 1 258 ? 66.212  54.180  87.609  1.00 10.00 ? 258 LEU D C   1 
ATOM 11070 O O   . LEU D 1 258 ? 66.663  54.055  88.747  1.00 10.00 ? 258 LEU D O   1 
ATOM 11071 C CB  . LEU D 1 258 ? 67.762  54.354  85.600  1.00 10.00 ? 258 LEU D CB  1 
ATOM 11072 C CG  . LEU D 1 258 ? 68.939  53.708  84.848  1.00 10.00 ? 258 LEU D CG  1 
ATOM 11073 C CD1 . LEU D 1 258 ? 68.514  53.242  83.485  1.00 10.00 ? 258 LEU D CD1 1 
ATOM 11074 C CD2 . LEU D 1 258 ? 70.078  54.707  84.733  1.00 10.00 ? 258 LEU D CD2 1 
ATOM 11075 N N   . VAL D 1 259 ? 65.133  54.904  87.319  1.00 10.00 ? 259 VAL D N   1 
ATOM 11076 C CA  . VAL D 1 259 ? 64.395  55.639  88.330  1.00 10.00 ? 259 VAL D CA  1 
ATOM 11077 C C   . VAL D 1 259 ? 63.558  54.652  89.164  1.00 10.00 ? 259 VAL D C   1 
ATOM 11078 O O   . VAL D 1 259 ? 63.234  54.926  90.322  1.00 10.00 ? 259 VAL D O   1 
ATOM 11079 C CB  . VAL D 1 259 ? 63.524  56.705  87.632  1.00 10.00 ? 259 VAL D CB  1 
ATOM 11080 C CG1 . VAL D 1 259 ? 62.836  57.660  88.664  1.00 10.00 ? 259 VAL D CG1 1 
ATOM 11081 C CG2 . VAL D 1 259 ? 64.415  57.490  86.722  1.00 10.00 ? 259 VAL D CG2 1 
ATOM 11082 N N   . ILE D 1 260 ? 63.226  53.496  88.587  1.00 10.00 ? 260 ILE D N   1 
ATOM 11083 C CA  . ILE D 1 260 ? 62.460  52.497  89.321  1.00 10.00 ? 260 ILE D CA  1 
ATOM 11084 C C   . ILE D 1 260 ? 63.375  51.952  90.400  1.00 10.00 ? 260 ILE D C   1 
ATOM 11085 O O   . ILE D 1 260 ? 62.955  51.737  91.539  1.00 10.00 ? 260 ILE D O   1 
ATOM 11086 C CB  . ILE D 1 260 ? 62.000  51.324  88.420  1.00 10.00 ? 260 ILE D CB  1 
ATOM 11087 C CG1 . ILE D 1 260 ? 60.843  51.776  87.526  1.00 10.00 ? 260 ILE D CG1 1 
ATOM 11088 C CG2 . ILE D 1 260 ? 61.574  50.133  89.279  1.00 10.00 ? 260 ILE D CG2 1 
ATOM 11089 C CD1 . ILE D 1 260 ? 60.323  50.697  86.596  1.00 10.00 ? 260 ILE D CD1 1 
ATOM 11090 N N   . VAL D 1 261 ? 64.635  51.726  90.045  1.00 10.00 ? 261 VAL D N   1 
ATOM 11091 C CA  . VAL D 1 261 ? 65.556  51.223  91.038  1.00 10.00 ? 261 VAL D CA  1 
ATOM 11092 C C   . VAL D 1 261 ? 65.800  52.262  92.131  1.00 10.00 ? 261 VAL D C   1 
ATOM 11093 O O   . VAL D 1 261 ? 66.170  51.902  93.220  1.00 10.00 ? 261 VAL D O   1 
ATOM 11094 C CB  . VAL D 1 261 ? 66.868  50.697  90.389  1.00 10.00 ? 261 VAL D CB  1 
ATOM 11095 C CG1 . VAL D 1 261 ? 67.959  50.552  91.425  1.00 10.00 ? 261 VAL D CG1 1 
ATOM 11096 C CG2 . VAL D 1 261 ? 66.579  49.313  89.751  1.00 10.00 ? 261 VAL D CG2 1 
ATOM 11097 N N   . GLU D 1 262 ? 65.566  53.558  91.855  1.00 10.00 ? 262 GLU D N   1 
ATOM 11098 C CA  . GLU D 1 262 ? 65.698  54.584  92.882  1.00 10.00 ? 262 GLU D CA  1 
ATOM 11099 C C   . GLU D 1 262 ? 64.706  54.358  94.017  1.00 10.00 ? 262 GLU D C   1 
ATOM 11100 O O   . GLU D 1 262 ? 65.014  54.349  95.208  1.00 10.00 ? 262 GLU D O   1 
ATOM 11101 C CB  . GLU D 1 262 ? 65.511  55.975  92.275  1.00 10.00 ? 262 GLU D CB  1 
ATOM 11102 C CG  . GLU D 1 262 ? 66.438  56.272  91.109  1.00 10.00 ? 262 GLU D CG  1 
ATOM 11103 C CD  . GLU D 1 262 ? 65.881  57.331  90.176  1.00 10.00 ? 262 GLU D CD  1 
ATOM 11104 O OE1 . GLU D 1 262 ? 64.720  57.745  90.374  1.00 10.00 ? 262 GLU D OE1 1 
ATOM 11105 O OE2 . GLU D 1 262 ? 66.606  57.747  89.248  1.00 10.00 ? 262 GLU D OE2 1 
ATOM 11106 N N   . LEU D 1 263 ? 63.476  54.060  93.583  1.00 10.00 ? 263 LEU D N   1 
ATOM 11107 C CA  . LEU D 1 263 ? 62.370  53.780  94.464  1.00 10.00 ? 263 LEU D CA  1 
ATOM 11108 C C   . LEU D 1 263 ? 62.716  52.594  95.353  1.00 10.00 ? 263 LEU D C   1 
ATOM 11109 O O   . LEU D 1 263 ? 62.561  52.645  96.573  1.00 10.00 ? 263 LEU D O   1 
ATOM 11110 C CB  . LEU D 1 263 ? 61.139  53.487  93.608  1.00 10.00 ? 263 LEU D CB  1 
ATOM 11111 C CG  . LEU D 1 263 ? 60.576  54.676  92.840  1.00 10.00 ? 263 LEU D CG  1 
ATOM 11112 C CD1 . LEU D 1 263 ? 59.956  54.199  91.593  1.00 10.00 ? 263 LEU D CD1 1 
ATOM 11113 C CD2 . LEU D 1 263 ? 59.574  55.439  93.680  1.00 10.00 ? 263 LEU D CD2 1 
ATOM 11114 N N   . ILE D 1 264 ? 63.166  51.528  94.708  1.00 10.00 ? 264 ILE D N   1 
ATOM 11115 C CA  . ILE D 1 264 ? 63.575  50.286  95.350  1.00 10.00 ? 264 ILE D CA  1 
ATOM 11116 C C   . ILE D 1 264 ? 64.475  50.625  96.565  1.00 10.00 ? 264 ILE D C   1 
ATOM 11117 O O   . ILE D 1 264 ? 64.087  50.415  97.730  1.00 10.00 ? 264 ILE D O   1 
ATOM 11118 C CB  . ILE D 1 264 ? 64.274  49.398  94.269  1.00 10.00 ? 264 ILE D CB  1 
ATOM 11119 C CG1 . ILE D 1 264 ? 63.296  49.248  93.068  1.00 10.00 ? 264 ILE D CG1 1 
ATOM 11120 C CG2 . ILE D 1 264 ? 64.798  48.064  94.930  1.00 10.00 ? 264 ILE D CG2 1 
ATOM 11121 C CD1 . ILE D 1 264 ? 63.920  48.873  91.717  1.00 10.00 ? 264 ILE D CD1 1 
ATOM 11122 N N   . PRO D 1 265 ? 65.693  51.130  96.312  1.00 10.00 ? 265 PRO D N   1 
ATOM 11123 C CA  . PRO D 1 265 ? 66.622  51.510  97.373  1.00 10.00 ? 265 PRO D CA  1 
ATOM 11124 C C   . PRO D 1 265 ? 65.994  52.327  98.504  1.00 10.00 ? 265 PRO D C   1 
ATOM 11125 O O   . PRO D 1 265 ? 66.285  52.098  99.681  1.00 10.00 ? 265 PRO D O   1 
ATOM 11126 C CB  . PRO D 1 265 ? 67.685  52.260  96.585  1.00 10.00 ? 265 PRO D CB  1 
ATOM 11127 C CG  . PRO D 1 265 ? 67.893  51.290  95.459  1.00 10.00 ? 265 PRO D CG  1 
ATOM 11128 C CD  . PRO D 1 265 ? 66.471  50.891  95.078  1.00 10.00 ? 265 PRO D CD  1 
ATOM 11129 N N   . SER D 1 266 ? 65.110  53.250  98.151  1.00 10.00 ? 266 SER D N   1 
ATOM 11130 C CA  . SER D 1 266 ? 64.461  54.055  99.184  1.00 10.00 ? 266 SER D CA  1 
ATOM 11131 C C   . SER D 1 266 ? 63.531  53.149  99.977  1.00 10.00 ? 266 SER D C   1 
ATOM 11132 O O   . SER D 1 266 ? 63.706  52.992  101.180 1.00 10.00 ? 266 SER D O   1 
ATOM 11133 C CB  . SER D 1 266 ? 63.659  55.204  98.571  1.00 10.00 ? 266 SER D CB  1 
ATOM 11134 O OG  . SER D 1 266 ? 62.675  55.674  99.470  1.00 10.00 ? 266 SER D OG  1 
ATOM 11135 N N   . THR D 1 267 ? 62.558  52.547  99.286  1.00 10.00 ? 267 THR D N   1 
ATOM 11136 C CA  . THR D 1 267 ? 61.573  51.631  99.860  1.00 10.00 ? 267 THR D CA  1 
ATOM 11137 C C   . THR D 1 267 ? 62.242  50.458  100.617 1.00 10.00 ? 267 THR D C   1 
ATOM 11138 O O   . THR D 1 267 ? 61.978  50.208  101.807 1.00 10.00 ? 267 THR D O   1 
ATOM 11139 C CB  . THR D 1 267 ? 60.619  51.107  98.703  1.00 10.00 ? 267 THR D CB  1 
ATOM 11140 O OG1 . THR D 1 267 ? 59.757  50.075  99.196  1.00 10.00 ? 267 THR D OG1 1 
ATOM 11141 C CG2 . THR D 1 267 ? 61.401  50.601  97.558  1.00 10.00 ? 267 THR D CG2 1 
ATOM 11142 N N   . SER D 1 268 ? 63.138  49.760  99.930  1.00 10.00 ? 268 SER D N   1 
ATOM 11143 C CA  . SER D 1 268 ? 63.846  48.615  100.504 1.00 10.00 ? 268 SER D CA  1 
ATOM 11144 C C   . SER D 1 268 ? 64.577  49.009  101.786 1.00 10.00 ? 268 SER D C   1 
ATOM 11145 O O   . SER D 1 268 ? 64.423  48.360  102.823 1.00 10.00 ? 268 SER D O   1 
ATOM 11146 C CB  . SER D 1 268 ? 64.828  48.017  99.475  1.00 10.00 ? 268 SER D CB  1 
ATOM 11147 O OG  . SER D 1 268 ? 65.745  47.117  100.088 1.00 10.00 ? 268 SER D OG  1 
ATOM 11148 N N   . SER D 1 269 ? 65.365  50.076  101.730 1.00 10.00 ? 269 SER D N   1 
ATOM 11149 C CA  . SER D 1 269 ? 66.067  50.513  102.911 1.00 10.00 ? 269 SER D CA  1 
ATOM 11150 C C   . SER D 1 269 ? 65.088  51.221  103.864 1.00 10.00 ? 269 SER D C   1 
ATOM 11151 O O   . SER D 1 269 ? 65.402  51.433  105.033 1.00 10.00 ? 269 SER D O   1 
ATOM 11152 C CB  . SER D 1 269 ? 67.235  51.402  102.513 1.00 10.00 ? 269 SER D CB  1 
ATOM 11153 O OG  . SER D 1 269 ? 68.173  50.671  101.756 1.00 10.00 ? 269 SER D OG  1 
ATOM 11154 N N   . ALA D 1 270 ? 63.876  51.470  103.376 1.00 10.00 ? 270 ALA D N   1 
ATOM 11155 C CA  . ALA D 1 270 ? 62.807  52.128  104.130 1.00 10.00 ? 270 ALA D CA  1 
ATOM 11156 C C   . ALA D 1 270 ? 61.880  51.057  104.722 1.00 10.00 ? 270 ALA D C   1 
ATOM 11157 O O   . ALA D 1 270 ? 61.052  51.330  105.600 1.00 10.00 ? 270 ALA D O   1 
ATOM 11158 C CB  . ALA D 1 270 ? 61.999  53.045  103.207 1.00 10.00 ? 270 ALA D CB  1 
ATOM 11159 N N   . VAL D 1 271 ? 62.007  49.841  104.203 1.00 10.00 ? 271 VAL D N   1 
ATOM 11160 C CA  . VAL D 1 271 ? 61.210  48.687  104.653 1.00 10.00 ? 271 VAL D CA  1 
ATOM 11161 C C   . VAL D 1 271 ? 62.094  47.499  104.203 1.00 10.00 ? 271 VAL D C   1 
ATOM 11162 O O   . VAL D 1 271 ? 62.282  47.243  103.012 1.00 10.00 ? 271 VAL D O   1 
ATOM 11163 C CB  . VAL D 1 271 ? 59.768  48.735  104.006 1.00 10.00 ? 271 VAL D CB  1 
ATOM 11164 C CG1 . VAL D 1 271 ? 59.759  48.121  102.636 1.00 10.00 ? 271 VAL D CG1 1 
ATOM 11165 C CG2 . VAL D 1 271 ? 58.752  48.096  104.901 1.00 10.00 ? 271 VAL D CG2 1 
ATOM 11166 N N   . PRO D 1 272 ? 62.640  46.739  105.172 1.00 10.00 ? 272 PRO D N   1 
ATOM 11167 C CA  . PRO D 1 272 ? 63.540  45.583  105.081 1.00 10.00 ? 272 PRO D CA  1 
ATOM 11168 C C   . PRO D 1 272 ? 63.117  44.311  104.394 1.00 10.00 ? 272 PRO D C   1 
ATOM 11169 O O   . PRO D 1 272 ? 61.994  43.858  104.537 1.00 10.00 ? 272 PRO D O   1 
ATOM 11170 C CB  . PRO D 1 272 ? 63.903  45.336  106.533 1.00 10.00 ? 272 PRO D CB  1 
ATOM 11171 C CG  . PRO D 1 272 ? 62.618  45.515  107.168 1.00 10.00 ? 272 PRO D CG  1 
ATOM 11172 C CD  . PRO D 1 272 ? 62.060  46.782  106.524 1.00 10.00 ? 272 PRO D CD  1 
ATOM 11173 N N   . LEU D 1 273 ? 64.080  43.713  103.701 1.00 10.00 ? 273 LEU D N   1 
ATOM 11174 C CA  . LEU D 1 273 ? 63.876  42.488  102.947 1.00 10.00 ? 273 LEU D CA  1 
ATOM 11175 C C   . LEU D 1 273 ? 65.227  41.828  102.670 1.00 10.00 ? 273 LEU D C   1 
ATOM 11176 O O   . LEU D 1 273 ? 66.256  42.510  102.630 1.00 10.00 ? 273 LEU D O   1 
ATOM 11177 C CB  . LEU D 1 273 ? 63.209  42.829  101.619 1.00 10.00 ? 273 LEU D CB  1 
ATOM 11178 C CG  . LEU D 1 273 ? 64.044  43.459  100.497 1.00 10.00 ? 273 LEU D CG  1 
ATOM 11179 C CD1 . LEU D 1 273 ? 63.105  43.928  99.389  1.00 10.00 ? 273 LEU D CD1 1 
ATOM 11180 C CD2 . LEU D 1 273 ? 64.861  44.624  101.024 1.00 10.00 ? 273 LEU D CD2 1 
ATOM 11181 N N   . ILE D 1 274 ? 65.230  40.508  102.488 1.00 10.00 ? 274 ILE D N   1 
ATOM 11182 C CA  . ILE D 1 274 ? 66.481  39.809  102.176 1.00 10.00 ? 274 ILE D CA  1 
ATOM 11183 C C   . ILE D 1 274 ? 66.899  40.103  100.741 1.00 10.00 ? 274 ILE D C   1 
ATOM 11184 O O   . ILE D 1 274 ? 66.163  39.823  99.792  1.00 10.00 ? 274 ILE D O   1 
ATOM 11185 C CB  . ILE D 1 274 ? 66.390  38.267  102.316 1.00 10.00 ? 274 ILE D CB  1 
ATOM 11186 C CG1 . ILE D 1 274 ? 64.991  37.778  101.947 1.00 10.00 ? 274 ILE D CG1 1 
ATOM 11187 C CG2 . ILE D 1 274 ? 66.824  37.847  103.698 1.00 10.00 ? 274 ILE D CG2 1 
ATOM 11188 C CD1 . ILE D 1 274 ? 64.858  36.256  101.865 1.00 10.00 ? 274 ILE D CD1 1 
ATOM 11189 N N   . GLY D 1 275 ? 68.093  40.665  100.598 1.00 10.00 ? 275 GLY D N   1 
ATOM 11190 C CA  . GLY D 1 275 ? 68.613  41.008  99.288  1.00 10.00 ? 275 GLY D CA  1 
ATOM 11191 C C   . GLY D 1 275 ? 68.356  39.991  98.193  1.00 10.00 ? 275 GLY D C   1 
ATOM 11192 O O   . GLY D 1 275 ? 68.018  40.371  97.074  1.00 10.00 ? 275 GLY D O   1 
ATOM 11193 N N   . LYS D 1 276 ? 68.500  38.706  98.511  1.00 10.00 ? 276 LYS D N   1 
ATOM 11194 C CA  . LYS D 1 276 ? 68.298  37.639  97.529  1.00 10.00 ? 276 LYS D CA  1 
ATOM 11195 C C   . LYS D 1 276 ? 67.115  37.939  96.609  1.00 10.00 ? 276 LYS D C   1 
ATOM 11196 O O   . LYS D 1 276 ? 67.051  37.445  95.480  1.00 10.00 ? 276 LYS D O   1 
ATOM 11197 C CB  . LYS D 1 276 ? 68.068  36.287  98.224  1.00 10.00 ? 276 LYS D CB  1 
ATOM 11198 C CG  . LYS D 1 276 ? 69.152  35.854  99.210  1.00 10.00 ? 276 LYS D CG  1 
ATOM 11199 C CD  . LYS D 1 276 ? 69.021  36.568  100.559 1.00 10.00 ? 276 LYS D CD  1 
ATOM 11200 C CE  . LYS D 1 276 ? 70.114  36.143  101.536 1.00 10.00 ? 276 LYS D CE  1 
ATOM 11201 N NZ  . LYS D 1 276 ? 69.992  36.807  102.863 1.00 10.00 ? 276 LYS D NZ  1 
ATOM 11202 N N   . TYR D 1 277 ? 66.184  38.757  97.096  1.00 10.00 ? 277 TYR D N   1 
ATOM 11203 C CA  . TYR D 1 277 ? 65.021  39.111  96.337  1.00 10.00 ? 277 TYR D CA  1 
ATOM 11204 C C   . TYR D 1 277 ? 65.302  40.069  95.163  1.00 10.00 ? 277 TYR D C   1 
ATOM 11205 O O   . TYR D 1 277 ? 65.002  39.742  94.020  1.00 10.00 ? 277 TYR D O   1 
ATOM 11206 C CB  . TYR D 1 277 ? 64.045  39.761  97.263  1.00 10.00 ? 277 TYR D CB  1 
ATOM 11207 C CG  . TYR D 1 277 ? 63.157  38.854  97.996  1.00 10.00 ? 277 TYR D CG  1 
ATOM 11208 C CD1 . TYR D 1 277 ? 63.072  38.936  99.365  1.00 10.00 ? 277 TYR D CD1 1 
ATOM 11209 C CD2 . TYR D 1 277 ? 62.239  38.057  97.299  1.00 10.00 ? 277 TYR D CD2 1 
ATOM 11210 C CE1 . TYR D 1 277 ? 62.079  38.270  100.042 1.00 10.00 ? 277 TYR D CE1 1 
ATOM 11211 C CE2 . TYR D 1 277 ? 61.232  37.379  97.951  1.00 10.00 ? 277 TYR D CE2 1 
ATOM 11212 C CZ  . TYR D 1 277 ? 61.149  37.487  99.335  1.00 10.00 ? 277 TYR D CZ  1 
ATOM 11213 O OH  . TYR D 1 277 ? 60.146  36.816  100.015 1.00 10.00 ? 277 TYR D OH  1 
ATOM 11214 N N   . MET D 1 278 ? 65.820  41.261  95.466  1.00 10.00 ? 278 MET D N   1 
ATOM 11215 C CA  . MET D 1 278 ? 66.116  42.266  94.431  1.00 10.00 ? 278 MET D CA  1 
ATOM 11216 C C   . MET D 1 278 ? 66.941  41.619  93.316  1.00 10.00 ? 278 MET D C   1 
ATOM 11217 O O   . MET D 1 278 ? 66.918  42.090  92.184  1.00 10.00 ? 278 MET D O   1 
ATOM 11218 C CB  . MET D 1 278 ? 66.877  43.488  95.017  1.00 10.00 ? 278 MET D CB  1 
ATOM 11219 C CG  . MET D 1 278 ? 66.535  44.929  94.379  1.00 10.00 ? 278 MET D CG  1 
ATOM 11220 S SD  . MET D 1 278 ? 66.125  45.068  92.605  1.00 10.00 ? 278 MET D SD  1 
ATOM 11221 C CE  . MET D 1 278 ? 67.692  44.928  91.842  1.00 10.00 ? 278 MET D CE  1 
ATOM 11222 N N   . LEU D 1 279 ? 67.664  40.543  93.639  1.00 10.00 ? 279 LEU D N   1 
ATOM 11223 C CA  . LEU D 1 279 ? 68.472  39.817  92.654  1.00 10.00 ? 279 LEU D CA  1 
ATOM 11224 C C   . LEU D 1 279 ? 67.600  39.398  91.484  1.00 10.00 ? 279 LEU D C   1 
ATOM 11225 O O   . LEU D 1 279 ? 68.044  39.378  90.337  1.00 10.00 ? 279 LEU D O   1 
ATOM 11226 C CB  . LEU D 1 279 ? 69.108  38.579  93.295  1.00 10.00 ? 279 LEU D CB  1 
ATOM 11227 C CG  . LEU D 1 279 ? 70.069  38.824  94.464  1.00 10.00 ? 279 LEU D CG  1 
ATOM 11228 C CD1 . LEU D 1 279 ? 70.547  37.493  95.017  1.00 10.00 ? 279 LEU D CD1 1 
ATOM 11229 C CD2 . LEU D 1 279 ? 71.251  39.663  93.999  1.00 10.00 ? 279 LEU D CD2 1 
ATOM 11230 N N   . PHE D 1 280 ? 66.344  39.093  91.797  1.00 10.00 ? 280 PHE D N   1 
ATOM 11231 C CA  . PHE D 1 280 ? 65.400  38.697  90.761  1.00 10.00 ? 280 PHE D CA  1 
ATOM 11232 C C   . PHE D 1 280 ? 65.327  39.819  89.772  1.00 10.00 ? 280 PHE D C   1 
ATOM 11233 O O   . PHE D 1 280 ? 65.679  39.658  88.618  1.00 10.00 ? 280 PHE D O   1 
ATOM 11234 C CB  . PHE D 1 280 ? 64.022  38.465  91.359  1.00 10.00 ? 280 PHE D CB  1 
ATOM 11235 C CG  . PHE D 1 280 ? 64.057  37.598  92.552  1.00 10.00 ? 280 PHE D CG  1 
ATOM 11236 C CD1 . PHE D 1 280 ? 62.956  37.493  93.380  1.00 10.00 ? 280 PHE D CD1 1 
ATOM 11237 C CD2 . PHE D 1 280 ? 65.234  36.923  92.878  1.00 10.00 ? 280 PHE D CD2 1 
ATOM 11238 C CE1 . PHE D 1 280 ? 63.033  36.746  94.507  1.00 10.00 ? 280 PHE D CE1 1 
ATOM 11239 C CE2 . PHE D 1 280 ? 65.333  36.183  93.981  1.00 10.00 ? 280 PHE D CE2 1 
ATOM 11240 C CZ  . PHE D 1 280 ? 64.241  36.083  94.813  1.00 10.00 ? 280 PHE D CZ  1 
ATOM 11241 N N   . THR D 1 281 ? 64.864  40.971  90.248  1.00 10.00 ? 281 THR D N   1 
ATOM 11242 C CA  . THR D 1 281 ? 64.730  42.199  89.415  1.00 10.00 ? 281 THR D CA  1 
ATOM 11243 C C   . THR D 1 281 ? 66.034  42.567  88.723  1.00 10.00 ? 281 THR D C   1 
ATOM 11244 O O   . THR D 1 281 ? 66.036  42.941  87.554  1.00 10.00 ? 281 THR D O   1 
ATOM 11245 C CB  . THR D 1 281 ? 64.283  43.468  90.239  1.00 10.00 ? 281 THR D CB  1 
ATOM 11246 O OG1 . THR D 1 281 ? 64.566  43.278  91.632  1.00 10.00 ? 281 THR D OG1 1 
ATOM 11247 C CG2 . THR D 1 281 ? 62.794  43.775  90.025  1.00 10.00 ? 281 THR D CG2 1 
ATOM 11248 N N   . MET D 1 282 ? 67.135  42.430  89.456  1.00 10.00 ? 282 MET D N   1 
ATOM 11249 C CA  . MET D 1 282 ? 68.451  42.788  88.957  1.00 10.00 ? 282 MET D CA  1 
ATOM 11250 C C   . MET D 1 282 ? 68.647  42.269  87.548  1.00 10.00 ? 282 MET D C   1 
ATOM 11251 O O   . MET D 1 282 ? 68.391  42.966  86.567  1.00 10.00 ? 282 MET D O   1 
ATOM 11252 C CB  . MET D 1 282 ? 69.534  42.222  89.877  1.00 10.00 ? 282 MET D CB  1 
ATOM 11253 C CG  . MET D 1 282 ? 70.863  42.955  89.793  1.00 10.00 ? 282 MET D CG  1 
ATOM 11254 S SD  . MET D 1 282 ? 70.724  44.679  90.329  1.00 10.00 ? 282 MET D SD  1 
ATOM 11255 C CE  . MET D 1 282 ? 70.473  45.523  88.762  1.00 10.00 ? 282 MET D CE  1 
ATOM 11256 N N   . ILE D 1 283 ? 69.115  41.039  87.443  1.00 10.00 ? 283 ILE D N   1 
ATOM 11257 C CA  . ILE D 1 283 ? 69.333  40.454  86.122  1.00 10.00 ? 283 ILE D CA  1 
ATOM 11258 C C   . ILE D 1 283 ? 68.121  40.476  85.198  1.00 10.00 ? 283 ILE D C   1 
ATOM 11259 O O   . ILE D 1 283 ? 68.285  40.797  84.040  1.00 10.00 ? 283 ILE D O   1 
ATOM 11260 C CB  . ILE D 1 283 ? 69.856  38.996  86.214  1.00 10.00 ? 283 ILE D CB  1 
ATOM 11261 C CG1 . ILE D 1 283 ? 68.937  38.161  87.110  1.00 10.00 ? 283 ILE D CG1 1 
ATOM 11262 C CG2 . ILE D 1 283 ? 71.297  38.994  86.718  1.00 10.00 ? 283 ILE D CG2 1 
ATOM 11263 C CD1 . ILE D 1 283 ? 69.313  36.691  87.184  1.00 10.00 ? 283 ILE D CD1 1 
ATOM 11264 N N   . PHE D 1 284 ? 66.929  40.128  85.685  1.00 10.00 ? 284 PHE D N   1 
ATOM 11265 C CA  . PHE D 1 284 ? 65.735  40.170  84.813  1.00 10.00 ? 284 PHE D CA  1 
ATOM 11266 C C   . PHE D 1 284 ? 65.726  41.514  84.093  1.00 10.00 ? 284 PHE D C   1 
ATOM 11267 O O   . PHE D 1 284 ? 65.556  41.595  82.872  1.00 10.00 ? 284 PHE D O   1 
ATOM 11268 C CB  . PHE D 1 284 ? 64.352  40.171  85.528  1.00 10.00 ? 284 PHE D CB  1 
ATOM 11269 C CG  . PHE D 1 284 ? 64.098  39.056  86.534  1.00 10.00 ? 284 PHE D CG  1 
ATOM 11270 C CD1 . PHE D 1 284 ? 62.946  39.131  87.344  1.00 10.00 ? 284 PHE D CD1 1 
ATOM 11271 C CD2 . PHE D 1 284 ? 65.004  38.026  86.759  1.00 10.00 ? 284 PHE D CD2 1 
ATOM 11272 C CE1 . PHE D 1 284 ? 62.711  38.236  88.344  1.00 10.00 ? 284 PHE D CE1 1 
ATOM 11273 C CE2 . PHE D 1 284 ? 64.761  37.123  87.772  1.00 10.00 ? 284 PHE D CE2 1 
ATOM 11274 C CZ  . PHE D 1 284 ? 63.610  37.237  88.564  1.00 10.00 ? 284 PHE D CZ  1 
ATOM 11275 N N   . VAL D 1 285 ? 65.850  42.595  84.861  1.00 10.00 ? 285 VAL D N   1 
ATOM 11276 C CA  . VAL D 1 285 ? 65.812  43.909  84.207  1.00 10.00 ? 285 VAL D CA  1 
ATOM 11277 C C   . VAL D 1 285 ? 67.104  44.253  83.521  1.00 10.00 ? 285 VAL D C   1 
ATOM 11278 O O   . VAL D 1 285 ? 67.065  44.894  82.485  1.00 10.00 ? 285 VAL D O   1 
ATOM 11279 C CB  . VAL D 1 285 ? 65.409  45.096  85.144  1.00 10.00 ? 285 VAL D CB  1 
ATOM 11280 C CG1 . VAL D 1 285 ? 66.509  46.158  85.181  1.00 10.00 ? 285 VAL D CG1 1 
ATOM 11281 C CG2 . VAL D 1 285 ? 64.103  45.691  84.648  1.00 10.00 ? 285 VAL D CG2 1 
ATOM 11282 N N   . ILE D 1 286 ? 68.250  43.854  84.070  1.00 10.00 ? 286 ILE D N   1 
ATOM 11283 C CA  . ILE D 1 286 ? 69.469  44.167  83.354  1.00 10.00 ? 286 ILE D CA  1 
ATOM 11284 C C   . ILE D 1 286 ? 69.278  43.373  82.071  1.00 10.00 ? 286 ILE D C   1 
ATOM 11285 O O   . ILE D 1 286 ? 69.917  43.646  81.060  1.00 10.00 ? 286 ILE D O   1 
ATOM 11286 C CB  . ILE D 1 286 ? 70.737  43.668  84.067  1.00 10.00 ? 286 ILE D CB  1 
ATOM 11287 C CG1 . ILE D 1 286 ? 70.689  44.032  85.563  1.00 10.00 ? 286 ILE D CG1 1 
ATOM 11288 C CG2 . ILE D 1 286 ? 71.981  44.244  83.355  1.00 10.00 ? 286 ILE D CG2 1 
ATOM 11289 C CD1 . ILE D 1 286 ? 71.303  42.962  86.512  1.00 10.00 ? 286 ILE D CD1 1 
ATOM 11290 N N   . SER D 1 287 ? 68.367  42.401  82.111  1.00 10.00 ? 287 SER D N   1 
ATOM 11291 C CA  . SER D 1 287 ? 68.112  41.605  80.935  1.00 10.00 ? 287 SER D CA  1 
ATOM 11292 C C   . SER D 1 287 ? 67.439  42.470  79.883  1.00 10.00 ? 287 SER D C   1 
ATOM 11293 O O   . SER D 1 287 ? 67.787  42.385  78.708  1.00 10.00 ? 287 SER D O   1 
ATOM 11294 C CB  . SER D 1 287 ? 67.261  40.375  81.258  1.00 10.00 ? 287 SER D CB  1 
ATOM 11295 O OG  . SER D 1 287 ? 67.150  39.520  80.128  1.00 10.00 ? 287 SER D OG  1 
ATOM 11296 N N   . SER D 1 288 ? 66.489  43.319  80.278  1.00 10.00 ? 288 SER D N   1 
ATOM 11297 C CA  . SER D 1 288 ? 65.872  44.163  79.263  1.00 10.00 ? 288 SER D CA  1 
ATOM 11298 C C   . SER D 1 288 ? 67.003  45.045  78.755  1.00 10.00 ? 288 SER D C   1 
ATOM 11299 O O   . SER D 1 288 ? 67.063  45.323  77.584  1.00 10.00 ? 288 SER D O   1 
ATOM 11300 C CB  . SER D 1 288 ? 64.748  45.015  79.840  1.00 10.00 ? 288 SER D CB  1 
ATOM 11301 O OG  . SER D 1 288 ? 64.065  45.694  78.799  1.00 10.00 ? 288 SER D OG  1 
ATOM 11302 N N   . ILE D 1 289 ? 67.925  45.455  79.626  1.00 10.00 ? 289 ILE D N   1 
ATOM 11303 C CA  . ILE D 1 289 ? 69.014  46.264  79.136  1.00 10.00 ? 289 ILE D CA  1 
ATOM 11304 C C   . ILE D 1 289 ? 69.940  45.397  78.274  1.00 10.00 ? 289 ILE D C   1 
ATOM 11305 O O   . ILE D 1 289 ? 70.149  45.730  77.125  1.00 10.00 ? 289 ILE D O   1 
ATOM 11306 C CB  . ILE D 1 289 ? 69.765  46.948  80.312  1.00 10.00 ? 289 ILE D CB  1 
ATOM 11307 C CG1 . ILE D 1 289 ? 69.097  48.312  80.621  1.00 10.00 ? 289 ILE D CG1 1 
ATOM 11308 C CG2 . ILE D 1 289 ? 71.275  46.975  80.028  1.00 10.00 ? 289 ILE D CG2 1 
ATOM 11309 C CD1 . ILE D 1 289 ? 69.695  49.091  81.790  1.00 10.00 ? 289 ILE D CD1 1 
ATOM 11310 N N   . ILE D 1 290 ? 70.467  44.290  78.810  1.00 10.00 ? 290 ILE D N   1 
ATOM 11311 C CA  . ILE D 1 290 ? 71.345  43.395  78.043  1.00 10.00 ? 290 ILE D CA  1 
ATOM 11312 C C   . ILE D 1 290 ? 70.721  43.115  76.673  1.00 10.00 ? 290 ILE D C   1 
ATOM 11313 O O   . ILE D 1 290 ? 71.396  43.157  75.645  1.00 10.00 ? 290 ILE D O   1 
ATOM 11314 C CB  . ILE D 1 290 ? 71.572  42.025  78.777  1.00 10.00 ? 290 ILE D CB  1 
ATOM 11315 C CG1 . ILE D 1 290 ? 70.241  41.260  78.867  1.00 10.00 ? 290 ILE D CG1 1 
ATOM 11316 C CG2 . ILE D 1 290 ? 72.182  42.264  80.185  1.00 10.00 ? 290 ILE D CG2 1 
ATOM 11317 C CD1 . ILE D 1 290 ? 70.292  40.027  79.751  1.00 10.00 ? 290 ILE D CD1 1 
ATOM 11318 N N   . VAL D 1 291 ? 69.420  42.846  76.671  1.00 10.00 ? 291 VAL D N   1 
ATOM 11319 C CA  . VAL D 1 291 ? 68.697  42.560  75.441  1.00 10.00 ? 291 VAL D CA  1 
ATOM 11320 C C   . VAL D 1 291 ? 68.549  43.831  74.563  1.00 10.00 ? 291 VAL D C   1 
ATOM 11321 O O   . VAL D 1 291 ? 68.885  43.773  73.396  1.00 10.00 ? 291 VAL D O   1 
ATOM 11322 C CB  . VAL D 1 291 ? 67.300  41.891  75.768  1.00 10.00 ? 291 VAL D CB  1 
ATOM 11323 C CG1 . VAL D 1 291 ? 66.552  41.493  74.473  1.00 10.00 ? 291 VAL D CG1 1 
ATOM 11324 C CG2 . VAL D 1 291 ? 67.522  40.653  76.670  1.00 10.00 ? 291 VAL D CG2 1 
ATOM 11325 N N   . THR D 1 292 ? 68.057  44.958  75.096  1.00 10.00 ? 292 THR D N   1 
ATOM 11326 C CA  . THR D 1 292 ? 67.993  46.156  74.239  1.00 10.00 ? 292 THR D CA  1 
ATOM 11327 C C   . THR D 1 292 ? 69.404  46.458  73.801  1.00 10.00 ? 292 THR D C   1 
ATOM 11328 O O   . THR D 1 292 ? 69.626  47.084  72.774  1.00 10.00 ? 292 THR D O   1 
ATOM 11329 C CB  . THR D 1 292 ? 67.510  47.462  74.912  1.00 10.00 ? 292 THR D CB  1 
ATOM 11330 O OG1 . THR D 1 292 ? 67.173  48.391  73.885  1.00 10.00 ? 292 THR D OG1 1 
ATOM 11331 C CG2 . THR D 1 292 ? 68.626  48.149  75.684  1.00 10.00 ? 292 THR D CG2 1 
ATOM 11332 N N   . VAL D 1 293 ? 70.358  46.054  74.627  1.00 10.00 ? 293 VAL D N   1 
ATOM 11333 C CA  . VAL D 1 293 ? 71.785  46.272  74.291  1.00 10.00 ? 293 VAL D CA  1 
ATOM 11334 C C   . VAL D 1 293 ? 72.010  45.666  72.944  1.00 10.00 ? 293 VAL D C   1 
ATOM 11335 O O   . VAL D 1 293 ? 72.349  46.358  71.991  1.00 10.00 ? 293 VAL D O   1 
ATOM 11336 C CB  . VAL D 1 293 ? 72.801  45.562  75.231  1.00 10.00 ? 293 VAL D CB  1 
ATOM 11337 C CG1 . VAL D 1 293 ? 74.158  45.455  74.518  1.00 10.00 ? 293 VAL D CG1 1 
ATOM 11338 C CG2 . VAL D 1 293 ? 72.958  46.331  76.542  1.00 10.00 ? 293 VAL D CG2 1 
ATOM 11339 N N   . VAL D 1 294 ? 71.807  44.354  72.904  1.00 10.00 ? 294 VAL D N   1 
ATOM 11340 C CA  . VAL D 1 294 ? 71.979  43.552  71.694  1.00 10.00 ? 294 VAL D CA  1 
ATOM 11341 C C   . VAL D 1 294 ? 70.888  43.848  70.697  1.00 10.00 ? 294 VAL D C   1 
ATOM 11342 O O   . VAL D 1 294 ? 71.183  44.190  69.568  1.00 10.00 ? 294 VAL D O   1 
ATOM 11343 C CB  . VAL D 1 294 ? 71.958  42.003  71.963  1.00 10.00 ? 294 VAL D CB  1 
ATOM 11344 C CG1 . VAL D 1 294 ? 71.591  41.254  70.664  1.00 10.00 ? 294 VAL D CG1 1 
ATOM 11345 C CG2 . VAL D 1 294 ? 73.368  41.519  72.453  1.00 10.00 ? 294 VAL D CG2 1 
ATOM 11346 N N   . VAL D 1 295 ? 69.634  43.713  71.116  1.00 10.00 ? 295 VAL D N   1 
ATOM 11347 C CA  . VAL D 1 295 ? 68.493  43.954  70.209  1.00 10.00 ? 295 VAL D CA  1 
ATOM 11348 C C   . VAL D 1 295 ? 68.456  45.285  69.470  1.00 10.00 ? 295 VAL D C   1 
ATOM 11349 O O   . VAL D 1 295 ? 68.257  45.292  68.263  1.00 10.00 ? 295 VAL D O   1 
ATOM 11350 C CB  . VAL D 1 295 ? 67.112  43.769  70.906  1.00 10.00 ? 295 VAL D CB  1 
ATOM 11351 C CG1 . VAL D 1 295 ? 67.098  42.475  71.679  1.00 10.00 ? 295 VAL D CG1 1 
ATOM 11352 C CG2 . VAL D 1 295 ? 66.782  44.956  71.782  1.00 10.00 ? 295 VAL D CG2 1 
ATOM 11353 N N   . ILE D 1 296 ? 68.617  46.421  70.152  1.00 10.00 ? 296 ILE D N   1 
ATOM 11354 C CA  . ILE D 1 296 ? 68.595  47.625  69.327  1.00 10.00 ? 296 ILE D CA  1 
ATOM 11355 C C   . ILE D 1 296 ? 69.981  47.810  68.723  1.00 10.00 ? 296 ILE D C   1 
ATOM 11356 O O   . ILE D 1 296 ? 70.107  48.312  67.606  1.00 10.00 ? 296 ILE D O   1 
ATOM 11357 C CB  . ILE D 1 296 ? 68.037  48.955  70.018  1.00 10.00 ? 296 ILE D CB  1 
ATOM 11358 C CG1 . ILE D 1 296 ? 68.577  49.140  71.434  1.00 10.00 ? 296 ILE D CG1 1 
ATOM 11359 C CG2 . ILE D 1 296 ? 66.480  48.965  69.973  1.00 10.00 ? 296 ILE D CG2 1 
ATOM 11360 C CD1 . ILE D 1 296 ? 67.918  50.313  72.176  1.00 10.00 ? 296 ILE D CD1 1 
ATOM 11361 N N   . ASN D 1 297 ? 71.026  47.363  69.421  1.00 10.00 ? 297 ASN D N   1 
ATOM 11362 C CA  . ASN D 1 297 ? 72.363  47.465  68.822  1.00 10.00 ? 297 ASN D CA  1 
ATOM 11363 C C   . ASN D 1 297 ? 72.131  46.655  67.552  1.00 10.00 ? 297 ASN D C   1 
ATOM 11364 O O   . ASN D 1 297 ? 72.419  47.107  66.451  1.00 10.00 ? 297 ASN D O   1 
ATOM 11365 C CB  . ASN D 1 297 ? 73.447  46.760  69.656  1.00 10.00 ? 297 ASN D CB  1 
ATOM 11366 C CG  . ASN D 1 297 ? 74.235  47.704  70.549  1.00 10.00 ? 297 ASN D CG  1 
ATOM 11367 O OD1 . ASN D 1 297 ? 75.438  47.857  70.385  1.00 10.00 ? 297 ASN D OD1 1 
ATOM 11368 N ND2 . ASN D 1 297 ? 73.562  48.319  71.505  1.00 10.00 ? 297 ASN D ND2 1 
ATOM 11369 N N   . THR D 1 298 ? 71.557  45.463  67.732  1.00 10.00 ? 298 THR D N   1 
ATOM 11370 C CA  . THR D 1 298 ? 71.247  44.574  66.610  1.00 10.00 ? 298 THR D CA  1 
ATOM 11371 C C   . THR D 1 298 ? 70.188  45.313  65.785  1.00 10.00 ? 298 THR D C   1 
ATOM 11372 O O   . THR D 1 298 ? 70.229  45.307  64.569  1.00 10.00 ? 298 THR D O   1 
ATOM 11373 C CB  . THR D 1 298 ? 70.691  43.152  67.082  1.00 10.00 ? 298 THR D CB  1 
ATOM 11374 O OG1 . THR D 1 298 ? 71.613  42.545  68.002  1.00 10.00 ? 298 THR D OG1 1 
ATOM 11375 C CG2 . THR D 1 298 ? 70.511  42.205  65.899  1.00 10.00 ? 298 THR D CG2 1 
ATOM 11376 N N   . HIS D 1 299 ? 69.265  45.997  66.452  1.00 10.00 ? 299 HIS D N   1 
ATOM 11377 C CA  . HIS D 1 299 ? 68.206  46.728  65.739  1.00 10.00 ? 299 HIS D CA  1 
ATOM 11378 C C   . HIS D 1 299 ? 68.890  47.664  64.734  1.00 10.00 ? 299 HIS D C   1 
ATOM 11379 O O   . HIS D 1 299 ? 68.526  47.701  63.555  1.00 10.00 ? 299 HIS D O   1 
ATOM 11380 C CB  . HIS D 1 299 ? 67.362  47.516  66.755  1.00 10.00 ? 299 HIS D CB  1 
ATOM 11381 C CG  . HIS D 1 299 ? 65.965  47.864  66.313  1.00 10.00 ? 299 HIS D CG  1 
ATOM 11382 N ND1 . HIS D 1 299 ? 65.014  48.334  67.196  1.00 10.00 ? 299 HIS D ND1 1 
ATOM 11383 C CD2 . HIS D 1 299 ? 65.347  47.781  65.114  1.00 10.00 ? 299 HIS D CD2 1 
ATOM 11384 C CE1 . HIS D 1 299 ? 63.871  48.514  66.564  1.00 10.00 ? 299 HIS D CE1 1 
ATOM 11385 N NE2 . HIS D 1 299 ? 64.047  48.185  65.300  1.00 10.00 ? 299 HIS D NE2 1 
ATOM 11386 N N   . HIS D 1 300 ? 69.909  48.400  65.173  1.00 10.00 ? 300 HIS D N   1 
ATOM 11387 C CA  . HIS D 1 300 ? 70.576  49.302  64.220  1.00 10.00 ? 300 HIS D CA  1 
ATOM 11388 C C   . HIS D 1 300 ? 71.662  48.595  63.390  1.00 10.00 ? 300 HIS D C   1 
ATOM 11389 O O   . HIS D 1 300 ? 72.182  49.156  62.418  1.00 10.00 ? 300 HIS D O   1 
ATOM 11390 C CB  . HIS D 1 300 ? 71.104  50.568  64.937  1.00 10.00 ? 300 HIS D CB  1 
ATOM 11391 C CG  . HIS D 1 300 ? 70.032  51.307  65.678  1.00 10.00 ? 300 HIS D CG  1 
ATOM 11392 N ND1 . HIS D 1 300 ? 68.855  51.698  65.077  1.00 10.00 ? 300 HIS D ND1 1 
ATOM 11393 C CD2 . HIS D 1 300 ? 69.865  51.540  66.998  1.00 10.00 ? 300 HIS D CD2 1 
ATOM 11394 C CE1 . HIS D 1 300 ? 68.004  52.118  65.992  1.00 10.00 ? 300 HIS D CE1 1 
ATOM 11395 N NE2 . HIS D 1 300 ? 68.593  52.029  67.167  1.00 10.00 ? 300 HIS D NE2 1 
ATOM 11396 N N   . ARG D 1 301 ? 71.924  47.339  63.766  1.00 10.00 ? 301 ARG D N   1 
ATOM 11397 C CA  . ARG D 1 301 ? 72.909  46.411  63.149  1.00 10.00 ? 301 ARG D CA  1 
ATOM 11398 C C   . ARG D 1 301 ? 73.182  46.318  61.635  1.00 10.00 ? 301 ARG D C   1 
ATOM 11399 O O   . ARG D 1 301 ? 73.922  45.417  61.227  1.00 10.00 ? 301 ARG D O   1 
ATOM 11400 C CB  . ARG D 1 301 ? 72.581  44.973  63.554  1.00 10.00 ? 301 ARG D CB  1 
ATOM 11401 C CG  . ARG D 1 301 ? 71.577  44.305  62.587  1.00 10.00 ? 301 ARG D CG  1 
ATOM 11402 C CD  . ARG D 1 301 ? 71.201  42.908  63.043  1.00 10.00 ? 301 ARG D CD  1 
ATOM 11403 N NE  . ARG D 1 301 ? 70.168  42.247  62.235  1.00 10.00 ? 301 ARG D NE  1 
ATOM 11404 C CZ  . ARG D 1 301 ? 68.881  42.588  62.202  1.00 10.00 ? 301 ARG D CZ  1 
ATOM 11405 N NH1 . ARG D 1 301 ? 68.433  43.600  62.926  1.00 10.00 ? 301 ARG D NH1 1 
ATOM 11406 N NH2 . ARG D 1 301 ? 68.033  41.895  61.458  1.00 10.00 ? 301 ARG D NH2 1 
ATOM 11407 N N   . SER D 1 302 ? 72.607  47.178  60.803  1.00 10.00 ? 302 SER D N   1 
ATOM 11408 C CA  . SER D 1 302 ? 72.819  47.067  59.345  1.00 10.00 ? 302 SER D CA  1 
ATOM 11409 C C   . SER D 1 302 ? 73.475  48.302  58.727  1.00 10.00 ? 302 SER D C   1 
ATOM 11410 O O   . SER D 1 302 ? 73.069  49.412  59.013  1.00 10.00 ? 302 SER D O   1 
ATOM 11411 C CB  . SER D 1 302 ? 71.486  46.783  58.642  1.00 10.00 ? 302 SER D CB  1 
ATOM 11412 O OG  . SER D 1 302 ? 70.981  45.497  58.973  1.00 10.00 ? 302 SER D OG  1 
ATOM 11413 N N   . PRO D 1 303 ? 74.477  48.116  57.842  1.00 10.00 ? 303 PRO D N   1 
ATOM 11414 C CA  . PRO D 1 303 ? 75.185  49.212  57.206  1.00 10.00 ? 303 PRO D CA  1 
ATOM 11415 C C   . PRO D 1 303 ? 74.506  50.535  57.041  1.00 10.00 ? 303 PRO D C   1 
ATOM 11416 O O   . PRO D 1 303 ? 74.966  51.503  57.664  1.00 10.00 ? 303 PRO D O   1 
ATOM 11417 C CB  . PRO D 1 303 ? 75.691  48.565  55.937  1.00 10.00 ? 303 PRO D CB  1 
ATOM 11418 C CG  . PRO D 1 303 ? 76.286  47.269  56.566  1.00 10.00 ? 303 PRO D CG  1 
ATOM 11419 C CD  . PRO D 1 303 ? 75.308  46.897  57.723  1.00 10.00 ? 303 PRO D CD  1 
ATOM 11420 N N   . SER D 1 304 ? 73.456  50.599  56.225  1.00 10.00 ? 304 SER D N   1 
ATOM 11421 C CA  . SER D 1 304 ? 72.751  51.870  56.049  1.00 10.00 ? 304 SER D CA  1 
ATOM 11422 C C   . SER D 1 304 ? 71.247  51.862  56.347  1.00 10.00 ? 304 SER D C   1 
ATOM 11423 O O   . SER D 1 304 ? 70.576  52.915  56.346  1.00 10.00 ? 304 SER D O   1 
ATOM 11424 C CB  . SER D 1 304 ? 73.020  52.420  54.652  1.00 10.00 ? 304 SER D CB  1 
ATOM 11425 O OG  . SER D 1 304 ? 74.211  53.190  54.652  1.00 10.00 ? 304 SER D OG  1 
ATOM 11426 N N   . THR D 1 305 ? 70.690  50.688  56.618  1.00