data_2BMV
# 
_entry.id   2BMV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BMV         
PDBE  EBI-23360    
WWPDB D_1290023360 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BMV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Martinez-Julvez, M.' 1 ? 
'Hermoso, J.A.'       2 ? 
'Sancho, J.'          3 ? 
'Perez-Dorado, I.'    4 ? 
'Cremades, N.'        5 ? 
'Bueno, M.'           6 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Common Conformational Changes in Flavodoxins Induced by Fmn and Anion Binding: The Structure of Helicobacter Pylori Apoflavodoxin.' 
Proteins      69  581 ? 2007 PSFGEY US 0887-3585 0867 ? 17623845 10.1002/PROT.21410        
1       'Towards a Nwe Therapeutic Target: Helicobacter Pylori Flavodoxin' Biophys.Chem. 115 267 ? 2005 BICIAZ NE 0301-4622 0829 ? 
15752617 10.1016/J.BPC.2004.12.045 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Martinez-Julvez, M.' 1  
primary 'Cremades, N.'        2  
primary 'Bueno, M.'           3  
primary 'Perez-Dorado, I.'    4  
primary 'Maya, C.'            5  
primary 'Cuesta-Lopez, S.'    6  
primary 'Prada, D.'           7  
primary 'Falo, F.'            8  
primary 'Hermoso, J.A.'       9  
primary 'Sancho, J.'          10 
1       'Cremades, N.'        11 
1       'Buen, M.'            12 
1       'Toja, M.'            13 
1       'Sancho, J.'          14 
# 
_cell.entry_id           2BMV 
_cell.length_a           36.610 
_cell.length_b           45.712 
_cell.length_c           86.652 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BMV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man FLAVODOXIN     17512.309 1   ? ? ? ? 
2 non-polymer syn BENZAMIDINE    120.152   1   ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION' 35.453    1   ? ? ? ? 
4 water       nat water          18.015    111 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNSFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKT
IGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFEASKAVEGGKFVGLVIDEDNQDDLTDERISKWVEQVK
GSFA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNSFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKT
IGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFEASKAVEGGKFVGLVIDEDNQDDLTDERISKWVEQVK
GSFA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   LYS n 
1 4   ILE n 
1 5   GLY n 
1 6   ILE n 
1 7   PHE n 
1 8   PHE n 
1 9   GLY n 
1 10  THR n 
1 11  ASP n 
1 12  SER n 
1 13  GLY n 
1 14  ASN n 
1 15  ALA n 
1 16  GLU n 
1 17  ALA n 
1 18  ILE n 
1 19  ALA n 
1 20  GLU n 
1 21  LYS n 
1 22  ILE n 
1 23  SER n 
1 24  LYS n 
1 25  ALA n 
1 26  ILE n 
1 27  GLY n 
1 28  ASN n 
1 29  ALA n 
1 30  GLU n 
1 31  VAL n 
1 32  VAL n 
1 33  ASP n 
1 34  VAL n 
1 35  ALA n 
1 36  LYS n 
1 37  ALA n 
1 38  SER n 
1 39  LYS n 
1 40  GLU n 
1 41  GLN n 
1 42  PHE n 
1 43  ASN n 
1 44  SER n 
1 45  PHE n 
1 46  THR n 
1 47  LYS n 
1 48  VAL n 
1 49  ILE n 
1 50  LEU n 
1 51  VAL n 
1 52  ALA n 
1 53  PRO n 
1 54  THR n 
1 55  ALA n 
1 56  GLY n 
1 57  ALA n 
1 58  GLY n 
1 59  ASP n 
1 60  LEU n 
1 61  GLN n 
1 62  THR n 
1 63  ASP n 
1 64  TRP n 
1 65  GLU n 
1 66  ASP n 
1 67  PHE n 
1 68  LEU n 
1 69  GLY n 
1 70  THR n 
1 71  LEU n 
1 72  GLU n 
1 73  ALA n 
1 74  SER n 
1 75  ASP n 
1 76  PHE n 
1 77  ALA n 
1 78  ASN n 
1 79  LYS n 
1 80  THR n 
1 81  ILE n 
1 82  GLY n 
1 83  LEU n 
1 84  VAL n 
1 85  GLY n 
1 86  LEU n 
1 87  GLY n 
1 88  ASP n 
1 89  GLN n 
1 90  ASP n 
1 91  THR n 
1 92  TYR n 
1 93  SER n 
1 94  GLU n 
1 95  THR n 
1 96  PHE n 
1 97  ALA n 
1 98  GLU n 
1 99  GLY n 
1 100 ILE n 
1 101 PHE n 
1 102 HIS n 
1 103 ILE n 
1 104 TYR n 
1 105 GLU n 
1 106 LYS n 
1 107 ALA n 
1 108 LYS n 
1 109 ALA n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 VAL n 
1 114 GLY n 
1 115 GLN n 
1 116 THR n 
1 117 SER n 
1 118 THR n 
1 119 ASP n 
1 120 GLY n 
1 121 TYR n 
1 122 HIS n 
1 123 PHE n 
1 124 GLU n 
1 125 ALA n 
1 126 SER n 
1 127 LYS n 
1 128 ALA n 
1 129 VAL n 
1 130 GLU n 
1 131 GLY n 
1 132 GLY n 
1 133 LYS n 
1 134 PHE n 
1 135 VAL n 
1 136 GLY n 
1 137 LEU n 
1 138 VAL n 
1 139 ILE n 
1 140 ASP n 
1 141 GLU n 
1 142 ASP n 
1 143 ASN n 
1 144 GLN n 
1 145 ASP n 
1 146 ASP n 
1 147 LEU n 
1 148 THR n 
1 149 ASP n 
1 150 GLU n 
1 151 ARG n 
1 152 ILE n 
1 153 SER n 
1 154 LYS n 
1 155 TRP n 
1 156 VAL n 
1 157 GLU n 
1 158 GLN n 
1 159 VAL n 
1 160 LYS n 
1 161 GLY n 
1 162 SER n 
1 163 PHE n 
1 164 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HELICOBACTER PYLORI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     210 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'THE GENE THAT WAS EXPRESSED TO OBTAIN THE PROTEIN WAS ISOLATED FROM A PATIENT INFECTED WITH H.PYLORI SP.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FLAV_HELPY 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O25776 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2BMV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 164 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O25776 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  164 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       164 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2BMV ASN A 78  ? UNP O25776 THR 78  conflict 78  1 
1 2BMV SER A 117 ? UNP O25776 PRO 117 conflict 117 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BEN non-polymer         . BENZAMIDINE     ? 'C7 H8 N2'       120.152 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BMV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRUCKER-NONIUS 
_diffrn_detector.pdbx_collection_date   2004-10-25 
_diffrn_detector.details                'MONTEL MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ROTATING ANODE' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BMV 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.300 
_reflns.d_resolution_high            2.040 
_reflns.number_obs                   9402 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.17000 
_reflns.pdbx_Rsym_value              0.17000 
_reflns.pdbx_netI_over_sigmaI        11.8000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.100 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.11 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   90.4 
_reflns_shell.Rmerge_I_obs           0.56000 
_reflns_shell.pdbx_Rsym_value        0.56000 
_reflns_shell.meanI_over_sigI_obs    1.300 
_reflns_shell.pdbx_redundancy        1.80 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BMV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     8016 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             9.00 
_refine.ls_d_res_high                            2.11 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.288 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.200 
_refine.ls_number_reflns_R_free                  625 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.875 
_refine.B_iso_mean                               19.55 
_refine.aniso_B[1][1]                            -0.49000 
_refine.aniso_B[2][2]                            0.09000 
_refine.aniso_B[3][3]                            0.40000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1FUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.311 
_refine.pdbx_overall_ESU_R_Free                  0.256 
_refine.overall_SU_ML                            0.184 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.122 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1228 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               1349 
_refine_hist.d_res_high                       2.11 
_refine_hist.d_res_low                        9.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014 0.021 ? 1256 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 1095 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.464 1.942 ? 1693 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.829 3.000 ? 2561 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.729 5.000 ? 162  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.087 0.200 ? 187  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005 0.020 ? 1440 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002 0.020 ? 252  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.218 0.200 ? 284  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.249 0.200 ? 1244 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088 0.200 ? 716  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.192 0.200 ? 84   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.251 0.200 ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.216 0.200 ? 33   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.233 0.200 ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.639 1.500 ? 799  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.177 2.000 ? 1266 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.977 3.000 ? 457  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.077 4.500 ? 427  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.11 
_refine_ls_shell.d_res_low                        2.16 
_refine_ls_shell.number_reflns_R_work             520 
_refine_ls_shell.R_factor_R_work                  0.2590 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3510 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  2BMV 
_struct.title                     'Apoflavodoxin from Helicobacter pylori' 
_struct.pdbx_descriptor           FLAVODOXIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BMV 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ELECTRON TRANSPORT, FLAVOPROTEIN, HELICOBACTER PYLORI, FMN, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 13  ? GLY A 27  ? GLY A 13  GLY A 27  1 ? 15 
HELX_P HELX_P2 2 ALA A 35  ? ALA A 37  ? ALA A 35  ALA A 37  5 ? 3  
HELX_P HELX_P3 3 SER A 38  ? ASN A 43  ? SER A 38  ASN A 43  1 ? 6  
HELX_P HELX_P4 4 GLN A 61  ? GLY A 69  ? GLN A 61  GLY A 69  1 ? 9  
HELX_P HELX_P5 5 ALA A 73  ? ASN A 78  ? ALA A 73  ASN A 78  1 ? 6  
HELX_P HELX_P6 6 GLU A 98  ? LYS A 108 ? GLU A 98  LYS A 108 1 ? 11 
HELX_P HELX_P7 7 GLN A 144 ? ASP A 146 ? GLN A 144 ASP A 146 5 ? 3  
HELX_P HELX_P8 8 LEU A 147 ? LYS A 160 ? LEU A 147 LYS A 160 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ALA A 29  ? ASP A 33  ? ALA A 29  ASP A 33  
AA 2 ILE A 4   ? PHE A 8   ? ILE A 4   PHE A 8   
AA 3 LYS A 47  ? ALA A 55  ? LYS A 47  ALA A 55  
AA 4 THR A 80  ? LEU A 86  ? THR A 80  LEU A 86  
AB 1 ALA A 29  ? ASP A 33  ? ALA A 29  ASP A 33  
AB 2 ILE A 4   ? PHE A 8   ? ILE A 4   PHE A 8   
AB 3 LYS A 47  ? ALA A 55  ? LYS A 47  ALA A 55  
AB 4 ASP A 59  ? LEU A 60  ? ASP A 59  LEU A 60  
AC 1 THR A 116 ? SER A 117 ? THR A 116 SER A 117 
AC 2 LYS A 133 ? PHE A 134 ? LYS A 133 PHE A 134 
AC 3 VAL A 129 ? GLU A 130 ? VAL A 129 GLU A 130 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 30  ? N GLU A 30  O ILE A 4   ? O ILE A 4   
AA 2 3 N GLY A 5   ? N GLY A 5   O LYS A 47  ? O LYS A 47  
AA 3 4 N VAL A 48  ? N VAL A 48  O THR A 80  ? O THR A 80  
AB 1 2 N GLU A 30  ? N GLU A 30  O ILE A 4   ? O ILE A 4   
AB 2 3 N GLY A 5   ? N GLY A 5   O LYS A 47  ? O LYS A 47  
AB 3 4 N ALA A 55  ? N ALA A 55  O ASP A 59  ? O ASP A 59  
AC 1 2 N THR A 116 ? N THR A 116 O PHE A 134 ? O PHE A 134 
AC 2 3 N LYS A 133 ? N LYS A 133 O GLU A 130 ? O GLU A 130 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A1166'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE BEN A1165' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 THR A 10 ? THR A 10   . ? 1_555 ? 
2  AC1 5 SER A 12 ? SER A 12   . ? 1_555 ? 
3  AC1 5 ALA A 15 ? ALA A 15   . ? 1_555 ? 
4  AC1 5 PRO A 53 ? PRO A 53   . ? 1_555 ? 
5  AC1 5 HOH D .  ? HOH A 2005 . ? 1_555 ? 
6  AC2 7 GLY A 2  ? GLY A 2    . ? 1_555 ? 
7  AC2 7 GLU A 30 ? GLU A 30   . ? 1_555 ? 
8  AC2 7 VAL A 34 ? VAL A 34   . ? 1_555 ? 
9  AC2 7 ALA A 37 ? ALA A 37   . ? 1_555 ? 
10 AC2 7 ASP A 66 ? ASP A 66   . ? 1_555 ? 
11 AC2 7 THR A 70 ? THR A 70   . ? 1_555 ? 
12 AC2 7 HOH D .  ? HOH A 2111 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2BMV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BMV 
_atom_sites.fract_transf_matrix[1][1]   0.027315 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021876 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011540 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 2   ? 21.149  32.205 36.032 1.00 32.18 ? 2    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 2   ? 21.212  33.638 35.593 1.00 31.69 ? 2    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 2   ? 19.833  34.146 35.218 1.00 31.44 ? 2    GLY A C   1 
ATOM   4    O  O   . GLY A 1 2   ? 19.257  34.923 35.962 1.00 32.88 ? 2    GLY A O   1 
ATOM   5    N  N   . LYS A 1 3   ? 19.268  33.648 34.114 1.00 29.89 ? 3    LYS A N   1 
ATOM   6    C  CA  . LYS A 1 3   ? 18.175  34.332 33.441 1.00 28.34 ? 3    LYS A CA  1 
ATOM   7    C  C   . LYS A 1 3   ? 17.006  33.432 32.976 1.00 26.61 ? 3    LYS A C   1 
ATOM   8    O  O   . LYS A 1 3   ? 15.927  33.959 32.732 1.00 26.38 ? 3    LYS A O   1 
ATOM   9    C  CB  . LYS A 1 3   ? 18.752  35.203 32.300 1.00 28.72 ? 3    LYS A CB  1 
ATOM   10   C  CG  . LYS A 1 3   ? 18.290  34.881 30.862 1.00 30.26 ? 3    LYS A CG  1 
ATOM   11   C  CD  . LYS A 1 3   ? 19.143  35.563 29.782 1.00 31.88 ? 3    LYS A CD  1 
ATOM   12   C  CE  . LYS A 1 3   ? 19.238  37.098 29.917 1.00 33.35 ? 3    LYS A CE  1 
ATOM   13   N  NZ  . LYS A 1 3   ? 18.011  37.746 30.502 1.00 34.01 ? 3    LYS A NZ  1 
ATOM   14   N  N   . ILE A 1 4   ? 17.189  32.111 32.858 1.00 24.81 ? 4    ILE A N   1 
ATOM   15   C  CA  . ILE A 1 4   ? 16.028  31.200 32.817 1.00 23.53 ? 4    ILE A CA  1 
ATOM   16   C  C   . ILE A 1 4   ? 15.529  30.927 34.240 1.00 22.06 ? 4    ILE A C   1 
ATOM   17   O  O   . ILE A 1 4   ? 16.277  30.474 35.085 1.00 22.04 ? 4    ILE A O   1 
ATOM   18   C  CB  . ILE A 1 4   ? 16.338  29.864 32.113 1.00 23.48 ? 4    ILE A CB  1 
ATOM   19   C  CG1 . ILE A 1 4   ? 16.816  30.076 30.676 1.00 23.19 ? 4    ILE A CG1 1 
ATOM   20   C  CG2 . ILE A 1 4   ? 15.089  28.992 32.053 1.00 24.25 ? 4    ILE A CG2 1 
ATOM   21   C  CD1 . ILE A 1 4   ? 17.338  28.785 30.009 1.00 21.77 ? 4    ILE A CD1 1 
ATOM   22   N  N   . GLY A 1 5   ? 14.260  31.200 34.503 1.00 20.09 ? 5    GLY A N   1 
ATOM   23   C  CA  . GLY A 1 5   ? 13.661  30.868 35.791 1.00 19.45 ? 5    GLY A CA  1 
ATOM   24   C  C   . GLY A 1 5   ? 12.880  29.553 35.759 1.00 18.75 ? 5    GLY A C   1 
ATOM   25   O  O   . GLY A 1 5   ? 11.886  29.418 35.045 1.00 18.48 ? 5    GLY A O   1 
ATOM   26   N  N   . ILE A 1 6   ? 13.331  28.590 36.548 1.00 17.40 ? 6    ILE A N   1 
ATOM   27   C  CA  . ILE A 1 6   ? 12.715  27.267 36.599 1.00 17.65 ? 6    ILE A CA  1 
ATOM   28   C  C   . ILE A 1 6   ? 11.998  27.168 37.951 1.00 17.45 ? 6    ILE A C   1 
ATOM   29   O  O   . ILE A 1 6   ? 12.631  27.081 39.017 1.00 17.36 ? 6    ILE A O   1 
ATOM   30   C  CB  . ILE A 1 6   ? 13.761  26.160 36.382 1.00 17.21 ? 6    ILE A CB  1 
ATOM   31   C  CG1 . ILE A 1 6   ? 14.561  26.448 35.085 1.00 17.96 ? 6    ILE A CG1 1 
ATOM   32   C  CG2 . ILE A 1 6   ? 13.096  24.798 36.316 1.00 17.59 ? 6    ILE A CG2 1 
ATOM   33   C  CD1 . ILE A 1 6   ? 15.725  25.489 34.779 1.00 17.73 ? 6    ILE A CD1 1 
ATOM   34   N  N   . PHE A 1 7   ? 10.672  27.292 37.857 1.00 17.16 ? 7    PHE A N   1 
ATOM   35   C  CA  . PHE A 1 7   ? 9.734   27.273 38.973 1.00 16.21 ? 7    PHE A CA  1 
ATOM   36   C  C   . PHE A 1 7   ? 9.149   25.895 39.173 1.00 15.46 ? 7    PHE A C   1 
ATOM   37   O  O   . PHE A 1 7   ? 8.554   25.355 38.270 1.00 14.93 ? 7    PHE A O   1 
ATOM   38   C  CB  . PHE A 1 7   ? 8.606   28.256 38.683 1.00 15.89 ? 7    PHE A CB  1 
ATOM   39   C  CG  . PHE A 1 7   ? 9.051   29.670 38.743 1.00 15.13 ? 7    PHE A CG  1 
ATOM   40   C  CD1 . PHE A 1 7   ? 9.528   30.322 37.610 1.00 17.91 ? 7    PHE A CD1 1 
ATOM   41   C  CD2 . PHE A 1 7   ? 9.100   30.331 39.952 1.00 15.82 ? 7    PHE A CD2 1 
ATOM   42   C  CE1 . PHE A 1 7   ? 9.982   31.668 37.690 1.00 18.27 ? 7    PHE A CE1 1 
ATOM   43   C  CE2 . PHE A 1 7   ? 9.535   31.654 40.031 1.00 16.68 ? 7    PHE A CE2 1 
ATOM   44   C  CZ  . PHE A 1 7   ? 9.977   32.317 38.904 1.00 19.03 ? 7    PHE A CZ  1 
ATOM   45   N  N   . PHE A 1 8   ? 9.338   25.338 40.373 1.00 14.90 ? 8    PHE A N   1 
ATOM   46   C  CA  . PHE A 1 8   ? 8.778   24.068 40.726 1.00 14.94 ? 8    PHE A CA  1 
ATOM   47   C  C   . PHE A 1 8   ? 7.892   24.182 41.967 1.00 15.14 ? 8    PHE A C   1 
ATOM   48   O  O   . PHE A 1 8   ? 8.034   25.088 42.765 1.00 15.10 ? 8    PHE A O   1 
ATOM   49   C  CB  . PHE A 1 8   ? 9.878   23.031 40.997 1.00 14.21 ? 8    PHE A CB  1 
ATOM   50   C  CG  . PHE A 1 8   ? 10.557  23.208 42.334 1.00 13.98 ? 8    PHE A CG  1 
ATOM   51   C  CD1 . PHE A 1 8   ? 10.033  22.623 43.481 1.00 15.85 ? 8    PHE A CD1 1 
ATOM   52   C  CD2 . PHE A 1 8   ? 11.712  23.981 42.444 1.00 15.31 ? 8    PHE A CD2 1 
ATOM   53   C  CE1 . PHE A 1 8   ? 10.648  22.808 44.719 1.00 14.87 ? 8    PHE A CE1 1 
ATOM   54   C  CE2 . PHE A 1 8   ? 12.337  24.162 43.694 1.00 15.50 ? 8    PHE A CE2 1 
ATOM   55   C  CZ  . PHE A 1 8   ? 11.814  23.583 44.812 1.00 13.50 ? 8    PHE A CZ  1 
ATOM   56   N  N   . GLY A 1 9   ? 6.994   23.217 42.076 1.00 15.09 ? 9    GLY A N   1 
ATOM   57   C  CA  . GLY A 1 9   ? 6.152   22.984 43.226 1.00 15.50 ? 9    GLY A CA  1 
ATOM   58   C  C   . GLY A 1 9   ? 6.125   21.477 43.392 1.00 14.90 ? 9    GLY A C   1 
ATOM   59   O  O   . GLY A 1 9   ? 6.124   20.752 42.409 1.00 15.29 ? 9    GLY A O   1 
ATOM   60   N  N   . THR A 1 10  ? 6.151   20.998 44.625 1.00 15.12 ? 10   THR A N   1 
ATOM   61   C  CA  . THR A 1 10  ? 6.240   19.576 44.873 1.00 14.88 ? 10   THR A CA  1 
ATOM   62   C  C   . THR A 1 10  ? 5.733   19.183 46.263 1.00 16.17 ? 10   THR A C   1 
ATOM   63   O  O   . THR A 1 10  ? 5.914   19.906 47.198 1.00 15.09 ? 10   THR A O   1 
ATOM   64   C  CB  . THR A 1 10  ? 7.705   19.136 44.681 1.00 14.45 ? 10   THR A CB  1 
ATOM   65   O  OG1 . THR A 1 10  ? 7.777   17.712 44.771 1.00 12.34 ? 10   THR A OG1 1 
ATOM   66   C  CG2 . THR A 1 10  ? 8.605   19.675 45.781 1.00 14.20 ? 10   THR A CG2 1 
ATOM   67   N  N   . ASP A 1 11  ? 5.035   18.052 46.341 1.00 17.27 ? 11   ASP A N   1 
ATOM   68   C  CA  . ASP A 1 11  ? 4.735   17.372 47.602 1.00 18.57 ? 11   ASP A CA  1 
ATOM   69   C  C   . ASP A 1 11  ? 5.736   16.248 47.921 1.00 18.46 ? 11   ASP A C   1 
ATOM   70   O  O   . ASP A 1 11  ? 5.965   15.982 49.066 1.00 18.97 ? 11   ASP A O   1 
ATOM   71   C  CB  . ASP A 1 11  ? 3.362   16.712 47.534 1.00 18.77 ? 11   ASP A CB  1 
ATOM   72   C  CG  . ASP A 1 11  ? 2.245   17.692 47.518 1.00 19.78 ? 11   ASP A CG  1 
ATOM   73   O  OD1 . ASP A 1 11  ? 2.328   18.739 48.212 1.00 18.86 ? 11   ASP A OD1 1 
ATOM   74   O  OD2 . ASP A 1 11  ? 1.226   17.446 46.824 1.00 22.64 ? 11   ASP A OD2 1 
ATOM   75   N  N   . SER A 1 12  ? 6.305   15.596 46.900 1.00 18.92 ? 12   SER A N   1 
ATOM   76   C  CA  . SER A 1 12  ? 7.144   14.387 47.081 1.00 18.59 ? 12   SER A CA  1 
ATOM   77   C  C   . SER A 1 12  ? 8.628   14.672 46.960 1.00 18.12 ? 12   SER A C   1 
ATOM   78   O  O   . SER A 1 12  ? 9.455   13.874 47.433 1.00 19.12 ? 12   SER A O   1 
ATOM   79   C  CB  . SER A 1 12  ? 6.780   13.316 46.050 1.00 18.79 ? 12   SER A CB  1 
ATOM   80   O  OG  . SER A 1 12  ? 7.396   13.568 44.783 1.00 19.85 ? 12   SER A OG  1 
ATOM   81   N  N   . GLY A 1 13  ? 8.954   15.817 46.362 1.00 16.82 ? 13   GLY A N   1 
ATOM   82   C  CA  . GLY A 1 13  ? 10.321  16.182 46.029 1.00 16.10 ? 13   GLY A CA  1 
ATOM   83   C  C   . GLY A 1 13  ? 10.791  15.877 44.623 1.00 15.49 ? 13   GLY A C   1 
ATOM   84   O  O   . GLY A 1 13  ? 11.823  16.400 44.204 1.00 14.87 ? 13   GLY A O   1 
ATOM   85   N  N   . ASN A 1 14  ? 10.054  15.040 43.892 1.00 14.95 ? 14   ASN A N   1 
ATOM   86   C  CA  . ASN A 1 14  ? 10.449  14.640 42.541 1.00 15.06 ? 14   ASN A CA  1 
ATOM   87   C  C   . ASN A 1 14  ? 10.429  15.806 41.539 1.00 14.97 ? 14   ASN A C   1 
ATOM   88   O  O   . ASN A 1 14  ? 11.263  15.863 40.643 1.00 14.73 ? 14   ASN A O   1 
ATOM   89   C  CB  . ASN A 1 14  ? 9.546   13.516 42.012 1.00 15.63 ? 14   ASN A CB  1 
ATOM   90   C  CG  . ASN A 1 14  ? 9.918   12.119 42.563 1.00 16.02 ? 14   ASN A CG  1 
ATOM   91   O  OD1 . ASN A 1 14  ? 9.096   11.193 42.521 1.00 18.70 ? 14   ASN A OD1 1 
ATOM   92   N  ND2 . ASN A 1 14  ? 11.142  11.965 43.060 1.00 14.24 ? 14   ASN A ND2 1 
ATOM   93   N  N   . ALA A 1 15  ? 9.524   16.756 41.703 1.00 14.11 ? 15   ALA A N   1 
ATOM   94   C  CA  . ALA A 1 15  ? 9.508   17.914 40.804 1.00 14.91 ? 15   ALA A CA  1 
ATOM   95   C  C   . ALA A 1 15  ? 10.742  18.846 40.987 1.00 14.76 ? 15   ALA A C   1 
ATOM   96   O  O   . ALA A 1 15  ? 11.223  19.453 40.007 1.00 15.37 ? 15   ALA A O   1 
ATOM   97   C  CB  . ALA A 1 15  ? 8.215   18.704 40.945 1.00 14.12 ? 15   ALA A CB  1 
ATOM   98   N  N   . GLU A 1 16  ? 11.246  18.940 42.207 1.00 14.40 ? 16   GLU A N   1 
ATOM   99   C  CA  . GLU A 1 16  ? 12.452  19.742 42.476 1.00 15.29 ? 16   GLU A CA  1 
ATOM   100  C  C   . GLU A 1 16  ? 13.657  19.095 41.818 1.00 15.34 ? 16   GLU A C   1 
ATOM   101  O  O   . GLU A 1 16  ? 14.432  19.761 41.135 1.00 15.69 ? 16   GLU A O   1 
ATOM   102  C  CB  . GLU A 1 16  ? 12.705  19.882 43.981 1.00 14.54 ? 16   GLU A CB  1 
ATOM   103  C  CG  . GLU A 1 16  ? 13.951  20.687 44.309 1.00 13.88 ? 16   GLU A CG  1 
ATOM   104  C  CD  . GLU A 1 16  ? 14.076  21.123 45.757 1.00 14.30 ? 16   GLU A CD  1 
ATOM   105  O  OE1 . GLU A 1 16  ? 13.290  20.703 46.615 1.00 14.75 ? 16   GLU A OE1 1 
ATOM   106  O  OE2 . GLU A 1 16  ? 15.004  21.894 46.030 1.00 14.26 ? 16   GLU A OE2 1 
ATOM   107  N  N   . ALA A 1 17  ? 13.767  17.779 41.996 1.00 15.77 ? 17   ALA A N   1 
ATOM   108  C  CA  . ALA A 1 17  ? 14.866  17.005 41.446 1.00 15.50 ? 17   ALA A CA  1 
ATOM   109  C  C   . ALA A 1 17  ? 14.798  17.039 39.924 1.00 15.16 ? 17   ALA A C   1 
ATOM   110  O  O   . ALA A 1 17  ? 15.839  17.091 39.279 1.00 15.23 ? 17   ALA A O   1 
ATOM   111  C  CB  . ALA A 1 17  ? 14.840  15.571 41.972 1.00 15.23 ? 17   ALA A CB  1 
ATOM   112  N  N   . ILE A 1 18  ? 13.591  17.078 39.356 1.00 14.67 ? 18   ILE A N   1 
ATOM   113  C  CA  . ILE A 1 18  ? 13.453  17.235 37.893 1.00 15.52 ? 18   ILE A CA  1 
ATOM   114  C  C   . ILE A 1 18  ? 13.904  18.649 37.434 1.00 16.43 ? 18   ILE A C   1 
ATOM   115  O  O   . ILE A 1 18  ? 14.613  18.794 36.437 1.00 16.36 ? 18   ILE A O   1 
ATOM   116  C  CB  . ILE A 1 18  ? 12.005  16.984 37.404 1.00 15.53 ? 18   ILE A CB  1 
ATOM   117  C  CG1 . ILE A 1 18  ? 11.549  15.542 37.706 1.00 15.86 ? 18   ILE A CG1 1 
ATOM   118  C  CG2 . ILE A 1 18  ? 11.857  17.312 35.907 1.00 13.34 ? 18   ILE A CG2 1 
ATOM   119  C  CD1 . ILE A 1 18  ? 12.235  14.500 36.952 1.00 15.43 ? 18   ILE A CD1 1 
ATOM   120  N  N   . ALA A 1 19  ? 13.488  19.659 38.181 1.00 16.46 ? 19   ALA A N   1 
ATOM   121  C  CA  . ALA A 1 19  ? 13.879  21.027 37.904 1.00 17.46 ? 19   ALA A CA  1 
ATOM   122  C  C   . ALA A 1 19  ? 15.381  21.176 37.857 1.00 18.04 ? 19   ALA A C   1 
ATOM   123  O  O   . ALA A 1 19  ? 15.857  21.923 37.018 1.00 18.34 ? 19   ALA A O   1 
ATOM   124  C  CB  . ALA A 1 19  ? 13.328  21.942 38.929 1.00 17.28 ? 19   ALA A CB  1 
ATOM   125  N  N   . GLU A 1 20  ? 16.096  20.526 38.788 1.00 17.98 ? 20   GLU A N   1 
ATOM   126  C  CA  . GLU A 1 20  ? 17.537  20.675 38.896 1.00 18.69 ? 20   GLU A CA  1 
ATOM   127  C  C   . GLU A 1 20  ? 18.224  19.981 37.739 1.00 18.99 ? 20   GLU A C   1 
ATOM   128  O  O   . GLU A 1 20  ? 19.211  20.494 37.244 1.00 18.82 ? 20   GLU A O   1 
ATOM   129  C  CB  . GLU A 1 20  ? 18.101  20.091 40.214 1.00 19.33 ? 20   GLU A CB  1 
ATOM   130  C  CG  . GLU A 1 20  ? 17.696  20.861 41.460 1.00 20.67 ? 20   GLU A CG  1 
ATOM   131  C  CD  . GLU A 1 20  ? 18.334  22.225 41.583 1.00 21.94 ? 20   GLU A CD  1 
ATOM   132  O  OE1 . GLU A 1 20  ? 17.935  22.959 42.519 1.00 22.68 ? 20   GLU A OE1 1 
ATOM   133  O  OE2 . GLU A 1 20  ? 19.237  22.557 40.776 1.00 23.83 ? 20   GLU A OE2 1 
ATOM   134  N  N   . LYS A 1 21  ? 17.725  18.804 37.357 1.00 18.65 ? 21   LYS A N   1 
ATOM   135  C  CA  . LYS A 1 21  ? 18.245  18.064 36.212 1.00 19.62 ? 21   LYS A CA  1 
ATOM   136  C  C   . LYS A 1 21  ? 18.131  18.906 34.944 1.00 18.95 ? 21   LYS A C   1 
ATOM   137  O  O   . LYS A 1 21  ? 19.090  19.022 34.196 1.00 18.00 ? 21   LYS A O   1 
ATOM   138  C  CB  . LYS A 1 21  ? 17.516  16.722 36.047 1.00 20.35 ? 21   LYS A CB  1 
ATOM   139  C  CG  . LYS A 1 21  ? 17.911  15.668 37.108 1.00 22.50 ? 21   LYS A CG  1 
ATOM   140  C  CD  . LYS A 1 21  ? 16.951  14.444 37.094 1.00 24.99 ? 21   LYS A CD  1 
ATOM   141  C  CE  . LYS A 1 21  ? 17.634  13.135 37.485 1.00 27.25 ? 21   LYS A CE  1 
ATOM   142  N  NZ  . LYS A 1 21  ? 16.778  11.963 37.113 1.00 27.61 ? 21   LYS A NZ  1 
ATOM   143  N  N   . ILE A 1 22  ? 16.984  19.551 34.770 1.00 18.01 ? 22   ILE A N   1 
ATOM   144  C  CA  . ILE A 1 22  ? 16.749  20.439 33.638 1.00 18.04 ? 22   ILE A CA  1 
ATOM   145  C  C   . ILE A 1 22  ? 17.702  21.627 33.686 1.00 17.97 ? 22   ILE A C   1 
ATOM   146  O  O   . ILE A 1 22  ? 18.325  21.969 32.697 1.00 18.49 ? 22   ILE A O   1 
ATOM   147  C  CB  . ILE A 1 22  ? 15.313  20.978 33.645 1.00 17.89 ? 22   ILE A CB  1 
ATOM   148  C  CG1 . ILE A 1 22  ? 14.337  19.850 33.395 1.00 17.63 ? 22   ILE A CG1 1 
ATOM   149  C  CG2 . ILE A 1 22  ? 15.132  22.032 32.562 1.00 15.88 ? 22   ILE A CG2 1 
ATOM   150  C  CD1 . ILE A 1 22  ? 12.901  20.308 33.457 1.00 20.15 ? 22   ILE A CD1 1 
ATOM   151  N  N   . SER A 1 23  ? 17.801  22.239 34.850 1.00 18.08 ? 23   SER A N   1 
ATOM   152  C  CA  . SER A 1 23  ? 18.712  23.342 35.065 1.00 17.91 ? 23   SER A CA  1 
ATOM   153  C  C   . SER A 1 23  ? 20.171  23.003 34.689 1.00 17.39 ? 23   SER A C   1 
ATOM   154  O  O   . SER A 1 23  ? 20.863  23.827 34.078 1.00 17.99 ? 23   SER A O   1 
ATOM   155  C  CB  . SER A 1 23  ? 18.629  23.824 36.524 1.00 17.59 ? 23   SER A CB  1 
ATOM   156  O  OG  . SER A 1 23  ? 19.571  24.871 36.758 1.00 17.14 ? 23   SER A OG  1 
ATOM   157  N  N   . LYS A 1 24  ? 20.640  21.812 35.037 1.00 18.21 ? 24   LYS A N   1 
ATOM   158  C  CA  . LYS A 1 24  ? 22.039  21.402 34.725 1.00 19.25 ? 24   LYS A CA  1 
ATOM   159  C  C   . LYS A 1 24  ? 22.223  21.175 33.238 1.00 18.68 ? 24   LYS A C   1 
ATOM   160  O  O   . LYS A 1 24  ? 23.255  21.508 32.660 1.00 17.22 ? 24   LYS A O   1 
ATOM   161  C  CB  . LYS A 1 24  ? 22.445  20.127 35.472 1.00 20.32 ? 24   LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 24  ? 22.452  20.269 36.993 1.00 24.62 ? 24   LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 24  ? 23.871  20.473 37.536 1.00 30.15 ? 24   LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 24  ? 23.819  20.915 39.008 1.00 32.61 ? 24   LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 24  ? 23.589  22.411 39.178 1.00 34.52 ? 24   LYS A NZ  1 
ATOM   166  N  N   . ALA A 1 25  ? 21.192  20.595 32.638 1.00 19.41 ? 25   ALA A N   1 
ATOM   167  C  CA  . ALA A 1 25  ? 21.134  20.369 31.202 1.00 20.06 ? 25   ALA A CA  1 
ATOM   168  C  C   . ALA A 1 25  ? 21.188  21.683 30.383 1.00 20.21 ? 25   ALA A C   1 
ATOM   169  O  O   . ALA A 1 25  ? 22.088  21.837 29.577 1.00 20.75 ? 25   ALA A O   1 
ATOM   170  C  CB  . ALA A 1 25  ? 19.909  19.551 30.849 1.00 19.67 ? 25   ALA A CB  1 
ATOM   171  N  N   . ILE A 1 26  ? 20.273  22.626 30.624 1.00 20.52 ? 26   ILE A N   1 
ATOM   172  C  CA  . ILE A 1 26  ? 20.096  23.810 29.754 1.00 19.76 ? 26   ILE A CA  1 
ATOM   173  C  C   . ILE A 1 26  ? 21.098  24.910 30.052 1.00 20.39 ? 26   ILE A C   1 
ATOM   174  O  O   . ILE A 1 26  ? 21.579  25.559 29.125 1.00 20.20 ? 26   ILE A O   1 
ATOM   175  C  CB  . ILE A 1 26  ? 18.637  24.348 29.843 1.00 19.89 ? 26   ILE A CB  1 
ATOM   176  C  CG1 . ILE A 1 26  ? 18.291  25.244 28.652 1.00 20.94 ? 26   ILE A CG1 1 
ATOM   177  C  CG2 . ILE A 1 26  ? 18.358  25.102 31.142 1.00 18.05 ? 26   ILE A CG2 1 
ATOM   178  C  CD1 . ILE A 1 26  ? 16.788  25.469 28.506 1.00 19.99 ? 26   ILE A CD1 1 
ATOM   179  N  N   . GLY A 1 27  ? 21.450  25.075 31.327 1.00 20.78 ? 27   GLY A N   1 
ATOM   180  C  CA  . GLY A 1 27  ? 22.372  26.125 31.776 1.00 21.06 ? 27   GLY A CA  1 
ATOM   181  C  C   . GLY A 1 27  ? 21.644  27.453 31.999 1.00 21.09 ? 27   GLY A C   1 
ATOM   182  O  O   . GLY A 1 27  ? 20.473  27.575 31.616 1.00 21.64 ? 27   GLY A O   1 
ATOM   183  N  N   . ASN A 1 28  ? 22.332  28.406 32.634 1.00 21.05 ? 28   ASN A N   1 
ATOM   184  C  CA  . ASN A 1 28  ? 21.897  29.806 32.798 1.00 21.38 ? 28   ASN A CA  1 
ATOM   185  C  C   . ASN A 1 28  ? 20.515  29.944 33.443 1.00 20.78 ? 28   ASN A C   1 
ATOM   186  O  O   . ASN A 1 28  ? 19.716  30.786 33.053 1.00 21.33 ? 28   ASN A O   1 
ATOM   187  C  CB  . ASN A 1 28  ? 21.956  30.542 31.439 1.00 22.59 ? 28   ASN A CB  1 
ATOM   188  C  CG  . ASN A 1 28  ? 21.680  32.067 31.544 1.00 22.74 ? 28   ASN A CG  1 
ATOM   189  O  OD1 . ASN A 1 28  ? 20.943  32.629 30.725 1.00 27.50 ? 28   ASN A OD1 1 
ATOM   190  N  ND2 . ASN A 1 28  ? 22.285  32.725 32.521 1.00 25.00 ? 28   ASN A ND2 1 
ATOM   191  N  N   . ALA A 1 29  ? 20.233  29.094 34.420 1.00 19.35 ? 29   ALA A N   1 
ATOM   192  C  CA  . ALA A 1 29  ? 18.908  29.030 35.002 1.00 18.63 ? 29   ALA A CA  1 
ATOM   193  C  C   . ALA A 1 29  ? 19.023  29.220 36.497 1.00 17.82 ? 29   ALA A C   1 
ATOM   194  O  O   . ALA A 1 29  ? 20.086  29.076 37.059 1.00 15.10 ? 29   ALA A O   1 
ATOM   195  C  CB  . ALA A 1 29  ? 18.235  27.708 34.707 1.00 18.20 ? 29   ALA A CB  1 
ATOM   196  N  N   . GLU A 1 30  ? 17.888  29.567 37.092 1.00 17.70 ? 30   GLU A N   1 
ATOM   197  C  CA  . GLU A 1 30  ? 17.701  29.630 38.518 1.00 17.53 ? 30   GLU A CA  1 
ATOM   198  C  C   . GLU A 1 30  ? 16.505  28.744 38.852 1.00 16.94 ? 30   GLU A C   1 
ATOM   199  O  O   . GLU A 1 30  ? 15.470  28.854 38.217 1.00 16.53 ? 30   GLU A O   1 
ATOM   200  C  CB  . GLU A 1 30  ? 17.348  31.055 38.932 1.00 17.43 ? 30   GLU A CB  1 
ATOM   201  C  CG  . GLU A 1 30  ? 18.402  32.072 38.596 1.00 18.05 ? 30   GLU A CG  1 
ATOM   202  C  CD  . GLU A 1 30  ? 19.672  31.838 39.369 1.00 19.68 ? 30   GLU A CD  1 
ATOM   203  O  OE1 . GLU A 1 30  ? 19.662  31.035 40.350 1.00 20.64 ? 30   GLU A OE1 1 
ATOM   204  O  OE2 . GLU A 1 30  ? 20.664  32.470 38.980 1.00 19.22 ? 30   GLU A OE2 1 
ATOM   205  N  N   . VAL A 1 31  ? 16.628  27.953 39.911 1.00 16.51 ? 31   VAL A N   1 
ATOM   206  C  CA  . VAL A 1 31  ? 15.563  27.058 40.332 1.00 16.65 ? 31   VAL A CA  1 
ATOM   207  C  C   . VAL A 1 31  ? 14.885  27.619 41.580 1.00 15.90 ? 31   VAL A C   1 
ATOM   208  O  O   . VAL A 1 31  ? 15.538  27.821 42.591 1.00 15.62 ? 31   VAL A O   1 
ATOM   209  C  CB  . VAL A 1 31  ? 16.108  25.641 40.639 1.00 17.14 ? 31   VAL A CB  1 
ATOM   210  C  CG1 . VAL A 1 31  ? 14.985  24.748 41.082 1.00 18.67 ? 31   VAL A CG1 1 
ATOM   211  C  CG2 . VAL A 1 31  ? 16.843  25.053 39.417 1.00 16.25 ? 31   VAL A CG2 1 
ATOM   212  N  N   . VAL A 1 32  ? 13.566  27.782 41.522 1.00 15.55 ? 32   VAL A N   1 
ATOM   213  C  CA  . VAL A 1 32  ? 12.826  28.514 42.522 1.00 14.79 ? 32   VAL A CA  1 
ATOM   214  C  C   . VAL A 1 32  ? 11.549  27.759 42.913 1.00 14.61 ? 32   VAL A C   1 
ATOM   215  O  O   . VAL A 1 32  ? 10.836  27.254 42.077 1.00 13.01 ? 32   VAL A O   1 
ATOM   216  C  CB  . VAL A 1 32  ? 12.502  29.942 42.006 1.00 15.51 ? 32   VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 32  ? 12.012  30.848 43.133 1.00 16.99 ? 32   VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 32  ? 13.708  30.570 41.340 1.00 14.55 ? 32   VAL A CG2 1 
ATOM   219  N  N   . ASP A 1 33  ? 11.320  27.636 44.220 1.00 14.91 ? 33   ASP A N   1 
ATOM   220  C  CA  . ASP A 1 33  ? 10.179  26.925 44.780 1.00 15.70 ? 33   ASP A CA  1 
ATOM   221  C  C   . ASP A 1 33  ? 9.039   27.944 44.730 1.00 16.31 ? 33   ASP A C   1 
ATOM   222  O  O   . ASP A 1 33  ? 9.180   29.045 45.261 1.00 15.13 ? 33   ASP A O   1 
ATOM   223  C  CB  . ASP A 1 33  ? 10.527  26.515 46.225 1.00 15.67 ? 33   ASP A CB  1 
ATOM   224  C  CG  . ASP A 1 33  ? 9.497   25.625 46.898 1.00 15.70 ? 33   ASP A CG  1 
ATOM   225  O  OD1 . ASP A 1 33  ? 8.367   25.390 46.421 1.00 17.97 ? 33   ASP A OD1 1 
ATOM   226  O  OD2 . ASP A 1 33  ? 9.752   25.133 48.004 1.00 18.63 ? 33   ASP A OD2 1 
ATOM   227  N  N   . VAL A 1 34  ? 7.950   27.595 44.045 1.00 16.67 ? 34   VAL A N   1 
ATOM   228  C  CA  . VAL A 1 34  ? 6.792   28.480 43.958 1.00 17.28 ? 34   VAL A CA  1 
ATOM   229  C  C   . VAL A 1 34  ? 6.178   28.766 45.325 1.00 18.12 ? 34   VAL A C   1 
ATOM   230  O  O   . VAL A 1 34  ? 5.527   29.809 45.484 1.00 19.93 ? 34   VAL A O   1 
ATOM   231  C  CB  . VAL A 1 34  ? 5.693   27.966 42.989 1.00 17.64 ? 34   VAL A CB  1 
ATOM   232  C  CG1 . VAL A 1 34  ? 6.233   27.843 41.576 1.00 17.40 ? 34   VAL A CG1 1 
ATOM   233  C  CG2 . VAL A 1 34  ? 5.101   26.655 43.456 1.00 16.55 ? 34   VAL A CG2 1 
ATOM   234  N  N   . ALA A 1 35  ? 6.392   27.880 46.303 1.00 18.38 ? 35   ALA A N   1 
ATOM   235  C  CA  . ALA A 1 35  ? 5.967   28.111 47.693 1.00 18.82 ? 35   ALA A CA  1 
ATOM   236  C  C   . ALA A 1 35  ? 6.608   29.354 48.295 1.00 20.21 ? 35   ALA A C   1 
ATOM   237  O  O   . ALA A 1 35  ? 6.023   29.970 49.171 1.00 20.41 ? 35   ALA A O   1 
ATOM   238  C  CB  . ALA A 1 35  ? 6.262   26.903 48.591 1.00 18.29 ? 35   ALA A CB  1 
ATOM   239  N  N   . LYS A 1 36  ? 7.799   29.715 47.818 1.00 21.91 ? 36   LYS A N   1 
ATOM   240  C  CA  . LYS A 1 36  ? 8.582   30.825 48.369 1.00 22.84 ? 36   LYS A CA  1 
ATOM   241  C  C   . LYS A 1 36  ? 8.736   31.983 47.391 1.00 23.31 ? 36   LYS A C   1 
ATOM   242  O  O   . LYS A 1 36  ? 9.521   32.929 47.645 1.00 23.37 ? 36   LYS A O   1 
ATOM   243  C  CB  . LYS A 1 36  ? 9.947   30.297 48.850 1.00 22.98 ? 36   LYS A CB  1 
ATOM   244  C  CG  . LYS A 1 36  ? 9.765   29.305 50.033 1.00 25.77 ? 36   LYS A CG  1 
ATOM   245  C  CD  . LYS A 1 36  ? 11.052  28.842 50.667 1.00 29.19 ? 36   LYS A CD  1 
ATOM   246  C  CE  . LYS A 1 36  ? 10.890  27.489 51.405 1.00 31.30 ? 36   LYS A CE  1 
ATOM   247  N  NZ  . LYS A 1 36  ? 11.604  26.368 50.667 1.00 32.95 ? 36   LYS A NZ  1 
ATOM   248  N  N   . ALA A 1 37  ? 7.957   31.933 46.306 1.00 23.25 ? 37   ALA A N   1 
ATOM   249  C  CA  . ALA A 1 37  ? 8.055   32.912 45.228 1.00 23.50 ? 37   ALA A CA  1 
ATOM   250  C  C   . ALA A 1 37  ? 6.789   33.768 45.101 1.00 23.88 ? 37   ALA A C   1 
ATOM   251  O  O   . ALA A 1 37  ? 5.724   33.447 45.640 1.00 23.92 ? 37   ALA A O   1 
ATOM   252  C  CB  . ALA A 1 37  ? 8.381   32.236 43.899 1.00 22.98 ? 37   ALA A CB  1 
ATOM   253  N  N   . SER A 1 38  ? 6.944   34.869 44.382 1.00 24.39 ? 38   SER A N   1 
ATOM   254  C  CA  . SER A 1 38  ? 5.890   35.858 44.192 1.00 25.00 ? 38   SER A CA  1 
ATOM   255  C  C   . SER A 1 38  ? 5.758   36.234 42.726 1.00 24.94 ? 38   SER A C   1 
ATOM   256  O  O   . SER A 1 38  ? 6.622   35.891 41.903 1.00 24.00 ? 38   SER A O   1 
ATOM   257  C  CB  . SER A 1 38  ? 6.224   37.107 45.005 1.00 25.11 ? 38   SER A CB  1 
ATOM   258  O  OG  . SER A 1 38  ? 7.578   37.479 44.773 1.00 26.96 ? 38   SER A OG  1 
ATOM   259  N  N   . LYS A 1 39  ? 4.665   36.940 42.423 1.00 25.19 ? 39   LYS A N   1 
ATOM   260  C  CA  . LYS A 1 39  ? 4.420   37.542 41.111 1.00 25.67 ? 39   LYS A CA  1 
ATOM   261  C  C   . LYS A 1 39  ? 5.640   38.355 40.693 1.00 25.86 ? 39   LYS A C   1 
ATOM   262  O  O   . LYS A 1 39  ? 6.061   38.307 39.551 1.00 25.97 ? 39   LYS A O   1 
ATOM   263  C  CB  . LYS A 1 39  ? 3.186   38.449 41.176 1.00 25.15 ? 39   LYS A CB  1 
ATOM   264  C  CG  . LYS A 1 39  ? 2.858   39.220 39.894 1.00 25.55 ? 39   LYS A CG  1 
ATOM   265  C  CD  . LYS A 1 39  ? 1.548   40.032 40.025 1.00 26.24 ? 39   LYS A CD  1 
ATOM   266  C  CE  . LYS A 1 39  ? 1.552   40.960 41.255 1.00 27.78 ? 39   LYS A CE  1 
ATOM   267  N  NZ  . LYS A 1 39  ? 0.466   42.029 41.199 1.00 28.75 ? 39   LYS A NZ  1 
ATOM   268  N  N   . GLU A 1 40  ? 6.195   39.069 41.664 1.00 26.42 ? 40   GLU A N   1 
ATOM   269  C  CA  . GLU A 1 40  ? 7.444   39.826 41.534 1.00 26.90 ? 40   GLU A CA  1 
ATOM   270  C  C   . GLU A 1 40  ? 8.589   38.956 40.997 1.00 25.83 ? 40   GLU A C   1 
ATOM   271  O  O   . GLU A 1 40  ? 9.182   39.251 39.986 1.00 25.72 ? 40   GLU A O   1 
ATOM   272  C  CB  . GLU A 1 40  ? 7.800   40.444 42.903 1.00 27.13 ? 40   GLU A CB  1 
ATOM   273  C  CG  . GLU A 1 40  ? 6.975   41.689 43.290 1.00 29.35 ? 40   GLU A CG  1 
ATOM   274  C  CD  . GLU A 1 40  ? 5.476   41.444 43.612 1.00 31.40 ? 40   GLU A CD  1 
ATOM   275  O  OE1 . GLU A 1 40  ? 5.125   40.455 44.315 1.00 27.89 ? 40   GLU A OE1 1 
ATOM   276  O  OE2 . GLU A 1 40  ? 4.639   42.282 43.172 1.00 32.92 ? 40   GLU A OE2 1 
ATOM   277  N  N   . GLN A 1 41  ? 8.852   37.855 41.670 1.00 25.82 ? 41   GLN A N   1 
ATOM   278  C  CA  . GLN A 1 41  ? 9.854   36.896 41.247 1.00 25.89 ? 41   GLN A CA  1 
ATOM   279  C  C   . GLN A 1 41  ? 9.627   36.344 39.835 1.00 25.44 ? 41   GLN A C   1 
ATOM   280  O  O   . GLN A 1 41  ? 10.568  36.206 39.068 1.00 26.21 ? 41   GLN A O   1 
ATOM   281  C  CB  . GLN A 1 41  ? 9.791   35.724 42.205 1.00 26.58 ? 41   GLN A CB  1 
ATOM   282  C  CG  . GLN A 1 41  ? 10.834  34.707 41.984 1.00 28.46 ? 41   GLN A CG  1 
ATOM   283  C  CD  . GLN A 1 41  ? 11.993  34.920 42.884 1.00 31.07 ? 41   GLN A CD  1 
ATOM   284  O  OE1 . GLN A 1 41  ? 11.896  35.687 43.852 1.00 35.42 ? 41   GLN A OE1 1 
ATOM   285  N  NE2 . GLN A 1 41  ? 13.101  34.241 42.594 1.00 32.44 ? 41   GLN A NE2 1 
ATOM   286  N  N   . PHE A 1 42  ? 8.381   35.987 39.519 1.00 24.68 ? 42   PHE A N   1 
ATOM   287  C  CA  . PHE A 1 42  ? 8.019   35.445 38.211 1.00 24.13 ? 42   PHE A CA  1 
ATOM   288  C  C   . PHE A 1 42  ? 8.425   36.409 37.112 1.00 23.74 ? 42   PHE A C   1 
ATOM   289  O  O   . PHE A 1 42  ? 8.970   36.011 36.081 1.00 22.91 ? 42   PHE A O   1 
ATOM   290  C  CB  . PHE A 1 42  ? 6.511   35.207 38.126 1.00 23.50 ? 42   PHE A CB  1 
ATOM   291  C  CG  . PHE A 1 42  ? 6.088   34.251 37.019 1.00 22.12 ? 42   PHE A CG  1 
ATOM   292  C  CD1 . PHE A 1 42  ? 6.622   32.992 36.925 1.00 19.79 ? 42   PHE A CD1 1 
ATOM   293  C  CD2 . PHE A 1 42  ? 5.128   34.615 36.091 1.00 19.81 ? 42   PHE A CD2 1 
ATOM   294  C  CE1 . PHE A 1 42  ? 6.199   32.091 35.921 1.00 18.69 ? 42   PHE A CE1 1 
ATOM   295  C  CE2 . PHE A 1 42  ? 4.716   33.730 35.101 1.00 17.38 ? 42   PHE A CE2 1 
ATOM   296  C  CZ  . PHE A 1 42  ? 5.250   32.469 35.015 1.00 16.60 ? 42   PHE A CZ  1 
ATOM   297  N  N   . ASN A 1 43  ? 8.154   37.685 37.360 1.00 24.45 ? 43   ASN A N   1 
ATOM   298  C  CA  . ASN A 1 43  ? 8.368   38.750 36.387 1.00 24.78 ? 43   ASN A CA  1 
ATOM   299  C  C   . ASN A 1 43  ? 9.814   39.269 36.361 1.00 24.22 ? 43   ASN A C   1 
ATOM   300  O  O   . ASN A 1 43  ? 10.126  40.177 35.621 1.00 24.46 ? 43   ASN A O   1 
ATOM   301  C  CB  . ASN A 1 43  ? 7.320   39.857 36.599 1.00 25.04 ? 43   ASN A CB  1 
ATOM   302  C  CG  . ASN A 1 43  ? 5.895   39.351 36.333 1.00 26.90 ? 43   ASN A CG  1 
ATOM   303  O  OD1 . ASN A 1 43  ? 5.735   38.327 35.664 1.00 29.81 ? 43   ASN A OD1 1 
ATOM   304  N  ND2 . ASN A 1 43  ? 4.855   40.056 36.861 1.00 24.03 ? 43   ASN A ND2 1 
ATOM   305  N  N   . SER A 1 44  ? 10.702  38.640 37.128 1.00 24.17 ? 44   SER A N   1 
ATOM   306  C  CA  . SER A 1 44  ? 12.143  38.924 37.070 1.00 23.90 ? 44   SER A CA  1 
ATOM   307  C  C   . SER A 1 44  ? 12.853  38.000 36.081 1.00 23.53 ? 44   SER A C   1 
ATOM   308  O  O   . SER A 1 44  ? 14.083  37.978 36.016 1.00 23.98 ? 44   SER A O   1 
ATOM   309  C  CB  . SER A 1 44  ? 12.767  38.724 38.441 1.00 24.06 ? 44   SER A CB  1 
ATOM   310  O  OG  . SER A 1 44  ? 13.061  37.348 38.674 1.00 24.69 ? 44   SER A OG  1 
ATOM   311  N  N   . PHE A 1 45  ? 12.071  37.201 35.356 1.00 22.89 ? 45   PHE A N   1 
ATOM   312  C  CA  . PHE A 1 45  ? 12.558  36.420 34.224 1.00 22.05 ? 45   PHE A CA  1 
ATOM   313  C  C   . PHE A 1 45  ? 11.704  36.707 32.989 1.00 21.76 ? 45   PHE A C   1 
ATOM   314  O  O   . PHE A 1 45  ? 10.517  37.006 33.098 1.00 22.01 ? 45   PHE A O   1 
ATOM   315  C  CB  . PHE A 1 45  ? 12.503  34.919 34.546 1.00 22.04 ? 45   PHE A CB  1 
ATOM   316  C  CG  . PHE A 1 45  ? 13.163  34.543 35.847 1.00 19.68 ? 45   PHE A CG  1 
ATOM   317  C  CD1 . PHE A 1 45  ? 12.454  34.605 37.041 1.00 18.78 ? 45   PHE A CD1 1 
ATOM   318  C  CD2 . PHE A 1 45  ? 14.478  34.103 35.873 1.00 17.29 ? 45   PHE A CD2 1 
ATOM   319  C  CE1 . PHE A 1 45  ? 13.053  34.251 38.261 1.00 17.13 ? 45   PHE A CE1 1 
ATOM   320  C  CE2 . PHE A 1 45  ? 15.092  33.749 37.077 1.00 19.08 ? 45   PHE A CE2 1 
ATOM   321  C  CZ  . PHE A 1 45  ? 14.364  33.842 38.294 1.00 17.91 ? 45   PHE A CZ  1 
ATOM   322  N  N   . THR A 1 46  ? 12.309  36.625 31.809 1.00 21.73 ? 46   THR A N   1 
ATOM   323  C  CA  . THR A 1 46  ? 11.556  36.712 30.545 1.00 21.96 ? 46   THR A CA  1 
ATOM   324  C  C   . THR A 1 46  ? 11.304  35.327 29.916 1.00 21.27 ? 46   THR A C   1 
ATOM   325  O  O   . THR A 1 46  ? 10.458  35.182 28.997 1.00 22.27 ? 46   THR A O   1 
ATOM   326  C  CB  . THR A 1 46  ? 12.272  37.606 29.544 1.00 22.09 ? 46   THR A CB  1 
ATOM   327  O  OG1 . THR A 1 46  ? 13.513  37.007 29.158 1.00 22.06 ? 46   THR A OG1 1 
ATOM   328  C  CG2 . THR A 1 46  ? 12.681  38.947 30.179 1.00 23.65 ? 46   THR A CG2 1 
ATOM   329  N  N   . LYS A 1 47  ? 12.022  34.322 30.402 1.00 19.74 ? 47   LYS A N   1 
ATOM   330  C  CA  . LYS A 1 47  ? 11.928  32.944 29.869 1.00 19.71 ? 47   LYS A CA  1 
ATOM   331  C  C   . LYS A 1 47  ? 11.774  31.991 31.049 1.00 18.29 ? 47   LYS A C   1 
ATOM   332  O  O   . LYS A 1 47  ? 12.492  32.100 32.027 1.00 17.38 ? 47   LYS A O   1 
ATOM   333  C  CB  . LYS A 1 47  ? 13.157  32.561 29.031 1.00 20.21 ? 47   LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 47  ? 13.627  33.632 27.982 1.00 22.06 ? 47   LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 47  ? 13.491  33.157 26.512 1.00 24.30 ? 47   LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 47  ? 14.650  33.604 25.591 1.00 25.51 ? 47   LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 47  ? 14.425  34.867 24.810 1.00 27.54 ? 47   LYS A NZ  1 
ATOM   338  N  N   . VAL A 1 48  ? 10.806  31.094 31.008 1.00 17.24 ? 48   VAL A N   1 
ATOM   339  C  CA  . VAL A 1 48  ? 10.614  30.210 32.147 1.00 16.04 ? 48   VAL A CA  1 
ATOM   340  C  C   . VAL A 1 48  ? 10.278  28.793 31.763 1.00 16.28 ? 48   VAL A C   1 
ATOM   341  O  O   . VAL A 1 48  ? 9.733   28.531 30.687 1.00 15.51 ? 48   VAL A O   1 
ATOM   342  C  CB  . VAL A 1 48  ? 9.522   30.748 33.128 1.00 16.35 ? 48   VAL A CB  1 
ATOM   343  C  CG1 . VAL A 1 48  ? 9.952   32.043 33.721 1.00 16.76 ? 48   VAL A CG1 1 
ATOM   344  C  CG2 . VAL A 1 48  ? 8.125   30.859 32.484 1.00 12.95 ? 48   VAL A CG2 1 
ATOM   345  N  N   . ILE A 1 49  ? 10.634  27.876 32.668 1.00 16.24 ? 49   ILE A N   1 
ATOM   346  C  CA  . ILE A 1 49  ? 10.239  26.472 32.592 1.00 15.04 ? 49   ILE A CA  1 
ATOM   347  C  C   . ILE A 1 49  ? 9.468   26.175 33.879 1.00 14.42 ? 49   ILE A C   1 
ATOM   348  O  O   . ILE A 1 49  ? 9.959   26.404 34.977 1.00 14.47 ? 49   ILE A O   1 
ATOM   349  C  CB  . ILE A 1 49  ? 11.460  25.557 32.456 1.00 15.24 ? 49   ILE A CB  1 
ATOM   350  C  CG1 . ILE A 1 49  ? 12.183  25.790 31.128 1.00 16.35 ? 49   ILE A CG1 1 
ATOM   351  C  CG2 . ILE A 1 49  ? 11.075  24.123 32.621 1.00 14.16 ? 49   ILE A CG2 1 
ATOM   352  C  CD1 . ILE A 1 49  ? 13.610  25.319 31.184 1.00 16.64 ? 49   ILE A CD1 1 
ATOM   353  N  N   . LEU A 1 50  ? 8.264   25.660 33.717 1.00 15.30 ? 50   LEU A N   1 
ATOM   354  C  CA  . LEU A 1 50  ? 7.274   25.498 34.793 1.00 16.65 ? 50   LEU A CA  1 
ATOM   355  C  C   . LEU A 1 50  ? 7.102   24.008 35.038 1.00 16.54 ? 50   LEU A C   1 
ATOM   356  O  O   . LEU A 1 50  ? 6.647   23.275 34.144 1.00 17.67 ? 50   LEU A O   1 
ATOM   357  C  CB  . LEU A 1 50  ? 5.956   26.127 34.339 1.00 17.87 ? 50   LEU A CB  1 
ATOM   358  C  CG  . LEU A 1 50  ? 5.688   27.615 34.619 1.00 18.64 ? 50   LEU A CG  1 
ATOM   359  C  CD1 . LEU A 1 50  ? 6.979   28.402 34.818 1.00 19.14 ? 50   LEU A CD1 1 
ATOM   360  C  CD2 . LEU A 1 50  ? 4.776   28.299 33.611 1.00 17.86 ? 50   LEU A CD2 1 
ATOM   361  N  N   . VAL A 1 51  ? 7.538   23.559 36.210 1.00 15.55 ? 51   VAL A N   1 
ATOM   362  C  CA  . VAL A 1 51  ? 7.537   22.150 36.575 1.00 16.04 ? 51   VAL A CA  1 
ATOM   363  C  C   . VAL A 1 51  ? 6.537   21.882 37.713 1.00 16.46 ? 51   VAL A C   1 
ATOM   364  O  O   . VAL A 1 51  ? 6.737   22.251 38.882 1.00 16.33 ? 51   VAL A O   1 
ATOM   365  C  CB  . VAL A 1 51  ? 8.942   21.676 37.019 1.00 15.70 ? 51   VAL A CB  1 
ATOM   366  C  CG1 . VAL A 1 51  ? 8.975   20.177 37.131 1.00 15.28 ? 51   VAL A CG1 1 
ATOM   367  C  CG2 . VAL A 1 51  ? 10.029  22.182 36.047 1.00 13.56 ? 51   VAL A CG2 1 
ATOM   368  N  N   . ALA A 1 52  ? 5.470   21.195 37.362 1.00 17.37 ? 52   ALA A N   1 
ATOM   369  C  CA  . ALA A 1 52  ? 4.347   21.060 38.257 1.00 18.31 ? 52   ALA A CA  1 
ATOM   370  C  C   . ALA A 1 52  ? 3.826   19.626 38.210 1.00 19.01 ? 52   ALA A C   1 
ATOM   371  O  O   . ALA A 1 52  ? 3.418   19.137 37.123 1.00 21.00 ? 52   ALA A O   1 
ATOM   372  C  CB  . ALA A 1 52  ? 3.253   22.044 37.815 1.00 18.49 ? 52   ALA A CB  1 
ATOM   373  N  N   . PRO A 1 53  ? 3.805   18.945 39.345 1.00 18.73 ? 53   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 53  ? 3.201   17.633 39.393 1.00 18.90 ? 53   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 53  ? 1.687   17.773 39.493 1.00 18.30 ? 53   PRO A C   1 
ATOM   376  O  O   . PRO A 1 53  ? 1.160   18.839 39.800 1.00 17.65 ? 53   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 53  ? 3.829   17.006 40.641 1.00 18.81 ? 53   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 53  ? 4.064   18.182 41.559 1.00 19.57 ? 53   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 53  ? 4.322   19.342 40.660 1.00 19.84 ? 53   PRO A CD  1 
ATOM   380  N  N   . THR A 1 54  ? 1.007   16.690 39.155 1.00 18.45 ? 54   THR A N   1 
ATOM   381  C  CA  . THR A 1 54  ? -0.448  16.591 39.237 1.00 18.11 ? 54   THR A CA  1 
ATOM   382  C  C   . THR A 1 54  ? -0.730  15.987 40.561 1.00 18.53 ? 54   THR A C   1 
ATOM   383  O  O   . THR A 1 54  ? -0.039  15.072 40.945 1.00 19.15 ? 54   THR A O   1 
ATOM   384  C  CB  . THR A 1 54  ? -0.946  15.640 38.203 1.00 17.59 ? 54   THR A CB  1 
ATOM   385  O  OG1 . THR A 1 54  ? -0.616  16.156 36.904 1.00 15.72 ? 54   THR A OG1 1 
ATOM   386  C  CG2 . THR A 1 54  ? -2.501  15.481 38.260 1.00 15.77 ? 54   THR A CG2 1 
ATOM   387  N  N   . ALA A 1 55  ? -1.750  16.500 41.233 1.00 18.60 ? 55   ALA A N   1 
ATOM   388  C  CA  . ALA A 1 55  ? -2.202  16.010 42.504 1.00 18.55 ? 55   ALA A CA  1 
ATOM   389  C  C   . ALA A 1 55  ? -3.608  15.389 42.348 1.00 18.65 ? 55   ALA A C   1 
ATOM   390  O  O   . ALA A 1 55  ? -4.503  16.014 41.763 1.00 18.66 ? 55   ALA A O   1 
ATOM   391  C  CB  . ALA A 1 55  ? -2.237  17.142 43.474 1.00 18.80 ? 55   ALA A CB  1 
ATOM   392  N  N   . GLY A 1 56  ? -3.768  14.151 42.835 1.00 18.59 ? 56   GLY A N   1 
ATOM   393  C  CA  . GLY A 1 56  ? -5.029  13.436 42.752 1.00 17.98 ? 56   GLY A CA  1 
ATOM   394  C  C   . GLY A 1 56  ? -5.463  13.222 41.309 1.00 17.98 ? 56   GLY A C   1 
ATOM   395  O  O   . GLY A 1 56  ? -4.650  12.901 40.438 1.00 16.81 ? 56   GLY A O   1 
ATOM   396  N  N   . ALA A 1 57  ? -6.750  13.439 41.056 1.00 17.67 ? 57   ALA A N   1 
ATOM   397  C  CA  . ALA A 1 57  ? -7.317  13.235 39.731 1.00 17.77 ? 57   ALA A CA  1 
ATOM   398  C  C   . ALA A 1 57  ? -7.295  14.527 38.946 1.00 18.07 ? 57   ALA A C   1 
ATOM   399  O  O   . ALA A 1 57  ? -8.327  15.153 38.772 1.00 17.84 ? 57   ALA A O   1 
ATOM   400  C  CB  . ALA A 1 57  ? -8.743  12.706 39.829 1.00 17.76 ? 57   ALA A CB  1 
ATOM   401  N  N   . GLY A 1 58  ? -6.101  14.936 38.518 1.00 18.38 ? 58   GLY A N   1 
ATOM   402  C  CA  . GLY A 1 58  ? -5.928  16.045 37.597 1.00 18.59 ? 58   GLY A CA  1 
ATOM   403  C  C   . GLY A 1 58  ? -5.751  17.437 38.181 1.00 18.57 ? 58   GLY A C   1 
ATOM   404  O  O   . GLY A 1 58  ? -5.581  18.383 37.414 1.00 19.54 ? 58   GLY A O   1 
ATOM   405  N  N   . ASP A 1 59  ? -5.822  17.582 39.509 1.00 18.52 ? 59   ASP A N   1 
ATOM   406  C  CA  . ASP A 1 59  ? -5.483  18.860 40.159 1.00 17.41 ? 59   ASP A CA  1 
ATOM   407  C  C   . ASP A 1 59  ? -3.990  19.175 40.090 1.00 16.77 ? 59   ASP A C   1 
ATOM   408  O  O   . ASP A 1 59  ? -3.144  18.314 39.863 1.00 14.85 ? 59   ASP A O   1 
ATOM   409  C  CB  . ASP A 1 59  ? -5.900  18.877 41.637 1.00 18.50 ? 59   ASP A CB  1 
ATOM   410  C  CG  . ASP A 1 59  ? -7.390  18.924 41.821 1.00 20.02 ? 59   ASP A CG  1 
ATOM   411  O  OD1 . ASP A 1 59  ? -8.106  18.809 40.813 1.00 24.23 ? 59   ASP A OD1 1 
ATOM   412  O  OD2 . ASP A 1 59  ? -7.936  19.078 42.941 1.00 25.56 ? 59   ASP A OD2 1 
ATOM   413  N  N   . LEU A 1 60  ? -3.703  20.459 40.246 1.00 16.07 ? 60   LEU A N   1 
ATOM   414  C  CA  . LEU A 1 60  ? -2.357  20.959 40.297 1.00 16.11 ? 60   LEU A CA  1 
ATOM   415  C  C   . LEU A 1 60  ? -1.872  20.833 41.739 1.00 15.85 ? 60   LEU A C   1 
ATOM   416  O  O   . LEU A 1 60  ? -2.644  21.044 42.680 1.00 14.42 ? 60   LEU A O   1 
ATOM   417  C  CB  . LEU A 1 60  ? -2.395  22.411 39.818 1.00 16.74 ? 60   LEU A CB  1 
ATOM   418  C  CG  . LEU A 1 60  ? -1.153  23.219 39.604 1.00 16.37 ? 60   LEU A CG  1 
ATOM   419  C  CD1 . LEU A 1 60  ? -0.254  22.683 38.493 1.00 19.06 ? 60   LEU A CD1 1 
ATOM   420  C  CD2 . LEU A 1 60  ? -1.592  24.653 39.290 1.00 16.34 ? 60   LEU A CD2 1 
ATOM   421  N  N   . GLN A 1 61  ? -0.611  20.442 41.927 1.00 16.46 ? 61   GLN A N   1 
ATOM   422  C  CA  . GLN A 1 61  ? 0.002   20.516 43.276 1.00 17.03 ? 61   GLN A CA  1 
ATOM   423  C  C   . GLN A 1 61  ? -0.315  21.832 43.993 1.00 17.54 ? 61   GLN A C   1 
ATOM   424  O  O   . GLN A 1 61  ? -0.312  22.870 43.384 1.00 18.22 ? 61   GLN A O   1 
ATOM   425  C  CB  . GLN A 1 61  ? 1.515   20.335 43.216 1.00 16.39 ? 61   GLN A CB  1 
ATOM   426  C  CG  . GLN A 1 61  ? 2.146   20.088 44.585 1.00 15.32 ? 61   GLN A CG  1 
ATOM   427  C  CD  . GLN A 1 61  ? 2.739   21.325 45.203 1.00 10.24 ? 61   GLN A CD  1 
ATOM   428  O  OE1 . GLN A 1 61  ? 2.885   22.353 44.521 1.00 13.63 ? 61   GLN A OE1 1 
ATOM   429  N  NE2 . GLN A 1 61  ? 3.071   21.253 46.492 1.00 10.89 ? 61   GLN A NE2 1 
ATOM   430  N  N   . THR A 1 62  ? -0.571  21.770 45.297 1.00 18.66 ? 62   THR A N   1 
ATOM   431  C  CA  . THR A 1 62  ? -1.201  22.865 46.042 1.00 19.95 ? 62   THR A CA  1 
ATOM   432  C  C   . THR A 1 62  ? -0.422  24.197 46.010 1.00 19.48 ? 62   THR A C   1 
ATOM   433  O  O   . THR A 1 62  ? -1.010  25.251 45.791 1.00 18.70 ? 62   THR A O   1 
ATOM   434  C  CB  . THR A 1 62  ? -1.405  22.409 47.500 1.00 20.08 ? 62   THR A CB  1 
ATOM   435  O  OG1 . THR A 1 62  ? -2.106  21.163 47.492 1.00 25.72 ? 62   THR A OG1 1 
ATOM   436  C  CG2 . THR A 1 62  ? -2.319  23.305 48.241 1.00 20.99 ? 62   THR A CG2 1 
ATOM   437  N  N   . ASP A 1 63  ? 0.891   24.135 46.250 1.00 18.84 ? 63   ASP A N   1 
ATOM   438  C  CA  . ASP A 1 63  ? 1.744   25.322 46.155 1.00 18.35 ? 63   ASP A CA  1 
ATOM   439  C  C   . ASP A 1 63  ? 1.621   25.990 44.773 1.00 18.72 ? 63   ASP A C   1 
ATOM   440  O  O   . ASP A 1 63  ? 1.470   27.215 44.660 1.00 18.56 ? 63   ASP A O   1 
ATOM   441  C  CB  . ASP A 1 63  ? 3.202   24.955 46.442 1.00 18.05 ? 63   ASP A CB  1 
ATOM   442  C  CG  . ASP A 1 63  ? 3.408   24.427 47.856 1.00 18.93 ? 63   ASP A CG  1 
ATOM   443  O  OD1 . ASP A 1 63  ? 2.893   25.081 48.797 1.00 21.44 ? 63   ASP A OD1 1 
ATOM   444  O  OD2 . ASP A 1 63  ? 4.078   23.388 48.118 1.00 15.29 ? 63   ASP A OD2 1 
ATOM   445  N  N   . TRP A 1 64  ? 1.683   25.175 43.723 1.00 18.43 ? 64   TRP A N   1 
ATOM   446  C  CA  . TRP A 1 64  ? 1.483   25.671 42.369 1.00 18.55 ? 64   TRP A CA  1 
ATOM   447  C  C   . TRP A 1 64  ? 0.098   26.320 42.206 1.00 18.62 ? 64   TRP A C   1 
ATOM   448  O  O   . TRP A 1 64  ? -0.031  27.409 41.654 1.00 17.64 ? 64   TRP A O   1 
ATOM   449  C  CB  . TRP A 1 64  ? 1.711   24.553 41.324 1.00 18.71 ? 64   TRP A CB  1 
ATOM   450  C  CG  . TRP A 1 64  ? 2.930   24.813 40.482 1.00 17.54 ? 64   TRP A CG  1 
ATOM   451  C  CD1 . TRP A 1 64  ? 4.045   24.039 40.399 1.00 16.19 ? 64   TRP A CD1 1 
ATOM   452  C  CD2 . TRP A 1 64  ? 3.175   25.953 39.668 1.00 18.13 ? 64   TRP A CD2 1 
ATOM   453  N  NE1 . TRP A 1 64  ? 4.967   24.620 39.569 1.00 15.55 ? 64   TRP A NE1 1 
ATOM   454  C  CE2 . TRP A 1 64  ? 4.464   25.800 39.104 1.00 18.99 ? 64   TRP A CE2 1 
ATOM   455  C  CE3 . TRP A 1 64  ? 2.433   27.087 39.327 1.00 16.02 ? 64   TRP A CE3 1 
ATOM   456  C  CZ2 . TRP A 1 64  ? 5.020   26.736 38.213 1.00 17.77 ? 64   TRP A CZ2 1 
ATOM   457  C  CZ3 . TRP A 1 64  ? 2.989   28.003 38.447 1.00 17.37 ? 64   TRP A CZ3 1 
ATOM   458  C  CH2 . TRP A 1 64  ? 4.276   27.824 37.904 1.00 15.26 ? 64   TRP A CH2 1 
ATOM   459  N  N   . GLU A 1 65  ? -0.938  25.659 42.693 1.00 19.17 ? 65   GLU A N   1 
ATOM   460  C  CA  . GLU A 1 65  ? -2.286  26.246 42.669 1.00 20.65 ? 65   GLU A CA  1 
ATOM   461  C  C   . GLU A 1 65  ? -2.341  27.646 43.312 1.00 20.52 ? 65   GLU A C   1 
ATOM   462  O  O   . GLU A 1 65  ? -2.861  28.602 42.727 1.00 21.00 ? 65   GLU A O   1 
ATOM   463  C  CB  . GLU A 1 65  ? -3.265  25.302 43.354 1.00 20.94 ? 65   GLU A CB  1 
ATOM   464  C  CG  . GLU A 1 65  ? -4.704  25.495 42.959 1.00 24.31 ? 65   GLU A CG  1 
ATOM   465  C  CD  . GLU A 1 65  ? -5.636  24.579 43.749 1.00 27.43 ? 65   GLU A CD  1 
ATOM   466  O  OE1 . GLU A 1 65  ? -6.221  25.056 44.746 1.00 28.13 ? 65   GLU A OE1 1 
ATOM   467  O  OE2 . GLU A 1 65  ? -5.771  23.382 43.374 1.00 27.35 ? 65   GLU A OE2 1 
ATOM   468  N  N   . ASP A 1 66  ? -1.793  27.749 44.508 1.00 20.53 ? 66   ASP A N   1 
ATOM   469  C  CA  . ASP A 1 66  ? -1.741  28.999 45.257 1.00 20.86 ? 66   ASP A CA  1 
ATOM   470  C  C   . ASP A 1 66  ? -0.999  30.076 44.503 1.00 20.18 ? 66   ASP A C   1 
ATOM   471  O  O   . ASP A 1 66  ? -1.459  31.217 44.455 1.00 20.05 ? 66   ASP A O   1 
ATOM   472  C  CB  . ASP A 1 66  ? -1.015  28.806 46.587 1.00 20.88 ? 66   ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 66  ? -1.807  27.964 47.589 1.00 20.44 ? 66   ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 66  ? -1.167  27.397 48.500 1.00 21.40 ? 66   ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 66  ? -3.040  27.819 47.568 1.00 18.93 ? 66   ASP A OD2 1 
ATOM   476  N  N   . PHE A 1 67  ? 0.146   29.707 43.923 1.00 18.91 ? 67   PHE A N   1 
ATOM   477  C  CA  . PHE A 1 67  ? 1.015   30.647 43.229 1.00 19.63 ? 67   PHE A CA  1 
ATOM   478  C  C   . PHE A 1 67  ? 0.350   31.115 41.945 1.00 19.18 ? 67   PHE A C   1 
ATOM   479  O  O   . PHE A 1 67  ? 0.329   32.293 41.631 1.00 18.68 ? 67   PHE A O   1 
ATOM   480  C  CB  . PHE A 1 67  ? 2.375   29.983 42.900 1.00 19.89 ? 67   PHE A CB  1 
ATOM   481  C  CG  . PHE A 1 67  ? 3.363   30.892 42.203 1.00 19.84 ? 67   PHE A CG  1 
ATOM   482  C  CD1 . PHE A 1 67  ? 3.810   32.054 42.818 1.00 23.05 ? 67   PHE A CD1 1 
ATOM   483  C  CD2 . PHE A 1 67  ? 3.877   30.574 40.951 1.00 21.74 ? 67   PHE A CD2 1 
ATOM   484  C  CE1 . PHE A 1 67  ? 4.735   32.899 42.182 1.00 22.70 ? 67   PHE A CE1 1 
ATOM   485  C  CE2 . PHE A 1 67  ? 4.809   31.421 40.302 1.00 20.47 ? 67   PHE A CE2 1 
ATOM   486  C  CZ  . PHE A 1 67  ? 5.234   32.569 40.921 1.00 23.04 ? 67   PHE A CZ  1 
ATOM   487  N  N   . LEU A 1 68  ? -0.171  30.165 41.193 1.00 19.98 ? 68   LEU A N   1 
ATOM   488  C  CA  . LEU A 1 68  ? -0.830  30.466 39.919 1.00 20.33 ? 68   LEU A CA  1 
ATOM   489  C  C   . LEU A 1 68  ? -2.012  31.392 40.151 1.00 20.88 ? 68   LEU A C   1 
ATOM   490  O  O   . LEU A 1 68  ? -2.384  32.161 39.288 1.00 20.23 ? 68   LEU A O   1 
ATOM   491  C  CB  . LEU A 1 68  ? -1.356  29.204 39.267 1.00 20.22 ? 68   LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 68  ? -1.874  29.333 37.824 1.00 20.22 ? 68   LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 68  ? -0.764  29.812 36.873 1.00 20.25 ? 68   LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 68  ? -2.469  27.984 37.379 1.00 18.69 ? 68   LEU A CD2 1 
ATOM   495  N  N   . GLY A 1 69  ? -2.606  31.297 41.330 1.00 21.62 ? 69   GLY A N   1 
ATOM   496  C  CA  . GLY A 1 69  ? -3.767  32.092 41.632 1.00 21.99 ? 69   GLY A CA  1 
ATOM   497  C  C   . GLY A 1 69  ? -3.474  33.574 41.719 1.00 22.37 ? 69   GLY A C   1 
ATOM   498  O  O   . GLY A 1 69  ? -4.382  34.358 41.564 1.00 21.77 ? 69   GLY A O   1 
ATOM   499  N  N   . THR A 1 70  ? -2.229  33.952 41.993 1.00 22.85 ? 70   THR A N   1 
ATOM   500  C  CA  . THR A 1 70  ? -1.869  35.350 42.110 1.00 23.92 ? 70   THR A CA  1 
ATOM   501  C  C   . THR A 1 70  ? -1.331  35.905 40.824 1.00 24.49 ? 70   THR A C   1 
ATOM   502  O  O   . THR A 1 70  ? -1.013  37.086 40.765 1.00 24.00 ? 70   THR A O   1 
ATOM   503  C  CB  . THR A 1 70  ? -0.788  35.554 43.185 1.00 24.15 ? 70   THR A CB  1 
ATOM   504  O  OG1 . THR A 1 70  ? 0.426   34.908 42.771 1.00 25.01 ? 70   THR A OG1 1 
ATOM   505  C  CG2 . THR A 1 70  ? -1.174  34.885 44.477 1.00 23.77 ? 70   THR A CG2 1 
ATOM   506  N  N   . LEU A 1 71  ? -1.165  35.037 39.829 1.00 25.69 ? 71   LEU A N   1 
ATOM   507  C  CA  . LEU A 1 71  ? -0.740  35.426 38.491 1.00 26.76 ? 71   LEU A CA  1 
ATOM   508  C  C   . LEU A 1 71  ? -1.949  35.489 37.547 1.00 27.68 ? 71   LEU A C   1 
ATOM   509  O  O   . LEU A 1 71  ? -2.883  34.700 37.661 1.00 27.97 ? 71   LEU A O   1 
ATOM   510  C  CB  . LEU A 1 71  ? 0.260   34.420 37.926 1.00 26.69 ? 71   LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 71  ? 1.482   33.973 38.736 1.00 26.88 ? 71   LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 71  ? 2.368   33.064 37.840 1.00 27.42 ? 71   LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 71  ? 2.303   35.150 39.287 1.00 28.12 ? 71   LEU A CD2 1 
ATOM   514  N  N   . GLU A 1 72  ? -1.931  36.450 36.637 1.00 28.71 ? 72   GLU A N   1 
ATOM   515  C  CA  . GLU A 1 72  ? -2.892  36.505 35.540 1.00 29.62 ? 72   GLU A CA  1 
ATOM   516  C  C   . GLU A 1 72  ? -2.190  36.283 34.199 1.00 29.59 ? 72   GLU A C   1 
ATOM   517  O  O   . GLU A 1 72  ? -0.966  36.195 34.146 1.00 29.85 ? 72   GLU A O   1 
ATOM   518  C  CB  . GLU A 1 72  ? -3.674  37.814 35.583 1.00 29.54 ? 72   GLU A CB  1 
ATOM   519  C  CG  . GLU A 1 72  ? -2.951  39.064 35.121 1.00 31.15 ? 72   GLU A CG  1 
ATOM   520  C  CD  . GLU A 1 72  ? -3.908  40.254 35.079 1.00 32.60 ? 72   GLU A CD  1 
ATOM   521  O  OE1 . GLU A 1 72  ? -4.380  40.641 33.968 1.00 34.01 ? 72   GLU A OE1 1 
ATOM   522  O  OE2 . GLU A 1 72  ? -4.217  40.770 36.172 1.00 31.14 ? 72   GLU A OE2 1 
ATOM   523  N  N   . ALA A 1 73  ? -2.972  36.177 33.128 1.00 29.72 ? 73   ALA A N   1 
ATOM   524  C  CA  . ALA A 1 73  ? -2.457  35.822 31.793 1.00 29.89 ? 73   ALA A CA  1 
ATOM   525  C  C   . ALA A 1 73  ? -1.500  36.845 31.160 1.00 29.79 ? 73   ALA A C   1 
ATOM   526  O  O   . ALA A 1 73  ? -0.700  36.485 30.294 1.00 29.93 ? 73   ALA A O   1 
ATOM   527  C  CB  . ALA A 1 73  ? -3.628  35.529 30.833 1.00 30.00 ? 73   ALA A CB  1 
ATOM   528  N  N   . SER A 1 74  ? -1.586  38.110 31.571 1.00 29.25 ? 74   SER A N   1 
ATOM   529  C  CA  . SER A 1 74  ? -0.609  39.119 31.146 1.00 29.15 ? 74   SER A CA  1 
ATOM   530  C  C   . SER A 1 74  ? 0.783   38.888 31.761 1.00 28.05 ? 74   SER A C   1 
ATOM   531  O  O   . SER A 1 74  ? 1.778   39.433 31.291 1.00 28.08 ? 74   SER A O   1 
ATOM   532  C  CB  . SER A 1 74  ? -1.103  40.540 31.486 1.00 29.36 ? 74   SER A CB  1 
ATOM   533  O  OG  . SER A 1 74  ? -1.228  40.722 32.891 1.00 31.31 ? 74   SER A OG  1 
ATOM   534  N  N   . ASP A 1 75  ? 0.851   38.094 32.816 1.00 27.11 ? 75   ASP A N   1 
ATOM   535  C  CA  . ASP A 1 75  ? 2.135   37.729 33.399 1.00 26.78 ? 75   ASP A CA  1 
ATOM   536  C  C   . ASP A 1 75  ? 2.899   36.725 32.564 1.00 26.28 ? 75   ASP A C   1 
ATOM   537  O  O   . ASP A 1 75  ? 4.092   36.513 32.808 1.00 27.22 ? 75   ASP A O   1 
ATOM   538  C  CB  . ASP A 1 75  ? 1.950   37.181 34.805 1.00 26.68 ? 75   ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 75  ? 1.357   38.199 35.738 1.00 26.65 ? 75   ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 75  ? 1.973   39.271 35.933 1.00 26.25 ? 75   ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 75  ? 0.278   38.019 36.322 1.00 27.65 ? 75   ASP A OD2 1 
ATOM   542  N  N   . PHE A 1 76  ? 2.214   36.093 31.614 1.00 25.86 ? 76   PHE A N   1 
ATOM   543  C  CA  . PHE A 1 76  ? 2.816   35.113 30.716 1.00 25.50 ? 76   PHE A CA  1 
ATOM   544  C  C   . PHE A 1 76  ? 3.018   35.606 29.267 1.00 25.73 ? 76   PHE A C   1 
ATOM   545  O  O   . PHE A 1 76  ? 3.955   35.163 28.601 1.00 24.75 ? 76   PHE A O   1 
ATOM   546  C  CB  . PHE A 1 76  ? 1.973   33.846 30.662 1.00 25.28 ? 76   PHE A CB  1 
ATOM   547  C  CG  . PHE A 1 76  ? 1.807   33.142 31.993 1.00 26.14 ? 76   PHE A CG  1 
ATOM   548  C  CD1 . PHE A 1 76  ? 0.857   33.561 32.906 1.00 25.91 ? 76   PHE A CD1 1 
ATOM   549  C  CD2 . PHE A 1 76  ? 2.567   32.029 32.309 1.00 26.47 ? 76   PHE A CD2 1 
ATOM   550  C  CE1 . PHE A 1 76  ? 0.687   32.892 34.116 1.00 26.62 ? 76   PHE A CE1 1 
ATOM   551  C  CE2 . PHE A 1 76  ? 2.383   31.364 33.494 1.00 26.32 ? 76   PHE A CE2 1 
ATOM   552  C  CZ  . PHE A 1 76  ? 1.442   31.794 34.399 1.00 25.04 ? 76   PHE A CZ  1 
ATOM   553  N  N   . ALA A 1 77  ? 2.136   36.493 28.781 1.00 25.68 ? 77   ALA A N   1 
ATOM   554  C  CA  . ALA A 1 77  ? 2.076   36.836 27.349 1.00 26.02 ? 77   ALA A CA  1 
ATOM   555  C  C   . ALA A 1 77  ? 3.422   37.262 26.756 1.00 26.14 ? 77   ALA A C   1 
ATOM   556  O  O   . ALA A 1 77  ? 3.729   36.865 25.643 1.00 26.77 ? 77   ALA A O   1 
ATOM   557  C  CB  . ALA A 1 77  ? 1.006   37.895 27.071 1.00 25.61 ? 77   ALA A CB  1 
ATOM   558  N  N   . ASN A 1 78  ? 4.226   38.040 27.490 1.00 26.35 ? 78   ASN A N   1 
ATOM   559  C  CA  . ASN A 1 78  ? 5.547   38.471 26.991 1.00 26.60 ? 78   ASN A CA  1 
ATOM   560  C  C   . ASN A 1 78  ? 6.730   37.571 27.395 1.00 26.09 ? 78   ASN A C   1 
ATOM   561  O  O   . ASN A 1 78  ? 7.868   38.028 27.492 1.00 25.70 ? 78   ASN A O   1 
ATOM   562  C  CB  . ASN A 1 78  ? 5.815   39.946 27.349 1.00 27.17 ? 78   ASN A CB  1 
ATOM   563  C  CG  . ASN A 1 78  ? 6.304   40.152 28.778 1.00 28.99 ? 78   ASN A CG  1 
ATOM   564  O  OD1 . ASN A 1 78  ? 7.349   40.778 28.996 1.00 34.37 ? 78   ASN A OD1 1 
ATOM   565  N  ND2 . ASN A 1 78  ? 5.538   39.679 29.754 1.00 34.67 ? 78   ASN A ND2 1 
ATOM   566  N  N   . LYS A 1 79  ? 6.455   36.284 27.605 1.00 25.51 ? 79   LYS A N   1 
ATOM   567  C  CA  . LYS A 1 79  ? 7.497   35.335 27.975 1.00 25.39 ? 79   LYS A CA  1 
ATOM   568  C  C   . LYS A 1 79  ? 7.516   34.101 27.092 1.00 24.06 ? 79   LYS A C   1 
ATOM   569  O  O   . LYS A 1 79  ? 6.492   33.697 26.552 1.00 24.76 ? 79   LYS A O   1 
ATOM   570  C  CB  . LYS A 1 79  ? 7.306   34.863 29.417 1.00 25.46 ? 79   LYS A CB  1 
ATOM   571  C  CG  . LYS A 1 79  ? 7.491   35.939 30.445 1.00 27.11 ? 79   LYS A CG  1 
ATOM   572  C  CD  . LYS A 1 79  ? 6.630   35.654 31.669 1.00 29.13 ? 79   LYS A CD  1 
ATOM   573  C  CE  . LYS A 1 79  ? 7.419   35.232 32.879 1.00 29.73 ? 79   LYS A CE  1 
ATOM   574  N  NZ  . LYS A 1 79  ? 7.406   36.377 33.856 1.00 31.55 ? 79   LYS A NZ  1 
ATOM   575  N  N   . THR A 1 80  ? 8.696   33.495 27.002 1.00 22.83 ? 80   THR A N   1 
ATOM   576  C  CA  . THR A 1 80  ? 8.859   32.124 26.525 1.00 21.80 ? 80   THR A CA  1 
ATOM   577  C  C   . THR A 1 80  ? 8.684   31.193 27.712 1.00 20.53 ? 80   THR A C   1 
ATOM   578  O  O   . THR A 1 80  ? 9.258   31.429 28.769 1.00 19.29 ? 80   THR A O   1 
ATOM   579  C  CB  . THR A 1 80  ? 10.243  31.924 25.924 1.00 22.05 ? 80   THR A CB  1 
ATOM   580  O  OG1 . THR A 1 80  ? 10.483  32.943 24.953 1.00 22.79 ? 80   THR A OG1 1 
ATOM   581  C  CG2 . THR A 1 80  ? 10.324  30.603 25.135 1.00 21.22 ? 80   THR A CG2 1 
ATOM   582  N  N   . ILE A 1 81  ? 7.879   30.155 27.502 1.00 19.58 ? 81   ILE A N   1 
ATOM   583  C  CA  . ILE A 1 81  ? 7.406   29.244 28.520 1.00 19.28 ? 81   ILE A CA  1 
ATOM   584  C  C   . ILE A 1 81  ? 7.599   27.815 28.040 1.00 18.63 ? 81   ILE A C   1 
ATOM   585  O  O   . ILE A 1 81  ? 7.121   27.438 26.967 1.00 17.40 ? 81   ILE A O   1 
ATOM   586  C  CB  . ILE A 1 81  ? 5.882   29.417 28.762 1.00 20.20 ? 81   ILE A CB  1 
ATOM   587  C  CG1 . ILE A 1 81  ? 5.396   30.864 28.528 1.00 22.18 ? 81   ILE A CG1 1 
ATOM   588  C  CG2 . ILE A 1 81  ? 5.464   28.776 30.121 1.00 21.71 ? 81   ILE A CG2 1 
ATOM   589  C  CD1 . ILE A 1 81  ? 5.251   31.700 29.709 1.00 24.15 ? 81   ILE A CD1 1 
ATOM   590  N  N   . GLY A 1 82  ? 8.262   27.001 28.851 1.00 18.43 ? 82   GLY A N   1 
ATOM   591  C  CA  . GLY A 1 82  ? 8.213   25.559 28.710 1.00 18.87 ? 82   GLY A CA  1 
ATOM   592  C  C   . GLY A 1 82  ? 7.543   24.950 29.922 1.00 19.31 ? 82   GLY A C   1 
ATOM   593  O  O   . GLY A 1 82  ? 7.856   25.329 31.058 1.00 19.18 ? 82   GLY A O   1 
ATOM   594  N  N   . LEU A 1 83  ? 6.622   24.014 29.690 1.00 18.74 ? 83   LEU A N   1 
ATOM   595  C  CA  . LEU A 1 83  ? 5.938   23.297 30.748 1.00 18.68 ? 83   LEU A CA  1 
ATOM   596  C  C   . LEU A 1 83  ? 6.476   21.877 30.896 1.00 17.39 ? 83   LEU A C   1 
ATOM   597  O  O   . LEU A 1 83  ? 6.829   21.228 29.926 1.00 18.44 ? 83   LEU A O   1 
ATOM   598  C  CB  . LEU A 1 83  ? 4.420   23.234 30.482 1.00 18.02 ? 83   LEU A CB  1 
ATOM   599  C  CG  . LEU A 1 83  ? 3.711   24.543 30.065 1.00 18.47 ? 83   LEU A CG  1 
ATOM   600  C  CD1 . LEU A 1 83  ? 2.241   24.240 29.718 1.00 18.88 ? 83   LEU A CD1 1 
ATOM   601  C  CD2 . LEU A 1 83  ? 3.774   25.573 31.148 1.00 18.03 ? 83   LEU A CD2 1 
ATOM   602  N  N   . VAL A 1 84  ? 6.538   21.407 32.124 1.00 17.31 ? 84   VAL A N   1 
ATOM   603  C  CA  . VAL A 1 84  ? 7.006   20.055 32.456 1.00 16.84 ? 84   VAL A CA  1 
ATOM   604  C  C   . VAL A 1 84  ? 6.020   19.478 33.452 1.00 16.15 ? 84   VAL A C   1 
ATOM   605  O  O   . VAL A 1 84  ? 5.863   19.989 34.560 1.00 16.32 ? 84   VAL A O   1 
ATOM   606  C  CB  . VAL A 1 84  ? 8.394   20.070 33.072 1.00 16.75 ? 84   VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 84  ? 8.830   18.632 33.487 1.00 16.83 ? 84   VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 84  ? 9.384   20.685 32.110 1.00 18.32 ? 84   VAL A CG2 1 
ATOM   609  N  N   . GLY A 1 85  ? 5.291   18.457 33.035 1.00 16.42 ? 85   GLY A N   1 
ATOM   610  C  CA  . GLY A 1 85  ? 4.322   17.818 33.895 1.00 15.80 ? 85   GLY A CA  1 
ATOM   611  C  C   . GLY A 1 85  ? 4.845   16.521 34.472 1.00 15.97 ? 85   GLY A C   1 
ATOM   612  O  O   . GLY A 1 85  ? 5.694   15.873 33.892 1.00 17.08 ? 85   GLY A O   1 
ATOM   613  N  N   . LEU A 1 86  ? 4.385   16.181 35.666 1.00 16.08 ? 86   LEU A N   1 
ATOM   614  C  CA  . LEU A 1 86  ? 4.624   14.867 36.212 1.00 16.14 ? 86   LEU A CA  1 
ATOM   615  C  C   . LEU A 1 86  ? 3.249   14.249 36.340 1.00 16.63 ? 86   LEU A C   1 
ATOM   616  O  O   . LEU A 1 86  ? 2.248   14.949 36.636 1.00 17.14 ? 86   LEU A O   1 
ATOM   617  C  CB  . LEU A 1 86  ? 5.310   14.932 37.562 1.00 17.26 ? 86   LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 86  ? 6.810   15.145 37.587 1.00 18.54 ? 86   LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 86  ? 7.138   16.613 37.397 1.00 20.60 ? 86   LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 86  ? 7.364   14.626 38.897 1.00 19.73 ? 86   LEU A CD2 1 
ATOM   621  N  N   . GLY A 1 87  ? 3.192   12.952 36.102 1.00 16.39 ? 87   GLY A N   1 
ATOM   622  C  CA  . GLY A 1 87  ? 1.953   12.220 36.235 1.00 17.16 ? 87   GLY A CA  1 
ATOM   623  C  C   . GLY A 1 87  ? 2.145   10.735 36.294 1.00 16.97 ? 87   GLY A C   1 
ATOM   624  O  O   . GLY A 1 87  ? 3.264   10.212 36.155 1.00 16.93 ? 87   GLY A O   1 
ATOM   625  N  N   . ASP A 1 88  ? 1.021   10.060 36.473 1.00 17.51 ? 88   ASP A N   1 
ATOM   626  C  CA  . ASP A 1 88  ? 0.979   8.633  36.656 1.00 18.16 ? 88   ASP A CA  1 
ATOM   627  C  C   . ASP A 1 88  ? -0.122  8.102  35.767 1.00 18.45 ? 88   ASP A C   1 
ATOM   628  O  O   . ASP A 1 88  ? -1.312  8.059  36.160 1.00 17.78 ? 88   ASP A O   1 
ATOM   629  C  CB  . ASP A 1 88  ? 0.730   8.324  38.133 1.00 19.05 ? 88   ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 88  ? 0.509   6.855  38.407 1.00 20.09 ? 88   ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 88  ? 0.525   6.024  37.478 1.00 24.54 ? 88   ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 88  ? 0.313   6.432  39.552 1.00 23.83 ? 88   ASP A OD2 1 
ATOM   633  N  N   . GLN A 1 89  ? 0.296   7.686  34.569 1.00 18.21 ? 89   GLN A N   1 
ATOM   634  C  CA  . GLN A 1 89  ? -0.593  7.186  33.524 1.00 19.44 ? 89   GLN A CA  1 
ATOM   635  C  C   . GLN A 1 89  ? -1.364  5.900  33.881 1.00 20.27 ? 89   GLN A C   1 
ATOM   636  O  O   . GLN A 1 89  ? -2.464  5.697  33.408 1.00 20.57 ? 89   GLN A O   1 
ATOM   637  C  CB  . GLN A 1 89  ? 0.190   6.958  32.221 1.00 19.05 ? 89   GLN A CB  1 
ATOM   638  C  CG  . GLN A 1 89  ? 1.269   5.854  32.273 1.00 17.88 ? 89   GLN A CG  1 
ATOM   639  C  CD  . GLN A 1 89  ? 2.393   6.119  31.284 1.00 18.66 ? 89   GLN A CD  1 
ATOM   640  O  OE1 . GLN A 1 89  ? 2.228   5.866  30.109 1.00 17.16 ? 89   GLN A OE1 1 
ATOM   641  N  NE2 . GLN A 1 89  ? 3.517   6.676  31.754 1.00 16.96 ? 89   GLN A NE2 1 
ATOM   642  N  N   . ASP A 1 90  ? -0.776  5.053  34.714 1.00 21.09 ? 90   ASP A N   1 
ATOM   643  C  CA  . ASP A 1 90  ? -1.432  3.821  35.170 1.00 21.55 ? 90   ASP A CA  1 
ATOM   644  C  C   . ASP A 1 90  ? -2.645  4.056  36.141 1.00 20.64 ? 90   ASP A C   1 
ATOM   645  O  O   . ASP A 1 90  ? -3.714  3.462  35.969 1.00 19.82 ? 90   ASP A O   1 
ATOM   646  C  CB  . ASP A 1 90  ? -0.354  2.905  35.803 1.00 22.48 ? 90   ASP A CB  1 
ATOM   647  C  CG  . ASP A 1 90  ? 0.643   2.301  34.751 1.00 25.91 ? 90   ASP A CG  1 
ATOM   648  O  OD1 . ASP A 1 90  ? 0.582   2.628  33.530 1.00 29.43 ? 90   ASP A OD1 1 
ATOM   649  O  OD2 . ASP A 1 90  ? 1.552   1.485  35.066 1.00 30.63 ? 90   ASP A OD2 1 
ATOM   650  N  N   . THR A 1 91  ? -2.475  4.931  37.140 1.00 20.04 ? 91   THR A N   1 
ATOM   651  C  CA  . THR A 1 91  ? -3.479  5.191  38.191 1.00 19.23 ? 91   THR A CA  1 
ATOM   652  C  C   . THR A 1 91  ? -4.550  6.191  37.728 1.00 18.92 ? 91   THR A C   1 
ATOM   653  O  O   . THR A 1 91  ? -5.733  6.128  38.135 1.00 18.24 ? 91   THR A O   1 
ATOM   654  C  CB  . THR A 1 91  ? -2.771  5.772  39.492 1.00 18.96 ? 91   THR A CB  1 
ATOM   655  O  OG1 . THR A 1 91  ? -1.821  4.823  40.016 1.00 20.12 ? 91   THR A OG1 1 
ATOM   656  C  CG2 . THR A 1 91  ? -3.769  5.954  40.643 1.00 18.06 ? 91   THR A CG2 1 
ATOM   657  N  N   . TYR A 1 92  ? -4.106  7.128  36.897 1.00 19.14 ? 92   TYR A N   1 
ATOM   658  C  CA  . TYR A 1 92  ? -4.908  8.265  36.437 1.00 19.41 ? 92   TYR A CA  1 
ATOM   659  C  C   . TYR A 1 92  ? -4.868  8.343  34.927 1.00 20.28 ? 92   TYR A C   1 
ATOM   660  O  O   . TYR A 1 92  ? -4.441  9.349  34.361 1.00 20.19 ? 92   TYR A O   1 
ATOM   661  C  CB  . TYR A 1 92  ? -4.360  9.572  37.011 1.00 19.15 ? 92   TYR A CB  1 
ATOM   662  C  CG  . TYR A 1 92  ? -4.458  9.652  38.500 1.00 17.88 ? 92   TYR A CG  1 
ATOM   663  C  CD1 . TYR A 1 92  ? -5.693  9.652  39.127 1.00 16.85 ? 92   TYR A CD1 1 
ATOM   664  C  CD2 . TYR A 1 92  ? -3.311  9.738  39.286 1.00 17.68 ? 92   TYR A CD2 1 
ATOM   665  C  CE1 . TYR A 1 92  ? -5.800  9.713  40.513 1.00 18.40 ? 92   TYR A CE1 1 
ATOM   666  C  CE2 . TYR A 1 92  ? -3.392  9.807  40.668 1.00 15.82 ? 92   TYR A CE2 1 
ATOM   667  C  CZ  . TYR A 1 92  ? -4.643  9.783  41.274 1.00 18.10 ? 92   TYR A CZ  1 
ATOM   668  O  OH  . TYR A 1 92  ? -4.739  9.857  42.634 1.00 16.81 ? 92   TYR A OH  1 
ATOM   669  N  N   . SER A 1 93  ? -5.347  7.279  34.298 1.00 20.86 ? 93   SER A N   1 
ATOM   670  C  CA  . SER A 1 93  ? -5.330  7.116  32.849 1.00 21.73 ? 93   SER A CA  1 
ATOM   671  C  C   . SER A 1 93  ? -6.195  8.157  32.127 1.00 21.12 ? 93   SER A C   1 
ATOM   672  O  O   . SER A 1 93  ? -5.908  8.507  31.001 1.00 21.38 ? 93   SER A O   1 
ATOM   673  C  CB  . SER A 1 93  ? -5.821  5.705  32.484 1.00 21.55 ? 93   SER A CB  1 
ATOM   674  O  OG  . SER A 1 93  ? -5.035  5.187  31.424 1.00 24.97 ? 93   SER A OG  1 
ATOM   675  N  N   . GLU A 1 94  ? -7.219  8.661  32.809 1.00 20.67 ? 94   GLU A N   1 
ATOM   676  C  CA  . GLU A 1 94  ? -8.187  9.581  32.231 1.00 20.72 ? 94   GLU A CA  1 
ATOM   677  C  C   . GLU A 1 94  ? -7.938  11.050 32.579 1.00 20.48 ? 94   GLU A C   1 
ATOM   678  O  O   . GLU A 1 94  ? -8.670  11.937 32.127 1.00 20.94 ? 94   GLU A O   1 
ATOM   679  C  CB  . GLU A 1 94  ? -9.562  9.170  32.710 1.00 20.62 ? 94   GLU A CB  1 
ATOM   680  C  CG  . GLU A 1 94  ? -9.896  7.773  32.233 1.00 22.28 ? 94   GLU A CG  1 
ATOM   681  C  CD  . GLU A 1 94  ? -11.376 7.562  32.114 1.00 25.85 ? 94   GLU A CD  1 
ATOM   682  O  OE1 . GLU A 1 94  ? -12.039 7.440  33.175 1.00 24.07 ? 94   GLU A OE1 1 
ATOM   683  O  OE2 . GLU A 1 94  ? -11.870 7.520  30.958 1.00 30.46 ? 94   GLU A OE2 1 
ATOM   684  N  N   . THR A 1 95  ? -6.888  11.290 33.360 1.00 19.94 ? 95   THR A N   1 
ATOM   685  C  CA  . THR A 1 95  ? -6.539  12.615 33.825 1.00 20.10 ? 95   THR A CA  1 
ATOM   686  C  C   . THR A 1 95  ? -4.984  12.766 33.912 1.00 19.78 ? 95   THR A C   1 
ATOM   687  O  O   . THR A 1 95  ? -4.476  13.601 34.611 1.00 19.68 ? 95   THR A O   1 
ATOM   688  C  CB  . THR A 1 95  ? -7.334  12.821 35.145 1.00 20.70 ? 95   THR A CB  1 
ATOM   689  O  OG1 . THR A 1 95  ? -7.726  14.174 35.311 1.00 25.15 ? 95   THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 95  ? -6.555  12.432 36.377 1.00 19.06 ? 95   THR A CG2 1 
ATOM   691  N  N   . PHE A 1 96  ? -4.263  11.982 33.102 1.00 19.94 ? 96   PHE A N   1 
ATOM   692  C  CA  . PHE A 1 96  ? -2.803  11.870 33.126 1.00 19.58 ? 96   PHE A CA  1 
ATOM   693  C  C   . PHE A 1 96  ? -2.046  13.198 32.945 1.00 19.41 ? 96   PHE A C   1 
ATOM   694  O  O   . PHE A 1 96  ? -2.162  13.866 31.916 1.00 19.48 ? 96   PHE A O   1 
ATOM   695  C  CB  . PHE A 1 96  ? -2.354  10.879 32.056 1.00 19.46 ? 96   PHE A CB  1 
ATOM   696  C  CG  . PHE A 1 96  ? -0.861  10.723 31.953 1.00 19.66 ? 96   PHE A CG  1 
ATOM   697  C  CD1 . PHE A 1 96  ? -0.092  10.461 33.093 1.00 18.43 ? 96   PHE A CD1 1 
ATOM   698  C  CD2 . PHE A 1 96  ? -0.230  10.814 30.710 1.00 20.31 ? 96   PHE A CD2 1 
ATOM   699  C  CE1 . PHE A 1 96  ? 1.280   10.289 33.003 1.00 19.28 ? 96   PHE A CE1 1 
ATOM   700  C  CE2 . PHE A 1 96  ? 1.140   10.645 30.600 1.00 20.96 ? 96   PHE A CE2 1 
ATOM   701  C  CZ  . PHE A 1 96  ? 1.909   10.386 31.765 1.00 20.91 ? 96   PHE A CZ  1 
ATOM   702  N  N   . ALA A 1 97  ? -1.300  13.573 33.988 1.00 19.77 ? 97   ALA A N   1 
ATOM   703  C  CA  . ALA A 1 97  ? -0.439  14.765 33.986 1.00 20.07 ? 97   ALA A CA  1 
ATOM   704  C  C   . ALA A 1 97  ? -1.202  16.051 33.675 1.00 20.33 ? 97   ALA A C   1 
ATOM   705  O  O   . ALA A 1 97  ? -0.643  17.007 33.141 1.00 21.40 ? 97   ALA A O   1 
ATOM   706  C  CB  . ALA A 1 97  ? 0.679   14.579 32.987 1.00 20.19 ? 97   ALA A CB  1 
ATOM   707  N  N   . GLU A 1 98  ? -2.491  16.048 33.983 1.00 20.15 ? 98   GLU A N   1 
ATOM   708  C  CA  . GLU A 1 98  ? -3.372  17.152 33.680 1.00 20.53 ? 98   GLU A CA  1 
ATOM   709  C  C   . GLU A 1 98  ? -3.073  18.406 34.526 1.00 20.09 ? 98   GLU A C   1 
ATOM   710  O  O   . GLU A 1 98  ? -3.569  19.496 34.239 1.00 19.40 ? 98   GLU A O   1 
ATOM   711  C  CB  . GLU A 1 98  ? -4.794  16.652 33.883 1.00 20.88 ? 98   GLU A CB  1 
ATOM   712  C  CG  . GLU A 1 98  ? -5.922  17.585 33.528 1.00 21.34 ? 98   GLU A CG  1 
ATOM   713  C  CD  . GLU A 1 98  ? -7.221  16.813 33.464 1.00 22.56 ? 98   GLU A CD  1 
ATOM   714  O  OE1 . GLU A 1 98  ? -8.102  17.009 34.349 1.00 20.81 ? 98   GLU A OE1 1 
ATOM   715  O  OE2 . GLU A 1 98  ? -7.334  15.971 32.536 1.00 24.40 ? 98   GLU A OE2 1 
ATOM   716  N  N   . GLY A 1 99  ? -2.256  18.247 35.566 1.00 19.67 ? 99   GLY A N   1 
ATOM   717  C  CA  . GLY A 1 99  ? -1.731  19.366 36.337 1.00 19.59 ? 99   GLY A CA  1 
ATOM   718  C  C   . GLY A 1 99  ? -1.273  20.551 35.502 1.00 19.59 ? 99   GLY A C   1 
ATOM   719  O  O   . GLY A 1 99  ? -1.600  21.701 35.808 1.00 18.61 ? 99   GLY A O   1 
ATOM   720  N  N   . ILE A 1 100 ? -0.515  20.281 34.438 1.00 20.70 ? 100  ILE A N   1 
ATOM   721  C  CA  . ILE A 1 100 ? 0.087   21.356 33.662 1.00 20.75 ? 100  ILE A CA  1 
ATOM   722  C  C   . ILE A 1 100 ? -0.964  22.108 32.877 1.00 20.91 ? 100  ILE A C   1 
ATOM   723  O  O   . ILE A 1 100 ? -0.758  23.281 32.515 1.00 20.71 ? 100  ILE A O   1 
ATOM   724  C  CB  . ILE A 1 100 ? 1.246   20.891 32.717 1.00 21.26 ? 100  ILE A CB  1 
ATOM   725  C  CG1 . ILE A 1 100 ? 0.932   19.569 31.994 1.00 22.05 ? 100  ILE A CG1 1 
ATOM   726  C  CG2 . ILE A 1 100 ? 2.560   20.817 33.499 1.00 21.65 ? 100  ILE A CG2 1 
ATOM   727  C  CD1 . ILE A 1 100 ? 2.023   19.173 30.961 1.00 23.73 ? 100  ILE A CD1 1 
ATOM   728  N  N   . PHE A 1 101 ? -2.088  21.449 32.607 1.00 20.51 ? 101  PHE A N   1 
ATOM   729  C  CA  . PHE A 1 101 ? -3.158  22.103 31.878 1.00 20.24 ? 101  PHE A CA  1 
ATOM   730  C  C   . PHE A 1 101 ? -3.678  23.348 32.599 1.00 19.92 ? 101  PHE A C   1 
ATOM   731  O  O   . PHE A 1 101 ? -3.908  24.372 31.962 1.00 20.84 ? 101  PHE A O   1 
ATOM   732  C  CB  . PHE A 1 101 ? -4.269  21.100 31.511 1.00 20.88 ? 101  PHE A CB  1 
ATOM   733  C  CG  . PHE A 1 101 ? -5.645  21.720 31.383 1.00 20.33 ? 101  PHE A CG  1 
ATOM   734  C  CD1 . PHE A 1 101 ? -6.097  22.180 30.154 1.00 21.14 ? 101  PHE A CD1 1 
ATOM   735  C  CD2 . PHE A 1 101 ? -6.473  21.834 32.486 1.00 19.99 ? 101  PHE A CD2 1 
ATOM   736  C  CE1 . PHE A 1 101 ? -7.382  22.757 30.001 1.00 21.73 ? 101  PHE A CE1 1 
ATOM   737  C  CE2 . PHE A 1 101 ? -7.777  22.383 32.355 1.00 23.50 ? 101  PHE A CE2 1 
ATOM   738  C  CZ  . PHE A 1 101 ? -8.214  22.876 31.103 1.00 22.49 ? 101  PHE A CZ  1 
ATOM   739  N  N   . HIS A 1 102 ? -3.810  23.292 33.926 1.00 19.80 ? 102  HIS A N   1 
ATOM   740  C  CA  . HIS A 1 102 ? -4.210  24.456 34.713 1.00 18.93 ? 102  HIS A CA  1 
ATOM   741  C  C   . HIS A 1 102 ? -3.230  25.616 34.541 1.00 18.23 ? 102  HIS A C   1 
ATOM   742  O  O   . HIS A 1 102 ? -3.645  26.755 34.450 1.00 17.43 ? 102  HIS A O   1 
ATOM   743  C  CB  . HIS A 1 102 ? -4.375  24.064 36.172 1.00 19.58 ? 102  HIS A CB  1 
ATOM   744  C  CG  . HIS A 1 102 ? -5.349  22.935 36.354 1.00 21.67 ? 102  HIS A CG  1 
ATOM   745  N  ND1 . HIS A 1 102 ? -6.692  23.065 36.063 1.00 23.24 ? 102  HIS A ND1 1 
ATOM   746  C  CD2 . HIS A 1 102 ? -5.162  21.638 36.695 1.00 23.78 ? 102  HIS A CD2 1 
ATOM   747  C  CE1 . HIS A 1 102 ? -7.304  21.911 36.283 1.00 24.31 ? 102  HIS A CE1 1 
ATOM   748  N  NE2 . HIS A 1 102 ? -6.400  21.024 36.659 1.00 23.44 ? 102  HIS A NE2 1 
ATOM   749  N  N   . ILE A 1 103 ? -1.939  25.308 34.485 1.00 17.81 ? 103  ILE A N   1 
ATOM   750  C  CA  . ILE A 1 103 ? -0.921  26.320 34.185 1.00 18.54 ? 103  ILE A CA  1 
ATOM   751  C  C   . ILE A 1 103 ? -1.072  26.824 32.748 1.00 18.15 ? 103  ILE A C   1 
ATOM   752  O  O   . ILE A 1 103 ? -1.027  28.006 32.532 1.00 17.36 ? 103  ILE A O   1 
ATOM   753  C  CB  . ILE A 1 103 ? 0.495   25.786 34.436 1.00 18.16 ? 103  ILE A CB  1 
ATOM   754  C  CG1 . ILE A 1 103 ? 0.689   25.534 35.932 1.00 19.81 ? 103  ILE A CG1 1 
ATOM   755  C  CG2 . ILE A 1 103 ? 1.548   26.799 33.943 1.00 19.22 ? 103  ILE A CG2 1 
ATOM   756  C  CD1 . ILE A 1 103 ? 2.019   24.821 36.318 1.00 20.39 ? 103  ILE A CD1 1 
ATOM   757  N  N   . TYR A 1 104 ? -1.299  25.908 31.802 1.00 19.01 ? 104  TYR A N   1 
ATOM   758  C  CA  . TYR A 1 104 ? -1.490  26.225 30.395 1.00 20.13 ? 104  TYR A CA  1 
ATOM   759  C  C   . TYR A 1 104 ? -2.679  27.155 30.164 1.00 21.05 ? 104  TYR A C   1 
ATOM   760  O  O   . TYR A 1 104 ? -2.625  27.993 29.277 1.00 21.35 ? 104  TYR A O   1 
ATOM   761  C  CB  . TYR A 1 104 ? -1.668  24.935 29.558 1.00 20.41 ? 104  TYR A CB  1 
ATOM   762  C  CG  . TYR A 1 104 ? -1.739  25.155 28.060 1.00 21.42 ? 104  TYR A CG  1 
ATOM   763  C  CD1 . TYR A 1 104 ? -0.588  25.436 27.312 1.00 21.61 ? 104  TYR A CD1 1 
ATOM   764  C  CD2 . TYR A 1 104 ? -2.959  25.072 27.379 1.00 23.21 ? 104  TYR A CD2 1 
ATOM   765  C  CE1 . TYR A 1 104 ? -0.663  25.639 25.960 1.00 24.42 ? 104  TYR A CE1 1 
ATOM   766  C  CE2 . TYR A 1 104 ? -3.038  25.269 26.011 1.00 22.39 ? 104  TYR A CE2 1 
ATOM   767  C  CZ  . TYR A 1 104 ? -1.890  25.553 25.303 1.00 24.22 ? 104  TYR A CZ  1 
ATOM   768  O  OH  . TYR A 1 104 ? -1.946  25.751 23.938 1.00 23.65 ? 104  TYR A OH  1 
ATOM   769  N  N   . GLU A 1 105 ? -3.735  27.036 30.961 1.00 20.91 ? 105  GLU A N   1 
ATOM   770  C  CA  . GLU A 1 105 ? -4.877  27.914 30.764 1.00 21.79 ? 105  GLU A CA  1 
ATOM   771  C  C   . GLU A 1 105 ? -4.513  29.407 30.851 1.00 21.17 ? 105  GLU A C   1 
ATOM   772  O  O   . GLU A 1 105 ? -5.174  30.237 30.220 1.00 20.24 ? 105  GLU A O   1 
ATOM   773  C  CB  . GLU A 1 105 ? -6.013  27.539 31.684 1.00 22.13 ? 105  GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 105 ? -6.672  26.245 31.225 1.00 24.99 ? 105  GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 105 ? -7.376  26.402 29.882 1.00 28.41 ? 105  GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 105 ? -6.741  26.208 28.817 1.00 32.12 ? 105  GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 105 ? -8.565  26.754 29.892 1.00 30.42 ? 105  GLU A OE2 1 
ATOM   778  N  N   . LYS A 1 106 ? -3.446  29.715 31.591 1.00 20.48 ? 106  LYS A N   1 
ATOM   779  C  CA  . LYS A 1 106 ? -2.880  31.061 31.633 1.00 20.35 ? 106  LYS A CA  1 
ATOM   780  C  C   . LYS A 1 106 ? -1.637  31.269 30.761 1.00 20.26 ? 106  LYS A C   1 
ATOM   781  O  O   . LYS A 1 106 ? -1.529  32.280 30.069 1.00 21.31 ? 106  LYS A O   1 
ATOM   782  C  CB  . LYS A 1 106 ? -2.610  31.446 33.079 1.00 19.85 ? 106  LYS A CB  1 
ATOM   783  C  CG  . LYS A 1 106 ? -3.941  31.760 33.836 1.00 20.06 ? 106  LYS A CG  1 
ATOM   784  C  CD  . LYS A 1 106 ? -3.786  31.741 35.375 1.00 18.87 ? 106  LYS A CD  1 
ATOM   785  C  CE  . LYS A 1 106 ? -5.057  32.274 36.113 1.00 16.53 ? 106  LYS A CE  1 
ATOM   786  N  NZ  . LYS A 1 106 ? -4.734  32.890 37.453 1.00 16.09 ? 106  LYS A NZ  1 
ATOM   787  N  N   . ALA A 1 107 ? -0.717  30.313 30.796 1.00 19.78 ? 107  ALA A N   1 
ATOM   788  C  CA  . ALA A 1 107 ? 0.547   30.364 30.075 1.00 19.02 ? 107  ALA A CA  1 
ATOM   789  C  C   . ALA A 1 107 ? 0.436   30.373 28.522 1.00 19.01 ? 107  ALA A C   1 
ATOM   790  O  O   . ALA A 1 107 ? 1.338   30.877 27.837 1.00 19.47 ? 107  ALA A O   1 
ATOM   791  C  CB  . ALA A 1 107 ? 1.413   29.212 30.535 1.00 18.97 ? 107  ALA A CB  1 
ATOM   792  N  N   . LYS A 1 108 ? -0.662  29.852 27.982 1.00 19.18 ? 108  LYS A N   1 
ATOM   793  C  CA  . LYS A 1 108 ? -0.893  29.774 26.521 1.00 19.45 ? 108  LYS A CA  1 
ATOM   794  C  C   . LYS A 1 108 ? -1.120  31.137 25.865 1.00 19.43 ? 108  LYS A C   1 
ATOM   795  O  O   . LYS A 1 108 ? -1.278  31.224 24.634 1.00 19.06 ? 108  LYS A O   1 
ATOM   796  C  CB  . LYS A 1 108 ? -2.124  28.912 26.198 1.00 19.14 ? 108  LYS A CB  1 
ATOM   797  C  CG  . LYS A 1 108 ? -3.449  29.646 26.405 1.00 19.75 ? 108  LYS A CG  1 
ATOM   798  C  CD  . LYS A 1 108 ? -4.609  28.677 26.647 1.00 20.95 ? 108  LYS A CD  1 
ATOM   799  C  CE  . LYS A 1 108 ? -5.965  29.381 26.713 1.00 21.66 ? 108  LYS A CE  1 
ATOM   800  N  NZ  . LYS A 1 108 ? -7.074  28.383 26.656 1.00 23.50 ? 108  LYS A NZ  1 
ATOM   801  N  N   . ALA A 1 109 ? -1.212  32.183 26.682 1.00 19.50 ? 109  ALA A N   1 
ATOM   802  C  CA  . ALA A 1 109 ? -1.167  33.540 26.177 1.00 19.78 ? 109  ALA A CA  1 
ATOM   803  C  C   . ALA A 1 109 ? 0.259   33.843 25.651 1.00 20.05 ? 109  ALA A C   1 
ATOM   804  O  O   . ALA A 1 109 ? 0.446   34.666 24.743 1.00 19.96 ? 109  ALA A O   1 
ATOM   805  C  CB  . ALA A 1 109 ? -1.565  34.515 27.266 1.00 19.46 ? 109  ALA A CB  1 
ATOM   806  N  N   . GLY A 1 110 ? 1.259   33.165 26.201 1.00 20.19 ? 110  GLY A N   1 
ATOM   807  C  CA  . GLY A 1 110 ? 2.642   33.425 25.832 1.00 20.29 ? 110  GLY A CA  1 
ATOM   808  C  C   . GLY A 1 110 ? 3.120   32.582 24.675 1.00 20.31 ? 110  GLY A C   1 
ATOM   809  O  O   . GLY A 1 110 ? 2.333   31.928 23.966 1.00 19.70 ? 110  GLY A O   1 
ATOM   810  N  N   . LYS A 1 111 ? 4.434   32.600 24.485 1.00 20.54 ? 111  LYS A N   1 
ATOM   811  C  CA  . LYS A 1 111 ? 5.072   31.704 23.534 1.00 20.38 ? 111  LYS A CA  1 
ATOM   812  C  C   . LYS A 1 111 ? 5.402   30.416 24.277 1.00 19.97 ? 111  LYS A C   1 
ATOM   813  O  O   . LYS A 1 111 ? 6.499   30.232 24.808 1.00 19.59 ? 111  LYS A O   1 
ATOM   814  C  CB  . LYS A 1 111 ? 6.314   32.344 22.907 1.00 20.34 ? 111  LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 111 ? 6.886   31.591 21.724 1.00 21.18 ? 111  LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 111 ? 8.348   32.006 21.406 1.00 23.19 ? 111  LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 111 ? 8.950   31.155 20.279 1.00 23.51 ? 111  LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 111 ? 10.456  31.150 20.275 1.00 26.71 ? 111  LYS A NZ  1 
ATOM   819  N  N   . VAL A 1 112 ? 4.433   29.514 24.303 1.00 20.06 ? 112  VAL A N   1 
ATOM   820  C  CA  . VAL A 1 112 ? 4.661   28.171 24.810 1.00 20.24 ? 112  VAL A CA  1 
ATOM   821  C  C   . VAL A 1 112 ? 5.450   27.346 23.769 1.00 20.32 ? 112  VAL A C   1 
ATOM   822  O  O   . VAL A 1 112 ? 5.025   27.177 22.631 1.00 19.95 ? 112  VAL A O   1 
ATOM   823  C  CB  . VAL A 1 112 ? 3.333   27.477 25.204 1.00 21.12 ? 112  VAL A CB  1 
ATOM   824  C  CG1 . VAL A 1 112 ? 3.589   26.058 25.819 1.00 20.85 ? 112  VAL A CG1 1 
ATOM   825  C  CG2 . VAL A 1 112 ? 2.530   28.360 26.203 1.00 21.01 ? 112  VAL A CG2 1 
ATOM   826  N  N   . VAL A 1 113 ? 6.619   26.880 24.180 1.00 20.17 ? 113  VAL A N   1 
ATOM   827  C  CA  . VAL A 1 113 ? 7.474   26.011 23.377 1.00 20.72 ? 113  VAL A CA  1 
ATOM   828  C  C   . VAL A 1 113 ? 7.648   24.702 24.144 1.00 20.21 ? 113  VAL A C   1 
ATOM   829  O  O   . VAL A 1 113 ? 7.374   24.666 25.323 1.00 20.74 ? 113  VAL A O   1 
ATOM   830  C  CB  . VAL A 1 113 ? 8.853   26.692 23.101 1.00 20.58 ? 113  VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 113 ? 8.650   28.022 22.376 1.00 21.77 ? 113  VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 113 ? 9.650   26.906 24.408 1.00 21.18 ? 113  VAL A CG2 1 
ATOM   833  N  N   . GLY A 1 114 ? 8.048   23.620 23.465 1.00 20.22 ? 114  GLY A N   1 
ATOM   834  C  CA  . GLY A 1 114 ? 8.388   22.360 24.122 1.00 19.35 ? 114  GLY A CA  1 
ATOM   835  C  C   . GLY A 1 114 ? 7.264   21.315 24.157 1.00 19.61 ? 114  GLY A C   1 
ATOM   836  O  O   . GLY A 1 114 ? 7.309   20.352 24.945 1.00 18.97 ? 114  GLY A O   1 
ATOM   837  N  N   . GLN A 1 115 ? 6.256   21.483 23.316 1.00 19.39 ? 115  GLN A N   1 
ATOM   838  C  CA  . GLN A 1 115 ? 5.205   20.476 23.208 1.00 19.28 ? 115  GLN A CA  1 
ATOM   839  C  C   . GLN A 1 115 ? 5.809   19.134 22.768 1.00 19.39 ? 115  GLN A C   1 
ATOM   840  O  O   . GLN A 1 115 ? 6.767   19.087 22.008 1.00 19.43 ? 115  GLN A O   1 
ATOM   841  C  CB  . GLN A 1 115 ? 4.136   20.904 22.216 1.00 19.35 ? 115  GLN A CB  1 
ATOM   842  C  CG  . GLN A 1 115 ? 3.357   22.124 22.658 1.00 20.00 ? 115  GLN A CG  1 
ATOM   843  C  CD  . GLN A 1 115 ? 3.942   23.421 22.150 1.00 20.84 ? 115  GLN A CD  1 
ATOM   844  O  OE1 . GLN A 1 115 ? 5.088   23.478 21.703 1.00 20.21 ? 115  GLN A OE1 1 
ATOM   845  N  NE2 . GLN A 1 115 ? 3.155   24.473 22.224 1.00 24.27 ? 115  GLN A NE2 1 
ATOM   846  N  N   . THR A 1 116 ? 5.249   18.047 23.268 1.00 19.65 ? 116  THR A N   1 
ATOM   847  C  CA  . THR A 1 116 ? 5.774   16.726 23.002 1.00 19.83 ? 116  THR A CA  1 
ATOM   848  C  C   . THR A 1 116 ? 4.677   15.773 22.536 1.00 20.67 ? 116  THR A C   1 
ATOM   849  O  O   . THR A 1 116 ? 3.465   15.929 22.841 1.00 20.06 ? 116  THR A O   1 
ATOM   850  C  CB  . THR A 1 116 ? 6.418   16.113 24.244 1.00 19.36 ? 116  THR A CB  1 
ATOM   851  O  OG1 . THR A 1 116 ? 5.435   16.029 25.287 1.00 20.36 ? 116  THR A OG1 1 
ATOM   852  C  CG2 . THR A 1 116 ? 7.541   16.995 24.788 1.00 19.41 ? 116  THR A CG2 1 
ATOM   853  N  N   . SER A 1 117 ? 5.168   14.766 21.837 1.00 21.16 ? 117  SER A N   1 
ATOM   854  C  CA  . SER A 1 117 ? 4.393   13.667 21.350 1.00 21.98 ? 117  SER A CA  1 
ATOM   855  C  C   . SER A 1 117 ? 3.797   12.899 22.523 1.00 22.19 ? 117  SER A C   1 
ATOM   856  O  O   . SER A 1 117 ? 4.453   12.534 23.504 1.00 22.37 ? 117  SER A O   1 
ATOM   857  C  CB  . SER A 1 117 ? 5.280   12.753 20.486 1.00 22.11 ? 117  SER A CB  1 
ATOM   858  O  OG  . SER A 1 117 ? 4.519   11.766 19.806 1.00 24.96 ? 117  SER A OG  1 
ATOM   859  N  N   . THR A 1 118 ? 2.520   12.655 22.371 1.00 22.08 ? 118  THR A N   1 
ATOM   860  C  CA  . THR A 1 118 ? 1.763   11.759 23.205 1.00 23.03 ? 118  THR A CA  1 
ATOM   861  C  C   . THR A 1 118 ? 2.200   10.280 22.992 1.00 23.49 ? 118  THR A C   1 
ATOM   862  O  O   . THR A 1 118 ? 1.788   9.389  23.744 1.00 22.95 ? 118  THR A O   1 
ATOM   863  C  CB  . THR A 1 118 ? 0.280   12.067 22.885 1.00 22.09 ? 118  THR A CB  1 
ATOM   864  O  OG1 . THR A 1 118 ? -0.573  11.706 23.963 1.00 27.36 ? 118  THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 118 ? -0.209  11.296 21.685 1.00 23.00 ? 118  THR A CG2 1 
ATOM   866  N  N   . ASP A 1 119 ? 3.065   10.039 21.990 1.00 24.93 ? 119  ASP A N   1 
ATOM   867  C  CA  . ASP A 1 119 ? 3.665   8.716  21.739 1.00 25.32 ? 119  ASP A CA  1 
ATOM   868  C  C   . ASP A 1 119 ? 4.534   8.209  22.890 1.00 25.53 ? 119  ASP A C   1 
ATOM   869  O  O   . ASP A 1 119 ? 5.342   8.959  23.454 1.00 24.54 ? 119  ASP A O   1 
ATOM   870  C  CB  . ASP A 1 119 ? 4.521   8.727  20.473 1.00 25.88 ? 119  ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 119 ? 5.126   7.338  20.142 1.00 27.19 ? 119  ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 119 ? 4.418   6.298  20.254 1.00 28.03 ? 119  ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 119 ? 6.308   7.195  19.766 1.00 27.82 ? 119  ASP A OD2 1 
ATOM   874  N  N   . GLY A 1 120 ? 4.382   6.919  23.193 1.00 25.40 ? 120  GLY A N   1 
ATOM   875  C  CA  . GLY A 1 120 ? 5.149   6.259  24.237 1.00 26.26 ? 120  GLY A CA  1 
ATOM   876  C  C   . GLY A 1 120 ? 4.457   6.201  25.606 1.00 26.19 ? 120  GLY A C   1 
ATOM   877  O  O   . GLY A 1 120 ? 4.949   5.531  26.501 1.00 26.44 ? 120  GLY A O   1 
ATOM   878  N  N   . TYR A 1 121 ? 3.333   6.902  25.753 1.00 26.37 ? 121  TYR A N   1 
ATOM   879  C  CA  . TYR A 1 121 ? 2.543   6.939  26.988 1.00 26.04 ? 121  TYR A CA  1 
ATOM   880  C  C   . TYR A 1 121 ? 1.253   6.160  26.734 1.00 27.12 ? 121  TYR A C   1 
ATOM   881  O  O   . TYR A 1 121 ? 0.710   6.209  25.602 1.00 26.94 ? 121  TYR A O   1 
ATOM   882  C  CB  . TYR A 1 121 ? 2.201   8.379  27.367 1.00 25.69 ? 121  TYR A CB  1 
ATOM   883  C  CG  . TYR A 1 121 ? 3.401   9.323  27.506 1.00 23.76 ? 121  TYR A CG  1 
ATOM   884  C  CD1 . TYR A 1 121 ? 3.905   10.014 26.404 1.00 24.84 ? 121  TYR A CD1 1 
ATOM   885  C  CD2 . TYR A 1 121 ? 3.996   9.561  28.748 1.00 22.89 ? 121  TYR A CD2 1 
ATOM   886  C  CE1 . TYR A 1 121 ? 5.004   10.922 26.537 1.00 24.09 ? 121  TYR A CE1 1 
ATOM   887  C  CE2 . TYR A 1 121 ? 5.083   10.456 28.893 1.00 21.64 ? 121  TYR A CE2 1 
ATOM   888  C  CZ  . TYR A 1 121 ? 5.565   11.143 27.782 1.00 20.79 ? 121  TYR A CZ  1 
ATOM   889  O  OH  . TYR A 1 121 ? 6.641   11.984 27.888 1.00 20.21 ? 121  TYR A OH  1 
ATOM   890  N  N   . HIS A 1 122 ? 0.790   5.427  27.756 1.00 26.74 ? 122  HIS A N   1 
ATOM   891  C  CA  . HIS A 1 122 ? -0.425  4.597  27.673 1.00 27.41 ? 122  HIS A CA  1 
ATOM   892  C  C   . HIS A 1 122 ? -1.485  5.199  28.574 1.00 26.17 ? 122  HIS A C   1 
ATOM   893  O  O   . HIS A 1 122 ? -1.379  5.114  29.781 1.00 25.78 ? 122  HIS A O   1 
ATOM   894  C  CB  . HIS A 1 122 ? -0.193  3.124  28.097 1.00 28.15 ? 122  HIS A CB  1 
ATOM   895  C  CG  . HIS A 1 122 ? 1.240   2.672  28.048 1.00 32.49 ? 122  HIS A CG  1 
ATOM   896  N  ND1 . HIS A 1 122 ? 1.823   2.153  26.907 1.00 35.90 ? 122  HIS A ND1 1 
ATOM   897  C  CD2 . HIS A 1 122 ? 2.200   2.637  29.010 1.00 36.25 ? 122  HIS A CD2 1 
ATOM   898  C  CE1 . HIS A 1 122 ? 3.082   1.833  27.164 1.00 37.62 ? 122  HIS A CE1 1 
ATOM   899  N  NE2 . HIS A 1 122 ? 3.337   2.120  28.431 1.00 37.54 ? 122  HIS A NE2 1 
ATOM   900  N  N   . PHE A 1 123 ? -2.477  5.841  27.975 1.00 25.54 ? 123  PHE A N   1 
ATOM   901  C  CA  . PHE A 1 123 ? -3.542  6.498  28.726 1.00 25.71 ? 123  PHE A CA  1 
ATOM   902  C  C   . PHE A 1 123 ? -4.747  6.820  27.825 1.00 25.53 ? 123  PHE A C   1 
ATOM   903  O  O   . PHE A 1 123 ? -4.641  6.836  26.600 1.00 25.40 ? 123  PHE A O   1 
ATOM   904  C  CB  . PHE A 1 123 ? -3.001  7.778  29.402 1.00 25.11 ? 123  PHE A CB  1 
ATOM   905  C  CG  . PHE A 1 123 ? -2.695  8.897  28.440 1.00 23.86 ? 123  PHE A CG  1 
ATOM   906  C  CD1 . PHE A 1 123 ? -1.567  8.855  27.629 1.00 23.79 ? 123  PHE A CD1 1 
ATOM   907  C  CD2 . PHE A 1 123 ? -3.543  9.988  28.345 1.00 23.65 ? 123  PHE A CD2 1 
ATOM   908  C  CE1 . PHE A 1 123 ? -1.299  9.865  26.746 1.00 23.94 ? 123  PHE A CE1 1 
ATOM   909  C  CE2 . PHE A 1 123 ? -3.279  11.016 27.465 1.00 23.39 ? 123  PHE A CE2 1 
ATOM   910  C  CZ  . PHE A 1 123 ? -2.147  10.964 26.674 1.00 23.78 ? 123  PHE A CZ  1 
ATOM   911  N  N   . GLU A 1 124 ? -5.890  7.095  28.436 1.00 25.44 ? 124  GLU A N   1 
ATOM   912  C  CA  . GLU A 1 124 ? -7.095  7.323  27.655 1.00 25.88 ? 124  GLU A CA  1 
ATOM   913  C  C   . GLU A 1 124 ? -7.433  8.796  27.443 1.00 25.17 ? 124  GLU A C   1 
ATOM   914  O  O   . GLU A 1 124 ? -7.956  9.164  26.400 1.00 25.72 ? 124  GLU A O   1 
ATOM   915  C  CB  . GLU A 1 124 ? -8.254  6.612  28.311 1.00 26.62 ? 124  GLU A CB  1 
ATOM   916  C  CG  . GLU A 1 124 ? -7.966  5.154  28.580 1.00 29.41 ? 124  GLU A CG  1 
ATOM   917  C  CD  . GLU A 1 124 ? -8.970  4.576  29.538 1.00 33.43 ? 124  GLU A CD  1 
ATOM   918  O  OE1 . GLU A 1 124 ? -10.183 4.866  29.326 1.00 32.03 ? 124  GLU A OE1 1 
ATOM   919  O  OE2 . GLU A 1 124 ? -8.539  3.864  30.499 1.00 36.17 ? 124  GLU A OE2 1 
ATOM   920  N  N   . ALA A 1 125 ? -7.121  9.642  28.413 1.00 24.31 ? 125  ALA A N   1 
ATOM   921  C  CA  . ALA A 1 125 ? -7.477  11.054 28.332 1.00 23.11 ? 125  ALA A CA  1 
ATOM   922  C  C   . ALA A 1 125 ? -6.611  11.937 29.231 1.00 22.50 ? 125  ALA A C   1 
ATOM   923  O  O   . ALA A 1 125 ? -6.153  11.530 30.307 1.00 20.58 ? 125  ALA A O   1 
ATOM   924  C  CB  . ALA A 1 125 ? -8.949  11.231 28.688 1.00 23.03 ? 125  ALA A CB  1 
ATOM   925  N  N   . SER A 1 126 ? -6.411  13.161 28.766 1.00 21.81 ? 126  SER A N   1 
ATOM   926  C  CA  . SER A 1 126 ? -5.709  14.180 29.526 1.00 21.68 ? 126  SER A CA  1 
ATOM   927  C  C   . SER A 1 126 ? -5.976  15.519 28.871 1.00 21.41 ? 126  SER A C   1 
ATOM   928  O  O   . SER A 1 126 ? -5.756  15.685 27.678 1.00 20.84 ? 126  SER A O   1 
ATOM   929  C  CB  . SER A 1 126 ? -4.207  13.900 29.551 1.00 21.88 ? 126  SER A CB  1 
ATOM   930  O  OG  . SER A 1 126 ? -3.473  15.048 29.918 1.00 22.43 ? 126  SER A OG  1 
ATOM   931  N  N   . LYS A 1 127 ? -6.466  16.476 29.648 1.00 21.46 ? 127  LYS A N   1 
ATOM   932  C  CA  . LYS A 1 127 ? -6.562  17.842 29.161 1.00 21.00 ? 127  LYS A CA  1 
ATOM   933  C  C   . LYS A 1 127 ? -5.180  18.464 28.912 1.00 21.07 ? 127  LYS A C   1 
ATOM   934  O  O   . LYS A 1 127 ? -5.095  19.510 28.254 1.00 20.27 ? 127  LYS A O   1 
ATOM   935  C  CB  . LYS A 1 127 ? -7.388  18.690 30.136 1.00 21.25 ? 127  LYS A CB  1 
ATOM   936  C  CG  . LYS A 1 127 ? -8.911  18.373 30.095 1.00 20.97 ? 127  LYS A CG  1 
ATOM   937  C  CD  . LYS A 1 127 ? -9.638  19.259 31.092 1.00 23.88 ? 127  LYS A CD  1 
ATOM   938  C  CE  . LYS A 1 127 ? -11.127 19.228 30.906 1.00 27.52 ? 127  LYS A CE  1 
ATOM   939  N  NZ  . LYS A 1 127 ? -11.883 19.073 32.221 1.00 29.72 ? 127  LYS A NZ  1 
ATOM   940  N  N   . ALA A 1 128 ? -4.109  17.845 29.440 1.00 20.97 ? 128  ALA A N   1 
ATOM   941  C  CA  . ALA A 1 128 ? -2.725  18.203 29.066 1.00 21.35 ? 128  ALA A CA  1 
ATOM   942  C  C   . ALA A 1 128 ? -2.454  18.111 27.558 1.00 21.54 ? 128  ALA A C   1 
ATOM   943  O  O   . ALA A 1 128 ? -1.408  18.523 27.091 1.00 21.41 ? 128  ALA A O   1 
ATOM   944  C  CB  . ALA A 1 128 ? -1.681  17.337 29.819 1.00 21.14 ? 128  ALA A CB  1 
ATOM   945  N  N   . VAL A 1 129 ? -3.394  17.553 26.807 1.00 22.31 ? 129  VAL A N   1 
ATOM   946  C  CA  . VAL A 1 129 ? -3.239  17.357 25.380 1.00 22.96 ? 129  VAL A CA  1 
ATOM   947  C  C   . VAL A 1 129 ? -4.111  18.364 24.614 1.00 23.89 ? 129  VAL A C   1 
ATOM   948  O  O   . VAL A 1 129 ? -5.325  18.338 24.758 1.00 22.81 ? 129  VAL A O   1 
ATOM   949  C  CB  . VAL A 1 129 ? -3.602  15.916 25.007 1.00 23.14 ? 129  VAL A CB  1 
ATOM   950  C  CG1 . VAL A 1 129 ? -3.677  15.759 23.509 1.00 23.10 ? 129  VAL A CG1 1 
ATOM   951  C  CG2 . VAL A 1 129 ? -2.574  14.979 25.579 1.00 22.13 ? 129  VAL A CG2 1 
ATOM   952  N  N   . GLU A 1 130 ? -3.453  19.266 23.854 1.00 24.84 ? 130  GLU A N   1 
ATOM   953  C  CA  . GLU A 1 130 ? -4.088  20.313 23.056 1.00 25.71 ? 130  GLU A CA  1 
ATOM   954  C  C   . GLU A 1 130 ? -3.576  20.205 21.629 1.00 25.61 ? 130  GLU A C   1 
ATOM   955  O  O   . GLU A 1 130 ? -2.364  20.319 21.386 1.00 24.69 ? 130  GLU A O   1 
ATOM   956  C  CB  . GLU A 1 130 ? -3.764  21.733 23.586 1.00 27.20 ? 130  GLU A CB  1 
ATOM   957  C  CG  . GLU A 1 130 ? -4.329  22.903 22.727 1.00 29.74 ? 130  GLU A CG  1 
ATOM   958  C  CD  . GLU A 1 130 ? -3.281  23.632 21.866 1.00 34.59 ? 130  GLU A CD  1 
ATOM   959  O  OE1 . GLU A 1 130 ? -2.071  23.510 22.170 1.00 39.27 ? 130  GLU A OE1 1 
ATOM   960  O  OE2 . GLU A 1 130 ? -3.641  24.347 20.876 1.00 36.43 ? 130  GLU A OE2 1 
ATOM   961  N  N   . GLY A 1 131 ? -4.502  19.971 20.689 1.00 25.77 ? 131  GLY A N   1 
ATOM   962  C  CA  . GLY A 1 131 ? -4.169  19.904 19.278 1.00 25.66 ? 131  GLY A CA  1 
ATOM   963  C  C   . GLY A 1 131 ? -3.227  18.767 18.929 1.00 25.44 ? 131  GLY A C   1 
ATOM   964  O  O   . GLY A 1 131 ? -2.422  18.900 18.017 1.00 25.58 ? 131  GLY A O   1 
ATOM   965  N  N   . GLY A 1 132 ? -3.307  17.666 19.671 1.00 25.48 ? 132  GLY A N   1 
ATOM   966  C  CA  . GLY A 1 132 ? -2.637  16.430 19.286 1.00 25.13 ? 132  GLY A CA  1 
ATOM   967  C  C   . GLY A 1 132 ? -1.358  16.134 20.023 1.00 24.76 ? 132  GLY A C   1 
ATOM   968  O  O   . GLY A 1 132 ? -0.834  15.013 19.945 1.00 25.19 ? 132  GLY A O   1 
ATOM   969  N  N   . LYS A 1 133 ? -0.879  17.133 20.766 1.00 24.01 ? 133  LYS A N   1 
ATOM   970  C  CA  . LYS A 1 133 ? 0.380   17.076 21.477 1.00 22.92 ? 133  LYS A CA  1 
ATOM   971  C  C   . LYS A 1 133 ? 0.152   17.424 22.959 1.00 21.74 ? 133  LYS A C   1 
ATOM   972  O  O   . LYS A 1 133 ? -0.776  18.178 23.285 1.00 20.58 ? 133  LYS A O   1 
ATOM   973  C  CB  . LYS A 1 133 ? 1.338   18.105 20.861 1.00 23.39 ? 133  LYS A CB  1 
ATOM   974  C  CG  . LYS A 1 133 ? 2.002   17.664 19.541 1.00 25.50 ? 133  LYS A CG  1 
ATOM   975  C  CD  . LYS A 1 133 ? 2.015   18.762 18.491 1.00 27.77 ? 133  LYS A CD  1 
ATOM   976  C  CE  . LYS A 1 133 ? 2.655   20.062 18.978 1.00 29.70 ? 133  LYS A CE  1 
ATOM   977  N  NZ  . LYS A 1 133 ? 1.610   21.062 19.420 1.00 31.22 ? 133  LYS A NZ  1 
ATOM   978  N  N   . PHE A 1 134 ? 0.966   16.845 23.844 1.00 20.56 ? 134  PHE A N   1 
ATOM   979  C  CA  . PHE A 1 134 ? 1.102   17.357 25.208 1.00 20.62 ? 134  PHE A CA  1 
ATOM   980  C  C   . PHE A 1 134 ? 1.617   18.767 25.116 1.00 19.73 ? 134  PHE A C   1 
ATOM   981  O  O   . PHE A 1 134 ? 2.503   19.055 24.320 1.00 19.91 ? 134  PHE A O   1 
ATOM   982  C  CB  . PHE A 1 134 ? 2.108   16.567 26.040 1.00 20.06 ? 134  PHE A CB  1 
ATOM   983  C  CG  . PHE A 1 134 ? 1.580   15.252 26.574 1.00 20.52 ? 134  PHE A CG  1 
ATOM   984  C  CD1 . PHE A 1 134 ? 2.327   14.085 26.420 1.00 18.05 ? 134  PHE A CD1 1 
ATOM   985  C  CD2 . PHE A 1 134 ? 0.368   15.187 27.247 1.00 18.61 ? 134  PHE A CD2 1 
ATOM   986  C  CE1 . PHE A 1 134 ? 1.886   12.876 26.954 1.00 20.85 ? 134  PHE A CE1 1 
ATOM   987  C  CE2 . PHE A 1 134 ? -0.091  13.984 27.777 1.00 19.41 ? 134  PHE A CE2 1 
ATOM   988  C  CZ  . PHE A 1 134 ? 0.665   12.811 27.627 1.00 17.77 ? 134  PHE A CZ  1 
ATOM   989  N  N   . VAL A 1 135 ? 1.085   19.628 25.968 1.00 19.21 ? 135  VAL A N   1 
ATOM   990  C  CA  . VAL A 1 135 ? 1.481   21.024 26.005 1.00 18.96 ? 135  VAL A CA  1 
ATOM   991  C  C   . VAL A 1 135 ? 2.907   21.216 26.511 1.00 19.58 ? 135  VAL A C   1 
ATOM   992  O  O   . VAL A 1 135 ? 3.439   22.324 26.478 1.00 20.66 ? 135  VAL A O   1 
ATOM   993  C  CB  . VAL A 1 135 ? 0.503   21.863 26.857 1.00 18.48 ? 135  VAL A CB  1 
ATOM   994  C  CG1 . VAL A 1 135 ? -0.888  21.913 26.173 1.00 16.90 ? 135  VAL A CG1 1 
ATOM   995  C  CG2 . VAL A 1 135 ? 0.405   21.346 28.309 1.00 17.81 ? 135  VAL A CG2 1 
ATOM   996  N  N   . GLY A 1 136 ? 3.518   20.148 26.997 1.00 19.29 ? 136  GLY A N   1 
ATOM   997  C  CA  . GLY A 1 136 ? 4.836   20.253 27.578 1.00 19.04 ? 136  GLY A CA  1 
ATOM   998  C  C   . GLY A 1 136 ? 5.516   18.899 27.637 1.00 18.35 ? 136  GLY A C   1 
ATOM   999  O  O   . GLY A 1 136 ? 5.009   17.904 27.116 1.00 17.93 ? 136  GLY A O   1 
ATOM   1000 N  N   . LEU A 1 137 ? 6.667   18.878 28.290 1.00 17.41 ? 137  LEU A N   1 
ATOM   1001 C  CA  . LEU A 1 137 ? 7.333   17.645 28.643 1.00 17.22 ? 137  LEU A CA  1 
ATOM   1002 C  C   . LEU A 1 137 ? 6.521   16.906 29.718 1.00 17.53 ? 137  LEU A C   1 
ATOM   1003 O  O   . LEU A 1 137 ? 6.030   17.531 30.645 1.00 19.28 ? 137  LEU A O   1 
ATOM   1004 C  CB  . LEU A 1 137 ? 8.735   17.949 29.157 1.00 16.53 ? 137  LEU A CB  1 
ATOM   1005 C  CG  . LEU A 1 137 ? 9.509   16.735 29.676 1.00 15.87 ? 137  LEU A CG  1 
ATOM   1006 C  CD1 . LEU A 1 137 ? 9.686   15.706 28.543 1.00 19.83 ? 137  LEU A CD1 1 
ATOM   1007 C  CD2 . LEU A 1 137 ? 10.861  17.164 30.206 1.00 14.43 ? 137  LEU A CD2 1 
ATOM   1008 N  N   . VAL A 1 138 ? 6.434   15.585 29.617 1.00 17.77 ? 138  VAL A N   1 
ATOM   1009 C  CA  . VAL A 1 138 ? 5.633   14.762 30.539 1.00 19.11 ? 138  VAL A CA  1 
ATOM   1010 C  C   . VAL A 1 138 ? 6.513   13.623 31.088 1.00 19.26 ? 138  VAL A C   1 
ATOM   1011 O  O   . VAL A 1 138 ? 7.059   12.809 30.327 1.00 18.67 ? 138  VAL A O   1 
ATOM   1012 C  CB  . VAL A 1 138 ? 4.367   14.221 29.860 1.00 18.96 ? 138  VAL A CB  1 
ATOM   1013 C  CG1 . VAL A 1 138 ? 3.685   13.116 30.705 1.00 22.08 ? 138  VAL A CG1 1 
ATOM   1014 C  CG2 . VAL A 1 138 ? 3.364   15.361 29.622 1.00 19.19 ? 138  VAL A CG2 1 
ATOM   1015 N  N   . ILE A 1 139 ? 6.658   13.609 32.412 1.00 19.10 ? 139  ILE A N   1 
ATOM   1016 C  CA  . ILE A 1 139 ? 7.494   12.649 33.110 1.00 19.58 ? 139  ILE A CA  1 
ATOM   1017 C  C   . ILE A 1 139 ? 6.583   11.766 33.954 1.00 19.55 ? 139  ILE A C   1 
ATOM   1018 O  O   . ILE A 1 139 ? 5.633   12.258 34.553 1.00 19.65 ? 139  ILE A O   1 
ATOM   1019 C  CB  . ILE A 1 139 ? 8.496   13.418 34.021 1.00 19.41 ? 139  ILE A CB  1 
ATOM   1020 C  CG1 . ILE A 1 139 ? 9.602   14.100 33.197 1.00 19.56 ? 139  ILE A CG1 1 
ATOM   1021 C  CG2 . ILE A 1 139 ? 9.082   12.508 35.107 1.00 19.98 ? 139  ILE A CG2 1 
ATOM   1022 C  CD1 . ILE A 1 139 ? 9.986   13.361 31.882 1.00 17.69 ? 139  ILE A CD1 1 
ATOM   1023 N  N   . ASP A 1 140 ? 6.861   10.471 33.999 1.00 19.64 ? 140  ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 140 ? 6.071   9.541  34.829 1.00 20.26 ? 140  ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 140 ? 7.063   8.655  35.537 1.00 21.20 ? 140  ASP A C   1 
ATOM   1026 O  O   . ASP A 1 140 ? 7.557   7.663  34.962 1.00 21.67 ? 140  ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 140 ? 5.100   8.713  33.982 1.00 19.69 ? 140  ASP A CB  1 
ATOM   1028 C  CG  . ASP A 1 140 ? 4.264   7.731  34.812 1.00 19.11 ? 140  ASP A CG  1 
ATOM   1029 O  OD1 . ASP A 1 140 ? 4.595   7.428  35.973 1.00 15.61 ? 140  ASP A OD1 1 
ATOM   1030 O  OD2 . ASP A 1 140 ? 3.226   7.215  34.381 1.00 15.10 ? 140  ASP A OD2 1 
ATOM   1031 N  N   . GLU A 1 141 ? 7.386   9.060  36.759 1.00 21.83 ? 141  GLU A N   1 
ATOM   1032 C  CA  . GLU A 1 141 ? 8.388   8.412  37.571 1.00 22.70 ? 141  GLU A CA  1 
ATOM   1033 C  C   . GLU A 1 141 ? 7.876   7.145  38.248 1.00 23.04 ? 141  GLU A C   1 
ATOM   1034 O  O   . GLU A 1 141 ? 8.680   6.328  38.701 1.00 21.96 ? 141  GLU A O   1 
ATOM   1035 C  CB  . GLU A 1 141 ? 8.894   9.381  38.633 1.00 23.54 ? 141  GLU A CB  1 
ATOM   1036 C  CG  . GLU A 1 141 ? 9.742   10.516 38.063 1.00 25.81 ? 141  GLU A CG  1 
ATOM   1037 C  CD  . GLU A 1 141 ? 11.215  10.215 38.103 1.00 28.51 ? 141  GLU A CD  1 
ATOM   1038 O  OE1 . GLU A 1 141 ? 11.637  9.208  37.490 1.00 28.65 ? 141  GLU A OE1 1 
ATOM   1039 O  OE2 . GLU A 1 141 ? 11.942  10.975 38.783 1.00 32.03 ? 141  GLU A OE2 1 
ATOM   1040 N  N   . ASP A 1 142 ? 6.554   6.967  38.302 1.00 23.00 ? 142  ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 142 ? 5.974   5.748  38.899 1.00 23.52 ? 142  ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 142 ? 6.058   4.521  37.985 1.00 22.89 ? 142  ASP A C   1 
ATOM   1043 O  O   . ASP A 1 142 ? 6.219   3.371  38.439 1.00 22.77 ? 142  ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 142 ? 4.516   6.012  39.281 1.00 24.51 ? 142  ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 142 ? 4.393   6.998  40.434 1.00 26.74 ? 142  ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 142 ? 4.681   6.580  41.581 1.00 28.92 ? 142  ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 142 ? 4.022   8.193  40.280 1.00 29.17 ? 142  ASP A OD2 1 
ATOM   1048 N  N   . ASN A 1 143 ? 5.968   4.766  36.686 1.00 22.36 ? 143  ASN A N   1 
ATOM   1049 C  CA  . ASN A 1 143 ? 5.871   3.692  35.726 1.00 22.22 ? 143  ASN A CA  1 
ATOM   1050 C  C   . ASN A 1 143 ? 6.991   3.720  34.690 1.00 21.97 ? 143  ASN A C   1 
ATOM   1051 O  O   . ASN A 1 143 ? 7.295   2.708  34.127 1.00 21.98 ? 143  ASN A O   1 
ATOM   1052 C  CB  . ASN A 1 143 ? 4.498   3.733  35.032 1.00 22.44 ? 143  ASN A CB  1 
ATOM   1053 C  CG  . ASN A 1 143 ? 3.326   3.872  36.004 1.00 21.84 ? 143  ASN A CG  1 
ATOM   1054 O  OD1 . ASN A 1 143 ? 3.058   2.978  36.823 1.00 25.12 ? 143  ASN A OD1 1 
ATOM   1055 N  ND2 . ASN A 1 143 ? 2.589   4.972  35.883 1.00 18.74 ? 143  ASN A ND2 1 
ATOM   1056 N  N   . GLN A 1 144 ? 7.589   4.888  34.434 1.00 22.25 ? 144  GLN A N   1 
ATOM   1057 C  CA  . GLN A 1 144 ? 8.571   5.061  33.342 1.00 21.57 ? 144  GLN A CA  1 
ATOM   1058 C  C   . GLN A 1 144 ? 9.755   5.865  33.874 1.00 21.72 ? 144  GLN A C   1 
ATOM   1059 O  O   . GLN A 1 144 ? 10.323  6.709  33.179 1.00 21.61 ? 144  GLN A O   1 
ATOM   1060 C  CB  . GLN A 1 144 ? 7.923   5.756  32.125 1.00 21.01 ? 144  GLN A CB  1 
ATOM   1061 C  CG  . GLN A 1 144 ? 6.630   5.064  31.622 1.00 20.89 ? 144  GLN A CG  1 
ATOM   1062 C  CD  . GLN A 1 144 ? 6.114   5.587  30.259 1.00 22.17 ? 144  GLN A CD  1 
ATOM   1063 O  OE1 . GLN A 1 144 ? 5.940   6.807  30.070 1.00 16.57 ? 144  GLN A OE1 1 
ATOM   1064 N  NE2 . GLN A 1 144 ? 5.811   4.658  29.339 1.00 19.89 ? 144  GLN A NE2 1 
ATOM   1065 N  N   . ASP A 1 145 ? 10.114  5.611  35.133 1.00 21.73 ? 145  ASP A N   1 
ATOM   1066 C  CA  . ASP A 1 145 ? 11.230  6.310  35.781 1.00 22.40 ? 145  ASP A CA  1 
ATOM   1067 C  C   . ASP A 1 145 ? 12.510  6.086  34.988 1.00 22.37 ? 145  ASP A C   1 
ATOM   1068 O  O   . ASP A 1 145 ? 13.427  6.908  35.007 1.00 22.20 ? 145  ASP A O   1 
ATOM   1069 C  CB  . ASP A 1 145 ? 11.442  5.838  37.234 1.00 21.95 ? 145  ASP A CB  1 
ATOM   1070 C  CG  . ASP A 1 145 ? 11.623  4.339  37.338 1.00 23.73 ? 145  ASP A CG  1 
ATOM   1071 O  OD1 . ASP A 1 145 ? 10.619  3.604  37.184 1.00 24.38 ? 145  ASP A OD1 1 
ATOM   1072 O  OD2 . ASP A 1 145 ? 12.734  3.802  37.565 1.00 24.35 ? 145  ASP A OD2 1 
ATOM   1073 N  N   . ASP A 1 146 ? 12.551  4.939  34.323 1.00 22.90 ? 146  ASP A N   1 
ATOM   1074 C  CA  . ASP A 1 146 ? 13.677  4.538  33.483 1.00 23.44 ? 146  ASP A CA  1 
ATOM   1075 C  C   . ASP A 1 146 ? 13.820  5.348  32.182 1.00 22.82 ? 146  ASP A C   1 
ATOM   1076 O  O   . ASP A 1 146 ? 14.872  5.342  31.571 1.00 23.04 ? 146  ASP A O   1 
ATOM   1077 C  CB  . ASP A 1 146 ? 13.614  3.025  33.211 1.00 23.83 ? 146  ASP A CB  1 
ATOM   1078 C  CG  . ASP A 1 146 ? 12.383  2.599  32.389 1.00 25.03 ? 146  ASP A CG  1 
ATOM   1079 O  OD1 . ASP A 1 146 ? 11.261  3.075  32.659 1.00 24.97 ? 146  ASP A OD1 1 
ATOM   1080 O  OD2 . ASP A 1 146 ? 12.456  1.762  31.452 1.00 26.95 ? 146  ASP A OD2 1 
ATOM   1081 N  N   . LEU A 1 147 ? 12.777  6.061  31.769 1.00 22.31 ? 147  LEU A N   1 
ATOM   1082 C  CA  . LEU A 1 147 ? 12.854  6.923  30.591 1.00 21.74 ? 147  LEU A CA  1 
ATOM   1083 C  C   . LEU A 1 147 ? 13.110  8.415  30.916 1.00 21.83 ? 147  LEU A C   1 
ATOM   1084 O  O   . LEU A 1 147 ? 13.302  9.218  30.011 1.00 21.02 ? 147  LEU A O   1 
ATOM   1085 C  CB  . LEU A 1 147 ? 11.565  6.788  29.764 1.00 21.34 ? 147  LEU A CB  1 
ATOM   1086 C  CG  . LEU A 1 147 ? 11.132  5.395  29.272 1.00 20.78 ? 147  LEU A CG  1 
ATOM   1087 C  CD1 . LEU A 1 147 ? 9.824   5.468  28.490 1.00 19.37 ? 147  LEU A CD1 1 
ATOM   1088 C  CD2 . LEU A 1 147 ? 12.205  4.730  28.423 1.00 18.92 ? 147  LEU A CD2 1 
ATOM   1089 N  N   . THR A 1 148 ? 13.106  8.790  32.197 1.00 22.67 ? 148  THR A N   1 
ATOM   1090 C  CA  . THR A 1 148 ? 13.053  10.212 32.570 1.00 23.33 ? 148  THR A CA  1 
ATOM   1091 C  C   . THR A 1 148 ? 14.280  11.023 32.092 1.00 24.11 ? 148  THR A C   1 
ATOM   1092 O  O   . THR A 1 148 ? 14.122  12.139 31.622 1.00 24.81 ? 148  THR A O   1 
ATOM   1093 C  CB  . THR A 1 148 ? 12.770  10.358 34.099 1.00 23.52 ? 148  THR A CB  1 
ATOM   1094 O  OG1 . THR A 1 148 ? 11.362  10.166 34.332 1.00 24.25 ? 148  THR A OG1 1 
ATOM   1095 C  CG2 . THR A 1 148 ? 13.067  11.779 34.636 1.00 23.56 ? 148  THR A CG2 1 
ATOM   1096 N  N   . ASP A 1 149 ? 15.481  10.451 32.159 1.00 24.95 ? 149  ASP A N   1 
ATOM   1097 C  CA  . ASP A 1 149 ? 16.704  11.163 31.737 1.00 25.77 ? 149  ASP A CA  1 
ATOM   1098 C  C   . ASP A 1 149 ? 16.826  11.394 30.223 1.00 25.48 ? 149  ASP A C   1 
ATOM   1099 O  O   . ASP A 1 149 ? 17.163  12.489 29.792 1.00 25.38 ? 149  ASP A O   1 
ATOM   1100 C  CB  . ASP A 1 149 ? 17.952  10.443 32.263 1.00 25.98 ? 149  ASP A CB  1 
ATOM   1101 C  CG  . ASP A 1 149 ? 18.093  10.549 33.772 1.00 27.39 ? 149  ASP A CG  1 
ATOM   1102 O  OD1 . ASP A 1 149 ? 17.794  11.613 34.357 1.00 29.24 ? 149  ASP A OD1 1 
ATOM   1103 O  OD2 . ASP A 1 149 ? 18.498  9.613  34.468 1.00 31.63 ? 149  ASP A OD2 1 
ATOM   1104 N  N   . GLU A 1 150 ? 16.600  10.343 29.434 1.00 26.18 ? 150  GLU A N   1 
ATOM   1105 C  CA  . GLU A 1 150 ? 16.437  10.428 27.978 1.00 26.13 ? 150  GLU A CA  1 
ATOM   1106 C  C   . GLU A 1 150 ? 15.442  11.528 27.616 1.00 25.42 ? 150  GLU A C   1 
ATOM   1107 O  O   . GLU A 1 150 ? 15.742  12.421 26.819 1.00 25.24 ? 150  GLU A O   1 
ATOM   1108 C  CB  . GLU A 1 150 ? 15.886  9.111  27.417 1.00 27.37 ? 150  GLU A CB  1 
ATOM   1109 C  CG  . GLU A 1 150 ? 16.867  7.982  27.120 1.00 29.38 ? 150  GLU A CG  1 
ATOM   1110 C  CD  . GLU A 1 150 ? 16.122  6.702  26.700 1.00 31.76 ? 150  GLU A CD  1 
ATOM   1111 O  OE1 . GLU A 1 150 ? 15.909  6.544  25.478 1.00 34.23 ? 150  GLU A OE1 1 
ATOM   1112 O  OE2 . GLU A 1 150 ? 15.730  5.870  27.573 1.00 30.56 ? 150  GLU A OE2 1 
ATOM   1113 N  N   . ARG A 1 151 ? 14.255  11.464 28.217 1.00 23.81 ? 151  ARG A N   1 
ATOM   1114 C  CA  . ARG A 1 151 ? 13.217  12.456 27.980 1.00 22.79 ? 151  ARG A CA  1 
ATOM   1115 C  C   . ARG A 1 151 ? 13.702  13.889 28.234 1.00 22.70 ? 151  ARG A C   1 
ATOM   1116 O  O   . ARG A 1 151 ? 13.541  14.776 27.390 1.00 22.15 ? 151  ARG A O   1 
ATOM   1117 C  CB  . ARG A 1 151 ? 11.969  12.107 28.814 1.00 22.58 ? 151  ARG A CB  1 
ATOM   1118 C  CG  . ARG A 1 151 ? 11.200  10.943 28.192 1.00 19.80 ? 151  ARG A CG  1 
ATOM   1119 C  CD  . ARG A 1 151 ? 10.033  10.401 29.011 1.00 18.75 ? 151  ARG A CD  1 
ATOM   1120 N  NE  . ARG A 1 151 ? 9.112   9.591  28.219 1.00 16.13 ? 151  ARG A NE  1 
ATOM   1121 C  CZ  . ARG A 1 151 ? 8.077   8.907  28.721 1.00 16.60 ? 151  ARG A CZ  1 
ATOM   1122 N  NH1 . ARG A 1 151 ? 7.822   8.902  30.024 1.00 18.10 ? 151  ARG A NH1 1 
ATOM   1123 N  NH2 . ARG A 1 151 ? 7.302   8.207  27.917 1.00 14.12 ? 151  ARG A NH2 1 
ATOM   1124 N  N   . ILE A 1 152 ? 14.318  14.120 29.382 1.00 22.66 ? 152  ILE A N   1 
ATOM   1125 C  CA  . ILE A 1 152 ? 14.805  15.467 29.709 1.00 22.61 ? 152  ILE A CA  1 
ATOM   1126 C  C   . ILE A 1 152 ? 15.872  15.910 28.724 1.00 22.06 ? 152  ILE A C   1 
ATOM   1127 O  O   . ILE A 1 152 ? 15.883  17.060 28.299 1.00 21.30 ? 152  ILE A O   1 
ATOM   1128 C  CB  . ILE A 1 152 ? 15.341  15.535 31.174 1.00 22.48 ? 152  ILE A CB  1 
ATOM   1129 C  CG1 . ILE A 1 152 ? 14.164  15.466 32.154 1.00 22.79 ? 152  ILE A CG1 1 
ATOM   1130 C  CG2 . ILE A 1 152 ? 16.163  16.830 31.428 1.00 23.16 ? 152  ILE A CG2 1 
ATOM   1131 C  CD1 . ILE A 1 152 ? 14.594  15.100 33.561 1.00 22.10 ? 152  ILE A CD1 1 
ATOM   1132 N  N   . SER A 1 153 ? 16.758  14.997 28.355 1.00 22.36 ? 153  SER A N   1 
ATOM   1133 C  CA  . SER A 1 153 ? 17.876  15.324 27.478 1.00 22.55 ? 153  SER A CA  1 
ATOM   1134 C  C   . SER A 1 153 ? 17.356  15.780 26.108 1.00 23.52 ? 153  SER A C   1 
ATOM   1135 O  O   . SER A 1 153 ? 17.694  16.867 25.631 1.00 22.64 ? 153  SER A O   1 
ATOM   1136 C  CB  . SER A 1 153 ? 18.799  14.109 27.344 1.00 22.88 ? 153  SER A CB  1 
ATOM   1137 O  OG  . SER A 1 153 ? 19.802  14.343 26.373 1.00 22.74 ? 153  SER A OG  1 
ATOM   1138 N  N   . LYS A 1 154 ? 16.506  14.957 25.487 1.00 24.03 ? 154  LYS A N   1 
ATOM   1139 C  CA  . LYS A 1 154 ? 15.902  15.287 24.194 1.00 24.35 ? 154  LYS A CA  1 
ATOM   1140 C  C   . LYS A 1 154 ? 15.071  16.584 24.262 1.00 24.19 ? 154  LYS A C   1 
ATOM   1141 O  O   . LYS A 1 154 ? 15.104  17.406 23.355 1.00 24.16 ? 154  LYS A O   1 
ATOM   1142 C  CB  . LYS A 1 154 ? 15.004  14.143 23.691 1.00 24.79 ? 154  LYS A CB  1 
ATOM   1143 C  CG  . LYS A 1 154 ? 15.690  12.787 23.493 1.00 26.95 ? 154  LYS A CG  1 
ATOM   1144 C  CD  . LYS A 1 154 ? 14.634  11.650 23.519 1.00 29.97 ? 154  LYS A CD  1 
ATOM   1145 C  CE  . LYS A 1 154 ? 15.120  10.365 22.851 1.00 32.19 ? 154  LYS A CE  1 
ATOM   1146 N  NZ  . LYS A 1 154 ? 14.025  9.348  22.756 1.00 34.05 ? 154  LYS A NZ  1 
ATOM   1147 N  N   . TRP A 1 155 ? 14.346  16.775 25.351 1.00 23.80 ? 155  TRP A N   1 
ATOM   1148 C  CA  . TRP A 1 155 ? 13.506  17.959 25.497 1.00 23.53 ? 155  TRP A CA  1 
ATOM   1149 C  C   . TRP A 1 155 ? 14.311  19.247 25.591 1.00 23.48 ? 155  TRP A C   1 
ATOM   1150 O  O   . TRP A 1 155 ? 13.900  20.272 25.053 1.00 23.22 ? 155  TRP A O   1 
ATOM   1151 C  CB  . TRP A 1 155 ? 12.611  17.816 26.719 1.00 23.23 ? 155  TRP A CB  1 
ATOM   1152 C  CG  . TRP A 1 155 ? 11.588  18.867 26.820 1.00 22.38 ? 155  TRP A CG  1 
ATOM   1153 C  CD1 . TRP A 1 155 ? 10.439  18.949 26.109 1.00 20.39 ? 155  TRP A CD1 1 
ATOM   1154 C  CD2 . TRP A 1 155 ? 11.619  20.019 27.672 1.00 21.23 ? 155  TRP A CD2 1 
ATOM   1155 N  NE1 . TRP A 1 155 ? 9.732   20.063 26.486 1.00 18.80 ? 155  TRP A NE1 1 
ATOM   1156 C  CE2 . TRP A 1 155 ? 10.440  20.744 27.436 1.00 20.30 ? 155  TRP A CE2 1 
ATOM   1157 C  CE3 . TRP A 1 155 ? 12.521  20.501 28.639 1.00 24.21 ? 155  TRP A CE3 1 
ATOM   1158 C  CZ2 . TRP A 1 155 ? 10.130  21.933 28.123 1.00 21.11 ? 155  TRP A CZ2 1 
ATOM   1159 C  CZ3 . TRP A 1 155 ? 12.225  21.679 29.315 1.00 23.21 ? 155  TRP A CZ3 1 
ATOM   1160 C  CH2 . TRP A 1 155 ? 11.032  22.381 29.059 1.00 20.93 ? 155  TRP A CH2 1 
ATOM   1161 N  N   . VAL A 1 156 ? 15.448  19.190 26.279 1.00 23.43 ? 156  VAL A N   1 
ATOM   1162 C  CA  . VAL A 1 156 ? 16.334  20.336 26.403 1.00 23.27 ? 156  VAL A CA  1 
ATOM   1163 C  C   . VAL A 1 156 ? 16.962  20.708 25.037 1.00 23.66 ? 156  VAL A C   1 
ATOM   1164 O  O   . VAL A 1 156 ? 17.044  21.879 24.700 1.00 22.40 ? 156  VAL A O   1 
ATOM   1165 C  CB  . VAL A 1 156 ? 17.398  20.108 27.499 1.00 23.48 ? 156  VAL A CB  1 
ATOM   1166 C  CG1 . VAL A 1 156 ? 18.489  21.191 27.474 1.00 21.73 ? 156  VAL A CG1 1 
ATOM   1167 C  CG2 . VAL A 1 156 ? 16.730  20.093 28.882 1.00 23.73 ? 156  VAL A CG2 1 
ATOM   1168 N  N   . GLU A 1 157 ? 17.385  19.702 24.272 1.00 24.39 ? 157  GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 157 ? 17.863  19.887 22.904 1.00 25.23 ? 157  GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 157 ? 16.768  20.521 22.021 1.00 24.89 ? 157  GLU A C   1 
ATOM   1171 O  O   . GLU A 1 157 ? 17.042  21.432 21.247 1.00 25.39 ? 157  GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 157 ? 18.371  18.550 22.339 1.00 25.73 ? 157  GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 157 ? 19.870  18.311 22.654 1.00 29.55 ? 157  GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 157 ? 20.284  16.839 22.854 1.00 32.57 ? 157  GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 157 ? 19.494  15.937 22.518 1.00 34.09 ? 157  GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 157 ? 21.433  16.575 23.345 1.00 34.91 ? 157  GLU A OE2 1 
ATOM   1177 N  N   . GLN A 1 158 ? 15.531  20.073 22.206 1.00 24.14 ? 158  GLN A N   1 
ATOM   1178 C  CA  . GLN A 1 158 ? 14.352  20.570 21.495 1.00 24.10 ? 158  GLN A CA  1 
ATOM   1179 C  C   . GLN A 1 158 ? 14.045  22.048 21.766 1.00 23.27 ? 158  GLN A C   1 
ATOM   1180 O  O   . GLN A 1 158 ? 13.668  22.779 20.862 1.00 22.75 ? 158  GLN A O   1 
ATOM   1181 C  CB  . GLN A 1 158 ? 13.126  19.733 21.919 1.00 24.25 ? 158  GLN A CB  1 
ATOM   1182 C  CG  . GLN A 1 158 ? 11.854  20.009 21.137 1.00 24.97 ? 158  GLN A CG  1 
ATOM   1183 C  CD  . GLN A 1 158 ? 10.637  19.321 21.731 1.00 25.00 ? 158  GLN A CD  1 
ATOM   1184 O  OE1 . GLN A 1 158 ? 9.525   19.801 21.562 1.00 28.25 ? 158  GLN A OE1 1 
ATOM   1185 N  NE2 . GLN A 1 158 ? 10.845  18.208 22.424 1.00 23.33 ? 158  GLN A NE2 1 
ATOM   1186 N  N   . VAL A 1 159 ? 14.179  22.489 23.011 1.00 23.09 ? 159  VAL A N   1 
ATOM   1187 C  CA  . VAL A 1 159 ? 13.813  23.877 23.361 1.00 22.99 ? 159  VAL A CA  1 
ATOM   1188 C  C   . VAL A 1 159 ? 15.005  24.821 23.562 1.00 23.55 ? 159  VAL A C   1 
ATOM   1189 O  O   . VAL A 1 159 ? 14.819  26.010 23.627 1.00 22.94 ? 159  VAL A O   1 
ATOM   1190 C  CB  . VAL A 1 159 ? 12.936  23.949 24.633 1.00 22.92 ? 159  VAL A CB  1 
ATOM   1191 C  CG1 . VAL A 1 159 ? 11.738  23.044 24.496 1.00 22.01 ? 159  VAL A CG1 1 
ATOM   1192 C  CG2 . VAL A 1 159 ? 13.750  23.616 25.914 1.00 20.03 ? 159  VAL A CG2 1 
ATOM   1193 N  N   . LYS A 1 160 ? 16.218  24.297 23.655 1.00 24.86 ? 160  LYS A N   1 
ATOM   1194 C  CA  . LYS A 1 160 ? 17.343  25.120 24.101 1.00 25.94 ? 160  LYS A CA  1 
ATOM   1195 C  C   . LYS A 1 160 ? 17.493  26.381 23.234 1.00 26.06 ? 160  LYS A C   1 
ATOM   1196 O  O   . LYS A 1 160 ? 17.758  27.474 23.762 1.00 25.85 ? 160  LYS A O   1 
ATOM   1197 C  CB  . LYS A 1 160 ? 18.641  24.292 24.220 1.00 26.36 ? 160  LYS A CB  1 
ATOM   1198 C  CG  . LYS A 1 160 ? 19.924  24.863 23.602 1.00 29.18 ? 160  LYS A CG  1 
ATOM   1199 C  CD  . LYS A 1 160 ? 20.447  23.974 22.453 1.00 33.41 ? 160  LYS A CD  1 
ATOM   1200 C  CE  . LYS A 1 160 ? 21.540  23.001 22.889 1.00 35.33 ? 160  LYS A CE  1 
ATOM   1201 N  NZ  . LYS A 1 160 ? 22.922  23.504 22.570 1.00 35.73 ? 160  LYS A NZ  1 
ATOM   1202 N  N   . GLY A 1 161 ? 17.285  26.248 21.929 1.00 25.86 ? 161  GLY A N   1 
ATOM   1203 C  CA  . GLY A 1 161 ? 17.388  27.387 21.021 1.00 25.94 ? 161  GLY A CA  1 
ATOM   1204 C  C   . GLY A 1 161 ? 16.332  28.452 21.275 1.00 25.97 ? 161  GLY A C   1 
ATOM   1205 O  O   . GLY A 1 161 ? 16.612  29.642 21.121 1.00 25.79 ? 161  GLY A O   1 
ATOM   1206 N  N   . SER A 1 162 ? 15.128  28.014 21.648 1.00 25.71 ? 162  SER A N   1 
ATOM   1207 C  CA  . SER A 1 162 ? 14.054  28.905 22.054 1.00 26.09 ? 162  SER A CA  1 
ATOM   1208 C  C   . SER A 1 162 ? 14.398  29.701 23.295 1.00 26.49 ? 162  SER A C   1 
ATOM   1209 O  O   . SER A 1 162 ? 13.944  30.833 23.445 1.00 27.38 ? 162  SER A O   1 
ATOM   1210 C  CB  . SER A 1 162 ? 12.764  28.117 22.311 1.00 26.02 ? 162  SER A CB  1 
ATOM   1211 O  OG  . SER A 1 162 ? 12.373  27.397 21.154 1.00 25.38 ? 162  SER A OG  1 
ATOM   1212 N  N   . PHE A 1 163 ? 15.179  29.106 24.189 1.00 26.82 ? 163  PHE A N   1 
ATOM   1213 C  CA  . PHE A 1 163 ? 15.692  29.801 25.353 1.00 27.18 ? 163  PHE A CA  1 
ATOM   1214 C  C   . PHE A 1 163 ? 17.036  30.388 24.910 1.00 28.48 ? 163  PHE A C   1 
ATOM   1215 O  O   . PHE A 1 163 ? 17.814  29.715 24.252 1.00 30.08 ? 163  PHE A O   1 
ATOM   1216 C  CB  . PHE A 1 163 ? 15.788  28.849 26.544 1.00 26.74 ? 163  PHE A CB  1 
ATOM   1217 C  CG  . PHE A 1 163 ? 14.445  28.444 27.102 1.00 25.64 ? 163  PHE A CG  1 
ATOM   1218 C  CD1 . PHE A 1 163 ? 13.825  27.279 26.686 1.00 24.37 ? 163  PHE A CD1 1 
ATOM   1219 C  CD2 . PHE A 1 163 ? 13.800  29.237 28.020 1.00 24.40 ? 163  PHE A CD2 1 
ATOM   1220 C  CE1 . PHE A 1 163 ? 12.569  26.904 27.205 1.00 24.01 ? 163  PHE A CE1 1 
ATOM   1221 C  CE2 . PHE A 1 163 ? 12.548  28.886 28.520 1.00 25.40 ? 163  PHE A CE2 1 
ATOM   1222 C  CZ  . PHE A 1 163 ? 11.936  27.705 28.106 1.00 23.74 ? 163  PHE A CZ  1 
ATOM   1223 N  N   . ALA A 1 164 ? 17.290  31.660 25.192 1.00 29.67 ? 164  ALA A N   1 
ATOM   1224 C  CA  . ALA A 1 164 ? 18.389  32.392 24.514 1.00 30.13 ? 164  ALA A CA  1 
ATOM   1225 C  C   . ALA A 1 164 ? 19.315  33.115 25.498 1.00 30.46 ? 164  ALA A C   1 
ATOM   1226 O  O   . ALA A 1 164 ? 20.298  33.709 25.058 1.00 30.97 ? 164  ALA A O   1 
ATOM   1227 C  CB  . ALA A 1 164 ? 17.800  33.382 23.530 1.00 29.99 ? 164  ALA A CB  1 
ATOM   1228 O  OXT . ALA A 1 164 ? 19.047  33.079 26.698 1.00 30.97 ? 164  ALA A OXT 1 
HETATM 1229 C  C1  . BEN B 2 .   ? 19.807  36.426 39.177 1.00 32.17 ? 1165 BEN A C1  1 
HETATM 1230 C  C2  . BEN B 2 .   ? 19.610  37.228 38.072 1.00 30.43 ? 1165 BEN A C2  1 
HETATM 1231 C  C3  . BEN B 2 .   ? 18.336  37.343 37.536 1.00 33.05 ? 1165 BEN A C3  1 
HETATM 1232 C  C4  . BEN B 2 .   ? 17.258  36.660 38.093 1.00 30.49 ? 1165 BEN A C4  1 
HETATM 1233 C  C5  . BEN B 2 .   ? 17.473  35.865 39.205 1.00 31.84 ? 1165 BEN A C5  1 
HETATM 1234 C  C6  . BEN B 2 .   ? 18.742  35.746 39.751 1.00 31.47 ? 1165 BEN A C6  1 
HETATM 1235 C  C   . BEN B 2 .   ? 21.168  36.280 39.780 1.00 31.76 ? 1165 BEN A C   1 
HETATM 1236 N  N1  . BEN B 2 .   ? 21.873  37.278 40.071 1.00 31.92 ? 1165 BEN A N1  1 
HETATM 1237 N  N2  . BEN B 2 .   ? 21.636  35.066 39.975 1.00 31.63 ? 1165 BEN A N2  1 
HETATM 1238 CL CL  . CL  C 3 .   ? 6.596   15.975 42.873 1.00 8.55  ? 1166 CL  A CL  1 
HETATM 1239 O  O   . HOH D 4 .   ? 15.694  38.228 29.712 1.00 32.71 ? 2001 HOH A O   1 
HETATM 1240 O  O   . HOH D 4 .   ? 7.022   11.437 49.778 1.00 38.77 ? 2002 HOH A O   1 
HETATM 1241 O  O   . HOH D 4 .   ? 4.502   12.910 49.248 1.00 45.11 ? 2003 HOH A O   1 
HETATM 1242 O  O   . HOH D 4 .   ? -0.746  18.948 46.338 1.00 27.23 ? 2004 HOH A O   1 
HETATM 1243 O  O   . HOH D 4 .   ? 4.534   16.252 44.371 1.00 36.48 ? 2005 HOH A O   1 
HETATM 1244 O  O   . HOH D 4 .   ? 5.023   13.434 42.022 1.00 33.14 ? 2006 HOH A O   1 
HETATM 1245 O  O   . HOH D 4 .   ? 9.544   12.434 50.154 1.00 25.40 ? 2007 HOH A O   1 
HETATM 1246 O  O   . HOH D 4 .   ? 6.605   11.440 40.910 1.00 55.28 ? 2008 HOH A O   1 
HETATM 1247 O  O   . HOH D 4 .   ? 12.456  22.642 49.030 1.00 39.09 ? 2009 HOH A O   1 
HETATM 1248 O  O   . HOH D 4 .   ? 16.922  20.713 47.535 1.00 25.78 ? 2010 HOH A O   1 
HETATM 1249 O  O   . HOH D 4 .   ? 11.505  19.055 47.279 1.00 22.58 ? 2011 HOH A O   1 
HETATM 1250 O  O   . HOH D 4 .   ? -3.876  42.297 39.694 1.00 50.37 ? 2012 HOH A O   1 
HETATM 1251 O  O   . HOH D 4 .   ? 18.121  16.376 40.304 1.00 27.69 ? 2013 HOH A O   1 
HETATM 1252 O  O   . HOH D 4 .   ? 13.590  42.202 35.237 1.00 42.42 ? 2014 HOH A O   1 
HETATM 1253 O  O   . HOH D 4 .   ? 16.541  23.230 44.288 1.00 32.89 ? 2015 HOH A O   1 
HETATM 1254 O  O   . HOH D 4 .   ? 21.107  21.571 39.687 1.00 49.08 ? 2016 HOH A O   1 
HETATM 1255 O  O   . HOH D 4 .   ? 20.376  24.892 39.685 1.00 34.54 ? 2017 HOH A O   1 
HETATM 1256 O  O   . HOH D 4 .   ? 20.645  17.480 39.047 1.00 36.51 ? 2018 HOH A O   1 
HETATM 1257 O  O   . HOH D 4 .   ? 21.616  26.495 35.414 1.00 25.62 ? 2019 HOH A O   1 
HETATM 1258 O  O   . HOH D 4 .   ? 26.324  21.835 38.388 1.00 39.65 ? 2020 HOH A O   1 
HETATM 1259 O  O   . HOH D 4 .   ? 20.748  32.209 42.573 1.00 21.86 ? 2021 HOH A O   1 
HETATM 1260 O  O   . HOH D 4 .   ? 19.385  27.167 40.809 1.00 33.89 ? 2022 HOH A O   1 
HETATM 1261 O  O   . HOH D 4 .   ? 17.935  29.228 43.232 1.00 38.72 ? 2023 HOH A O   1 
HETATM 1262 O  O   . HOH D 4 .   ? 7.640   35.904 22.396 1.00 30.38 ? 2024 HOH A O   1 
HETATM 1263 O  O   . HOH D 4 .   ? 6.595   23.423 46.724 1.00 16.27 ? 2025 HOH A O   1 
HETATM 1264 O  O   . HOH D 4 .   ? 13.480  29.134 46.292 1.00 31.77 ? 2026 HOH A O   1 
HETATM 1265 O  O   . HOH D 4 .   ? -3.970  1.723  32.121 1.00 35.99 ? 2027 HOH A O   1 
HETATM 1266 O  O   . HOH D 4 .   ? 9.795   37.914 45.137 1.00 47.95 ? 2028 HOH A O   1 
HETATM 1267 O  O   . HOH D 4 .   ? -2.146  42.205 41.839 1.00 29.85 ? 2029 HOH A O   1 
HETATM 1268 O  O   . HOH D 4 .   ? 5.840   41.891 40.042 1.00 39.96 ? 2030 HOH A O   1 
HETATM 1269 O  O   . HOH D 4 .   ? 10.738  41.337 39.015 1.00 38.72 ? 2031 HOH A O   1 
HETATM 1270 O  O   . HOH D 4 .   ? -9.979  25.499 33.568 1.00 44.18 ? 2032 HOH A O   1 
HETATM 1271 O  O   . HOH D 4 .   ? 16.178  37.635 34.295 1.00 29.25 ? 2033 HOH A O   1 
HETATM 1272 O  O   . HOH D 4 .   ? 13.255  39.930 33.811 1.00 46.51 ? 2034 HOH A O   1 
HETATM 1273 O  O   . HOH D 4 .   ? -4.897  10.762 24.300 1.00 35.89 ? 2035 HOH A O   1 
HETATM 1274 O  O   . HOH D 4 .   ? 1.364   17.951 35.859 1.00 25.30 ? 2036 HOH A O   1 
HETATM 1275 O  O   . HOH D 4 .   ? 2.093   13.838 40.140 1.00 26.70 ? 2037 HOH A O   1 
HETATM 1276 O  O   . HOH D 4 .   ? 1.516   16.202 43.466 1.00 43.61 ? 2038 HOH A O   1 
HETATM 1277 O  O   . HOH D 4 .   ? -4.444  12.759 37.814 1.00 21.71 ? 2039 HOH A O   1 
HETATM 1278 O  O   . HOH D 4 .   ? -1.171  12.831 44.546 1.00 36.18 ? 2040 HOH A O   1 
HETATM 1279 O  O   . HOH D 4 .   ? -1.938  12.923 40.793 1.00 31.94 ? 2041 HOH A O   1 
HETATM 1280 O  O   . HOH D 4 .   ? -8.824  14.576 42.965 1.00 25.35 ? 2042 HOH A O   1 
HETATM 1281 O  O   . HOH D 4 .   ? -9.046  17.917 38.699 1.00 28.54 ? 2043 HOH A O   1 
HETATM 1282 O  O   . HOH D 4 .   ? -6.131  17.792 45.179 1.00 41.24 ? 2044 HOH A O   1 
HETATM 1283 O  O   . HOH D 4 .   ? -7.000  21.160 44.288 1.00 50.33 ? 2045 HOH A O   1 
HETATM 1284 O  O   . HOH D 4 .   ? -10.855 19.692 41.272 1.00 47.99 ? 2046 HOH A O   1 
HETATM 1285 O  O   . HOH D 4 .   ? -5.914  29.563 44.194 1.00 34.46 ? 2047 HOH A O   1 
HETATM 1286 O  O   . HOH D 4 .   ? -5.536  27.086 45.739 1.00 36.61 ? 2048 HOH A O   1 
HETATM 1287 O  O   . HOH D 4 .   ? -4.733  28.659 40.756 1.00 30.17 ? 2049 HOH A O   1 
HETATM 1288 O  O   . HOH D 4 .   ? -5.971  22.590 40.441 1.00 25.29 ? 2050 HOH A O   1 
HETATM 1289 O  O   . HOH D 4 .   ? 1.509   27.552 48.840 1.00 28.21 ? 2051 HOH A O   1 
HETATM 1290 O  O   . HOH D 4 .   ? -4.106  31.658 45.405 1.00 36.72 ? 2052 HOH A O   1 
HETATM 1291 O  O   . HOH D 4 .   ? -4.846  36.594 40.043 1.00 30.42 ? 2053 HOH A O   1 
HETATM 1292 O  O   . HOH D 4 .   ? -5.859  36.077 34.601 1.00 29.48 ? 2054 HOH A O   1 
HETATM 1293 O  O   . HOH D 4 .   ? 4.792   35.644 22.426 1.00 24.97 ? 2055 HOH A O   1 
HETATM 1294 O  O   . HOH D 4 .   ? 5.807   23.402 27.203 1.00 23.29 ? 2056 HOH A O   1 
HETATM 1295 O  O   . HOH D 4 .   ? -1.892  0.962  35.893 1.00 37.47 ? 2057 HOH A O   1 
HETATM 1296 O  O   . HOH D 4 .   ? -6.432  2.951  35.381 1.00 36.22 ? 2058 HOH A O   1 
HETATM 1297 O  O   . HOH D 4 .   ? -1.468  2.575  31.731 1.00 28.50 ? 2059 HOH A O   1 
HETATM 1298 O  O   . HOH D 4 .   ? -1.302  4.114  42.542 1.00 43.24 ? 2060 HOH A O   1 
HETATM 1299 O  O   . HOH D 4 .   ? -8.063  8.067  35.746 1.00 25.97 ? 2061 HOH A O   1 
HETATM 1300 O  O   . HOH D 4 .   ? -1.551  12.070 36.850 1.00 6.99  ? 2062 HOH A O   1 
HETATM 1301 O  O   . HOH D 4 .   ? -8.502  18.984 35.865 1.00 22.31 ? 2063 HOH A O   1 
HETATM 1302 O  O   . HOH D 4 .   ? -9.335  14.559 31.825 1.00 23.02 ? 2064 HOH A O   1 
HETATM 1303 O  O   . HOH D 4 .   ? -7.799  25.535 35.247 1.00 29.83 ? 2065 HOH A O   1 
HETATM 1304 O  O   . HOH D 4 .   ? -6.313  24.965 39.013 1.00 46.17 ? 2066 HOH A O   1 
HETATM 1305 O  O   . HOH D 4 .   ? -5.624  28.054 35.847 1.00 38.40 ? 2067 HOH A O   1 
HETATM 1306 O  O   . HOH D 4 .   ? -1.218  28.505 22.233 1.00 43.66 ? 2068 HOH A O   1 
HETATM 1307 O  O   . HOH D 4 .   ? -4.279  26.512 23.338 1.00 43.12 ? 2069 HOH A O   1 
HETATM 1308 O  O   . HOH D 4 .   ? -5.360  29.938 38.456 1.00 39.21 ? 2070 HOH A O   1 
HETATM 1309 O  O   . HOH D 4 .   ? 0.150   31.691 22.598 1.00 27.44 ? 2071 HOH A O   1 
HETATM 1310 O  O   . HOH D 4 .   ? 2.680   35.447 22.949 1.00 41.95 ? 2072 HOH A O   1 
HETATM 1311 O  O   . HOH D 4 .   ? -1.021  36.232 23.758 1.00 31.19 ? 2073 HOH A O   1 
HETATM 1312 O  O   . HOH D 4 .   ? 3.591   29.326 20.832 1.00 41.45 ? 2074 HOH A O   1 
HETATM 1313 O  O   . HOH D 4 .   ? 9.412   23.252 20.554 1.00 30.45 ? 2075 HOH A O   1 
HETATM 1314 O  O   . HOH D 4 .   ? 5.095   11.348 16.778 1.00 41.74 ? 2076 HOH A O   1 
HETATM 1315 O  O   . HOH D 4 .   ? 8.193   14.797 21.024 1.00 34.55 ? 2077 HOH A O   1 
HETATM 1316 O  O   . HOH D 4 .   ? -3.635  11.268 22.181 1.00 32.26 ? 2078 HOH A O   1 
HETATM 1317 O  O   . HOH D 4 .   ? 6.553   11.040 22.932 1.00 30.59 ? 2079 HOH A O   1 
HETATM 1318 O  O   . HOH D 4 .   ? 7.619   8.572  25.017 1.00 41.30 ? 2080 HOH A O   1 
HETATM 1319 O  O   . HOH D 4 .   ? 6.864   14.371 26.864 1.00 27.42 ? 2081 HOH A O   1 
HETATM 1320 O  O   . HOH D 4 .   ? 9.049   13.384 25.638 1.00 31.06 ? 2082 HOH A O   1 
HETATM 1321 O  O   . HOH D 4 .   ? -0.693  7.496  23.319 1.00 36.98 ? 2083 HOH A O   1 
HETATM 1322 O  O   . HOH D 4 .   ? -2.510  6.406  24.940 1.00 38.96 ? 2084 HOH A O   1 
HETATM 1323 O  O   . HOH D 4 .   ? -6.819  1.838  32.168 1.00 49.83 ? 2085 HOH A O   1 
HETATM 1324 O  O   . HOH D 4 .   ? -9.922  10.934 25.133 1.00 42.08 ? 2086 HOH A O   1 
HETATM 1325 O  O   . HOH D 4 .   ? -7.910  14.032 26.144 1.00 29.69 ? 2087 HOH A O   1 
HETATM 1326 O  O   . HOH D 4 .   ? -9.346  14.658 28.758 1.00 57.85 ? 2088 HOH A O   1 
HETATM 1327 O  O   . HOH D 4 .   ? -10.155 20.474 34.809 1.00 29.72 ? 2089 HOH A O   1 
HETATM 1328 O  O   . HOH D 4 .   ? -6.074  17.152 20.357 1.00 34.77 ? 2090 HOH A O   1 
HETATM 1329 O  O   . HOH D 4 .   ? 14.562  11.937 39.663 1.00 41.38 ? 2091 HOH A O   1 
HETATM 1330 O  O   . HOH D 4 .   ? 13.967  8.944  36.861 1.00 37.40 ? 2092 HOH A O   1 
HETATM 1331 O  O   . HOH D 4 .   ? 5.786   11.281 38.460 1.00 39.88 ? 2093 HOH A O   1 
HETATM 1332 O  O   . HOH D 4 .   ? 4.277   7.492  44.393 1.00 33.57 ? 2094 HOH A O   1 
HETATM 1333 O  O   . HOH D 4 .   ? 1.589   3.168  39.092 1.00 30.84 ? 2095 HOH A O   1 
HETATM 1334 O  O   . HOH D 4 .   ? 6.555   1.462  29.731 1.00 36.37 ? 2096 HOH A O   1 
HETATM 1335 O  O   . HOH D 4 .   ? 8.100   2.451  27.626 1.00 37.05 ? 2097 HOH A O   1 
HETATM 1336 O  O   . HOH D 4 .   ? 15.596  7.988  33.861 1.00 41.41 ? 2098 HOH A O   1 
HETATM 1337 O  O   . HOH D 4 .   ? 14.584  2.265  30.303 1.00 48.55 ? 2099 HOH A O   1 
HETATM 1338 O  O   . HOH D 4 .   ? 12.482  0.796  28.941 1.00 40.09 ? 2100 HOH A O   1 
HETATM 1339 O  O   . HOH D 4 .   ? 14.977  -0.236 32.101 1.00 52.85 ? 2101 HOH A O   1 
HETATM 1340 O  O   . HOH D 4 .   ? 9.282   9.295  32.837 1.00 24.83 ? 2102 HOH A O   1 
HETATM 1341 O  O   . HOH D 4 .   ? 19.269  8.078  36.014 1.00 40.21 ? 2103 HOH A O   1 
HETATM 1342 O  O   . HOH D 4 .   ? 16.253  7.790  30.440 1.00 42.34 ? 2104 HOH A O   1 
HETATM 1343 O  O   . HOH D 4 .   ? 11.680  14.597 25.609 1.00 37.37 ? 2105 HOH A O   1 
HETATM 1344 O  O   . HOH D 4 .   ? 15.267  16.734 21.021 1.00 36.78 ? 2106 HOH A O   1 
HETATM 1345 O  O   . HOH D 4 .   ? 16.722  23.711 20.075 1.00 36.23 ? 2107 HOH A O   1 
HETATM 1346 O  O   . HOH D 4 .   ? 23.720  24.309 26.041 1.00 40.74 ? 2108 HOH A O   1 
HETATM 1347 O  O   . HOH D 4 .   ? 17.906  31.003 27.261 1.00 46.24 ? 2109 HOH A O   1 
HETATM 1348 O  O   . HOH D 4 .   ? 16.988  33.721 28.020 1.00 46.40 ? 2110 HOH A O   1 
HETATM 1349 O  O   . HOH D 4 .   ? 20.990  39.879 39.864 1.00 25.26 ? 2111 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  TRP 64  64  64  TRP TRP A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 GLN 144 144 144 GLN GLN A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 TRP 155 155 155 TRP TRP A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BEN 1   1165 1165 BEN BEN A . 
C 3 CL  1   1166 1166 CL  CL  A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-05-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Data collection'           
4 3 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            struct 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_struct.title' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         6.0990 
_pdbx_refine_tls.origin_y         21.9770 
_pdbx_refine_tls.origin_z         33.4930 
_pdbx_refine_tls.T[1][1]          0.0093 
_pdbx_refine_tls.T[2][2]          0.0728 
_pdbx_refine_tls.T[3][3]          0.0430 
_pdbx_refine_tls.T[1][2]          -0.0258 
_pdbx_refine_tls.T[1][3]          -0.0018 
_pdbx_refine_tls.T[2][3]          0.0093 
_pdbx_refine_tls.L[1][1]          2.4179 
_pdbx_refine_tls.L[2][2]          1.5998 
_pdbx_refine_tls.L[3][3]          1.1346 
_pdbx_refine_tls.L[1][2]          0.5031 
_pdbx_refine_tls.L[1][3]          -0.6280 
_pdbx_refine_tls.L[2][3]          0.0464 
_pdbx_refine_tls.S[1][1]          -0.1249 
_pdbx_refine_tls.S[1][2]          0.2349 
_pdbx_refine_tls.S[1][3]          0.0867 
_pdbx_refine_tls.S[2][1]          0.0365 
_pdbx_refine_tls.S[2][2]          0.1649 
_pdbx_refine_tls.S[2][3]          -0.0731 
_pdbx_refine_tls.S[3][1]          0.0396 
_pdbx_refine_tls.S[3][2]          -0.0909 
_pdbx_refine_tls.S[3][3]          -0.0400 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     2 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     164 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.0 ? 1 ? ? ? ? 
DENZO  'data reduction' .   ? 2 ? ? ? ? 
SCALA  'data scaling'   .   ? 3 ? ? ? ? 
MOLREP phasing          .   ? 4 ? ? ? ? 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2BMV 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE AUTHORS REPORT THAT DISCREPANCIES IN SEQUENCE ARE DUE TO
THE FACT THAT THE GENE WAS ISOLATED FROM A PATIENT INFECTED
WITH H.PYLORI. THE CONFLICTS REPORTED BELOW COULD BE THAT
FROM A VARIANT STRAIN OF THE BACTERIA.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2055 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2072 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              66 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              66 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              66 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.56 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            6.26 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 95  ? ? -145.16 26.00 
2 1 ALA A 128 ? ? -56.17  -9.38 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 BENZAMIDINE    BEN 
3 'CHLORIDE ION' CL  
4 water          HOH 
#