data_2BGY
# 
_entry.id   2BGY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BGY         
PDBE  EBI-22286    
WWPDB D_1290022286 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1WLG     unspecified            'CRYSTAL STRUCTURE OF FLGE31, A MAJOR FRAGMENT OF THE HOOKPROTEIN' 
PDB  2BGZ     unspecified            
'ATOMIC MODEL OF THE BACTERIAL FLAGELLAR BASED ON DOCKING AN X-RAY DERIVED HOOK STRUCTURE INTO AN EM MAP' 
EMDB EMD-1132 'associated EM volume' 'A PARTIAL ATOMIC STRUCTURE FOR THE FLAGELLAR HOOK OF SALMONELLA TYPHIMURIUM' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BGY 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shaikh, T.R.'   1 
'Thomas, D.R.'   2 
'Chen, J.Z.'     3 
'Samatey, F.A.'  4 
'Matsunami, H.'  5 
'Imada, K.'      6 
'Namba, K.'      7 
'DeRosier, D.J.' 8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A Partial Atomic Structure for the Flagellar Hook of Salmonella Typhimurium.'                           
Proc.Natl.Acad.Sci.USA 102 1023 ? 2005 PNASA6 US 0027-8424 0040 ? 15657146 10.1073/PNAS.0409020102 
1       'Structure of the Bacterial Flagellar Hook and Implication for the Molecular Universal Joint Mechanism.' Nature 431 1062 ? 
2004 NATUAS UK 0028-0836 0006 ? 15510139 10.1038/NATURE02997     
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shaikh, T.R.'   1  
primary 'Thomas, D.R.'   2  
primary 'Chen, J.Z.'     3  
primary 'Samatey, F.A.'  4  
primary 'Matsunami, H.'  5  
primary 'Imada, K.'      6  
primary 'Namba, K.'      7  
primary 'Derosier, D.J.' 8  
1       'Samatey, F.A.'  9  
1       'Matsunami, H.'  10 
1       'Imada, K.'      11 
1       'Nagashima, S.'  12 
1       'Shaikh, T.R.'   13 
1       'Thomas, D.R.'   14 
1       'Chen, J.Z.'     15 
1       'Derosier, D.J.' 16 
1       'Kitao, A.'      17 
1       'Namba, K.'      18 
# 
_cell.entry_id           2BGY 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BGY 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'FLAGELLAR HOOK PROTEIN FLGE' 
_entity.formula_weight             31335.084 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'FLGE31 RESIDUES 71-363' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTT
ASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLK
FNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQV
LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTT
ASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLK
FNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQV
LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LEU n 
1 3   ASP n 
1 4   VAL n 
1 5   ALA n 
1 6   ILE n 
1 7   SER n 
1 8   GLN n 
1 9   ASN n 
1 10  GLY n 
1 11  PHE n 
1 12  PHE n 
1 13  ARG n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  SER n 
1 18  ASN n 
1 19  GLY n 
1 20  SER n 
1 21  VAL n 
1 22  PHE n 
1 23  TYR n 
1 24  SER n 
1 25  ARG n 
1 26  ASN n 
1 27  GLY n 
1 28  GLN n 
1 29  PHE n 
1 30  LYS n 
1 31  LEU n 
1 32  ASP n 
1 33  GLU n 
1 34  ASN n 
1 35  ARG n 
1 36  ASN n 
1 37  LEU n 
1 38  VAL n 
1 39  ASN n 
1 40  MET n 
1 41  GLN n 
1 42  GLY n 
1 43  MET n 
1 44  GLN n 
1 45  LEU n 
1 46  THR n 
1 47  GLY n 
1 48  TYR n 
1 49  PRO n 
1 50  ALA n 
1 51  THR n 
1 52  GLY n 
1 53  THR n 
1 54  PRO n 
1 55  PRO n 
1 56  THR n 
1 57  ILE n 
1 58  GLN n 
1 59  GLN n 
1 60  GLY n 
1 61  ALA n 
1 62  ASN n 
1 63  PRO n 
1 64  ALA n 
1 65  PRO n 
1 66  ILE n 
1 67  THR n 
1 68  ILE n 
1 69  PRO n 
1 70  ASN n 
1 71  THR n 
1 72  LEU n 
1 73  MET n 
1 74  ALA n 
1 75  ALA n 
1 76  LYS n 
1 77  SER n 
1 78  THR n 
1 79  THR n 
1 80  THR n 
1 81  ALA n 
1 82  SER n 
1 83  MET n 
1 84  GLN n 
1 85  ILE n 
1 86  ASN n 
1 87  LEU n 
1 88  ASN n 
1 89  SER n 
1 90  THR n 
1 91  ASP n 
1 92  PRO n 
1 93  VAL n 
1 94  PRO n 
1 95  SER n 
1 96  LYS n 
1 97  THR n 
1 98  PRO n 
1 99  PHE n 
1 100 SER n 
1 101 VAL n 
1 102 SER n 
1 103 ASP n 
1 104 ALA n 
1 105 ASP n 
1 106 SER n 
1 107 TYR n 
1 108 ASN n 
1 109 LYS n 
1 110 LYS n 
1 111 GLY n 
1 112 THR n 
1 113 VAL n 
1 114 THR n 
1 115 VAL n 
1 116 TYR n 
1 117 ASP n 
1 118 SER n 
1 119 GLN n 
1 120 GLY n 
1 121 ASN n 
1 122 ALA n 
1 123 HIS n 
1 124 ASP n 
1 125 MET n 
1 126 ASN n 
1 127 VAL n 
1 128 TYR n 
1 129 PHE n 
1 130 VAL n 
1 131 LYS n 
1 132 THR n 
1 133 LYS n 
1 134 ASP n 
1 135 ASN n 
1 136 GLU n 
1 137 TRP n 
1 138 ALA n 
1 139 VAL n 
1 140 TYR n 
1 141 THR n 
1 142 HIS n 
1 143 ASP n 
1 144 SER n 
1 145 SER n 
1 146 ASP n 
1 147 PRO n 
1 148 ALA n 
1 149 ALA n 
1 150 THR n 
1 151 ALA n 
1 152 PRO n 
1 153 THR n 
1 154 THR n 
1 155 ALA n 
1 156 SER n 
1 157 THR n 
1 158 THR n 
1 159 LEU n 
1 160 LYS n 
1 161 PHE n 
1 162 ASN n 
1 163 GLU n 
1 164 ASN n 
1 165 GLY n 
1 166 ILE n 
1 167 LEU n 
1 168 GLU n 
1 169 SER n 
1 170 GLY n 
1 171 GLY n 
1 172 THR n 
1 173 VAL n 
1 174 ASN n 
1 175 ILE n 
1 176 THR n 
1 177 THR n 
1 178 GLY n 
1 179 THR n 
1 180 ILE n 
1 181 ASN n 
1 182 GLY n 
1 183 ALA n 
1 184 THR n 
1 185 ALA n 
1 186 ALA n 
1 187 THR n 
1 188 PHE n 
1 189 SER n 
1 190 LEU n 
1 191 SER n 
1 192 PHE n 
1 193 LEU n 
1 194 ASN n 
1 195 SER n 
1 196 MET n 
1 197 GLN n 
1 198 GLN n 
1 199 ASN n 
1 200 THR n 
1 201 GLY n 
1 202 ALA n 
1 203 ASN n 
1 204 ASN n 
1 205 ILE n 
1 206 VAL n 
1 207 ALA n 
1 208 THR n 
1 209 ASN n 
1 210 GLN n 
1 211 ASN n 
1 212 GLY n 
1 213 TYR n 
1 214 LYS n 
1 215 PRO n 
1 216 GLY n 
1 217 ASP n 
1 218 LEU n 
1 219 VAL n 
1 220 SER n 
1 221 TYR n 
1 222 GLN n 
1 223 ILE n 
1 224 ASN n 
1 225 ASN n 
1 226 ASP n 
1 227 GLY n 
1 228 THR n 
1 229 VAL n 
1 230 VAL n 
1 231 GLY n 
1 232 ASN n 
1 233 TYR n 
1 234 SER n 
1 235 ASN n 
1 236 GLU n 
1 237 GLN n 
1 238 GLU n 
1 239 GLN n 
1 240 VAL n 
1 241 LEU n 
1 242 GLY n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 ALA n 
1 248 ASN n 
1 249 PHE n 
1 250 ALA n 
1 251 ASN n 
1 252 ASN n 
1 253 GLU n 
1 254 GLY n 
1 255 LEU n 
1 256 ALA n 
1 257 SER n 
1 258 GLN n 
1 259 GLY n 
1 260 ASP n 
1 261 ASN n 
1 262 VAL n 
1 263 TRP n 
1 264 ALA n 
1 265 ALA n 
1 266 THR n 
1 267 GLN n 
1 268 ALA n 
1 269 SER n 
1 270 GLY n 
1 271 VAL n 
1 272 ALA n 
1 273 LEU n 
1 274 LEU n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 GLY n 
1 279 SER n 
1 280 GLY n 
1 281 ASN n 
1 282 PHE n 
1 283 GLY n 
1 284 LYS n 
1 285 LEU n 
1 286 THR n 
1 287 ASN n 
1 288 GLY n 
1 289 ALA n 
1 290 LEU n 
1 291 GLU n 
1 292 ALA n 
1 293 SER n 
1 294 ASN n 
1 295 VAL n 
1 296 ASP n 
1 297 LEU n 
1 298 SER n 
1 299 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SALMONELLA TYPHIMURIUM' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     90371 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FLGE_SALTY 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P16322 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2BGY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 299 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16322 
_struct_ref_seq.db_align_beg                  71 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  369 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       71 
_struct_ref_seq.pdbx_auth_seq_align_end       369 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BGY 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 2BGY 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            20.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2156 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2156 
_refine_hist.d_res_high                       20.00 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  2BGY 
_struct.title                     
'Fit of the x-ray strucutre of the baterial flagellar hook fragment flge31 into an EM map from the hook of Caulobacter crescentus.' 
_struct.pdbx_descriptor           'FLAGELLAR HOOK PROTEIN FLGE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BGY 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
_struct_keywords.text            'MOTOR PROTEIN, BACTERIAL MOTILITY, FLAGELLAR HOOK, FLAGELLUM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        251 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        255 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         321 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         325 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 53 A . ? THR 123 A PRO 54 A ? PRO 124 A 1 3.72  
2 THR 97 A . ? THR 167 A PRO 98 A ? PRO 168 A 1 -7.92 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 6 ? 
AC ? 6 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 5 ? 
AG ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? parallel      
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 2   ? ASP A 3   ? LEU A 72  ASP A 73  
AA 2 GLN A 28  ? LEU A 31  ? GLN A 98  LEU A 101 
AA 3 LEU A 37  ? VAL A 38  ? LEU A 107 VAL A 108 
AB 1 ALA A 64  ? PRO A 65  ? ALA A 134 PRO A 135 
AB 2 GLN A 44  ? TYR A 48  ? GLN A 114 TYR A 118 
AB 3 PHE A 12  ? VAL A 15  ? PHE A 82  VAL A 85  
AB 4 VAL A 21  ? SER A 24  ? VAL A 91  SER A 94  
AB 5 VAL A 262 ? ALA A 264 ? VAL A 332 ALA A 334 
AB 6 ALA A 256 ? SER A 257 ? ALA A 326 SER A 327 
AC 1 ALA A 64  ? PRO A 65  ? ALA A 134 PRO A 135 
AC 2 GLN A 44  ? TYR A 48  ? GLN A 114 TYR A 118 
AC 3 GLU A 238 ? ILE A 244 ? GLU A 308 ILE A 314 
AC 4 THR A 228 ? ASN A 232 ? THR A 298 ASN A 302 
AC 5 SER A 220 ? ILE A 223 ? SER A 290 ILE A 293 
AC 6 ALA A 289 ? ALA A 292 ? ALA A 359 ALA A 362 
AD 1 THR A 172 ? THR A 176 ? THR A 242 THR A 246 
AD 2 THR A 187 ? SER A 191 ? THR A 257 SER A 261 
AD 3 THR A 80  ? ASN A 88  ? THR A 150 ASN A 158 
AD 4 ASN A 204 ? GLN A 210 ? ASN A 274 GLN A 280 
AE 1 THR A 172 ? THR A 176 ? THR A 242 THR A 246 
AE 2 THR A 187 ? SER A 191 ? THR A 257 SER A 261 
AE 3 THR A 80  ? ASN A 88  ? THR A 150 ASN A 158 
AE 4 MET A 196 ? GLN A 198 ? MET A 266 GLN A 268 
AF 1 LYS A 109 ? TYR A 116 ? LYS A 179 TYR A 186 
AF 2 ALA A 122 ? LYS A 133 ? ALA A 192 LYS A 203 
AF 3 GLU A 136 ? ASP A 143 ? GLU A 206 ASP A 213 
AF 4 THR A 157 ? PHE A 161 ? THR A 227 PHE A 231 
AF 5 LEU A 167 ? SER A 169 ? LEU A 237 SER A 239 
AG 1 LEU A 246 ? ASN A 248 ? LEU A 316 ASN A 318 
AG 2 LEU A 273 ? GLY A 275 ? LEU A 343 GLY A 345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 2   ? N LEU A 72  O PHE A 29  ? O PHE A 99  
AA 2 3 N LYS A 30  ? N LYS A 100 O VAL A 38  ? O VAL A 108 
AB 1 2 N ALA A 64  ? N ALA A 134 O GLY A 47  ? O GLY A 117 
AB 2 3 N THR A 46  ? N THR A 116 O ARG A 13  ? O ARG A 83  
AB 3 4 N LEU A 14  ? N LEU A 84  O PHE A 22  ? O PHE A 92  
AB 4 5 N TYR A 23  ? N TYR A 93  O TRP A 263 ? O TRP A 333 
AB 5 6 N ALA A 264 ? N ALA A 334 O ALA A 256 ? O ALA A 326 
AC 1 2 N ALA A 64  ? N ALA A 134 O GLY A 47  ? O GLY A 117 
AC 2 3 N TYR A 48  ? N TYR A 118 O GLN A 243 ? O GLN A 313 
AC 3 4 N LEU A 241 ? N LEU A 311 O VAL A 229 ? O VAL A 299 
AC 4 5 N ASN A 232 ? N ASN A 302 O SER A 220 ? O SER A 290 
AC 5 6 N ILE A 223 ? N ILE A 293 O ALA A 289 ? O ALA A 359 
AD 1 2 N ILE A 175 ? N ILE A 245 O PHE A 188 ? O PHE A 258 
AD 2 3 N SER A 191 ? N SER A 261 O ALA A 81  ? O ALA A 151 
AD 3 4 N ASN A 86  ? N ASN A 156 O ASN A 204 ? O ASN A 274 
AE 1 2 N ILE A 175 ? N ILE A 245 O PHE A 188 ? O PHE A 258 
AE 2 3 N SER A 191 ? N SER A 261 O ALA A 81  ? O ALA A 151 
AE 3 4 N LEU A 87  ? N LEU A 157 O MET A 196 ? O MET A 266 
AF 1 2 N VAL A 115 ? N VAL A 185 O HIS A 123 ? O HIS A 193 
AF 2 3 N THR A 132 ? N THR A 202 O GLU A 136 ? O GLU A 206 
AF 3 4 N VAL A 139 ? N VAL A 209 O THR A 157 ? O THR A 227 
AF 4 5 O LYS A 160 ? O LYS A 230 N GLU A 168 ? N GLU A 238 
AG 1 2 N ASN A 248 ? N ASN A 318 O LEU A 273 ? O LEU A 343 
# 
_database_PDB_matrix.entry_id          2BGY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BGY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLY A 1 1   ? 111.655 181.398 115.655 1.00 32.50 ? 71  GLY A N   1 
ATOM 2    C CA  . GLY A 1 1   ? 112.206 180.453 114.628 1.00 31.82 ? 71  GLY A CA  1 
ATOM 3    C C   . GLY A 1 1   ? 111.459 179.128 114.595 1.00 31.71 ? 71  GLY A C   1 
ATOM 4    O O   . GLY A 1 1   ? 111.578 178.319 115.511 1.00 31.92 ? 71  GLY A O   1 
ATOM 5    N N   . LEU A 1 2   ? 110.682 178.909 113.531 1.00 31.12 ? 72  LEU A N   1 
ATOM 6    C CA  . LEU A 1 2   ? 109.870 177.704 113.364 1.00 30.72 ? 72  LEU A CA  1 
ATOM 7    C C   . LEU A 1 2   ? 110.661 176.680 112.539 1.00 29.86 ? 72  LEU A C   1 
ATOM 8    O O   . LEU A 1 2   ? 111.515 177.039 111.731 1.00 29.07 ? 72  LEU A O   1 
ATOM 9    C CB  . LEU A 1 2   ? 108.555 178.013 112.635 1.00 30.73 ? 72  LEU A CB  1 
ATOM 10   C CG  . LEU A 1 2   ? 107.553 178.952 113.310 1.00 32.36 ? 72  LEU A CG  1 
ATOM 11   C CD1 . LEU A 1 2   ? 108.032 180.407 113.284 1.00 35.62 ? 72  LEU A CD1 1 
ATOM 12   C CD2 . LEU A 1 2   ? 106.211 178.875 112.661 1.00 32.72 ? 72  LEU A CD2 1 
ATOM 13   N N   . ASP A 1 3   ? 110.378 175.405 112.768 1.00 29.04 ? 73  ASP A N   1 
ATOM 14   C CA  . ASP A 1 3   ? 111.007 174.328 112.021 1.00 29.36 ? 73  ASP A CA  1 
ATOM 15   C C   . ASP A 1 3   ? 109.951 173.303 111.658 1.00 29.42 ? 73  ASP A C   1 
ATOM 16   O O   . ASP A 1 3   ? 109.403 172.631 112.523 1.00 28.25 ? 73  ASP A O   1 
ATOM 17   C CB  . ASP A 1 3   ? 112.151 173.685 112.810 1.00 29.57 ? 73  ASP A CB  1 
ATOM 18   C CG  . ASP A 1 3   ? 113.031 172.838 111.928 1.00 30.85 ? 73  ASP A CG  1 
ATOM 19   O OD1 . ASP A 1 3   ? 112.672 171.725 111.498 1.00 31.63 ? 73  ASP A OD1 1 
ATOM 20   O OD2 . ASP A 1 3   ? 114.133 173.291 111.565 1.00 30.56 ? 73  ASP A OD2 1 
ATOM 21   N N   . VAL A 1 4   ? 109.619 173.251 110.380 1.00 30.33 ? 74  VAL A N   1 
ATOM 22   C CA  . VAL A 1 4   ? 108.721 172.254 109.835 1.00 32.14 ? 74  VAL A CA  1 
ATOM 23   C C   . VAL A 1 4   ? 109.333 171.731 108.512 1.00 34.06 ? 74  VAL A C   1 
ATOM 24   O O   . VAL A 1 4   ? 108.704 171.784 107.470 1.00 35.49 ? 74  VAL A O   1 
ATOM 25   C CB  . VAL A 1 4   ? 107.286 172.821 109.589 1.00 32.11 ? 74  VAL A CB  1 
ATOM 26   C CG1 . VAL A 1 4   ? 106.621 173.246 110.910 1.00 31.63 ? 74  VAL A CG1 1 
ATOM 27   C CG2 . VAL A 1 4   ? 107.299 174.014 108.605 1.00 31.70 ? 74  VAL A CG2 1 
ATOM 28   N N   . ALA A 1 5   ? 110.565 171.236 108.530 1.00 36.96 ? 75  ALA A N   1 
ATOM 29   C CA  . ALA A 1 5   ? 111.136 170.664 107.279 1.00 38.49 ? 75  ALA A CA  1 
ATOM 30   C C   . ALA A 1 5   ? 110.474 169.331 106.873 1.00 40.42 ? 75  ALA A C   1 
ATOM 31   O O   . ALA A 1 5   ? 109.868 168.645 107.728 1.00 40.61 ? 75  ALA A O   1 
ATOM 32   C CB  . ALA A 1 5   ? 112.622 170.507 107.372 1.00 38.00 ? 75  ALA A CB  1 
ATOM 33   N N   . ILE A 1 6   ? 110.596 168.981 105.578 1.00 41.78 ? 76  ILE A N   1 
ATOM 34   C CA  . ILE A 1 6   ? 109.838 167.861 104.986 1.00 42.93 ? 76  ILE A CA  1 
ATOM 35   C C   . ILE A 1 6   ? 110.770 166.711 104.515 1.00 43.70 ? 76  ILE A C   1 
ATOM 36   O O   . ILE A 1 6   ? 111.542 166.880 103.551 1.00 44.06 ? 76  ILE A O   1 
ATOM 37   C CB  . ILE A 1 6   ? 108.935 168.363 103.788 1.00 42.95 ? 76  ILE A CB  1 
ATOM 38   C CG1 . ILE A 1 6   ? 107.799 169.267 104.257 1.00 42.34 ? 76  ILE A CG1 1 
ATOM 39   C CG2 . ILE A 1 6   ? 108.294 167.197 102.996 1.00 43.16 ? 76  ILE A CG2 1 
ATOM 40   C CD1 . ILE A 1 6   ? 107.140 170.015 103.107 1.00 41.64 ? 76  ILE A CD1 1 
ATOM 41   N N   . SER A 1 7   ? 110.689 165.548 105.185 1.00 44.11 ? 77  SER A N   1 
ATOM 42   C CA  . SER A 1 7   ? 111.412 164.320 104.754 1.00 44.24 ? 77  SER A CA  1 
ATOM 43   C C   . SER A 1 7   ? 110.661 163.578 103.643 1.00 44.17 ? 77  SER A C   1 
ATOM 44   O O   . SER A 1 7   ? 111.171 162.611 103.067 1.00 44.31 ? 77  SER A O   1 
ATOM 45   C CB  . SER A 1 7   ? 111.617 163.338 105.916 1.00 44.08 ? 77  SER A CB  1 
ATOM 46   O OG  . SER A 1 7   ? 110.392 163.035 106.560 1.00 44.54 ? 77  SER A OG  1 
ATOM 47   N N   . GLN A 1 8   ? 109.440 164.035 103.387 1.00 43.62 ? 78  GLN A N   1 
ATOM 48   C CA  . GLN A 1 8   ? 108.538 163.473 102.392 1.00 42.95 ? 78  GLN A CA  1 
ATOM 49   C C   . GLN A 1 8   ? 108.621 164.230 101.064 1.00 41.61 ? 78  GLN A C   1 
ATOM 50   O O   . GLN A 1 8   ? 109.417 165.198 100.887 1.00 42.65 ? 78  GLN A O   1 
ATOM 51   C CB  . GLN A 1 8   ? 107.096 163.582 102.917 1.00 43.36 ? 78  GLN A CB  1 
ATOM 52   C CG  . GLN A 1 8   ? 106.682 162.563 103.945 1.00 43.22 ? 78  GLN A CG  1 
ATOM 53   C CD  . GLN A 1 8   ? 105.705 161.521 103.395 1.00 44.70 ? 78  GLN A CD  1 
ATOM 54   O OE1 . GLN A 1 8   ? 105.584 160.439 103.957 1.00 45.05 ? 78  GLN A OE1 1 
ATOM 55   N NE2 . GLN A 1 8   ? 105.011 161.849 102.306 1.00 43.19 ? 78  GLN A NE2 1 
ATOM 56   N N   . ASN A 1 9   ? 107.788 163.775 100.128 1.00 39.27 ? 79  ASN A N   1 
ATOM 57   C CA  . ASN A 1 9   ? 107.470 164.537 98.915  1.00 36.97 ? 79  ASN A CA  1 
ATOM 58   C C   . ASN A 1 9   ? 106.358 165.610 99.115  1.00 33.44 ? 79  ASN A C   1 
ATOM 59   O O   . ASN A 1 9   ? 105.431 165.547 99.969  1.00 32.71 ? 79  ASN A O   1 
ATOM 60   C CB  . ASN A 1 9   ? 107.162 163.600 97.709  1.00 37.50 ? 79  ASN A CB  1 
ATOM 61   C CG  . ASN A 1 9   ? 107.927 163.995 96.412  1.00 38.36 ? 79  ASN A CG  1 
ATOM 62   O OD1 . ASN A 1 9   ? 108.085 165.175 96.100  1.00 35.50 ? 79  ASN A OD1 1 
ATOM 63   N ND2 . ASN A 1 9   ? 108.367 162.987 95.646  1.00 38.89 ? 79  ASN A ND2 1 
ATOM 64   N N   . GLY A 1 10  ? 106.473 166.601 98.270  1.00 29.26 ? 80  GLY A N   1 
ATOM 65   C CA  . GLY A 1 10  ? 105.813 167.855 98.457  1.00 25.74 ? 80  GLY A CA  1 
ATOM 66   C C   . GLY A 1 10  ? 106.930 168.837 98.685  1.00 22.34 ? 80  GLY A C   1 
ATOM 67   O O   . GLY A 1 10  ? 107.979 168.490 99.254  1.00 21.02 ? 80  GLY A O   1 
ATOM 68   N N   . PHE A 1 11  ? 106.676 170.059 98.234  1.00 18.61 ? 81  PHE A N   1 
ATOM 69   C CA  . PHE A 1 11  ? 107.558 171.186 98.462  1.00 16.78 ? 81  PHE A CA  1 
ATOM 70   C C   . PHE A 1 11  ? 106.735 172.284 99.075  1.00 14.31 ? 81  PHE A C   1 
ATOM 71   O O   . PHE A 1 11  ? 105.565 172.436 98.744  1.00 14.39 ? 81  PHE A O   1 
ATOM 72   C CB  . PHE A 1 11  ? 108.143 171.727 97.142  1.00 16.75 ? 81  PHE A CB  1 
ATOM 73   C CG  . PHE A 1 11  ? 109.106 170.784 96.472  1.00 16.14 ? 81  PHE A CG  1 
ATOM 74   C CD1 . PHE A 1 11  ? 108.642 169.755 95.667  1.00 18.17 ? 81  PHE A CD1 1 
ATOM 75   C CD2 . PHE A 1 11  ? 110.480 170.918 96.669  1.00 16.46 ? 81  PHE A CD2 1 
ATOM 76   C CE1 . PHE A 1 11  ? 109.548 168.873 95.077  1.00 18.93 ? 81  PHE A CE1 1 
ATOM 77   C CE2 . PHE A 1 11  ? 111.379 170.067 96.069  1.00 19.91 ? 81  PHE A CE2 1 
ATOM 78   C CZ  . PHE A 1 11  ? 110.918 169.041 95.264  1.00 19.68 ? 81  PHE A CZ  1 
ATOM 79   N N   . PHE A 1 12  ? 107.344 173.080 99.948  1.00 14.05 ? 82  PHE A N   1 
ATOM 80   C CA  . PHE A 1 12  ? 106.717 174.366 100.291 1.00 13.25 ? 82  PHE A CA  1 
ATOM 81   C C   . PHE A 1 12  ? 106.823 175.275 99.074  1.00 11.94 ? 82  PHE A C   1 
ATOM 82   O O   . PHE A 1 12  ? 107.739 175.107 98.265  1.00 12.35 ? 82  PHE A O   1 
ATOM 83   C CB  . PHE A 1 12  ? 107.387 175.044 101.480 1.00 12.71 ? 82  PHE A CB  1 
ATOM 84   C CG  . PHE A 1 12  ? 107.267 174.271 102.759 1.00 14.41 ? 82  PHE A CG  1 
ATOM 85   C CD1 . PHE A 1 12  ? 106.034 174.122 103.381 1.00 16.47 ? 82  PHE A CD1 1 
ATOM 86   C CD2 . PHE A 1 12  ? 108.378 173.675 103.323 1.00 15.43 ? 82  PHE A CD2 1 
ATOM 87   C CE1 . PHE A 1 12  ? 105.904 173.398 104.556 1.00 15.26 ? 82  PHE A CE1 1 
ATOM 88   C CE2 . PHE A 1 12  ? 108.258 172.939 104.505 1.00 16.24 ? 82  PHE A CE2 1 
ATOM 89   C CZ  . PHE A 1 12  ? 107.028 172.807 105.121 1.00 16.58 ? 82  PHE A CZ  1 
ATOM 90   N N   . ARG A 1 13  ? 105.885 176.207 98.954  1.00 11.26 ? 83  ARG A N   1 
ATOM 91   C CA  . ARG A 1 13  ? 105.787 177.137 97.824  1.00 11.77 ? 83  ARG A CA  1 
ATOM 92   C C   . ARG A 1 13  ? 106.083 178.526 98.368  1.00 12.62 ? 83  ARG A C   1 
ATOM 93   O O   . ARG A 1 13  ? 105.377 179.014 99.257  1.00 12.98 ? 83  ARG A O   1 
ATOM 94   C CB  . ARG A 1 13  ? 104.383 177.075 97.223  1.00 11.17 ? 83  ARG A CB  1 
ATOM 95   C CG  . ARG A 1 13  ? 104.147 177.986 96.029  1.00 11.89 ? 83  ARG A CG  1 
ATOM 96   C CD  . ARG A 1 13  ? 102.695 177.978 95.616  1.00 12.10 ? 83  ARG A CD  1 
ATOM 97   N NE  . ARG A 1 13  ? 102.390 178.865 94.512  1.00 14.84 ? 83  ARG A NE  1 
ATOM 98   C CZ  . ARG A 1 13  ? 102.309 180.181 94.596  1.00 14.48 ? 83  ARG A CZ  1 
ATOM 99   N NH1 . ARG A 1 13  ? 102.485 180.809 95.742  1.00 13.81 ? 83  ARG A NH1 1 
ATOM 100  N NH2 . ARG A 1 13  ? 101.991 180.875 93.530  1.00 16.51 ? 83  ARG A NH2 1 
ATOM 101  N N   . LEU A 1 14  ? 107.139 179.138 97.855  1.00 13.51 ? 84  LEU A N   1 
ATOM 102  C CA  . LEU A 1 14  ? 107.613 180.430 98.324  1.00 15.50 ? 84  LEU A CA  1 
ATOM 103  C C   . LEU A 1 14  ? 107.579 181.473 97.198  1.00 15.49 ? 84  LEU A C   1 
ATOM 104  O O   . LEU A 1 14  ? 107.628 181.115 96.023  1.00 15.92 ? 84  LEU A O   1 
ATOM 105  C CB  . LEU A 1 14  ? 109.058 180.287 98.792  1.00 14.71 ? 84  LEU A CB  1 
ATOM 106  C CG  . LEU A 1 14  ? 109.487 179.223 99.835  1.00 19.67 ? 84  LEU A CG  1 
ATOM 107  C CD1 . LEU A 1 14  ? 108.635 179.216 101.017 1.00 23.28 ? 84  LEU A CD1 1 
ATOM 108  C CD2 . LEU A 1 14  ? 109.583 177.879 99.306  1.00 22.76 ? 84  LEU A CD2 1 
ATOM 109  N N   . VAL A 1 15  ? 107.524 182.744 97.576  1.00 16.11 ? 85  VAL A N   1 
ATOM 110  C CA  . VAL A 1 15  ? 107.701 183.837 96.618  1.00 16.40 ? 85  VAL A CA  1 
ATOM 111  C C   . VAL A 1 15  ? 108.749 184.823 97.095  1.00 17.99 ? 85  VAL A C   1 
ATOM 112  O O   . VAL A 1 15  ? 108.863 185.101 98.302  1.00 17.53 ? 85  VAL A O   1 
ATOM 113  C CB  . VAL A 1 15  ? 106.394 184.624 96.335  1.00 15.91 ? 85  VAL A CB  1 
ATOM 114  C CG1 . VAL A 1 15  ? 105.394 183.779 95.606  1.00 16.22 ? 85  VAL A CG1 1 
ATOM 115  C CG2 . VAL A 1 15  ? 105.757 185.224 97.639  1.00 15.09 ? 85  VAL A CG2 1 
ATOM 116  N N   . ASP A 1 16  ? 109.497 185.391 96.153  1.00 19.73 ? 86  ASP A N   1 
ATOM 117  C CA  . ASP A 1 16  ? 110.347 186.542 96.481  1.00 21.05 ? 86  ASP A CA  1 
ATOM 118  C C   . ASP A 1 16  ? 109.512 187.836 96.473  1.00 22.36 ? 86  ASP A C   1 
ATOM 119  O O   . ASP A 1 16  ? 108.310 187.812 96.191  1.00 22.20 ? 86  ASP A O   1 
ATOM 120  C CB  . ASP A 1 16  ? 111.613 186.627 95.606  1.00 21.43 ? 86  ASP A CB  1 
ATOM 121  C CG  . ASP A 1 16  ? 111.338 186.911 94.118  1.00 20.93 ? 86  ASP A CG  1 
ATOM 122  O OD1 . ASP A 1 16  ? 110.291 187.463 93.726  1.00 23.14 ? 86  ASP A OD1 1 
ATOM 123  O OD2 . ASP A 1 16  ? 112.175 186.610 93.251  1.00 24.17 ? 86  ASP A OD2 1 
ATOM 124  N N   . SER A 1 17  ? 110.115 188.967 96.817  1.00 24.13 ? 87  SER A N   1 
ATOM 125  C CA  . SER A 1 17  ? 109.315 190.190 96.982  1.00 25.29 ? 87  SER A CA  1 
ATOM 126  C C   . SER A 1 17  ? 108.791 190.719 95.630  1.00 26.02 ? 87  SER A C   1 
ATOM 127  O O   . SER A 1 17  ? 107.908 191.572 95.594  1.00 27.04 ? 87  SER A O   1 
ATOM 128  C CB  . SER A 1 17  ? 110.098 191.271 97.763  1.00 25.39 ? 87  SER A CB  1 
ATOM 129  O OG  . SER A 1 17  ? 111.325 191.542 97.125  1.00 27.32 ? 87  SER A OG  1 
ATOM 130  N N   . ASN A 1 18  ? 109.314 190.201 94.525  1.00 26.08 ? 88  ASN A N   1 
ATOM 131  C CA  . ASN A 1 18  ? 108.762 190.484 93.196  1.00 26.22 ? 88  ASN A CA  1 
ATOM 132  C C   . ASN A 1 18  ? 107.636 189.540 92.724  1.00 25.39 ? 88  ASN A C   1 
ATOM 133  O O   . ASN A 1 18  ? 107.096 189.737 91.626  1.00 25.65 ? 88  ASN A O   1 
ATOM 134  C CB  . ASN A 1 18  ? 109.886 190.486 92.152  1.00 26.85 ? 88  ASN A CB  1 
ATOM 135  C CG  . ASN A 1 18  ? 110.731 191.795 92.138  1.00 28.82 ? 88  ASN A CG  1 
ATOM 136  O OD1 . ASN A 1 18  ? 111.682 191.887 91.372  1.00 34.21 ? 88  ASN A OD1 1 
ATOM 137  N ND2 . ASN A 1 18  ? 110.390 192.777 92.965  1.00 29.45 ? 88  ASN A ND2 1 
ATOM 138  N N   . GLY A 1 19  ? 107.299 188.516 93.517  1.00 23.85 ? 89  GLY A N   1 
ATOM 139  C CA  . GLY A 1 19  ? 106.224 187.589 93.182  1.00 23.18 ? 89  GLY A CA  1 
ATOM 140  C C   . GLY A 1 19  ? 106.654 186.356 92.403  1.00 21.55 ? 89  GLY A C   1 
ATOM 141  O O   . GLY A 1 19  ? 105.810 185.515 92.057  1.00 21.49 ? 89  GLY A O   1 
ATOM 142  N N   . SER A 1 20  ? 107.941 186.232 92.120  1.00 20.52 ? 90  SER A N   1 
ATOM 143  C CA  . SER A 1 20  ? 108.423 185.020 91.448  1.00 20.32 ? 90  SER A CA  1 
ATOM 144  C C   . SER A 1 20  ? 108.320 183.850 92.433  1.00 18.58 ? 90  SER A C   1 
ATOM 145  O O   . SER A 1 20  ? 108.576 184.003 93.625  1.00 17.96 ? 90  SER A O   1 
ATOM 146  C CB  . SER A 1 20  ? 109.850 185.172 90.945  1.00 21.03 ? 90  SER A CB  1 
ATOM 147  O OG  . SER A 1 20  ? 109.943 186.260 90.045  1.00 24.11 ? 90  SER A OG  1 
ATOM 148  N N   . VAL A 1 21  ? 107.940 182.694 91.913  1.00 17.35 ? 91  VAL A N   1 
ATOM 149  C CA  . VAL A 1 21  ? 107.573 181.558 92.727  1.00 16.40 ? 91  VAL A CA  1 
ATOM 150  C C   . VAL A 1 21  ? 108.682 180.512 92.715  1.00 16.15 ? 91  VAL A C   1 
ATOM 151  O O   . VAL A 1 21  ? 109.200 180.155 91.654  1.00 16.28 ? 91  VAL A O   1 
ATOM 152  C CB  . VAL A 1 21  ? 106.255 180.901 92.195  1.00 16.38 ? 91  VAL A CB  1 
ATOM 153  C CG1 . VAL A 1 21  ? 105.802 179.788 93.097  1.00 17.18 ? 91  VAL A CG1 1 
ATOM 154  C CG2 . VAL A 1 21  ? 105.170 181.940 92.036  1.00 17.33 ? 91  VAL A CG2 1 
ATOM 155  N N   . PHE A 1 22  ? 108.992 180.002 93.908  1.00 14.47 ? 92  PHE A N   1 
ATOM 156  C CA  . PHE A 1 22  ? 110.016 179.008 94.145  1.00 14.62 ? 92  PHE A CA  1 
ATOM 157  C C   . PHE A 1 22  ? 109.478 177.924 95.084  1.00 13.65 ? 92  PHE A C   1 
ATOM 158  O O   . PHE A 1 22  ? 108.374 178.041 95.634  1.00 12.21 ? 92  PHE A O   1 
ATOM 159  C CB  . PHE A 1 22  ? 111.253 179.674 94.762  1.00 15.13 ? 92  PHE A CB  1 
ATOM 160  C CG  . PHE A 1 22  ? 111.835 180.777 93.907  1.00 18.73 ? 92  PHE A CG  1 
ATOM 161  C CD1 . PHE A 1 22  ? 112.701 180.468 92.860  1.00 22.47 ? 92  PHE A CD1 1 
ATOM 162  C CD2 . PHE A 1 22  ? 111.479 182.101 94.108  1.00 21.29 ? 92  PHE A CD2 1 
ATOM 163  C CE1 . PHE A 1 22  ? 113.251 181.480 92.038  1.00 24.17 ? 92  PHE A CE1 1 
ATOM 164  C CE2 . PHE A 1 22  ? 112.038 183.110 93.297  1.00 23.95 ? 92  PHE A CE2 1 
ATOM 165  C CZ  . PHE A 1 22  ? 112.907 182.785 92.261  1.00 25.16 ? 92  PHE A CZ  1 
ATOM 166  N N   . TYR A 1 23  ? 110.248 176.852 95.219  1.00 14.06 ? 93  TYR A N   1 
ATOM 167  C CA  . TYR A 1 23  ? 109.805 175.652 95.930  1.00 13.39 ? 93  TYR A CA  1 
ATOM 168  C C   . TYR A 1 23  ? 110.979 175.127 96.754  1.00 13.43 ? 93  TYR A C   1 
ATOM 169  O O   . TYR A 1 23  ? 112.126 175.192 96.307  1.00 13.45 ? 93  TYR A O   1 
ATOM 170  C CB  . TYR A 1 23  ? 109.326 174.565 94.930  1.00 14.02 ? 93  TYR A CB  1 
ATOM 171  C CG  . TYR A 1 23  ? 108.245 175.079 94.054  1.00 11.96 ? 93  TYR A CG  1 
ATOM 172  C CD1 . TYR A 1 23  ? 106.916 175.010 94.446  1.00 10.85 ? 93  TYR A CD1 1 
ATOM 173  C CD2 . TYR A 1 23  ? 108.547 175.716 92.869  1.00 13.37 ? 93  TYR A CD2 1 
ATOM 174  C CE1 . TYR A 1 23  ? 105.926 175.546 93.669  1.00 13.44 ? 93  TYR A CE1 1 
ATOM 175  C CE2 . TYR A 1 23  ? 107.564 176.258 92.081  1.00 12.39 ? 93  TYR A CE2 1 
ATOM 176  C CZ  . TYR A 1 23  ? 106.249 176.154 92.474  1.00 15.05 ? 93  TYR A CZ  1 
ATOM 177  O OH  . TYR A 1 23  ? 105.220 176.704 91.736  1.00 17.46 ? 93  TYR A OH  1 
ATOM 178  N N   . SER A 1 24  ? 110.698 174.614 97.954  1.00 13.47 ? 94  SER A N   1 
ATOM 179  C CA  . SER A 1 24  ? 111.741 174.041 98.802  1.00 14.96 ? 94  SER A CA  1 
ATOM 180  C C   . SER A 1 24  ? 111.143 173.152 99.861  1.00 15.81 ? 94  SER A C   1 
ATOM 181  O O   . SER A 1 24  ? 110.057 173.458 100.365 1.00 15.61 ? 94  SER A O   1 
ATOM 182  C CB  . SER A 1 24  ? 112.524 175.144 99.522  1.00 15.61 ? 94  SER A CB  1 
ATOM 183  O OG  . SER A 1 24  ? 113.611 174.580 100.234 1.00 16.22 ? 94  SER A OG  1 
ATOM 184  N N   . ARG A 1 25  ? 111.867 172.077 100.202 1.00 17.06 ? 95  ARG A N   1 
ATOM 185  C CA  . ARG A 1 25  ? 111.537 171.227 101.339 1.00 18.97 ? 95  ARG A CA  1 
ATOM 186  C C   . ARG A 1 25  ? 112.097 171.749 102.681 1.00 19.09 ? 95  ARG A C   1 
ATOM 187  O O   . ARG A 1 25  ? 111.688 171.280 103.735 1.00 19.84 ? 95  ARG A O   1 
ATOM 188  C CB  . ARG A 1 25  ? 112.035 169.796 101.076 1.00 19.51 ? 95  ARG A CB  1 
ATOM 189  C CG  . ARG A 1 25  ? 111.373 169.112 99.874  1.00 22.82 ? 95  ARG A CG  1 
ATOM 190  C CD  . ARG A 1 25  ? 111.760 167.648 99.733  1.00 28.14 ? 95  ARG A CD  1 
ATOM 191  N NE  . ARG A 1 25  ? 111.098 166.984 98.610  1.00 32.56 ? 95  ARG A NE  1 
ATOM 192  C CZ  . ARG A 1 25  ? 111.722 166.421 97.568  1.00 33.33 ? 95  ARG A CZ  1 
ATOM 193  N NH1 . ARG A 1 25  ? 113.041 166.451 97.474  1.00 31.23 ? 95  ARG A NH1 1 
ATOM 194  N NH2 . ARG A 1 25  ? 111.007 165.839 96.603  1.00 33.07 ? 95  ARG A NH2 1 
ATOM 195  N N   . ASN A 1 26  ? 113.029 172.697 102.647 1.00 19.80 ? 96  ASN A N   1 
ATOM 196  C CA  . ASN A 1 26  ? 113.538 173.327 103.871 1.00 21.36 ? 96  ASN A CA  1 
ATOM 197  C C   . ASN A 1 26  ? 112.378 173.978 104.605 1.00 21.17 ? 96  ASN A C   1 
ATOM 198  O O   . ASN A 1 26  ? 111.623 174.747 104.016 1.00 21.90 ? 96  ASN A O   1 
ATOM 199  C CB  . ASN A 1 26  ? 114.550 174.418 103.548 1.00 22.07 ? 96  ASN A CB  1 
ATOM 200  C CG  . ASN A 1 26  ? 115.829 173.890 102.991 1.00 26.37 ? 96  ASN A CG  1 
ATOM 201  O OD1 . ASN A 1 26  ? 116.095 172.684 103.004 1.00 30.08 ? 96  ASN A OD1 1 
ATOM 202  N ND2 . ASN A 1 26  ? 116.660 174.808 102.495 1.00 31.74 ? 96  ASN A ND2 1 
ATOM 203  N N   . GLY A 1 27  ? 112.211 173.656 105.877 1.00 21.23 ? 97  GLY A N   1 
ATOM 204  C CA  . GLY A 1 27  ? 111.138 174.233 106.647 1.00 20.57 ? 97  GLY A CA  1 
ATOM 205  C C   . GLY A 1 27  ? 111.576 175.131 107.783 1.00 20.46 ? 97  GLY A C   1 
ATOM 206  O O   . GLY A 1 27  ? 110.921 175.149 108.816 1.00 21.80 ? 97  GLY A O   1 
ATOM 207  N N   . GLN A 1 28  ? 112.643 175.886 107.587 1.00 20.62 ? 98  GLN A N   1 
ATOM 208  C CA  . GLN A 1 28  ? 113.131 176.809 108.614 1.00 20.86 ? 98  GLN A CA  1 
ATOM 209  C C   . GLN A 1 28  ? 112.619 178.214 108.318 1.00 20.55 ? 98  GLN A C   1 
ATOM 210  O O   . GLN A 1 28  ? 113.047 178.851 107.349 1.00 20.45 ? 98  GLN A O   1 
ATOM 211  C CB  . GLN A 1 28  ? 114.657 176.823 108.684 1.00 21.17 ? 98  GLN A CB  1 
ATOM 212  C CG  . GLN A 1 28  ? 115.276 175.511 109.080 1.00 24.90 ? 98  GLN A CG  1 
ATOM 213  C CD  . GLN A 1 28  ? 115.123 174.454 108.020 1.00 28.32 ? 98  GLN A CD  1 
ATOM 214  O OE1 . GLN A 1 28  ? 115.505 174.672 106.857 1.00 31.46 ? 98  GLN A OE1 1 
ATOM 215  N NE2 . GLN A 1 28  ? 114.543 173.304 108.399 1.00 28.73 ? 98  GLN A NE2 1 
ATOM 216  N N   . PHE A 1 29  ? 111.693 178.691 109.155 1.00 19.76 ? 99  PHE A N   1 
ATOM 217  C CA  . PHE A 1 29  ? 111.044 179.970 108.937 1.00 18.80 ? 99  PHE A CA  1 
ATOM 218  C C   . PHE A 1 29  ? 111.194 180.848 110.166 1.00 18.36 ? 99  PHE A C   1 
ATOM 219  O O   . PHE A 1 29  ? 111.230 180.349 111.302 1.00 19.99 ? 99  PHE A O   1 
ATOM 220  C CB  . PHE A 1 29  ? 109.571 179.765 108.632 1.00 18.02 ? 99  PHE A CB  1 
ATOM 221  C CG  . PHE A 1 29  ? 109.350 178.930 107.422 1.00 18.18 ? 99  PHE A CG  1 
ATOM 222  C CD1 . PHE A 1 29  ? 109.696 179.418 106.177 1.00 17.81 ? 99  PHE A CD1 1 
ATOM 223  C CD2 . PHE A 1 29  ? 108.873 177.639 107.530 1.00 18.74 ? 99  PHE A CD2 1 
ATOM 224  C CE1 . PHE A 1 29  ? 109.541 178.628 105.041 1.00 18.60 ? 99  PHE A CE1 1 
ATOM 225  C CE2 . PHE A 1 29  ? 108.739 176.840 106.381 1.00 19.27 ? 99  PHE A CE2 1 
ATOM 226  C CZ  . PHE A 1 29  ? 109.044 177.360 105.155 1.00 16.60 ? 99  PHE A CZ  1 
ATOM 227  N N   . LYS A 1 30  ? 111.326 182.130 109.911 1.00 17.21 ? 100 LYS A N   1 
ATOM 228  C CA  . LYS A 1 30  ? 111.264 183.171 110.931 1.00 16.73 ? 100 LYS A CA  1 
ATOM 229  C C   . LYS A 1 30  ? 110.117 184.120 110.605 1.00 16.10 ? 100 LYS A C   1 
ATOM 230  O O   . LYS A 1 30  ? 109.859 184.400 109.442 1.00 15.18 ? 100 LYS A O   1 
ATOM 231  C CB  . LYS A 1 30  ? 112.595 183.942 110.925 1.00 16.59 ? 100 LYS A CB  1 
ATOM 232  C CG  . LYS A 1 30  ? 113.744 183.191 111.515 1.00 20.47 ? 100 LYS A CG  1 
ATOM 233  C CD  . LYS A 1 30  ? 115.025 184.021 111.496 1.00 23.52 ? 100 LYS A CD  1 
ATOM 234  C CE  . LYS A 1 30  ? 116.159 183.308 112.209 1.00 27.15 ? 100 LYS A CE  1 
ATOM 235  N NZ  . LYS A 1 30  ? 117.405 184.165 112.217 1.00 29.53 ? 100 LYS A NZ  1 
ATOM 236  N N   . LEU A 1 31  ? 109.452 184.657 111.632 1.00 15.83 ? 101 LEU A N   1 
ATOM 237  C CA  . LEU A 1 31  ? 108.417 185.655 111.442 1.00 15.91 ? 101 LEU A CA  1 
ATOM 238  C C   . LEU A 1 31  ? 109.059 187.038 111.388 1.00 16.02 ? 101 LEU A C   1 
ATOM 239  O O   . LEU A 1 31  ? 109.530 187.544 112.406 1.00 17.24 ? 101 LEU A O   1 
ATOM 240  C CB  . LEU A 1 31  ? 107.388 185.582 112.584 1.00 16.52 ? 101 LEU A CB  1 
ATOM 241  C CG  . LEU A 1 31  ? 106.159 186.477 112.490 1.00 16.85 ? 101 LEU A CG  1 
ATOM 242  C CD1 . LEU A 1 31  ? 105.370 186.192 111.237 1.00 17.69 ? 101 LEU A CD1 1 
ATOM 243  C CD2 . LEU A 1 31  ? 105.269 186.349 113.699 1.00 21.04 ? 101 LEU A CD2 1 
ATOM 244  N N   . ASP A 1 32  ? 109.074 187.653 110.223 1.00 15.16 ? 102 ASP A N   1 
ATOM 245  C CA  . ASP A 1 32  ? 109.744 188.950 110.056 1.00 15.60 ? 102 ASP A CA  1 
ATOM 246  C C   . ASP A 1 32  ? 108.855 190.168 110.403 1.00 15.06 ? 102 ASP A C   1 
ATOM 247  O O   . ASP A 1 32  ? 107.720 190.025 110.856 1.00 13.94 ? 102 ASP A O   1 
ATOM 248  C CB  . ASP A 1 32  ? 110.397 189.003 108.668 1.00 14.67 ? 102 ASP A CB  1 
ATOM 249  C CG  . ASP A 1 32  ? 109.411 189.222 107.512 1.00 14.85 ? 102 ASP A CG  1 
ATOM 250  O OD1 . ASP A 1 32  ? 108.173 189.385 107.688 1.00 13.70 ? 102 ASP A OD1 1 
ATOM 251  O OD2 . ASP A 1 32  ? 109.850 189.271 106.326 1.00 16.62 ? 102 ASP A OD2 1 
ATOM 252  N N   . GLU A 1 33  ? 109.361 191.379 110.198 1.00 15.74 ? 103 GLU A N   1 
ATOM 253  C CA  . GLU A 1 33  ? 108.628 192.578 110.619 1.00 15.39 ? 103 GLU A CA  1 
ATOM 254  C C   . GLU A 1 33  ? 107.378 192.828 109.792 1.00 15.14 ? 103 GLU A C   1 
ATOM 255  O O   . GLU A 1 33  ? 106.432 193.460 110.270 1.00 15.08 ? 103 GLU A O   1 
ATOM 256  C CB  . GLU A 1 33  ? 109.536 193.797 110.538 1.00 15.49 ? 103 GLU A CB  1 
ATOM 257  C CG  . GLU A 1 33  ? 110.677 193.742 111.517 1.00 16.62 ? 103 GLU A CG  1 
ATOM 258  C CD  . GLU A 1 33  ? 111.597 194.907 111.347 1.00 19.76 ? 103 GLU A CD  1 
ATOM 259  O OE1 . GLU A 1 33  ? 112.409 194.878 110.390 1.00 18.83 ? 103 GLU A OE1 1 
ATOM 260  O OE2 . GLU A 1 33  ? 111.459 195.865 112.148 1.00 20.90 ? 103 GLU A OE2 1 
ATOM 261  N N   . ASN A 1 34  ? 107.396 192.341 108.550 1.00 14.39 ? 104 ASN A N   1 
ATOM 262  C CA  . ASN A 1 34  ? 106.283 192.403 107.629 1.00 14.51 ? 104 ASN A CA  1 
ATOM 263  C C   . ASN A 1 34  ? 105.225 191.360 108.003 1.00 14.00 ? 104 ASN A C   1 
ATOM 264  O O   . ASN A 1 34  ? 104.183 191.326 107.355 1.00 14.55 ? 104 ASN A O   1 
ATOM 265  C CB  . ASN A 1 34  ? 106.733 192.122 106.168 1.00 13.72 ? 104 ASN A CB  1 
ATOM 266  C CG  . ASN A 1 34  ? 107.612 193.243 105.559 1.00 18.94 ? 104 ASN A CG  1 
ATOM 267  O OD1 . ASN A 1 34  ? 107.520 194.389 105.959 1.00 23.68 ? 104 ASN A OD1 1 
ATOM 268  N ND2 . ASN A 1 34  ? 108.489 192.882 104.594 1.00 22.51 ? 104 ASN A ND2 1 
ATOM 269  N N   . ARG A 1 35  ? 105.518 190.522 109.004 1.00 13.80 ? 105 ARG A N   1 
ATOM 270  C CA  . ARG A 1 35  ? 104.609 189.473 109.539 1.00 13.94 ? 105 ARG A CA  1 
ATOM 271  C C   . ARG A 1 35  ? 104.418 188.295 108.568 1.00 13.55 ? 105 ARG A C   1 
ATOM 272  O O   . ARG A 1 35  ? 103.413 187.579 108.629 1.00 13.13 ? 105 ARG A O   1 
ATOM 273  C CB  . ARG A 1 35  ? 103.257 190.050 109.915 1.00 14.46 ? 105 ARG A CB  1 
ATOM 274  C CG  . ARG A 1 35  ? 103.296 191.136 110.955 1.00 17.93 ? 105 ARG A CG  1 
ATOM 275  C CD  . ARG A 1 35  ? 102.824 190.591 112.288 1.00 25.43 ? 105 ARG A CD  1 
ATOM 276  N NE  . ARG A 1 35  ? 103.883 190.419 113.217 1.00 26.57 ? 105 ARG A NE  1 
ATOM 277  C CZ  . ARG A 1 35  ? 103.847 189.700 114.344 1.00 26.06 ? 105 ARG A CZ  1 
ATOM 278  N NH1 . ARG A 1 35  ? 102.813 188.956 114.734 1.00 22.70 ? 105 ARG A NH1 1 
ATOM 279  N NH2 . ARG A 1 35  ? 104.921 189.731 115.111 1.00 25.08 ? 105 ARG A NH2 1 
ATOM 280  N N   . ASN A 1 36  ? 105.386 188.116 107.681 1.00 12.57 ? 106 ASN A N   1 
ATOM 281  C CA  . ASN A 1 36  ? 105.509 186.924 106.843 1.00 12.62 ? 106 ASN A CA  1 
ATOM 282  C C   . ASN A 1 36  ? 106.430 185.900 107.497 1.00 13.20 ? 106 ASN A C   1 
ATOM 283  O O   . ASN A 1 36  ? 107.259 186.259 108.349 1.00 14.42 ? 106 ASN A O   1 
ATOM 284  C CB  . ASN A 1 36  ? 106.094 187.283 105.457 1.00 12.34 ? 106 ASN A CB  1 
ATOM 285  C CG  . ASN A 1 36  ? 105.298 188.315 104.695 1.00 13.19 ? 106 ASN A CG  1 
ATOM 286  O OD1 . ASN A 1 36  ? 105.883 189.256 104.126 1.00 15.16 ? 106 ASN A OD1 1 
ATOM 287  N ND2 . ASN A 1 36  ? 103.992 188.161 104.643 1.00 13.68 ? 106 ASN A ND2 1 
ATOM 288  N N   . LEU A 1 37  ? 106.294 184.632 107.083 1.00 12.78 ? 107 LEU A N   1 
ATOM 289  C CA  . LEU A 1 37  ? 107.198 183.551 107.434 1.00 13.92 ? 107 LEU A CA  1 
ATOM 290  C C   . LEU A 1 37  ? 108.213 183.405 106.326 1.00 13.98 ? 107 LEU A C   1 
ATOM 291  O O   . LEU A 1 37  ? 107.863 183.089 105.175 1.00 14.59 ? 107 LEU A O   1 
ATOM 292  C CB  . LEU A 1 37  ? 106.448 182.223 107.661 1.00 13.17 ? 107 LEU A CB  1 
ATOM 293  C CG  . LEU A 1 37  ? 105.502 182.172 108.858 1.00 15.86 ? 107 LEU A CG  1 
ATOM 294  C CD1 . LEU A 1 37  ? 104.591 180.915 108.841 1.00 15.61 ? 107 LEU A CD1 1 
ATOM 295  C CD2 . LEU A 1 37  ? 106.276 182.235 110.162 1.00 16.96 ? 107 LEU A CD2 1 
ATOM 296  N N   . VAL A 1 38  ? 109.461 183.696 106.641 1.00 13.88 ? 108 VAL A N   1 
ATOM 297  C CA  . VAL A 1 38  ? 110.484 183.756 105.603 1.00 14.78 ? 108 VAL A CA  1 
ATOM 298  C C   . VAL A 1 38  ? 111.597 182.738 105.820 1.00 15.13 ? 108 VAL A C   1 
ATOM 299  O O   . VAL A 1 38  ? 111.927 182.369 106.956 1.00 15.03 ? 108 VAL A O   1 
ATOM 300  C CB  . VAL A 1 38  ? 111.103 185.166 105.466 1.00 13.95 ? 108 VAL A CB  1 
ATOM 301  C CG1 . VAL A 1 38  ? 110.015 186.187 105.022 1.00 12.59 ? 108 VAL A CG1 1 
ATOM 302  C CG2 . VAL A 1 38  ? 111.775 185.598 106.789 1.00 14.76 ? 108 VAL A CG2 1 
ATOM 303  N N   . ASN A 1 39  ? 112.163 182.261 104.714 1.00 16.27 ? 109 ASN A N   1 
ATOM 304  C CA  . ASN A 1 39  ? 113.352 181.434 104.773 1.00 18.09 ? 109 ASN A CA  1 
ATOM 305  C C   . ASN A 1 39  ? 114.600 182.327 104.920 1.00 20.26 ? 109 ASN A C   1 
ATOM 306  O O   . ASN A 1 39  ? 114.498 183.546 105.067 1.00 19.91 ? 109 ASN A O   1 
ATOM 307  C CB  . ASN A 1 39  ? 113.415 180.447 103.583 1.00 17.79 ? 109 ASN A CB  1 
ATOM 308  C CG  . ASN A 1 39  ? 113.797 181.102 102.280 1.00 19.58 ? 109 ASN A CG  1 
ATOM 309  O OD1 . ASN A 1 39  ? 114.016 182.322 102.208 1.00 17.70 ? 109 ASN A OD1 1 
ATOM 310  N ND2 . ASN A 1 39  ? 113.861 180.290 101.213 1.00 18.89 ? 109 ASN A ND2 1 
ATOM 311  N N   . MET A 1 40  ? 115.782 181.722 104.892 1.00 23.89 ? 110 MET A N   1 
ATOM 312  C CA  . MET A 1 40  ? 117.010 182.456 105.204 1.00 26.54 ? 110 MET A CA  1 
ATOM 313  C C   . MET A 1 40  ? 117.368 183.479 104.110 1.00 27.22 ? 110 MET A C   1 
ATOM 314  O O   . MET A 1 40  ? 118.119 184.434 104.365 1.00 28.94 ? 110 MET A O   1 
ATOM 315  C CB  . MET A 1 40  ? 118.152 181.444 105.444 1.00 27.68 ? 110 MET A CB  1 
ATOM 316  C CG  . MET A 1 40  ? 119.174 181.798 106.530 1.00 31.76 ? 110 MET A CG  1 
ATOM 317  S SD  . MET A 1 40  ? 120.477 180.461 106.631 1.00 39.16 ? 110 MET A SD  1 
ATOM 318  C CE  . MET A 1 40  ? 121.784 181.275 107.696 1.00 38.24 ? 110 MET A CE  1 
ATOM 319  N N   . GLN A 1 41  ? 116.848 183.284 102.897 1.00 26.45 ? 111 GLN A N   1 
ATOM 320  C CA  . GLN A 1 41  ? 116.971 184.258 101.799 1.00 26.70 ? 111 GLN A CA  1 
ATOM 321  C C   . GLN A 1 41  ? 115.860 185.329 101.742 1.00 24.02 ? 111 GLN A C   1 
ATOM 322  O O   . GLN A 1 41  ? 115.829 186.163 100.844 1.00 23.99 ? 111 GLN A O   1 
ATOM 323  C CB  . GLN A 1 41  ? 117.006 183.536 100.466 1.00 27.23 ? 111 GLN A CB  1 
ATOM 324  C CG  . GLN A 1 41  ? 118.138 182.532 100.354 1.00 31.13 ? 111 GLN A CG  1 
ATOM 325  C CD  . GLN A 1 41  ? 117.628 181.126 100.361 1.00 34.70 ? 111 GLN A CD  1 
ATOM 326  O OE1 . GLN A 1 41  ? 117.428 180.530 101.424 1.00 35.47 ? 111 GLN A OE1 1 
ATOM 327  N NE2 . GLN A 1 41  ? 117.386 180.582 99.161  1.00 38.49 ? 111 GLN A NE2 1 
ATOM 328  N N   . GLY A 1 42  ? 114.943 185.290 102.694 1.00 22.46 ? 112 GLY A N   1 
ATOM 329  C CA  . GLY A 1 42  ? 113.862 186.250 102.774 1.00 20.47 ? 112 GLY A CA  1 
ATOM 330  C C   . GLY A 1 42  ? 112.668 185.958 101.886 1.00 19.40 ? 112 GLY A C   1 
ATOM 331  O O   . GLY A 1 42  ? 111.781 186.783 101.760 1.00 19.48 ? 112 GLY A O   1 
ATOM 332  N N   . MET A 1 43  ? 112.621 184.777 101.276 1.00 17.58 ? 113 MET A N   1 
ATOM 333  C CA  . MET A 1 43  ? 111.456 184.403 100.491 1.00 16.85 ? 113 MET A CA  1 
ATOM 334  C C   . MET A 1 43  ? 110.325 184.060 101.434 1.00 15.75 ? 113 MET A C   1 
ATOM 335  O O   . MET A 1 43  ? 110.560 183.519 102.504 1.00 14.97 ? 113 MET A O   1 
ATOM 336  C CB  . MET A 1 43  ? 111.783 183.206 99.609  1.00 17.29 ? 113 MET A CB  1 
ATOM 337  C CG  . MET A 1 43  ? 112.763 183.514 98.459  1.00 20.05 ? 113 MET A CG  1 
ATOM 338  S SD  . MET A 1 43  ? 113.216 181.927 97.653  1.00 25.21 ? 113 MET A SD  1 
ATOM 339  C CE  . MET A 1 43  ? 114.557 181.603 98.469  1.00 25.58 ? 113 MET A CE  1 
ATOM 340  N N   . GLN A 1 44  ? 109.111 184.340 100.992 1.00 14.84 ? 114 GLN A N   1 
ATOM 341  C CA  . GLN A 1 44  ? 107.919 184.293 101.808 1.00 14.19 ? 114 GLN A CA  1 
ATOM 342  C C   . GLN A 1 44  ? 107.158 182.996 101.575 1.00 13.94 ? 114 GLN A C   1 
ATOM 343  O O   . GLN A 1 44  ? 106.843 182.657 100.433 1.00 12.73 ? 114 GLN A O   1 
ATOM 344  C CB  . GLN A 1 44  ? 107.035 185.467 101.477 1.00 14.24 ? 114 GLN A CB  1 
ATOM 345  C CG  . GLN A 1 44  ? 107.692 186.779 101.783 1.00 17.24 ? 114 GLN A CG  1 
ATOM 346  C CD  . GLN A 1 44  ? 107.044 187.928 101.083 1.00 18.72 ? 114 GLN A CD  1 
ATOM 347  O OE1 . GLN A 1 44  ? 105.844 187.932 100.850 1.00 21.58 ? 114 GLN A OE1 1 
ATOM 348  N NE2 . GLN A 1 44  ? 107.831 188.948 100.803 1.00 22.30 ? 114 GLN A NE2 1 
ATOM 349  N N   . LEU A 1 45  ? 106.880 182.276 102.657 1.00 11.64 ? 115 LEU A N   1 
ATOM 350  C CA  . LEU A 1 45  ? 106.055 181.082 102.571 1.00 11.63 ? 115 LEU A CA  1 
ATOM 351  C C   . LEU A 1 45  ? 104.634 181.462 102.164 1.00 11.96 ? 115 LEU A C   1 
ATOM 352  O O   . LEU A 1 45  ? 104.083 182.445 102.668 1.00 10.76 ? 115 LEU A O   1 
ATOM 353  C CB  . LEU A 1 45  ? 106.076 180.378 103.940 1.00 12.10 ? 115 LEU A CB  1 
ATOM 354  C CG  . LEU A 1 45  ? 105.364 179.040 104.043 1.00 13.12 ? 115 LEU A CG  1 
ATOM 355  C CD1 . LEU A 1 45  ? 106.065 177.990 103.196 1.00 12.71 ? 115 LEU A CD1 1 
ATOM 356  C CD2 . LEU A 1 45  ? 105.311 178.598 105.549 1.00 13.08 ? 115 LEU A CD2 1 
ATOM 357  N N   . THR A 1 46  ? 104.029 180.682 101.269 1.00 12.39 ? 116 THR A N   1 
ATOM 358  C CA  . THR A 1 46  ? 102.695 180.986 100.787 1.00 12.38 ? 116 THR A CA  1 
ATOM 359  C C   . THR A 1 46  ? 101.686 179.907 101.144 1.00 12.39 ? 116 THR A C   1 
ATOM 360  O O   . THR A 1 46  ? 102.038 178.760 101.467 1.00 13.68 ? 116 THR A O   1 
ATOM 361  C CB  . THR A 1 46  ? 102.672 181.226 99.255  1.00 13.09 ? 116 THR A CB  1 
ATOM 362  O OG1 . THR A 1 46  ? 103.005 180.006 98.562  1.00 11.25 ? 116 THR A OG1 1 
ATOM 363  C CG2 . THR A 1 46  ? 103.719 182.242 98.843  1.00 12.38 ? 116 THR A CG2 1 
ATOM 364  N N   . GLY A 1 47  ? 100.438 180.304 101.066 1.00 12.54 ? 117 GLY A N   1 
ATOM 365  C CA  . GLY A 1 47  ? 99.297  179.454 101.376 1.00 13.29 ? 117 GLY A CA  1 
ATOM 366  C C   . GLY A 1 47  ? 97.972  180.167 101.178 1.00 13.04 ? 117 GLY A C   1 
ATOM 367  O O   . GLY A 1 47  ? 97.924  181.344 100.848 1.00 13.67 ? 117 GLY A O   1 
ATOM 368  N N   . TYR A 1 48  ? 96.874  179.461 101.397 1.00 12.91 ? 118 TYR A N   1 
ATOM 369  C CA  . TYR A 1 48  ? 95.566  180.058 101.275 1.00 14.38 ? 118 TYR A CA  1 
ATOM 370  C C   . TYR A 1 48  ? 95.300  181.017 102.408 1.00 15.60 ? 118 TYR A C   1 
ATOM 371  O O   . TYR A 1 48  ? 95.603  180.707 103.577 1.00 15.36 ? 118 TYR A O   1 
ATOM 372  C CB  . TYR A 1 48  ? 94.505  178.991 101.271 1.00 15.81 ? 118 TYR A CB  1 
ATOM 373  C CG  . TYR A 1 48  ? 94.767  177.937 100.207 1.00 18.46 ? 118 TYR A CG  1 
ATOM 374  C CD1 . TYR A 1 48  ? 94.827  178.282 98.848  1.00 22.97 ? 118 TYR A CD1 1 
ATOM 375  C CD2 . TYR A 1 48  ? 94.932  176.621 100.550 1.00 22.66 ? 118 TYR A CD2 1 
ATOM 376  C CE1 . TYR A 1 48  ? 95.062  177.318 97.880  1.00 21.34 ? 118 TYR A CE1 1 
ATOM 377  C CE2 . TYR A 1 48  ? 95.150  175.657 99.594  1.00 25.50 ? 118 TYR A CE2 1 
ATOM 378  C CZ  . TYR A 1 48  ? 95.219  176.008 98.262  1.00 26.27 ? 118 TYR A CZ  1 
ATOM 379  O OH  . TYR A 1 48  ? 95.458  175.021 97.334  1.00 27.13 ? 118 TYR A OH  1 
ATOM 380  N N   . PRO A 1 49  ? 94.775  182.188 102.089 1.00 16.71 ? 119 PRO A N   1 
ATOM 381  C CA  . PRO A 1 49  ? 94.355  183.141 103.115 1.00 17.86 ? 119 PRO A CA  1 
ATOM 382  C C   . PRO A 1 49  ? 93.073  182.698 103.852 1.00 18.20 ? 119 PRO A C   1 
ATOM 383  O O   . PRO A 1 49  ? 92.309  181.847 103.390 1.00 18.21 ? 119 PRO A O   1 
ATOM 384  C CB  . PRO A 1 49  ? 94.092  184.429 102.315 1.00 18.78 ? 119 PRO A CB  1 
ATOM 385  C CG  . PRO A 1 49  ? 93.785  183.958 100.966 1.00 18.14 ? 119 PRO A CG  1 
ATOM 386  C CD  . PRO A 1 49  ? 94.569  182.708 100.726 1.00 18.12 ? 119 PRO A CD  1 
ATOM 387  N N   . ALA A 1 50  ? 92.869  183.276 105.016 1.00 19.05 ? 120 ALA A N   1 
ATOM 388  C CA  . ALA A 1 50  ? 91.651  183.088 105.754 1.00 20.82 ? 120 ALA A CA  1 
ATOM 389  C C   . ALA A 1 50  ? 90.758  184.267 105.467 1.00 22.68 ? 120 ALA A C   1 
ATOM 390  O O   . ALA A 1 50  ? 91.257  185.389 105.415 1.00 23.14 ? 120 ALA A O   1 
ATOM 391  C CB  . ALA A 1 50  ? 91.953  183.030 107.222 1.00 20.52 ? 120 ALA A CB  1 
ATOM 392  N N   . THR A 1 51  ? 89.454  184.012 105.297 1.00 24.23 ? 121 THR A N   1 
ATOM 393  C CA  . THR A 1 51  ? 88.441  185.057 105.154 1.00 27.04 ? 121 THR A CA  1 
ATOM 394  C C   . THR A 1 51  ? 87.180  184.806 105.991 1.00 27.38 ? 121 THR A C   1 
ATOM 395  O O   . THR A 1 51  ? 86.933  183.686 106.452 1.00 26.20 ? 121 THR A O   1 
ATOM 396  C CB  . THR A 1 51  ? 88.012  185.177 103.672 1.00 26.93 ? 121 THR A CB  1 
ATOM 397  O OG1 . THR A 1 51  ? 87.719  183.875 103.139 1.00 30.74 ? 121 THR A OG1 1 
ATOM 398  C CG2 . THR A 1 51  ? 89.168  185.687 102.817 1.00 29.62 ? 121 THR A CG2 1 
ATOM 399  N N   . GLY A 1 52  ? 86.395  185.870 106.174 1.00 29.32 ? 122 GLY A N   1 
ATOM 400  C CA  . GLY A 1 52  ? 85.136  185.814 106.899 1.00 30.05 ? 122 GLY A CA  1 
ATOM 401  C C   . GLY A 1 52  ? 85.240  186.072 108.388 1.00 31.44 ? 122 GLY A C   1 
ATOM 402  O O   . GLY A 1 52  ? 86.326  186.319 108.921 1.00 32.06 ? 122 GLY A O   1 
ATOM 403  N N   . THR A 1 53  ? 84.089  186.041 109.065 1.00 32.05 ? 123 THR A N   1 
ATOM 404  C CA  . THR A 1 53  ? 84.029  186.053 110.523 1.00 32.68 ? 123 THR A CA  1 
ATOM 405  C C   . THR A 1 53  ? 82.969  185.049 110.965 1.00 32.66 ? 123 THR A C   1 
ATOM 406  O O   . THR A 1 53  ? 81.797  185.252 110.701 1.00 34.10 ? 123 THR A O   1 
ATOM 407  C CB  . THR A 1 53  ? 83.728  187.440 111.070 1.00 33.22 ? 123 THR A CB  1 
ATOM 408  O OG1 . THR A 1 53  ? 84.720  188.373 110.601 1.00 34.63 ? 123 THR A OG1 1 
ATOM 409  C CG2 . THR A 1 53  ? 83.906  187.458 112.593 1.00 33.13 ? 123 THR A CG2 1 
ATOM 410  N N   . PRO A 1 54  ? 83.369  183.950 111.591 1.00 31.93 ? 124 PRO A N   1 
ATOM 411  C CA  . PRO A 1 54  ? 84.769  183.697 111.945 1.00 30.75 ? 124 PRO A CA  1 
ATOM 412  C C   . PRO A 1 54  ? 85.630  183.409 110.697 1.00 29.22 ? 124 PRO A C   1 
ATOM 413  O O   . PRO A 1 54  ? 85.123  182.908 109.674 1.00 28.49 ? 124 PRO A O   1 
ATOM 414  C CB  . PRO A 1 54  ? 84.668  182.475 112.874 1.00 31.15 ? 124 PRO A CB  1 
ATOM 415  C CG  . PRO A 1 54  ? 83.225  182.338 113.199 1.00 31.29 ? 124 PRO A CG  1 
ATOM 416  C CD  . PRO A 1 54  ? 82.506  182.822 111.976 1.00 32.43 ? 124 PRO A CD  1 
ATOM 417  N N   . PRO A 1 55  ? 86.914  183.767 110.732 1.00 27.42 ? 125 PRO A N   1 
ATOM 418  C CA  . PRO A 1 55  ? 87.790  183.467 109.595 1.00 26.12 ? 125 PRO A CA  1 
ATOM 419  C C   . PRO A 1 55  ? 87.807  181.965 109.305 1.00 24.70 ? 125 PRO A C   1 
ATOM 420  O O   . PRO A 1 55  ? 87.773  181.224 110.259 1.00 23.96 ? 125 PRO A O   1 
ATOM 421  C CB  . PRO A 1 55  ? 89.173  183.933 110.073 1.00 25.97 ? 125 PRO A CB  1 
ATOM 422  C CG  . PRO A 1 55  ? 88.899  184.951 111.139 1.00 26.98 ? 125 PRO A CG  1 
ATOM 423  C CD  . PRO A 1 55  ? 87.613  184.504 111.806 1.00 27.24 ? 125 PRO A CD  1 
ATOM 424  N N   . THR A 1 56  ? 87.800  181.555 108.035 1.00 23.62 ? 126 THR A N   1 
ATOM 425  C CA  . THR A 1 56  ? 87.928  180.151 107.606 1.00 23.36 ? 126 THR A CA  1 
ATOM 426  C C   . THR A 1 56  ? 88.789  180.113 106.345 1.00 23.25 ? 126 THR A C   1 
ATOM 427  O O   . THR A 1 56  ? 88.948  181.146 105.720 1.00 25.13 ? 126 THR A O   1 
ATOM 428  C CB  . THR A 1 56  ? 86.522  179.526 107.253 1.00 23.26 ? 126 THR A CB  1 
ATOM 429  O OG1 . THR A 1 56  ? 85.892  180.340 106.262 1.00 23.72 ? 126 THR A OG1 1 
ATOM 430  C CG2 . THR A 1 56  ? 85.527  179.589 108.446 1.00 23.15 ? 126 THR A CG2 1 
ATOM 431  N N   . ILE A 1 57  ? 89.304  178.934 105.983 1.00 23.71 ? 127 ILE A N   1 
ATOM 432  C CA  . ILE A 1 57  ? 89.992  178.637 104.702 1.00 24.52 ? 127 ILE A CA  1 
ATOM 433  C C   . ILE A 1 57  ? 89.051  178.002 103.640 1.00 27.20 ? 127 ILE A C   1 
ATOM 434  O O   . ILE A 1 57  ? 88.643  176.847 103.749 1.00 28.27 ? 127 ILE A O   1 
ATOM 435  C CB  . ILE A 1 57  ? 91.097  177.578 104.869 1.00 23.13 ? 127 ILE A CB  1 
ATOM 436  C CG1 . ILE A 1 57  ? 92.034  177.853 106.050 1.00 21.85 ? 127 ILE A CG1 1 
ATOM 437  C CG2 . ILE A 1 57  ? 91.880  177.401 103.530 1.00 22.06 ? 127 ILE A CG2 1 
ATOM 438  C CD1 . ILE A 1 57  ? 92.965  178.958 105.832 1.00 20.02 ? 127 ILE A CD1 1 
ATOM 439  N N   . GLN A 1 58  ? 88.819  178.723 102.568 1.00 29.69 ? 128 GLN A N   1 
ATOM 440  C CA  . GLN A 1 58  ? 88.087  178.244 101.366 1.00 31.39 ? 128 GLN A CA  1 
ATOM 441  C C   . GLN A 1 58  ? 88.844  177.306 100.353 1.00 32.55 ? 128 GLN A C   1 
ATOM 442  O O   . GLN A 1 58  ? 90.043  177.462 100.127 1.00 32.34 ? 128 GLN A O   1 
ATOM 443  C CB  . GLN A 1 58  ? 87.727  179.492 100.574 1.00 31.22 ? 128 GLN A CB  1 
ATOM 444  C CG  . GLN A 1 58  ? 89.038  180.156 100.042 1.00 34.02 ? 128 GLN A CG  1 
ATOM 445  C CD  . GLN A 1 58  ? 89.369  181.503 100.646 1.00 37.53 ? 128 GLN A CD  1 
ATOM 446  O OE1 . GLN A 1 58  ? 89.340  182.524 99.928  1.00 36.07 ? 128 GLN A OE1 1 
ATOM 447  N NE2 . GLN A 1 58  ? 89.764  181.506 101.935 1.00 31.21 ? 128 GLN A NE2 1 
ATOM 448  N N   . GLN A 1 59  ? 88.129  176.390 99.687  1.00 33.62 ? 129 GLN A N   1 
ATOM 449  C CA  . GLN A 1 59  ? 88.750  175.618 98.580  1.00 34.42 ? 129 GLN A CA  1 
ATOM 450  C C   . GLN A 1 59  ? 89.042  176.482 97.314  1.00 33.93 ? 129 GLN A C   1 
ATOM 451  O O   . GLN A 1 59  ? 89.867  176.095 96.490  1.00 34.90 ? 129 GLN A O   1 
ATOM 452  C CB  . GLN A 1 59  ? 87.974  174.312 98.216  1.00 35.16 ? 129 GLN A CB  1 
ATOM 453  C CG  . GLN A 1 59  ? 86.470  174.234 98.578  1.00 38.41 ? 129 GLN A CG  1 
ATOM 454  C CD  . GLN A 1 59  ? 85.645  173.279 97.676  1.00 41.69 ? 129 GLN A CD  1 
ATOM 455  O OE1 . GLN A 1 59  ? 86.125  172.211 97.257  1.00 44.04 ? 129 GLN A OE1 1 
ATOM 456  N NE2 . GLN A 1 59  ? 84.402  173.670 97.386  1.00 44.44 ? 129 GLN A NE2 1 
ATOM 457  N N   . GLY A 1 60  ? 88.443  177.668 97.169  1.00 33.71 ? 130 GLY A N   1 
ATOM 458  C CA  . GLY A 1 60  ? 88.669  178.473 95.955  1.00 33.00 ? 130 GLY A CA  1 
ATOM 459  C C   . GLY A 1 60  ? 89.805  179.502 95.893  1.00 32.06 ? 130 GLY A C   1 
ATOM 460  O O   . GLY A 1 60  ? 89.776  180.404 95.041  1.00 31.92 ? 130 GLY A O   1 
ATOM 461  N N   . ALA A 1 61  ? 90.817  179.356 96.752  1.00 29.97 ? 131 ALA A N   1 
ATOM 462  C CA  . ALA A 1 61  ? 91.702  180.469 97.080  1.00 27.15 ? 131 ALA A CA  1 
ATOM 463  C C   . ALA A 1 61  ? 93.027  180.444 96.332  1.00 24.25 ? 131 ALA A C   1 
ATOM 464  O O   . ALA A 1 61  ? 93.580  179.406 96.071  1.00 23.65 ? 131 ALA A O   1 
ATOM 465  C CB  . ALA A 1 61  ? 91.988  180.482 98.596  1.00 27.12 ? 131 ALA A CB  1 
ATOM 466  N N   . ASN A 1 62  ? 93.527  181.624 96.037  1.00 22.49 ? 132 ASN A N   1 
ATOM 467  C CA  . ASN A 1 62  ? 94.835  181.801 95.431  1.00 21.39 ? 132 ASN A CA  1 
ATOM 468  C C   . ASN A 1 62  ? 95.876  181.795 96.532  1.00 19.14 ? 132 ASN A C   1 
ATOM 469  O O   . ASN A 1 62  ? 95.702  182.543 97.493  1.00 17.41 ? 132 ASN A O   1 
ATOM 470  C CB  . ASN A 1 62  ? 94.838  183.166 94.797  1.00 22.75 ? 132 ASN A CB  1 
ATOM 471  C CG  . ASN A 1 62  ? 95.951  183.361 93.801  1.00 26.75 ? 132 ASN A CG  1 
ATOM 472  O OD1 . ASN A 1 62  ? 95.867  184.250 92.957  1.00 34.85 ? 132 ASN A OD1 1 
ATOM 473  N ND2 . ASN A 1 62  ? 96.970  182.513 93.854  1.00 31.27 ? 132 ASN A ND2 1 
ATOM 474  N N   . PRO A 1 63  ? 96.938  180.998 96.438  1.00 17.65 ? 133 PRO A N   1 
ATOM 475  C CA  . PRO A 1 63  ? 98.003  181.122 97.432  1.00 17.28 ? 133 PRO A CA  1 
ATOM 476  C C   . PRO A 1 63  ? 98.636  182.495 97.403  1.00 15.90 ? 133 PRO A C   1 
ATOM 477  O O   . PRO A 1 63  ? 98.849  183.084 96.365  1.00 16.03 ? 133 PRO A O   1 
ATOM 478  C CB  . PRO A 1 63  ? 99.018  180.057 97.014  1.00 17.75 ? 133 PRO A CB  1 
ATOM 479  C CG  . PRO A 1 63  ? 98.683  179.741 95.657  1.00 18.69 ? 133 PRO A CG  1 
ATOM 480  C CD  . PRO A 1 63  ? 97.246  179.925 95.480  1.00 18.27 ? 133 PRO A CD  1 
ATOM 481  N N   . ALA A 1 64  ? 98.941  182.962 98.602  1.00 15.60 ? 134 ALA A N   1 
ATOM 482  C CA  . ALA A 1 64  ? 99.495  184.261 98.843  1.00 15.00 ? 134 ALA A CA  1 
ATOM 483  C C   . ALA A 1 64  ? 100.443 184.139 100.046 1.00 13.84 ? 134 ALA A C   1 
ATOM 484  O O   . ALA A 1 64  ? 100.347 183.166 100.795 1.00 12.80 ? 134 ALA A O   1 
ATOM 485  C CB  . ALA A 1 64  ? 98.405  185.182 99.156  1.00 14.53 ? 134 ALA A CB  1 
ATOM 486  N N   . PRO A 1 65  ? 101.350 185.099 100.241 1.00 13.78 ? 135 PRO A N   1 
ATOM 487  C CA  . PRO A 1 65  ? 102.213 185.089 101.428 1.00 13.78 ? 135 PRO A CA  1 
ATOM 488  C C   . PRO A 1 65  ? 101.396 184.921 102.698 1.00 13.21 ? 135 PRO A C   1 
ATOM 489  O O   . PRO A 1 65  ? 100.390 185.586 102.880 1.00 13.19 ? 135 PRO A O   1 
ATOM 490  C CB  . PRO A 1 65  ? 102.917 186.457 101.382 1.00 12.45 ? 135 PRO A CB  1 
ATOM 491  C CG  . PRO A 1 65  ? 102.992 186.725 99.905  1.00 14.14 ? 135 PRO A CG  1 
ATOM 492  C CD  . PRO A 1 65  ? 101.638 186.261 99.379  1.00 14.43 ? 135 PRO A CD  1 
ATOM 493  N N   . ILE A 1 66  ? 101.798 183.964 103.520 1.00 13.14 ? 136 ILE A N   1 
ATOM 494  C CA  . ILE A 1 66  ? 101.177 183.758 104.835 1.00 13.26 ? 136 ILE A CA  1 
ATOM 495  C C   . ILE A 1 66  ? 101.450 185.037 105.637 1.00 13.22 ? 136 ILE A C   1 
ATOM 496  O O   . ILE A 1 66  ? 102.568 185.575 105.616 1.00 13.57 ? 136 ILE A O   1 
ATOM 497  C CB  . ILE A 1 66  ? 101.792 182.568 105.540 1.00 14.01 ? 136 ILE A CB  1 
ATOM 498  C CG1 . ILE A 1 66  ? 101.461 181.249 104.816 1.00 14.79 ? 136 ILE A CG1 1 
ATOM 499  C CG2 . ILE A 1 66  ? 101.339 182.486 107.027 1.00 14.58 ? 136 ILE A CG2 1 
ATOM 500  C CD1 . ILE A 1 66  ? 99.977  180.964 104.655 1.00 17.34 ? 136 ILE A CD1 1 
ATOM 501  N N   . THR A 1 67  ? 100.440 185.558 106.298 1.00 14.22 ? 137 THR A N   1 
ATOM 502  C CA  . THR A 1 67  ? 100.671 186.570 107.341 1.00 14.17 ? 137 THR A CA  1 
ATOM 503  C C   . THR A 1 67  ? 100.232 186.088 108.695 1.00 14.39 ? 137 THR A C   1 
ATOM 504  O O   . THR A 1 67  ? 99.207  185.378 108.825 1.00 13.13 ? 137 THR A O   1 
ATOM 505  C CB  . THR A 1 67  ? 99.947  187.894 107.037 1.00 14.77 ? 137 THR A CB  1 
ATOM 506  O OG1 . THR A 1 67  ? 98.534  187.697 106.876 1.00 15.96 ? 137 THR A OG1 1 
ATOM 507  C CG2 . THR A 1 67  ? 100.427 188.479 105.724 1.00 16.93 ? 137 THR A CG2 1 
ATOM 508  N N   . ILE A 1 68  ? 100.983 186.495 109.717 1.00 12.87 ? 138 ILE A N   1 
ATOM 509  C CA  . ILE A 1 68  ? 100.595 186.279 111.105 1.00 13.28 ? 138 ILE A CA  1 
ATOM 510  C C   . ILE A 1 68  ? 100.514 187.644 111.786 1.00 13.70 ? 138 ILE A C   1 
ATOM 511  O O   . ILE A 1 68  ? 101.465 188.072 112.434 1.00 13.43 ? 138 ILE A O   1 
ATOM 512  C CB  . ILE A 1 68  ? 101.547 185.314 111.810 1.00 14.15 ? 138 ILE A CB  1 
ATOM 513  C CG1 . ILE A 1 68  ? 101.499 183.957 111.087 1.00 16.89 ? 138 ILE A CG1 1 
ATOM 514  C CG2 . ILE A 1 68  ? 101.130 185.157 113.275 1.00 13.63 ? 138 ILE A CG2 1 
ATOM 515  C CD1 . ILE A 1 68  ? 102.532 182.966 111.556 1.00 20.49 ? 138 ILE A CD1 1 
ATOM 516  N N   . PRO A 1 69  ? 99.408  188.350 111.586 1.00 14.02 ? 139 PRO A N   1 
ATOM 517  C CA  . PRO A 1 69  ? 99.310  189.741 112.063 1.00 15.15 ? 139 PRO A CA  1 
ATOM 518  C C   . PRO A 1 69  ? 99.369  189.837 113.576 1.00 16.42 ? 139 PRO A C   1 
ATOM 519  O O   . PRO A 1 69  ? 98.901  188.935 114.254 1.00 16.14 ? 139 PRO A O   1 
ATOM 520  C CB  . PRO A 1 69  ? 97.942  190.224 111.569 1.00 15.08 ? 139 PRO A CB  1 
ATOM 521  C CG  . PRO A 1 69  ? 97.422  189.205 110.625 1.00 16.02 ? 139 PRO A CG  1 
ATOM 522  C CD  . PRO A 1 69  ? 98.180  187.921 110.882 1.00 14.89 ? 139 PRO A CD  1 
ATOM 523  N N   . ASN A 1 70  ? 99.391  190.717 112.737 1.00 18.40 ? 140 ASN A N   1 
ATOM 524  C CA  . ASN A 1 70  ? 99.992  190.954 114.044 1.00 21.14 ? 140 ASN A CA  1 
ATOM 525  C C   . ASN A 1 70  ? 99.250  192.033 114.852 1.00 21.61 ? 140 ASN A C   1 
ATOM 526  O O   . ASN A 1 70  ? 99.625  192.353 115.988 1.00 21.57 ? 140 ASN A O   1 
ATOM 527  C CB  . ASN A 1 70  ? 101.455 191.392 113.926 1.00 23.13 ? 140 ASN A CB  1 
ATOM 528  C CG  . ASN A 1 70  ? 101.651 192.601 113.010 1.00 25.80 ? 140 ASN A CG  1 
ATOM 529  O OD1 . ASN A 1 70  ? 100.749 193.423 112.877 1.00 32.39 ? 140 ASN A OD1 1 
ATOM 530  N ND2 . ASN A 1 70  ? 102.792 192.758 112.366 1.00 32.40 ? 140 ASN A ND2 1 
ATOM 531  N N   . THR A 1 71  ? 98.195  192.576 114.273 1.00 21.99 ? 141 THR A N   1 
ATOM 532  C CA  . THR A 1 71  ? 97.413  193.646 114.930 1.00 22.53 ? 141 THR A CA  1 
ATOM 533  C C   . THR A 1 71  ? 96.753  193.131 116.218 1.00 21.83 ? 141 THR A C   1 
ATOM 534  O O   . THR A 1 71  ? 96.342  191.963 116.302 1.00 21.38 ? 141 THR A O   1 
ATOM 535  C CB  . THR A 1 71  ? 96.334  194.177 113.977 1.00 23.18 ? 141 THR A CB  1 
ATOM 536  O OG1 . THR A 1 71  ? 95.078  194.213 114.637 1.00 28.36 ? 141 THR A OG1 1 
ATOM 537  C CG2 . THR A 1 71  ? 96.167  193.316 112.723 1.00 22.40 ? 141 THR A CG2 1 
ATOM 538  N N   . LEU A 1 72  ? 96.681  194.039 117.189 1.00 21.49 ? 142 LEU A N   1 
ATOM 539  C CA  . LEU A 1 72  ? 96.073  193.764 118.507 1.00 22.33 ? 142 LEU A CA  1 
ATOM 540  C C   . LEU A 1 72  ? 94.604  193.409 118.378 1.00 20.94 ? 142 LEU A C   1 
ATOM 541  O O   . LEU A 1 72  ? 94.031  193.456 117.283 1.00 21.34 ? 142 LEU A O   1 
ATOM 542  C CB  . LEU A 1 72  ? 95.996  195.016 119.407 1.00 23.39 ? 142 LEU A CB  1 
ATOM 543  C CG  . LEU A 1 72  ? 97.311  195.749 119.653 1.00 28.78 ? 142 LEU A CG  1 
ATOM 544  C CD1 . LEU A 1 72  ? 97.131  196.986 120.548 1.00 30.67 ? 142 LEU A CD1 1 
ATOM 545  C CD2 . LEU A 1 72  ? 98.353  194.885 120.369 1.00 31.64 ? 142 LEU A CD2 1 
ATOM 546  N N   . MET A 1 73  ? 94.027  193.063 119.503 1.00 19.78 ? 143 MET A N   1 
ATOM 547  C CA  . MET A 1 73  ? 92.587  192.871 119.574 1.00 20.08 ? 143 MET A CA  1 
ATOM 548  C C   . MET A 1 73  ? 92.110  193.830 120.656 1.00 19.97 ? 143 MET A C   1 
ATOM 549  O O   . MET A 1 73  ? 92.915  194.368 121.426 1.00 18.17 ? 143 MET A O   1 
ATOM 550  C CB  . MET A 1 73  ? 92.230  191.428 119.930 1.00 20.16 ? 143 MET A CB  1 
ATOM 551  C CG  . MET A 1 73  ? 90.736  191.143 119.738 1.00 21.07 ? 143 MET A CG  1 
ATOM 552  S SD  . MET A 1 73  ? 90.312  189.422 119.894 1.00 20.94 ? 143 MET A SD  1 
ATOM 553  C CE  . MET A 1 73  ? 90.217  188.674 118.280 1.00 21.63 ? 143 MET A CE  1 
ATOM 554  N N   . ALA A 1 74  ? 90.819  194.049 120.676 1.00 20.84 ? 144 ALA A N   1 
ATOM 555  C CA  . ALA A 1 74  ? 90.203  195.000 121.612 1.00 21.43 ? 144 ALA A CA  1 
ATOM 556  C C   . ALA A 1 74  ? 90.021  194.387 123.000 1.00 21.46 ? 144 ALA A C   1 
ATOM 557  O O   . ALA A 1 74  ? 90.516  193.282 123.284 1.00 20.90 ? 144 ALA A O   1 
ATOM 558  C CB  . ALA A 1 74  ? 88.830  195.426 121.102 1.00 22.19 ? 144 ALA A CB  1 
ATOM 559  N N   . ALA A 1 75  ? 89.307  195.151 123.810 1.00 21.12 ? 145 ALA A N   1 
ATOM 560  C CA  . ALA A 1 75  ? 88.946  194.750 125.167 1.00 21.44 ? 145 ALA A CA  1 
ATOM 561  C C   . ALA A 1 75  ? 87.779  193.794 125.068 1.00 21.39 ? 145 ALA A C   1 
ATOM 562  O O   . ALA A 1 75  ? 87.317  193.460 123.965 1.00 22.03 ? 145 ALA A O   1 
ATOM 563  C CB  . ALA A 1 75  ? 88.570  195.962 126.007 1.00 21.37 ? 145 ALA A CB  1 
ATOM 564  N N   . LYS A 1 76  ? 87.321  193.417 126.211 1.00 21.40 ? 146 LYS A N   1 
ATOM 565  C CA  . LYS A 1 76  ? 86.340  192.370 126.318 1.00 21.21 ? 146 LYS A CA  1 
ATOM 566  C C   . LYS A 1 76  ? 85.253  192.726 127.330 1.00 20.85 ? 146 LYS A C   1 
ATOM 567  O O   . LYS A 1 76  ? 85.416  192.489 128.523 1.00 19.92 ? 146 LYS A O   1 
ATOM 568  C CB  . LYS A 1 76  ? 87.126  191.147 126.758 1.00 21.83 ? 146 LYS A CB  1 
ATOM 569  C CG  . LYS A 1 76  ? 86.379  189.846 126.651 1.00 21.29 ? 146 LYS A CG  1 
ATOM 570  C CD  . LYS A 1 76  ? 85.957  189.570 125.216 1.00 23.10 ? 146 LYS A CD  1 
ATOM 571  C CE  . LYS A 1 76  ? 85.164  188.286 125.077 1.00 25.36 ? 146 LYS A CE  1 
ATOM 572  N NZ  . LYS A 1 76  ? 84.734  188.031 123.700 1.00 27.22 ? 146 LYS A NZ  1 
ATOM 573  N N   . SER A 1 77  ? 84.158  193.294 126.824 1.00 20.28 ? 147 SER A N   1 
ATOM 574  C CA  . SER A 1 77  ? 82.987  193.635 127.619 1.00 20.20 ? 147 SER A CA  1 
ATOM 575  C C   . SER A 1 77  ? 82.391  192.326 128.083 1.00 18.81 ? 147 SER A C   1 
ATOM 576  O O   . SER A 1 77  ? 82.295  191.378 127.337 1.00 18.87 ? 147 SER A O   1 
ATOM 577  C CB  . SER A 1 77  ? 81.951  194.391 126.777 1.00 19.65 ? 147 SER A CB  1 
ATOM 578  O OG  . SER A 1 77  ? 81.091  195.181 127.584 1.00 21.69 ? 147 SER A OG  1 
ATOM 579  N N   . THR A 1 78  ? 81.970  192.291 129.329 1.00 18.12 ? 148 THR A N   1 
ATOM 580  C CA  . THR A 1 78  ? 81.349  191.096 129.880 1.00 17.21 ? 148 THR A CA  1 
ATOM 581  C C   . THR A 1 78  ? 79.982  190.873 129.290 1.00 17.41 ? 148 THR A C   1 
ATOM 582  O O   . THR A 1 78  ? 79.181  191.833 129.243 1.00 17.99 ? 148 THR A O   1 
ATOM 583  C CB  . THR A 1 78  ? 81.188  191.311 131.387 1.00 17.43 ? 148 THR A CB  1 
ATOM 584  O OG1 . THR A 1 78  ? 82.490  191.462 131.974 1.00 16.35 ? 148 THR A OG1 1 
ATOM 585  C CG2 . THR A 1 78  ? 80.544  190.102 132.044 1.00 16.56 ? 148 THR A CG2 1 
ATOM 586  N N   . THR A 1 79  ? 79.726  189.648 128.833 1.00 17.82 ? 149 THR A N   1 
ATOM 587  C CA  . THR A 1 79  ? 78.374  189.219 128.383 1.00 18.20 ? 149 THR A CA  1 
ATOM 588  C C   . THR A 1 79  ? 77.759  188.048 129.158 1.00 18.55 ? 149 THR A C   1 
ATOM 589  O O   . THR A 1 79  ? 76.556  187.712 128.976 1.00 19.12 ? 149 THR A O   1 
ATOM 590  C CB  . THR A 1 79  ? 78.392  188.818 126.918 1.00 18.05 ? 149 THR A CB  1 
ATOM 591  O OG1 . THR A 1 79  ? 79.319  187.754 126.729 1.00 20.31 ? 149 THR A OG1 1 
ATOM 592  C CG2 . THR A 1 79  ? 78.877  189.949 126.027 1.00 19.12 ? 149 THR A CG2 1 
ATOM 593  N N   . THR A 1 80  ? 78.558  187.378 129.974 1.00 19.02 ? 150 THR A N   1 
ATOM 594  C CA  . THR A 1 80  ? 77.999  186.412 130.929 1.00 17.90 ? 150 THR A CA  1 
ATOM 595  C C   . THR A 1 80  ? 78.645  186.595 132.285 1.00 17.75 ? 150 THR A C   1 
ATOM 596  O O   . THR A 1 80  ? 79.808  187.004 132.416 1.00 16.82 ? 150 THR A O   1 
ATOM 597  C CB  . THR A 1 80  ? 78.195  184.952 130.483 1.00 18.87 ? 150 THR A CB  1 
ATOM 598  O OG1 . THR A 1 80  ? 79.591  184.650 130.428 1.00 18.62 ? 150 THR A OG1 1 
ATOM 599  C CG2 . THR A 1 80  ? 77.642  184.700 129.090 1.00 19.95 ? 150 THR A CG2 1 
ATOM 600  N N   . ALA A 1 81  ? 77.867  186.281 133.305 1.00 17.42 ? 151 ALA A N   1 
ATOM 601  C CA  . ALA A 1 81  ? 78.368  186.204 134.657 1.00 17.14 ? 151 ALA A CA  1 
ATOM 602  C C   . ALA A 1 81  ? 77.540  185.189 135.412 1.00 17.29 ? 151 ALA A C   1 
ATOM 603  O O   . ALA A 1 81  ? 76.396  184.898 135.029 1.00 15.23 ? 151 ALA A O   1 
ATOM 604  C CB  . ALA A 1 81  ? 78.313  187.531 135.310 1.00 17.10 ? 151 ALA A CB  1 
ATOM 605  N N   . SER A 1 82  ? 78.113  184.658 136.488 1.00 17.12 ? 152 SER A N   1 
ATOM 606  C CA  . SER A 1 82  ? 77.411  183.662 137.309 1.00 16.91 ? 152 SER A CA  1 
ATOM 607  C C   . SER A 1 82  ? 77.726  183.876 138.785 1.00 16.17 ? 152 SER A C   1 
ATOM 608  O O   . SER A 1 82  ? 78.793  184.390 139.160 1.00 15.54 ? 152 SER A O   1 
ATOM 609  C CB  . SER A 1 82  ? 77.767  182.232 136.872 1.00 17.32 ? 152 SER A CB  1 
ATOM 610  O OG  . SER A 1 82  ? 79.175  181.995 136.929 1.00 18.72 ? 152 SER A OG  1 
ATOM 611  N N   . MET A 1 83  ? 76.786  183.474 139.628 1.00 16.20 ? 153 MET A N   1 
ATOM 612  C CA  . MET A 1 83  ? 76.982  183.520 141.073 1.00 15.37 ? 153 MET A CA  1 
ATOM 613  C C   . MET A 1 83  ? 76.257  182.304 141.617 1.00 15.34 ? 153 MET A C   1 
ATOM 614  O O   . MET A 1 83  ? 75.070  182.155 141.400 1.00 16.23 ? 153 MET A O   1 
ATOM 615  C CB  . MET A 1 83  ? 76.421  184.827 141.658 1.00 15.48 ? 153 MET A CB  1 
ATOM 616  C CG  . MET A 1 83  ? 76.681  185.027 143.138 1.00 17.00 ? 153 MET A CG  1 
ATOM 617  S SD  . MET A 1 83  ? 76.079  186.583 143.769 1.00 17.84 ? 153 MET A SD  1 
ATOM 618  C CE  . MET A 1 83  ? 77.398  187.649 143.369 1.00 18.41 ? 153 MET A CE  1 
ATOM 619  N N   . GLN A 1 84  ? 76.974  181.430 142.295 1.00 14.91 ? 154 GLN A N   1 
ATOM 620  C CA  . GLN A 1 84  ? 76.372  180.234 142.906 1.00 15.28 ? 154 GLN A CA  1 
ATOM 621  C C   . GLN A 1 84  ? 76.286  180.475 144.395 1.00 14.57 ? 154 GLN A C   1 
ATOM 622  O O   . GLN A 1 84  ? 77.304  180.636 145.042 1.00 14.68 ? 154 GLN A O   1 
ATOM 623  C CB  . GLN A 1 84  ? 77.251  178.994 142.644 1.00 16.00 ? 154 GLN A CB  1 
ATOM 624  C CG  . GLN A 1 84  ? 76.664  177.666 143.147 1.00 18.42 ? 154 GLN A CG  1 
ATOM 625  C CD  . GLN A 1 84  ? 77.682  176.513 143.119 1.00 22.63 ? 154 GLN A CD  1 
ATOM 626  O OE1 . GLN A 1 84  ? 78.677  176.578 142.388 1.00 26.65 ? 154 GLN A OE1 1 
ATOM 627  N NE2 . GLN A 1 84  ? 77.444  175.475 143.922 1.00 23.16 ? 154 GLN A NE2 1 
ATOM 628  N N   . ILE A 1 85  ? 75.079  180.464 144.952 1.00 13.93 ? 155 ILE A N   1 
ATOM 629  C CA  . ILE A 1 85  ? 74.891  180.790 146.354 1.00 14.07 ? 155 ILE A CA  1 
ATOM 630  C C   . ILE A 1 85  ? 74.114  179.668 147.044 1.00 14.82 ? 155 ILE A C   1 
ATOM 631  O O   . ILE A 1 85  ? 73.250  179.050 146.433 1.00 14.05 ? 155 ILE A O   1 
ATOM 632  C CB  . ILE A 1 85  ? 74.190  182.168 146.508 1.00 13.99 ? 155 ILE A CB  1 
ATOM 633  C CG1 . ILE A 1 85  ? 74.069  182.557 147.976 1.00 14.43 ? 155 ILE A CG1 1 
ATOM 634  C CG2 . ILE A 1 85  ? 72.808  182.182 145.835 1.00 16.09 ? 155 ILE A CG2 1 
ATOM 635  C CD1 . ILE A 1 85  ? 73.717  184.030 148.144 1.00 14.83 ? 155 ILE A CD1 1 
ATOM 636  N N   . ASN A 1 86  ? 74.485  179.413 148.290 1.00 15.37 ? 156 ASN A N   1 
ATOM 637  C CA  . ASN A 1 86  ? 73.731  178.537 149.188 1.00 15.26 ? 156 ASN A CA  1 
ATOM 638  C C   . ASN A 1 86  ? 72.969  179.433 150.161 1.00 15.81 ? 156 ASN A C   1 
ATOM 639  O O   . ASN A 1 86  ? 73.584  180.191 150.917 1.00 15.25 ? 156 ASN A O   1 
ATOM 640  C CB  . ASN A 1 86  ? 74.679  177.638 149.957 1.00 15.55 ? 156 ASN A CB  1 
ATOM 641  C CG  . ASN A 1 86  ? 75.260  176.527 149.104 1.00 17.22 ? 156 ASN A CG  1 
ATOM 642  O OD1 . ASN A 1 86  ? 74.599  176.000 148.226 1.00 19.35 ? 156 ASN A OD1 1 
ATOM 643  N ND2 . ASN A 1 86  ? 76.500  176.186 149.356 1.00 21.48 ? 156 ASN A ND2 1 
ATOM 644  N N   . LEU A 1 87  ? 71.639  179.364 150.114 1.00 15.74 ? 157 LEU A N   1 
ATOM 645  C CA  . LEU A 1 87  ? 70.797  180.189 150.936 1.00 15.36 ? 157 LEU A CA  1 
ATOM 646  C C   . LEU A 1 87  ? 70.140  179.341 152.034 1.00 15.69 ? 157 LEU A C   1 
ATOM 647  O O   . LEU A 1 87  ? 69.852  178.167 151.850 1.00 16.20 ? 157 LEU A O   1 
ATOM 648  C CB  . LEU A 1 87  ? 69.737  180.902 150.083 1.00 15.58 ? 157 LEU A CB  1 
ATOM 649  C CG  . LEU A 1 87  ? 70.261  181.996 149.146 1.00 15.29 ? 157 LEU A CG  1 
ATOM 650  C CD1 . LEU A 1 87  ? 69.223  182.321 148.077 1.00 16.70 ? 157 LEU A CD1 1 
ATOM 651  C CD2 . LEU A 1 87  ? 70.642  183.225 149.925 1.00 15.28 ? 157 LEU A CD2 1 
ATOM 652  N N   . ASN A 1 88  ? 69.966  179.954 153.203 1.00 14.93 ? 158 ASN A N   1 
ATOM 653  C CA  . ASN A 1 88  ? 69.502  179.257 154.393 1.00 14.47 ? 158 ASN A CA  1 
ATOM 654  C C   . ASN A 1 88  ? 67.982  179.320 154.511 1.00 14.71 ? 158 ASN A C   1 
ATOM 655  O O   . ASN A 1 88  ? 67.423  180.393 154.700 1.00 13.87 ? 158 ASN A O   1 
ATOM 656  C CB  . ASN A 1 88  ? 70.125  179.942 155.599 1.00 14.25 ? 158 ASN A CB  1 
ATOM 657  C CG  . ASN A 1 88  ? 69.557  179.460 156.899 1.00 14.84 ? 158 ASN A CG  1 
ATOM 658  O OD1 . ASN A 1 88  ? 69.266  178.273 157.042 1.00 16.46 ? 158 ASN A OD1 1 
ATOM 659  N ND2 . ASN A 1 88  ? 69.446  180.369 157.885 1.00 13.15 ? 158 ASN A ND2 1 
ATOM 660  N N   . SER A 1 89  ? 67.310  178.172 154.408 1.00 15.38 ? 159 SER A N   1 
ATOM 661  C CA  . SER A 1 89  ? 65.846  178.160 154.470 1.00 16.09 ? 159 SER A CA  1 
ATOM 662  C C   . SER A 1 89  ? 65.286  178.719 155.787 1.00 16.00 ? 159 SER A C   1 
ATOM 663  O O   . SER A 1 89  ? 64.151  179.227 155.812 1.00 15.80 ? 159 SER A O   1 
ATOM 664  C CB  . SER A 1 89  ? 65.270  176.775 154.189 1.00 17.32 ? 159 SER A CB  1 
ATOM 665  O OG  . SER A 1 89  ? 65.233  176.005 155.354 1.00 21.27 ? 159 SER A OG  1 
ATOM 666  N N   . THR A 1 90  ? 66.067  178.625 156.861 1.00 15.53 ? 160 THR A N   1 
ATOM 667  C CA  . THR A 1 90  ? 65.627  179.136 158.162 1.00 15.40 ? 160 THR A CA  1 
ATOM 668  C C   . THR A 1 90  ? 65.864  180.625 158.363 1.00 15.05 ? 160 THR A C   1 
ATOM 669  O O   . THR A 1 90  ? 65.528  181.146 159.407 1.00 15.33 ? 160 THR A O   1 
ATOM 670  C CB  . THR A 1 90  ? 66.241  178.346 159.384 1.00 15.44 ? 160 THR A CB  1 
ATOM 671  O OG1 . THR A 1 90  ? 67.667  178.512 159.467 1.00 13.73 ? 160 THR A OG1 1 
ATOM 672  C CG2 . THR A 1 90  ? 66.004  176.843 159.251 1.00 16.06 ? 160 THR A CG2 1 
ATOM 673  N N   . ASP A 1 91  ? 66.413  181.319 157.373 1.00 15.97 ? 161 ASP A N   1 
ATOM 674  C CA  . ASP A 1 91  ? 66.638  182.762 157.485 1.00 16.08 ? 161 ASP A CA  1 
ATOM 675  C C   . ASP A 1 91  ? 65.352  183.556 157.727 1.00 16.55 ? 161 ASP A C   1 
ATOM 676  O O   . ASP A 1 91  ? 64.272  183.162 157.313 1.00 15.51 ? 161 ASP A O   1 
ATOM 677  C CB  . ASP A 1 91  ? 67.315  183.301 156.242 1.00 15.89 ? 161 ASP A CB  1 
ATOM 678  C CG  . ASP A 1 91  ? 68.747  183.706 156.479 1.00 16.69 ? 161 ASP A CG  1 
ATOM 679  O OD1 . ASP A 1 91  ? 69.548  183.005 157.110 1.00 16.29 ? 161 ASP A OD1 1 
ATOM 680  O OD2 . ASP A 1 91  ? 69.132  184.813 156.001 1.00 20.82 ? 161 ASP A OD2 1 
ATOM 681  N N   . PRO A 1 92  ? 65.460  184.669 158.426 1.00 17.64 ? 162 PRO A N   1 
ATOM 682  C CA  . PRO A 1 92  ? 64.299  185.520 158.621 1.00 18.62 ? 162 PRO A CA  1 
ATOM 683  C C   . PRO A 1 92  ? 64.020  186.349 157.403 1.00 20.35 ? 162 PRO A C   1 
ATOM 684  O O   . PRO A 1 92  ? 64.934  186.619 156.621 1.00 20.40 ? 162 PRO A O   1 
ATOM 685  C CB  . PRO A 1 92  ? 64.712  186.407 159.801 1.00 19.07 ? 162 PRO A CB  1 
ATOM 686  C CG  . PRO A 1 92  ? 66.141  186.477 159.730 1.00 18.62 ? 162 PRO A CG  1 
ATOM 687  C CD  . PRO A 1 92  ? 66.627  185.170 159.146 1.00 17.50 ? 162 PRO A CD  1 
ATOM 688  N N   . VAL A 1 93  ? 62.756  186.736 157.240 1.00 21.51 ? 163 VAL A N   1 
ATOM 689  C CA  . VAL A 1 93  ? 62.393  187.814 156.346 1.00 23.16 ? 163 VAL A CA  1 
ATOM 690  C C   . VAL A 1 93  ? 62.773  189.104 157.066 1.00 23.72 ? 163 VAL A C   1 
ATOM 691  O O   . VAL A 1 93  ? 62.258  189.352 158.163 1.00 25.30 ? 163 VAL A O   1 
ATOM 692  C CB  . VAL A 1 93  ? 60.856  187.801 156.051 1.00 22.89 ? 163 VAL A CB  1 
ATOM 693  C CG1 . VAL A 1 93  ? 60.428  189.082 155.343 1.00 24.55 ? 163 VAL A CG1 1 
ATOM 694  C CG2 . VAL A 1 93  ? 60.470  186.577 155.250 1.00 24.20 ? 163 VAL A CG2 1 
ATOM 695  N N   . PRO A 1 94  ? 63.647  189.934 156.500 1.00 24.40 ? 164 PRO A N   1 
ATOM 696  C CA  . PRO A 1 94  ? 64.045  191.169 157.183 1.00 25.21 ? 164 PRO A CA  1 
ATOM 697  C C   . PRO A 1 94  ? 62.836  192.032 157.547 1.00 27.55 ? 164 PRO A C   1 
ATOM 698  O O   . PRO A 1 94  ? 61.906  192.175 156.745 1.00 26.91 ? 164 PRO A O   1 
ATOM 699  C CB  . PRO A 1 94  ? 64.944  191.873 156.169 1.00 25.17 ? 164 PRO A CB  1 
ATOM 700  C CG  . PRO A 1 94  ? 65.405  190.784 155.219 1.00 24.00 ? 164 PRO A CG  1 
ATOM 701  C CD  . PRO A 1 94  ? 64.318  189.786 155.192 1.00 23.82 ? 164 PRO A CD  1 
ATOM 702  N N   . SER A 1 95  ? 62.836  192.551 158.771 1.00 29.91 ? 165 SER A N   1 
ATOM 703  C CA  . SER A 1 95  ? 61.735  193.393 159.236 1.00 32.15 ? 165 SER A CA  1 
ATOM 704  C C   . SER A 1 95  ? 61.942  194.805 158.745 1.00 33.75 ? 165 SER A C   1 
ATOM 705  O O   . SER A 1 95  ? 60.975  195.466 158.382 1.00 34.89 ? 165 SER A O   1 
ATOM 706  C CB  . SER A 1 95  ? 61.572  193.357 160.778 1.00 32.32 ? 165 SER A CB  1 
ATOM 707  O OG  . SER A 1 95  ? 62.798  193.564 161.460 1.00 32.78 ? 165 SER A OG  1 
ATOM 708  N N   . LYS A 1 96  ? 63.194  195.263 158.730 1.00 35.32 ? 166 LYS A N   1 
ATOM 709  C CA  . LYS A 1 96  ? 63.516  196.583 158.191 1.00 37.02 ? 166 LYS A CA  1 
ATOM 710  C C   . LYS A 1 96  ? 63.173  196.682 156.705 1.00 37.62 ? 166 LYS A C   1 
ATOM 711  O O   . LYS A 1 96  ? 63.703  195.925 155.871 1.00 37.55 ? 166 LYS A O   1 
ATOM 712  C CB  . LYS A 1 96  ? 64.998  196.948 158.413 1.00 37.51 ? 166 LYS A CB  1 
ATOM 713  C CG  . LYS A 1 96  ? 65.213  198.293 159.150 1.00 39.95 ? 166 LYS A CG  1 
ATOM 714  C CD  . LYS A 1 96  ? 64.319  199.403 158.591 1.00 41.43 ? 166 LYS A CD  1 
ATOM 715  C CE  . LYS A 1 96  ? 64.872  200.803 158.851 1.00 42.76 ? 166 LYS A CE  1 
ATOM 716  N NZ  . LYS A 1 96  ? 64.542  201.709 157.699 1.00 42.64 ? 166 LYS A NZ  1 
ATOM 717  N N   . THR A 1 97  ? 62.252  197.597 156.397 1.00 38.26 ? 167 THR A N   1 
ATOM 718  C CA  . THR A 1 97  ? 61.936  197.987 155.029 1.00 38.88 ? 167 THR A CA  1 
ATOM 719  C C   . THR A 1 97  ? 62.218  199.492 154.893 1.00 38.65 ? 167 THR A C   1 
ATOM 720  O O   . THR A 1 97  ? 62.335  200.204 155.896 1.00 39.25 ? 167 THR A O   1 
ATOM 721  C CB  . THR A 1 97  ? 60.452  197.706 154.673 1.00 39.25 ? 167 THR A CB  1 
ATOM 722  O OG1 . THR A 1 97  ? 59.619  197.859 155.832 1.00 41.35 ? 167 THR A OG1 1 
ATOM 723  C CG2 . THR A 1 97  ? 60.233  196.258 154.253 1.00 39.52 ? 167 THR A CG2 1 
ATOM 724  N N   . PRO A 1 98  ? 62.367  199.973 153.665 1.00 37.88 ? 168 PRO A N   1 
ATOM 725  C CA  . PRO A 1 98  ? 62.443  199.127 152.472 1.00 36.86 ? 168 PRO A CA  1 
ATOM 726  C C   . PRO A 1 98  ? 63.856  198.558 152.320 1.00 35.25 ? 168 PRO A C   1 
ATOM 727  O O   . PRO A 1 98  ? 64.745  198.872 153.127 1.00 34.63 ? 168 PRO A O   1 
ATOM 728  C CB  . PRO A 1 98  ? 62.129  200.105 151.331 1.00 37.20 ? 168 PRO A CB  1 
ATOM 729  C CG  . PRO A 1 98  ? 61.793  201.410 151.991 1.00 38.05 ? 168 PRO A CG  1 
ATOM 730  C CD  . PRO A 1 98  ? 62.484  201.400 153.325 1.00 38.18 ? 168 PRO A CD  1 
ATOM 731  N N   . PHE A 1 99  ? 64.066  197.734 151.299 1.00 33.55 ? 169 PHE A N   1 
ATOM 732  C CA  . PHE A 1 99  ? 65.416  197.335 150.954 1.00 32.06 ? 169 PHE A CA  1 
ATOM 733  C C   . PHE A 1 99  ? 66.248  198.574 150.624 1.00 32.03 ? 169 PHE A C   1 
ATOM 734  O O   . PHE A 1 99  ? 65.795  199.437 149.891 1.00 30.91 ? 169 PHE A O   1 
ATOM 735  C CB  . PHE A 1 99  ? 65.450  196.403 149.752 1.00 31.77 ? 169 PHE A CB  1 
ATOM 736  C CG  . PHE A 1 99  ? 66.827  196.228 149.202 1.00 28.88 ? 169 PHE A CG  1 
ATOM 737  C CD1 . PHE A 1 99  ? 67.788  195.570 149.948 1.00 26.39 ? 169 PHE A CD1 1 
ATOM 738  C CD2 . PHE A 1 99  ? 67.183  196.774 147.970 1.00 26.91 ? 169 PHE A CD2 1 
ATOM 739  C CE1 . PHE A 1 99  ? 69.072  195.428 149.465 1.00 25.55 ? 169 PHE A CE1 1 
ATOM 740  C CE2 . PHE A 1 99  ? 68.457  196.628 147.479 1.00 26.45 ? 169 PHE A CE2 1 
ATOM 741  C CZ  . PHE A 1 99  ? 69.409  195.958 148.225 1.00 25.49 ? 169 PHE A CZ  1 
ATOM 742  N N   . SER A 1 100 ? 67.454  198.649 151.177 1.00 31.86 ? 170 SER A N   1 
ATOM 743  C CA  . SER A 1 100 ? 68.395  199.716 150.843 1.00 32.56 ? 170 SER A CA  1 
ATOM 744  C C   . SER A 1 100 ? 69.796  199.161 150.886 1.00 33.02 ? 170 SER A C   1 
ATOM 745  O O   . SER A 1 100 ? 70.143  198.445 151.821 1.00 33.12 ? 170 SER A O   1 
ATOM 746  C CB  . SER A 1 100 ? 68.273  200.882 151.834 1.00 32.39 ? 170 SER A CB  1 
ATOM 747  O OG  . SER A 1 100 ? 69.378  201.769 151.697 1.00 33.96 ? 170 SER A OG  1 
ATOM 748  N N   . VAL A 1 101 ? 70.594  199.469 149.867 1.00 33.37 ? 171 VAL A N   1 
ATOM 749  C CA  . VAL A 1 101 ? 71.983  199.036 149.833 1.00 34.11 ? 171 VAL A CA  1 
ATOM 750  C C   . VAL A 1 101 ? 72.771  199.555 151.050 1.00 34.80 ? 171 VAL A C   1 
ATOM 751  O O   . VAL A 1 101 ? 73.769  198.960 151.417 1.00 35.31 ? 171 VAL A O   1 
ATOM 752  C CB  . VAL A 1 101 ? 72.706  199.437 148.511 1.00 34.32 ? 171 VAL A CB  1 
ATOM 753  C CG1 . VAL A 1 101 ? 72.001  198.835 147.285 1.00 34.08 ? 171 VAL A CG1 1 
ATOM 754  C CG2 . VAL A 1 101 ? 72.838  200.972 148.382 1.00 34.18 ? 171 VAL A CG2 1 
ATOM 755  N N   . SER A 1 102 ? 72.301  200.637 151.681 1.00 35.50 ? 172 SER A N   1 
ATOM 756  C CA  . SER A 1 102 ? 72.950  201.228 152.865 1.00 36.16 ? 172 SER A CA  1 
ATOM 757  C C   . SER A 1 102 ? 72.500  200.692 154.234 1.00 35.81 ? 172 SER A C   1 
ATOM 758  O O   . SER A 1 102 ? 73.156  200.977 155.241 1.00 36.46 ? 172 SER A O   1 
ATOM 759  C CB  . SER A 1 102 ? 72.741  202.749 152.860 1.00 36.39 ? 172 SER A CB  1 
ATOM 760  O OG  . SER A 1 102 ? 72.853  203.281 151.542 1.00 38.42 ? 172 SER A OG  1 
ATOM 761  N N   . ASP A 1 103 ? 71.391  199.952 154.290 1.00 35.12 ? 173 ASP A N   1 
ATOM 762  C CA  . ASP A 1 103 ? 70.841  199.424 155.555 1.00 34.19 ? 173 ASP A CA  1 
ATOM 763  C C   . ASP A 1 103 ? 71.087  197.908 155.666 1.00 33.07 ? 173 ASP A C   1 
ATOM 764  O O   . ASP A 1 103 ? 70.376  197.124 155.055 1.00 31.80 ? 173 ASP A O   1 
ATOM 765  C CB  . ASP A 1 103 ? 69.336  199.716 155.627 1.00 34.39 ? 173 ASP A CB  1 
ATOM 766  C CG  . ASP A 1 103 ? 68.740  199.524 157.026 1.00 36.16 ? 173 ASP A CG  1 
ATOM 767  O OD1 . ASP A 1 103 ? 69.437  199.601 158.084 1.00 40.83 ? 173 ASP A OD1 1 
ATOM 768  O OD2 . ASP A 1 103 ? 67.520  199.304 157.167 1.00 40.44 ? 173 ASP A OD2 1 
ATOM 769  N N   . ALA A 1 104 ? 72.081  197.513 156.460 1.00 32.34 ? 174 ALA A N   1 
ATOM 770  C CA  . ALA A 1 104 ? 72.598  196.132 156.448 1.00 31.69 ? 174 ALA A CA  1 
ATOM 771  C C   . ALA A 1 104 ? 71.624  195.126 157.031 1.00 30.58 ? 174 ALA A C   1 
ATOM 772  O O   . ALA A 1 104 ? 71.790  193.926 156.852 1.00 30.57 ? 174 ALA A O   1 
ATOM 773  C CB  . ALA A 1 104 ? 73.936  196.055 157.172 1.00 31.74 ? 174 ALA A CB  1 
ATOM 774  N N   . ASP A 1 105 ? 70.589  195.599 157.713 1.00 29.02 ? 175 ASP A N   1 
ATOM 775  C CA  . ASP A 1 105 ? 69.555  194.691 158.185 1.00 28.06 ? 175 ASP A CA  1 
ATOM 776  C C   . ASP A 1 105 ? 68.289  194.701 157.328 1.00 26.28 ? 175 ASP A C   1 
ATOM 777  O O   . ASP A 1 105 ? 67.266  194.187 157.739 1.00 25.49 ? 175 ASP A O   1 
ATOM 778  C CB  . ASP A 1 105 ? 69.250  194.869 159.690 1.00 28.97 ? 175 ASP A CB  1 
ATOM 779  C CG  . ASP A 1 105 ? 68.919  196.304 160.096 1.00 31.36 ? 175 ASP A CG  1 
ATOM 780  O OD1 . ASP A 1 105 ? 68.596  197.162 159.247 1.00 36.75 ? 175 ASP A OD1 1 
ATOM 781  O OD2 . ASP A 1 105 ? 68.958  196.646 161.292 1.00 33.52 ? 175 ASP A OD2 1 
ATOM 782  N N   . SER A 1 106 ? 68.383  195.251 156.117 1.00 24.86 ? 176 SER A N   1 
ATOM 783  C CA  . SER A 1 106 ? 67.277  195.238 155.161 1.00 23.16 ? 176 SER A CA  1 
ATOM 784  C C   . SER A 1 106 ? 67.450  194.130 154.117 1.00 21.97 ? 176 SER A C   1 
ATOM 785  O O   . SER A 1 106 ? 66.558  193.928 153.306 1.00 21.78 ? 176 SER A O   1 
ATOM 786  C CB  . SER A 1 106 ? 67.131  196.604 154.452 1.00 23.83 ? 176 SER A CB  1 
ATOM 787  O OG  . SER A 1 106 ? 68.149  196.825 153.489 1.00 22.57 ? 176 SER A OG  1 
ATOM 788  N N   . TYR A 1 107 ? 68.578  193.410 154.151 1.00 19.93 ? 177 TYR A N   1 
ATOM 789  C CA  . TYR A 1 107 ? 68.768  192.268 153.251 1.00 19.33 ? 177 TYR A CA  1 
ATOM 790  C C   . TYR A 1 107 ? 69.435  191.090 153.958 1.00 18.27 ? 177 TYR A C   1 
ATOM 791  O O   . TYR A 1 107 ? 70.011  191.251 155.050 1.00 18.07 ? 177 TYR A O   1 
ATOM 792  C CB  . TYR A 1 107 ? 69.566  192.706 152.026 1.00 18.43 ? 177 TYR A CB  1 
ATOM 793  C CG  . TYR A 1 107 ? 70.892  193.323 152.347 1.00 20.42 ? 177 TYR A CG  1 
ATOM 794  C CD1 . TYR A 1 107 ? 72.022  192.529 152.543 1.00 18.93 ? 177 TYR A CD1 1 
ATOM 795  C CD2 . TYR A 1 107 ? 71.031  194.711 152.468 1.00 20.40 ? 177 TYR A CD2 1 
ATOM 796  C CE1 . TYR A 1 107 ? 73.244  193.086 152.838 1.00 19.68 ? 177 TYR A CE1 1 
ATOM 797  C CE2 . TYR A 1 107 ? 72.243  195.265 152.771 1.00 21.74 ? 177 TYR A CE2 1 
ATOM 798  C CZ  . TYR A 1 107 ? 73.354  194.453 152.956 1.00 22.79 ? 177 TYR A CZ  1 
ATOM 799  O OH  . TYR A 1 107 ? 74.577  195.025 153.258 1.00 25.81 ? 177 TYR A OH  1 
ATOM 800  N N   . ASN A 1 108 ? 69.366  189.910 153.338 1.00 17.07 ? 178 ASN A N   1 
ATOM 801  C CA  . ASN A 1 108 ? 69.908  188.677 153.959 1.00 16.63 ? 178 ASN A CA  1 
ATOM 802  C C   . ASN A 1 108 ? 71.346  188.359 153.596 1.00 16.42 ? 178 ASN A C   1 
ATOM 803  O O   . ASN A 1 108 ? 72.024  187.675 154.363 1.00 16.99 ? 178 ASN A O   1 
ATOM 804  C CB  . ASN A 1 108 ? 69.050  187.465 153.607 1.00 16.23 ? 178 ASN A CB  1 
ATOM 805  C CG  . ASN A 1 108 ? 67.620  187.608 154.070 1.00 16.17 ? 178 ASN A CG  1 
ATOM 806  O OD1 . ASN A 1 108 ? 66.841  188.391 153.524 1.00 17.17 ? 178 ASN A OD1 1 
ATOM 807  N ND2 . ASN A 1 108 ? 67.267  186.853 155.080 1.00 15.00 ? 178 ASN A ND2 1 
ATOM 808  N N   . LYS A 1 109 ? 71.820  188.848 152.443 1.00 15.85 ? 179 LYS A N   1 
ATOM 809  C CA  . LYS A 1 109 ? 73.169  188.538 151.973 1.00 16.00 ? 179 LYS A CA  1 
ATOM 810  C C   . LYS A 1 109 ? 73.529  189.499 150.860 1.00 16.49 ? 179 LYS A C   1 
ATOM 811  O O   . LYS A 1 109 ? 72.664  189.877 150.083 1.00 16.30 ? 179 LYS A O   1 
ATOM 812  C CB  . LYS A 1 109 ? 73.258  187.086 151.443 1.00 16.30 ? 179 LYS A CB  1 
ATOM 813  C CG  . LYS A 1 109 ? 74.673  186.619 151.038 1.00 16.21 ? 179 LYS A CG  1 
ATOM 814  C CD  . LYS A 1 109 ? 75.570  186.521 152.281 1.00 16.59 ? 179 LYS A CD  1 
ATOM 815  C CE  . LYS A 1 109 ? 76.930  185.890 152.004 1.00 17.57 ? 179 LYS A CE  1 
ATOM 816  N NZ  . LYS A 1 109 ? 77.707  185.607 153.250 1.00 17.70 ? 179 LYS A NZ  1 
ATOM 817  N N   . LYS A 1 110 ? 74.810  189.852 150.782 1.00 17.36 ? 180 LYS A N   1 
ATOM 818  C CA  . LYS A 1 110 ? 75.351  190.677 149.708 1.00 18.17 ? 180 LYS A CA  1 
ATOM 819  C C   . LYS A 1 110 ? 76.552  189.954 149.106 1.00 18.03 ? 180 LYS A C   1 
ATOM 820  O O   . LYS A 1 110 ? 77.380  189.390 149.812 1.00 17.00 ? 180 LYS A O   1 
ATOM 821  C CB  . LYS A 1 110 ? 75.762  192.065 150.252 1.00 19.49 ? 180 LYS A CB  1 
ATOM 822  C CG  . LYS A 1 110 ? 76.580  192.943 149.296 1.00 21.12 ? 180 LYS A CG  1 
ATOM 823  C CD  . LYS A 1 110 ? 76.940  194.269 149.980 1.00 24.17 ? 180 LYS A CD  1 
ATOM 824  C CE  . LYS A 1 110 ? 78.165  194.938 149.325 1.00 26.56 ? 180 LYS A CE  1 
ATOM 825  N NZ  . LYS A 1 110 ? 78.781  195.967 150.230 1.00 29.10 ? 180 LYS A NZ  1 
ATOM 826  N N   . GLY A 1 111 ? 76.643  189.960 147.786 1.00 18.09 ? 181 GLY A N   1 
ATOM 827  C CA  . GLY A 1 111 ? 77.822  189.464 147.103 1.00 18.07 ? 181 GLY A CA  1 
ATOM 828  C C   . GLY A 1 111 ? 78.257  190.435 146.033 1.00 18.76 ? 181 GLY A C   1 
ATOM 829  O O   . GLY A 1 111 ? 77.540  191.365 145.720 1.00 18.20 ? 181 GLY A O   1 
ATOM 830  N N   . THR A 1 112 ? 79.427  190.201 145.469 1.00 18.88 ? 182 THR A N   1 
ATOM 831  C CA  . THR A 1 112 ? 79.965  191.068 144.437 1.00 19.76 ? 182 THR A CA  1 
ATOM 832  C C   . THR A 1 112 ? 80.510  190.289 143.264 1.00 18.26 ? 182 THR A C   1 
ATOM 833  O O   . THR A 1 112 ? 81.083  189.227 143.431 1.00 18.24 ? 182 THR A O   1 
ATOM 834  C CB  . THR A 1 112 ? 81.077  191.924 145.028 1.00 20.30 ? 182 THR A CB  1 
ATOM 835  O OG1 . THR A 1 112 ? 80.584  192.654 146.173 1.00 25.04 ? 182 THR A OG1 1 
ATOM 836  C CG2 . THR A 1 112 ? 81.466  193.010 144.058 1.00 21.79 ? 182 THR A CG2 1 
ATOM 837  N N   . VAL A 1 113 ? 80.351  190.830 142.055 1.00 17.68 ? 183 VAL A N   1 
ATOM 838  C CA  . VAL A 1 113 ? 81.074  190.316 140.905 1.00 17.64 ? 183 VAL A CA  1 
ATOM 839  C C   . VAL A 1 113 ? 81.498  191.525 140.068 1.00 17.31 ? 183 VAL A C   1 
ATOM 840  O O   . VAL A 1 113 ? 80.708  192.443 139.823 1.00 17.12 ? 183 VAL A O   1 
ATOM 841  C CB  . VAL A 1 113 ? 80.260  189.296 140.091 1.00 18.22 ? 183 VAL A CB  1 
ATOM 842  C CG1 . VAL A 1 113 ? 78.922  189.868 139.680 1.00 19.08 ? 183 VAL A CG1 1 
ATOM 843  C CG2 . VAL A 1 113 ? 81.037  188.808 138.881 1.00 19.27 ? 183 VAL A CG2 1 
ATOM 844  N N   . THR A 1 114 ? 82.776  191.546 139.745 1.00 17.48 ? 184 THR A N   1 
ATOM 845  C CA  . THR A 1 114 ? 83.371  192.607 138.952 1.00 16.78 ? 184 THR A CA  1 
ATOM 846  C C   . THR A 1 114 ? 83.298  192.215 137.487 1.00 16.14 ? 184 THR A C   1 
ATOM 847  O O   . THR A 1 114 ? 83.831  191.192 137.081 1.00 16.98 ? 184 THR A O   1 
ATOM 848  C CB  . THR A 1 114 ? 84.834  192.794 139.389 1.00 16.33 ? 184 THR A CB  1 
ATOM 849  O OG1 . THR A 1 114 ? 84.845  193.366 140.690 1.00 19.08 ? 184 THR A OG1 1 
ATOM 850  C CG2 . THR A 1 114 ? 85.546  193.845 138.486 1.00 16.73 ? 184 THR A CG2 1 
ATOM 851  N N   . VAL A 1 115 ? 82.618  193.045 136.702 1.00 15.82 ? 185 VAL A N   1 
ATOM 852  C CA  . VAL A 1 115 ? 82.524  192.900 135.261 1.00 15.83 ? 185 VAL A CA  1 
ATOM 853  C C   . VAL A 1 115 ? 83.247  194.087 134.582 1.00 16.10 ? 185 VAL A C   1 
ATOM 854  O O   . VAL A 1 115 ? 83.742  194.992 135.244 1.00 17.22 ? 185 VAL A O   1 
ATOM 855  C CB  . VAL A 1 115 ? 81.044  192.792 134.826 1.00 14.96 ? 185 VAL A CB  1 
ATOM 856  C CG1 . VAL A 1 115 ? 80.320  191.670 135.635 1.00 15.83 ? 185 VAL A CG1 1 
ATOM 857  C CG2 . VAL A 1 115 ? 80.319  194.086 135.017 1.00 15.04 ? 185 VAL A CG2 1 
ATOM 858  N N   . TYR A 1 116 ? 83.366  193.998 133.275 1.00 17.46 ? 186 TYR A N   1 
ATOM 859  C CA  . TYR A 1 116 ? 84.103  194.972 132.464 1.00 17.92 ? 186 TYR A CA  1 
ATOM 860  C C   . TYR A 1 116 ? 83.214  195.478 131.340 1.00 19.08 ? 186 TYR A C   1 
ATOM 861  O O   . TYR A 1 116 ? 82.382  194.738 130.865 1.00 18.84 ? 186 TYR A O   1 
ATOM 862  C CB  . TYR A 1 116 ? 85.371  194.297 131.926 1.00 17.06 ? 186 TYR A CB  1 
ATOM 863  C CG  . TYR A 1 116 ? 86.260  193.882 133.075 1.00 19.24 ? 186 TYR A CG  1 
ATOM 864  C CD1 . TYR A 1 116 ? 87.122  194.790 133.656 1.00 21.69 ? 186 TYR A CD1 1 
ATOM 865  C CD2 . TYR A 1 116 ? 86.181  192.597 133.631 1.00 20.01 ? 186 TYR A CD2 1 
ATOM 866  C CE1 . TYR A 1 116 ? 87.898  194.453 134.739 1.00 22.52 ? 186 TYR A CE1 1 
ATOM 867  C CE2 . TYR A 1 116 ? 86.975  192.243 134.731 1.00 21.31 ? 186 TYR A CE2 1 
ATOM 868  C CZ  . TYR A 1 116 ? 87.822  193.188 135.278 1.00 23.41 ? 186 TYR A CZ  1 
ATOM 869  O OH  . TYR A 1 116 ? 88.620  192.889 136.360 1.00 25.13 ? 186 TYR A OH  1 
ATOM 870  N N   . ASP A 1 117 ? 83.390  196.746 130.942 1.00 19.98 ? 187 ASP A N   1 
ATOM 871  C CA  . ASP A 1 117 ? 82.789  197.278 129.715 1.00 20.94 ? 187 ASP A CA  1 
ATOM 872  C C   . ASP A 1 117 ? 83.803  197.210 128.533 1.00 22.34 ? 187 ASP A C   1 
ATOM 873  O O   . ASP A 1 117 ? 84.928  196.719 128.702 1.00 21.34 ? 187 ASP A O   1 
ATOM 874  C CB  . ASP A 1 117 ? 82.229  198.691 129.950 1.00 20.20 ? 187 ASP A CB  1 
ATOM 875  C CG  . ASP A 1 117 ? 83.260  199.688 130.422 1.00 20.76 ? 187 ASP A CG  1 
ATOM 876  O OD1 . ASP A 1 117 ? 84.441  199.584 130.040 1.00 22.33 ? 187 ASP A OD1 1 
ATOM 877  O OD2 . ASP A 1 117 ? 82.975  200.640 131.188 1.00 21.56 ? 187 ASP A OD2 1 
ATOM 878  N N   . SER A 1 118 ? 83.417  197.687 127.340 1.00 24.14 ? 188 SER A N   1 
ATOM 879  C CA  . SER A 1 118 ? 84.299  197.585 126.158 1.00 25.89 ? 188 SER A CA  1 
ATOM 880  C C   . SER A 1 118 ? 85.565  198.426 126.274 1.00 25.91 ? 188 SER A C   1 
ATOM 881  O O   . SER A 1 118 ? 86.554  198.161 125.630 1.00 27.15 ? 188 SER A O   1 
ATOM 882  C CB  . SER A 1 118 ? 83.557  197.971 124.879 1.00 26.17 ? 188 SER A CB  1 
ATOM 883  O OG  . SER A 1 118 ? 82.313  197.289 124.813 1.00 32.62 ? 188 SER A OG  1 
ATOM 884  N N   . GLN A 1 119 ? 85.549  199.440 127.112 1.00 26.91 ? 189 GLN A N   1 
ATOM 885  C CA  . GLN A 1 119 ? 86.756  200.212 127.344 1.00 27.21 ? 189 GLN A CA  1 
ATOM 886  C C   . GLN A 1 119 ? 87.668  199.552 128.371 1.00 26.48 ? 189 GLN A C   1 
ATOM 887  O O   . GLN A 1 119 ? 88.824  199.950 128.540 1.00 25.47 ? 189 GLN A O   1 
ATOM 888  C CB  . GLN A 1 119 ? 86.374  201.581 127.837 1.00 28.04 ? 189 GLN A CB  1 
ATOM 889  C CG  . GLN A 1 119 ? 86.286  202.613 126.770 1.00 32.17 ? 189 GLN A CG  1 
ATOM 890  C CD  . GLN A 1 119 ? 87.107  203.808 127.167 1.00 37.19 ? 189 GLN A CD  1 
ATOM 891  O OE1 . GLN A 1 119 ? 86.952  204.325 128.283 1.00 40.97 ? 189 GLN A OE1 1 
ATOM 892  N NE2 . GLN A 1 119 ? 87.997  204.240 126.284 1.00 40.72 ? 189 GLN A NE2 1 
ATOM 893  N N   . GLY A 1 120 ? 87.134  198.547 129.063 1.00 25.52 ? 190 GLY A N   1 
ATOM 894  C CA  . GLY A 1 120 ? 87.861  197.827 130.090 1.00 24.76 ? 190 GLY A CA  1 
ATOM 895  C C   . GLY A 1 120 ? 87.765  198.364 131.503 1.00 24.04 ? 190 GLY A C   1 
ATOM 896  O O   . GLY A 1 120 ? 88.524  197.915 132.382 1.00 23.23 ? 190 GLY A O   1 
ATOM 897  N N   . ASN A 1 121 ? 86.873  199.321 131.747 1.00 23.19 ? 191 ASN A N   1 
ATOM 898  C CA  . ASN A 1 121 ? 86.634  199.807 133.087 1.00 22.64 ? 191 ASN A CA  1 
ATOM 899  C C   . ASN A 1 121 ? 86.005  198.667 133.884 1.00 22.40 ? 191 ASN A C   1 
ATOM 900  O O   . ASN A 1 121 ? 85.193  197.914 133.342 1.00 21.55 ? 191 ASN A O   1 
ATOM 901  C CB  . ASN A 1 121 ? 85.657  200.993 133.124 1.00 22.96 ? 191 ASN A CB  1 
ATOM 902  C CG  . ASN A 1 121 ? 86.125  202.190 132.273 1.00 24.78 ? 191 ASN A CG  1 
ATOM 903  O OD1 . ASN A 1 121 ? 87.179  202.754 132.524 1.00 25.64 ? 191 ASN A OD1 1 
ATOM 904  N ND2 . ASN A 1 121 ? 85.320  202.586 131.309 1.00 23.86 ? 191 ASN A ND2 1 
ATOM 905  N N   . ALA A 1 122 ? 86.385  198.561 135.154 1.00 21.61 ? 192 ALA A N   1 
ATOM 906  C CA  . ALA A 1 122 ? 85.756  197.609 136.062 1.00 21.33 ? 192 ALA A CA  1 
ATOM 907  C C   . ALA A 1 122 ? 84.507  198.206 136.675 1.00 20.64 ? 192 ALA A C   1 
ATOM 908  O O   . ALA A 1 122 ? 84.501  199.340 137.152 1.00 21.14 ? 192 ALA A O   1 
ATOM 909  C CB  . ALA A 1 122 ? 86.745  197.172 137.151 1.00 21.46 ? 192 ALA A CB  1 
ATOM 910  N N   . HIS A 1 123 ? 83.425  197.431 136.665 1.00 20.39 ? 193 HIS A N   1 
ATOM 911  C CA  . HIS A 1 123 ? 82.238  197.765 137.396 1.00 19.96 ? 193 HIS A CA  1 
ATOM 912  C C   . HIS A 1 123 ? 82.045  196.709 138.502 1.00 19.49 ? 193 HIS A C   1 
ATOM 913  O O   . HIS A 1 123 ? 81.796  195.558 138.203 1.00 19.64 ? 193 HIS A O   1 
ATOM 914  C CB  . HIS A 1 123 ? 81.006  197.769 136.485 1.00 19.10 ? 193 HIS A CB  1 
ATOM 915  C CG  . HIS A 1 123 ? 81.120  198.673 135.289 1.00 21.83 ? 193 HIS A CG  1 
ATOM 916  N ND1 . HIS A 1 123 ? 80.170  199.621 134.973 1.00 21.73 ? 193 HIS A ND1 1 
ATOM 917  C CD2 . HIS A 1 123 ? 82.063  198.751 134.318 1.00 22.54 ? 193 HIS A CD2 1 
ATOM 918  C CE1 . HIS A 1 123 ? 80.522  200.239 133.856 1.00 23.98 ? 193 HIS A CE1 1 
ATOM 919  N NE2 . HIS A 1 123 ? 81.671  199.739 133.443 1.00 21.35 ? 193 HIS A NE2 1 
ATOM 920  N N   . ASP A 1 124 ? 82.092  197.136 139.754 1.00 18.78 ? 194 ASP A N   1 
ATOM 921  C CA  . ASP A 1 124 ? 81.811  196.249 140.872 1.00 19.29 ? 194 ASP A CA  1 
ATOM 922  C C   . ASP A 1 124 ? 80.304  196.141 141.099 1.00 17.81 ? 194 ASP A C   1 
ATOM 923  O O   . ASP A 1 124 ? 79.677  196.998 141.764 1.00 18.13 ? 194 ASP A O   1 
ATOM 924  C CB  . ASP A 1 124 ? 82.476  196.775 142.136 1.00 20.17 ? 194 ASP A CB  1 
ATOM 925  C CG  . ASP A 1 124 ? 83.990  196.832 142.031 1.00 23.46 ? 194 ASP A CG  1 
ATOM 926  O OD1 . ASP A 1 124 ? 84.625  196.094 141.249 1.00 24.53 ? 194 ASP A OD1 1 
ATOM 927  O OD2 . ASP A 1 124 ? 84.629  197.621 142.751 1.00 29.17 ? 194 ASP A OD2 1 
ATOM 928  N N   . MET A 1 125 ? 79.742  195.054 140.591 1.00 17.84 ? 195 MET A N   1 
ATOM 929  C CA  . MET A 1 125 ? 78.309  194.787 140.659 1.00 17.60 ? 195 MET A CA  1 
ATOM 930  C C   . MET A 1 125 ? 77.983  194.108 141.990 1.00 16.82 ? 195 MET A C   1 
ATOM 931  O O   . MET A 1 125 ? 78.439  192.985 142.260 1.00 16.99 ? 195 MET A O   1 
ATOM 932  C CB  . MET A 1 125 ? 77.890  193.891 139.489 1.00 17.52 ? 195 MET A CB  1 
ATOM 933  C CG  . MET A 1 125 ? 78.088  194.502 138.102 1.00 18.69 ? 195 MET A CG  1 
ATOM 934  S SD  . MET A 1 125 ? 77.231  196.054 137.863 1.00 18.17 ? 195 MET A SD  1 
ATOM 935  C CE  . MET A 1 125 ? 75.628  195.630 138.222 1.00 16.37 ? 195 MET A CE  1 
ATOM 936  N N   . ASN A 1 126 ? 77.241  194.817 142.815 1.00 16.17 ? 196 ASN A N   1 
ATOM 937  C CA  . ASN A 1 126 ? 76.720  194.293 144.069 1.00 16.32 ? 196 ASN A CA  1 
ATOM 938  C C   . ASN A 1 126 ? 75.347  193.637 143.868 1.00 16.06 ? 196 ASN A C   1 
ATOM 939  O O   . ASN A 1 126 ? 74.478  194.166 143.183 1.00 15.66 ? 196 ASN A O   1 
ATOM 940  C CB  . ASN A 1 126 ? 76.656  195.362 145.144 1.00 16.33 ? 196 ASN A CB  1 
ATOM 941  C CG  . ASN A 1 126 ? 78.043  195.843 145.591 1.00 18.15 ? 196 ASN A CG  1 
ATOM 942  O OD1 . ASN A 1 126 ? 78.187  196.977 146.038 1.00 23.85 ? 196 ASN A OD1 1 
ATOM 943  N ND2 . ASN A 1 126 ? 79.045  194.997 145.476 1.00 19.06 ? 196 ASN A ND2 1 
ATOM 944  N N   . VAL A 1 127 ? 75.197  192.472 144.490 1.00 15.14 ? 197 VAL A N   1 
ATOM 945  C CA  . VAL A 1 127 ? 74.041  191.607 144.346 1.00 15.32 ? 197 VAL A CA  1 
ATOM 946  C C   . VAL A 1 127 ? 73.500  191.358 145.738 1.00 15.09 ? 197 VAL A C   1 
ATOM 947  O O   . VAL A 1 127 ? 74.253  190.895 146.604 1.00 16.65 ? 197 VAL A O   1 
ATOM 948  C CB  . VAL A 1 127 ? 74.428  190.248 143.709 1.00 14.33 ? 197 VAL A CB  1 
ATOM 949  C CG1 . VAL A 1 127 ? 73.179  189.453 143.396 1.00 15.87 ? 197 VAL A CG1 1 
ATOM 950  C CG2 . VAL A 1 127 ? 75.270  190.417 142.458 1.00 14.89 ? 197 VAL A CG2 1 
ATOM 951  N N   . TYR A 1 128 ? 72.244  191.693 145.975 1.00 14.57 ? 198 TYR A N   1 
ATOM 952  C CA  . TYR A 1 128 ? 71.625  191.584 147.281 1.00 15.11 ? 198 TYR A CA  1 
ATOM 953  C C   . TYR A 1 128 ? 70.453  190.622 147.239 1.00 15.64 ? 198 TYR A C   1 
ATOM 954  O O   . TYR A 1 128 ? 69.621  190.694 146.328 1.00 15.52 ? 198 TYR A O   1 
ATOM 955  C CB  . TYR A 1 128 ? 71.100  192.927 147.752 1.00 15.91 ? 198 TYR A CB  1 
ATOM 956  C CG  . TYR A 1 128 ? 72.161  193.974 147.873 1.00 16.37 ? 198 TYR A CG  1 
ATOM 957  C CD1 . TYR A 1 128 ? 72.551  194.715 146.760 1.00 18.56 ? 198 TYR A CD1 1 
ATOM 958  C CD2 . TYR A 1 128 ? 72.776  194.248 149.093 1.00 19.69 ? 198 TYR A CD2 1 
ATOM 959  C CE1 . TYR A 1 128 ? 73.530  195.697 146.853 1.00 18.80 ? 198 TYR A CE1 1 
ATOM 960  C CE2 . TYR A 1 128 ? 73.758  195.250 149.184 1.00 20.60 ? 198 TYR A CE2 1 
ATOM 961  C CZ  . TYR A 1 128 ? 74.120  195.964 148.056 1.00 21.51 ? 198 TYR A CZ  1 
ATOM 962  O OH  . TYR A 1 128 ? 75.096  196.945 148.104 1.00 22.56 ? 198 TYR A OH  1 
ATOM 963  N N   . PHE A 1 129 ? 70.405  189.742 148.237 1.00 14.85 ? 199 PHE A N   1 
ATOM 964  C CA  . PHE A 1 129 ? 69.385  188.718 148.372 1.00 14.92 ? 199 PHE A CA  1 
ATOM 965  C C   . PHE A 1 129 ? 68.489  189.071 149.546 1.00 16.28 ? 199 PHE A C   1 
ATOM 966  O O   . PHE A 1 129 ? 68.983  189.247 150.657 1.00 16.51 ? 199 PHE A O   1 
ATOM 967  C CB  . PHE A 1 129 ? 70.035  187.353 148.592 1.00 14.23 ? 199 PHE A CB  1 
ATOM 968  C CG  . PHE A 1 129 ? 70.925  186.916 147.450 1.00 14.69 ? 199 PHE A CG  1 
ATOM 969  C CD1 . PHE A 1 129 ? 72.222  187.383 147.355 1.00 10.59 ? 199 PHE A CD1 1 
ATOM 970  C CD2 . PHE A 1 129 ? 70.459  186.074 146.451 1.00 12.10 ? 199 PHE A CD2 1 
ATOM 971  C CE1 . PHE A 1 129 ? 73.025  187.009 146.328 1.00 13.05 ? 199 PHE A CE1 1 
ATOM 972  C CE2 . PHE A 1 129 ? 71.271  185.695 145.426 1.00 10.42 ? 199 PHE A CE2 1 
ATOM 973  C CZ  . PHE A 1 129 ? 72.543  186.154 145.346 1.00 10.66 ? 199 PHE A CZ  1 
ATOM 974  N N   . VAL A 1 130 ? 67.178  189.167 149.297 1.00 16.74 ? 200 VAL A N   1 
ATOM 975  C CA  . VAL A 1 130 ? 66.206  189.492 150.331 1.00 18.19 ? 200 VAL A CA  1 
ATOM 976  C C   . VAL A 1 130 ? 65.116  188.432 150.321 1.00 18.82 ? 200 VAL A C   1 
ATOM 977  O O   . VAL A 1 130 ? 64.341  188.333 149.361 1.00 18.98 ? 200 VAL A O   1 
ATOM 978  C CB  . VAL A 1 130 ? 65.577  190.882 150.102 1.00 18.83 ? 200 VAL A CB  1 
ATOM 979  C CG1 . VAL A 1 130 ? 64.595  191.204 151.231 1.00 21.43 ? 200 VAL A CG1 1 
ATOM 980  C CG2 . VAL A 1 130 ? 66.654  191.952 150.006 1.00 19.10 ? 200 VAL A CG2 1 
ATOM 981  N N   . LYS A 1 131 ? 65.049  187.644 151.379 1.00 17.87 ? 201 LYS A N   1 
ATOM 982  C CA  . LYS A 1 131 ? 64.020  186.639 151.503 1.00 18.15 ? 201 LYS A CA  1 
ATOM 983  C C   . LYS A 1 131 ? 62.678  187.342 151.585 1.00 19.62 ? 201 LYS A C   1 
ATOM 984  O O   . LYS A 1 131 ? 62.518  188.253 152.389 1.00 19.56 ? 201 LYS A O   1 
ATOM 985  C CB  . LYS A 1 131 ? 64.237  185.802 152.742 1.00 18.07 ? 201 LYS A CB  1 
ATOM 986  C CG  . LYS A 1 131 ? 63.244  184.656 152.859 1.00 18.07 ? 201 LYS A CG  1 
ATOM 987  C CD  . LYS A 1 131 ? 63.587  183.801 154.044 1.00 17.92 ? 201 LYS A CD  1 
ATOM 988  C CE  . LYS A 1 131 ? 62.504  182.768 154.342 1.00 19.13 ? 201 LYS A CE  1 
ATOM 989  N NZ  . LYS A 1 131 ? 63.068  181.640 155.158 1.00 18.83 ? 201 LYS A NZ  1 
ATOM 990  N N   . THR A 1 132 ? 61.749  186.973 150.714 1.00 21.11 ? 202 THR A N   1 
ATOM 991  C CA  . THR A 1 132 ? 60.424  187.640 150.671 1.00 23.64 ? 202 THR A CA  1 
ATOM 992  C C   . THR A 1 132 ? 59.355  186.827 151.414 1.00 24.93 ? 202 THR A C   1 
ATOM 993  O O   . THR A 1 132 ? 58.438  187.392 152.035 1.00 25.40 ? 202 THR A O   1 
ATOM 994  C CB  . THR A 1 132 ? 59.983  187.918 149.214 1.00 23.38 ? 202 THR A CB  1 
ATOM 995  O OG1 . THR A 1 132 ? 60.025  186.711 148.427 1.00 27.37 ? 202 THR A OG1 1 
ATOM 996  C CG2 . THR A 1 132 ? 60.948  188.845 148.527 1.00 24.83 ? 202 THR A CG2 1 
ATOM 997  N N   . LYS A 1 133 ? 59.501  185.512 151.337 1.00 26.04 ? 203 LYS A N   1 
ATOM 998  C CA  . LYS A 1 133 ? 58.625  184.529 151.971 1.00 27.43 ? 203 LYS A CA  1 
ATOM 999  C C   . LYS A 1 133 ? 59.292  183.151 151.843 1.00 26.92 ? 203 LYS A C   1 
ATOM 1000 O O   . LYS A 1 133 ? 60.406  183.042 151.318 1.00 25.21 ? 203 LYS A O   1 
ATOM 1001 C CB  . LYS A 1 133 ? 57.244  184.524 151.303 1.00 28.70 ? 203 LYS A CB  1 
ATOM 1002 C CG  . LYS A 1 133 ? 57.258  184.314 149.776 1.00 31.39 ? 203 LYS A CG  1 
ATOM 1003 C CD  . LYS A 1 133 ? 55.825  184.208 149.207 1.00 34.79 ? 203 LYS A CD  1 
ATOM 1004 C CE  . LYS A 1 133 ? 55.469  185.400 148.308 1.00 36.91 ? 203 LYS A CE  1 
ATOM 1005 N NZ  . LYS A 1 133 ? 54.407  185.059 147.286 1.00 38.79 ? 203 LYS A NZ  1 
ATOM 1006 N N   . ASP A 1 134 ? 58.629  182.095 152.309 1.00 27.02 ? 204 ASP A N   1 
ATOM 1007 C CA  . ASP A 1 134 ? 59.177  180.753 152.202 1.00 27.50 ? 204 ASP A CA  1 
ATOM 1008 C C   . ASP A 1 134 ? 59.647  180.476 150.765 1.00 27.02 ? 204 ASP A C   1 
ATOM 1009 O O   . ASP A 1 134 ? 58.914  180.717 149.810 1.00 27.52 ? 204 ASP A O   1 
ATOM 1010 C CB  . ASP A 1 134 ? 58.138  179.702 152.593 1.00 29.08 ? 204 ASP A CB  1 
ATOM 1011 C CG  . ASP A 1 134 ? 57.766  179.735 154.076 1.00 31.82 ? 204 ASP A CG  1 
ATOM 1012 O OD1 . ASP A 1 134 ? 58.306  180.569 154.858 1.00 33.77 ? 204 ASP A OD1 1 
ATOM 1013 O OD2 . ASP A 1 134 ? 56.915  178.930 154.540 1.00 37.31 ? 204 ASP A OD2 1 
ATOM 1014 N N   . ASN A 1 135 ? 60.890  180.035 150.627 1.00 25.77 ? 205 ASN A N   1 
ATOM 1015 C CA  . ASN A 1 135 ? 61.442  179.552 149.358 1.00 25.69 ? 205 ASN A CA  1 
ATOM 1016 C C   . ASN A 1 135 ? 61.565  180.590 148.226 1.00 23.75 ? 205 ASN A C   1 
ATOM 1017 O O   . ASN A 1 135 ? 61.806  180.216 147.102 1.00 23.93 ? 205 ASN A O   1 
ATOM 1018 C CB  . ASN A 1 135 ? 60.622  178.350 148.852 1.00 25.82 ? 205 ASN A CB  1 
ATOM 1019 C CG  . ASN A 1 135 ? 60.627  177.159 149.822 1.00 28.72 ? 205 ASN A CG  1 
ATOM 1020 O OD1 . ASN A 1 135 ? 61.582  176.936 150.577 1.00 27.19 ? 205 ASN A OD1 1 
ATOM 1021 N ND2 . ASN A 1 135 ? 59.549  176.361 149.770 1.00 31.13 ? 205 ASN A ND2 1 
ATOM 1022 N N   . GLU A 1 136 ? 61.411  181.872 148.517 1.00 22.95 ? 206 GLU A N   1 
ATOM 1023 C CA  . GLU A 1 136 ? 61.558  182.909 147.490 1.00 22.15 ? 206 GLU A CA  1 
ATOM 1024 C C   . GLU A 1 136 ? 62.450  184.031 147.981 1.00 21.12 ? 206 GLU A C   1 
ATOM 1025 O O   . GLU A 1 136 ? 62.327  184.481 149.138 1.00 20.23 ? 206 GLU A O   1 
ATOM 1026 C CB  . GLU A 1 136 ? 60.210  183.484 147.082 1.00 22.33 ? 206 GLU A CB  1 
ATOM 1027 C CG  . GLU A 1 136 ? 59.332  182.472 146.348 1.00 27.46 ? 206 GLU A CG  1 
ATOM 1028 C CD  . GLU A 1 136 ? 58.112  183.094 145.675 1.00 30.40 ? 206 GLU A CD  1 
ATOM 1029 O OE1 . GLU A 1 136 ? 58.120  184.316 145.380 1.00 33.18 ? 206 GLU A OE1 1 
ATOM 1030 O OE2 . GLU A 1 136 ? 57.144  182.333 145.449 1.00 36.14 ? 206 GLU A OE2 1 
ATOM 1031 N N   . TRP A 1 137 ? 63.337  184.472 147.096 1.00 19.05 ? 207 TRP A N   1 
ATOM 1032 C CA  . TRP A 1 137 ? 64.362  185.441 147.437 1.00 17.64 ? 207 TRP A CA  1 
ATOM 1033 C C   . TRP A 1 137 ? 64.444  186.445 146.313 1.00 17.31 ? 207 TRP A C   1 
ATOM 1034 O O   . TRP A 1 137 ? 64.789  186.088 145.184 1.00 17.78 ? 207 TRP A O   1 
ATOM 1035 C CB  . TRP A 1 137 ? 65.731  184.757 147.596 1.00 17.44 ? 207 TRP A CB  1 
ATOM 1036 C CG  . TRP A 1 137 ? 65.788  183.697 148.666 1.00 17.12 ? 207 TRP A CG  1 
ATOM 1037 C CD1 . TRP A 1 137 ? 65.267  182.433 148.609 1.00 16.29 ? 207 TRP A CD1 1 
ATOM 1038 C CD2 . TRP A 1 137 ? 66.435  183.802 149.943 1.00 16.08 ? 207 TRP A CD2 1 
ATOM 1039 N NE1 . TRP A 1 137 ? 65.530  181.758 149.776 1.00 15.92 ? 207 TRP A NE1 1 
ATOM 1040 C CE2 . TRP A 1 137 ? 66.249  182.575 150.610 1.00 17.90 ? 207 TRP A CE2 1 
ATOM 1041 C CE3 . TRP A 1 137 ? 67.188  184.800 150.573 1.00 16.25 ? 207 TRP A CE3 1 
ATOM 1042 C CZ2 . TRP A 1 137 ? 66.777  182.326 151.874 1.00 18.96 ? 207 TRP A CZ2 1 
ATOM 1043 C CZ3 . TRP A 1 137 ? 67.686  184.561 151.826 1.00 18.76 ? 207 TRP A CZ3 1 
ATOM 1044 C CH2 . TRP A 1 137 ? 67.490  183.329 152.461 1.00 18.16 ? 207 TRP A CH2 1 
ATOM 1045 N N   . ALA A 1 138 ? 64.154  187.700 146.629 1.00 16.95 ? 208 ALA A N   1 
ATOM 1046 C CA  . ALA A 1 138 ? 64.328  188.780 145.681 1.00 16.27 ? 208 ALA A CA  1 
ATOM 1047 C C   . ALA A 1 138 ? 65.783  189.146 145.582 1.00 15.80 ? 208 ALA A C   1 
ATOM 1048 O O   . ALA A 1 138 ? 66.523  189.101 146.577 1.00 15.64 ? 208 ALA A O   1 
ATOM 1049 C CB  . ALA A 1 138 ? 63.537  189.962 146.064 1.00 16.58 ? 208 ALA A CB  1 
ATOM 1050 N N   . VAL A 1 139 ? 66.186  189.496 144.358 1.00 16.66 ? 209 VAL A N   1 
ATOM 1051 C CA  . VAL A 1 139 ? 67.573  189.808 144.044 1.00 16.51 ? 209 VAL A CA  1 
ATOM 1052 C C   . VAL A 1 139 ? 67.673  191.183 143.446 1.00 16.33 ? 209 VAL A C   1 
ATOM 1053 O O   . VAL A 1 139 ? 67.071  191.449 142.401 1.00 17.25 ? 209 VAL A O   1 
ATOM 1054 C CB  . VAL A 1 139 ? 68.169  188.798 143.013 1.00 16.11 ? 209 VAL A CB  1 
ATOM 1055 C CG1 . VAL A 1 139 ? 69.618  189.119 142.733 1.00 18.10 ? 209 VAL A CG1 1 
ATOM 1056 C CG2 . VAL A 1 139 ? 68.020  187.367 143.517 1.00 17.34 ? 209 VAL A CG2 1 
ATOM 1057 N N   . TYR A 1 140 ? 68.427  192.041 144.103 1.00 16.03 ? 210 TYR A N   1 
ATOM 1058 C CA  . TYR A 1 140 ? 68.684  193.393 143.626 1.00 16.05 ? 210 TYR A CA  1 
ATOM 1059 C C   . TYR A 1 140 ? 70.093  193.461 143.159 1.00 15.83 ? 210 TYR A C   1 
ATOM 1060 O O   . TYR A 1 140 ? 70.953  192.802 143.721 1.00 14.06 ? 210 TYR A O   1 
ATOM 1061 C CB  . TYR A 1 140 ? 68.465  194.390 144.761 1.00 16.59 ? 210 TYR A CB  1 
ATOM 1062 C CG  . TYR A 1 140 ? 67.043  194.429 145.287 1.00 17.33 ? 210 TYR A CG  1 
ATOM 1063 C CD1 . TYR A 1 140 ? 66.607  193.520 146.252 1.00 19.55 ? 210 TYR A CD1 1 
ATOM 1064 C CD2 . TYR A 1 140 ? 66.138  195.359 144.817 1.00 20.55 ? 210 TYR A CD2 1 
ATOM 1065 C CE1 . TYR A 1 140 ? 65.335  193.535 146.717 1.00 21.68 ? 210 TYR A CE1 1 
ATOM 1066 C CE2 . TYR A 1 140 ? 64.836  195.384 145.276 1.00 22.49 ? 210 TYR A CE2 1 
ATOM 1067 C CZ  . TYR A 1 140 ? 64.439  194.480 146.227 1.00 22.60 ? 210 TYR A CZ  1 
ATOM 1068 O OH  . TYR A 1 140 ? 63.148  194.508 146.703 1.00 23.30 ? 210 TYR A OH  1 
ATOM 1069 N N   . THR A 1 141 ? 70.339  194.270 142.127 1.00 16.05 ? 211 THR A N   1 
ATOM 1070 C CA  . THR A 1 141 ? 71.674  194.546 141.624 1.00 16.08 ? 211 THR A CA  1 
ATOM 1071 C C   . THR A 1 141 ? 71.932  196.054 141.525 1.00 17.29 ? 211 THR A C   1 
ATOM 1072 O O   . THR A 1 141 ? 70.999  196.864 141.383 1.00 16.69 ? 211 THR A O   1 
ATOM 1073 C CB  . THR A 1 141 ? 71.910  193.876 140.266 1.00 16.80 ? 211 THR A CB  1 
ATOM 1074 O OG1 . THR A 1 141 ? 70.853  194.202 139.341 1.00 16.48 ? 211 THR A OG1 1 
ATOM 1075 C CG2 . THR A 1 141 ? 71.805  192.367 140.414 1.00 15.99 ? 211 THR A CG2 1 
ATOM 1076 N N   . HIS A 1 142 ? 73.208  196.406 141.585 1.00 17.15 ? 212 HIS A N   1 
ATOM 1077 C CA  . HIS A 1 142 ? 73.621  197.808 141.592 1.00 18.55 ? 212 HIS A CA  1 
ATOM 1078 C C   . HIS A 1 142 ? 75.063  197.909 141.191 1.00 18.97 ? 212 HIS A C   1 
ATOM 1079 O O   . HIS A 1 142 ? 75.903  197.152 141.691 1.00 18.72 ? 212 HIS A O   1 
ATOM 1080 C CB  . HIS A 1 142 ? 73.413  198.436 142.988 1.00 18.76 ? 212 HIS A CB  1 
ATOM 1081 C CG  . HIS A 1 142 ? 73.643  199.912 143.004 1.00 21.36 ? 212 HIS A CG  1 
ATOM 1082 N ND1 . HIS A 1 142 ? 72.887  200.780 142.241 1.00 21.67 ? 212 HIS A ND1 1 
ATOM 1083 C CD2 . HIS A 1 142 ? 74.565  200.671 143.642 1.00 23.24 ? 212 HIS A CD2 1 
ATOM 1084 C CE1 . HIS A 1 142 ? 73.326  202.013 142.426 1.00 23.74 ? 212 HIS A CE1 1 
ATOM 1085 N NE2 . HIS A 1 142 ? 74.338  201.973 143.270 1.00 22.87 ? 212 HIS A NE2 1 
ATOM 1086 N N   . ASP A 1 143 ? 75.360  198.842 140.283 1.00 18.63 ? 213 ASP A N   1 
ATOM 1087 C CA  . ASP A 1 143 ? 76.734  199.122 139.873 1.00 19.75 ? 213 ASP A CA  1 
ATOM 1088 C C   . ASP A 1 143 ? 77.325  200.103 140.877 1.00 21.39 ? 213 ASP A C   1 
ATOM 1089 O O   . ASP A 1 143 ? 77.051  201.302 140.808 1.00 22.41 ? 213 ASP A O   1 
ATOM 1090 C CB  . ASP A 1 143 ? 76.732  199.698 138.445 1.00 19.14 ? 213 ASP A CB  1 
ATOM 1091 C CG  . ASP A 1 143 ? 78.115  199.810 137.845 1.00 19.68 ? 213 ASP A CG  1 
ATOM 1092 O OD1 . ASP A 1 143 ? 79.134  199.690 138.571 1.00 16.88 ? 213 ASP A OD1 1 
ATOM 1093 O OD2 . ASP A 1 143 ? 78.278  200.003 136.618 1.00 18.70 ? 213 ASP A OD2 1 
ATOM 1094 N N   . SER A 1 144 ? 78.153  199.596 141.790 1.00 22.23 ? 214 SER A N   1 
ATOM 1095 C CA  . SER A 1 144 ? 78.718  200.403 142.868 1.00 24.11 ? 214 SER A CA  1 
ATOM 1096 C C   . SER A 1 144 ? 79.809  201.315 142.356 1.00 25.03 ? 214 SER A C   1 
ATOM 1097 O O   . SER A 1 144 ? 80.320  202.138 143.096 1.00 26.19 ? 214 SER A O   1 
ATOM 1098 C CB  . SER A 1 144 ? 79.284  199.496 143.976 1.00 23.33 ? 214 SER A CB  1 
ATOM 1099 O OG  . SER A 1 144 ? 80.456  198.827 143.551 1.00 22.29 ? 214 SER A OG  1 
ATOM 1100 N N   . SER A 1 145 ? 80.193  201.130 141.101 1.00 25.66 ? 215 SER A N   1 
ATOM 1101 C CA  . SER A 1 145 ? 81.290  201.859 140.506 1.00 26.55 ? 215 SER A CA  1 
ATOM 1102 C C   . SER A 1 145 ? 80.786  203.098 139.739 1.00 28.05 ? 215 SER A C   1 
ATOM 1103 O O   . SER A 1 145 ? 81.601  203.837 139.216 1.00 28.24 ? 215 SER A O   1 
ATOM 1104 C CB  . SER A 1 145 ? 82.062  200.944 139.548 1.00 25.94 ? 215 SER A CB  1 
ATOM 1105 O OG  . SER A 1 145 ? 82.794  199.931 140.238 1.00 25.45 ? 215 SER A OG  1 
ATOM 1106 N N   . ASP A 1 146 ? 79.463  203.301 139.665 1.00 29.51 ? 216 ASP A N   1 
ATOM 1107 C CA  . ASP A 1 146 ? 78.843  204.431 138.931 1.00 31.14 ? 216 ASP A CA  1 
ATOM 1108 C C   . ASP A 1 146 ? 78.034  205.358 139.863 1.00 31.74 ? 216 ASP A C   1 
ATOM 1109 O O   . ASP A 1 146 ? 76.905  205.021 140.221 1.00 31.82 ? 216 ASP A O   1 
ATOM 1110 C CB  . ASP A 1 146 ? 77.911  203.903 137.822 1.00 31.07 ? 216 ASP A CB  1 
ATOM 1111 C CG  . ASP A 1 146 ? 77.236  205.035 137.004 1.00 32.78 ? 216 ASP A CG  1 
ATOM 1112 O OD1 . ASP A 1 146 ? 77.618  206.223 137.166 1.00 35.73 ? 216 ASP A OD1 1 
ATOM 1113 O OD2 . ASP A 1 146 ? 76.317  204.828 136.180 1.00 30.69 ? 216 ASP A OD2 1 
ATOM 1114 N N   . PRO A 1 147 ? 78.586  206.519 140.251 1.00 33.38 ? 217 PRO A N   1 
ATOM 1115 C CA  . PRO A 1 147 ? 77.883  207.429 141.189 1.00 34.23 ? 217 PRO A CA  1 
ATOM 1116 C C   . PRO A 1 147 ? 76.533  207.977 140.709 1.00 34.76 ? 217 PRO A C   1 
ATOM 1117 O O   . PRO A 1 147 ? 75.729  208.383 141.536 1.00 35.33 ? 217 PRO A O   1 
ATOM 1118 C CB  . PRO A 1 147 ? 78.876  208.579 141.408 1.00 33.72 ? 217 PRO A CB  1 
ATOM 1119 C CG  . PRO A 1 147 ? 79.854  208.469 140.304 1.00 34.14 ? 217 PRO A CG  1 
ATOM 1120 C CD  . PRO A 1 147 ? 79.908  207.033 139.873 1.00 32.81 ? 217 PRO A CD  1 
ATOM 1121 N N   . ALA A 1 148 ? 76.292  207.992 139.402 1.00 35.76 ? 218 ALA A N   1 
ATOM 1122 C CA  . ALA A 1 148 ? 75.002  208.409 138.853 1.00 35.70 ? 218 ALA A CA  1 
ATOM 1123 C C   . ALA A 1 148 ? 73.934  207.310 138.794 1.00 36.17 ? 218 ALA A C   1 
ATOM 1124 O O   . ALA A 1 148 ? 72.797  207.582 138.432 1.00 36.03 ? 218 ALA A O   1 
ATOM 1125 C CB  . ALA A 1 148 ? 75.206  209.007 137.456 1.00 35.98 ? 218 ALA A CB  1 
ATOM 1126 N N   . ALA A 1 149 ? 74.270  206.075 139.151 1.00 36.16 ? 219 ALA A N   1 
ATOM 1127 C CA  . ALA A 1 149 ? 73.300  204.985 139.063 1.00 36.34 ? 219 ALA A CA  1 
ATOM 1128 C C   . ALA A 1 149 ? 72.190  205.108 140.126 1.00 36.43 ? 219 ALA A C   1 
ATOM 1129 O O   . ALA A 1 149 ? 72.462  205.364 141.300 1.00 35.37 ? 219 ALA A O   1 
ATOM 1130 C CB  . ALA A 1 149 ? 74.024  203.628 139.176 1.00 36.32 ? 219 ALA A CB  1 
ATOM 1131 N N   . THR A 1 150 ? 70.939  204.936 139.702 1.00 37.60 ? 220 THR A N   1 
ATOM 1132 C CA  . THR A 1 150 ? 69.793  205.031 140.619 1.00 38.19 ? 220 THR A CA  1 
ATOM 1133 C C   . THR A 1 150 ? 69.814  203.853 141.589 1.00 38.30 ? 220 THR A C   1 
ATOM 1134 O O   . THR A 1 150 ? 70.194  202.735 141.222 1.00 38.07 ? 220 THR A O   1 
ATOM 1135 C CB  . THR A 1 150 ? 68.454  205.056 139.863 1.00 38.47 ? 220 THR A CB  1 
ATOM 1136 O OG1 . THR A 1 150 ? 68.325  203.885 139.033 1.00 39.86 ? 220 THR A OG1 1 
ATOM 1137 C CG2 . THR A 1 150 ? 68.397  206.230 138.883 1.00 39.12 ? 220 THR A CG2 1 
ATOM 1138 N N   . ALA A 1 151 ? 69.431  204.118 142.835 1.00 38.45 ? 221 ALA A N   1 
ATOM 1139 C CA  . ALA A 1 151 ? 69.405  203.082 143.858 1.00 38.04 ? 221 ALA A CA  1 
ATOM 1140 C C   . ALA A 1 151 ? 68.343  202.043 143.487 1.00 37.86 ? 221 ALA A C   1 
ATOM 1141 O O   . ALA A 1 151 ? 67.245  202.394 143.057 1.00 38.20 ? 221 ALA A O   1 
ATOM 1142 C CB  . ALA A 1 151 ? 69.111  203.686 145.218 1.00 38.73 ? 221 ALA A CB  1 
ATOM 1143 N N   . PRO A 1 152 ? 68.655  200.768 143.652 1.00 36.90 ? 222 PRO A N   1 
ATOM 1144 C CA  . PRO A 1 152 ? 67.729  199.715 143.235 1.00 36.73 ? 222 PRO A CA  1 
ATOM 1145 C C   . PRO A 1 152 ? 66.514  199.653 144.159 1.00 36.44 ? 222 PRO A C   1 
ATOM 1146 O O   . PRO A 1 152 ? 66.645  199.361 145.351 1.00 37.35 ? 222 PRO A O   1 
ATOM 1147 C CB  . PRO A 1 152 ? 68.570  198.435 143.339 1.00 36.61 ? 222 PRO A CB  1 
ATOM 1148 C CG  . PRO A 1 152 ? 69.646  198.751 144.332 1.00 37.00 ? 222 PRO A CG  1 
ATOM 1149 C CD  . PRO A 1 152 ? 69.873  200.233 144.279 1.00 36.97 ? 222 PRO A CD  1 
ATOM 1150 N N   . THR A 1 153 ? 65.339  199.933 143.615 1.00 35.90 ? 223 THR A N   1 
ATOM 1151 C CA  . THR A 1 153 ? 64.109  199.806 144.396 1.00 35.27 ? 223 THR A CA  1 
ATOM 1152 C C   . THR A 1 153 ? 63.241  198.658 143.917 1.00 34.12 ? 223 THR A C   1 
ATOM 1153 O O   . THR A 1 153 ? 62.314  198.273 144.615 1.00 35.05 ? 223 THR A O   1 
ATOM 1154 C CB  . THR A 1 153 ? 63.323  201.110 144.335 1.00 35.25 ? 223 THR A CB  1 
ATOM 1155 O OG1 . THR A 1 153 ? 63.052  201.421 142.963 1.00 35.69 ? 223 THR A OG1 1 
ATOM 1156 C CG2 . THR A 1 153 ? 64.180  202.270 144.844 1.00 35.36 ? 223 THR A CG2 1 
ATOM 1157 N N   . THR A 1 154 ? 63.535  198.121 142.735 1.00 32.81 ? 224 THR A N   1 
ATOM 1158 C CA  . THR A 1 154 ? 62.815  196.992 142.183 1.00 31.67 ? 224 THR A CA  1 
ATOM 1159 C C   . THR A 1 154 ? 63.812  195.858 141.910 1.00 30.07 ? 224 THR A C   1 
ATOM 1160 O O   . THR A 1 154 ? 64.938  196.107 141.466 1.00 30.23 ? 224 THR A O   1 
ATOM 1161 C CB  . THR A 1 154 ? 62.030  197.428 140.912 1.00 32.30 ? 224 THR A CB  1 
ATOM 1162 O OG1 . THR A 1 154 ? 61.592  196.288 140.169 1.00 34.63 ? 224 THR A OG1 1 
ATOM 1163 C CG2 . THR A 1 154 ? 62.910  198.168 139.931 1.00 33.35 ? 224 THR A CG2 1 
ATOM 1164 N N   . ALA A 1 155 ? 63.398  194.625 142.199 1.00 27.80 ? 225 ALA A N   1 
ATOM 1165 C CA  . ALA A 1 155 ? 64.286  193.447 142.063 1.00 26.60 ? 225 ALA A CA  1 
ATOM 1166 C C   . ALA A 1 155 ? 64.558  193.156 140.603 1.00 25.51 ? 225 ALA A C   1 
ATOM 1167 O O   . ALA A 1 155 ? 63.679  193.326 139.761 1.00 24.98 ? 225 ALA A O   1 
ATOM 1168 C CB  . ALA A 1 155 ? 63.661  192.234 142.695 1.00 26.41 ? 225 ALA A CB  1 
ATOM 1169 N N   . SER A 1 156 ? 65.772  192.707 140.325 1.00 23.52 ? 226 SER A N   1 
ATOM 1170 C CA  . SER A 1 156 ? 66.189  192.283 139.008 1.00 22.29 ? 226 SER A CA  1 
ATOM 1171 C C   . SER A 1 156 ? 65.640  190.912 138.707 1.00 21.69 ? 226 SER A C   1 
ATOM 1172 O O   . SER A 1 156 ? 65.318  190.613 137.569 1.00 22.05 ? 226 SER A O   1 
ATOM 1173 C CB  . SER A 1 156 ? 67.727  192.256 138.932 1.00 21.54 ? 226 SER A CB  1 
ATOM 1174 O OG  . SER A 1 156 ? 68.247  193.558 139.136 1.00 20.08 ? 226 SER A OG  1 
ATOM 1175 N N   . THR A 1 157 ? 65.586  190.055 139.712 1.00 20.61 ? 227 THR A N   1 
ATOM 1176 C CA  . THR A 1 157 ? 64.914  188.781 139.583 1.00 20.40 ? 227 THR A CA  1 
ATOM 1177 C C   . THR A 1 157 ? 64.481  188.268 140.936 1.00 20.67 ? 227 THR A C   1 
ATOM 1178 O O   . THR A 1 157 ? 64.777  188.874 141.960 1.00 20.23 ? 227 THR A O   1 
ATOM 1179 C CB  . THR A 1 157 ? 65.821  187.758 138.843 1.00 20.39 ? 227 THR A CB  1 
ATOM 1180 O OG1 . THR A 1 157 ? 65.083  186.568 138.521 1.00 19.95 ? 227 THR A OG1 1 
ATOM 1181 C CG2 . THR A 1 157 ? 66.994  187.275 139.720 1.00 18.95 ? 227 THR A CG2 1 
ATOM 1182 N N   . THR A 1 158 ? 63.709  187.195 140.923 1.00 20.87 ? 228 THR A N   1 
ATOM 1183 C CA  . THR A 1 158 ? 63.325  186.509 142.148 1.00 21.15 ? 228 THR A CA  1 
ATOM 1184 C C   . THR A 1 158 ? 63.664  185.022 141.995 1.00 20.75 ? 228 THR A C   1 
ATOM 1185 O O   . THR A 1 158 ? 63.210  184.335 141.036 1.00 21.65 ? 228 THR A O   1 
ATOM 1186 C CB  . THR A 1 158 ? 61.822  186.764 142.455 1.00 21.94 ? 228 THR A CB  1 
ATOM 1187 O OG1 . THR A 1 158 ? 61.619  188.137 142.790 1.00 22.76 ? 228 THR A OG1 1 
ATOM 1188 C CG2 . THR A 1 158 ? 61.393  186.029 143.716 1.00 21.83 ? 228 THR A CG2 1 
ATOM 1189 N N   . LEU A 1 159 ? 64.483  184.515 142.921 1.00 19.65 ? 229 LEU A N   1 
ATOM 1190 C CA  . LEU A 1 159 ? 64.821  183.107 142.964 1.00 19.05 ? 229 LEU A CA  1 
ATOM 1191 C C   . LEU A 1 159 ? 63.742  182.338 143.718 1.00 19.59 ? 229 LEU A C   1 
ATOM 1192 O O   . LEU A 1 159 ? 63.397  182.694 144.832 1.00 20.05 ? 229 LEU A O   1 
ATOM 1193 C CB  . LEU A 1 159 ? 66.182  182.897 143.632 1.00 18.27 ? 229 LEU A CB  1 
ATOM 1194 C CG  . LEU A 1 159 ? 67.368  183.656 143.001 1.00 16.67 ? 229 LEU A CG  1 
ATOM 1195 C CD1 . LEU A 1 159 ? 68.654  183.256 143.733 1.00 18.32 ? 229 LEU A CD1 1 
ATOM 1196 C CD2 . LEU A 1 159 ? 67.494  183.394 141.564 1.00 15.51 ? 229 LEU A CD2 1 
ATOM 1197 N N   . LYS A 1 160 ? 63.198  181.314 143.078 1.00 20.13 ? 230 LYS A N   1 
ATOM 1198 C CA  . LYS A 1 160 ? 62.207  180.420 143.692 1.00 20.29 ? 230 LYS A CA  1 
ATOM 1199 C C   . LYS A 1 160 ? 62.795  179.029 143.764 1.00 20.15 ? 230 LYS A C   1 
ATOM 1200 O O   . LYS A 1 160 ? 63.279  178.499 142.788 1.00 20.36 ? 230 LYS A O   1 
ATOM 1201 C CB  . LYS A 1 160 ? 60.911  180.406 142.890 1.00 21.43 ? 230 LYS A CB  1 
ATOM 1202 C CG  . LYS A 1 160 ? 60.258  181.787 142.795 1.00 23.99 ? 230 LYS A CG  1 
ATOM 1203 C CD  . LYS A 1 160 ? 58.815  181.736 142.279 1.00 29.51 ? 230 LYS A CD  1 
ATOM 1204 C CE  . LYS A 1 160 ? 58.262  183.138 141.984 1.00 32.14 ? 230 LYS A CE  1 
ATOM 1205 N NZ  . LYS A 1 160 ? 56.974  183.017 141.223 1.00 36.35 ? 230 LYS A NZ  1 
ATOM 1206 N N   . PHE A 1 161 ? 62.779  178.438 144.944 1.00 19.68 ? 231 PHE A N   1 
ATOM 1207 C CA  . PHE A 1 161 ? 63.324  177.115 145.138 1.00 19.98 ? 231 PHE A CA  1 
ATOM 1208 C C   . PHE A 1 161 ? 62.162  176.174 145.435 1.00 19.77 ? 231 PHE A C   1 
ATOM 1209 O O   . PHE A 1 161 ? 61.173  176.579 146.056 1.00 19.41 ? 231 PHE A O   1 
ATOM 1210 C CB  . PHE A 1 161 ? 64.318  177.102 146.305 1.00 19.84 ? 231 PHE A CB  1 
ATOM 1211 C CG  . PHE A 1 161 ? 65.542  177.950 146.058 1.00 20.12 ? 231 PHE A CG  1 
ATOM 1212 C CD1 . PHE A 1 161 ? 65.538  179.304 146.397 1.00 19.04 ? 231 PHE A CD1 1 
ATOM 1213 C CD2 . PHE A 1 161 ? 66.676  177.403 145.481 1.00 18.34 ? 231 PHE A CD2 1 
ATOM 1214 C CE1 . PHE A 1 161 ? 66.647  180.106 146.138 1.00 17.23 ? 231 PHE A CE1 1 
ATOM 1215 C CE2 . PHE A 1 161 ? 67.797  178.201 145.225 1.00 17.05 ? 231 PHE A CE2 1 
ATOM 1216 C CZ  . PHE A 1 161 ? 67.777  179.547 145.561 1.00 15.97 ? 231 PHE A CZ  1 
ATOM 1217 N N   . ASN A 1 162 ? 62.291  174.947 144.969 1.00 20.79 ? 232 ASN A N   1 
ATOM 1218 C CA  . ASN A 1 162 ? 61.317  173.904 145.271 1.00 21.18 ? 232 ASN A CA  1 
ATOM 1219 C C   . ASN A 1 162 ? 61.510  173.294 146.658 1.00 21.40 ? 232 ASN A C   1 
ATOM 1220 O O   . ASN A 1 162 ? 62.387  173.692 147.415 1.00 20.06 ? 232 ASN A O   1 
ATOM 1221 C CB  . ASN A 1 162 ? 61.270  172.852 144.144 1.00 21.75 ? 232 ASN A CB  1 
ATOM 1222 C CG  . ASN A 1 162 ? 62.499  171.959 144.073 1.00 21.71 ? 232 ASN A CG  1 
ATOM 1223 O OD1 . ASN A 1 162 ? 63.289  171.819 145.026 1.00 21.56 ? 232 ASN A OD1 1 
ATOM 1224 N ND2 . ASN A 1 162 ? 62.663  171.328 142.911 1.00 22.49 ? 232 ASN A ND2 1 
ATOM 1225 N N   . GLU A 1 163 ? 60.648  172.342 147.013 1.00 21.84 ? 233 GLU A N   1 
ATOM 1226 C CA  . GLU A 1 163 ? 60.680  171.705 148.336 1.00 22.34 ? 233 GLU A CA  1 
ATOM 1227 C C   . GLU A 1 163 ? 62.018  171.065 148.691 1.00 21.38 ? 233 GLU A C   1 
ATOM 1228 O O   . GLU A 1 163 ? 62.363  170.966 149.868 1.00 21.66 ? 233 GLU A O   1 
ATOM 1229 C CB  . GLU A 1 163 ? 59.586  170.651 148.440 1.00 23.45 ? 233 GLU A CB  1 
ATOM 1230 C CG  . GLU A 1 163 ? 58.590  170.856 149.553 1.00 29.85 ? 233 GLU A CG  1 
ATOM 1231 C CD  . GLU A 1 163 ? 57.489  169.786 149.539 1.00 35.09 ? 233 GLU A CD  1 
ATOM 1232 O OE1 . GLU A 1 163 ? 56.625  169.804 148.622 1.00 39.17 ? 233 GLU A OE1 1 
ATOM 1233 O OE2 . GLU A 1 163 ? 57.497  168.913 150.441 1.00 39.91 ? 233 GLU A OE2 1 
ATOM 1234 N N   . ASN A 1 164 ? 62.761  170.610 147.680 1.00 19.84 ? 234 ASN A N   1 
ATOM 1235 C CA  . ASN A 1 164 ? 64.079  170.048 147.903 1.00 19.46 ? 234 ASN A CA  1 
ATOM 1236 C C   . ASN A 1 164 ? 65.216  171.076 147.897 1.00 19.51 ? 234 ASN A C   1 
ATOM 1237 O O   . ASN A 1 164 ? 66.346  170.702 148.036 1.00 20.70 ? 234 ASN A O   1 
ATOM 1238 C CB  . ASN A 1 164 ? 64.364  168.978 146.856 1.00 19.25 ? 234 ASN A CB  1 
ATOM 1239 C CG  . ASN A 1 164 ? 63.499  167.789 147.054 1.00 19.80 ? 234 ASN A CG  1 
ATOM 1240 O OD1 . ASN A 1 164 ? 63.144  167.479 148.204 1.00 18.62 ? 234 ASN A OD1 1 
ATOM 1241 N ND2 . ASN A 1 164 ? 63.157  167.098 145.970 1.00 18.26 ? 234 ASN A ND2 1 
ATOM 1242 N N   . GLY A 1 165 ? 64.896  172.338 147.677 1.00 19.13 ? 235 GLY A N   1 
ATOM 1243 C CA  . GLY A 1 165 ? 65.889  173.400 147.756 1.00 19.96 ? 235 GLY A CA  1 
ATOM 1244 C C   . GLY A 1 165 ? 66.639  173.601 146.456 1.00 20.55 ? 235 GLY A C   1 
ATOM 1245 O O   . GLY A 1 165 ? 67.664  174.286 146.424 1.00 20.70 ? 235 GLY A O   1 
ATOM 1246 N N   . ILE A 1 166 ? 66.129  172.996 145.386 1.00 21.15 ? 236 ILE A N   1 
ATOM 1247 C CA  . ILE A 1 166 ? 66.678  173.159 144.037 1.00 22.10 ? 236 ILE A CA  1 
ATOM 1248 C C   . ILE A 1 166 ? 66.043  174.369 143.345 1.00 21.82 ? 236 ILE A C   1 
ATOM 1249 O O   . ILE A 1 166 ? 64.841  174.654 143.508 1.00 21.61 ? 236 ILE A O   1 
ATOM 1250 C CB  . ILE A 1 166 ? 66.439  171.853 143.246 1.00 22.98 ? 236 ILE A CB  1 
ATOM 1251 C CG1 . ILE A 1 166 ? 67.364  170.760 143.813 1.00 25.57 ? 236 ILE A CG1 1 
ATOM 1252 C CG2 . ILE A 1 166 ? 66.629  172.064 141.749 1.00 23.02 ? 236 ILE A CG2 1 
ATOM 1253 C CD1 . ILE A 1 166 ? 66.966  169.349 143.429 1.00 29.32 ? 236 ILE A CD1 1 
ATOM 1254 N N   . LEU A 1 167 ? 66.866  175.112 142.602 1.00 22.04 ? 237 LEU A N   1 
ATOM 1255 C CA  . LEU A 1 167 ? 66.412  176.308 141.917 1.00 22.81 ? 237 LEU A CA  1 
ATOM 1256 C C   . LEU A 1 167 ? 65.437  175.923 140.819 1.00 23.74 ? 237 LEU A C   1 
ATOM 1257 O O   . LEU A 1 167 ? 65.770  175.105 139.970 1.00 23.91 ? 237 LEU A O   1 
ATOM 1258 C CB  . LEU A 1 167 ? 67.611  177.046 141.317 1.00 22.78 ? 237 LEU A CB  1 
ATOM 1259 C CG  . LEU A 1 167 ? 67.361  178.395 140.660 1.00 22.74 ? 237 LEU A CG  1 
ATOM 1260 C CD1 . LEU A 1 167 ? 66.715  179.330 141.610 1.00 22.55 ? 237 LEU A CD1 1 
ATOM 1261 C CD2 . LEU A 1 167 ? 68.707  178.932 140.201 1.00 23.84 ? 237 LEU A CD2 1 
ATOM 1262 N N   . GLU A 1 168 ? 64.245  176.505 140.866 1.00 25.02 ? 238 GLU A N   1 
ATOM 1263 C CA  . GLU A 1 168 ? 63.122  176.141 139.997 1.00 26.45 ? 238 GLU A CA  1 
ATOM 1264 C C   . GLU A 1 168 ? 62.842  177.209 138.941 1.00 25.95 ? 238 GLU A C   1 
ATOM 1265 O O   . GLU A 1 168 ? 62.440  176.877 137.822 1.00 27.03 ? 238 GLU A O   1 
ATOM 1266 C CB  . GLU A 1 168 ? 61.881  175.958 140.871 1.00 27.68 ? 238 GLU A CB  1 
ATOM 1267 C CG  . GLU A 1 168 ? 60.655  175.385 140.200 1.00 31.69 ? 238 GLU A CG  1 
ATOM 1268 C CD  . GLU A 1 168 ? 59.708  174.790 141.238 1.00 35.83 ? 238 GLU A CD  1 
ATOM 1269 O OE1 . GLU A 1 168 ? 59.305  175.538 142.151 1.00 38.95 ? 238 GLU A OE1 1 
ATOM 1270 O OE2 . GLU A 1 168 ? 59.405  173.575 141.163 1.00 39.91 ? 238 GLU A OE2 1 
ATOM 1271 N N   . SER A 1 169 ? 63.048  178.473 139.302 1.00 24.41 ? 239 SER A N   1 
ATOM 1272 C CA  . SER A 1 169 ? 62.836  179.621 138.413 1.00 23.32 ? 239 SER A CA  1 
ATOM 1273 C C   . SER A 1 169 ? 63.564  180.906 138.863 1.00 22.20 ? 239 SER A C   1 
ATOM 1274 O O   . SER A 1 169 ? 63.945  181.049 140.029 1.00 21.09 ? 239 SER A O   1 
ATOM 1275 C CB  . SER A 1 169 ? 61.332  179.906 138.262 1.00 23.93 ? 239 SER A CB  1 
ATOM 1276 O OG  . SER A 1 169 ? 60.763  180.419 139.451 1.00 22.66 ? 239 SER A OG  1 
ATOM 1277 N N   . GLY A 1 170 ? 63.739  181.835 137.912 1.00 20.43 ? 240 GLY A N   1 
ATOM 1278 C CA  . GLY A 1 170 ? 64.294  183.159 138.162 1.00 19.87 ? 240 GLY A CA  1 
ATOM 1279 C C   . GLY A 1 170 ? 65.821  183.202 138.093 1.00 19.27 ? 240 GLY A C   1 
ATOM 1280 O O   . GLY A 1 170 ? 66.418  184.237 138.382 1.00 19.15 ? 240 GLY A O   1 
ATOM 1281 N N   . GLY A 1 171 ? 66.433  182.106 137.662 1.00 19.41 ? 241 GLY A N   1 
ATOM 1282 C CA  . GLY A 1 171 ? 67.880  181.910 137.749 1.00 19.59 ? 241 GLY A CA  1 
ATOM 1283 C C   . GLY A 1 171 ? 68.726  182.615 136.705 1.00 19.70 ? 241 GLY A C   1 
ATOM 1284 O O   . GLY A 1 171 ? 69.961  182.606 136.797 1.00 19.83 ? 241 GLY A O   1 
ATOM 1285 N N   . THR A 1 172 ? 68.083  183.253 135.729 1.00 20.10 ? 242 THR A N   1 
ATOM 1286 C CA  . THR A 1 172 ? 68.802  183.900 134.631 1.00 20.51 ? 242 THR A CA  1 
ATOM 1287 C C   . THR A 1 172 ? 68.168  185.251 134.366 1.00 19.88 ? 242 THR A C   1 
ATOM 1288 O O   . THR A 1 172 ? 66.960  185.333 134.199 1.00 20.58 ? 242 THR A O   1 
ATOM 1289 C CB  . THR A 1 172 ? 68.731  183.021 133.357 1.00 20.99 ? 242 THR A CB  1 
ATOM 1290 O OG1 . THR A 1 172 ? 69.281  181.726 133.608 1.00 23.77 ? 242 THR A OG1 1 
ATOM 1291 C CG2 . THR A 1 172 ? 69.611  183.560 132.258 1.00 22.44 ? 242 THR A CG2 1 
ATOM 1292 N N   . VAL A 1 173 ? 68.973  186.312 134.330 1.00 19.86 ? 243 VAL A N   1 
ATOM 1293 C CA  . VAL A 1 173 ? 68.461  187.667 134.182 1.00 19.62 ? 243 VAL A CA  1 
ATOM 1294 C C   . VAL A 1 173 ? 69.524  188.513 133.460 1.00 19.95 ? 243 VAL A C   1 
ATOM 1295 O O   . VAL A 1 173 ? 70.713  188.433 133.770 1.00 18.43 ? 243 VAL A O   1 
ATOM 1296 C CB  . VAL A 1 173 ? 68.057  188.299 135.545 1.00 20.20 ? 243 VAL A CB  1 
ATOM 1297 C CG1 . VAL A 1 173 ? 69.231  188.346 136.502 1.00 18.34 ? 243 VAL A CG1 1 
ATOM 1298 C CG2 . VAL A 1 173 ? 67.476  189.694 135.361 1.00 20.98 ? 243 VAL A CG2 1 
ATOM 1299 N N   . ASN A 1 174 ? 69.094  189.311 132.487 1.00 19.52 ? 244 ASN A N   1 
ATOM 1300 C CA  . ASN A 1 174 ? 69.999  190.281 131.859 1.00 19.79 ? 244 ASN A CA  1 
ATOM 1301 C C   . ASN A 1 174 ? 70.181  191.491 132.749 1.00 19.20 ? 244 ASN A C   1 
ATOM 1302 O O   . ASN A 1 174 ? 69.192  192.055 133.234 1.00 18.80 ? 244 ASN A O   1 
ATOM 1303 C CB  . ASN A 1 174 ? 69.459  190.727 130.486 1.00 20.05 ? 244 ASN A CB  1 
ATOM 1304 C CG  . ASN A 1 174 ? 69.503  189.629 129.469 1.00 21.55 ? 244 ASN A CG  1 
ATOM 1305 O OD1 . ASN A 1 174 ? 68.569  189.480 128.658 1.00 30.02 ? 244 ASN A OD1 1 
ATOM 1306 N ND2 . ASN A 1 174 ? 70.558  188.828 129.495 1.00 19.61 ? 244 ASN A ND2 1 
ATOM 1307 N N   . ILE A 1 175 ? 71.442  191.892 132.938 1.00 18.12 ? 245 ILE A N   1 
ATOM 1308 C CA  . ILE A 1 175 ? 71.804  193.076 133.722 1.00 18.68 ? 245 ILE A CA  1 
ATOM 1309 C C   . ILE A 1 175 ? 72.538  194.070 132.811 1.00 18.60 ? 245 ILE A C   1 
ATOM 1310 O O   . ILE A 1 175 ? 73.378  193.664 131.998 1.00 19.34 ? 245 ILE A O   1 
ATOM 1311 C CB  . ILE A 1 175 ? 72.739  192.684 134.890 1.00 18.43 ? 245 ILE A CB  1 
ATOM 1312 C CG1 . ILE A 1 175 ? 72.077  191.634 135.790 1.00 19.86 ? 245 ILE A CG1 1 
ATOM 1313 C CG2 . ILE A 1 175 ? 73.166  193.919 135.695 1.00 19.25 ? 245 ILE A CG2 1 
ATOM 1314 C CD1 . ILE A 1 175 ? 70.803  192.105 136.472 1.00 19.19 ? 245 ILE A CD1 1 
ATOM 1315 N N   . THR A 1 176 ? 72.218  195.344 132.937 1.00 18.74 ? 246 THR A N   1 
ATOM 1316 C CA  . THR A 1 176 ? 72.983  196.412 132.301 1.00 19.64 ? 246 THR A CA  1 
ATOM 1317 C C   . THR A 1 176 ? 73.698  197.230 133.372 1.00 19.61 ? 246 THR A C   1 
ATOM 1318 O O   . THR A 1 176 ? 73.065  197.712 134.317 1.00 20.66 ? 246 THR A O   1 
ATOM 1319 C CB  . THR A 1 176 ? 72.052  197.281 131.440 1.00 20.12 ? 246 THR A CB  1 
ATOM 1320 O OG1 . THR A 1 176 ? 71.560  196.491 130.357 1.00 22.13 ? 246 THR A OG1 1 
ATOM 1321 C CG2 . THR A 1 176 ? 72.822  198.428 130.724 1.00 21.57 ? 246 THR A CG2 1 
ATOM 1322 N N   . THR A 1 177 ? 75.019  197.367 133.260 1.00 19.70 ? 247 THR A N   1 
ATOM 1323 C CA  . THR A 1 177 ? 75.758  198.198 134.204 1.00 20.50 ? 247 THR A CA  1 
ATOM 1324 C C   . THR A 1 177 ? 75.417  199.671 134.034 1.00 22.14 ? 247 THR A C   1 
ATOM 1325 O O   . THR A 1 177 ? 74.640  200.054 133.133 1.00 22.23 ? 247 THR A O   1 
ATOM 1326 C CB  . THR A 1 177 ? 77.289  198.075 134.052 1.00 19.71 ? 247 THR A CB  1 
ATOM 1327 O OG1 . THR A 1 177 ? 77.701  198.648 132.801 1.00 20.06 ? 247 THR A OG1 1 
ATOM 1328 C CG2 . THR A 1 177 ? 77.757  196.615 134.043 1.00 19.36 ? 247 THR A CG2 1 
ATOM 1329 N N   . GLY A 1 178 ? 76.012  200.482 134.913 1.00 22.87 ? 248 GLY A N   1 
ATOM 1330 C CA  . GLY A 1 178 ? 76.117  201.912 134.721 1.00 24.14 ? 248 GLY A CA  1 
ATOM 1331 C C   . GLY A 1 178 ? 77.188  202.245 133.688 1.00 25.46 ? 248 GLY A C   1 
ATOM 1332 O O   . GLY A 1 178 ? 77.635  201.388 132.945 1.00 24.12 ? 248 GLY A O   1 
ATOM 1333 N N   . THR A 1 179 ? 77.587  203.517 133.655 1.00 27.13 ? 249 THR A N   1 
ATOM 1334 C CA  . THR A 1 179 ? 78.656  203.997 132.776 1.00 28.32 ? 249 THR A CA  1 
ATOM 1335 C C   . THR A 1 179 ? 79.757  204.649 133.596 1.00 28.88 ? 249 THR A C   1 
ATOM 1336 O O   . THR A 1 179 ? 79.498  205.207 134.658 1.00 30.40 ? 249 THR A O   1 
ATOM 1337 C CB  . THR A 1 179 ? 78.108  205.016 131.762 1.00 28.77 ? 249 THR A CB  1 
ATOM 1338 O OG1 . THR A 1 179 ? 77.419  206.051 132.463 1.00 30.83 ? 249 THR A OG1 1 
ATOM 1339 C CG2 . THR A 1 179 ? 77.039  204.382 130.841 1.00 28.44 ? 249 THR A CG2 1 
ATOM 1340 N N   . ILE A 1 180 ? 80.983  204.565 133.097 1.00 29.98 ? 250 ILE A N   1 
ATOM 1341 C CA  . ILE A 1 180 ? 82.160  205.099 133.764 1.00 31.00 ? 250 ILE A CA  1 
ATOM 1342 C C   . ILE A 1 180 ? 82.953  205.944 132.785 1.00 31.62 ? 250 ILE A C   1 
ATOM 1343 O O   . ILE A 1 180 ? 83.256  205.466 131.710 1.00 31.60 ? 250 ILE A O   1 
ATOM 1344 C CB  . ILE A 1 180 ? 83.082  203.948 134.219 1.00 31.55 ? 250 ILE A CB  1 
ATOM 1345 C CG1 . ILE A 1 180 ? 82.401  203.106 135.300 1.00 31.57 ? 250 ILE A CG1 1 
ATOM 1346 C CG2 . ILE A 1 180 ? 84.453  204.513 134.703 1.00 31.70 ? 250 ILE A CG2 1 
ATOM 1347 C CD1 . ILE A 1 180 ? 83.214  201.896 135.713 1.00 31.61 ? 250 ILE A CD1 1 
ATOM 1348 N N   . ASN A 1 181 ? 83.321  207.167 133.164 1.00 32.58 ? 251 ASN A N   1 
ATOM 1349 C CA  . ASN A 1 181 ? 84.212  207.994 132.327 1.00 33.35 ? 251 ASN A CA  1 
ATOM 1350 C C   . ASN A 1 181 ? 83.796  207.998 130.834 1.00 32.67 ? 251 ASN A C   1 
ATOM 1351 O O   . ASN A 1 181 ? 84.617  207.809 129.928 1.00 33.59 ? 251 ASN A O   1 
ATOM 1352 C CB  . ASN A 1 181 ? 85.679  207.543 132.496 1.00 33.98 ? 251 ASN A CB  1 
ATOM 1353 C CG  . ASN A 1 181 ? 86.689  208.604 132.014 1.00 37.72 ? 251 ASN A CG  1 
ATOM 1354 O OD1 . ASN A 1 181 ? 87.584  208.308 131.209 1.00 41.55 ? 251 ASN A OD1 1 
ATOM 1355 N ND2 . ASN A 1 181 ? 86.542  209.851 132.504 1.00 42.16 ? 251 ASN A ND2 1 
ATOM 1356 N N   . GLY A 1 182 ? 82.504  208.175 130.600 1.00 31.57 ? 252 GLY A N   1 
ATOM 1357 C CA  . GLY A 1 182 ? 81.976  208.340 129.253 1.00 31.07 ? 252 GLY A CA  1 
ATOM 1358 C C   . GLY A 1 182 ? 81.990  207.107 128.367 1.00 30.08 ? 252 GLY A C   1 
ATOM 1359 O O   . GLY A 1 182 ? 81.818  207.226 127.144 1.00 29.69 ? 252 GLY A O   1 
ATOM 1360 N N   . ALA A 1 183 ? 82.173  205.930 128.958 1.00 29.42 ? 253 ALA A N   1 
ATOM 1361 C CA  . ALA A 1 183 ? 82.215  204.685 128.195 1.00 28.25 ? 253 ALA A CA  1 
ATOM 1362 C C   . ALA A 1 183 ? 80.892  203.970 128.297 1.00 28.06 ? 253 ALA A C   1 
ATOM 1363 O O   . ALA A 1 183 ? 80.170  204.104 129.293 1.00 27.75 ? 253 ALA A O   1 
ATOM 1364 C CB  . ALA A 1 183 ? 83.359  203.771 128.688 1.00 28.60 ? 253 ALA A CB  1 
ATOM 1365 N N   . THR A 1 184 ? 80.584  203.189 127.267 1.00 27.93 ? 254 THR A N   1 
ATOM 1366 C CA  . THR A 1 184 ? 79.305  202.499 127.162 1.00 27.94 ? 254 THR A CA  1 
ATOM 1367 C C   . THR A 1 184 ? 79.221  201.382 128.210 1.00 27.20 ? 254 THR A C   1 
ATOM 1368 O O   . THR A 1 184 ? 80.240  200.782 128.531 1.00 27.52 ? 254 THR A O   1 
ATOM 1369 C CB  . THR A 1 184 ? 79.159  201.835 125.794 1.00 28.84 ? 254 THR A CB  1 
ATOM 1370 O OG1 . THR A 1 184 ? 80.324  201.055 125.531 1.00 30.94 ? 254 THR A OG1 1 
ATOM 1371 C CG2 . THR A 1 184 ? 79.144  202.849 124.641 1.00 29.75 ? 254 THR A CG2 1 
ATOM 1372 N N   . ALA A 1 185 ? 78.010  201.082 128.671 1.00 25.50 ? 255 ALA A N   1 
ATOM 1373 C CA  . ALA A 1 185 ? 77.769  200.070 129.712 1.00 24.72 ? 255 ALA A CA  1 
ATOM 1374 C C   . ALA A 1 185 ? 78.028  198.653 129.197 1.00 23.55 ? 255 ALA A C   1 
ATOM 1375 O O   . ALA A 1 185 ? 78.056  198.416 127.999 1.00 23.81 ? 255 ALA A O   1 
ATOM 1376 C CB  . ALA A 1 185 ? 76.347  200.183 130.208 1.00 25.04 ? 255 ALA A CB  1 
ATOM 1377 N N   . ALA A 1 186 ? 78.224  197.702 130.103 1.00 22.30 ? 256 ALA A N   1 
ATOM 1378 C CA  . ALA A 1 186 ? 78.197  196.290 129.749 1.00 20.72 ? 256 ALA A CA  1 
ATOM 1379 C C   . ALA A 1 186 ? 76.776  195.743 129.939 1.00 20.47 ? 256 ALA A C   1 
ATOM 1380 O O   . ALA A 1 186 ? 76.062  196.155 130.846 1.00 19.67 ? 256 ALA A O   1 
ATOM 1381 C CB  . ALA A 1 186 ? 79.183  195.506 130.611 1.00 20.90 ? 256 ALA A CB  1 
ATOM 1382 N N   . THR A 1 187 ? 76.374  194.828 129.075 1.00 19.42 ? 257 THR A N   1 
ATOM 1383 C CA  . THR A 1 187 ? 75.108  194.111 129.199 1.00 19.99 ? 257 THR A CA  1 
ATOM 1384 C C   . THR A 1 187 ? 75.383  192.641 129.190 1.00 19.04 ? 257 THR A C   1 
ATOM 1385 O O   . THR A 1 187 ? 75.978  192.106 128.230 1.00 20.54 ? 257 THR A O   1 
ATOM 1386 C CB  . THR A 1 187 ? 74.154  194.521 128.043 1.00 20.12 ? 257 THR A CB  1 
ATOM 1387 O OG1 . THR A 1 187 ? 73.809  195.885 128.233 1.00 22.29 ? 257 THR A OG1 1 
ATOM 1388 C CG2 . THR A 1 187 ? 72.837  193.798 128.090 1.00 21.35 ? 257 THR A CG2 1 
ATOM 1389 N N   . PHE A 1 188 ? 74.988  191.957 130.266 1.00 18.64 ? 258 PHE A N   1 
ATOM 1390 C CA  . PHE A 1 188 ? 75.366  190.542 130.441 1.00 17.43 ? 258 PHE A CA  1 
ATOM 1391 C C   . PHE A 1 188 ? 74.240  189.730 131.068 1.00 16.80 ? 258 PHE A C   1 
ATOM 1392 O O   . PHE A 1 188 ? 73.389  190.278 131.772 1.00 16.16 ? 258 PHE A O   1 
ATOM 1393 C CB  . PHE A 1 188 ? 76.653  190.427 131.292 1.00 16.74 ? 258 PHE A CB  1 
ATOM 1394 C CG  . PHE A 1 188 ? 76.513  190.976 132.687 1.00 16.08 ? 258 PHE A CG  1 
ATOM 1395 C CD1 . PHE A 1 188 ? 76.747  192.322 132.938 1.00 15.78 ? 258 PHE A CD1 1 
ATOM 1396 C CD2 . PHE A 1 188 ? 76.175  190.130 133.762 1.00 14.69 ? 258 PHE A CD2 1 
ATOM 1397 C CE1 . PHE A 1 188 ? 76.613  192.848 134.211 1.00 16.92 ? 258 PHE A CE1 1 
ATOM 1398 C CE2 . PHE A 1 188 ? 76.058  190.662 135.058 1.00 13.27 ? 258 PHE A CE2 1 
ATOM 1399 C CZ  . PHE A 1 188 ? 76.264  192.021 135.278 1.00 15.62 ? 258 PHE A CZ  1 
ATOM 1400 N N   . SER A 1 189 ? 74.213  188.447 130.742 1.00 16.90 ? 259 SER A N   1 
ATOM 1401 C CA  . SER A 1 189 ? 73.341  187.473 131.387 1.00 17.56 ? 259 SER A CA  1 
ATOM 1402 C C   . SER A 1 189 ? 73.989  187.020 132.696 1.00 17.34 ? 259 SER A C   1 
ATOM 1403 O O   . SER A 1 189 ? 75.109  186.529 132.706 1.00 17.14 ? 259 SER A O   1 
ATOM 1404 C CB  . SER A 1 189 ? 73.090  186.281 130.471 1.00 18.37 ? 259 SER A CB  1 
ATOM 1405 O OG  . SER A 1 189 ? 72.182  185.320 131.050 1.00 20.91 ? 259 SER A OG  1 
ATOM 1406 N N   . LEU A 1 190 ? 73.281  187.246 133.795 1.00 16.81 ? 260 LEU A N   1 
ATOM 1407 C CA  . LEU A 1 190 ? 73.669  186.773 135.120 1.00 16.74 ? 260 LEU A CA  1 
ATOM 1408 C C   . LEU A 1 190 ? 72.898  185.496 135.468 1.00 16.44 ? 260 LEU A C   1 
ATOM 1409 O O   . LEU A 1 190 ? 71.666  185.505 135.460 1.00 16.09 ? 260 LEU A O   1 
ATOM 1410 C CB  . LEU A 1 190 ? 73.335  187.848 136.134 1.00 16.54 ? 260 LEU A CB  1 
ATOM 1411 C CG  . LEU A 1 190 ? 73.688  187.559 137.588 1.00 16.78 ? 260 LEU A CG  1 
ATOM 1412 C CD1 . LEU A 1 190 ? 75.175  187.252 137.756 1.00 18.30 ? 260 LEU A CD1 1 
ATOM 1413 C CD2 . LEU A 1 190 ? 73.271  188.746 138.414 1.00 17.34 ? 260 LEU A CD2 1 
ATOM 1414 N N   . SER A 1 191 ? 73.632  184.445 135.806 1.00 16.42 ? 261 SER A N   1 
ATOM 1415 C CA  . SER A 1 191 ? 73.079  183.113 136.026 1.00 17.02 ? 261 SER A CA  1 
ATOM 1416 C C   . SER A 1 191 ? 73.326  182.707 137.465 1.00 17.12 ? 261 SER A C   1 
ATOM 1417 O O   . SER A 1 191 ? 74.422  182.866 137.957 1.00 17.44 ? 261 SER A O   1 
ATOM 1418 C CB  . SER A 1 191 ? 73.770  182.103 135.103 1.00 16.33 ? 261 SER A CB  1 
ATOM 1419 O OG  . SER A 1 191 ? 73.409  180.768 135.433 1.00 18.75 ? 261 SER A OG  1 
ATOM 1420 N N   . PHE A 1 192 ? 72.315  182.160 138.118 1.00 16.82 ? 262 PHE A N   1 
ATOM 1421 C CA  . PHE A 1 192 ? 72.424  181.658 139.494 1.00 16.79 ? 262 PHE A CA  1 
ATOM 1422 C C   . PHE A 1 192 ? 72.416  180.117 139.514 1.00 18.00 ? 262 PHE A C   1 
ATOM 1423 O O   . PHE A 1 192 ? 72.190  179.476 140.555 1.00 17.65 ? 262 PHE A O   1 
ATOM 1424 C CB  . PHE A 1 192 ? 71.310  182.262 140.351 1.00 16.04 ? 262 PHE A CB  1 
ATOM 1425 C CG  . PHE A 1 192 ? 71.419  183.742 140.500 1.00 15.53 ? 262 PHE A CG  1 
ATOM 1426 C CD1 . PHE A 1 192 ? 72.260  184.295 141.472 1.00 15.52 ? 262 PHE A CD1 1 
ATOM 1427 C CD2 . PHE A 1 192 ? 70.726  184.600 139.658 1.00 17.52 ? 262 PHE A CD2 1 
ATOM 1428 C CE1 . PHE A 1 192 ? 72.386  185.672 141.602 1.00 15.91 ? 262 PHE A CE1 1 
ATOM 1429 C CE2 . PHE A 1 192 ? 70.840  186.006 139.803 1.00 17.39 ? 262 PHE A CE2 1 
ATOM 1430 C CZ  . PHE A 1 192 ? 71.675  186.523 140.777 1.00 16.50 ? 262 PHE A CZ  1 
ATOM 1431 N N   . LEU A 1 193 ? 72.647  179.526 138.351 1.00 19.08 ? 263 LEU A N   1 
ATOM 1432 C CA  . LEU A 1 193 ? 72.781  178.070 138.207 1.00 20.15 ? 263 LEU A CA  1 
ATOM 1433 C C   . LEU A 1 193 ? 73.552  177.420 139.344 1.00 19.73 ? 263 LEU A C   1 
ATOM 1434 O O   . LEU A 1 193 ? 74.630  177.875 139.728 1.00 19.37 ? 263 LEU A O   1 
ATOM 1435 C CB  . LEU A 1 193 ? 73.490  177.727 136.896 1.00 21.61 ? 263 LEU A CB  1 
ATOM 1436 C CG  . LEU A 1 193 ? 73.190  176.462 136.075 1.00 25.41 ? 263 LEU A CG  1 
ATOM 1437 C CD1 . LEU A 1 193 ? 74.513  175.954 135.445 1.00 26.56 ? 263 LEU A CD1 1 
ATOM 1438 C CD2 . LEU A 1 193 ? 72.481  175.370 136.798 1.00 28.50 ? 263 LEU A CD2 1 
ATOM 1439 N N   . ASN A 1 194 ? 72.980  176.348 139.882 1.00 20.00 ? 264 ASN A N   1 
ATOM 1440 C CA  . ASN A 1 194 ? 73.587  175.522 140.928 1.00 19.94 ? 264 ASN A CA  1 
ATOM 1441 C C   . ASN A 1 194 ? 73.460  176.108 142.324 1.00 18.89 ? 264 ASN A C   1 
ATOM 1442 O O   . ASN A 1 194 ? 73.942  175.484 143.281 1.00 17.95 ? 264 ASN A O   1 
ATOM 1443 C CB  . ASN A 1 194 ? 75.060  175.166 140.655 1.00 21.20 ? 264 ASN A CB  1 
ATOM 1444 C CG  . ASN A 1 194 ? 75.231  174.389 139.375 1.00 24.06 ? 264 ASN A CG  1 
ATOM 1445 O OD1 . ASN A 1 194 ? 74.436  173.499 139.096 1.00 27.50 ? 264 ASN A OD1 1 
ATOM 1446 N ND2 . ASN A 1 194 ? 76.234  174.755 138.559 1.00 27.15 ? 264 ASN A ND2 1 
ATOM 1447 N N   . SER A 1 195 ? 72.827  177.289 142.427 1.00 17.53 ? 265 SER A N   1 
ATOM 1448 C CA  . SER A 1 195 ? 72.406  177.848 143.705 1.00 17.01 ? 265 SER A CA  1 
ATOM 1449 C C   . SER A 1 195 ? 71.348  176.942 144.318 1.00 17.44 ? 265 SER A C   1 
ATOM 1450 O O   . SER A 1 195 ? 70.523  176.361 143.601 1.00 15.73 ? 265 SER A O   1 
ATOM 1451 C CB  . SER A 1 195 ? 71.780  179.237 143.529 1.00 16.67 ? 265 SER A CB  1 
ATOM 1452 O OG  . SER A 1 195 ? 72.757  180.166 143.133 1.00 14.69 ? 265 SER A OG  1 
ATOM 1453 N N   . MET A 1 196 ? 71.357  176.866 145.636 1.00 17.59 ? 266 MET A N   1 
ATOM 1454 C CA  . MET A 1 196 ? 70.464  175.969 146.357 1.00 19.82 ? 266 MET A CA  1 
ATOM 1455 C C   . MET A 1 196 ? 70.000  176.632 147.654 1.00 19.14 ? 266 MET A C   1 
ATOM 1456 O O   . MET A 1 196 ? 70.654  177.509 148.169 1.00 18.92 ? 266 MET A O   1 
ATOM 1457 C CB  . MET A 1 196 ? 71.252  174.722 146.743 1.00 20.91 ? 266 MET A CB  1 
ATOM 1458 C CG  . MET A 1 196 ? 70.979  173.477 145.953 1.00 28.24 ? 266 MET A CG  1 
ATOM 1459 S SD  . MET A 1 196 ? 72.199  172.185 146.349 1.00 40.46 ? 266 MET A SD  1 
ATOM 1460 C CE  . MET A 1 196 ? 72.578  172.498 148.142 1.00 39.19 ? 266 MET A CE  1 
ATOM 1461 N N   . GLN A 1 197 ? 68.857  176.200 148.162 1.00 18.36 ? 267 GLN A N   1 
ATOM 1462 C CA  . GLN A 1 197 ? 68.415  176.558 149.489 1.00 17.89 ? 267 GLN A CA  1 
ATOM 1463 C C   . GLN A 1 197 ? 68.615  175.346 150.374 1.00 18.41 ? 267 GLN A C   1 
ATOM 1464 O O   . GLN A 1 197 ? 68.004  174.297 150.184 1.00 19.44 ? 267 GLN A O   1 
ATOM 1465 C CB  . GLN A 1 197 ? 66.960  177.023 149.473 1.00 18.69 ? 267 GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 197 ? 66.524  177.659 150.777 1.00 17.71 ? 267 GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 197 ? 65.042  177.967 150.785 1.00 19.25 ? 267 GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 197 ? 64.643  179.123 150.710 1.00 20.49 ? 267 GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 197 ? 64.216  176.917 150.847 1.00 20.75 ? 267 GLN A NE2 1 
ATOM 1470 N N   . GLN A 1 198 ? 69.522  175.475 151.324 1.00 18.43 ? 268 GLN A N   1 
ATOM 1471 C CA  . GLN A 1 198 ? 69.812  174.440 152.279 1.00 18.94 ? 268 GLN A CA  1 
ATOM 1472 C C   . GLN A 1 198 ? 68.732  174.444 153.369 1.00 18.02 ? 268 GLN A C   1 
ATOM 1473 O O   . GLN A 1 198 ? 68.186  175.515 153.726 1.00 17.12 ? 268 GLN A O   1 
ATOM 1474 C CB  . GLN A 1 198 ? 71.173  174.696 152.925 1.00 19.16 ? 268 GLN A CB  1 
ATOM 1475 C CG  . GLN A 1 198 ? 72.383  174.635 151.971 1.00 22.62 ? 268 GLN A CG  1 
ATOM 1476 C CD  . GLN A 1 198 ? 73.686  174.888 152.713 1.00 22.90 ? 268 GLN A CD  1 
ATOM 1477 O OE1 . GLN A 1 198 ? 74.580  174.030 152.721 1.00 25.55 ? 268 GLN A OE1 1 
ATOM 1478 N NE2 . GLN A 1 198 ? 73.786  176.050 153.366 1.00 21.73 ? 268 GLN A NE2 1 
ATOM 1479 N N   . ASN A 1 199 ? 68.424  173.268 153.907 1.00 17.52 ? 269 ASN A N   1 
ATOM 1480 C CA  . ASN A 1 199 ? 67.549  173.194 155.080 1.00 17.37 ? 269 ASN A CA  1 
ATOM 1481 C C   . ASN A 1 199 ? 68.083  174.043 156.231 1.00 16.97 ? 269 ASN A C   1 
ATOM 1482 O O   . ASN A 1 199 ? 67.310  174.737 156.893 1.00 17.01 ? 269 ASN A O   1 
ATOM 1483 C CB  . ASN A 1 199 ? 67.356  171.752 155.552 1.00 17.50 ? 269 ASN A CB  1 
ATOM 1484 C CG  . ASN A 1 199 ? 66.539  170.927 154.552 1.00 18.57 ? 269 ASN A CG  1 
ATOM 1485 O OD1 . ASN A 1 199 ? 65.761  171.479 153.790 1.00 17.56 ? 269 ASN A OD1 1 
ATOM 1486 N ND2 . ASN A 1 199 ? 66.708  169.620 154.572 1.00 20.59 ? 269 ASN A ND2 1 
ATOM 1487 N N   . THR A 1 200 ? 69.390  173.981 156.454 1.00 18.06 ? 270 THR A N   1 
ATOM 1488 C CA  . THR A 1 200 ? 70.043  174.771 157.505 1.00 18.67 ? 270 THR A CA  1 
ATOM 1489 C C   . THR A 1 200 ? 71.492  175.107 157.126 1.00 18.90 ? 270 THR A C   1 
ATOM 1490 O O   . THR A 1 200 ? 72.262  174.267 156.660 1.00 19.77 ? 270 THR A O   1 
ATOM 1491 C CB  . THR A 1 200 ? 69.969  174.032 158.870 1.00 18.98 ? 270 THR A CB  1 
ATOM 1492 O OG1 . THR A 1 200 ? 70.658  174.780 159.890 1.00 19.70 ? 270 THR A OG1 1 
ATOM 1493 C CG2 . THR A 1 200 ? 70.727  172.731 158.864 1.00 20.71 ? 270 THR A CG2 1 
ATOM 1494 N N   . GLY A 1 201 ? 71.858  176.359 157.332 1.00 19.82 ? 271 GLY A N   1 
ATOM 1495 C CA  . GLY A 1 201 ? 73.226  176.789 157.121 1.00 20.28 ? 271 GLY A CA  1 
ATOM 1496 C C   . GLY A 1 201 ? 73.288  178.288 157.190 1.00 20.64 ? 271 GLY A C   1 
ATOM 1497 O O   . GLY A 1 201 ? 72.330  178.936 157.658 1.00 22.31 ? 271 GLY A O   1 
ATOM 1498 N N   . ALA A 1 202 ? 74.406  178.849 156.754 1.00 19.68 ? 272 ALA A N   1 
ATOM 1499 C CA  . ALA A 1 202 ? 74.518  180.293 156.634 1.00 19.44 ? 272 ALA A CA  1 
ATOM 1500 C C   . ALA A 1 202 ? 74.633  180.653 155.163 1.00 18.12 ? 272 ALA A C   1 
ATOM 1501 O O   . ALA A 1 202 ? 75.225  179.925 154.381 1.00 17.99 ? 272 ALA A O   1 
ATOM 1502 C CB  . ALA A 1 202 ? 75.690  180.833 157.431 1.00 20.54 ? 272 ALA A CB  1 
ATOM 1503 N N   . ASN A 1 203 ? 73.985  181.754 154.802 1.00 17.65 ? 273 ASN A N   1 
ATOM 1504 C CA  . ASN A 1 203 ? 74.047  182.281 153.457 1.00 18.09 ? 273 ASN A CA  1 
ATOM 1505 C C   . ASN A 1 203 ? 75.499  182.464 153.055 1.00 18.26 ? 273 ASN A C   1 
ATOM 1506 O O   . ASN A 1 203 ? 76.263  183.119 153.771 1.00 18.41 ? 273 ASN A O   1 
ATOM 1507 C CB  . ASN A 1 203 ? 73.357  183.627 153.367 1.00 16.66 ? 273 ASN A CB  1 
ATOM 1508 C CG  . ASN A 1 203 ? 71.903  183.568 153.740 1.00 17.57 ? 273 ASN A CG  1 
ATOM 1509 O OD1 . ASN A 1 203 ? 71.242  182.542 153.575 1.00 14.66 ? 273 ASN A OD1 1 
ATOM 1510 N ND2 . ASN A 1 203 ? 71.403  184.659 154.284 1.00 12.68 ? 273 ASN A ND2 1 
ATOM 1511 N N   . ASN A 1 204 ? 75.866  181.880 151.918 1.00 17.96 ? 274 ASN A N   1 
ATOM 1512 C CA  . ASN A 1 204 ? 77.260  181.811 151.504 1.00 18.02 ? 274 ASN A CA  1 
ATOM 1513 C C   . ASN A 1 204 ? 77.442  181.654 149.997 1.00 17.49 ? 274 ASN A C   1 
ATOM 1514 O O   . ASN A 1 204 ? 76.902  180.724 149.371 1.00 16.05 ? 274 ASN A O   1 
ATOM 1515 C CB  . ASN A 1 204 ? 77.904  180.642 152.208 1.00 17.57 ? 274 ASN A CB  1 
ATOM 1516 C CG  . ASN A 1 204 ? 79.373  180.559 151.941 1.00 20.60 ? 274 ASN A CG  1 
ATOM 1517 O OD1 . ASN A 1 204 ? 80.111  181.536 152.139 1.00 19.39 ? 274 ASN A OD1 1 
ATOM 1518 N ND2 . ASN A 1 204 ? 79.813  179.402 151.456 1.00 20.38 ? 274 ASN A ND2 1 
ATOM 1519 N N   . ILE A 1 205 ? 78.236  182.545 149.411 1.00 17.13 ? 275 ILE A N   1 
ATOM 1520 C CA  . ILE A 1 205 ? 78.534  182.462 147.986 1.00 17.22 ? 275 ILE A CA  1 
ATOM 1521 C C   . ILE A 1 205 ? 79.728  181.535 147.776 1.00 17.76 ? 275 ILE A C   1 
ATOM 1522 O O   . ILE A 1 205 ? 80.810  181.756 148.324 1.00 17.72 ? 275 ILE A O   1 
ATOM 1523 C CB  . ILE A 1 205 ? 78.735  183.869 147.427 1.00 16.47 ? 275 ILE A CB  1 
ATOM 1524 C CG1 . ILE A 1 205 ? 77.412  184.643 147.552 1.00 18.60 ? 275 ILE A CG1 1 
ATOM 1525 C CG2 . ILE A 1 205 ? 79.191  183.832 145.988 1.00 17.84 ? 275 ILE A CG2 1 
ATOM 1526 C CD1 . ILE A 1 205 ? 77.569  186.106 147.645 1.00 17.54 ? 275 ILE A CD1 1 
ATOM 1527 N N   . VAL A 1 206 ? 79.501  180.486 147.006 1.00 17.72 ? 276 VAL A N   1 
ATOM 1528 C CA  . VAL A 1 206 ? 80.482  179.421 146.773 1.00 19.52 ? 276 VAL A CA  1 
ATOM 1529 C C   . VAL A 1 206 ? 81.353  179.722 145.566 1.00 19.18 ? 276 VAL A C   1 
ATOM 1530 O O   . VAL A 1 206 ? 82.532  179.337 145.548 1.00 19.86 ? 276 VAL A O   1 
ATOM 1531 C CB  . VAL A 1 206 ? 79.753  178.085 146.617 1.00 20.03 ? 276 VAL A CB  1 
ATOM 1532 C CG1 . VAL A 1 206 ? 80.667  176.970 146.136 1.00 23.15 ? 276 VAL A CG1 1 
ATOM 1533 C CG2 . VAL A 1 206 ? 79.150  177.728 147.966 1.00 23.81 ? 276 VAL A CG2 1 
ATOM 1534 N N   . ALA A 1 207 ? 80.793  180.422 144.575 1.00 18.33 ? 277 ALA A N   1 
ATOM 1535 C CA  . ALA A 1 207 ? 81.523  180.668 143.327 1.00 18.13 ? 277 ALA A CA  1 
ATOM 1536 C C   . ALA A 1 207 ? 80.947  181.860 142.574 1.00 17.83 ? 277 ALA A C   1 
ATOM 1537 O O   . ALA A 1 207 ? 79.761  182.123 142.618 1.00 16.83 ? 277 ALA A O   1 
ATOM 1538 C CB  . ALA A 1 207 ? 81.497  179.440 142.452 1.00 18.72 ? 277 ALA A CB  1 
ATOM 1539 N N   . THR A 1 208 ? 81.813  182.623 141.924 1.00 18.65 ? 278 THR A N   1 
ATOM 1540 C CA  . THR A 1 208 ? 81.371  183.561 140.896 1.00 18.10 ? 278 THR A CA  1 
ATOM 1541 C C   . THR A 1 208 ? 82.271  183.411 139.669 1.00 18.61 ? 278 THR A C   1 
ATOM 1542 O O   . THR A 1 208 ? 83.409  182.953 139.770 1.00 18.68 ? 278 THR A O   1 
ATOM 1543 C CB  . THR A 1 208 ? 81.420  185.006 141.388 1.00 19.08 ? 278 THR A CB  1 
ATOM 1544 O OG1 . THR A 1 208 ? 82.771  185.370 141.663 1.00 19.36 ? 278 THR A OG1 1 
ATOM 1545 C CG2 . THR A 1 208 ? 80.729  185.182 142.754 1.00 18.75 ? 278 THR A CG2 1 
ATOM 1546 N N   . ASN A 1 209 ? 81.750  183.816 138.523 1.00 18.40 ? 279 ASN A N   1 
ATOM 1547 C CA  . ASN A 1 209 ? 82.520  183.900 137.285 1.00 19.86 ? 279 ASN A CA  1 
ATOM 1548 C C   . ASN A 1 209 ? 81.934  184.956 136.364 1.00 18.77 ? 279 ASN A C   1 
ATOM 1549 O O   . ASN A 1 209 ? 80.791  185.372 136.518 1.00 17.91 ? 279 ASN A O   1 
ATOM 1550 C CB  . ASN A 1 209 ? 82.575  182.553 136.561 1.00 20.47 ? 279 ASN A CB  1 
ATOM 1551 C CG  . ASN A 1 209 ? 83.975  182.234 135.989 1.00 25.17 ? 279 ASN A CG  1 
ATOM 1552 O OD1 . ASN A 1 209 ? 84.649  183.102 135.408 1.00 28.00 ? 279 ASN A OD1 1 
ATOM 1553 N ND2 . ASN A 1 209 ? 84.418  180.990 136.177 1.00 28.50 ? 279 ASN A ND2 1 
ATOM 1554 N N   . GLN A 1 210 ? 82.766  185.421 135.438 1.00 18.22 ? 280 GLN A N   1 
ATOM 1555 C CA  . GLN A 1 210 ? 82.344  186.295 134.339 1.00 17.43 ? 280 GLN A CA  1 
ATOM 1556 C C   . GLN A 1 210 ? 83.411  186.240 133.236 1.00 17.78 ? 280 GLN A C   1 
ATOM 1557 O O   . GLN A 1 210 ? 84.560  185.873 133.510 1.00 16.84 ? 280 GLN A O   1 
ATOM 1558 C CB  . GLN A 1 210 ? 82.158  187.705 134.877 1.00 17.25 ? 280 GLN A CB  1 
ATOM 1559 C CG  . GLN A 1 210 ? 83.414  188.334 135.490 1.00 17.25 ? 280 GLN A CG  1 
ATOM 1560 C CD  . GLN A 1 210 ? 84.325  188.980 134.447 1.00 19.97 ? 280 GLN A CD  1 
ATOM 1561 O OE1 . GLN A 1 210 ? 85.563  188.784 134.454 1.00 20.56 ? 280 GLN A OE1 1 
ATOM 1562 N NE2 . GLN A 1 210 ? 83.724  189.734 133.546 1.00 15.27 ? 280 GLN A NE2 1 
ATOM 1563 N N   . ASN A 1 211 ? 83.036  186.618 132.012 1.00 18.45 ? 281 ASN A N   1 
ATOM 1564 C CA  . ASN A 1 211 ? 83.849  186.357 130.815 1.00 18.65 ? 281 ASN A CA  1 
ATOM 1565 C C   . ASN A 1 211 ? 84.518  187.575 130.173 1.00 18.94 ? 281 ASN A C   1 
ATOM 1566 O O   . ASN A 1 211 ? 84.988  187.510 129.037 1.00 20.05 ? 281 ASN A O   1 
ATOM 1567 C CB  . ASN A 1 211 ? 83.007  185.637 129.768 1.00 18.89 ? 281 ASN A CB  1 
ATOM 1568 C CG  . ASN A 1 211 ? 81.976  186.536 129.112 1.00 18.44 ? 281 ASN A CG  1 
ATOM 1569 O OD1 . ASN A 1 211 ? 81.594  187.592 129.635 1.00 18.54 ? 281 ASN A OD1 1 
ATOM 1570 N ND2 . ASN A 1 211 ? 81.563  186.143 127.920 1.00 18.29 ? 281 ASN A ND2 1 
ATOM 1571 N N   . GLY A 1 212 ? 84.531  188.679 130.885 1.00 18.74 ? 282 GLY A N   1 
ATOM 1572 C CA  . GLY A 1 212 ? 85.148  189.917 130.410 1.00 19.03 ? 282 GLY A CA  1 
ATOM 1573 C C   . GLY A 1 212 ? 86.511  190.132 131.024 1.00 19.05 ? 282 GLY A C   1 
ATOM 1574 O O   . GLY A 1 212 ? 86.890  189.448 131.969 1.00 20.57 ? 282 GLY A O   1 
ATOM 1575 N N   . TYR A 1 213 ? 87.246  191.090 130.486 1.00 18.39 ? 283 TYR A N   1 
ATOM 1576 C CA  . TYR A 1 213 ? 88.563  191.436 131.010 1.00 17.88 ? 283 TYR A CA  1 
ATOM 1577 C C   . TYR A 1 213 ? 89.127  192.680 130.320 1.00 18.48 ? 283 TYR A C   1 
ATOM 1578 O O   . TYR A 1 213 ? 88.395  193.447 129.686 1.00 19.07 ? 283 TYR A O   1 
ATOM 1579 C CB  . TYR A 1 213 ? 89.529  190.257 130.842 1.00 18.14 ? 283 TYR A CB  1 
ATOM 1580 C CG  . TYR A 1 213 ? 89.515  189.596 129.470 1.00 16.94 ? 283 TYR A CG  1 
ATOM 1581 C CD1 . TYR A 1 213 ? 90.221  190.167 128.406 1.00 18.69 ? 283 TYR A CD1 1 
ATOM 1582 C CD2 . TYR A 1 213 ? 88.808  188.405 129.289 1.00 18.10 ? 283 TYR A CD2 1 
ATOM 1583 C CE1 . TYR A 1 213 ? 90.210  189.546 127.152 1.00 18.48 ? 283 TYR A CE1 1 
ATOM 1584 C CE2 . TYR A 1 213 ? 88.796  187.788 128.037 1.00 19.03 ? 283 TYR A CE2 1 
ATOM 1585 C CZ  . TYR A 1 213 ? 89.495  188.359 126.968 1.00 19.08 ? 283 TYR A CZ  1 
ATOM 1586 O OH  . TYR A 1 213 ? 89.474  187.758 125.751 1.00 21.61 ? 283 TYR A OH  1 
ATOM 1587 N N   . LYS A 1 214 ? 90.433  192.834 130.480 1.00 18.06 ? 284 LYS A N   1 
ATOM 1588 C CA  . LYS A 1 214 ? 91.182  193.968 129.912 1.00 19.01 ? 284 LYS A CA  1 
ATOM 1589 C C   . LYS A 1 214 ? 91.864  193.565 128.607 1.00 18.85 ? 284 LYS A C   1 
ATOM 1590 O O   . LYS A 1 214 ? 92.217  192.389 128.402 1.00 18.16 ? 284 LYS A O   1 
ATOM 1591 C CB  . LYS A 1 214 ? 92.275  194.425 130.892 1.00 20.13 ? 284 LYS A CB  1 
ATOM 1592 C CG  . LYS A 1 214 ? 93.265  193.319 131.293 1.00 23.13 ? 284 LYS A CG  1 
ATOM 1593 C CD  . LYS A 1 214 ? 94.306  193.807 132.309 1.00 28.56 ? 284 LYS A CD  1 
ATOM 1594 C CE  . LYS A 1 214 ? 95.289  192.721 132.752 1.00 29.80 ? 284 LYS A CE  1 
ATOM 1595 N NZ  . LYS A 1 214 ? 96.268  193.204 133.739 1.00 32.68 ? 284 LYS A NZ  1 
ATOM 1596 N N   . PRO A 1 215 ? 92.076  194.487 127.642 1.00 18.76 ? 285 PRO A N   1 
ATOM 1597 C CA  . PRO A 1 215 ? 92.816  194.116 126.477 1.00 18.32 ? 285 PRO A CA  1 
ATOM 1598 C C   . PRO A 1 215 ? 94.068  193.569 127.087 1.00 16.82 ? 285 PRO A C   1 
ATOM 1599 O O   . PRO A 1 215 ? 94.853  194.354 127.697 1.00 16.65 ? 285 PRO A O   1 
ATOM 1600 C CB  . PRO A 1 215 ? 92.852  195.401 125.662 1.00 18.26 ? 285 PRO A CB  1 
ATOM 1601 C CG  . PRO A 1 215 ? 92.088  196.468 126.440 1.00 20.16 ? 285 PRO A CG  1 
ATOM 1602 C CD  . PRO A 1 215 ? 91.617  195.871 127.728 1.00 19.43 ? 285 PRO A CD  1 
ATOM 1603 N N   . GLY A 1 216 ? 94.203  192.250 127.010 1.00 16.93 ? 286 GLY A N   1 
ATOM 1604 C CA  . GLY A 1 216 ? 95.299  191.541 127.703 1.00 17.00 ? 286 GLY A CA  1 
ATOM 1605 C C   . GLY A 1 216 ? 96.395  191.042 126.755 1.00 16.23 ? 286 GLY A C   1 
ATOM 1606 O O   . GLY A 1 216 ? 96.852  191.768 125.863 1.00 15.72 ? 286 GLY A O   1 
ATOM 1607 N N   . ASP A 1 217 ? 96.758  189.784 127.007 1.00 17.51 ? 287 ASP A N   1 
ATOM 1608 C CA  . ASP A 1 217 ? 97.783  189.044 126.234 1.00 18.06 ? 287 ASP A CA  1 
ATOM 1609 C C   . ASP A 1 217 ? 97.480  187.540 126.307 1.00 17.12 ? 287 ASP A C   1 
ATOM 1610 O O   . ASP A 1 217 ? 96.895  187.061 127.298 1.00 16.46 ? 287 ASP A O   1 
ATOM 1611 C CB  . ASP A 1 217 ? 99.169  189.322 126.816 1.00 18.83 ? 287 ASP A CB  1 
ATOM 1612 C CG  . ASP A 1 217 ? 99.706  190.707 126.445 1.00 22.59 ? 287 ASP A CG  1 
ATOM 1613 O OD1 . ASP A 1 217 ? 100.485 190.846 125.426 1.00 24.25 ? 287 ASP A OD1 1 
ATOM 1614 O OD2 . ASP A 1 217 ? 99.382  191.736 127.152 1.00 28.76 ? 287 ASP A OD2 1 
ATOM 1615 N N   . LEU A 1 218 ? 97.901  186.803 125.255 1.00 15.77 ? 288 LEU A N   1 
ATOM 1616 C CA  . LEU A 1 218 ? 97.565  185.362 125.163 1.00 16.24 ? 288 LEU A CA  1 
ATOM 1617 C C   . LEU A 1 218 ? 98.673  184.293 125.244 1.00 16.33 ? 288 LEU A C   1 
ATOM 1618 O O   . LEU A 1 218 ? 99.406  184.204 126.239 1.00 16.76 ? 288 LEU A O   1 
ATOM 1619 C CB  . LEU A 1 218 ? 96.959  184.880 123.888 1.00 16.16 ? 288 LEU A CB  1 
ATOM 1620 C CG  . LEU A 1 218 ? 97.037  183.350 123.899 1.00 17.22 ? 288 LEU A CG  1 
ATOM 1621 C CD1 . LEU A 1 218 ? 95.681  182.680 124.087 1.00 17.08 ? 288 LEU A CD1 1 
ATOM 1622 C CD2 . LEU A 1 218 ? 97.646  182.765 122.636 1.00 17.19 ? 288 LEU A CD2 1 
ATOM 1623 N N   . VAL A 1 219 ? 98.792  183.446 124.146 1.00 16.10 ? 289 VAL A N   1 
ATOM 1624 C CA  . VAL A 1 219 ? 99.529  182.188 124.377 1.00 16.29 ? 289 VAL A CA  1 
ATOM 1625 C C   . VAL A 1 219 ? 100.429 181.364 123.349 1.00 15.29 ? 289 VAL A C   1 
ATOM 1626 O O   . VAL A 1 219 ? 101.650 181.307 123.489 1.00 15.43 ? 289 VAL A O   1 
ATOM 1627 C CB  . VAL A 1 219 ? 98.513  181.162 124.857 1.00 16.70 ? 289 VAL A CB  1 
ATOM 1628 C CG1 . VAL A 1 219 ? 99.132  180.049 125.687 1.00 19.12 ? 289 VAL A CG1 1 
ATOM 1629 C CG2 . VAL A 1 219 ? 97.431  181.799 125.744 1.00 18.27 ? 289 VAL A CG2 1 
ATOM 1630 N N   . SER A 1 220 ? 99.899  180.589 122.382 1.00 13.27 ? 290 SER A N   1 
ATOM 1631 C CA  . SER A 1 220 ? 100.777 179.696 121.497 1.00 12.79 ? 290 SER A CA  1 
ATOM 1632 C C   . SER A 1 220 ? 100.169 179.629 120.097 1.00 11.77 ? 290 SER A C   1 
ATOM 1633 O O   . SER A 1 220 ? 99.032  180.051 119.894 1.00 10.46 ? 290 SER A O   1 
ATOM 1634 C CB  . SER A 1 220 ? 100.812 178.286 122.086 1.00 11.90 ? 290 SER A CB  1 
ATOM 1635 O OG  . SER A 1 220 ? 99.485  177.795 122.239 1.00 14.01 ? 290 SER A OG  1 
ATOM 1636 N N   . TYR A 1 221 ? 100.909 179.061 119.177 1.00 12.62 ? 291 TYR A N   1 
ATOM 1637 C CA  . TYR A 1 221 ? 100.403 178.753 117.831 1.00 12.83 ? 291 TYR A CA  1 
ATOM 1638 C C   . TYR A 1 221 ? 100.958 177.412 117.421 1.00 13.15 ? 291 TYR A C   1 
ATOM 1639 O O   . TYR A 1 221 ? 101.946 176.903 117.991 1.00 13.01 ? 291 TYR A O   1 
ATOM 1640 C CB  . TYR A 1 221 ? 100.788 179.839 116.817 1.00 13.12 ? 291 TYR A CB  1 
ATOM 1641 C CG  . TYR A 1 221 ? 102.221 180.263 116.892 1.00 16.42 ? 291 TYR A CG  1 
ATOM 1642 C CD1 . TYR A 1 221 ? 102.604 181.222 117.817 1.00 21.75 ? 291 TYR A CD1 1 
ATOM 1643 C CD2 . TYR A 1 221 ? 103.198 179.700 116.085 1.00 22.33 ? 291 TYR A CD2 1 
ATOM 1644 C CE1 . TYR A 1 221 ? 103.914 181.614 117.943 1.00 24.37 ? 291 TYR A CE1 1 
ATOM 1645 C CE2 . TYR A 1 221 ? 104.535 180.114 116.200 1.00 22.38 ? 291 TYR A CE2 1 
ATOM 1646 C CZ  . TYR A 1 221 ? 104.867 181.063 117.148 1.00 24.27 ? 291 TYR A CZ  1 
ATOM 1647 O OH  . TYR A 1 221 ? 106.163 181.511 117.338 1.00 29.71 ? 291 TYR A OH  1 
ATOM 1648 N N   . GLN A 1 222 ? 100.311 176.786 116.445 1.00 11.78 ? 292 GLN A N   1 
ATOM 1649 C CA  . GLN A 1 222 ? 100.680 175.449 116.091 1.00 11.70 ? 292 GLN A CA  1 
ATOM 1650 C C   . GLN A 1 222 ? 100.434 175.193 114.617 1.00 11.54 ? 292 GLN A C   1 
ATOM 1651 O O   . GLN A 1 222 ? 99.602  175.853 113.988 1.00 11.61 ? 292 GLN A O   1 
ATOM 1652 C CB  . GLN A 1 222 ? 99.901  174.458 116.935 1.00 12.67 ? 292 GLN A CB  1 
ATOM 1653 C CG  . GLN A 1 222 ? 98.411  174.471 116.778 1.00 12.52 ? 292 GLN A CG  1 
ATOM 1654 C CD  . GLN A 1 222 ? 97.717  173.671 117.855 1.00 15.64 ? 292 GLN A CD  1 
ATOM 1655 O OE1 . GLN A 1 222 ? 97.773  174.050 119.036 1.00 13.61 ? 292 GLN A OE1 1 
ATOM 1656 N NE2 . GLN A 1 222 ? 97.093  172.536 117.477 1.00 15.43 ? 292 GLN A NE2 1 
ATOM 1657 N N   . ILE A 1 223 ? 101.183 174.249 114.097 1.00 11.44 ? 293 ILE A N   1 
ATOM 1658 C CA  . ILE A 1 223 ? 100.959 173.686 112.772 1.00 11.94 ? 293 ILE A CA  1 
ATOM 1659 C C   . ILE A 1 223 ? 100.472 172.253 113.013 1.00 12.18 ? 293 ILE A C   1 
ATOM 1660 O O   . ILE A 1 223 ? 101.185 171.427 113.606 1.00 13.18 ? 293 ILE A O   1 
ATOM 1661 C CB  . ILE A 1 223 ? 102.219 173.677 111.972 1.00 12.21 ? 293 ILE A CB  1 
ATOM 1662 C CG1 . ILE A 1 223 ? 102.735 175.108 111.756 1.00 13.67 ? 293 ILE A CG1 1 
ATOM 1663 C CG2 . ILE A 1 223 ? 101.994 173.031 110.616 1.00 11.91 ? 293 ILE A CG2 1 
ATOM 1664 C CD1 . ILE A 1 223 ? 104.130 175.112 111.146 1.00 13.61 ? 293 ILE A CD1 1 
ATOM 1665 N N   . ASN A 1 224 ? 99.259  171.982 112.570 1.00 12.32 ? 294 ASN A N   1 
ATOM 1666 C CA  . ASN A 1 224 ? 98.686  170.630 112.641 1.00 12.77 ? 294 ASN A CA  1 
ATOM 1667 C C   . ASN A 1 224 ? 99.225  169.726 111.507 1.00 13.14 ? 294 ASN A C   1 
ATOM 1668 O O   . ASN A 1 224 ? 99.910  170.196 110.612 1.00 13.52 ? 294 ASN A O   1 
ATOM 1669 C CB  . ASN A 1 224 ? 97.165  170.747 112.604 1.00 12.37 ? 294 ASN A CB  1 
ATOM 1670 C CG  . ASN A 1 224 ? 96.600  171.438 113.837 1.00 13.46 ? 294 ASN A CG  1 
ATOM 1671 O OD1 . ASN A 1 224 ? 97.208  171.383 114.890 1.00 14.82 ? 294 ASN A OD1 1 
ATOM 1672 N ND2 . ASN A 1 224 ? 95.425  172.061 113.714 1.00 13.33 ? 294 ASN A ND2 1 
ATOM 1673 N N   . ASN A 1 225 ? 98.948  168.432 111.560 1.00 13.34 ? 295 ASN A N   1 
ATOM 1674 C CA  . ASN A 1 225 ? 99.561  167.507 110.598 1.00 14.08 ? 295 ASN A CA  1 
ATOM 1675 C C   . ASN A 1 225 ? 98.955  167.562 109.181 1.00 13.69 ? 295 ASN A C   1 
ATOM 1676 O O   . ASN A 1 225 ? 99.492  166.928 108.270 1.00 14.17 ? 295 ASN A O   1 
ATOM 1677 C CB  . ASN A 1 225 ? 99.653  166.075 111.155 1.00 13.98 ? 295 ASN A CB  1 
ATOM 1678 C CG  . ASN A 1 225 ? 98.297  165.407 111.291 1.00 16.07 ? 295 ASN A CG  1 
ATOM 1679 O OD1 . ASN A 1 225 ? 97.355  165.682 110.534 1.00 18.96 ? 295 ASN A OD1 1 
ATOM 1680 N ND2 . ASN A 1 225 ? 98.186  164.514 112.289 1.00 20.58 ? 295 ASN A ND2 1 
ATOM 1681 N N   . ASP A 1 226 ? 97.878  168.314 109.014 1.00 13.80 ? 296 ASP A N   1 
ATOM 1682 C CA  . ASP A 1 226 ? 97.323  168.687 107.694 1.00 14.17 ? 296 ASP A CA  1 
ATOM 1683 C C   . ASP A 1 226 ? 97.745  170.111 107.285 1.00 14.80 ? 296 ASP A C   1 
ATOM 1684 O O   . ASP A 1 226 ? 97.168  170.692 106.357 1.00 14.21 ? 296 ASP A O   1 
ATOM 1685 C CB  . ASP A 1 226 ? 95.793  168.589 107.696 1.00 14.66 ? 296 ASP A CB  1 
ATOM 1686 C CG  . ASP A 1 226 ? 95.123  169.584 108.659 1.00 16.10 ? 296 ASP A CG  1 
ATOM 1687 O OD1 . ASP A 1 226 ? 95.840  170.378 109.353 1.00 14.47 ? 296 ASP A OD1 1 
ATOM 1688 O OD2 . ASP A 1 226 ? 93.872  169.624 108.811 1.00 20.99 ? 296 ASP A OD2 1 
ATOM 1689 N N   . GLY A 1 227 ? 98.720  170.670 108.006 1.00 14.63 ? 297 GLY A N   1 
ATOM 1690 C CA  . GLY A 1 227 ? 99.267  171.982 107.694 1.00 14.37 ? 297 GLY A CA  1 
ATOM 1691 C C   . GLY A 1 227 ? 98.431  173.197 108.115 1.00 14.19 ? 297 GLY A C   1 
ATOM 1692 O O   . GLY A 1 227 ? 98.795  174.350 107.815 1.00 14.19 ? 297 GLY A O   1 
ATOM 1693 N N   . THR A 1 228 ? 97.270  172.974 108.730 1.00 13.19 ? 298 THR A N   1 
ATOM 1694 C CA  . THR A 1 228 ? 96.498  174.074 109.267 1.00 13.97 ? 298 THR A CA  1 
ATOM 1695 C C   . THR A 1 228 ? 97.256  174.759 110.380 1.00 13.46 ? 298 THR A C   1 
ATOM 1696 O O   . THR A 1 228 ? 97.867  174.111 111.223 1.00 13.00 ? 298 THR A O   1 
ATOM 1697 C CB  . THR A 1 228 ? 95.123  173.648 109.759 1.00 14.54 ? 298 THR A CB  1 
ATOM 1698 O OG1 . THR A 1 228 ? 95.226  172.602 110.728 1.00 20.19 ? 298 THR A OG1 1 
ATOM 1699 C CG2 . THR A 1 228 ? 94.330  173.055 108.626 1.00 12.99 ? 298 THR A CG2 1 
ATOM 1700 N N   . VAL A 1 229 ? 97.231  176.078 110.362 1.00 13.32 ? 299 VAL A N   1 
ATOM 1701 C CA  . VAL A 1 229 ? 97.941  176.888 111.337 1.00 12.27 ? 299 VAL A CA  1 
ATOM 1702 C C   . VAL A 1 229 ? 96.887  177.522 112.244 1.00 11.75 ? 299 VAL A C   1 
ATOM 1703 O O   . VAL A 1 229 ? 95.945  178.179 111.767 1.00 11.07 ? 299 VAL A O   1 
ATOM 1704 C CB  . VAL A 1 229 ? 98.768  177.986 110.640 1.00 13.70 ? 299 VAL A CB  1 
ATOM 1705 C CG1 . VAL A 1 229 ? 99.546  178.801 111.646 1.00 12.71 ? 299 VAL A CG1 1 
ATOM 1706 C CG2 . VAL A 1 229 ? 99.706  177.378 109.587 1.00 12.81 ? 299 VAL A CG2 1 
ATOM 1707 N N   . VAL A 1 230 ? 97.013  177.292 113.549 1.00 11.59 ? 300 VAL A N   1 
ATOM 1708 C CA  . VAL A 1 230 ? 96.020  177.714 114.545 1.00 11.42 ? 300 VAL A CA  1 
ATOM 1709 C C   . VAL A 1 230 ? 96.684  178.504 115.689 1.00 10.88 ? 300 VAL A C   1 
ATOM 1710 O O   . VAL A 1 230 ? 97.766  178.145 116.160 1.00 10.93 ? 300 VAL A O   1 
ATOM 1711 C CB  . VAL A 1 230 ? 95.306  176.462 115.101 1.00 11.81 ? 300 VAL A CB  1 
ATOM 1712 C CG1 . VAL A 1 230 ? 94.390  176.780 116.246 1.00 14.73 ? 300 VAL A CG1 1 
ATOM 1713 C CG2 . VAL A 1 230 ? 94.561  175.802 114.004 1.00 13.94 ? 300 VAL A CG2 1 
ATOM 1714 N N   . GLY A 1 231 ? 96.064  179.615 116.052 1.00 10.25 ? 301 GLY A N   1 
ATOM 1715 C CA  . GLY A 1 231 ? 96.426  180.357 117.248 1.00 10.73 ? 301 GLY A CA  1 
ATOM 1716 C C   . GLY A 1 231 ? 95.561  179.970 118.438 1.00 10.83 ? 301 GLY A C   1 
ATOM 1717 O O   . GLY A 1 231 ? 94.342  179.758 118.302 1.00 10.65 ? 301 GLY A O   1 
ATOM 1718 N N   . ASN A 1 232 ? 96.194  179.947 119.605 1.00 11.39 ? 302 ASN A N   1 
ATOM 1719 C CA  . ASN A 1 232 ? 95.568  179.572 120.863 1.00 12.08 ? 302 ASN A CA  1 
ATOM 1720 C C   . ASN A 1 232 ? 95.602  180.828 121.746 1.00 12.83 ? 302 ASN A C   1 
ATOM 1721 O O   . ASN A 1 232 ? 96.656  181.455 121.884 1.00 14.13 ? 302 ASN A O   1 
ATOM 1722 C CB  . ASN A 1 232 ? 96.315  178.409 121.505 1.00 12.33 ? 302 ASN A CB  1 
ATOM 1723 C CG  . ASN A 1 232 ? 96.395  177.193 120.566 1.00 12.79 ? 302 ASN A CG  1 
ATOM 1724 O OD1 . ASN A 1 232 ? 95.377  176.732 120.087 1.00 15.31 ? 302 ASN A OD1 1 
ATOM 1725 N ND2 . ASN A 1 232 ? 97.574  176.693 120.339 1.00 10.88 ? 302 ASN A ND2 1 
ATOM 1726 N N   . TYR A 1 233 ? 94.459  181.205 122.292 1.00 12.49 ? 303 TYR A N   1 
ATOM 1727 C CA  . TYR A 1 233 ? 94.345  182.478 123.012 1.00 13.33 ? 303 TYR A CA  1 
ATOM 1728 C C   . TYR A 1 233 ? 93.921  182.310 124.461 1.00 14.35 ? 303 TYR A C   1 
ATOM 1729 O O   . TYR A 1 233 ? 93.347  181.282 124.874 1.00 14.66 ? 303 TYR A O   1 
ATOM 1730 C CB  . TYR A 1 233 ? 93.449  183.503 122.261 1.00 12.54 ? 303 TYR A CB  1 
ATOM 1731 C CG  . TYR A 1 233 ? 93.898  183.772 120.816 1.00 12.75 ? 303 TYR A CG  1 
ATOM 1732 C CD1 . TYR A 1 233 ? 93.671  182.842 119.801 1.00 12.88 ? 303 TYR A CD1 1 
ATOM 1733 C CD2 . TYR A 1 233 ? 94.575  184.944 120.478 1.00 12.14 ? 303 TYR A CD2 1 
ATOM 1734 C CE1 . TYR A 1 233 ? 94.092  183.070 118.511 1.00 12.84 ? 303 TYR A CE1 1 
ATOM 1735 C CE2 . TYR A 1 233 ? 94.973  185.199 119.175 1.00 12.03 ? 303 TYR A CE2 1 
ATOM 1736 C CZ  . TYR A 1 233 ? 94.754  184.252 118.198 1.00 11.67 ? 303 TYR A CZ  1 
ATOM 1737 O OH  . TYR A 1 233 ? 95.191  184.494 116.897 1.00 11.99 ? 303 TYR A OH  1 
ATOM 1738 N N   . SER A 1 234 ? 94.208  183.350 125.231 1.00 14.75 ? 304 SER A N   1 
ATOM 1739 C CA  . SER A 1 234 ? 94.088  183.304 126.692 1.00 15.98 ? 304 SER A CA  1 
ATOM 1740 C C   . SER A 1 234 ? 92.639  183.337 127.191 1.00 16.29 ? 304 SER A C   1 
ATOM 1741 O O   . SER A 1 234 ? 92.378  183.186 128.394 1.00 16.56 ? 304 SER A O   1 
ATOM 1742 C CB  . SER A 1 234 ? 94.860  184.494 127.266 1.00 16.48 ? 304 SER A CB  1 
ATOM 1743 O OG  . SER A 1 234 ? 94.193  185.691 126.972 1.00 16.58 ? 304 SER A OG  1 
ATOM 1744 N N   . ASN A 1 235 ? 91.708  183.559 126.280 1.00 15.87 ? 305 ASN A N   1 
ATOM 1745 C CA  . ASN A 1 235 ? 90.276  183.381 126.532 1.00 16.74 ? 305 ASN A CA  1 
ATOM 1746 C C   . ASN A 1 235 ? 89.747  181.955 126.321 1.00 16.98 ? 305 ASN A C   1 
ATOM 1747 O O   . ASN A 1 235 ? 88.547  181.757 126.206 1.00 17.11 ? 305 ASN A O   1 
ATOM 1748 C CB  . ASN A 1 235 ? 89.497  184.339 125.644 1.00 16.60 ? 305 ASN A CB  1 
ATOM 1749 C CG  . ASN A 1 235 ? 89.732  184.075 124.170 1.00 15.98 ? 305 ASN A CG  1 
ATOM 1750 O OD1 . ASN A 1 235 ? 90.433  183.134 123.816 1.00 15.94 ? 305 ASN A OD1 1 
ATOM 1751 N ND2 . ASN A 1 235 ? 89.169  184.903 123.318 1.00 16.41 ? 305 ASN A ND2 1 
ATOM 1752 N N   . GLU A 1 236 ? 90.658  180.994 126.205 1.00 17.54 ? 306 GLU A N   1 
ATOM 1753 C CA  . GLU A 1 236 ? 90.370  179.574 125.958 1.00 19.04 ? 306 GLU A CA  1 
ATOM 1754 C C   . GLU A 1 236 ? 89.681  179.300 124.619 1.00 17.99 ? 306 GLU A C   1 
ATOM 1755 O O   . GLU A 1 236 ? 88.946  178.308 124.452 1.00 16.81 ? 306 GLU A O   1 
ATOM 1756 C CB  . GLU A 1 236 ? 89.620  178.938 127.147 1.00 20.35 ? 306 GLU A CB  1 
ATOM 1757 C CG  . GLU A 1 236 ? 90.340  179.127 128.469 1.00 24.95 ? 306 GLU A CG  1 
ATOM 1758 C CD  . GLU A 1 236 ? 91.790  178.697 128.407 1.00 31.65 ? 306 GLU A CD  1 
ATOM 1759 O OE1 . GLU A 1 236 ? 92.076  177.482 128.590 1.00 39.78 ? 306 GLU A OE1 1 
ATOM 1760 O OE2 . GLU A 1 236 ? 92.665  179.563 128.173 1.00 38.65 ? 306 GLU A OE2 1 
ATOM 1761 N N   . GLN A 1 237 ? 89.941  180.191 123.660 1.00 16.77 ? 307 GLN A N   1 
ATOM 1762 C CA  . GLN A 1 237 ? 89.422  180.043 122.310 1.00 16.53 ? 307 GLN A CA  1 
ATOM 1763 C C   . GLN A 1 237 ? 90.595  179.946 121.344 1.00 15.57 ? 307 GLN A C   1 
ATOM 1764 O O   . GLN A 1 237 ? 91.749  180.259 121.695 1.00 14.30 ? 307 GLN A O   1 
ATOM 1765 C CB  . GLN A 1 237 ? 88.504  181.218 121.908 1.00 16.52 ? 307 GLN A CB  1 
ATOM 1766 C CG  . GLN A 1 237 ? 87.407  181.584 122.897 1.00 18.63 ? 307 GLN A CG  1 
ATOM 1767 C CD  . GLN A 1 237 ? 86.370  180.479 123.068 1.00 21.03 ? 307 GLN A CD  1 
ATOM 1768 O OE1 . GLN A 1 237 ? 86.070  179.744 122.123 1.00 22.20 ? 307 GLN A OE1 1 
ATOM 1769 N NE2 . GLN A 1 237 ? 85.819  180.372 124.266 1.00 22.17 ? 307 GLN A NE2 1 
ATOM 1770 N N   . GLU A 1 238 ? 90.293  179.498 120.126 1.00 15.57 ? 308 GLU A N   1 
ATOM 1771 C CA  . GLU A 1 238 ? 91.289  179.320 119.081 1.00 16.22 ? 308 GLU A CA  1 
ATOM 1772 C C   . GLU A 1 238 ? 90.806  179.986 117.799 1.00 16.41 ? 308 GLU A C   1 
ATOM 1773 O O   . GLU A 1 238 ? 89.616  180.214 117.625 1.00 16.03 ? 308 GLU A O   1 
ATOM 1774 C CB  . GLU A 1 238 ? 91.563  177.824 118.814 1.00 16.70 ? 308 GLU A CB  1 
ATOM 1775 C CG  . GLU A 1 238 ? 92.095  177.060 120.037 1.00 19.18 ? 308 GLU A CG  1 
ATOM 1776 C CD  . GLU A 1 238 ? 91.032  176.827 121.127 1.00 21.35 ? 308 GLU A CD  1 
ATOM 1777 O OE1 . GLU A 1 238 ? 89.899  176.392 120.808 1.00 23.41 ? 308 GLU A OE1 1 
ATOM 1778 O OE2 . GLU A 1 238 ? 91.304  177.103 122.318 1.00 25.14 ? 308 GLU A OE2 1 
ATOM 1779 N N   . GLN A 1 239 ? 91.750  180.313 116.913 1.00 16.42 ? 309 GLN A N   1 
ATOM 1780 C CA  . GLN A 1 239 ? 91.443  180.871 115.594 1.00 16.91 ? 309 GLN A CA  1 
ATOM 1781 C C   . GLN A 1 239 ? 92.328  180.181 114.570 1.00 15.50 ? 309 GLN A C   1 
ATOM 1782 O O   . GLN A 1 239 ? 93.554  180.131 114.747 1.00 15.03 ? 309 GLN A O   1 
ATOM 1783 C CB  . GLN A 1 239 ? 91.768  182.373 115.503 1.00 17.59 ? 309 GLN A CB  1 
ATOM 1784 C CG  . GLN A 1 239 ? 90.817  183.288 116.193 1.00 21.72 ? 309 GLN A CG  1 
ATOM 1785 C CD  . GLN A 1 239 ? 91.128  184.776 115.968 1.00 24.44 ? 309 GLN A CD  1 
ATOM 1786 O OE1 . GLN A 1 239 ? 92.296  185.216 116.006 1.00 26.28 ? 309 GLN A OE1 1 
ATOM 1787 N NE2 . GLN A 1 239 ? 90.090  185.549 115.763 1.00 24.12 ? 309 GLN A NE2 1 
ATOM 1788 N N   . VAL A 1 240 ? 91.739  179.713 113.481 1.00 13.80 ? 310 VAL A N   1 
ATOM 1789 C CA  . VAL A 1 240 ? 92.516  179.286 112.321 1.00 13.65 ? 310 VAL A CA  1 
ATOM 1790 C C   . VAL A 1 240 ? 93.136  180.492 111.635 1.00 12.84 ? 310 VAL A C   1 
ATOM 1791 O O   . VAL A 1 240 ? 92.464  181.500 111.424 1.00 12.12 ? 310 VAL A O   1 
ATOM 1792 C CB  . VAL A 1 240 ? 91.703  178.467 111.302 1.00 14.35 ? 310 VAL A CB  1 
ATOM 1793 C CG1 . VAL A 1 240 ? 90.726  179.315 110.604 1.00 19.11 ? 310 VAL A CG1 1 
ATOM 1794 C CG2 . VAL A 1 240 ? 92.630  177.887 110.264 1.00 15.63 ? 310 VAL A CG2 1 
ATOM 1795 N N   . LEU A 1 241 ? 94.424  180.387 111.297 1.00 11.49 ? 311 LEU A N   1 
ATOM 1796 C CA  . LEU A 1 241 ? 95.183  181.496 110.726 1.00 11.66 ? 311 LEU A CA  1 
ATOM 1797 C C   . LEU A 1 241 ? 95.612  181.296 109.268 1.00 12.32 ? 311 LEU A C   1 
ATOM 1798 O O   . LEU A 1 241 ? 96.056  182.238 108.619 1.00 12.18 ? 311 LEU A O   1 
ATOM 1799 C CB  . LEU A 1 241 ? 96.433  181.751 111.569 1.00 12.04 ? 311 LEU A CB  1 
ATOM 1800 C CG  . LEU A 1 241 ? 96.175  181.986 113.063 1.00 11.94 ? 311 LEU A CG  1 
ATOM 1801 C CD1 . LEU A 1 241 ? 97.491  182.061 113.876 1.00 10.88 ? 311 LEU A CD1 1 
ATOM 1802 C CD2 . LEU A 1 241 ? 95.368  183.302 113.201 1.00 13.42 ? 311 LEU A CD2 1 
ATOM 1803 N N   . GLY A 1 242 ? 95.520  180.063 108.780 1.00 12.12 ? 312 GLY A N   1 
ATOM 1804 C CA  . GLY A 1 242 ? 95.930  179.727 107.432 1.00 12.30 ? 312 GLY A CA  1 
ATOM 1805 C C   . GLY A 1 242 ? 96.154  178.249 107.313 1.00 12.75 ? 312 GLY A C   1 
ATOM 1806 O O   . GLY A 1 242 ? 95.941  177.520 108.258 1.00 11.74 ? 312 GLY A O   1 
ATOM 1807 N N   . GLN A 1 243 ? 96.547  177.785 106.132 1.00 12.96 ? 313 GLN A N   1 
ATOM 1808 C CA  . GLN A 1 243 ? 96.865  176.368 105.923 1.00 13.02 ? 313 GLN A CA  1 
ATOM 1809 C C   . GLN A 1 243 ? 97.956  176.240 104.886 1.00 13.67 ? 313 GLN A C   1 
ATOM 1810 O O   . GLN A 1 243 ? 97.788  176.684 103.738 1.00 11.59 ? 313 GLN A O   1 
ATOM 1811 C CB  . GLN A 1 243 ? 95.633  175.538 105.517 1.00 13.98 ? 313 GLN A CB  1 
ATOM 1812 C CG  . GLN A 1 243 ? 95.934  174.065 105.212 1.00 14.47 ? 313 GLN A CG  1 
ATOM 1813 C CD  . GLN A 1 243 ? 94.689  173.218 104.963 1.00 16.14 ? 313 GLN A CD  1 
ATOM 1814 O OE1 . GLN A 1 243 ? 93.690  173.715 104.494 1.00 18.66 ? 313 GLN A OE1 1 
ATOM 1815 N NE2 . GLN A 1 243 ? 94.779  171.943 105.259 1.00 15.64 ? 313 GLN A NE2 1 
ATOM 1816 N N   . ILE A 1 244 ? 99.061  175.633 105.287 1.00 14.28 ? 314 ILE A N   1 
ATOM 1817 C CA  . ILE A 1 244 ? 100.248 175.486 104.474 1.00 15.42 ? 314 ILE A CA  1 
ATOM 1818 C C   . ILE A 1 244 ? 99.863  174.649 103.246 1.00 16.28 ? 314 ILE A C   1 
ATOM 1819 O O   . ILE A 1 244 ? 99.096  173.684 103.359 1.00 15.99 ? 314 ILE A O   1 
ATOM 1820 C CB  . ILE A 1 244 ? 101.346 174.776 105.266 1.00 16.59 ? 314 ILE A CB  1 
ATOM 1821 C CG1 . ILE A 1 244 ? 101.819 175.647 106.428 1.00 17.77 ? 314 ILE A CG1 1 
ATOM 1822 C CG2 . ILE A 1 244 ? 102.504 174.375 104.384 1.00 17.71 ? 314 ILE A CG2 1 
ATOM 1823 C CD1 . ILE A 1 244 ? 102.577 174.863 107.494 1.00 18.78 ? 314 ILE A CD1 1 
ATOM 1824 N N   . VAL A 1 245 ? 100.381 175.043 102.096 1.00 15.26 ? 315 VAL A N   1 
ATOM 1825 C CA  . VAL A 1 245 ? 100.159 174.265 100.859 1.00 16.62 ? 315 VAL A CA  1 
ATOM 1826 C C   . VAL A 1 245 ? 101.363 173.466 100.530 1.00 16.70 ? 315 VAL A C   1 
ATOM 1827 O O   . VAL A 1 245 ? 102.492 173.900 100.769 1.00 18.25 ? 315 VAL A O   1 
ATOM 1828 C CB  . VAL A 1 245 ? 99.828  175.137 99.628  1.00 16.97 ? 315 VAL A CB  1 
ATOM 1829 C CG1 . VAL A 1 245 ? 98.478  175.673 99.751  1.00 19.79 ? 315 VAL A CG1 1 
ATOM 1830 C CG2 . VAL A 1 245 ? 100.857 176.261 99.384  1.00 17.01 ? 315 VAL A CG2 1 
ATOM 1831 N N   . LEU A 1 246 ? 101.145 172.288 99.956  1.00 16.08 ? 316 LEU A N   1 
ATOM 1832 C CA  . LEU A 1 246 ? 102.222 171.502 99.400  1.00 14.94 ? 316 LEU A CA  1 
ATOM 1833 C C   . LEU A 1 246 ? 102.126 171.490 97.874  1.00 14.98 ? 316 LEU A C   1 
ATOM 1834 O O   . LEU A 1 246 ? 101.044 171.703 97.317  1.00 15.13 ? 316 LEU A O   1 
ATOM 1835 C CB  . LEU A 1 246 ? 102.224 170.086 99.943  1.00 15.59 ? 316 LEU A CB  1 
ATOM 1836 C CG  . LEU A 1 246 ? 102.435 169.949 101.448 1.00 14.56 ? 316 LEU A CG  1 
ATOM 1837 C CD1 . LEU A 1 246 ? 102.401 168.484 101.818 1.00 16.00 ? 316 LEU A CD1 1 
ATOM 1838 C CD2 . LEU A 1 246 ? 103.739 170.581 101.863 1.00 16.86 ? 316 LEU A CD2 1 
ATOM 1839 N N   . ALA A 1 247 ? 103.270 171.252 97.234  1.00 15.42 ? 317 ALA A N   1 
ATOM 1840 C CA  . ALA A 1 247 ? 103.350 171.153 95.774  1.00 16.16 ? 317 ALA A CA  1 
ATOM 1841 C C   . ALA A 1 247 ? 104.031 169.873 95.339  1.00 16.24 ? 317 ALA A C   1 
ATOM 1842 O O   . ALA A 1 247 ? 104.931 169.375 95.971  1.00 15.72 ? 317 ALA A O   1 
ATOM 1843 C CB  . ALA A 1 247 ? 104.113 172.342 95.200  1.00 16.89 ? 317 ALA A CB  1 
ATOM 1844 N N   . ASN A 1 248 ? 103.634 169.392 94.169  1.00 17.74 ? 318 ASN A N   1 
ATOM 1845 C CA  . ASN A 1 248 ? 104.226 168.206 93.574  1.00 19.09 ? 318 ASN A CA  1 
ATOM 1846 C C   . ASN A 1 248 ? 104.484 168.533 92.120  1.00 18.69 ? 318 ASN A C   1 
ATOM 1847 O O   . ASN A 1 248 ? 103.775 169.338 91.559  1.00 16.64 ? 318 ASN A O   1 
ATOM 1848 C CB  . ASN A 1 248 ? 103.248 167.025 93.664  1.00 20.63 ? 318 ASN A CB  1 
ATOM 1849 C CG  . ASN A 1 248 ? 103.689 165.957 94.678  1.00 25.80 ? 318 ASN A CG  1 
ATOM 1850 O OD1 . ASN A 1 248 ? 102.850 165.269 95.264  1.00 36.30 ? 318 ASN A OD1 1 
ATOM 1851 N ND2 . ASN A 1 248 ? 104.988 165.826 94.895  1.00 32.06 ? 318 ASN A ND2 1 
ATOM 1852 N N   . PHE A 1 249 ? 105.473 167.883 91.507  1.00 19.33 ? 319 PHE A N   1 
ATOM 1853 C CA  . PHE A 1 249 ? 105.755 168.081 90.083  1.00 19.52 ? 319 PHE A CA  1 
ATOM 1854 C C   . PHE A 1 249 ? 105.709 166.740 89.322  1.00 20.91 ? 319 PHE A C   1 
ATOM 1855 O O   . PHE A 1 249 ? 105.988 165.713 89.899  1.00 20.84 ? 319 PHE A O   1 
ATOM 1856 C CB  . PHE A 1 249 ? 107.111 168.747 89.902  1.00 20.33 ? 319 PHE A CB  1 
ATOM 1857 C CG  . PHE A 1 249 ? 107.205 170.087 90.560  1.00 19.65 ? 319 PHE A CG  1 
ATOM 1858 C CD1 . PHE A 1 249 ? 107.523 170.180 91.915  1.00 20.60 ? 319 PHE A CD1 1 
ATOM 1859 C CD2 . PHE A 1 249 ? 106.913 171.242 89.849  1.00 19.20 ? 319 PHE A CD2 1 
ATOM 1860 C CE1 . PHE A 1 249 ? 107.576 171.403 92.534  1.00 20.57 ? 319 PHE A CE1 1 
ATOM 1861 C CE2 . PHE A 1 249 ? 106.970 172.485 90.461  1.00 19.77 ? 319 PHE A CE2 1 
ATOM 1862 C CZ  . PHE A 1 249 ? 107.301 172.570 91.793  1.00 20.72 ? 319 PHE A CZ  1 
ATOM 1863 N N   . ALA A 1 250 ? 105.342 166.764 88.046  1.00 21.63 ? 320 ALA A N   1 
ATOM 1864 C CA  . ALA A 1 250 ? 105.410 165.550 87.204  1.00 22.29 ? 320 ALA A CA  1 
ATOM 1865 C C   . ALA A 1 250 ? 106.835 165.037 87.080  1.00 23.05 ? 320 ALA A C   1 
ATOM 1866 O O   . ALA A 1 250 ? 107.081 163.812 87.060  1.00 24.45 ? 320 ALA A O   1 
ATOM 1867 C CB  . ALA A 1 250 ? 104.820 165.816 85.824  1.00 22.22 ? 320 ALA A CB  1 
ATOM 1868 N N   . ASN A 1 251 ? 107.795 165.958 87.026  1.00 22.93 ? 321 ASN A N   1 
ATOM 1869 C CA  . ASN A 1 251 ? 109.201 165.592 86.908  1.00 23.57 ? 321 ASN A CA  1 
ATOM 1870 C C   . ASN A 1 251 ? 110.093 166.402 87.870  1.00 23.63 ? 321 ASN A C   1 
ATOM 1871 O O   . ASN A 1 251 ? 110.569 167.487 87.528  1.00 22.77 ? 321 ASN A O   1 
ATOM 1872 C CB  . ASN A 1 251 ? 109.636 165.810 85.453  1.00 24.11 ? 321 ASN A CB  1 
ATOM 1873 C CG  . ASN A 1 251 ? 111.149 165.742 85.254  1.00 25.06 ? 321 ASN A CG  1 
ATOM 1874 O OD1 . ASN A 1 251 ? 111.846 164.976 85.916  1.00 28.50 ? 321 ASN A OD1 1 
ATOM 1875 N ND2 . ASN A 1 251 ? 111.653 166.547 84.321  1.00 28.80 ? 321 ASN A ND2 1 
ATOM 1876 N N   . ASN A 1 252 ? 110.317 165.854 89.060  1.00 24.15 ? 322 ASN A N   1 
ATOM 1877 C CA  . ASN A 1 252 ? 111.187 166.476 90.049  1.00 24.46 ? 322 ASN A CA  1 
ATOM 1878 C C   . ASN A 1 252 ? 112.613 166.630 89.547  1.00 24.24 ? 322 ASN A C   1 
ATOM 1879 O O   . ASN A 1 252 ? 113.287 167.557 89.925  1.00 23.59 ? 322 ASN A O   1 
ATOM 1880 C CB  . ASN A 1 252 ? 111.210 165.662 91.353  1.00 25.32 ? 322 ASN A CB  1 
ATOM 1881 C CG  . ASN A 1 252 ? 109.879 165.674 92.089  1.00 25.71 ? 322 ASN A CG  1 
ATOM 1882 O OD1 . ASN A 1 252 ? 109.600 164.767 92.879  1.00 35.76 ? 322 ASN A OD1 1 
ATOM 1883 N ND2 . ASN A 1 252 ? 109.080 166.682 91.865  1.00 23.27 ? 322 ASN A ND2 1 
ATOM 1884 N N   . GLU A 1 253 ? 113.071 165.716 88.689  1.00 24.77 ? 323 GLU A N   1 
ATOM 1885 C CA  . GLU A 1 253 ? 114.421 165.781 88.108  1.00 24.44 ? 323 GLU A CA  1 
ATOM 1886 C C   . GLU A 1 253 ? 114.608 167.060 87.264  1.00 23.89 ? 323 GLU A C   1 
ATOM 1887 O O   . GLU A 1 253 ? 115.728 167.496 87.020  1.00 24.25 ? 323 GLU A O   1 
ATOM 1888 C CB  . GLU A 1 253 ? 114.663 164.521 87.257  1.00 25.64 ? 323 GLU A CB  1 
ATOM 1889 C CG  . GLU A 1 253 ? 116.057 164.346 86.658  1.00 26.76 ? 323 GLU A CG  1 
ATOM 1890 C CD  . GLU A 1 253 ? 116.225 164.986 85.290  1.00 28.83 ? 323 GLU A CD  1 
ATOM 1891 O OE1 . GLU A 1 253 ? 115.207 165.220 84.588  1.00 29.65 ? 323 GLU A OE1 1 
ATOM 1892 O OE2 . GLU A 1 253 ? 117.382 165.276 84.909  1.00 33.61 ? 323 GLU A OE2 1 
ATOM 1893 N N   . GLY A 1 254 ? 113.507 167.666 86.838  1.00 23.44 ? 324 GLY A N   1 
ATOM 1894 C CA  . GLY A 1 254 ? 113.524 168.861 86.008  1.00 22.96 ? 324 GLY A CA  1 
ATOM 1895 C C   . GLY A 1 254 ? 113.656 170.168 86.770  1.00 23.28 ? 324 GLY A C   1 
ATOM 1896 O O   . GLY A 1 254 ? 113.827 171.228 86.158  1.00 22.90 ? 324 GLY A O   1 
ATOM 1897 N N   . LEU A 1 255 ? 113.550 170.111 88.100  1.00 22.59 ? 325 LEU A N   1 
ATOM 1898 C CA  . LEU A 1 255 ? 113.523 171.332 88.920  1.00 22.09 ? 325 LEU A CA  1 
ATOM 1899 C C   . LEU A 1 255 ? 114.922 171.964 88.923  1.00 22.36 ? 325 LEU A C   1 
ATOM 1900 O O   . LEU A 1 255 ? 115.900 171.252 88.908  1.00 22.48 ? 325 LEU A O   1 
ATOM 1901 C CB  . LEU A 1 255 ? 113.093 170.996 90.363  1.00 21.96 ? 325 LEU A CB  1 
ATOM 1902 C CG  . LEU A 1 255 ? 111.623 170.600 90.595  1.00 19.90 ? 325 LEU A CG  1 
ATOM 1903 C CD1 . LEU A 1 255 ? 111.478 169.948 92.007  1.00 21.45 ? 325 LEU A CD1 1 
ATOM 1904 C CD2 . LEU A 1 255 ? 110.687 171.772 90.448  1.00 19.86 ? 325 LEU A CD2 1 
ATOM 1905 N N   . ALA A 1 256 ? 114.997 173.285 88.935  1.00 22.94 ? 326 ALA A N   1 
ATOM 1906 C CA  . ALA A 1 256 ? 116.271 174.018 88.932  1.00 23.75 ? 326 ALA A CA  1 
ATOM 1907 C C   . ALA A 1 256 ? 116.741 174.261 90.361  1.00 24.57 ? 326 ALA A C   1 
ATOM 1908 O O   . ALA A 1 256 ? 116.052 174.908 91.136  1.00 23.23 ? 326 ALA A O   1 
ATOM 1909 C CB  . ALA A 1 256 ? 116.112 175.301 88.224  1.00 23.03 ? 326 ALA A CB  1 
ATOM 1910 N N   . SER A 1 257 ? 117.880 173.687 90.724  1.00 25.61 ? 327 SER A N   1 
ATOM 1911 C CA  . SER A 1 257 ? 118.421 173.879 92.064  1.00 26.86 ? 327 SER A CA  1 
ATOM 1912 C C   . SER A 1 257 ? 118.854 175.337 92.263  1.00 27.20 ? 327 SER A C   1 
ATOM 1913 O O   . SER A 1 257 ? 119.554 175.914 91.427  1.00 27.98 ? 327 SER A O   1 
ATOM 1914 C CB  . SER A 1 257 ? 119.582 172.911 92.304  1.00 27.16 ? 327 SER A CB  1 
ATOM 1915 O OG  . SER A 1 257 ? 120.121 173.084 93.598  1.00 29.37 ? 327 SER A OG  1 
ATOM 1916 N N   . GLN A 1 258 ? 118.401 175.943 93.357  1.00 27.10 ? 328 GLN A N   1 
ATOM 1917 C CA  . GLN A 1 258 ? 118.698 177.328 93.679  1.00 27.10 ? 328 GLN A CA  1 
ATOM 1918 C C   . GLN A 1 258 ? 119.748 177.409 94.765  1.00 27.65 ? 328 GLN A C   1 
ATOM 1919 O O   . GLN A 1 258 ? 120.038 178.470 95.276  1.00 27.03 ? 328 GLN A O   1 
ATOM 1920 C CB  . GLN A 1 258 ? 117.430 178.017 94.167  1.00 27.27 ? 328 GLN A CB  1 
ATOM 1921 C CG  . GLN A 1 258 ? 116.271 177.919 93.212  1.00 27.25 ? 328 GLN A CG  1 
ATOM 1922 C CD  . GLN A 1 258 ? 116.577 178.612 91.918  1.00 28.63 ? 328 GLN A CD  1 
ATOM 1923 O OE1 . GLN A 1 258 ? 116.851 179.801 91.920  1.00 28.36 ? 328 GLN A OE1 1 
ATOM 1924 N NE2 . GLN A 1 258 ? 116.550 177.876 90.817  1.00 28.82 ? 328 GLN A NE2 1 
ATOM 1925 N N   . GLY A 1 259 ? 120.309 176.270 95.133  1.00 27.77 ? 329 GLY A N   1 
ATOM 1926 C CA  . GLY A 1 259 ? 121.178 176.216 96.278  1.00 28.76 ? 329 GLY A CA  1 
ATOM 1927 C C   . GLY A 1 259 ? 120.385 176.027 97.560  1.00 29.11 ? 329 GLY A C   1 
ATOM 1928 O O   . GLY A 1 259 ? 119.158 176.245 97.652  1.00 27.87 ? 329 GLY A O   1 
ATOM 1929 N N   . ASP A 1 260 ? 121.138 175.640 98.571  1.00 29.68 ? 330 ASP A N   1 
ATOM 1930 C CA  . ASP A 1 260 ? 120.572 174.972 99.694  1.00 30.93 ? 330 ASP A CA  1 
ATOM 1931 C C   . ASP A 1 260 ? 119.708 173.819 99.108  1.00 30.94 ? 330 ASP A C   1 
ATOM 1932 O O   . ASP A 1 260 ? 120.079 173.168 98.097  1.00 33.58 ? 330 ASP A O   1 
ATOM 1933 C CB  . ASP A 1 260 ? 119.853 175.997 100.563 1.00 31.27 ? 330 ASP A CB  1 
ATOM 1934 C CG  . ASP A 1 260 ? 120.692 177.245 100.773 1.00 33.51 ? 330 ASP A CG  1 
ATOM 1935 O OD1 . ASP A 1 260 ? 121.782 177.131 101.380 1.00 35.35 ? 330 ASP A OD1 1 
ATOM 1936 O OD2 . ASP A 1 260 ? 120.374 178.380 100.338 1.00 40.47 ? 330 ASP A OD2 1 
ATOM 1937 N N   . ASN A 1 261 ? 118.609 173.519 99.741  1.00 29.67 ? 331 ASN A N   1 
ATOM 1938 C CA  . ASN A 1 261 ? 117.699 172.517 99.231  1.00 28.92 ? 331 ASN A CA  1 
ATOM 1939 C C   . ASN A 1 261 ? 116.431 173.247 98.752  1.00 26.55 ? 331 ASN A C   1 
ATOM 1940 O O   . ASN A 1 261 ? 115.313 172.829 99.051  1.00 26.72 ? 331 ASN A O   1 
ATOM 1941 C CB  . ASN A 1 261 ? 117.456 171.521 100.368 1.00 29.44 ? 331 ASN A CB  1 
ATOM 1942 C CG  . ASN A 1 261 ? 116.985 170.161 99.892  1.00 33.46 ? 331 ASN A CG  1 
ATOM 1943 O OD1 . ASN A 1 261 ? 117.034 169.814 98.685  1.00 39.15 ? 331 ASN A OD1 1 
ATOM 1944 N ND2 . ASN A 1 261 ? 116.507 169.369 100.845 1.00 36.41 ? 331 ASN A ND2 1 
ATOM 1945 N N   . VAL A 1 262 ? 116.641 174.345 98.019  1.00 23.92 ? 332 VAL A N   1 
ATOM 1946 C CA  . VAL A 1 262 ? 115.553 175.158 97.440  1.00 22.49 ? 332 VAL A CA  1 
ATOM 1947 C C   . VAL A 1 262 ? 115.560 175.032 95.915  1.00 21.65 ? 332 VAL A C   1 
ATOM 1948 O O   . VAL A 1 262 ? 116.611 174.949 95.308  1.00 21.23 ? 332 VAL A O   1 
ATOM 1949 C CB  . VAL A 1 262 ? 115.667 176.625 97.833  1.00 23.06 ? 332 VAL A CB  1 
ATOM 1950 C CG1 . VAL A 1 262 ? 114.646 177.492 97.065  1.00 22.43 ? 332 VAL A CG1 1 
ATOM 1951 C CG2 . VAL A 1 262 ? 115.461 176.784 99.347  1.00 22.29 ? 332 VAL A CG2 1 
ATOM 1952 N N   . TRP A 1 263 ? 114.370 175.044 95.321  1.00 20.72 ? 333 TRP A N   1 
ATOM 1953 C CA  . TRP A 1 263 ? 114.176 174.673 93.910  1.00 20.25 ? 333 TRP A CA  1 
ATOM 1954 C C   . TRP A 1 263 ? 113.196 175.607 93.205  1.00 19.47 ? 333 TRP A C   1 
ATOM 1955 O O   . TRP A 1 263 ? 112.281 176.096 93.826  1.00 17.75 ? 333 TRP A O   1 
ATOM 1956 C CB  . TRP A 1 263 ? 113.586 173.280 93.864  1.00 21.25 ? 333 TRP A CB  1 
ATOM 1957 C CG  . TRP A 1 263 ? 114.409 172.263 94.549  1.00 22.66 ? 333 TRP A CG  1 
ATOM 1958 C CD1 . TRP A 1 263 ? 114.363 171.921 95.855  1.00 25.78 ? 333 TRP A CD1 1 
ATOM 1959 C CD2 . TRP A 1 263 ? 115.410 171.430 93.949  1.00 27.81 ? 333 TRP A CD2 1 
ATOM 1960 N NE1 . TRP A 1 263 ? 115.276 170.925 96.122  1.00 27.85 ? 333 TRP A NE1 1 
ATOM 1961 C CE2 . TRP A 1 263 ? 115.926 170.600 94.963  1.00 29.48 ? 333 TRP A CE2 1 
ATOM 1962 C CE3 . TRP A 1 263 ? 115.913 171.290 92.649  1.00 28.95 ? 333 TRP A CE3 1 
ATOM 1963 C CZ2 . TRP A 1 263 ? 116.926 169.652 94.727  1.00 31.84 ? 333 TRP A CZ2 1 
ATOM 1964 C CZ3 . TRP A 1 263 ? 116.920 170.350 92.418  1.00 30.47 ? 333 TRP A CZ3 1 
ATOM 1965 C CH2 . TRP A 1 263 ? 117.405 169.544 93.450  1.00 32.58 ? 333 TRP A CH2 1 
ATOM 1966 N N   . ALA A 1 264 ? 113.369 175.798 91.892  1.00 18.85 ? 334 ALA A N   1 
ATOM 1967 C CA  . ALA A 1 264 ? 112.447 176.580 91.078  1.00 18.96 ? 334 ALA A CA  1 
ATOM 1968 C C   . ALA A 1 264 ? 111.825 175.688 90.002  1.00 18.91 ? 334 ALA A C   1 
ATOM 1969 O O   . ALA A 1 264 ? 112.470 174.760 89.523  1.00 18.33 ? 334 ALA A O   1 
ATOM 1970 C CB  . ALA A 1 264 ? 113.166 177.734 90.429  1.00 18.98 ? 334 ALA A CB  1 
ATOM 1971 N N   . ALA A 1 265 ? 110.559 175.935 89.650  1.00 19.77 ? 335 ALA A N   1 
ATOM 1972 C CA  . ALA A 1 265 ? 109.927 175.153 88.581  1.00 19.75 ? 335 ALA A CA  1 
ATOM 1973 C C   . ALA A 1 265 ? 110.520 175.608 87.251  1.00 20.62 ? 335 ALA A C   1 
ATOM 1974 O O   . ALA A 1 265 ? 110.977 176.732 87.126  1.00 20.84 ? 335 ALA A O   1 
ATOM 1975 C CB  . ALA A 1 265 ? 108.452 175.330 88.569  1.00 20.61 ? 335 ALA A CB  1 
ATOM 1976 N N   . THR A 1 266 ? 110.511 174.690 86.295  1.00 21.58 ? 336 THR A N   1 
ATOM 1977 C CA  . THR A 1 266 ? 111.008 174.922 84.945  1.00 22.91 ? 336 THR A CA  1 
ATOM 1978 C C   . THR A 1 266 ? 110.052 174.295 83.949  1.00 23.71 ? 336 THR A C   1 
ATOM 1979 O O   . THR A 1 266 ? 109.113 173.611 84.324  1.00 23.11 ? 336 THR A O   1 
ATOM 1980 C CB  . THR A 1 266 ? 112.368 174.262 84.780  1.00 22.23 ? 336 THR A CB  1 
ATOM 1981 O OG1 . THR A 1 266 ? 112.252 172.849 84.987  1.00 22.33 ? 336 THR A OG1 1 
ATOM 1982 C CG2 . THR A 1 266 ? 113.348 174.720 85.858  1.00 21.64 ? 336 THR A CG2 1 
ATOM 1983 N N   . GLN A 1 267 ? 110.315 174.506 82.660  1.00 25.64 ? 337 GLN A N   1 
ATOM 1984 C CA  . GLN A 1 267 ? 109.542 173.825 81.633  1.00 26.71 ? 337 GLN A CA  1 
ATOM 1985 C C   . GLN A 1 267 ? 109.727 172.328 81.758  1.00 26.29 ? 337 GLN A C   1 
ATOM 1986 O O   . GLN A 1 267 ? 108.783 171.549 81.544  1.00 26.95 ? 337 GLN A O   1 
ATOM 1987 C CB  . GLN A 1 267 ? 109.929 174.319 80.224  1.00 28.40 ? 337 GLN A CB  1 
ATOM 1988 C CG  . GLN A 1 267 ? 108.835 174.053 79.204  1.00 31.20 ? 337 GLN A CG  1 
ATOM 1989 C CD  . GLN A 1 267 ? 109.365 173.899 77.789  1.00 37.80 ? 337 GLN A CD  1 
ATOM 1990 O OE1 . GLN A 1 267 ? 109.523 172.766 77.293  1.00 42.32 ? 337 GLN A OE1 1 
ATOM 1991 N NE2 . GLN A 1 267 ? 109.642 175.035 77.125  1.00 39.24 ? 337 GLN A NE2 1 
ATOM 1992 N N   . ALA A 1 268 ? 110.929 171.904 82.142  1.00 25.49 ? 338 ALA A N   1 
ATOM 1993 C CA  . ALA A 1 268 ? 111.206 170.472 82.250  1.00 24.64 ? 338 ALA A CA  1 
ATOM 1994 C C   . ALA A 1 268 ? 110.455 169.765 83.386  1.00 24.58 ? 338 ALA A C   1 
ATOM 1995 O O   . ALA A 1 268 ? 110.119 168.585 83.253  1.00 24.11 ? 338 ALA A O   1 
ATOM 1996 C CB  . ALA A 1 268 ? 112.683 170.243 82.393  1.00 24.50 ? 338 ALA A CB  1 
ATOM 1997 N N   . SER A 1 269 ? 110.232 170.470 84.506  1.00 23.82 ? 339 SER A N   1 
ATOM 1998 C CA  . SER A 1 269 ? 109.602 169.880 85.691  1.00 23.45 ? 339 SER A CA  1 
ATOM 1999 C C   . SER A 1 269 ? 108.107 169.864 85.576  1.00 23.34 ? 339 SER A C   1 
ATOM 2000 O O   . SER A 1 269 ? 107.436 169.040 86.212  1.00 23.22 ? 339 SER A O   1 
ATOM 2001 C CB  . SER A 1 269 ? 109.972 170.656 86.979  1.00 23.45 ? 339 SER A CB  1 
ATOM 2002 O OG  . SER A 1 269 ? 109.405 171.964 86.992  1.00 21.87 ? 339 SER A OG  1 
ATOM 2003 N N   . GLY A 1 270 ? 107.581 170.790 84.783  1.00 23.16 ? 340 GLY A N   1 
ATOM 2004 C CA  . GLY A 1 270 ? 106.162 171.038 84.730  1.00 23.72 ? 340 GLY A CA  1 
ATOM 2005 C C   . GLY A 1 270 ? 105.777 172.074 85.773  1.00 23.23 ? 340 GLY A C   1 
ATOM 2006 O O   . GLY A 1 270 ? 106.576 172.469 86.619  1.00 23.41 ? 340 GLY A O   1 
ATOM 2007 N N   . VAL A 1 271 ? 104.533 172.510 85.703  1.00 23.46 ? 341 VAL A N   1 
ATOM 2008 C CA  . VAL A 1 271 ? 103.979 173.430 86.690  1.00 22.30 ? 341 VAL A CA  1 
ATOM 2009 C C   . VAL A 1 271 ? 103.772 172.724 88.031  1.00 21.27 ? 341 VAL A C   1 
ATOM 2010 O O   . VAL A 1 271 ? 103.519 171.511 88.081  1.00 21.53 ? 341 VAL A O   1 
ATOM 2011 C CB  . VAL A 1 271 ? 102.662 174.062 86.169  1.00 22.94 ? 341 VAL A CB  1 
ATOM 2012 C CG1 . VAL A 1 271 ? 101.513 173.048 86.148  1.00 22.99 ? 341 VAL A CG1 1 
ATOM 2013 C CG2 . VAL A 1 271 ? 102.295 175.287 86.989  1.00 23.39 ? 341 VAL A CG2 1 
ATOM 2014 N N   . ALA A 1 272 ? 103.877 173.478 89.126  1.00 20.01 ? 342 ALA A N   1 
ATOM 2015 C CA  . ALA A 1 272 ? 103.510 172.947 90.427  1.00 18.92 ? 342 ALA A CA  1 
ATOM 2016 C C   . ALA A 1 272 ? 102.027 172.639 90.484  1.00 17.36 ? 342 ALA A C   1 
ATOM 2017 O O   . ALA A 1 272 ? 101.180 173.438 90.077  1.00 16.56 ? 342 ALA A O   1 
ATOM 2018 C CB  . ALA A 1 272 ? 103.875 173.946 91.534  1.00 18.58 ? 342 ALA A CB  1 
ATOM 2019 N N   . LEU A 1 273 ? 101.712 171.475 91.021  1.00 18.14 ? 343 LEU A N   1 
ATOM 2020 C CA  . LEU A 1 273 ? 100.338 171.090 91.287  1.00 18.32 ? 343 LEU A CA  1 
ATOM 2021 C C   . LEU A 1 273 ? 100.182 171.103 92.803  1.00 17.50 ? 343 LEU A C   1 
ATOM 2022 O O   . LEU A 1 273 ? 100.918 170.423 93.506  1.00 17.67 ? 343 LEU A O   1 
ATOM 2023 C CB  . LEU A 1 273 ? 100.090 169.694 90.762  1.00 19.98 ? 343 LEU A CB  1 
ATOM 2024 C CG  . LEU A 1 273 ? 98.652  169.333 90.442  1.00 24.24 ? 343 LEU A CG  1 
ATOM 2025 C CD1 . LEU A 1 273 ? 98.289  169.847 89.076  1.00 28.34 ? 343 LEU A CD1 1 
ATOM 2026 C CD2 . LEU A 1 273 ? 98.494  167.788 90.463  1.00 27.99 ? 343 LEU A CD2 1 
ATOM 2027 N N   . LEU A 1 274 ? 99.250  171.900 93.284  1.00 17.35 ? 344 LEU A N   1 
ATOM 2028 C CA  . LEU A 1 274 ? 99.154  172.206 94.703  1.00 17.02 ? 344 LEU A CA  1 
ATOM 2029 C C   . LEU A 1 274 ? 98.084  171.366 95.413  1.00 17.29 ? 344 LEU A C   1 
ATOM 2030 O O   . LEU A 1 274 ? 97.099  170.942 94.802  1.00 17.00 ? 344 LEU A O   1 
ATOM 2031 C CB  . LEU A 1 274 ? 98.856  173.706 94.864  1.00 17.10 ? 344 LEU A CB  1 
ATOM 2032 C CG  . LEU A 1 274 ? 99.861  174.683 94.231  1.00 16.92 ? 344 LEU A CG  1 
ATOM 2033 C CD1 . LEU A 1 274 ? 99.537  176.149 94.673  1.00 19.27 ? 344 LEU A CD1 1 
ATOM 2034 C CD2 . LEU A 1 274 ? 101.297 174.313 94.527  1.00 16.10 ? 344 LEU A CD2 1 
ATOM 2035 N N   . GLY A 1 275 ? 98.284  171.141 96.712  1.00 17.42 ? 345 GLY A N   1 
ATOM 2036 C CA  . GLY A 1 275 ? 97.266  170.547 97.571  1.00 18.30 ? 345 GLY A CA  1 
ATOM 2037 C C   . GLY A 1 275 ? 97.603  170.748 99.051  1.00 19.07 ? 345 GLY A C   1 
ATOM 2038 O O   . GLY A 1 275 ? 98.360  171.650 99.404  1.00 19.21 ? 345 GLY A O   1 
ATOM 2039 N N   . THR A 1 276 ? 97.037  169.904 99.908  1.00 19.29 ? 346 THR A N   1 
ATOM 2040 C CA  . THR A 1 276 ? 97.366  169.951 101.333 1.00 19.61 ? 346 THR A CA  1 
ATOM 2041 C C   . THR A 1 276 ? 97.762  168.597 101.877 1.00 20.20 ? 346 THR A C   1 
ATOM 2042 O O   . THR A 1 276 ? 97.324  167.548 101.377 1.00 20.76 ? 346 THR A O   1 
ATOM 2043 C CB  . THR A 1 276 ? 96.207  170.549 102.156 1.00 19.50 ? 346 THR A CB  1 
ATOM 2044 O OG1 . THR A 1 276 ? 94.980  169.859 101.890 1.00 18.86 ? 346 THR A OG1 1 
ATOM 2045 C CG2 . THR A 1 276 ? 95.954  171.980 101.747 1.00 18.78 ? 346 THR A CG2 1 
ATOM 2046 N N   . ALA A 1 277 ? 98.624  168.635 102.891 1.00 20.60 ? 347 ALA A N   1 
ATOM 2047 C CA  . ALA A 1 277 ? 99.030  167.461 103.642 1.00 21.41 ? 347 ALA A CA  1 
ATOM 2048 C C   . ALA A 1 277 ? 97.810  166.732 104.201 1.00 22.15 ? 347 ALA A C   1 
ATOM 2049 O O   . ALA A 1 277 ? 96.951  167.326 104.877 1.00 21.55 ? 347 ALA A O   1 
ATOM 2050 C CB  . ALA A 1 277 ? 99.945  167.856 104.785 1.00 21.26 ? 347 ALA A CB  1 
ATOM 2051 N N   . GLY A 1 278 ? 97.758  165.434 103.918 1.00 24.16 ? 348 GLY A N   1 
ATOM 2052 C CA  . GLY A 1 278 ? 96.706  164.552 104.409 1.00 25.54 ? 348 GLY A CA  1 
ATOM 2053 C C   . GLY A 1 278 ? 95.542  164.384 103.457 1.00 26.66 ? 348 GLY A C   1 
ATOM 2054 O O   . GLY A 1 278 ? 94.533  163.779 103.812 1.00 27.94 ? 348 GLY A O   1 
ATOM 2055 N N   . SER A 1 279 ? 95.673  164.933 102.257 1.00 27.33 ? 349 SER A N   1 
ATOM 2056 C CA  . SER A 1 279 ? 94.620  164.883 101.235 1.00 28.08 ? 349 SER A CA  1 
ATOM 2057 C C   . SER A 1 279 ? 95.244  164.621 99.863  1.00 27.97 ? 349 SER A C   1 
ATOM 2058 O O   . SER A 1 279 ? 96.401  164.962 99.611  1.00 27.81 ? 349 SER A O   1 
ATOM 2059 C CB  . SER A 1 279 ? 93.822  166.194 101.190 1.00 28.20 ? 349 SER A CB  1 
ATOM 2060 O OG  . SER A 1 279 ? 92.821  166.254 102.204 1.00 30.65 ? 349 SER A OG  1 
ATOM 2061 N N   . GLY A 1 280 ? 94.474  163.981 98.992  1.00 28.39 ? 350 GLY A N   1 
ATOM 2062 C CA  . GLY A 1 280 ? 94.893  163.739 97.625  1.00 28.31 ? 350 GLY A CA  1 
ATOM 2063 C C   . GLY A 1 280 ? 96.305  163.190 97.522  1.00 28.21 ? 350 GLY A C   1 
ATOM 2064 O O   . GLY A 1 280 ? 96.651  162.167 98.082  1.00 28.24 ? 350 GLY A O   1 
ATOM 2065 N N   . ASN A 1 281 ? 97.134  163.921 96.800  1.00 28.56 ? 351 ASN A N   1 
ATOM 2066 C CA  . ASN A 1 281 ? 98.482  163.502 96.491  1.00 28.31 ? 351 ASN A CA  1 
ATOM 2067 C C   . ASN A 1 281 ? 99.384  163.416 97.709  1.00 27.47 ? 351 ASN A C   1 
ATOM 2068 O O   . ASN A 1 281 ? 100.386 162.711 97.691  1.00 27.57 ? 351 ASN A O   1 
ATOM 2069 C CB  . ASN A 1 281 ? 99.060  164.530 95.528  1.00 29.12 ? 351 ASN A CB  1 
ATOM 2070 C CG  . ASN A 1 281 ? 100.239 164.016 94.737  1.00 30.69 ? 351 ASN A CG  1 
ATOM 2071 O OD1 . ASN A 1 281 ? 100.549 162.812 94.722  1.00 32.57 ? 351 ASN A OD1 1 
ATOM 2072 N ND2 . ASN A 1 281 ? 100.907 164.944 94.048  1.00 30.24 ? 351 ASN A ND2 1 
ATOM 2073 N N   . PHE A 1 282 ? 99.049  164.156 98.766  1.00 25.86 ? 352 PHE A N   1 
ATOM 2074 C CA  . PHE A 1 282 ? 99.962  164.304 99.887  1.00 24.92 ? 352 PHE A CA  1 
ATOM 2075 C C   . PHE A 1 282 ? 99.518  163.640 101.185 1.00 25.28 ? 352 PHE A C   1 
ATOM 2076 O O   . PHE A 1 282 ? 98.396  163.818 101.654 1.00 25.22 ? 352 PHE A O   1 
ATOM 2077 C CB  . PHE A 1 282 ? 100.220 165.791 100.171 1.00 24.06 ? 352 PHE A CB  1 
ATOM 2078 C CG  . PHE A 1 282 ? 100.506 166.597 98.942  1.00 20.59 ? 352 PHE A CG  1 
ATOM 2079 C CD1 . PHE A 1 282 ? 101.776 166.676 98.451  1.00 18.40 ? 352 PHE A CD1 1 
ATOM 2080 C CD2 . PHE A 1 282 ? 99.490  167.247 98.274  1.00 18.82 ? 352 PHE A CD2 1 
ATOM 2081 C CE1 . PHE A 1 282 ? 102.035 167.450 97.315  1.00 19.88 ? 352 PHE A CE1 1 
ATOM 2082 C CE2 . PHE A 1 282 ? 99.754  168.013 97.146  1.00 19.37 ? 352 PHE A CE2 1 
ATOM 2083 C CZ  . PHE A 1 282 ? 101.027 168.088 96.673  1.00 16.86 ? 352 PHE A CZ  1 
ATOM 2084 N N   . GLY A 1 283 ? 100.453 162.924 101.780 1.00 25.11 ? 353 GLY A N   1 
ATOM 2085 C CA  . GLY A 1 283 ? 100.286 162.415 103.106 1.00 26.60 ? 353 GLY A CA  1 
ATOM 2086 C C   . GLY A 1 283 ? 100.492 163.540 104.099 1.00 26.69 ? 353 GLY A C   1 
ATOM 2087 O O   . GLY A 1 283 ? 101.001 164.622 103.770 1.00 26.93 ? 353 GLY A O   1 
ATOM 2088 N N   . LYS A 1 284 ? 100.111 163.250 105.328 1.00 27.17 ? 354 LYS A N   1 
ATOM 2089 C CA  . LYS A 1 284 ? 100.232 164.182 106.432 1.00 26.65 ? 354 LYS A CA  1 
ATOM 2090 C C   . LYS A 1 284 ? 101.676 164.591 106.704 1.00 25.69 ? 354 LYS A C   1 
ATOM 2091 O O   . LYS A 1 284 ? 102.627 163.918 106.314 1.00 25.91 ? 354 LYS A O   1 
ATOM 2092 C CB  . LYS A 1 284 ? 99.601  163.563 107.689 1.00 27.33 ? 354 LYS A CB  1 
ATOM 2093 C CG  . LYS A 1 284 ? 98.091  163.384 107.581 1.00 29.42 ? 354 LYS A CG  1 
ATOM 2094 C CD  . LYS A 1 284 ? 97.481  162.726 108.812 1.00 32.79 ? 354 LYS A CD  1 
ATOM 2095 C CE  . LYS A 1 284 ? 95.974  162.941 108.864 1.00 34.49 ? 354 LYS A CE  1 
ATOM 2096 N NZ  . LYS A 1 284 ? 95.572  164.382 108.960 1.00 36.74 ? 354 LYS A NZ  1 
ATOM 2097 N N   . LEU A 1 285 ? 101.832 165.738 107.358 1.00 24.14 ? 355 LEU A N   1 
ATOM 2098 C CA  . LEU A 1 285 ? 103.105 166.160 107.904 1.00 23.94 ? 355 LEU A CA  1 
ATOM 2099 C C   . LEU A 1 285 ? 103.438 165.108 108.942 1.00 24.31 ? 355 LEU A C   1 
ATOM 2100 O O   . LEU A 1 285 ? 102.508 164.474 109.474 1.00 24.83 ? 355 LEU A O   1 
ATOM 2101 C CB  . LEU A 1 285 ? 102.981 167.561 108.512 1.00 23.78 ? 355 LEU A CB  1 
ATOM 2102 C CG  . LEU A 1 285 ? 102.543 168.638 107.490 1.00 20.67 ? 355 LEU A CG  1 
ATOM 2103 C CD1 . LEU A 1 285 ? 102.626 170.010 108.103 1.00 17.34 ? 355 LEU A CD1 1 
ATOM 2104 C CD2 . LEU A 1 285 ? 103.365 168.584 106.208 1.00 21.63 ? 355 LEU A CD2 1 
ATOM 2105 N N   . THR A 1 286 ? 104.721 164.871 109.193 1.00 25.05 ? 356 THR A N   1 
ATOM 2106 C CA  . THR A 1 286 ? 105.104 163.781 110.089 1.00 26.26 ? 356 THR A CA  1 
ATOM 2107 C C   . THR A 1 286 ? 104.578 164.071 111.469 1.00 25.44 ? 356 THR A C   1 
ATOM 2108 O O   . THR A 1 286 ? 104.265 163.163 112.190 1.00 24.88 ? 356 THR A O   1 
ATOM 2109 C CB  . THR A 1 286 ? 106.614 163.544 110.164 1.00 27.01 ? 356 THR A CB  1 
ATOM 2110 O OG1 . THR A 1 286 ? 107.253 164.628 110.843 1.00 29.59 ? 356 THR A OG1 1 
ATOM 2111 C CG2 . THR A 1 286 ? 107.261 163.536 108.769 1.00 28.21 ? 356 THR A CG2 1 
ATOM 2112 N N   . ASN A 1 287 ? 104.454 165.343 111.826 1.00 25.32 ? 357 ASN A N   1 
ATOM 2113 C CA  . ASN A 1 287 ? 103.962 165.688 113.162 1.00 25.16 ? 357 ASN A CA  1 
ATOM 2114 C C   . ASN A 1 287 ? 103.241 167.026 113.241 1.00 24.59 ? 357 ASN A C   1 
ATOM 2115 O O   . ASN A 1 287 ? 102.103 167.105 113.715 1.00 26.19 ? 357 ASN A O   1 
ATOM 2116 C CB  . ASN A 1 287 ? 105.107 165.718 114.171 1.00 25.17 ? 357 ASN A CB  1 
ATOM 2117 C CG  . ASN A 1 287 ? 104.616 165.955 115.568 1.00 25.74 ? 357 ASN A CG  1 
ATOM 2118 O OD1 . ASN A 1 287 ? 103.560 165.437 115.940 1.00 28.05 ? 357 ASN A OD1 1 
ATOM 2119 N ND2 . ASN A 1 287 ? 105.365 166.715 116.359 1.00 27.25 ? 357 ASN A ND2 1 
ATOM 2120 N N   . GLY A 1 288 ? 103.919 168.070 112.809 1.00 22.86 ? 358 GLY A N   1 
ATOM 2121 C CA  . GLY A 1 288 ? 103.453 169.420 113.059 1.00 21.79 ? 358 GLY A CA  1 
ATOM 2122 C C   . GLY A 1 288 ? 104.355 170.070 114.069 1.00 20.38 ? 358 GLY A C   1 
ATOM 2123 O O   . GLY A 1 288 ? 105.467 169.569 114.326 1.00 21.62 ? 358 GLY A O   1 
ATOM 2124 N N   . ALA A 1 289 ? 103.906 171.186 114.639 1.00 17.58 ? 359 ALA A N   1 
ATOM 2125 C CA  . ALA A 1 289 ? 104.701 171.904 115.633 1.00 16.95 ? 359 ALA A CA  1 
ATOM 2126 C C   . ALA A 1 289 ? 103.835 172.753 116.523 1.00 15.13 ? 359 ALA A C   1 
ATOM 2127 O O   . ALA A 1 289 ? 102.760 173.157 116.144 1.00 13.47 ? 359 ALA A O   1 
ATOM 2128 C CB  . ALA A 1 289 ? 105.724 172.795 114.952 1.00 16.89 ? 359 ALA A CB  1 
ATOM 2129 N N   . LEU A 1 290 ? 104.355 173.060 117.697 1.00 15.28 ? 360 LEU A N   1 
ATOM 2130 C CA  . LEU A 1 290 ? 103.668 173.867 118.670 1.00 13.62 ? 360 LEU A CA  1 
ATOM 2131 C C   . LEU A 1 290 ? 104.694 174.792 119.329 1.00 15.30 ? 360 LEU A C   1 
ATOM 2132 O O   . LEU A 1 290 ? 105.736 174.322 119.809 1.00 13.95 ? 360 LEU A O   1 
ATOM 2133 C CB  . LEU A 1 290 ? 103.007 172.929 119.708 1.00 14.41 ? 360 LEU A CB  1 
ATOM 2134 C CG  . LEU A 1 290 ? 102.389 173.595 120.922 1.00 14.23 ? 360 LEU A CG  1 
ATOM 2135 C CD1 . LEU A 1 290 ? 101.259 174.560 120.588 1.00 15.31 ? 360 LEU A CD1 1 
ATOM 2136 C CD2 . LEU A 1 290 ? 101.884 172.544 121.927 1.00 16.88 ? 360 LEU A CD2 1 
ATOM 2137 N N   . GLU A 1 291 ? 104.395 176.086 119.343 1.00 14.47 ? 361 GLU A N   1 
ATOM 2138 C CA  . GLU A 1 291 ? 105.305 177.120 119.838 1.00 17.81 ? 361 GLU A CA  1 
ATOM 2139 C C   . GLU A 1 291 ? 104.603 178.109 120.731 1.00 18.17 ? 361 GLU A C   1 
ATOM 2140 O O   . GLU A 1 291 ? 103.525 178.598 120.405 1.00 16.54 ? 361 GLU A O   1 
ATOM 2141 C CB  . GLU A 1 291 ? 105.854 177.935 118.656 1.00 18.55 ? 361 GLU A CB  1 
ATOM 2142 C CG  . GLU A 1 291 ? 106.647 177.132 117.656 1.00 23.25 ? 361 GLU A CG  1 
ATOM 2143 C CD  . GLU A 1 291 ? 108.093 176.933 118.106 1.00 30.00 ? 361 GLU A CD  1 
ATOM 2144 O OE1 . GLU A 1 291 ? 108.847 177.957 118.184 1.00 36.82 ? 361 GLU A OE1 1 
ATOM 2145 O OE2 . GLU A 1 291 ? 108.465 175.767 118.391 1.00 34.69 ? 361 GLU A OE2 1 
ATOM 2146 N N   . ALA A 1 292 ? 105.232 178.480 121.831 1.00 20.51 ? 362 ALA A N   1 
ATOM 2147 C CA  . ALA A 1 292 ? 104.648 179.483 122.718 1.00 22.27 ? 362 ALA A CA  1 
ATOM 2148 C C   . ALA A 1 292 ? 104.960 180.881 122.172 1.00 24.23 ? 362 ALA A C   1 
ATOM 2149 O O   . ALA A 1 292 ? 105.989 181.079 121.539 1.00 24.36 ? 362 ALA A O   1 
ATOM 2150 C CB  . ALA A 1 292 ? 105.200 179.306 124.128 1.00 23.19 ? 362 ALA A CB  1 
ATOM 2151 N N   . SER A 1 293 ? 104.075 181.846 122.368 1.00 25.75 ? 363 SER A N   1 
ATOM 2152 C CA  . SER A 1 293 ? 104.370 183.215 121.928 1.00 28.08 ? 363 SER A CA  1 
ATOM 2153 C C   . SER A 1 293 ? 105.509 183.832 122.755 1.00 29.42 ? 363 SER A C   1 
ATOM 2154 O O   . SER A 1 293 ? 105.448 183.785 123.987 1.00 30.77 ? 363 SER A O   1 
ATOM 2155 C CB  . SER A 1 293 ? 103.129 184.087 122.036 1.00 28.33 ? 363 SER A CB  1 
ATOM 2156 O OG  . SER A 1 293 ? 102.197 183.669 121.076 1.00 31.94 ? 363 SER A OG  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   71  71  GLY GLY A . n 
A 1 2   LEU 2   72  72  LEU LEU A . n 
A 1 3   ASP 3   73  73  ASP ASP A . n 
A 1 4   VAL 4   74  74  VAL VAL A . n 
A 1 5   ALA 5   75  75  ALA ALA A . n 
A 1 6   ILE 6   76  76  ILE ILE A . n 
A 1 7   SER 7   77  77  SER SER A . n 
A 1 8   GLN 8   78  78  GLN GLN A . n 
A 1 9   ASN 9   79  79  ASN ASN A . n 
A 1 10  GLY 10  80  80  GLY GLY A . n 
A 1 11  PHE 11  81  81  PHE PHE A . n 
A 1 12  PHE 12  82  82  PHE PHE A . n 
A 1 13  ARG 13  83  83  ARG ARG A . n 
A 1 14  LEU 14  84  84  LEU LEU A . n 
A 1 15  VAL 15  85  85  VAL VAL A . n 
A 1 16  ASP 16  86  86  ASP ASP A . n 
A 1 17  SER 17  87  87  SER SER A . n 
A 1 18  ASN 18  88  88  ASN ASN A . n 
A 1 19  GLY 19  89  89  GLY GLY A . n 
A 1 20  SER 20  90  90  SER SER A . n 
A 1 21  VAL 21  91  91  VAL VAL A . n 
A 1 22  PHE 22  92  92  PHE PHE A . n 
A 1 23  TYR 23  93  93  TYR TYR A . n 
A 1 24  SER 24  94  94  SER SER A . n 
A 1 25  ARG 25  95  95  ARG ARG A . n 
A 1 26  ASN 26  96  96  ASN ASN A . n 
A 1 27  GLY 27  97  97  GLY GLY A . n 
A 1 28  GLN 28  98  98  GLN GLN A . n 
A 1 29  PHE 29  99  99  PHE PHE A . n 
A 1 30  LYS 30  100 100 LYS LYS A . n 
A 1 31  LEU 31  101 101 LEU LEU A . n 
A 1 32  ASP 32  102 102 ASP ASP A . n 
A 1 33  GLU 33  103 103 GLU GLU A . n 
A 1 34  ASN 34  104 104 ASN ASN A . n 
A 1 35  ARG 35  105 105 ARG ARG A . n 
A 1 36  ASN 36  106 106 ASN ASN A . n 
A 1 37  LEU 37  107 107 LEU LEU A . n 
A 1 38  VAL 38  108 108 VAL VAL A . n 
A 1 39  ASN 39  109 109 ASN ASN A . n 
A 1 40  MET 40  110 110 MET MET A . n 
A 1 41  GLN 41  111 111 GLN GLN A . n 
A 1 42  GLY 42  112 112 GLY GLY A . n 
A 1 43  MET 43  113 113 MET MET A . n 
A 1 44  GLN 44  114 114 GLN GLN A . n 
A 1 45  LEU 45  115 115 LEU LEU A . n 
A 1 46  THR 46  116 116 THR THR A . n 
A 1 47  GLY 47  117 117 GLY GLY A . n 
A 1 48  TYR 48  118 118 TYR TYR A . n 
A 1 49  PRO 49  119 119 PRO PRO A . n 
A 1 50  ALA 50  120 120 ALA ALA A . n 
A 1 51  THR 51  121 121 THR THR A . n 
A 1 52  GLY 52  122 122 GLY GLY A . n 
A 1 53  THR 53  123 123 THR THR A . n 
A 1 54  PRO 54  124 124 PRO PRO A . n 
A 1 55  PRO 55  125 125 PRO PRO A . n 
A 1 56  THR 56  126 126 THR THR A . n 
A 1 57  ILE 57  127 127 ILE ILE A . n 
A 1 58  GLN 58  128 128 GLN GLN A . n 
A 1 59  GLN 59  129 129 GLN GLN A . n 
A 1 60  GLY 60  130 130 GLY GLY A . n 
A 1 61  ALA 61  131 131 ALA ALA A . n 
A 1 62  ASN 62  132 132 ASN ASN A . n 
A 1 63  PRO 63  133 133 PRO PRO A . n 
A 1 64  ALA 64  134 134 ALA ALA A . n 
A 1 65  PRO 65  135 135 PRO PRO A . n 
A 1 66  ILE 66  136 136 ILE ILE A . n 
A 1 67  THR 67  137 137 THR THR A . n 
A 1 68  ILE 68  138 138 ILE ILE A . n 
A 1 69  PRO 69  139 139 PRO PRO A . n 
A 1 70  ASN 70  140 140 ASN ASN A . n 
A 1 71  THR 71  141 141 THR THR A . n 
A 1 72  LEU 72  142 142 LEU LEU A . n 
A 1 73  MET 73  143 143 MET MET A . n 
A 1 74  ALA 74  144 144 ALA ALA A . n 
A 1 75  ALA 75  145 145 ALA ALA A . n 
A 1 76  LYS 76  146 146 LYS LYS A . n 
A 1 77  SER 77  147 147 SER SER A . n 
A 1 78  THR 78  148 148 THR THR A . n 
A 1 79  THR 79  149 149 THR THR A . n 
A 1 80  THR 80  150 150 THR THR A . n 
A 1 81  ALA 81  151 151 ALA ALA A . n 
A 1 82  SER 82  152 152 SER SER A . n 
A 1 83  MET 83  153 153 MET MET A . n 
A 1 84  GLN 84  154 154 GLN GLN A . n 
A 1 85  ILE 85  155 155 ILE ILE A . n 
A 1 86  ASN 86  156 156 ASN ASN A . n 
A 1 87  LEU 87  157 157 LEU LEU A . n 
A 1 88  ASN 88  158 158 ASN ASN A . n 
A 1 89  SER 89  159 159 SER SER A . n 
A 1 90  THR 90  160 160 THR THR A . n 
A 1 91  ASP 91  161 161 ASP ASP A . n 
A 1 92  PRO 92  162 162 PRO PRO A . n 
A 1 93  VAL 93  163 163 VAL VAL A . n 
A 1 94  PRO 94  164 164 PRO PRO A . n 
A 1 95  SER 95  165 165 SER SER A . n 
A 1 96  LYS 96  166 166 LYS LYS A . n 
A 1 97  THR 97  167 167 THR THR A . n 
A 1 98  PRO 98  168 168 PRO PRO A . n 
A 1 99  PHE 99  169 169 PHE PHE A . n 
A 1 100 SER 100 170 170 SER SER A . n 
A 1 101 VAL 101 171 171 VAL VAL A . n 
A 1 102 SER 102 172 172 SER SER A . n 
A 1 103 ASP 103 173 173 ASP ASP A . n 
A 1 104 ALA 104 174 174 ALA ALA A . n 
A 1 105 ASP 105 175 175 ASP ASP A . n 
A 1 106 SER 106 176 176 SER SER A . n 
A 1 107 TYR 107 177 177 TYR TYR A . n 
A 1 108 ASN 108 178 178 ASN ASN A . n 
A 1 109 LYS 109 179 179 LYS LYS A . n 
A 1 110 LYS 110 180 180 LYS LYS A . n 
A 1 111 GLY 111 181 181 GLY GLY A . n 
A 1 112 THR 112 182 182 THR THR A . n 
A 1 113 VAL 113 183 183 VAL VAL A . n 
A 1 114 THR 114 184 184 THR THR A . n 
A 1 115 VAL 115 185 185 VAL VAL A . n 
A 1 116 TYR 116 186 186 TYR TYR A . n 
A 1 117 ASP 117 187 187 ASP ASP A . n 
A 1 118 SER 118 188 188 SER SER A . n 
A 1 119 GLN 119 189 189 GLN GLN A . n 
A 1 120 GLY 120 190 190 GLY GLY A . n 
A 1 121 ASN 121 191 191 ASN ASN A . n 
A 1 122 ALA 122 192 192 ALA ALA A . n 
A 1 123 HIS 123 193 193 HIS HIS A . n 
A 1 124 ASP 124 194 194 ASP ASP A . n 
A 1 125 MET 125 195 195 MET MET A . n 
A 1 126 ASN 126 196 196 ASN ASN A . n 
A 1 127 VAL 127 197 197 VAL VAL A . n 
A 1 128 TYR 128 198 198 TYR TYR A . n 
A 1 129 PHE 129 199 199 PHE PHE A . n 
A 1 130 VAL 130 200 200 VAL VAL A . n 
A 1 131 LYS 131 201 201 LYS LYS A . n 
A 1 132 THR 132 202 202 THR THR A . n 
A 1 133 LYS 133 203 203 LYS LYS A . n 
A 1 134 ASP 134 204 204 ASP ASP A . n 
A 1 135 ASN 135 205 205 ASN ASN A . n 
A 1 136 GLU 136 206 206 GLU GLU A . n 
A 1 137 TRP 137 207 207 TRP TRP A . n 
A 1 138 ALA 138 208 208 ALA ALA A . n 
A 1 139 VAL 139 209 209 VAL VAL A . n 
A 1 140 TYR 140 210 210 TYR TYR A . n 
A 1 141 THR 141 211 211 THR THR A . n 
A 1 142 HIS 142 212 212 HIS HIS A . n 
A 1 143 ASP 143 213 213 ASP ASP A . n 
A 1 144 SER 144 214 214 SER SER A . n 
A 1 145 SER 145 215 215 SER SER A . n 
A 1 146 ASP 146 216 216 ASP ASP A . n 
A 1 147 PRO 147 217 217 PRO PRO A . n 
A 1 148 ALA 148 218 218 ALA ALA A . n 
A 1 149 ALA 149 219 219 ALA ALA A . n 
A 1 150 THR 150 220 220 THR THR A . n 
A 1 151 ALA 151 221 221 ALA ALA A . n 
A 1 152 PRO 152 222 222 PRO PRO A . n 
A 1 153 THR 153 223 223 THR THR A . n 
A 1 154 THR 154 224 224 THR THR A . n 
A 1 155 ALA 155 225 225 ALA ALA A . n 
A 1 156 SER 156 226 226 SER SER A . n 
A 1 157 THR 157 227 227 THR THR A . n 
A 1 158 THR 158 228 228 THR THR A . n 
A 1 159 LEU 159 229 229 LEU LEU A . n 
A 1 160 LYS 160 230 230 LYS LYS A . n 
A 1 161 PHE 161 231 231 PHE PHE A . n 
A 1 162 ASN 162 232 232 ASN ASN A . n 
A 1 163 GLU 163 233 233 GLU GLU A . n 
A 1 164 ASN 164 234 234 ASN ASN A . n 
A 1 165 GLY 165 235 235 GLY GLY A . n 
A 1 166 ILE 166 236 236 ILE ILE A . n 
A 1 167 LEU 167 237 237 LEU LEU A . n 
A 1 168 GLU 168 238 238 GLU GLU A . n 
A 1 169 SER 169 239 239 SER SER A . n 
A 1 170 GLY 170 240 240 GLY GLY A . n 
A 1 171 GLY 171 241 241 GLY GLY A . n 
A 1 172 THR 172 242 242 THR THR A . n 
A 1 173 VAL 173 243 243 VAL VAL A . n 
A 1 174 ASN 174 244 244 ASN ASN A . n 
A 1 175 ILE 175 245 245 ILE ILE A . n 
A 1 176 THR 176 246 246 THR THR A . n 
A 1 177 THR 177 247 247 THR THR A . n 
A 1 178 GLY 178 248 248 GLY GLY A . n 
A 1 179 THR 179 249 249 THR THR A . n 
A 1 180 ILE 180 250 250 ILE ILE A . n 
A 1 181 ASN 181 251 251 ASN ASN A . n 
A 1 182 GLY 182 252 252 GLY GLY A . n 
A 1 183 ALA 183 253 253 ALA ALA A . n 
A 1 184 THR 184 254 254 THR THR A . n 
A 1 185 ALA 185 255 255 ALA ALA A . n 
A 1 186 ALA 186 256 256 ALA ALA A . n 
A 1 187 THR 187 257 257 THR THR A . n 
A 1 188 PHE 188 258 258 PHE PHE A . n 
A 1 189 SER 189 259 259 SER SER A . n 
A 1 190 LEU 190 260 260 LEU LEU A . n 
A 1 191 SER 191 261 261 SER SER A . n 
A 1 192 PHE 192 262 262 PHE PHE A . n 
A 1 193 LEU 193 263 263 LEU LEU A . n 
A 1 194 ASN 194 264 264 ASN ASN A . n 
A 1 195 SER 195 265 265 SER SER A . n 
A 1 196 MET 196 266 266 MET MET A . n 
A 1 197 GLN 197 267 267 GLN GLN A . n 
A 1 198 GLN 198 268 268 GLN GLN A . n 
A 1 199 ASN 199 269 269 ASN ASN A . n 
A 1 200 THR 200 270 270 THR THR A . n 
A 1 201 GLY 201 271 271 GLY GLY A . n 
A 1 202 ALA 202 272 272 ALA ALA A . n 
A 1 203 ASN 203 273 273 ASN ASN A . n 
A 1 204 ASN 204 274 274 ASN ASN A . n 
A 1 205 ILE 205 275 275 ILE ILE A . n 
A 1 206 VAL 206 276 276 VAL VAL A . n 
A 1 207 ALA 207 277 277 ALA ALA A . n 
A 1 208 THR 208 278 278 THR THR A . n 
A 1 209 ASN 209 279 279 ASN ASN A . n 
A 1 210 GLN 210 280 280 GLN GLN A . n 
A 1 211 ASN 211 281 281 ASN ASN A . n 
A 1 212 GLY 212 282 282 GLY GLY A . n 
A 1 213 TYR 213 283 283 TYR TYR A . n 
A 1 214 LYS 214 284 284 LYS LYS A . n 
A 1 215 PRO 215 285 285 PRO PRO A . n 
A 1 216 GLY 216 286 286 GLY GLY A . n 
A 1 217 ASP 217 287 287 ASP ASP A . n 
A 1 218 LEU 218 288 288 LEU LEU A . n 
A 1 219 VAL 219 289 289 VAL VAL A . n 
A 1 220 SER 220 290 290 SER SER A . n 
A 1 221 TYR 221 291 291 TYR TYR A . n 
A 1 222 GLN 222 292 292 GLN GLN A . n 
A 1 223 ILE 223 293 293 ILE ILE A . n 
A 1 224 ASN 224 294 294 ASN ASN A . n 
A 1 225 ASN 225 295 295 ASN ASN A . n 
A 1 226 ASP 226 296 296 ASP ASP A . n 
A 1 227 GLY 227 297 297 GLY GLY A . n 
A 1 228 THR 228 298 298 THR THR A . n 
A 1 229 VAL 229 299 299 VAL VAL A . n 
A 1 230 VAL 230 300 300 VAL VAL A . n 
A 1 231 GLY 231 301 301 GLY GLY A . n 
A 1 232 ASN 232 302 302 ASN ASN A . n 
A 1 233 TYR 233 303 303 TYR TYR A . n 
A 1 234 SER 234 304 304 SER SER A . n 
A 1 235 ASN 235 305 305 ASN ASN A . n 
A 1 236 GLU 236 306 306 GLU GLU A . n 
A 1 237 GLN 237 307 307 GLN GLN A . n 
A 1 238 GLU 238 308 308 GLU GLU A . n 
A 1 239 GLN 239 309 309 GLN GLN A . n 
A 1 240 VAL 240 310 310 VAL VAL A . n 
A 1 241 LEU 241 311 311 LEU LEU A . n 
A 1 242 GLY 242 312 312 GLY GLY A . n 
A 1 243 GLN 243 313 313 GLN GLN A . n 
A 1 244 ILE 244 314 314 ILE ILE A . n 
A 1 245 VAL 245 315 315 VAL VAL A . n 
A 1 246 LEU 246 316 316 LEU LEU A . n 
A 1 247 ALA 247 317 317 ALA ALA A . n 
A 1 248 ASN 248 318 318 ASN ASN A . n 
A 1 249 PHE 249 319 319 PHE PHE A . n 
A 1 250 ALA 250 320 320 ALA ALA A . n 
A 1 251 ASN 251 321 321 ASN ASN A . n 
A 1 252 ASN 252 322 322 ASN ASN A . n 
A 1 253 GLU 253 323 323 GLU GLU A . n 
A 1 254 GLY 254 324 324 GLY GLY A . n 
A 1 255 LEU 255 325 325 LEU LEU A . n 
A 1 256 ALA 256 326 326 ALA ALA A . n 
A 1 257 SER 257 327 327 SER SER A . n 
A 1 258 GLN 258 328 328 GLN GLN A . n 
A 1 259 GLY 259 329 329 GLY GLY A . n 
A 1 260 ASP 260 330 330 ASP ASP A . n 
A 1 261 ASN 261 331 331 ASN ASN A . n 
A 1 262 VAL 262 332 332 VAL VAL A . n 
A 1 263 TRP 263 333 333 TRP TRP A . n 
A 1 264 ALA 264 334 334 ALA ALA A . n 
A 1 265 ALA 265 335 335 ALA ALA A . n 
A 1 266 THR 266 336 336 THR THR A . n 
A 1 267 GLN 267 337 337 GLN GLN A . n 
A 1 268 ALA 268 338 338 ALA ALA A . n 
A 1 269 SER 269 339 339 SER SER A . n 
A 1 270 GLY 270 340 340 GLY GLY A . n 
A 1 271 VAL 271 341 341 VAL VAL A . n 
A 1 272 ALA 272 342 342 ALA ALA A . n 
A 1 273 LEU 273 343 343 LEU LEU A . n 
A 1 274 LEU 274 344 344 LEU LEU A . n 
A 1 275 GLY 275 345 345 GLY GLY A . n 
A 1 276 THR 276 346 346 THR THR A . n 
A 1 277 ALA 277 347 347 ALA ALA A . n 
A 1 278 GLY 278 348 348 GLY GLY A . n 
A 1 279 SER 279 349 349 SER SER A . n 
A 1 280 GLY 280 350 350 GLY GLY A . n 
A 1 281 ASN 281 351 351 ASN ASN A . n 
A 1 282 PHE 282 352 352 PHE PHE A . n 
A 1 283 GLY 283 353 353 GLY GLY A . n 
A 1 284 LYS 284 354 354 LYS LYS A . n 
A 1 285 LEU 285 355 355 LEU LEU A . n 
A 1 286 THR 286 356 356 THR THR A . n 
A 1 287 ASN 287 357 357 ASN ASN A . n 
A 1 288 GLY 288 358 358 GLY GLY A . n 
A 1 289 ALA 289 359 359 ALA ALA A . n 
A 1 290 LEU 290 360 360 LEU LEU A . n 
A 1 291 GLU 291 361 361 GLU GLU A . n 
A 1 292 ALA 292 362 362 ALA ALA A . n 
A 1 293 SER 293 363 363 SER SER A . n 
A 1 294 ASN 294 364 ?   ?   ?   A . n 
A 1 295 VAL 295 365 ?   ?   ?   A . n 
A 1 296 ASP 296 366 ?   ?   ?   A . n 
A 1 297 LEU 297 367 ?   ?   ?   A . n 
A 1 298 SER 298 368 ?   ?   ?   A . n 
A 1 299 LYS 299 369 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-27 
2 'Structure model' 1 1 2014-02-05 
3 'Structure model' 1 2 2017-08-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Source and taxonomy'       
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' em_image_scans 
2 3 'Structure model' em_software    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_em_software.fitting_id'          
2 3 'Structure model' '_em_software.image_processing_id' 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_em_3d_fitting.id                1 
_em_3d_fitting.entry_id          2BGY 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         ? 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.details           ? 
_em_3d_fitting.method            ? 
# 
_em_3d_fitting_list.3d_fitting_id   1 
_em_3d_fitting_list.id              1 
_em_3d_fitting_list.pdb_entry_id    1WLG 
_em_3d_fitting_list.pdb_chain_id    ? 
_em_3d_fitting_list.details         ? 
# 
_em_3d_reconstruction.entry_id                    2BGY 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.resolution_method           'DIFFRACTION PATTERN/LAYERLINES' 
_em_3d_reconstruction.resolution                  9 
_em_3d_reconstruction.symmetry_type               HELICAL 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.details                     
'FIT OF S. TYPHIMURIUM HOOK CRYSTAL STRUCTURE PDB ID 1WLG INTO AN EM MAP OF HOOK FROM C. CRESCENTUS' 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               ? 
_em_3d_reconstruction.algorithm                   ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          '10 MM TRIS/HCL,5MM EDTA,0. 1%V/V TRITON X-100' 
_em_buffer.pH            8 
_em_buffer.details       '10 MM TRIS/HCL,5MM EDTA,0. 1%V/V TRITON X-100' 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 POLYHOOK 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_imaging.entry_id                        2BGY 
_em_imaging.id                              1 
_em_imaging.nominal_magnification           66000 
_em_imaging.nominal_defocus_min             1300 
_em_imaging.nominal_defocus_max             2700 
_em_imaging.microscope_model                'FEI/PHILIPS CM200FEG' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.specimen_id                     1 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.nominal_cs                      ? 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.calibrated_magnification        ? 
_em_imaging.accelerating_voltage            200 
_em_imaging.details                         ? 
_em_imaging.specimen_holder_type            . 
_em_imaging.specimen_holder_model           . 
_em_imaging.citation_id                     ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          'HOLEY CARBON' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
# 
_em_vitrification.entry_id              2BGY 
_em_vitrification.id                    1 
_em_vitrification.instrument            'HOMEMADE PLUNGER' 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.specimen_id           1 
_em_vitrification.details               'SAMPLES PREPARED AT 4 DEG C PLUNGED INTO LIQUID ETHANE' 
_em_vitrification.citation_id           ? 
_em_vitrification.humidity              ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                2BGY 
_em_experiment.id                      1 
_em_experiment.aggregation_state       '2D ARRAY' 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   CRYSTALLOGRAPHY 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CA  A PRO 139 ? ? N   A ASN 140 ? ? 1.19 
2 1 C   A PRO 139 ? ? CA  A ASN 140 ? ? 1.36 
3 1 CD1 A LEU 288 ? ? CA  A TYR 303 ? ? 1.73 
4 1 CG  A LEU 288 ? ? N   A VAL 289 ? ? 1.77 
5 1 CD2 A LEU 288 ? ? O   A ASN 302 ? ? 1.81 
6 1 CD1 A LEU 288 ? ? C   A TYR 303 ? ? 1.84 
7 1 CD1 A LEU 288 ? ? N   A SER 304 ? ? 1.98 
8 1 CD  A ARG 105 ? ? ND2 A ASN 140 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 124.60 120.30 4.30   0.50 N 
2 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH2 A ARG 105 ? ? 117.07 120.30 -3.23  0.50 N 
3 1 CA A PRO 139 ? ? C  A PRO 139 ? ? N   A ASN 140 ? ? 50.09  117.20 -67.11 2.20 Y 
4 1 O  A PRO 139 ? ? C  A PRO 139 ? ? N   A ASN 140 ? ? 157.54 122.70 34.84  1.60 Y 
5 1 C  A PRO 139 ? ? N  A ASN 140 ? ? CA  A ASN 140 ? ? 60.44  121.70 -61.26 2.50 Y 
6 1 CG A MET 143 ? ? SD A MET 143 ? ? CE  A MET 143 ? ? 109.84 100.20 9.64   1.60 N 
7 1 CB A LEU 288 ? ? CA A LEU 288 ? ? C   A LEU 288 ? ? 96.48  110.20 -13.72 1.90 N 
8 1 N  A VAL 289 ? ? CA A VAL 289 ? ? C   A VAL 289 ? ? 128.38 111.00 17.38  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 263 ? ? -39.61  131.58  
2 1 ASN A 264 ? ? 79.94   -0.33   
3 1 TYR A 283 ? ? -173.18 -162.77 
4 1 PRO A 285 ? ? -53.93  108.01  
5 1 LEU A 288 ? ? -114.11 -120.88 
6 1 VAL A 289 ? ? -148.19 -76.68  
7 1 ASP A 330 ? ? 50.17   -145.09 
8 1 ASN A 331 ? ? -110.00 45.51   
9 1 ASN A 357 ? ? -151.71 -55.40  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             PRO 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              139 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.96 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 364 ? A ASN 294 
2 1 Y 1 A VAL 365 ? A VAL 295 
3 1 Y 1 A ASP 366 ? A ASP 296 
4 1 Y 1 A LEU 367 ? A LEU 297 
5 1 Y 1 A SER 368 ? A SER 298 
6 1 Y 1 A LYS 369 ? A LYS 299 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.details                       ? 
_em_image_recording.id                            1 
_em_image_recording.avg_electron_dose_per_image   10 
_em_image_recording.film_or_detector_model        'KODAK SO-163 FILM' 
_em_image_recording.imaging_id                    1 
_em_image_recording.detector_mode                 ? 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_real_images               ? 
# 
loop_
_em_software.id 
_em_software.name 
_em_software.version 
_em_software.category 
_em_software.details 
_em_software.image_processing_id 
_em_software.imaging_id 
_em_software.fitting_id 
1 RSRef                      ? 'MODEL FITTING' ? ? ? 1 
2 'Brandeis Helical Package' ? RECONSTRUCTION  ? 1 ? ? 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.concentration           ? 
_em_specimen.vitrification_applied   YES 
_em_specimen.staining_applied        NO 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.details                 ? 
#