data_2BPC
# 
_entry.id   2BPC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BPC         
WWPDB D_1000177849 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BPC 
_pdbx_database_status.recvd_initial_deposition_date   1994-07-08 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sawaya, M.R.'  1 
'Pelletier, H.' 2 
'Kumar, A.'     3 
'Wilson, S.H.'  4 
'Kraut, J.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of rat DNA polymerase beta: evidence for a common polymerase mechanism.'                              
Science      264 1930 1935 1994 SCIEAS US 0036-8075 0038 ? 7516581 ? 
1       'Structures of Ternary Complexes of Rat DNA Polymerase Beta, a DNA Template-Primer, and ddCTP'                           
Science      264 1891 ?    1994 SCIEAS US 0036-8075 0038 ? ?       ? 
2       'Studies of the Domain Structure of Mammalian DNA Polymerase Beta. Identification of a Discrete Template Binding Domain' 
J.Biol.Chem. 265 2124 ?    1990 JBCHA3 US 0021-9258 0071 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sawaya, M.R.'   1  
primary 'Pelletier, H.'  2  
primary 'Kumar, A.'      3  
primary 'Wilson, S.H.'   4  
primary 'Kraut, J.'      5  
1       'Pelletier, H.'  6  
1       'Sawaya, M.R.'   7  
1       'Wilson, S.H.'   8  
1       'Kraut, J.'      9  
2       'Kumar, A.'      10 
2       'Widen, S.G.'    11 
2       'Williams, K.R.' 12 
2       'Kedar, P.'      13 
2       'Karpel, R.L.'   14 
2       'Wilson, S.H.'   15 
# 
_cell.entry_id           2BPC 
_cell.length_a           119.807 
_cell.length_b           62.633 
_cell.length_c           37.085 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BPC 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE BETA' 28774.527 1  2.7.7.7 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'  54.938    1  ?       ? ? ? 
3 water       nat water                 18.015    92 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVK
KLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDE
NEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRSE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVK
KLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDE
NEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRSE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   ARG n 
1 3   GLN n 
1 4   ASP n 
1 5   ASP n 
1 6   THR n 
1 7   SER n 
1 8   SER n 
1 9   SER n 
1 10  ILE n 
1 11  ASN n 
1 12  PHE n 
1 13  LEU n 
1 14  THR n 
1 15  ARG n 
1 16  VAL n 
1 17  THR n 
1 18  GLY n 
1 19  ILE n 
1 20  GLY n 
1 21  PRO n 
1 22  SER n 
1 23  ALA n 
1 24  ALA n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  VAL n 
1 29  ASP n 
1 30  GLU n 
1 31  GLY n 
1 32  ILE n 
1 33  LYS n 
1 34  THR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  LEU n 
1 39  ARG n 
1 40  LYS n 
1 41  ASN n 
1 42  GLU n 
1 43  ASP n 
1 44  LYS n 
1 45  LEU n 
1 46  ASN n 
1 47  HIS n 
1 48  HIS n 
1 49  GLN n 
1 50  ARG n 
1 51  ILE n 
1 52  GLY n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  PHE n 
1 57  GLU n 
1 58  ASP n 
1 59  PHE n 
1 60  GLU n 
1 61  LYS n 
1 62  ARG n 
1 63  ILE n 
1 64  PRO n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  MET n 
1 69  LEU n 
1 70  GLN n 
1 71  MET n 
1 72  GLN n 
1 73  ASP n 
1 74  ILE n 
1 75  VAL n 
1 76  LEU n 
1 77  ASN n 
1 78  GLU n 
1 79  VAL n 
1 80  LYS n 
1 81  LYS n 
1 82  LEU n 
1 83  ASP n 
1 84  PRO n 
1 85  GLU n 
1 86  TYR n 
1 87  ILE n 
1 88  ALA n 
1 89  THR n 
1 90  VAL n 
1 91  CYS n 
1 92  GLY n 
1 93  SER n 
1 94  PHE n 
1 95  ARG n 
1 96  ARG n 
1 97  GLY n 
1 98  ALA n 
1 99  GLU n 
1 100 SER n 
1 101 SER n 
1 102 GLY n 
1 103 ASP n 
1 104 MET n 
1 105 ASP n 
1 106 VAL n 
1 107 LEU n 
1 108 LEU n 
1 109 THR n 
1 110 HIS n 
1 111 PRO n 
1 112 ASN n 
1 113 PHE n 
1 114 THR n 
1 115 SER n 
1 116 GLU n 
1 117 SER n 
1 118 SER n 
1 119 LYS n 
1 120 GLN n 
1 121 PRO n 
1 122 LYS n 
1 123 LEU n 
1 124 LEU n 
1 125 HIS n 
1 126 ARG n 
1 127 VAL n 
1 128 VAL n 
1 129 GLU n 
1 130 GLN n 
1 131 LEU n 
1 132 GLN n 
1 133 LYS n 
1 134 VAL n 
1 135 ARG n 
1 136 PHE n 
1 137 ILE n 
1 138 THR n 
1 139 ASP n 
1 140 THR n 
1 141 LEU n 
1 142 SER n 
1 143 LYS n 
1 144 GLY n 
1 145 GLU n 
1 146 THR n 
1 147 LYS n 
1 148 PHE n 
1 149 MET n 
1 150 GLY n 
1 151 VAL n 
1 152 CYS n 
1 153 GLN n 
1 154 LEU n 
1 155 PRO n 
1 156 SER n 
1 157 GLU n 
1 158 ASN n 
1 159 ASP n 
1 160 GLU n 
1 161 ASN n 
1 162 GLU n 
1 163 TYR n 
1 164 PRO n 
1 165 HIS n 
1 166 ARG n 
1 167 ARG n 
1 168 ILE n 
1 169 ASP n 
1 170 ILE n 
1 171 ARG n 
1 172 LEU n 
1 173 ILE n 
1 174 PRO n 
1 175 LYS n 
1 176 ASP n 
1 177 GLN n 
1 178 TYR n 
1 179 TYR n 
1 180 CYS n 
1 181 GLY n 
1 182 VAL n 
1 183 LEU n 
1 184 TYR n 
1 185 PHE n 
1 186 THR n 
1 187 GLY n 
1 188 SER n 
1 189 ASP n 
1 190 ILE n 
1 191 PHE n 
1 192 ASN n 
1 193 LYS n 
1 194 ASN n 
1 195 MET n 
1 196 ARG n 
1 197 ALA n 
1 198 HIS n 
1 199 ALA n 
1 200 LEU n 
1 201 GLU n 
1 202 LYS n 
1 203 GLY n 
1 204 PHE n 
1 205 THR n 
1 206 ILE n 
1 207 ASN n 
1 208 GLU n 
1 209 TYR n 
1 210 THR n 
1 211 ILE n 
1 212 ARG n 
1 213 PRO n 
1 214 LEU n 
1 215 GLY n 
1 216 VAL n 
1 217 THR n 
1 218 GLY n 
1 219 VAL n 
1 220 ALA n 
1 221 GLY n 
1 222 GLU n 
1 223 PRO n 
1 224 LEU n 
1 225 PRO n 
1 226 VAL n 
1 227 ASP n 
1 228 SER n 
1 229 GLU n 
1 230 GLN n 
1 231 ASP n 
1 232 ILE n 
1 233 PHE n 
1 234 ASP n 
1 235 TYR n 
1 236 ILE n 
1 237 GLN n 
1 238 TRP n 
1 239 ARG n 
1 240 TYR n 
1 241 ARG n 
1 242 GLU n 
1 243 PRO n 
1 244 LYS n 
1 245 ASP n 
1 246 ARG n 
1 247 SER n 
1 248 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACTERIAL 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPOB_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06766 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGK
LRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDI
VLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQL
PSENDENEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFD
YIQWRYREPKDRSE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2BPC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 248 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06766 
_struct_ref_seq.db_align_beg                  87 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  334 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       88 
_struct_ref_seq.pdbx_auth_seq_align_end       335 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BPC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.10 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 2BPC 
_refine.ls_number_reflns_obs                     6929 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1880000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1923 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             92 
_refine_hist.number_atoms_total               2016 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        3.0   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2BPC 
_struct.title                     'CRYSTAL STRUCTURE OF RAT DNA POLYMERASE BETA: EVIDENCE FOR A COMMON POLYMERASE MECHANISM' 
_struct.pdbx_descriptor           'DNA POLYMERASE BETA (BETA POLYMERASE) (E.C.2.7.7.7) (31KD DOMAIN) COMPLEXED WITH MN2+' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BPC 
_struct_keywords.pdbx_keywords   NUCLEOTIDYLTRANSFERASE 
_struct_keywords.text            NUCLEOTIDYLTRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 6   ? ARG A 15  ? THR A 93  ARG A 102 1 ? 10 
HELX_P HELX_P2  2  GLY A 20  ? ASP A 29  ? GLY A 107 ASP A 116 1 ? 10 
HELX_P HELX_P3  3  LEU A 35  ? LYS A 40  ? LEU A 122 LYS A 127 1 ? 6  
HELX_P HELX_P4  4  ASN A 41  ? LEU A 45  ? ASN A 128 LEU A 132 5 ? 5  
HELX_P HELX_P5  5  ASN A 46  ? TYR A 55  ? ASN A 133 TYR A 142 1 ? 10 
HELX_P HELX_P6  6  TYR A 55  ? LYS A 61  ? TYR A 142 LYS A 148 1 ? 7  
HELX_P HELX_P7  7  ARG A 65  ? ASP A 83  ? ARG A 152 ASP A 170 1 ? 19 
HELX_P HELX_P8  8  GLN A 120 ? ARG A 135 ? GLN A 207 ARG A 222 1 ? 16 
HELX_P HELX_P9  9  GLN A 177 ? PHE A 185 ? GLN A 264 PHE A 272 1 ? 9  
HELX_P HELX_P10 10 SER A 188 ? GLY A 203 ? SER A 275 GLY A 290 1 ? 16 
HELX_P HELX_P11 11 GLU A 229 ? ILE A 236 ? GLU A 316 ILE A 323 1 ? 8  
HELX_P HELX_P12 12 GLU A 242 ? ARG A 246 ? GLU A 329 ARG A 333 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           187 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            274 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    188 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     275 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 63  ? PRO A 64  ? ILE A 150 PRO A 151 
A 2 SER A 100 ? SER A 101 ? SER A 187 SER A 188 
B 1 ILE A 87  ? VAL A 90  ? ILE A 174 VAL A 177 
B 2 MET A 104 ? THR A 109 ? MET A 191 THR A 196 
B 3 ARG A 166 ? LEU A 172 ? ARG A 253 LEU A 259 
B 4 LYS A 147 ? CYS A 152 ? LYS A 234 CYS A 239 
B 5 ILE A 137 ? LYS A 143 ? ILE A 224 LYS A 230 
C 1 PHE A 204 ? ILE A 206 ? PHE A 291 ILE A 293 
C 2 ILE A 211 ? PRO A 213 ? ILE A 298 PRO A 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 63  ? N ILE A 150 O SER A 101 ? O SER A 188 
B 1 2 N THR A 89  ? N THR A 176 O LEU A 107 ? O LEU A 194 
B 2 3 N MET A 104 ? N MET A 191 O ARG A 167 ? O ARG A 254 
B 3 4 O ILE A 170 ? O ILE A 257 N PHE A 148 ? N PHE A 235 
B 4 5 O VAL A 151 ? O VAL A 238 N THR A 138 ? N THR A 225 
C 1 2 O THR A 205 ? O THR A 292 N ARG A 212 ? N ARG A 299 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE MN A 500' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        ASP 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         103 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         ASP 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          190 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          2BPC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BPC 
_atom_sites.fract_transf_matrix[1][1]   0.008347 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015966 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026965 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   
'GLY     274  - SER     275               OMEGA = 359.92 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 4   ? 25.553 48.205  10.100  1.00 100.00 ? 91  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 4   ? 24.701 49.059  10.913  1.00 100.00 ? 91  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 4   ? 23.809 48.273  11.888  1.00 99.66  ? 91  ASP A C   1 
ATOM   4    O  O   . ASP A 1 4   ? 23.345 47.168  11.587  1.00 98.33  ? 91  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 4   ? 23.945 50.076  10.062  1.00 100.00 ? 91  ASP A CB  1 
ATOM   6    N  N   . ASP A 1 5   ? 23.594 48.882  13.065  1.00 98.67  ? 92  ASP A N   1 
ATOM   7    C  CA  . ASP A 1 5   ? 22.808 48.361  14.177  1.00 96.36  ? 92  ASP A CA  1 
ATOM   8    C  C   . ASP A 1 5   ? 21.401 47.863  13.875  1.00 94.37  ? 92  ASP A C   1 
ATOM   9    O  O   . ASP A 1 5   ? 20.489 48.163  14.645  1.00 94.14  ? 92  ASP A O   1 
ATOM   10   C  CB  . ASP A 1 5   ? 22.799 49.325  15.356  1.00 96.33  ? 92  ASP A CB  1 
ATOM   11   N  N   . THR A 1 6   ? 21.240 47.098  12.783  1.00 92.64  ? 93  THR A N   1 
ATOM   12   C  CA  . THR A 1 6   ? 19.953 46.527  12.356  1.00 89.46  ? 93  THR A CA  1 
ATOM   13   C  C   . THR A 1 6   ? 20.090 45.089  11.859  1.00 85.01  ? 93  THR A C   1 
ATOM   14   O  O   . THR A 1 6   ? 19.206 44.231  12.061  1.00 82.74  ? 93  THR A O   1 
ATOM   15   C  CB  . THR A 1 6   ? 19.152 47.429  11.399  1.00 90.32  ? 93  THR A CB  1 
ATOM   16   O  OG1 . THR A 1 6   ? 18.272 48.254  12.141  1.00 91.13  ? 93  THR A OG1 1 
ATOM   17   C  CG2 . THR A 1 6   ? 18.434 46.620  10.321  1.00 89.63  ? 93  THR A CG2 1 
ATOM   18   N  N   . SER A 1 7   ? 21.236 44.845  11.211  1.00 81.15  ? 94  SER A N   1 
ATOM   19   C  CA  . SER A 1 7   ? 21.561 43.530  10.707  1.00 71.64  ? 94  SER A CA  1 
ATOM   20   C  C   . SER A 1 7   ? 21.594 42.759  11.991  1.00 64.05  ? 94  SER A C   1 
ATOM   21   O  O   . SER A 1 7   ? 21.122 41.648  12.111  1.00 62.04  ? 94  SER A O   1 
ATOM   22   C  CB  . SER A 1 7   ? 22.943 43.549  10.067  1.00 69.00  ? 94  SER A CB  1 
ATOM   23   O  OG  . SER A 1 7   ? 23.415 42.239  9.839   1.00 67.67  ? 94  SER A OG  1 
ATOM   24   N  N   . SER A 1 8   ? 22.153 43.449  12.967  1.00 60.31  ? 95  SER A N   1 
ATOM   25   C  CA  . SER A 1 8   ? 22.272 42.917  14.288  1.00 60.09  ? 95  SER A CA  1 
ATOM   26   C  C   . SER A 1 8   ? 20.906 42.470  14.779  1.00 58.83  ? 95  SER A C   1 
ATOM   27   O  O   . SER A 1 8   ? 20.803 41.538  15.581  1.00 62.47  ? 95  SER A O   1 
ATOM   28   C  CB  . SER A 1 8   ? 22.940 43.925  15.219  1.00 58.04  ? 95  SER A CB  1 
ATOM   29   O  OG  . SER A 1 8   ? 22.439 45.218  14.963  1.00 56.65  ? 95  SER A OG  1 
ATOM   30   N  N   . SER A 1 9   ? 19.864 43.143  14.278  1.00 52.96  ? 96  SER A N   1 
ATOM   31   C  CA  . SER A 1 9   ? 18.509 42.822  14.662  1.00 44.26  ? 96  SER A CA  1 
ATOM   32   C  C   . SER A 1 9   ? 18.037 41.521  14.046  1.00 36.11  ? 96  SER A C   1 
ATOM   33   O  O   . SER A 1 9   ? 17.607 40.629  14.774  1.00 33.46  ? 96  SER A O   1 
ATOM   34   C  CB  . SER A 1 9   ? 17.547 43.984  14.535  1.00 43.48  ? 96  SER A CB  1 
ATOM   35   O  OG  . SER A 1 9   ? 17.957 45.008  15.426  1.00 43.41  ? 96  SER A OG  1 
ATOM   36   N  N   . ILE A 1 10  ? 18.141 41.390  12.728  1.00 30.43  ? 97  ILE A N   1 
ATOM   37   C  CA  . ILE A 1 10  ? 17.713 40.139  12.112  1.00 28.59  ? 97  ILE A CA  1 
ATOM   38   C  C   . ILE A 1 10  ? 18.329 38.934  12.759  1.00 33.39  ? 97  ILE A C   1 
ATOM   39   O  O   . ILE A 1 10  ? 17.652 37.948  12.951  1.00 41.86  ? 97  ILE A O   1 
ATOM   40   C  CB  . ILE A 1 10  ? 17.993 40.008  10.637  1.00 26.18  ? 97  ILE A CB  1 
ATOM   41   C  CG1 . ILE A 1 10  ? 16.970 40.821  9.867   1.00 27.20  ? 97  ILE A CG1 1 
ATOM   42   C  CG2 . ILE A 1 10  ? 18.082 38.529  10.246  1.00 17.98  ? 97  ILE A CG2 1 
ATOM   43   C  CD1 . ILE A 1 10  ? 17.117 42.299  10.231  1.00 32.15  ? 97  ILE A CD1 1 
ATOM   44   N  N   . ASN A 1 11  ? 19.596 39.048  13.115  1.00 34.31  ? 98  ASN A N   1 
ATOM   45   C  CA  . ASN A 1 11  ? 20.326 37.980  13.771  1.00 33.98  ? 98  ASN A CA  1 
ATOM   46   C  C   . ASN A 1 11  ? 19.682 37.587  15.076  1.00 30.09  ? 98  ASN A C   1 
ATOM   47   O  O   . ASN A 1 11  ? 19.463 36.413  15.326  1.00 31.18  ? 98  ASN A O   1 
ATOM   48   C  CB  . ASN A 1 11  ? 21.827 38.294  14.001  1.00 35.12  ? 98  ASN A CB  1 
ATOM   49   C  CG  . ASN A 1 11  ? 22.664 38.111  12.743  1.00 40.04  ? 98  ASN A CG  1 
ATOM   50   O  OD1 . ASN A 1 11  ? 22.232 37.495  11.753  1.00 40.50  ? 98  ASN A OD1 1 
ATOM   51   N  ND2 . ASN A 1 11  ? 23.883 38.630  12.766  1.00 44.70  ? 98  ASN A ND2 1 
ATOM   52   N  N   . PHE A 1 12  ? 19.382 38.572  15.902  1.00 31.13  ? 99  PHE A N   1 
ATOM   53   C  CA  . PHE A 1 12  ? 18.775 38.311  17.186  1.00 33.54  ? 99  PHE A CA  1 
ATOM   54   C  C   . PHE A 1 12  ? 17.469 37.559  17.020  1.00 32.91  ? 99  PHE A C   1 
ATOM   55   O  O   . PHE A 1 12  ? 17.179 36.635  17.764  1.00 34.06  ? 99  PHE A O   1 
ATOM   56   C  CB  . PHE A 1 12  ? 18.571 39.629  17.925  1.00 34.35  ? 99  PHE A CB  1 
ATOM   57   C  CG  . PHE A 1 12  ? 18.217 39.483  19.364  1.00 37.71  ? 99  PHE A CG  1 
ATOM   58   C  CD1 . PHE A 1 12  ? 19.229 39.418  20.314  1.00 42.57  ? 99  PHE A CD1 1 
ATOM   59   C  CD2 . PHE A 1 12  ? 16.883 39.432  19.782  1.00 39.48  ? 99  PHE A CD2 1 
ATOM   60   C  CE1 . PHE A 1 12  ? 18.968 39.298  21.681  1.00 40.85  ? 99  PHE A CE1 1 
ATOM   61   C  CE2 . PHE A 1 12  ? 16.596 39.321  21.138  1.00 41.71  ? 99  PHE A CE2 1 
ATOM   62   C  CZ  . PHE A 1 12  ? 17.635 39.255  22.075  1.00 43.49  ? 99  PHE A CZ  1 
ATOM   63   N  N   . LEU A 1 13  ? 16.702 37.966  16.020  1.00 32.00  ? 100 LEU A N   1 
ATOM   64   C  CA  . LEU A 1 13  ? 15.435 37.344  15.723  1.00 34.19  ? 100 LEU A CA  1 
ATOM   65   C  C   . LEU A 1 13  ? 15.600 35.842  15.609  1.00 37.26  ? 100 LEU A C   1 
ATOM   66   O  O   . LEU A 1 13  ? 15.044 35.092  16.421  1.00 41.30  ? 100 LEU A O   1 
ATOM   67   C  CB  . LEU A 1 13  ? 14.777 37.985  14.483  1.00 34.82  ? 100 LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 13  ? 13.796 39.094  14.861  1.00 35.00  ? 100 LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 13  ? 14.158 39.682  16.231  1.00 34.91  ? 100 LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 13  ? 13.809 40.184  13.790  1.00 34.13  ? 100 LEU A CD2 1 
ATOM   71   N  N   . THR A 1 14  ? 16.391 35.436  14.620  1.00 32.62  ? 101 THR A N   1 
ATOM   72   C  CA  . THR A 1 14  ? 16.715 34.049  14.343  1.00 31.23  ? 101 THR A CA  1 
ATOM   73   C  C   . THR A 1 14  ? 17.199 33.286  15.593  1.00 32.46  ? 101 THR A C   1 
ATOM   74   O  O   . THR A 1 14  ? 17.176 32.057  15.640  1.00 29.19  ? 101 THR A O   1 
ATOM   75   C  CB  . THR A 1 14  ? 17.843 34.059  13.314  1.00 35.56  ? 101 THR A CB  1 
ATOM   76   O  OG1 . THR A 1 14  ? 17.426 34.695  12.128  1.00 34.67  ? 101 THR A OG1 1 
ATOM   77   C  CG2 . THR A 1 14  ? 18.293 32.641  13.013  1.00 42.23  ? 101 THR A CG2 1 
ATOM   78   N  N   . ARG A 1 15  ? 17.649 34.016  16.632  1.00 34.30  ? 102 ARG A N   1 
ATOM   79   C  CA  . ARG A 1 15  ? 18.112 33.385  17.863  1.00 29.70  ? 102 ARG A CA  1 
ATOM   80   C  C   . ARG A 1 15  ? 16.966 32.713  18.569  1.00 29.24  ? 102 ARG A C   1 
ATOM   81   O  O   . ARG A 1 15  ? 17.199 31.852  19.424  1.00 33.15  ? 102 ARG A O   1 
ATOM   82   C  CB  . ARG A 1 15  ? 18.990 34.248  18.786  1.00 24.99  ? 102 ARG A CB  1 
ATOM   83   C  CG  . ARG A 1 15  ? 20.430 34.410  18.280  1.00 17.03  ? 102 ARG A CG  1 
ATOM   84   C  CD  . ARG A 1 15  ? 21.208 35.424  19.089  1.00 15.52  ? 102 ARG A CD  1 
ATOM   85   N  NE  . ARG A 1 15  ? 21.040 35.177  20.508  1.00 13.72  ? 102 ARG A NE  1 
ATOM   86   C  CZ  . ARG A 1 15  ? 21.340 36.083  21.434  1.00 15.26  ? 102 ARG A CZ  1 
ATOM   87   N  NH1 . ARG A 1 15  ? 21.817 37.294  21.093  1.00 15.93  ? 102 ARG A NH1 1 
ATOM   88   N  NH2 . ARG A 1 15  ? 21.149 35.771  22.726  1.00 7.99   ? 102 ARG A NH2 1 
ATOM   89   N  N   . VAL A 1 16  ? 15.747 33.154  18.174  1.00 27.64  ? 103 VAL A N   1 
ATOM   90   C  CA  . VAL A 1 16  ? 14.446 32.665  18.647  1.00 22.00  ? 103 VAL A CA  1 
ATOM   91   C  C   . VAL A 1 16  ? 13.993 31.470  17.828  1.00 16.25  ? 103 VAL A C   1 
ATOM   92   O  O   . VAL A 1 16  ? 13.796 31.539  16.585  1.00 5.72   ? 103 VAL A O   1 
ATOM   93   C  CB  . VAL A 1 16  ? 13.370 33.734  18.721  1.00 26.20  ? 103 VAL A CB  1 
ATOM   94   C  CG1 . VAL A 1 16  ? 11.993 33.125  18.969  1.00 24.72  ? 103 VAL A CG1 1 
ATOM   95   C  CG2 . VAL A 1 16  ? 13.721 34.667  19.875  1.00 30.19  ? 103 VAL A CG2 1 
ATOM   96   N  N   . THR A 1 17  ? 13.857 30.355  18.562  1.00 18.37  ? 104 THR A N   1 
ATOM   97   C  CA  . THR A 1 17  ? 13.446 29.178  17.870  1.00 22.69  ? 104 THR A CA  1 
ATOM   98   C  C   . THR A 1 17  ? 12.068 29.387  17.399  1.00 19.95  ? 104 THR A C   1 
ATOM   99   O  O   . THR A 1 17  ? 11.194 29.704  18.210  1.00 21.18  ? 104 THR A O   1 
ATOM   100  C  CB  . THR A 1 17  ? 13.498 27.847  18.622  1.00 24.90  ? 104 THR A CB  1 
ATOM   101  O  OG1 . THR A 1 17  ? 12.809 26.907  17.794  1.00 23.53  ? 104 THR A OG1 1 
ATOM   102  C  CG2 . THR A 1 17  ? 12.851 27.994  19.996  1.00 20.51  ? 104 THR A CG2 1 
ATOM   103  N  N   . GLY A 1 18  ? 11.941 29.211  16.105  1.00 11.12  ? 105 GLY A N   1 
ATOM   104  C  CA  . GLY A 1 18  ? 10.680 29.358  15.450  1.00 15.10  ? 105 GLY A CA  1 
ATOM   105  C  C   . GLY A 1 18  ? 10.854 30.402  14.386  1.00 23.24  ? 105 GLY A C   1 
ATOM   106  O  O   . GLY A 1 18  ? 10.380 30.256  13.241  1.00 20.89  ? 105 GLY A O   1 
ATOM   107  N  N   . ILE A 1 19  ? 11.565 31.463  14.826  1.00 29.81  ? 106 ILE A N   1 
ATOM   108  C  CA  . ILE A 1 19  ? 11.841 32.589  13.963  1.00 28.48  ? 106 ILE A CA  1 
ATOM   109  C  C   . ILE A 1 19  ? 12.970 32.292  13.039  1.00 28.68  ? 106 ILE A C   1 
ATOM   110  O  O   . ILE A 1 19  ? 14.129 32.358  13.451  1.00 31.88  ? 106 ILE A O   1 
ATOM   111  C  CB  . ILE A 1 19  ? 12.051 33.920  14.661  1.00 27.24  ? 106 ILE A CB  1 
ATOM   112  C  CG1 . ILE A 1 19  ? 10.877 34.227  15.578  1.00 23.98  ? 106 ILE A CG1 1 
ATOM   113  C  CG2 . ILE A 1 19  ? 12.044 34.967  13.564  1.00 31.26  ? 106 ILE A CG2 1 
ATOM   114  C  CD1 . ILE A 1 19  ? 11.153 35.398  16.506  1.00 21.29  ? 106 ILE A CD1 1 
ATOM   115  N  N   . GLY A 1 20  ? 12.561 31.951  11.822  1.00 29.52  ? 107 GLY A N   1 
ATOM   116  C  CA  . GLY A 1 20  ? 13.438 31.633  10.728  1.00 33.05  ? 107 GLY A CA  1 
ATOM   117  C  C   . GLY A 1 20  ? 13.753 32.948  10.071  1.00 37.86  ? 107 GLY A C   1 
ATOM   118  O  O   . GLY A 1 20  ? 13.162 33.965  10.421  1.00 37.10  ? 107 GLY A O   1 
ATOM   119  N  N   . PRO A 1 21  ? 14.673 32.947  9.125   1.00 45.96  ? 108 PRO A N   1 
ATOM   120  C  CA  . PRO A 1 21  ? 15.005 34.188  8.493   1.00 46.39  ? 108 PRO A CA  1 
ATOM   121  C  C   . PRO A 1 21  ? 13.892 34.949  7.821   1.00 43.63  ? 108 PRO A C   1 
ATOM   122  O  O   . PRO A 1 21  ? 13.570 36.006  8.350   1.00 45.19  ? 108 PRO A O   1 
ATOM   123  C  CB  . PRO A 1 21  ? 16.267 34.000  7.662   1.00 49.15  ? 108 PRO A CB  1 
ATOM   124  C  CG  . PRO A 1 21  ? 16.924 32.756  8.237   1.00 50.26  ? 108 PRO A CG  1 
ATOM   125  C  CD  . PRO A 1 21  ? 15.850 32.034  9.053   1.00 50.88  ? 108 PRO A CD  1 
ATOM   126  N  N   . SER A 1 22  ? 13.313 34.453  6.713   1.00 42.26  ? 109 SER A N   1 
ATOM   127  C  CA  . SER A 1 22  ? 12.233 35.194  6.042   1.00 42.16  ? 109 SER A CA  1 
ATOM   128  C  C   . SER A 1 22  ? 11.151 35.697  7.011   1.00 41.34  ? 109 SER A C   1 
ATOM   129  O  O   . SER A 1 22  ? 10.498 36.732  6.792   1.00 39.43  ? 109 SER A O   1 
ATOM   130  C  CB  . SER A 1 22  ? 11.677 34.488  4.808   1.00 41.84  ? 109 SER A CB  1 
ATOM   131  N  N   . ALA A 1 23  ? 11.002 34.937  8.100   1.00 40.57  ? 110 ALA A N   1 
ATOM   132  C  CA  . ALA A 1 23  ? 10.055 35.221  9.147   1.00 37.68  ? 110 ALA A CA  1 
ATOM   133  C  C   . ALA A 1 23  ? 10.609 36.312  10.025  1.00 33.59  ? 110 ALA A C   1 
ATOM   134  O  O   . ALA A 1 23  ? 9.866  37.162  10.461  1.00 34.53  ? 110 ALA A O   1 
ATOM   135  C  CB  . ALA A 1 23  ? 9.738  33.963  9.949   1.00 37.70  ? 110 ALA A CB  1 
ATOM   136  N  N   . ALA A 1 24  ? 11.915 36.282  10.271  1.00 34.99  ? 111 ALA A N   1 
ATOM   137  C  CA  . ALA A 1 24  ? 12.586 37.287  11.097  1.00 42.06  ? 111 ALA A CA  1 
ATOM   138  C  C   . ALA A 1 24  ? 12.565 38.673  10.459  1.00 46.34  ? 111 ALA A C   1 
ATOM   139  O  O   . ALA A 1 24  ? 12.459 39.715  11.123  1.00 45.40  ? 111 ALA A O   1 
ATOM   140  C  CB  . ALA A 1 24  ? 14.005 36.875  11.415  1.00 44.01  ? 111 ALA A CB  1 
ATOM   141  N  N   . ARG A 1 25  ? 12.654 38.667  9.141   1.00 50.35  ? 112 ARG A N   1 
ATOM   142  C  CA  . ARG A 1 25  ? 12.612 39.898  8.396   1.00 59.16  ? 112 ARG A CA  1 
ATOM   143  C  C   . ARG A 1 25  ? 11.246 40.601  8.552   1.00 58.81  ? 112 ARG A C   1 
ATOM   144  O  O   . ARG A 1 25  ? 11.218 41.713  9.093   1.00 59.25  ? 112 ARG A O   1 
ATOM   145  C  CB  . ARG A 1 25  ? 13.012 39.686  6.940   1.00 69.05  ? 112 ARG A CB  1 
ATOM   146  C  CG  . ARG A 1 25  ? 14.387 39.028  6.846   1.00 79.03  ? 112 ARG A CG  1 
ATOM   147  C  CD  . ARG A 1 25  ? 14.950 38.870  5.431   1.00 86.87  ? 112 ARG A CD  1 
ATOM   148  N  NE  . ARG A 1 25  ? 16.360 38.459  5.473   1.00 94.75  ? 112 ARG A NE  1 
ATOM   149  C  CZ  . ARG A 1 25  ? 17.229 38.471  4.453   1.00 99.75  ? 112 ARG A CZ  1 
ATOM   150  N  NH1 . ARG A 1 25  ? 16.882 38.880  3.226   1.00 100.00 ? 112 ARG A NH1 1 
ATOM   151  N  NH2 . ARG A 1 25  ? 18.490 38.065  4.675   1.00 100.00 ? 112 ARG A NH2 1 
ATOM   152  N  N   . LYS A 1 26  ? 10.122 39.966  8.113   1.00 56.14  ? 113 LYS A N   1 
ATOM   153  C  CA  . LYS A 1 26  ? 8.806  40.597  8.239   1.00 52.51  ? 113 LYS A CA  1 
ATOM   154  C  C   . LYS A 1 26  ? 8.563  41.127  9.609   1.00 45.72  ? 113 LYS A C   1 
ATOM   155  O  O   . LYS A 1 26  ? 7.922  42.138  9.790   1.00 44.72  ? 113 LYS A O   1 
ATOM   156  C  CB  . LYS A 1 26  ? 7.573  39.914  7.669   1.00 57.40  ? 113 LYS A CB  1 
ATOM   157  C  CG  . LYS A 1 26  ? 7.180  38.615  8.347   1.00 65.34  ? 113 LYS A CG  1 
ATOM   158  C  CD  . LYS A 1 26  ? 5.803  38.101  7.919   1.00 70.09  ? 113 LYS A CD  1 
ATOM   159  C  CE  . LYS A 1 26  ? 5.555  36.617  8.214   1.00 75.00  ? 113 LYS A CE  1 
ATOM   160  N  NZ  . LYS A 1 26  ? 5.778  36.184  9.614   1.00 75.96  ? 113 LYS A NZ  1 
ATOM   161  N  N   . LEU A 1 27  ? 9.117  40.467  10.578  1.00 45.35  ? 114 LEU A N   1 
ATOM   162  C  CA  . LEU A 1 27  ? 8.913  40.977  11.892  1.00 51.62  ? 114 LEU A CA  1 
ATOM   163  C  C   . LEU A 1 27  ? 9.572  42.322  12.063  1.00 55.19  ? 114 LEU A C   1 
ATOM   164  O  O   . LEU A 1 27  ? 9.036  43.171  12.784  1.00 52.54  ? 114 LEU A O   1 
ATOM   165  C  CB  . LEU A 1 27  ? 9.332  39.978  12.976  1.00 56.93  ? 114 LEU A CB  1 
ATOM   166  C  CG  . LEU A 1 27  ? 8.186  39.083  13.470  1.00 62.52  ? 114 LEU A CG  1 
ATOM   167  C  CD1 . LEU A 1 27  ? 7.112  38.897  12.402  1.00 63.76  ? 114 LEU A CD1 1 
ATOM   168  C  CD2 . LEU A 1 27  ? 8.723  37.705  13.863  1.00 63.67  ? 114 LEU A CD2 1 
ATOM   169  N  N   . VAL A 1 28  ? 10.733 42.505  11.401  1.00 60.44  ? 115 VAL A N   1 
ATOM   170  C  CA  . VAL A 1 28  ? 11.463 43.777  11.509  1.00 65.25  ? 115 VAL A CA  1 
ATOM   171  C  C   . VAL A 1 28  ? 10.670 44.933  10.917  1.00 68.86  ? 115 VAL A C   1 
ATOM   172  O  O   . VAL A 1 28  ? 10.726 46.072  11.397  1.00 69.58  ? 115 VAL A O   1 
ATOM   173  C  CB  . VAL A 1 28  ? 12.881 43.792  10.924  1.00 63.23  ? 115 VAL A CB  1 
ATOM   174  C  CG1 . VAL A 1 28  ? 13.706 44.864  11.635  1.00 61.54  ? 115 VAL A CG1 1 
ATOM   175  C  CG2 . VAL A 1 28  ? 13.562 42.435  11.028  1.00 63.71  ? 115 VAL A CG2 1 
ATOM   176  N  N   . ASP A 1 29  ? 9.929  44.598  9.857   1.00 69.53  ? 116 ASP A N   1 
ATOM   177  C  CA  . ASP A 1 29  ? 9.093  45.532  9.125   1.00 67.40  ? 116 ASP A CA  1 
ATOM   178  C  C   . ASP A 1 29  ? 7.963  46.106  9.938   1.00 62.25  ? 116 ASP A C   1 
ATOM   179  O  O   . ASP A 1 29  ? 7.309  47.039  9.495   1.00 64.22  ? 116 ASP A O   1 
ATOM   180  C  CB  . ASP A 1 29  ? 8.604  45.013  7.741   1.00 71.50  ? 116 ASP A CB  1 
ATOM   181  C  CG  . ASP A 1 29  ? 9.759  44.953  6.763   1.00 74.43  ? 116 ASP A CG  1 
ATOM   182  O  OD1 . ASP A 1 29  ? 10.892 45.190  7.130   1.00 77.24  ? 116 ASP A OD1 1 
ATOM   183  O  OD2 . ASP A 1 29  ? 9.445  44.628  5.509   1.00 73.02  ? 116 ASP A OD2 1 
ATOM   184  N  N   . GLU A 1 30  ? 7.724  45.529  11.103  1.00 58.78  ? 117 GLU A N   1 
ATOM   185  C  CA  . GLU A 1 30  ? 6.687  45.994  11.997  1.00 59.19  ? 117 GLU A CA  1 
ATOM   186  C  C   . GLU A 1 30  ? 7.417  46.783  13.087  1.00 56.79  ? 117 GLU A C   1 
ATOM   187  O  O   . GLU A 1 30  ? 6.831  47.345  14.026  1.00 57.78  ? 117 GLU A O   1 
ATOM   188  C  CB  . GLU A 1 30  ? 5.903  44.828  12.644  1.00 66.47  ? 117 GLU A CB  1 
ATOM   189  C  CG  . GLU A 1 30  ? 5.461  43.667  11.687  1.00 75.09  ? 117 GLU A CG  1 
ATOM   190  C  CD  . GLU A 1 30  ? 4.058  43.777  11.111  1.00 79.66  ? 117 GLU A CD  1 
ATOM   191  O  OE1 . GLU A 1 30  ? 3.128  44.105  11.821  1.00 81.91  ? 117 GLU A OE1 1 
ATOM   192  O  OE2 . GLU A 1 30  ? 3.897  43.286  9.880   1.00 79.94  ? 117 GLU A OE2 1 
ATOM   193  N  N   . GLY A 1 31  ? 8.749  46.806  12.949  1.00 51.27  ? 118 GLY A N   1 
ATOM   194  C  CA  . GLY A 1 31  ? 9.610  47.477  13.905  1.00 46.56  ? 118 GLY A CA  1 
ATOM   195  C  C   . GLY A 1 31  ? 9.947  46.530  15.054  1.00 47.18  ? 118 GLY A C   1 
ATOM   196  O  O   . GLY A 1 31  ? 10.543 46.923  16.055  1.00 46.11  ? 118 GLY A O   1 
ATOM   197  N  N   . ILE A 1 32  ? 9.540  45.261  14.902  1.00 50.19  ? 119 ILE A N   1 
ATOM   198  C  CA  . ILE A 1 32  ? 9.776  44.219  15.889  1.00 50.11  ? 119 ILE A CA  1 
ATOM   199  C  C   . ILE A 1 32  ? 11.229 43.796  15.760  1.00 53.11  ? 119 ILE A C   1 
ATOM   200  O  O   . ILE A 1 32  ? 11.572 43.064  14.813  1.00 55.52  ? 119 ILE A O   1 
ATOM   201  C  CB  . ILE A 1 32  ? 8.846  43.042  15.612  1.00 48.81  ? 119 ILE A CB  1 
ATOM   202  N  N   . LYS A 1 33  ? 12.075 44.247  16.711  1.00 48.80  ? 120 LYS A N   1 
ATOM   203  C  CA  . LYS A 1 33  ? 13.500 43.919  16.652  1.00 41.90  ? 120 LYS A CA  1 
ATOM   204  C  C   . LYS A 1 33  ? 14.094 43.347  17.915  1.00 36.25  ? 120 LYS A C   1 
ATOM   205  O  O   . LYS A 1 33  ? 14.854 42.381  17.822  1.00 37.43  ? 120 LYS A O   1 
ATOM   206  C  CB  . LYS A 1 33  ? 14.364 45.130  16.339  1.00 34.34  ? 120 LYS A CB  1 
ATOM   207  C  CG  . LYS A 1 33  ? 13.994 45.931  15.117  1.00 32.42  ? 120 LYS A CG  1 
ATOM   208  C  CD  . LYS A 1 33  ? 14.736 47.247  15.213  1.00 38.21  ? 120 LYS A CD  1 
ATOM   209  C  CE  . LYS A 1 33  ? 14.476 48.220  14.076  1.00 43.28  ? 120 LYS A CE  1 
ATOM   210  N  NZ  . LYS A 1 33  ? 15.091 49.540  14.323  1.00 43.28  ? 120 LYS A NZ  1 
ATOM   211  N  N   . THR A 1 34  ? 13.794 43.943  19.064  1.00 27.75  ? 121 THR A N   1 
ATOM   212  C  CA  . THR A 1 34  ? 14.390 43.396  20.245  1.00 31.05  ? 121 THR A CA  1 
ATOM   213  C  C   . THR A 1 34  ? 13.647 42.221  20.819  1.00 33.37  ? 121 THR A C   1 
ATOM   214  O  O   . THR A 1 34  ? 12.714 41.699  20.220  1.00 33.31  ? 121 THR A O   1 
ATOM   215  C  CB  . THR A 1 34  ? 14.769 44.440  21.308  1.00 31.13  ? 121 THR A CB  1 
ATOM   216  O  OG1 . THR A 1 34  ? 13.762 44.713  22.258  1.00 30.78  ? 121 THR A OG1 1 
ATOM   217  C  CG2 . THR A 1 34  ? 15.079 45.711  20.571  1.00 32.07  ? 121 THR A CG2 1 
ATOM   218  N  N   . LEU A 1 35  ? 14.116 41.825  21.991  1.00 36.76  ? 122 LEU A N   1 
ATOM   219  C  CA  . LEU A 1 35  ? 13.515 40.757  22.726  1.00 42.29  ? 122 LEU A CA  1 
ATOM   220  C  C   . LEU A 1 35  ? 12.183 41.363  23.145  1.00 38.79  ? 122 LEU A C   1 
ATOM   221  O  O   . LEU A 1 35  ? 11.102 40.906  22.768  1.00 34.12  ? 122 LEU A O   1 
ATOM   222  C  CB  . LEU A 1 35  ? 14.424 40.209  23.894  1.00 50.77  ? 122 LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 35  ? 15.622 41.092  24.373  1.00 53.59  ? 122 LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 35  ? 15.244 42.550  24.657  1.00 53.95  ? 122 LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 35  ? 16.347 40.505  25.591  1.00 52.03  ? 122 LEU A CD2 1 
ATOM   226  N  N   . GLU A 1 36  ? 12.298 42.465  23.882  1.00 43.51  ? 123 GLU A N   1 
ATOM   227  C  CA  . GLU A 1 36  ? 11.154 43.210  24.370  1.00 45.15  ? 123 GLU A CA  1 
ATOM   228  C  C   . GLU A 1 36  ? 10.143 43.524  23.273  1.00 43.74  ? 123 GLU A C   1 
ATOM   229  O  O   . GLU A 1 36  ? 8.965  43.552  23.610  1.00 44.88  ? 123 GLU A O   1 
ATOM   230  C  CB  . GLU A 1 36  ? 11.541 44.438  25.194  1.00 46.02  ? 123 GLU A CB  1 
ATOM   231  N  N   . ASP A 1 37  ? 10.588 43.744  22.000  1.00 40.22  ? 124 ASP A N   1 
ATOM   232  C  CA  . ASP A 1 37  ? 9.692  44.036  20.853  1.00 41.91  ? 124 ASP A CA  1 
ATOM   233  C  C   . ASP A 1 37  ? 8.867  42.823  20.500  1.00 43.93  ? 124 ASP A C   1 
ATOM   234  O  O   . ASP A 1 37  ? 7.816  42.898  19.849  1.00 45.47  ? 124 ASP A O   1 
ATOM   235  C  CB  . ASP A 1 37  ? 10.341 44.518  19.520  1.00 44.90  ? 124 ASP A CB  1 
ATOM   236  C  CG  . ASP A 1 37  ? 10.823 45.932  19.615  1.00 49.44  ? 124 ASP A CG  1 
ATOM   237  O  OD1 . ASP A 1 37  ? 10.795 46.517  20.678  1.00 51.84  ? 124 ASP A OD1 1 
ATOM   238  O  OD2 . ASP A 1 37  ? 11.266 46.455  18.475  1.00 49.42  ? 124 ASP A OD2 1 
ATOM   239  N  N   . LEU A 1 38  ? 9.387  41.682  20.913  1.00 41.76  ? 125 LEU A N   1 
ATOM   240  C  CA  . LEU A 1 38  ? 8.668  40.471  20.651  1.00 37.68  ? 125 LEU A CA  1 
ATOM   241  C  C   . LEU A 1 38  ? 7.603  40.347  21.712  1.00 30.16  ? 125 LEU A C   1 
ATOM   242  O  O   . LEU A 1 38  ? 6.443  40.367  21.383  1.00 31.00  ? 125 LEU A O   1 
ATOM   243  C  CB  . LEU A 1 38  ? 9.557  39.216  20.581  1.00 34.07  ? 125 LEU A CB  1 
ATOM   244  C  CG  . LEU A 1 38  ? 10.370 39.164  19.299  1.00 29.51  ? 125 LEU A CG  1 
ATOM   245  C  CD1 . LEU A 1 38  ? 10.824 37.741  19.094  1.00 29.25  ? 125 LEU A CD1 1 
ATOM   246  C  CD2 . LEU A 1 38  ? 9.503  39.576  18.121  1.00 30.99  ? 125 LEU A CD2 1 
ATOM   247  N  N   . ARG A 1 39  ? 8.051  40.269  22.961  1.00 25.65  ? 126 ARG A N   1 
ATOM   248  C  CA  . ARG A 1 39  ? 7.253  40.132  24.158  1.00 33.18  ? 126 ARG A CA  1 
ATOM   249  C  C   . ARG A 1 39  ? 5.945  40.914  24.187  1.00 41.24  ? 126 ARG A C   1 
ATOM   250  O  O   . ARG A 1 39  ? 4.918  40.448  24.712  1.00 41.92  ? 126 ARG A O   1 
ATOM   251  C  CB  . ARG A 1 39  ? 8.120  40.485  25.359  1.00 41.09  ? 126 ARG A CB  1 
ATOM   252  C  CG  . ARG A 1 39  ? 9.373  39.621  25.365  1.00 50.22  ? 126 ARG A CG  1 
ATOM   253  C  CD  . ARG A 1 39  ? 10.361 39.809  26.522  1.00 60.39  ? 126 ARG A CD  1 
ATOM   254  N  NE  . ARG A 1 39  ? 11.361 38.715  26.530  1.00 68.82  ? 126 ARG A NE  1 
ATOM   255  C  CZ  . ARG A 1 39  ? 12.293 38.439  27.467  1.00 71.27  ? 126 ARG A CZ  1 
ATOM   256  N  NH1 . ARG A 1 39  ? 12.443 39.174  28.581  1.00 70.94  ? 126 ARG A NH1 1 
ATOM   257  N  NH2 . ARG A 1 39  ? 13.098 37.381  27.268  1.00 70.59  ? 126 ARG A NH2 1 
ATOM   258  N  N   . LYS A 1 40  ? 6.014  42.123  23.632  1.00 43.91  ? 127 LYS A N   1 
ATOM   259  C  CA  . LYS A 1 40  ? 4.900  43.047  23.563  1.00 38.45  ? 127 LYS A CA  1 
ATOM   260  C  C   . LYS A 1 40  ? 4.148  42.764  22.322  1.00 31.24  ? 127 LYS A C   1 
ATOM   261  O  O   . LYS A 1 40  ? 3.256  43.520  21.973  1.00 38.55  ? 127 LYS A O   1 
ATOM   262  C  CB  . LYS A 1 40  ? 5.324  44.527  23.446  1.00 39.89  ? 127 LYS A CB  1 
ATOM   263  C  CG  . LYS A 1 40  ? 6.099  45.069  24.626  1.00 42.31  ? 127 LYS A CG  1 
ATOM   264  C  CD  . LYS A 1 40  ? 5.444  44.678  25.926  1.00 48.44  ? 127 LYS A CD  1 
ATOM   265  C  CE  . LYS A 1 40  ? 6.428  44.691  27.079  1.00 56.22  ? 127 LYS A CE  1 
ATOM   266  N  NZ  . LYS A 1 40  ? 5.975  43.852  28.202  1.00 59.73  ? 127 LYS A NZ  1 
ATOM   267  N  N   . ASN A 1 41  ? 4.509  41.714  21.646  1.00 20.93  ? 128 ASN A N   1 
ATOM   268  C  CA  . ASN A 1 41  ? 3.804  41.481  20.411  1.00 20.59  ? 128 ASN A CA  1 
ATOM   269  C  C   . ASN A 1 41  ? 3.537  40.043  20.013  1.00 26.41  ? 128 ASN A C   1 
ATOM   270  O  O   . ASN A 1 41  ? 3.638  39.685  18.817  1.00 25.77  ? 128 ASN A O   1 
ATOM   271  C  CB  . ASN A 1 41  ? 4.411  42.274  19.256  1.00 21.88  ? 128 ASN A CB  1 
ATOM   272  C  CG  . ASN A 1 41  ? 4.187  43.763  19.385  1.00 26.88  ? 128 ASN A CG  1 
ATOM   273  O  OD1 . ASN A 1 41  ? 3.065  44.271  19.124  1.00 26.28  ? 128 ASN A OD1 1 
ATOM   274  N  ND2 . ASN A 1 41  ? 5.178  44.415  20.014  1.00 30.09  ? 128 ASN A ND2 1 
ATOM   275  N  N   . GLU A 1 42  ? 3.170  39.248  21.039  1.00 25.18  ? 129 GLU A N   1 
ATOM   276  C  CA  . GLU A 1 42  ? 2.871  37.861  20.835  1.00 18.41  ? 129 GLU A CA  1 
ATOM   277  C  C   . GLU A 1 42  ? 1.938  37.623  19.693  1.00 22.07  ? 129 GLU A C   1 
ATOM   278  O  O   . GLU A 1 42  ? 1.896  36.508  19.204  1.00 30.70  ? 129 GLU A O   1 
ATOM   279  C  CB  . GLU A 1 42  ? 2.248  37.227  22.055  1.00 9.76   ? 129 GLU A CB  1 
ATOM   280  C  CG  . GLU A 1 42  ? 3.321  36.917  23.086  1.00 14.47  ? 129 GLU A CG  1 
ATOM   281  C  CD  . GLU A 1 42  ? 2.619  36.789  24.385  1.00 24.44  ? 129 GLU A CD  1 
ATOM   282  O  OE1 . GLU A 1 42  ? 1.787  37.629  24.685  1.00 25.20  ? 129 GLU A OE1 1 
ATOM   283  O  OE2 . GLU A 1 42  ? 3.043  35.790  25.167  1.00 26.73  ? 129 GLU A OE2 1 
ATOM   284  N  N   . ASP A 1 43  ? 1.187  38.630  19.277  1.00 11.69  ? 130 ASP A N   1 
ATOM   285  C  CA  . ASP A 1 43  ? 0.266  38.390  18.193  1.00 11.55  ? 130 ASP A CA  1 
ATOM   286  C  C   . ASP A 1 43  ? 0.826  38.232  16.808  1.00 11.61  ? 130 ASP A C   1 
ATOM   287  O  O   . ASP A 1 43  ? 0.157  37.702  15.908  1.00 9.99   ? 130 ASP A O   1 
ATOM   288  C  CB  . ASP A 1 43  ? -0.888 39.383  18.139  1.00 9.13   ? 130 ASP A CB  1 
ATOM   289  C  CG  . ASP A 1 43  ? -0.370 40.681  18.575  1.00 4.14   ? 130 ASP A CG  1 
ATOM   290  O  OD1 . ASP A 1 43  ? -0.047 40.782  19.724  1.00 3.40   ? 130 ASP A OD1 1 
ATOM   291  O  OD2 . ASP A 1 43  ? -0.272 41.612  17.638  1.00 1.00   ? 130 ASP A OD2 1 
ATOM   292  N  N   . LYS A 1 44  ? 2.026  38.707  16.594  1.00 14.39  ? 131 LYS A N   1 
ATOM   293  C  CA  . LYS A 1 44  ? 2.553  38.565  15.246  1.00 18.36  ? 131 LYS A CA  1 
ATOM   294  C  C   . LYS A 1 44  ? 3.144  37.156  14.938  1.00 17.80  ? 131 LYS A C   1 
ATOM   295  O  O   . LYS A 1 44  ? 3.333  36.803  13.759  1.00 10.99  ? 131 LYS A O   1 
ATOM   296  C  CB  . LYS A 1 44  ? 3.523  39.712  15.006  1.00 14.71  ? 131 LYS A CB  1 
ATOM   297  N  N   . LEU A 1 45  ? 3.406  36.406  16.049  1.00 13.17  ? 132 LEU A N   1 
ATOM   298  C  CA  . LEU A 1 45  ? 3.994  35.071  16.187  1.00 15.23  ? 132 LEU A CA  1 
ATOM   299  C  C   . LEU A 1 45  ? 3.128  33.807  16.290  1.00 18.33  ? 132 LEU A C   1 
ATOM   300  O  O   . LEU A 1 45  ? 2.045  33.739  16.866  1.00 15.12  ? 132 LEU A O   1 
ATOM   301  C  CB  . LEU A 1 45  ? 4.719  35.026  17.552  1.00 11.98  ? 132 LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 45  ? 5.681  36.155  17.803  1.00 6.24   ? 132 LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 45  ? 6.122  36.065  19.267  1.00 1.00   ? 132 LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 45  ? 6.830  36.086  16.770  1.00 1.00   ? 132 LEU A CD2 1 
ATOM   305  N  N   . ASN A 1 46  ? 3.691  32.729  15.773  1.00 18.81  ? 133 ASN A N   1 
ATOM   306  C  CA  . ASN A 1 46  ? 3.022  31.469  15.849  1.00 17.14  ? 133 ASN A CA  1 
ATOM   307  C  C   . ASN A 1 46  ? 3.226  30.845  17.229  1.00 23.93  ? 133 ASN A C   1 
ATOM   308  O  O   . ASN A 1 46  ? 3.885  31.421  18.135  1.00 22.65  ? 133 ASN A O   1 
ATOM   309  C  CB  . ASN A 1 46  ? 3.181  30.543  14.625  1.00 17.67  ? 133 ASN A CB  1 
ATOM   310  C  CG  . ASN A 1 46  ? 4.598  30.141  14.264  1.00 13.35  ? 133 ASN A CG  1 
ATOM   311  O  OD1 . ASN A 1 46  ? 4.894  29.892  13.069  1.00 5.12   ? 133 ASN A OD1 1 
ATOM   312  N  ND2 . ASN A 1 46  ? 5.422  29.976  15.304  1.00 13.51  ? 133 ASN A ND2 1 
ATOM   313  N  N   . HIS A 1 47  ? 2.628  29.669  17.410  1.00 22.51  ? 134 HIS A N   1 
ATOM   314  C  CA  . HIS A 1 47  ? 2.745  29.018  18.687  1.00 17.48  ? 134 HIS A CA  1 
ATOM   315  C  C   . HIS A 1 47  ? 4.197  28.737  18.988  1.00 17.17  ? 134 HIS A C   1 
ATOM   316  O  O   . HIS A 1 47  ? 4.626  28.879  20.124  1.00 18.40  ? 134 HIS A O   1 
ATOM   317  C  CB  . HIS A 1 47  ? 1.875  27.753  18.703  1.00 17.75  ? 134 HIS A CB  1 
ATOM   318  C  CG  . HIS A 1 47  ? 1.900  26.993  19.969  1.00 17.19  ? 134 HIS A CG  1 
ATOM   319  N  ND1 . HIS A 1 47  ? 1.207  27.433  21.074  1.00 17.84  ? 134 HIS A ND1 1 
ATOM   320  C  CD2 . HIS A 1 47  ? 2.520  25.830  20.285  1.00 20.41  ? 134 HIS A CD2 1 
ATOM   321  C  CE1 . HIS A 1 47  ? 1.418  26.551  22.048  1.00 18.13  ? 134 HIS A CE1 1 
ATOM   322  N  NE2 . HIS A 1 47  ? 2.204  25.574  21.610  1.00 20.08  ? 134 HIS A NE2 1 
ATOM   323  N  N   . HIS A 1 48  ? 4.921  28.358  17.926  1.00 14.12  ? 135 HIS A N   1 
ATOM   324  C  CA  . HIS A 1 48  ? 6.324  28.019  17.970  1.00 7.05   ? 135 HIS A CA  1 
ATOM   325  C  C   . HIS A 1 48  ? 7.144  29.186  18.495  1.00 6.38   ? 135 HIS A C   1 
ATOM   326  O  O   . HIS A 1 48  ? 7.711  29.194  19.604  1.00 6.95   ? 135 HIS A O   1 
ATOM   327  C  CB  . HIS A 1 48  ? 6.740  27.641  16.528  1.00 12.35  ? 135 HIS A CB  1 
ATOM   328  C  CG  . HIS A 1 48  ? 7.987  26.776  16.428  1.00 21.15  ? 135 HIS A CG  1 
ATOM   329  N  ND1 . HIS A 1 48  ? 8.248  25.983  15.310  1.00 22.23  ? 135 HIS A ND1 1 
ATOM   330  C  CD2 . HIS A 1 48  ? 9.020  26.576  17.316  1.00 17.66  ? 135 HIS A CD2 1 
ATOM   331  C  CE1 . HIS A 1 48  ? 9.404  25.360  15.542  1.00 18.00  ? 135 HIS A CE1 1 
ATOM   332  N  NE2 . HIS A 1 48  ? 9.889  25.691  16.737  1.00 13.97  ? 135 HIS A NE2 1 
ATOM   333  N  N   . GLN A 1 49  ? 7.176  30.192  17.646  1.00 8.34   ? 136 GLN A N   1 
ATOM   334  C  CA  . GLN A 1 49  ? 7.872  31.418  17.923  1.00 6.70   ? 136 GLN A CA  1 
ATOM   335  C  C   . GLN A 1 49  ? 7.517  31.930  19.306  1.00 9.37   ? 136 GLN A C   1 
ATOM   336  O  O   . GLN A 1 49  ? 8.390  32.384  20.061  1.00 13.78  ? 136 GLN A O   1 
ATOM   337  C  CB  . GLN A 1 49  ? 7.539  32.449  16.849  1.00 1.00   ? 136 GLN A CB  1 
ATOM   338  C  CG  . GLN A 1 49  ? 7.582  31.786  15.467  1.00 1.00   ? 136 GLN A CG  1 
ATOM   339  C  CD  . GLN A 1 49  ? 7.378  32.757  14.315  1.00 11.45  ? 136 GLN A CD  1 
ATOM   340  O  OE1 . GLN A 1 49  ? 8.124  32.719  13.340  1.00 14.75  ? 136 GLN A OE1 1 
ATOM   341  N  NE2 . GLN A 1 49  ? 6.366  33.638  14.383  1.00 14.45  ? 136 GLN A NE2 1 
ATOM   342  N  N   . ARG A 1 50  ? 6.240  31.817  19.651  1.00 6.51   ? 137 ARG A N   1 
ATOM   343  C  CA  . ARG A 1 50  ? 5.870  32.286  20.949  1.00 12.06  ? 137 ARG A CA  1 
ATOM   344  C  C   . ARG A 1 50  ? 6.517  31.464  22.033  1.00 19.04  ? 137 ARG A C   1 
ATOM   345  O  O   . ARG A 1 50  ? 6.993  31.998  23.048  1.00 18.42  ? 137 ARG A O   1 
ATOM   346  C  CB  . ARG A 1 50  ? 4.393  32.277  21.165  1.00 14.79  ? 137 ARG A CB  1 
ATOM   347  C  CG  . ARG A 1 50  ? 4.089  33.260  22.272  1.00 17.75  ? 137 ARG A CG  1 
ATOM   348  C  CD  . ARG A 1 50  ? 2.609  33.364  22.551  1.00 18.69  ? 137 ARG A CD  1 
ATOM   349  N  NE  . ARG A 1 50  ? 2.232  32.439  23.600  1.00 22.48  ? 137 ARG A NE  1 
ATOM   350  C  CZ  . ARG A 1 50  ? 1.853  31.168  23.424  1.00 24.27  ? 137 ARG A CZ  1 
ATOM   351  N  NH1 . ARG A 1 50  ? 1.786  30.594  22.222  1.00 16.66  ? 137 ARG A NH1 1 
ATOM   352  N  NH2 . ARG A 1 50  ? 1.530  30.445  24.512  1.00 25.50  ? 137 ARG A NH2 1 
ATOM   353  N  N   . ILE A 1 51  ? 6.520  30.144  21.795  1.00 23.54  ? 138 ILE A N   1 
ATOM   354  C  CA  . ILE A 1 51  ? 7.097  29.207  22.748  1.00 21.91  ? 138 ILE A CA  1 
ATOM   355  C  C   . ILE A 1 51  ? 8.583  29.393  22.888  1.00 9.59   ? 138 ILE A C   1 
ATOM   356  O  O   . ILE A 1 51  ? 9.089  29.484  24.004  1.00 6.48   ? 138 ILE A O   1 
ATOM   357  C  CB  . ILE A 1 51  ? 6.690  27.745  22.595  1.00 21.27  ? 138 ILE A CB  1 
ATOM   358  C  CG1 . ILE A 1 51  ? 5.174  27.658  22.565  1.00 16.15  ? 138 ILE A CG1 1 
ATOM   359  C  CG2 . ILE A 1 51  ? 7.135  27.045  23.877  1.00 22.94  ? 138 ILE A CG2 1 
ATOM   360  C  CD1 . ILE A 1 51  ? 4.621  27.866  23.964  1.00 17.86  ? 138 ILE A CD1 1 
ATOM   361  N  N   . GLY A 1 52  ? 9.254  29.481  21.749  1.00 2.99   ? 139 GLY A N   1 
ATOM   362  C  CA  . GLY A 1 52  ? 10.692 29.685  21.785  1.00 11.09  ? 139 GLY A CA  1 
ATOM   363  C  C   . GLY A 1 52  ? 11.079 30.912  22.627  1.00 17.66  ? 139 GLY A C   1 
ATOM   364  O  O   . GLY A 1 52  ? 12.024 30.843  23.454  1.00 18.94  ? 139 GLY A O   1 
ATOM   365  N  N   . LEU A 1 53  ? 10.313 32.019  22.399  1.00 15.35  ? 140 LEU A N   1 
ATOM   366  C  CA  . LEU A 1 53  ? 10.453 33.302  23.072  1.00 6.10   ? 140 LEU A CA  1 
ATOM   367  C  C   . LEU A 1 53  ? 10.178 33.175  24.567  1.00 14.12  ? 140 LEU A C   1 
ATOM   368  O  O   . LEU A 1 53  ? 10.819 33.789  25.456  1.00 13.01  ? 140 LEU A O   1 
ATOM   369  C  CB  . LEU A 1 53  ? 9.429  34.274  22.481  1.00 8.83   ? 140 LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 53  ? 9.313  35.562  23.302  1.00 14.48  ? 140 LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 53  ? 10.606 36.388  23.233  1.00 17.55  ? 140 LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 53  ? 8.103  36.388  22.869  1.00 14.92  ? 140 LEU A CD2 1 
ATOM   373  N  N   . LYS A 1 54  ? 9.173  32.353  24.861  1.00 17.62  ? 141 LYS A N   1 
ATOM   374  C  CA  . LYS A 1 54  ? 8.833  32.168  26.241  1.00 14.45  ? 141 LYS A CA  1 
ATOM   375  C  C   . LYS A 1 54  ? 10.036 31.619  26.984  1.00 14.40  ? 141 LYS A C   1 
ATOM   376  O  O   . LYS A 1 54  ? 10.344 31.942  28.125  1.00 11.52  ? 141 LYS A O   1 
ATOM   377  C  CB  . LYS A 1 54  ? 7.665  31.219  26.337  1.00 17.49  ? 141 LYS A CB  1 
ATOM   378  C  CG  . LYS A 1 54  ? 7.270  31.046  27.789  1.00 24.86  ? 141 LYS A CG  1 
ATOM   379  C  CD  . LYS A 1 54  ? 6.043  30.173  28.012  1.00 27.75  ? 141 LYS A CD  1 
ATOM   380  C  CE  . LYS A 1 54  ? 5.594  30.114  29.481  1.00 31.69  ? 141 LYS A CE  1 
ATOM   381  N  NZ  . LYS A 1 54  ? 6.595  29.569  30.421  1.00 32.56  ? 141 LYS A NZ  1 
ATOM   382  N  N   . TYR A 1 55  ? 10.736 30.791  26.240  1.00 16.54  ? 142 TYR A N   1 
ATOM   383  C  CA  . TYR A 1 55  ? 11.887 30.097  26.703  1.00 15.88  ? 142 TYR A CA  1 
ATOM   384  C  C   . TYR A 1 55  ? 13.301 30.468  26.316  1.00 19.93  ? 142 TYR A C   1 
ATOM   385  O  O   . TYR A 1 55  ? 14.246 29.749  26.735  1.00 17.21  ? 142 TYR A O   1 
ATOM   386  C  CB  . TYR A 1 55  ? 11.583 28.691  26.352  1.00 12.82  ? 142 TYR A CB  1 
ATOM   387  C  CG  . TYR A 1 55  ? 10.506 28.177  27.275  1.00 14.65  ? 142 TYR A CG  1 
ATOM   388  C  CD1 . TYR A 1 55  ? 10.657 28.276  28.652  1.00 8.30   ? 142 TYR A CD1 1 
ATOM   389  C  CD2 . TYR A 1 55  ? 9.365  27.536  26.759  1.00 13.82  ? 142 TYR A CD2 1 
ATOM   390  C  CE1 . TYR A 1 55  ? 9.681  27.735  29.483  1.00 9.85   ? 142 TYR A CE1 1 
ATOM   391  C  CE2 . TYR A 1 55  ? 8.380  26.989  27.570  1.00 8.42   ? 142 TYR A CE2 1 
ATOM   392  C  CZ  . TYR A 1 55  ? 8.555  27.101  28.945  1.00 13.32  ? 142 TYR A CZ  1 
ATOM   393  O  OH  . TYR A 1 55  ? 7.609  26.585  29.780  1.00 22.75  ? 142 TYR A OH  1 
ATOM   394  N  N   . PHE A 1 56  ? 13.394 31.568  25.562  1.00 15.78  ? 143 PHE A N   1 
ATOM   395  C  CA  . PHE A 1 56  ? 14.624 32.127  25.045  1.00 15.11  ? 143 PHE A CA  1 
ATOM   396  C  C   . PHE A 1 56  ? 15.812 31.873  25.897  1.00 13.91  ? 143 PHE A C   1 
ATOM   397  O  O   . PHE A 1 56  ? 16.739 31.164  25.516  1.00 12.03  ? 143 PHE A O   1 
ATOM   398  C  CB  . PHE A 1 56  ? 14.558 33.651  24.847  1.00 15.16  ? 143 PHE A CB  1 
ATOM   399  C  CG  . PHE A 1 56  ? 15.697 34.228  24.028  1.00 17.08  ? 143 PHE A CG  1 
ATOM   400  C  CD1 . PHE A 1 56  ? 15.726 34.115  22.633  1.00 19.27  ? 143 PHE A CD1 1 
ATOM   401  C  CD2 . PHE A 1 56  ? 16.740 34.918  24.648  1.00 19.11  ? 143 PHE A CD2 1 
ATOM   402  C  CE1 . PHE A 1 56  ? 16.757 34.653  21.858  1.00 17.36  ? 143 PHE A CE1 1 
ATOM   403  C  CE2 . PHE A 1 56  ? 17.783 35.471  23.901  1.00 16.11  ? 143 PHE A CE2 1 
ATOM   404  C  CZ  . PHE A 1 56  ? 17.789 35.336  22.510  1.00 16.05  ? 143 PHE A CZ  1 
ATOM   405  N  N   . GLU A 1 57  ? 15.738 32.467  27.054  1.00 18.12  ? 144 GLU A N   1 
ATOM   406  C  CA  . GLU A 1 57  ? 16.814 32.334  27.970  1.00 24.62  ? 144 GLU A CA  1 
ATOM   407  C  C   . GLU A 1 57  ? 17.231 30.903  28.223  1.00 32.69  ? 144 GLU A C   1 
ATOM   408  O  O   . GLU A 1 57  ? 18.360 30.559  27.894  1.00 38.43  ? 144 GLU A O   1 
ATOM   409  C  CB  . GLU A 1 57  ? 16.515 33.156  29.197  1.00 29.58  ? 144 GLU A CB  1 
ATOM   410  C  CG  . GLU A 1 57  ? 16.236 34.593  28.714  1.00 38.98  ? 144 GLU A CG  1 
ATOM   411  C  CD  . GLU A 1 57  ? 15.285 35.337  29.617  1.00 46.79  ? 144 GLU A CD  1 
ATOM   412  O  OE1 . GLU A 1 57  ? 14.083 35.094  29.549  1.00 43.95  ? 144 GLU A OE1 1 
ATOM   413  O  OE2 . GLU A 1 57  ? 15.861 36.268  30.406  1.00 47.76  ? 144 GLU A OE2 1 
ATOM   414  N  N   . ASP A 1 58  ? 16.330 30.076  28.751  1.00 30.31  ? 145 ASP A N   1 
ATOM   415  C  CA  . ASP A 1 58  ? 16.632 28.696  29.023  1.00 17.33  ? 145 ASP A CA  1 
ATOM   416  C  C   . ASP A 1 58  ? 17.082 27.996  27.750  1.00 17.29  ? 145 ASP A C   1 
ATOM   417  O  O   . ASP A 1 58  ? 17.928 27.109  27.752  1.00 20.14  ? 145 ASP A O   1 
ATOM   418  C  CB  . ASP A 1 58  ? 15.389 27.960  29.611  1.00 18.97  ? 145 ASP A CB  1 
ATOM   419  C  CG  . ASP A 1 58  ? 15.115 28.325  31.055  1.00 28.25  ? 145 ASP A CG  1 
ATOM   420  O  OD1 . ASP A 1 58  ? 16.043 28.682  31.736  1.00 32.89  ? 145 ASP A OD1 1 
ATOM   421  O  OD2 . ASP A 1 58  ? 13.868 28.122  31.537  1.00 27.70  ? 145 ASP A OD2 1 
ATOM   422  N  N   . PHE A 1 59  ? 16.524 28.365  26.623  1.00 11.33  ? 146 PHE A N   1 
ATOM   423  C  CA  . PHE A 1 59  ? 16.922 27.663  25.415  1.00 14.11  ? 146 PHE A CA  1 
ATOM   424  C  C   . PHE A 1 59  ? 18.353 27.782  25.022  1.00 13.80  ? 146 PHE A C   1 
ATOM   425  O  O   . PHE A 1 59  ? 18.894 26.975  24.242  1.00 9.44   ? 146 PHE A O   1 
ATOM   426  C  CB  . PHE A 1 59  ? 16.043 28.060  24.234  1.00 18.33  ? 146 PHE A CB  1 
ATOM   427  C  CG  . PHE A 1 59  ? 14.755 27.282  24.209  1.00 15.94  ? 146 PHE A CG  1 
ATOM   428  C  CD1 . PHE A 1 59  ? 14.349 26.560  25.337  1.00 8.69   ? 146 PHE A CD1 1 
ATOM   429  C  CD2 . PHE A 1 59  ? 13.942 27.305  23.072  1.00 12.98  ? 146 PHE A CD2 1 
ATOM   430  C  CE1 . PHE A 1 59  ? 13.147 25.852  25.333  1.00 3.63   ? 146 PHE A CE1 1 
ATOM   431  C  CE2 . PHE A 1 59  ? 12.739 26.596  23.054  1.00 8.78   ? 146 PHE A CE2 1 
ATOM   432  C  CZ  . PHE A 1 59  ? 12.348 25.884  24.189  1.00 2.82   ? 146 PHE A CZ  1 
ATOM   433  N  N   . GLU A 1 60  ? 18.922 28.843  25.560  1.00 21.65  ? 147 GLU A N   1 
ATOM   434  C  CA  . GLU A 1 60  ? 20.321 29.208  25.334  1.00 23.38  ? 147 GLU A CA  1 
ATOM   435  C  C   . GLU A 1 60  ? 21.342 28.445  26.133  1.00 17.31  ? 147 GLU A C   1 
ATOM   436  O  O   . GLU A 1 60  ? 22.419 28.256  25.603  1.00 21.50  ? 147 GLU A O   1 
ATOM   437  C  CB  . GLU A 1 60  ? 20.629 30.716  25.237  1.00 18.96  ? 147 GLU A CB  1 
ATOM   438  C  CG  . GLU A 1 60  ? 20.392 31.240  23.798  1.00 13.76  ? 147 GLU A CG  1 
ATOM   439  C  CD  . GLU A 1 60  ? 20.703 32.704  23.742  1.00 15.95  ? 147 GLU A CD  1 
ATOM   440  O  OE1 . GLU A 1 60  ? 20.622 33.412  24.754  1.00 12.93  ? 147 GLU A OE1 1 
ATOM   441  O  OE2 . GLU A 1 60  ? 20.989 33.128  22.510  1.00 18.25  ? 147 GLU A OE2 1 
ATOM   442  N  N   . LYS A 1 61  ? 20.972 28.053  27.366  1.00 10.10  ? 148 LYS A N   1 
ATOM   443  C  CA  . LYS A 1 61  ? 21.799 27.290  28.257  1.00 8.30   ? 148 LYS A CA  1 
ATOM   444  C  C   . LYS A 1 61  ? 21.979 25.834  27.713  1.00 16.43  ? 148 LYS A C   1 
ATOM   445  O  O   . LYS A 1 61  ? 21.263 25.333  26.830  1.00 21.22  ? 148 LYS A O   1 
ATOM   446  C  CB  . LYS A 1 61  ? 21.145 27.235  29.625  1.00 1.00   ? 148 LYS A CB  1 
ATOM   447  C  CG  . LYS A 1 61  ? 20.653 28.554  30.148  1.00 2.67   ? 148 LYS A CG  1 
ATOM   448  C  CD  . LYS A 1 61  ? 20.311 28.560  31.634  1.00 8.93   ? 148 LYS A CD  1 
ATOM   449  C  CE  . LYS A 1 61  ? 19.708 29.916  32.009  1.00 27.19  ? 148 LYS A CE  1 
ATOM   450  N  NZ  . LYS A 1 61  ? 19.779 30.282  33.445  1.00 34.31  ? 148 LYS A NZ  1 
ATOM   451  N  N   . ARG A 1 62  ? 22.972 25.119  28.222  1.00 15.50  ? 149 ARG A N   1 
ATOM   452  C  CA  . ARG A 1 62  ? 23.206 23.768  27.798  1.00 10.54  ? 149 ARG A CA  1 
ATOM   453  C  C   . ARG A 1 62  ? 22.867 22.803  28.851  1.00 11.77  ? 149 ARG A C   1 
ATOM   454  O  O   . ARG A 1 62  ? 22.763 23.213  30.015  1.00 13.13  ? 149 ARG A O   1 
ATOM   455  C  CB  . ARG A 1 62  ? 24.574 23.521  27.266  1.00 13.47  ? 149 ARG A CB  1 
ATOM   456  C  CG  . ARG A 1 62  ? 24.518 23.914  25.806  1.00 21.08  ? 149 ARG A CG  1 
ATOM   457  C  CD  . ARG A 1 62  ? 25.883 23.895  25.178  1.00 27.14  ? 149 ARG A CD  1 
ATOM   458  N  NE  . ARG A 1 62  ? 26.343 22.590  24.738  1.00 33.23  ? 149 ARG A NE  1 
ATOM   459  C  CZ  . ARG A 1 62  ? 26.205 22.244  23.470  1.00 39.74  ? 149 ARG A CZ  1 
ATOM   460  N  NH1 . ARG A 1 62  ? 25.634 23.067  22.579  1.00 39.32  ? 149 ARG A NH1 1 
ATOM   461  N  NH2 . ARG A 1 62  ? 26.645 21.053  23.085  1.00 46.29  ? 149 ARG A NH2 1 
ATOM   462  N  N   . ILE A 1 63  ? 22.689 21.539  28.439  1.00 14.37  ? 150 ILE A N   1 
ATOM   463  C  CA  . ILE A 1 63  ? 22.356 20.511  29.435  1.00 12.47  ? 150 ILE A CA  1 
ATOM   464  C  C   . ILE A 1 63  ? 23.556 19.655  29.949  1.00 6.59   ? 150 ILE A C   1 
ATOM   465  O  O   . ILE A 1 63  ? 24.253 18.974  29.204  1.00 1.00   ? 150 ILE A O   1 
ATOM   466  C  CB  . ILE A 1 63  ? 21.246 19.577  28.966  1.00 3.75   ? 150 ILE A CB  1 
ATOM   467  C  CG1 . ILE A 1 63  ? 20.299 20.291  28.016  1.00 6.26   ? 150 ILE A CG1 1 
ATOM   468  C  CG2 . ILE A 1 63  ? 20.528 19.093  30.218  1.00 1.00   ? 150 ILE A CG2 1 
ATOM   469  C  CD1 . ILE A 1 63  ? 19.614 19.350  27.020  1.00 11.67  ? 150 ILE A CD1 1 
ATOM   470  N  N   . PRO A 1 64  ? 23.834 19.655  31.236  1.00 4.35   ? 151 PRO A N   1 
ATOM   471  C  CA  . PRO A 1 64  ? 24.912 18.808  31.627  1.00 4.25   ? 151 PRO A CA  1 
ATOM   472  C  C   . PRO A 1 64  ? 24.389 17.393  31.555  1.00 9.59   ? 151 PRO A C   1 
ATOM   473  O  O   . PRO A 1 64  ? 23.207 17.135  31.810  1.00 8.38   ? 151 PRO A O   1 
ATOM   474  C  CB  . PRO A 1 64  ? 25.133 19.035  33.148  1.00 4.35   ? 151 PRO A CB  1 
ATOM   475  C  CG  . PRO A 1 64  ? 24.103 20.020  33.648  1.00 1.00   ? 151 PRO A CG  1 
ATOM   476  C  CD  . PRO A 1 64  ? 23.504 20.606  32.357  1.00 7.39   ? 151 PRO A CD  1 
ATOM   477  N  N   . ARG A 1 65  ? 25.276 16.459  31.269  1.00 17.73  ? 152 ARG A N   1 
ATOM   478  C  CA  . ARG A 1 65  ? 24.806 15.120  31.250  1.00 13.97  ? 152 ARG A CA  1 
ATOM   479  C  C   . ARG A 1 65  ? 24.211 14.667  32.589  1.00 12.50  ? 152 ARG A C   1 
ATOM   480  O  O   . ARG A 1 65  ? 23.370 13.812  32.509  1.00 20.05  ? 152 ARG A O   1 
ATOM   481  C  CB  . ARG A 1 65  ? 25.672 14.086  30.558  1.00 10.80  ? 152 ARG A CB  1 
ATOM   482  C  CG  . ARG A 1 65  ? 26.810 13.533  31.402  1.00 14.46  ? 152 ARG A CG  1 
ATOM   483  C  CD  . ARG A 1 65  ? 27.299 12.175  30.869  1.00 14.73  ? 152 ARG A CD  1 
ATOM   484  N  NE  . ARG A 1 65  ? 27.317 12.096  29.402  1.00 14.15  ? 152 ARG A NE  1 
ATOM   485  C  CZ  . ARG A 1 65  ? 27.046 10.958  28.716  1.00 19.55  ? 152 ARG A CZ  1 
ATOM   486  N  NH1 . ARG A 1 65  ? 26.727 9.804   29.339  1.00 21.73  ? 152 ARG A NH1 1 
ATOM   487  N  NH2 . ARG A 1 65  ? 27.068 10.972  27.373  1.00 8.15   ? 152 ARG A NH2 1 
ATOM   488  N  N   . GLU A 1 66  ? 24.584 15.202  33.767  1.00 8.85   ? 153 GLU A N   1 
ATOM   489  C  CA  . GLU A 1 66  ? 23.962 14.736  35.016  1.00 16.16  ? 153 GLU A CA  1 
ATOM   490  C  C   . GLU A 1 66  ? 22.454 14.857  34.831  1.00 25.25  ? 153 GLU A C   1 
ATOM   491  O  O   . GLU A 1 66  ? 21.701 13.922  35.102  1.00 29.45  ? 153 GLU A O   1 
ATOM   492  C  CB  . GLU A 1 66  ? 24.433 15.478  36.303  1.00 19.92  ? 153 GLU A CB  1 
ATOM   493  C  CG  . GLU A 1 66  ? 25.813 15.022  36.863  1.00 35.99  ? 153 GLU A CG  1 
ATOM   494  C  CD  . GLU A 1 66  ? 25.798 14.293  38.210  1.00 48.37  ? 153 GLU A CD  1 
ATOM   495  O  OE1 . GLU A 1 66  ? 25.452 14.874  39.241  1.00 53.91  ? 153 GLU A OE1 1 
ATOM   496  O  OE2 . GLU A 1 66  ? 26.218 13.021  38.194  1.00 45.41  ? 153 GLU A OE2 1 
ATOM   497  N  N   . GLU A 1 67  ? 22.051 16.001  34.278  1.00 22.98  ? 154 GLU A N   1 
ATOM   498  C  CA  . GLU A 1 67  ? 20.666 16.264  34.013  1.00 13.36  ? 154 GLU A CA  1 
ATOM   499  C  C   . GLU A 1 67  ? 20.188 15.446  32.871  1.00 7.89   ? 154 GLU A C   1 
ATOM   500  O  O   . GLU A 1 67  ? 19.211 14.726  32.988  1.00 8.67   ? 154 GLU A O   1 
ATOM   501  C  CB  . GLU A 1 67  ? 20.398 17.736  33.726  1.00 15.45  ? 154 GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 67  ? 20.390 18.558  35.047  1.00 22.32  ? 154 GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 67  ? 20.231 20.007  34.699  1.00 28.21  ? 154 GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 67  ? 19.610 20.284  33.695  1.00 27.31  ? 154 GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 67  ? 20.856 20.897  35.491  1.00 32.12  ? 154 GLU A OE2 1 
ATOM   506  N  N   . MET A 1 68  ? 20.892 15.578  31.773  1.00 5.47   ? 155 MET A N   1 
ATOM   507  C  CA  . MET A 1 68  ? 20.560 14.856  30.565  1.00 5.12   ? 155 MET A CA  1 
ATOM   508  C  C   . MET A 1 68  ? 20.251 13.419  30.761  1.00 7.39   ? 155 MET A C   1 
ATOM   509  O  O   . MET A 1 68  ? 19.446 12.840  30.098  1.00 11.61  ? 155 MET A O   1 
ATOM   510  C  CB  . MET A 1 68  ? 21.755 14.807  29.643  1.00 4.30   ? 155 MET A CB  1 
ATOM   511  C  CG  . MET A 1 68  ? 21.593 15.779  28.517  1.00 4.50   ? 155 MET A CG  1 
ATOM   512  S  SD  . MET A 1 68  ? 20.035 15.341  27.792  1.00 7.48   ? 155 MET A SD  1 
ATOM   513  C  CE  . MET A 1 68  ? 20.256 15.721  26.014  1.00 1.00   ? 155 MET A CE  1 
ATOM   514  N  N   . LEU A 1 69  ? 20.927 12.825  31.669  1.00 14.37  ? 156 LEU A N   1 
ATOM   515  C  CA  . LEU A 1 69  ? 20.731 11.430  31.953  1.00 18.63  ? 156 LEU A CA  1 
ATOM   516  C  C   . LEU A 1 69  ? 19.361 11.238  32.653  1.00 20.94  ? 156 LEU A C   1 
ATOM   517  O  O   . LEU A 1 69  ? 18.480 10.471  32.220  1.00 19.84  ? 156 LEU A O   1 
ATOM   518  C  CB  . LEU A 1 69  ? 21.948 11.078  32.822  1.00 21.27  ? 156 LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 69  ? 22.678 9.793   32.451  1.00 21.85  ? 156 LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 69  ? 22.985 9.730   30.953  1.00 12.88  ? 156 LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 69  ? 23.940 9.690   33.315  1.00 20.18  ? 156 LEU A CD2 1 
ATOM   522  N  N   . GLN A 1 70  ? 19.173 11.990  33.736  1.00 17.71  ? 157 GLN A N   1 
ATOM   523  C  CA  . GLN A 1 70  ? 17.948 12.004  34.540  1.00 19.16  ? 157 GLN A CA  1 
ATOM   524  C  C   . GLN A 1 70  ? 16.700 12.287  33.671  1.00 18.24  ? 157 GLN A C   1 
ATOM   525  O  O   . GLN A 1 70  ? 15.524 11.952  33.952  1.00 13.85  ? 157 GLN A O   1 
ATOM   526  C  CB  . GLN A 1 70  ? 18.148 13.150  35.525  1.00 23.34  ? 157 GLN A CB  1 
ATOM   527  C  CG  . GLN A 1 70  ? 17.333 13.046  36.809  1.00 33.93  ? 157 GLN A CG  1 
ATOM   528  C  CD  . GLN A 1 70  ? 17.620 14.329  37.553  1.00 48.48  ? 157 GLN A CD  1 
ATOM   529  O  OE1 . GLN A 1 70  ? 18.797 14.778  37.532  1.00 48.37  ? 157 GLN A OE1 1 
ATOM   530  N  NE2 . GLN A 1 70  ? 16.528 15.039  37.937  1.00 52.23  ? 157 GLN A NE2 1 
ATOM   531  N  N   . MET A 1 71  ? 16.986 12.962  32.576  1.00 12.83  ? 158 MET A N   1 
ATOM   532  C  CA  . MET A 1 71  ? 15.961 13.256  31.677  1.00 5.88   ? 158 MET A CA  1 
ATOM   533  C  C   . MET A 1 71  ? 15.721 11.932  31.048  1.00 9.72   ? 158 MET A C   1 
ATOM   534  O  O   . MET A 1 71  ? 14.656 11.379  31.272  1.00 13.73  ? 158 MET A O   1 
ATOM   535  C  CB  . MET A 1 71  ? 16.394 14.293  30.660  1.00 9.16   ? 158 MET A CB  1 
ATOM   536  C  CG  . MET A 1 71  ? 16.334 15.691  31.257  1.00 10.21  ? 158 MET A CG  1 
ATOM   537  S  SD  . MET A 1 71  ? 17.218 16.866  30.208  1.00 10.19  ? 158 MET A SD  1 
ATOM   538  C  CE  . MET A 1 71  ? 16.427 16.761  28.562  1.00 5.54   ? 158 MET A CE  1 
ATOM   539  N  N   . GLN A 1 72  ? 16.726 11.412  30.321  1.00 13.00  ? 159 GLN A N   1 
ATOM   540  C  CA  . GLN A 1 72  ? 16.650 10.094  29.641  1.00 11.95  ? 159 GLN A CA  1 
ATOM   541  C  C   . GLN A 1 72  ? 16.054 8.999   30.482  1.00 5.90   ? 159 GLN A C   1 
ATOM   542  O  O   . GLN A 1 72  ? 15.431 8.104   29.943  1.00 1.70   ? 159 GLN A O   1 
ATOM   543  C  CB  . GLN A 1 72  ? 17.972 9.523   29.093  1.00 11.87  ? 159 GLN A CB  1 
ATOM   544  C  CG  . GLN A 1 72  ? 17.945 7.986   28.830  1.00 9.90   ? 159 GLN A CG  1 
ATOM   545  C  CD  . GLN A 1 72  ? 19.270 7.414   28.341  1.00 9.85   ? 159 GLN A CD  1 
ATOM   546  O  OE1 . GLN A 1 72  ? 19.401 6.920   27.187  1.00 12.77  ? 159 GLN A OE1 1 
ATOM   547  N  NE2 . GLN A 1 72  ? 20.260 7.462   29.222  1.00 8.11   ? 159 GLN A NE2 1 
ATOM   548  N  N   . ASP A 1 73  ? 16.254 9.047   31.788  1.00 9.23   ? 160 ASP A N   1 
ATOM   549  C  CA  . ASP A 1 73  ? 15.662 8.018   32.602  1.00 14.64  ? 160 ASP A CA  1 
ATOM   550  C  C   . ASP A 1 73  ? 14.145 8.119   32.411  1.00 12.20  ? 160 ASP A C   1 
ATOM   551  O  O   . ASP A 1 73  ? 13.512 7.192   31.950  1.00 15.88  ? 160 ASP A O   1 
ATOM   552  C  CB  . ASP A 1 73  ? 16.097 8.119   34.094  1.00 24.11  ? 160 ASP A CB  1 
ATOM   553  C  CG  . ASP A 1 73  ? 17.503 7.587   34.296  1.00 35.76  ? 160 ASP A CG  1 
ATOM   554  O  OD1 . ASP A 1 73  ? 18.095 7.052   33.376  1.00 36.50  ? 160 ASP A OD1 1 
ATOM   555  O  OD2 . ASP A 1 73  ? 17.982 7.678   35.552  1.00 44.05  ? 160 ASP A OD2 1 
ATOM   556  N  N   . ILE A 1 74  ? 13.592 9.289   32.710  1.00 16.14  ? 161 ILE A N   1 
ATOM   557  C  CA  . ILE A 1 74  ? 12.188 9.623   32.588  1.00 6.11   ? 161 ILE A CA  1 
ATOM   558  C  C   . ILE A 1 74  ? 11.660 9.152   31.259  1.00 8.00   ? 161 ILE A C   1 
ATOM   559  O  O   . ILE A 1 74  ? 10.865 8.240   31.290  1.00 16.22  ? 161 ILE A O   1 
ATOM   560  C  CB  . ILE A 1 74  ? 11.967 11.091  32.937  1.00 5.76   ? 161 ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 74  ? 12.403 11.332  34.383  1.00 5.61   ? 161 ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 74  ? 10.511 11.444  32.927  1.00 6.61   ? 161 ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 74  ? 12.195 12.778  34.771  1.00 1.33   ? 161 ILE A CD1 1 
ATOM   564  N  N   . VAL A 1 75  ? 12.102 9.668   30.109  1.00 6.77   ? 162 VAL A N   1 
ATOM   565  C  CA  . VAL A 1 75  ? 11.584 9.169   28.821  1.00 6.81   ? 162 VAL A CA  1 
ATOM   566  C  C   . VAL A 1 75  ? 11.555 7.651   28.687  1.00 19.36  ? 162 VAL A C   1 
ATOM   567  O  O   . VAL A 1 75  ? 10.526 7.082   28.318  1.00 25.57  ? 162 VAL A O   1 
ATOM   568  C  CB  . VAL A 1 75  ? 12.431 9.637   27.651  1.00 1.34   ? 162 VAL A CB  1 
ATOM   569  C  CG1 . VAL A 1 75  ? 11.985 9.142   26.279  1.00 1.00   ? 162 VAL A CG1 1 
ATOM   570  C  CG2 . VAL A 1 75  ? 12.500 11.135  27.674  1.00 5.95   ? 162 VAL A CG2 1 
ATOM   571  N  N   . LEU A 1 76  ? 12.696 7.004   28.986  1.00 22.34  ? 163 LEU A N   1 
ATOM   572  C  CA  . LEU A 1 76  ? 12.864 5.552   28.874  1.00 11.67  ? 163 LEU A CA  1 
ATOM   573  C  C   . LEU A 1 76  ? 11.897 4.766   29.689  1.00 17.32  ? 163 LEU A C   1 
ATOM   574  O  O   . LEU A 1 76  ? 11.319 3.781   29.216  1.00 19.87  ? 163 LEU A O   1 
ATOM   575  C  CB  . LEU A 1 76  ? 14.274 5.020   29.145  1.00 1.94   ? 163 LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 76  ? 15.395 5.331   28.137  1.00 6.10   ? 163 LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 76  ? 16.515 4.290   28.217  1.00 12.02  ? 163 LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 76  ? 14.951 5.413   26.698  1.00 3.47   ? 163 LEU A CD2 1 
ATOM   579  N  N   . ASN A 1 77  ? 11.756 5.223   30.909  1.00 17.61  ? 164 ASN A N   1 
ATOM   580  C  CA  . ASN A 1 77  ? 10.866 4.594   31.834  1.00 25.82  ? 164 ASN A CA  1 
ATOM   581  C  C   . ASN A 1 77  ? 9.392  4.722   31.441  1.00 31.90  ? 164 ASN A C   1 
ATOM   582  O  O   . ASN A 1 77  ? 8.663  3.729   31.399  1.00 34.94  ? 164 ASN A O   1 
ATOM   583  C  CB  . ASN A 1 77  ? 11.120 5.092   33.253  1.00 31.44  ? 164 ASN A CB  1 
ATOM   584  C  CG  . ASN A 1 77  ? 10.055 4.671   34.251  1.00 43.01  ? 164 ASN A CG  1 
ATOM   585  O  OD1 . ASN A 1 77  ? 9.865  5.364   35.279  1.00 53.40  ? 164 ASN A OD1 1 
ATOM   586  N  ND2 . ASN A 1 77  ? 9.449  3.494   34.041  1.00 38.96  ? 164 ASN A ND2 1 
ATOM   587  N  N   . GLU A 1 78  ? 8.929  5.933   31.148  1.00 28.20  ? 165 GLU A N   1 
ATOM   588  C  CA  . GLU A 1 78  ? 7.533  6.085   30.783  1.00 20.93  ? 165 GLU A CA  1 
ATOM   589  C  C   . GLU A 1 78  ? 7.140  5.276   29.540  1.00 15.76  ? 165 GLU A C   1 
ATOM   590  O  O   . GLU A 1 78  ? 6.096  4.608   29.561  1.00 14.82  ? 165 GLU A O   1 
ATOM   591  C  CB  . GLU A 1 78  ? 7.073  7.564   30.665  1.00 19.66  ? 165 GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 78  ? 7.332  8.440   31.903  1.00 18.92  ? 165 GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 78  ? 6.602  7.894   33.102  1.00 27.52  ? 165 GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 78  ? 5.436  7.615   33.012  1.00 30.94  ? 165 GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 78  ? 7.243  7.946   34.270  1.00 29.09  ? 165 GLU A OE2 1 
ATOM   596  N  N   . VAL A 1 79  ? 7.934  5.324   28.446  1.00 15.34  ? 166 VAL A N   1 
ATOM   597  C  CA  . VAL A 1 79  ? 7.500  4.542   27.294  1.00 19.35  ? 166 VAL A CA  1 
ATOM   598  C  C   . VAL A 1 79  ? 7.411  3.092   27.628  1.00 22.53  ? 166 VAL A C   1 
ATOM   599  O  O   . VAL A 1 79  ? 6.622  2.363   27.085  1.00 24.22  ? 166 VAL A O   1 
ATOM   600  C  CB  . VAL A 1 79  ? 8.266  4.667   25.985  1.00 18.63  ? 166 VAL A CB  1 
ATOM   601  C  CG1 . VAL A 1 79  ? 8.439  6.118   25.601  1.00 23.68  ? 166 VAL A CG1 1 
ATOM   602  C  CG2 . VAL A 1 79  ? 9.592  3.950   26.030  1.00 19.98  ? 166 VAL A CG2 1 
ATOM   603  N  N   . LYS A 1 80  ? 8.243  2.682   28.536  1.00 27.12  ? 167 LYS A N   1 
ATOM   604  C  CA  . LYS A 1 80  ? 8.254  1.307   28.915  1.00 32.72  ? 167 LYS A CA  1 
ATOM   605  C  C   . LYS A 1 80  ? 6.953  0.841   29.560  1.00 33.22  ? 167 LYS A C   1 
ATOM   606  O  O   . LYS A 1 80  ? 6.573  -0.312  29.423  1.00 42.32  ? 167 LYS A O   1 
ATOM   607  C  CB  . LYS A 1 80  ? 9.472  1.042   29.771  1.00 37.95  ? 167 LYS A CB  1 
ATOM   608  C  CG  . LYS A 1 80  ? 9.922  -0.405  29.768  1.00 46.20  ? 167 LYS A CG  1 
ATOM   609  C  CD  . LYS A 1 80  ? 11.235 -0.584  30.529  1.00 54.43  ? 167 LYS A CD  1 
ATOM   610  C  CE  . LYS A 1 80  ? 11.892 -1.964  30.392  1.00 57.54  ? 167 LYS A CE  1 
ATOM   611  N  NZ  . LYS A 1 80  ? 13.306 -1.994  30.844  1.00 58.19  ? 167 LYS A NZ  1 
ATOM   612  N  N   . LYS A 1 81  ? 6.274  1.726   30.267  1.00 26.45  ? 168 LYS A N   1 
ATOM   613  C  CA  . LYS A 1 81  ? 5.028  1.424   30.949  1.00 20.38  ? 168 LYS A CA  1 
ATOM   614  C  C   . LYS A 1 81  ? 3.774  1.623   30.085  1.00 20.81  ? 168 LYS A C   1 
ATOM   615  O  O   . LYS A 1 81  ? 2.625  1.403   30.456  1.00 21.05  ? 168 LYS A O   1 
ATOM   616  C  CB  . LYS A 1 81  ? 4.955  2.156   32.267  1.00 24.36  ? 168 LYS A CB  1 
ATOM   617  C  CG  . LYS A 1 81  ? 6.200  1.999   33.123  1.00 26.56  ? 168 LYS A CG  1 
ATOM   618  C  CD  . LYS A 1 81  ? 5.981  2.402   34.578  1.00 33.46  ? 168 LYS A CD  1 
ATOM   619  C  CE  . LYS A 1 81  ? 5.616  3.867   34.836  1.00 38.52  ? 168 LYS A CE  1 
ATOM   620  N  NZ  . LYS A 1 81  ? 4.361  4.332   34.197  1.00 42.28  ? 168 LYS A NZ  1 
ATOM   621  N  N   . LEU A 1 82  ? 3.975  2.078   28.891  1.00 17.56  ? 169 LEU A N   1 
ATOM   622  C  CA  . LEU A 1 82  ? 2.846  2.238   28.040  1.00 14.78  ? 169 LEU A CA  1 
ATOM   623  C  C   . LEU A 1 82  ? 2.812  0.954   27.230  1.00 13.33  ? 169 LEU A C   1 
ATOM   624  O  O   . LEU A 1 82  ? 1.764  0.399   26.902  1.00 19.57  ? 169 LEU A O   1 
ATOM   625  C  CB  . LEU A 1 82  ? 3.021  3.453   27.095  1.00 12.62  ? 169 LEU A CB  1 
ATOM   626  C  CG  . LEU A 1 82  ? 3.146  4.744   27.875  1.00 16.41  ? 169 LEU A CG  1 
ATOM   627  C  CD1 . LEU A 1 82  ? 3.357  5.899   26.927  1.00 17.11  ? 169 LEU A CD1 1 
ATOM   628  C  CD2 . LEU A 1 82  ? 1.870  4.987   28.664  1.00 16.67  ? 169 LEU A CD2 1 
ATOM   629  N  N   . ASP A 1 83  ? 4.018  0.496   26.906  1.00 5.84   ? 170 ASP A N   1 
ATOM   630  C  CA  . ASP A 1 83  ? 4.214  -0.688  26.108  1.00 6.21   ? 170 ASP A CA  1 
ATOM   631  C  C   . ASP A 1 83  ? 5.706  -1.016  26.002  1.00 10.98  ? 170 ASP A C   1 
ATOM   632  O  O   . ASP A 1 83  ? 6.507  -0.331  25.368  1.00 12.82  ? 170 ASP A O   1 
ATOM   633  C  CB  . ASP A 1 83  ? 3.529  -0.484  24.714  1.00 1.00   ? 170 ASP A CB  1 
ATOM   634  C  CG  . ASP A 1 83  ? 3.735  -1.734  23.946  1.00 1.78   ? 170 ASP A CG  1 
ATOM   635  O  OD1 . ASP A 1 83  ? 4.019  -2.708  24.574  1.00 4.92   ? 170 ASP A OD1 1 
ATOM   636  O  OD2 . ASP A 1 83  ? 3.641  -1.700  22.627  1.00 1.00   ? 170 ASP A OD2 1 
ATOM   637  N  N   . PRO A 1 84  ? 6.109  -2.096  26.634  1.00 14.73  ? 171 PRO A N   1 
ATOM   638  C  CA  . PRO A 1 84  ? 7.496  -2.484  26.580  1.00 11.76  ? 171 PRO A CA  1 
ATOM   639  C  C   . PRO A 1 84  ? 7.923  -2.832  25.165  1.00 11.99  ? 171 PRO A C   1 
ATOM   640  O  O   . PRO A 1 84  ? 9.096  -3.013  24.904  1.00 12.55  ? 171 PRO A O   1 
ATOM   641  C  CB  . PRO A 1 84  ? 7.696  -3.680  27.469  1.00 11.26  ? 171 PRO A CB  1 
ATOM   642  C  CG  . PRO A 1 84  ? 6.308  -4.133  27.859  1.00 18.36  ? 171 PRO A CG  1 
ATOM   643  C  CD  . PRO A 1 84  ? 5.334  -3.014  27.482  1.00 19.25  ? 171 PRO A CD  1 
ATOM   644  N  N   . GLU A 1 85  ? 7.010  -2.917  24.217  1.00 12.30  ? 172 GLU A N   1 
ATOM   645  C  CA  . GLU A 1 85  ? 7.485  -3.223  22.890  1.00 17.09  ? 172 GLU A CA  1 
ATOM   646  C  C   . GLU A 1 85  ? 7.995  -1.947  22.242  1.00 15.27  ? 172 GLU A C   1 
ATOM   647  O  O   . GLU A 1 85  ? 8.288  -1.898  21.056  1.00 18.54  ? 172 GLU A O   1 
ATOM   648  C  CB  . GLU A 1 85  ? 6.410  -3.819  21.989  1.00 27.60  ? 172 GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 85  ? 6.988  -4.895  21.046  1.00 31.74  ? 172 GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 85  ? 6.885  -6.214  21.741  1.00 38.49  ? 172 GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 85  ? 5.798  -6.595  22.097  1.00 34.36  ? 172 GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 85  ? 8.006  -6.935  21.829  1.00 46.35  ? 172 GLU A OE2 1 
ATOM   653  N  N   . TYR A 1 86  ? 8.045  -0.891  23.033  1.00 13.70  ? 173 TYR A N   1 
ATOM   654  C  CA  . TYR A 1 86  ? 8.527  0.411   22.606  1.00 10.10  ? 173 TYR A CA  1 
ATOM   655  C  C   . TYR A 1 86  ? 10.030 0.506   22.834  1.00 10.24  ? 173 TYR A C   1 
ATOM   656  O  O   . TYR A 1 86  ? 10.460 0.394   23.991  1.00 4.77   ? 173 TYR A O   1 
ATOM   657  C  CB  . TYR A 1 86  ? 7.942  1.525   23.518  1.00 9.54   ? 173 TYR A CB  1 
ATOM   658  C  CG  . TYR A 1 86  ? 6.706  2.232   23.005  1.00 8.09   ? 173 TYR A CG  1 
ATOM   659  C  CD1 . TYR A 1 86  ? 6.543  2.544   21.655  1.00 2.59   ? 173 TYR A CD1 1 
ATOM   660  C  CD2 . TYR A 1 86  ? 5.716  2.630   23.894  1.00 5.17   ? 173 TYR A CD2 1 
ATOM   661  C  CE1 . TYR A 1 86  ? 5.422  3.229   21.192  1.00 1.00   ? 173 TYR A CE1 1 
ATOM   662  C  CE2 . TYR A 1 86  ? 4.580  3.305   23.461  1.00 2.16   ? 173 TYR A CE2 1 
ATOM   663  C  CZ  . TYR A 1 86  ? 4.443  3.599   22.108  1.00 1.00   ? 173 TYR A CZ  1 
ATOM   664  O  OH  . TYR A 1 86  ? 3.326  4.249   21.705  1.00 7.64   ? 173 TYR A OH  1 
ATOM   665  N  N   . ILE A 1 87  ? 10.817 0.727   21.771  1.00 12.42  ? 174 ILE A N   1 
ATOM   666  C  CA  . ILE A 1 87  ? 12.288 0.886   21.842  1.00 8.71   ? 174 ILE A CA  1 
ATOM   667  C  C   . ILE A 1 87  ? 12.605 2.346   21.870  1.00 1.00   ? 174 ILE A C   1 
ATOM   668  O  O   . ILE A 1 87  ? 12.268 3.035   20.944  1.00 1.00   ? 174 ILE A O   1 
ATOM   669  C  CB  . ILE A 1 87  ? 12.963 0.407   20.579  1.00 1.67   ? 174 ILE A CB  1 
ATOM   670  C  CG1 . ILE A 1 87  ? 12.864 -1.077  20.527  1.00 1.00   ? 174 ILE A CG1 1 
ATOM   671  C  CG2 . ILE A 1 87  ? 14.423 0.821   20.517  1.00 1.00   ? 174 ILE A CG2 1 
ATOM   672  C  CD1 . ILE A 1 87  ? 12.846 -1.458  19.075  1.00 1.00   ? 174 ILE A CD1 1 
ATOM   673  N  N   . ALA A 1 88  ? 13.269 2.844   22.868  1.00 6.81   ? 175 ALA A N   1 
ATOM   674  C  CA  . ALA A 1 88  ? 13.519 4.271   22.782  1.00 10.39  ? 175 ALA A CA  1 
ATOM   675  C  C   . ALA A 1 88  ? 14.965 4.633   23.037  1.00 10.36  ? 175 ALA A C   1 
ATOM   676  O  O   . ALA A 1 88  ? 15.423 4.500   24.158  1.00 14.03  ? 175 ALA A O   1 
ATOM   677  C  CB  . ALA A 1 88  ? 12.686 4.974   23.844  1.00 5.24   ? 175 ALA A CB  1 
ATOM   678  N  N   . THR A 1 89  ? 15.687 5.090   22.025  1.00 5.81   ? 176 THR A N   1 
ATOM   679  C  CA  . THR A 1 89  ? 17.077 5.478   22.255  1.00 9.99   ? 176 THR A CA  1 
ATOM   680  C  C   . THR A 1 89  ? 17.296 6.984   22.293  1.00 7.43   ? 176 THR A C   1 
ATOM   681  O  O   . THR A 1 89  ? 17.211 7.639   21.240  1.00 9.65   ? 176 THR A O   1 
ATOM   682  C  CB  . THR A 1 89  ? 17.983 5.144   21.064  1.00 9.87   ? 176 THR A CB  1 
ATOM   683  O  OG1 . THR A 1 89  ? 17.656 3.905   20.511  1.00 13.02  ? 176 THR A OG1 1 
ATOM   684  C  CG2 . THR A 1 89  ? 19.407 5.189   21.562  1.00 3.10   ? 176 THR A CG2 1 
ATOM   685  N  N   . VAL A 1 90  ? 17.631 7.584   23.416  1.00 7.19   ? 177 VAL A N   1 
ATOM   686  C  CA  . VAL A 1 90  ? 17.903 9.017   23.283  1.00 7.43   ? 177 VAL A CA  1 
ATOM   687  C  C   . VAL A 1 90  ? 19.314 9.124   22.668  1.00 7.25   ? 177 VAL A C   1 
ATOM   688  O  O   . VAL A 1 90  ? 20.288 8.672   23.281  1.00 11.04  ? 177 VAL A O   1 
ATOM   689  C  CB  . VAL A 1 90  ? 17.822 9.827   24.556  1.00 2.18   ? 177 VAL A CB  1 
ATOM   690  C  CG1 . VAL A 1 90  ? 18.456 9.091   25.711  1.00 1.00   ? 177 VAL A CG1 1 
ATOM   691  C  CG2 . VAL A 1 90  ? 18.604 11.084  24.229  1.00 1.00   ? 177 VAL A CG2 1 
ATOM   692  N  N   . CYS A 1 91  ? 19.396 9.666   21.452  1.00 3.23   ? 178 CYS A N   1 
ATOM   693  C  CA  . CYS A 1 91  ? 20.602 9.838   20.668  1.00 1.00   ? 178 CYS A CA  1 
ATOM   694  C  C   . CYS A 1 91  ? 21.347 11.152  20.833  1.00 10.35  ? 178 CYS A C   1 
ATOM   695  O  O   . CYS A 1 91  ? 21.446 11.748  21.924  1.00 9.12   ? 178 CYS A O   1 
ATOM   696  C  CB  . CYS A 1 91  ? 20.342 9.643   19.180  1.00 4.34   ? 178 CYS A CB  1 
ATOM   697  S  SG  . CYS A 1 91  ? 19.361 8.162   18.885  1.00 24.22  ? 178 CYS A SG  1 
ATOM   698  N  N   . GLY A 1 92  ? 21.899 11.592  19.693  1.00 11.85  ? 179 GLY A N   1 
ATOM   699  C  CA  . GLY A 1 92  ? 22.682 12.811  19.692  1.00 16.84  ? 179 GLY A CA  1 
ATOM   700  C  C   . GLY A 1 92  ? 24.053 12.607  20.419  1.00 24.25  ? 179 GLY A C   1 
ATOM   701  O  O   . GLY A 1 92  ? 24.375 11.545  20.967  1.00 21.07  ? 179 GLY A O   1 
ATOM   702  N  N   . SER A 1 93  ? 24.873 13.653  20.408  1.00 29.99  ? 180 SER A N   1 
ATOM   703  C  CA  . SER A 1 93  ? 26.193 13.714  21.021  1.00 32.00  ? 180 SER A CA  1 
ATOM   704  C  C   . SER A 1 93  ? 26.203 13.032  22.391  1.00 28.27  ? 180 SER A C   1 
ATOM   705  O  O   . SER A 1 93  ? 27.140 12.353  22.838  1.00 31.38  ? 180 SER A O   1 
ATOM   706  C  CB  . SER A 1 93  ? 26.476 15.187  21.234  1.00 35.22  ? 180 SER A CB  1 
ATOM   707  O  OG  . SER A 1 93  ? 25.386 15.734  21.974  1.00 40.41  ? 180 SER A OG  1 
ATOM   708  N  N   . PHE A 1 94  ? 25.096 13.218  23.044  1.00 19.25  ? 181 PHE A N   1 
ATOM   709  C  CA  . PHE A 1 94  ? 24.876 12.667  24.351  1.00 16.53  ? 181 PHE A CA  1 
ATOM   710  C  C   . PHE A 1 94  ? 25.218 11.151  24.443  1.00 13.45  ? 181 PHE A C   1 
ATOM   711  O  O   . PHE A 1 94  ? 25.976 10.684  25.311  1.00 5.77   ? 181 PHE A O   1 
ATOM   712  C  CB  . PHE A 1 94  ? 23.392 12.963  24.695  1.00 10.00  ? 181 PHE A CB  1 
ATOM   713  C  CG  . PHE A 1 94  ? 22.985 12.057  25.776  1.00 1.00   ? 181 PHE A CG  1 
ATOM   714  C  CD1 . PHE A 1 94  ? 23.373 12.334  27.086  1.00 1.00   ? 181 PHE A CD1 1 
ATOM   715  C  CD2 . PHE A 1 94  ? 22.266 10.908  25.449  1.00 1.00   ? 181 PHE A CD2 1 
ATOM   716  C  CE1 . PHE A 1 94  ? 23.025 11.443  28.102  1.00 1.00   ? 181 PHE A CE1 1 
ATOM   717  C  CE2 . PHE A 1 94  ? 21.902 10.023  26.462  1.00 1.00   ? 181 PHE A CE2 1 
ATOM   718  C  CZ  . PHE A 1 94  ? 22.289 10.301  27.778  1.00 1.00   ? 181 PHE A CZ  1 
ATOM   719  N  N   . ARG A 1 95  ? 24.641 10.391  23.507  1.00 15.48  ? 182 ARG A N   1 
ATOM   720  C  CA  . ARG A 1 95  ? 24.822 8.961   23.406  1.00 10.71  ? 182 ARG A CA  1 
ATOM   721  C  C   . ARG A 1 95  ? 26.323 8.679   23.399  1.00 13.82  ? 182 ARG A C   1 
ATOM   722  O  O   . ARG A 1 95  ? 26.801 7.765   24.073  1.00 10.99  ? 182 ARG A O   1 
ATOM   723  C  CB  . ARG A 1 95  ? 24.154 8.463   22.119  1.00 2.95   ? 182 ARG A CB  1 
ATOM   724  C  CG  . ARG A 1 95  ? 23.824 6.987   22.183  1.00 1.24   ? 182 ARG A CG  1 
ATOM   725  C  CD  . ARG A 1 95  ? 23.419 6.376   20.847  1.00 3.59   ? 182 ARG A CD  1 
ATOM   726  N  NE  . ARG A 1 95  ? 23.490 4.897   20.845  1.00 2.04   ? 182 ARG A NE  1 
ATOM   727  C  CZ  . ARG A 1 95  ? 23.622 4.141   19.726  1.00 1.00   ? 182 ARG A CZ  1 
ATOM   728  N  NH1 . ARG A 1 95  ? 23.690 4.619   18.472  1.00 1.00   ? 182 ARG A NH1 1 
ATOM   729  N  NH2 . ARG A 1 95  ? 23.695 2.835   19.862  1.00 1.00   ? 182 ARG A NH2 1 
ATOM   730  N  N   . ARG A 1 96  ? 27.043 9.532   22.633  1.00 18.62  ? 183 ARG A N   1 
ATOM   731  C  CA  . ARG A 1 96  ? 28.488 9.537   22.430  1.00 9.76   ? 183 ARG A CA  1 
ATOM   732  C  C   . ARG A 1 96  ? 29.276 10.030  23.619  1.00 7.32   ? 183 ARG A C   1 
ATOM   733  O  O   . ARG A 1 96  ? 30.392 10.449  23.490  1.00 11.46  ? 183 ARG A O   1 
ATOM   734  C  CB  . ARG A 1 96  ? 28.918 10.234  21.170  1.00 2.34   ? 183 ARG A CB  1 
ATOM   735  C  CG  . ARG A 1 96  ? 28.094 9.713   20.008  1.00 12.86  ? 183 ARG A CG  1 
ATOM   736  C  CD  . ARG A 1 96  ? 28.742 10.172  18.731  1.00 20.91  ? 183 ARG A CD  1 
ATOM   737  N  NE  . ARG A 1 96  ? 29.370 11.445  19.020  1.00 30.43  ? 183 ARG A NE  1 
ATOM   738  C  CZ  . ARG A 1 96  ? 29.064 12.560  18.389  1.00 36.71  ? 183 ARG A CZ  1 
ATOM   739  N  NH1 . ARG A 1 96  ? 28.178 12.589  17.415  1.00 38.84  ? 183 ARG A NH1 1 
ATOM   740  N  NH2 . ARG A 1 96  ? 29.679 13.673  18.727  1.00 39.28  ? 183 ARG A NH2 1 
ATOM   741  N  N   . GLY A 1 97  ? 28.710 9.980   24.801  1.00 10.59  ? 184 GLY A N   1 
ATOM   742  C  CA  . GLY A 1 97  ? 29.413 10.403  25.993  1.00 5.86   ? 184 GLY A CA  1 
ATOM   743  C  C   . GLY A 1 97  ? 29.597 11.891  26.224  1.00 10.03  ? 184 GLY A C   1 
ATOM   744  O  O   . GLY A 1 97  ? 30.052 12.194  27.310  1.00 15.48  ? 184 GLY A O   1 
ATOM   745  N  N   . ALA A 1 98  ? 29.277 12.785  25.253  1.00 10.05  ? 185 ALA A N   1 
ATOM   746  C  CA  . ALA A 1 98  ? 29.410 14.238  25.359  1.00 1.00   ? 185 ALA A CA  1 
ATOM   747  C  C   . ALA A 1 98  ? 29.099 14.703  26.753  1.00 10.03  ? 185 ALA A C   1 
ATOM   748  O  O   . ALA A 1 98  ? 28.152 14.234  27.400  1.00 16.27  ? 185 ALA A O   1 
ATOM   749  C  CB  . ALA A 1 98  ? 28.419 14.872  24.449  1.00 1.17   ? 185 ALA A CB  1 
ATOM   750  N  N   . GLU A 1 99  ? 29.935 15.594  27.217  1.00 15.25  ? 186 GLU A N   1 
ATOM   751  C  CA  . GLU A 1 99  ? 29.838 16.119  28.557  1.00 22.80  ? 186 GLU A CA  1 
ATOM   752  C  C   . GLU A 1 99  ? 28.606 17.011  28.871  1.00 24.67  ? 186 GLU A C   1 
ATOM   753  O  O   . GLU A 1 99  ? 28.146 17.125  30.050  1.00 21.19  ? 186 GLU A O   1 
ATOM   754  C  CB  . GLU A 1 99  ? 31.178 16.843  28.757  1.00 32.38  ? 186 GLU A CB  1 
ATOM   755  C  CG  . GLU A 1 99  ? 31.522 17.081  30.234  1.00 45.41  ? 186 GLU A CG  1 
ATOM   756  C  CD  . GLU A 1 99  ? 31.525 15.778  30.973  1.00 55.10  ? 186 GLU A CD  1 
ATOM   757  O  OE1 . GLU A 1 99  ? 32.474 15.028  30.870  1.00 56.90  ? 186 GLU A OE1 1 
ATOM   758  O  OE2 . GLU A 1 99  ? 30.367 15.451  31.539  1.00 59.14  ? 186 GLU A OE2 1 
ATOM   759  N  N   . SER A 1 100 ? 28.106 17.645  27.778  1.00 17.90  ? 187 SER A N   1 
ATOM   760  C  CA  . SER A 1 100 ? 26.979 18.550  27.781  1.00 11.71  ? 187 SER A CA  1 
ATOM   761  C  C   . SER A 1 100 ? 26.308 18.474  26.443  1.00 4.50   ? 187 SER A C   1 
ATOM   762  O  O   . SER A 1 100 ? 26.990 18.199  25.439  1.00 1.00   ? 187 SER A O   1 
ATOM   763  C  CB  . SER A 1 100 ? 27.339 20.005  28.089  1.00 18.07  ? 187 SER A CB  1 
ATOM   764  O  OG  . SER A 1 100 ? 27.534 20.746  26.889  1.00 22.34  ? 187 SER A OG  1 
ATOM   765  N  N   . SER A 1 101 ? 24.974 18.743  26.480  1.00 6.99   ? 188 SER A N   1 
ATOM   766  C  CA  . SER A 1 101 ? 24.150 18.696  25.285  1.00 9.99   ? 188 SER A CA  1 
ATOM   767  C  C   . SER A 1 101 ? 23.204 19.868  25.159  1.00 3.92   ? 188 SER A C   1 
ATOM   768  O  O   . SER A 1 101 ? 22.749 20.465  26.164  1.00 1.00   ? 188 SER A O   1 
ATOM   769  C  CB  . SER A 1 101 ? 23.351 17.378  25.150  1.00 19.07  ? 188 SER A CB  1 
ATOM   770  O  OG  . SER A 1 101 ? 24.104 16.200  24.849  1.00 17.98  ? 188 SER A OG  1 
ATOM   771  N  N   . GLY A 1 102 ? 22.940 20.128  23.864  1.00 4.19   ? 189 GLY A N   1 
ATOM   772  C  CA  . GLY A 1 102 ? 22.061 21.194  23.364  1.00 14.69  ? 189 GLY A CA  1 
ATOM   773  C  C   . GLY A 1 102 ? 20.552 20.929  23.478  1.00 25.66  ? 189 GLY A C   1 
ATOM   774  O  O   . GLY A 1 102 ? 19.765 21.759  23.945  1.00 28.84  ? 189 GLY A O   1 
ATOM   775  N  N   . ASP A 1 103 ? 20.157 19.744  23.043  1.00 25.47  ? 190 ASP A N   1 
ATOM   776  C  CA  . ASP A 1 103 ? 18.795 19.326  23.086  1.00 15.54  ? 190 ASP A CA  1 
ATOM   777  C  C   . ASP A 1 103 ? 18.786 17.840  23.171  1.00 14.24  ? 190 ASP A C   1 
ATOM   778  O  O   . ASP A 1 103 ? 19.808 17.208  22.947  1.00 18.90  ? 190 ASP A O   1 
ATOM   779  C  CB  . ASP A 1 103 ? 18.062 19.766  21.837  1.00 11.66  ? 190 ASP A CB  1 
ATOM   780  C  CG  . ASP A 1 103 ? 18.736 19.275  20.614  1.00 21.16  ? 190 ASP A CG  1 
ATOM   781  O  OD1 . ASP A 1 103 ? 19.052 18.111  20.413  1.00 25.03  ? 190 ASP A OD1 1 
ATOM   782  O  OD2 . ASP A 1 103 ? 19.051 20.280  19.838  1.00 28.14  ? 190 ASP A OD2 1 
ATOM   783  N  N   . MET A 1 104 ? 17.628 17.324  23.514  1.00 11.55  ? 191 MET A N   1 
ATOM   784  C  CA  . MET A 1 104 ? 17.367 15.922  23.638  1.00 1.00   ? 191 MET A CA  1 
ATOM   785  C  C   . MET A 1 104 ? 16.695 15.465  22.385  1.00 1.00   ? 191 MET A C   1 
ATOM   786  O  O   . MET A 1 104 ? 16.095 16.203  21.639  1.00 5.65   ? 191 MET A O   1 
ATOM   787  C  CB  . MET A 1 104 ? 16.461 15.669  24.856  1.00 1.00   ? 191 MET A CB  1 
ATOM   788  C  CG  . MET A 1 104 ? 15.890 14.280  24.915  1.00 4.54   ? 191 MET A CG  1 
ATOM   789  S  SD  . MET A 1 104 ? 15.477 13.728  26.598  1.00 16.82  ? 191 MET A SD  1 
ATOM   790  C  CE  . MET A 1 104 ? 17.076 13.250  27.282  1.00 18.69  ? 191 MET A CE  1 
ATOM   791  N  N   . ASP A 1 105 ? 16.803 14.233  22.105  1.00 7.80   ? 192 ASP A N   1 
ATOM   792  C  CA  . ASP A 1 105 ? 16.134 13.673  20.942  1.00 15.24  ? 192 ASP A CA  1 
ATOM   793  C  C   . ASP A 1 105 ? 16.083 12.225  21.068  1.00 19.58  ? 192 ASP A C   1 
ATOM   794  O  O   . ASP A 1 105 ? 17.098 11.554  20.914  1.00 20.78  ? 192 ASP A O   1 
ATOM   795  C  CB  . ASP A 1 105 ? 16.237 14.129  19.498  1.00 7.73   ? 192 ASP A CB  1 
ATOM   796  C  CG  . ASP A 1 105 ? 17.656 14.120  19.172  1.00 17.32  ? 192 ASP A CG  1 
ATOM   797  O  OD1 . ASP A 1 105 ? 18.463 14.171  20.083  1.00 19.27  ? 192 ASP A OD1 1 
ATOM   798  O  OD2 . ASP A 1 105 ? 17.910 14.096  17.873  1.00 22.27  ? 192 ASP A OD2 1 
ATOM   799  N  N   . VAL A 1 106 ? 14.861 11.856  21.399  1.00 13.60  ? 193 VAL A N   1 
ATOM   800  C  CA  . VAL A 1 106 ? 14.487 10.531  21.600  1.00 5.91   ? 193 VAL A CA  1 
ATOM   801  C  C   . VAL A 1 106 ? 14.069 9.960   20.317  1.00 9.38   ? 193 VAL A C   1 
ATOM   802  O  O   . VAL A 1 106 ? 13.333 10.583  19.616  1.00 16.18  ? 193 VAL A O   1 
ATOM   803  C  CB  . VAL A 1 106 ? 13.282 10.561  22.460  1.00 6.00   ? 193 VAL A CB  1 
ATOM   804  C  CG1 . VAL A 1 106 ? 13.012 9.152   22.949  1.00 7.08   ? 193 VAL A CG1 1 
ATOM   805  C  CG2 . VAL A 1 106 ? 13.651 11.465  23.614  1.00 15.44  ? 193 VAL A CG2 1 
ATOM   806  N  N   . LEU A 1 107 ? 14.555 8.795   20.012  1.00 15.54  ? 194 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 107 ? 14.153 8.110   18.811  1.00 18.16  ? 194 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 107 ? 13.285 6.953   19.277  1.00 17.82  ? 194 LEU A C   1 
ATOM   809  O  O   . LEU A 1 107 ? 13.604 6.228   20.257  1.00 12.77  ? 194 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 107 ? 15.179 7.834   17.713  1.00 18.73  ? 194 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 107 ? 15.509 9.117   16.996  1.00 12.55  ? 194 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 107 ? 16.058 10.076  18.052  1.00 7.79   ? 194 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 107 ? 16.490 8.831   15.856  1.00 8.92   ? 194 LEU A CD2 1 
ATOM   814  N  N   . LEU A 1 108 ? 12.158 6.814   18.595  1.00 15.74  ? 195 LEU A N   1 
ATOM   815  C  CA  . LEU A 1 108 ? 11.256 5.801   19.005  1.00 1.00   ? 195 LEU A CA  1 
ATOM   816  C  C   . LEU A 1 108 ? 10.608 5.094   17.909  1.00 1.42   ? 195 LEU A C   1 
ATOM   817  O  O   . LEU A 1 108 ? 10.354 5.613   16.804  1.00 1.39   ? 195 LEU A O   1 
ATOM   818  C  CB  . LEU A 1 108 ? 10.374 6.347   20.102  1.00 1.00   ? 195 LEU A CB  1 
ATOM   819  C  CG  . LEU A 1 108 ? 9.008  5.776   20.282  1.00 3.24   ? 195 LEU A CG  1 
ATOM   820  C  CD1 . LEU A 1 108 ? 8.776  5.899   21.796  1.00 4.02   ? 195 LEU A CD1 1 
ATOM   821  C  CD2 . LEU A 1 108 ? 7.972  6.627   19.507  1.00 1.00   ? 195 LEU A CD2 1 
ATOM   822  N  N   . THR A 1 109 ? 10.417 3.858   18.296  1.00 2.28   ? 196 THR A N   1 
ATOM   823  C  CA  . THR A 1 109 ? 9.830  2.886   17.447  1.00 4.01   ? 196 THR A CA  1 
ATOM   824  C  C   . THR A 1 109 ? 9.001  1.857   18.250  1.00 1.00   ? 196 THR A C   1 
ATOM   825  O  O   . THR A 1 109 ? 8.964  1.807   19.504  1.00 3.16   ? 196 THR A O   1 
ATOM   826  C  CB  . THR A 1 109 ? 10.959 2.287   16.580  1.00 5.01   ? 196 THR A CB  1 
ATOM   827  O  OG1 . THR A 1 109 ? 10.412 1.669   15.421  1.00 9.92   ? 196 THR A OG1 1 
ATOM   828  C  CG2 . THR A 1 109 ? 11.682 1.231   17.400  1.00 6.30   ? 196 THR A CG2 1 
ATOM   829  N  N   . HIS A 1 110 ? 8.307  1.054   17.470  1.00 1.00   ? 197 HIS A N   1 
ATOM   830  C  CA  . HIS A 1 110 ? 7.427  -0.026  17.875  1.00 1.14   ? 197 HIS A CA  1 
ATOM   831  C  C   . HIS A 1 110 ? 7.254  -0.938  16.638  1.00 5.10   ? 197 HIS A C   1 
ATOM   832  O  O   . HIS A 1 110 ? 7.070  -0.563  15.458  1.00 1.00   ? 197 HIS A O   1 
ATOM   833  C  CB  . HIS A 1 110 ? 6.099  0.513   18.407  1.00 1.00   ? 197 HIS A CB  1 
ATOM   834  C  CG  . HIS A 1 110 ? 5.177  -0.481  19.030  1.00 2.28   ? 197 HIS A CG  1 
ATOM   835  N  ND1 . HIS A 1 110 ? 4.429  -1.379  18.258  1.00 6.39   ? 197 HIS A ND1 1 
ATOM   836  C  CD2 . HIS A 1 110 ? 4.869  -0.675  20.356  1.00 3.37   ? 197 HIS A CD2 1 
ATOM   837  C  CE1 . HIS A 1 110 ? 3.718  -2.083  19.153  1.00 11.48  ? 197 HIS A CE1 1 
ATOM   838  N  NE2 . HIS A 1 110 ? 3.955  -1.691  20.419  1.00 2.16   ? 197 HIS A NE2 1 
ATOM   839  N  N   . PRO A 1 111 ? 7.364  -2.184  16.929  1.00 3.43   ? 198 PRO A N   1 
ATOM   840  C  CA  . PRO A 1 111 ? 7.261  -3.166  15.899  1.00 7.05   ? 198 PRO A CA  1 
ATOM   841  C  C   . PRO A 1 111 ? 5.956  -3.080  15.134  1.00 13.74  ? 198 PRO A C   1 
ATOM   842  O  O   . PRO A 1 111 ? 5.907  -3.609  14.007  1.00 12.46  ? 198 PRO A O   1 
ATOM   843  C  CB  . PRO A 1 111 ? 7.363  -4.516  16.620  1.00 5.99   ? 198 PRO A CB  1 
ATOM   844  C  CG  . PRO A 1 111 ? 7.466  -4.247  18.128  1.00 3.13   ? 198 PRO A CG  1 
ATOM   845  C  CD  . PRO A 1 111 ? 7.541  -2.730  18.309  1.00 1.90   ? 198 PRO A CD  1 
ATOM   846  N  N   . ASN A 1 112 ? 4.921  -2.428  15.756  1.00 11.48  ? 199 ASN A N   1 
ATOM   847  C  CA  . ASN A 1 112 ? 3.622  -2.314  15.089  1.00 13.01  ? 199 ASN A CA  1 
ATOM   848  C  C   . ASN A 1 112 ? 3.655  -1.471  13.887  1.00 12.83  ? 199 ASN A C   1 
ATOM   849  O  O   . ASN A 1 112 ? 2.852  -1.624  12.995  1.00 10.72  ? 199 ASN A O   1 
ATOM   850  C  CB  . ASN A 1 112 ? 2.476  -1.834  15.942  1.00 13.21  ? 199 ASN A CB  1 
ATOM   851  C  CG  . ASN A 1 112 ? 2.018  -2.967  16.818  1.00 16.01  ? 199 ASN A CG  1 
ATOM   852  O  OD1 . ASN A 1 112 ? 2.523  -4.101  16.697  1.00 13.61  ? 199 ASN A OD1 1 
ATOM   853  N  ND2 . ASN A 1 112 ? 0.991  -2.695  17.627  1.00 14.29  ? 199 ASN A ND2 1 
ATOM   854  N  N   . PHE A 1 113 ? 4.621  -0.595  13.944  1.00 20.06  ? 200 PHE A N   1 
ATOM   855  C  CA  . PHE A 1 113 ? 4.905  0.390   12.948  1.00 20.10  ? 200 PHE A CA  1 
ATOM   856  C  C   . PHE A 1 113 ? 6.155  0.120   12.094  1.00 12.83  ? 200 PHE A C   1 
ATOM   857  O  O   . PHE A 1 113 ? 7.265  0.066   12.588  1.00 8.32   ? 200 PHE A O   1 
ATOM   858  C  CB  . PHE A 1 113 ? 4.958  1.700   13.757  1.00 18.99  ? 200 PHE A CB  1 
ATOM   859  C  CG  . PHE A 1 113 ? 5.267  2.878   12.913  1.00 21.47  ? 200 PHE A CG  1 
ATOM   860  C  CD1 . PHE A 1 113 ? 4.651  3.021   11.669  1.00 18.34  ? 200 PHE A CD1 1 
ATOM   861  C  CD2 . PHE A 1 113 ? 6.147  3.859   13.375  1.00 22.11  ? 200 PHE A CD2 1 
ATOM   862  C  CE1 . PHE A 1 113 ? 4.932  4.116   10.851  1.00 18.13  ? 200 PHE A CE1 1 
ATOM   863  C  CE2 . PHE A 1 113 ? 6.437  4.962   12.575  1.00 21.49  ? 200 PHE A CE2 1 
ATOM   864  C  CZ  . PHE A 1 113 ? 5.830  5.076   11.319  1.00 22.77  ? 200 PHE A CZ  1 
ATOM   865  N  N   . THR A 1 114 ? 5.933  -0.007  10.799  1.00 10.22  ? 201 THR A N   1 
ATOM   866  C  CA  . THR A 1 114 ? 6.940  -0.248  9.796   1.00 11.69  ? 201 THR A CA  1 
ATOM   867  C  C   . THR A 1 114 ? 6.741  0.671   8.586   1.00 17.81  ? 201 THR A C   1 
ATOM   868  O  O   . THR A 1 114 ? 5.747  1.384   8.372   1.00 18.55  ? 201 THR A O   1 
ATOM   869  C  CB  . THR A 1 114 ? 6.924  -1.700  9.309   1.00 15.68  ? 201 THR A CB  1 
ATOM   870  O  OG1 . THR A 1 114 ? 5.617  -2.043  8.911   1.00 19.14  ? 201 THR A OG1 1 
ATOM   871  C  CG2 . THR A 1 114 ? 7.402  -2.676  10.369  1.00 14.96  ? 201 THR A CG2 1 
ATOM   872  N  N   . SER A 1 115 ? 7.709  0.665   7.716   1.00 19.27  ? 202 SER A N   1 
ATOM   873  C  CA  . SER A 1 115 ? 7.589  1.511   6.583   1.00 25.02  ? 202 SER A CA  1 
ATOM   874  C  C   . SER A 1 115 ? 6.503  1.119   5.644   1.00 32.42  ? 202 SER A C   1 
ATOM   875  O  O   . SER A 1 115 ? 6.533  1.531   4.502   1.00 30.50  ? 202 SER A O   1 
ATOM   876  C  CB  . SER A 1 115 ? 8.899  1.679   5.878   1.00 27.10  ? 202 SER A CB  1 
ATOM   877  O  OG  . SER A 1 115 ? 9.493  0.421   5.723   1.00 24.95  ? 202 SER A OG  1 
ATOM   878  N  N   . GLU A 1 116 ? 5.571  0.317   6.130   1.00 41.96  ? 203 GLU A N   1 
ATOM   879  C  CA  . GLU A 1 116 ? 4.453  -0.158  5.359   1.00 49.87  ? 203 GLU A CA  1 
ATOM   880  C  C   . GLU A 1 116 ? 3.134  0.475   5.818   1.00 47.11  ? 203 GLU A C   1 
ATOM   881  O  O   . GLU A 1 116 ? 2.218  0.706   5.014   1.00 47.97  ? 203 GLU A O   1 
ATOM   882  C  CB  . GLU A 1 116 ? 4.491  -1.686  5.420   1.00 62.15  ? 203 GLU A CB  1 
ATOM   883  C  CG  . GLU A 1 116 ? 4.244  -2.316  4.030   1.00 71.62  ? 203 GLU A CG  1 
ATOM   884  C  CD  . GLU A 1 116 ? 5.246  -3.426  3.833   1.00 79.07  ? 203 GLU A CD  1 
ATOM   885  O  OE1 . GLU A 1 116 ? 5.580  -4.123  4.770   1.00 81.74  ? 203 GLU A OE1 1 
ATOM   886  O  OE2 . GLU A 1 116 ? 5.806  -3.483  2.622   1.00 81.22  ? 203 GLU A OE2 1 
ATOM   887  N  N   . SER A 1 117 ? 3.057  0.755   7.127   1.00 44.35  ? 204 SER A N   1 
ATOM   888  C  CA  . SER A 1 117 ? 1.876  1.373   7.698   1.00 46.44  ? 204 SER A CA  1 
ATOM   889  C  C   . SER A 1 117 ? 1.949  2.863   7.586   1.00 50.01  ? 204 SER A C   1 
ATOM   890  O  O   . SER A 1 117 ? 1.142  3.483   6.920   1.00 46.65  ? 204 SER A O   1 
ATOM   891  C  CB  . SER A 1 117 ? 1.474  0.917   9.093   1.00 44.64  ? 204 SER A CB  1 
ATOM   892  O  OG  . SER A 1 117 ? 2.628  0.543   9.811   1.00 46.65  ? 204 SER A OG  1 
ATOM   893  N  N   . SER A 1 118 ? 2.953  3.442   8.224   1.00 55.72  ? 205 SER A N   1 
ATOM   894  C  CA  . SER A 1 118 ? 3.105  4.901   8.170   1.00 58.56  ? 205 SER A CA  1 
ATOM   895  C  C   . SER A 1 118 ? 1.920  5.712   8.808   1.00 54.18  ? 205 SER A C   1 
ATOM   896  O  O   . SER A 1 118 ? 1.969  6.936   9.048   1.00 56.78  ? 205 SER A O   1 
ATOM   897  C  CB  . SER A 1 118 ? 3.604  5.431   6.801   1.00 55.87  ? 205 SER A CB  1 
ATOM   898  O  OG  . SER A 1 118 ? 4.963  5.094   6.546   1.00 55.12  ? 205 SER A OG  1 
ATOM   899  N  N   . LYS A 1 119 ? 0.809  5.075   9.110   1.00 42.07  ? 206 LYS A N   1 
ATOM   900  C  CA  . LYS A 1 119 ? -0.206 5.905   9.689   1.00 39.70  ? 206 LYS A CA  1 
ATOM   901  C  C   . LYS A 1 119 ? -0.466 5.679   11.180  1.00 30.50  ? 206 LYS A C   1 
ATOM   902  O  O   . LYS A 1 119 ? -1.578 5.373   11.583  1.00 38.13  ? 206 LYS A O   1 
ATOM   903  C  CB  . LYS A 1 119 ? -1.472 5.878   8.866   1.00 46.99  ? 206 LYS A CB  1 
ATOM   904  C  CG  . LYS A 1 119 ? -1.956 4.469   8.592   1.00 52.08  ? 206 LYS A CG  1 
ATOM   905  C  CD  . LYS A 1 119 ? -1.544 3.939   7.241   1.00 55.34  ? 206 LYS A CD  1 
ATOM   906  C  CE  . LYS A 1 119 ? -1.626 2.421   7.169   1.00 60.80  ? 206 LYS A CE  1 
ATOM   907  N  NZ  . LYS A 1 119 ? -1.235 1.855   5.861   1.00 64.41  ? 206 LYS A NZ  1 
ATOM   908  N  N   . GLN A 1 120 ? 0.494  5.823   12.058  1.00 15.02  ? 207 GLN A N   1 
ATOM   909  C  CA  . GLN A 1 120 ? 0.119  5.549   13.431  1.00 13.64  ? 207 GLN A CA  1 
ATOM   910  C  C   . GLN A 1 120 ? 0.535  6.577   14.513  1.00 18.21  ? 207 GLN A C   1 
ATOM   911  O  O   . GLN A 1 120 ? 1.107  6.250   15.552  1.00 17.36  ? 207 GLN A O   1 
ATOM   912  C  CB  . GLN A 1 120 ? 0.653  4.160   13.804  1.00 13.27  ? 207 GLN A CB  1 
ATOM   913  C  CG  . GLN A 1 120 ? 0.544  3.060   12.738  1.00 12.61  ? 207 GLN A CG  1 
ATOM   914  C  CD  . GLN A 1 120 ? 0.850  1.761   13.446  1.00 19.55  ? 207 GLN A CD  1 
ATOM   915  O  OE1 . GLN A 1 120 ? 0.814  1.695   14.690  1.00 20.43  ? 207 GLN A OE1 1 
ATOM   916  N  NE2 . GLN A 1 120 ? 1.286  0.781   12.679  1.00 21.24  ? 207 GLN A NE2 1 
ATOM   917  N  N   . PRO A 1 121 ? 0.235  7.835   14.287  1.00 23.83  ? 208 PRO A N   1 
ATOM   918  C  CA  . PRO A 1 121 ? 0.578  8.887   15.196  1.00 20.51  ? 208 PRO A CA  1 
ATOM   919  C  C   . PRO A 1 121 ? 0.233  8.596   16.641  1.00 20.17  ? 208 PRO A C   1 
ATOM   920  O  O   . PRO A 1 121 ? 0.904  9.101   17.517  1.00 22.22  ? 208 PRO A O   1 
ATOM   921  C  CB  . PRO A 1 121 ? -0.249 10.067  14.725  1.00 23.02  ? 208 PRO A CB  1 
ATOM   922  C  CG  . PRO A 1 121 ? -1.397 9.517   13.899  1.00 22.17  ? 208 PRO A CG  1 
ATOM   923  C  CD  . PRO A 1 121 ? -1.121 8.046   13.722  1.00 25.13  ? 208 PRO A CD  1 
ATOM   924  N  N   . LYS A 1 122 ? -0.767 7.765   16.897  1.00 17.36  ? 209 LYS A N   1 
ATOM   925  C  CA  . LYS A 1 122 ? -1.114 7.454   18.286  1.00 18.54  ? 209 LYS A CA  1 
ATOM   926  C  C   . LYS A 1 122 ? 0.077  6.887   19.010  1.00 8.94   ? 209 LYS A C   1 
ATOM   927  O  O   . LYS A 1 122 ? 0.220  7.080   20.247  1.00 1.00   ? 209 LYS A O   1 
ATOM   928  C  CB  . LYS A 1 122 ? -2.200 6.406   18.387  1.00 32.52  ? 209 LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 122 ? -3.560 6.855   17.899  1.00 42.92  ? 209 LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 122 ? -4.241 7.770   18.901  1.00 48.12  ? 209 LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 122 ? -5.621 8.222   18.476  1.00 47.69  ? 209 LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 122 ? -6.359 8.692   19.647  1.00 48.95  ? 209 LYS A NZ  1 
ATOM   933  N  N   . LEU A 1 123 ? 0.887  6.167   18.184  1.00 4.98   ? 210 LEU A N   1 
ATOM   934  C  CA  . LEU A 1 123 ? 2.140  5.530   18.624  1.00 10.39  ? 210 LEU A CA  1 
ATOM   935  C  C   . LEU A 1 123 ? 3.035  6.551   19.308  1.00 6.26   ? 210 LEU A C   1 
ATOM   936  O  O   . LEU A 1 123 ? 3.589  6.360   20.389  1.00 1.16   ? 210 LEU A O   1 
ATOM   937  C  CB  . LEU A 1 123 ? 2.924  4.862   17.468  1.00 13.06  ? 210 LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 123 ? 2.507  3.384   17.368  1.00 15.90  ? 210 LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 123 ? 3.020  2.686   16.096  1.00 8.84   ? 210 LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 123 ? 2.835  2.641   18.687  1.00 5.78   ? 210 LEU A CD2 1 
ATOM   941  N  N   . LEU A 1 124 ? 3.163  7.681   18.660  1.00 2.91   ? 211 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 124 ? 3.946  8.714   19.223  1.00 2.49   ? 211 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 124 ? 3.188  9.432   20.333  1.00 6.20   ? 211 LEU A C   1 
ATOM   944  O  O   . LEU A 1 124 ? 3.659  9.570   21.508  1.00 8.36   ? 211 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 124 ? 4.253  9.684   18.084  1.00 1.31   ? 211 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 124 ? 4.802  11.046  18.482  1.00 1.00   ? 211 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 124 ? 5.881  10.963  19.537  1.00 1.00   ? 211 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 124 ? 5.345  11.630  17.191  1.00 7.02   ? 211 LEU A CD2 1 
ATOM   949  N  N   . HIS A 1 125 ? 2.000  9.871   19.900  1.00 1.00   ? 212 HIS A N   1 
ATOM   950  C  CA  . HIS A 1 125 ? 1.114  10.636  20.729  1.00 1.00   ? 212 HIS A CA  1 
ATOM   951  C  C   . HIS A 1 125 ? 0.920  10.190  22.117  1.00 1.00   ? 212 HIS A C   1 
ATOM   952  O  O   . HIS A 1 125 ? 0.989  10.950  23.063  1.00 2.91   ? 212 HIS A O   1 
ATOM   953  C  CB  . HIS A 1 125 ? -0.162 11.207  20.106  1.00 1.58   ? 212 HIS A CB  1 
ATOM   954  C  CG  . HIS A 1 125 ? 0.101  12.047  18.889  1.00 10.00  ? 212 HIS A CG  1 
ATOM   955  N  ND1 . HIS A 1 125 ? -0.906 12.351  17.969  1.00 16.70  ? 212 HIS A ND1 1 
ATOM   956  C  CD2 . HIS A 1 125 ? 1.258  12.602  18.426  1.00 11.88  ? 212 HIS A CD2 1 
ATOM   957  C  CE1 . HIS A 1 125 ? -0.363 13.077  16.996  1.00 17.09  ? 212 HIS A CE1 1 
ATOM   958  N  NE2 . HIS A 1 125 ? 0.948  13.232  17.238  1.00 16.74  ? 212 HIS A NE2 1 
ATOM   959  N  N   . ARG A 1 126 ? 0.670  8.950   22.196  1.00 1.00   ? 213 ARG A N   1 
ATOM   960  C  CA  . ARG A 1 126 ? 0.433  8.337   23.441  1.00 1.00   ? 213 ARG A CA  1 
ATOM   961  C  C   . ARG A 1 126 ? 1.525  8.679   24.477  1.00 3.81   ? 213 ARG A C   1 
ATOM   962  O  O   . ARG A 1 126 ? 1.270  8.943   25.666  1.00 1.64   ? 213 ARG A O   1 
ATOM   963  C  CB  . ARG A 1 126 ? 0.287  6.863   23.052  1.00 1.00   ? 213 ARG A CB  1 
ATOM   964  C  CG  . ARG A 1 126 ? -0.148 6.021   24.219  1.00 5.85   ? 213 ARG A CG  1 
ATOM   965  C  CD  . ARG A 1 126 ? -0.320 4.525   23.945  1.00 9.26   ? 213 ARG A CD  1 
ATOM   966  N  NE  . ARG A 1 126 ? -0.697 3.999   25.241  1.00 12.88  ? 213 ARG A NE  1 
ATOM   967  C  CZ  . ARG A 1 126 ? -0.481 2.790   25.667  1.00 13.42  ? 213 ARG A CZ  1 
ATOM   968  N  NH1 . ARG A 1 126 ? 0.138  1.932   24.859  1.00 20.14  ? 213 ARG A NH1 1 
ATOM   969  N  NH2 . ARG A 1 126 ? -0.880 2.477   26.922  1.00 3.54   ? 213 ARG A NH2 1 
ATOM   970  N  N   . VAL A 1 127 ? 2.774  8.722   23.992  1.00 5.57   ? 214 VAL A N   1 
ATOM   971  C  CA  . VAL A 1 127 ? 3.896  9.013   24.865  1.00 8.30   ? 214 VAL A CA  1 
ATOM   972  C  C   . VAL A 1 127 ? 4.017  10.490  25.145  1.00 10.82  ? 214 VAL A C   1 
ATOM   973  O  O   . VAL A 1 127 ? 4.291  10.888  26.288  1.00 9.09   ? 214 VAL A O   1 
ATOM   974  C  CB  . VAL A 1 127 ? 5.192  8.287   24.475  1.00 7.74   ? 214 VAL A CB  1 
ATOM   975  C  CG1 . VAL A 1 127 ? 4.957  6.965   23.705  1.00 6.83   ? 214 VAL A CG1 1 
ATOM   976  C  CG2 . VAL A 1 127 ? 6.363  9.165   24.020  1.00 1.00   ? 214 VAL A CG2 1 
ATOM   977  N  N   . VAL A 1 128 ? 3.784  11.268  24.067  1.00 11.17  ? 215 VAL A N   1 
ATOM   978  C  CA  . VAL A 1 128 ? 3.819  12.714  24.151  1.00 8.92   ? 215 VAL A CA  1 
ATOM   979  C  C   . VAL A 1 128 ? 2.899  13.062  25.310  1.00 4.34   ? 215 VAL A C   1 
ATOM   980  O  O   . VAL A 1 128 ? 3.288  13.742  26.241  1.00 1.52   ? 215 VAL A O   1 
ATOM   981  C  CB  . VAL A 1 128 ? 3.263  13.340  22.882  1.00 2.93   ? 215 VAL A CB  1 
ATOM   982  C  CG1 . VAL A 1 128 ? 3.247  14.833  23.053  1.00 1.00   ? 215 VAL A CG1 1 
ATOM   983  C  CG2 . VAL A 1 128 ? 4.093  12.959  21.673  1.00 1.00   ? 215 VAL A CG2 1 
ATOM   984  N  N   . GLU A 1 129 ? 1.690  12.492  25.240  1.00 7.11   ? 216 GLU A N   1 
ATOM   985  C  CA  . GLU A 1 129 ? 0.666  12.685  26.248  1.00 12.41  ? 216 GLU A CA  1 
ATOM   986  C  C   . GLU A 1 129 ? 1.112  12.164  27.570  1.00 8.30   ? 216 GLU A C   1 
ATOM   987  O  O   . GLU A 1 129 ? 0.887  12.821  28.587  1.00 8.00   ? 216 GLU A O   1 
ATOM   988  C  CB  . GLU A 1 129 ? -0.751 12.128  25.901  1.00 16.68  ? 216 GLU A CB  1 
ATOM   989  C  CG  . GLU A 1 129 ? -1.508 12.920  24.788  1.00 25.31  ? 216 GLU A CG  1 
ATOM   990  C  CD  . GLU A 1 129 ? -2.545 12.039  24.143  1.00 31.31  ? 216 GLU A CD  1 
ATOM   991  O  OE1 . GLU A 1 129 ? -3.029 11.130  24.780  1.00 36.94  ? 216 GLU A OE1 1 
ATOM   992  O  OE2 . GLU A 1 129 ? -2.811 12.280  22.851  1.00 29.69  ? 216 GLU A OE2 1 
ATOM   993  N  N   . GLN A 1 130 ? 1.720  10.980  27.532  1.00 8.61   ? 217 GLN A N   1 
ATOM   994  C  CA  . GLN A 1 130 ? 2.177  10.353  28.755  1.00 9.09   ? 217 GLN A CA  1 
ATOM   995  C  C   . GLN A 1 130 ? 3.164  11.275  29.483  1.00 11.52  ? 217 GLN A C   1 
ATOM   996  O  O   . GLN A 1 130 ? 2.971  11.629  30.643  1.00 1.90   ? 217 GLN A O   1 
ATOM   997  C  CB  . GLN A 1 130 ? 2.668  8.926   28.439  1.00 9.34   ? 217 GLN A CB  1 
ATOM   998  C  CG  . GLN A 1 130 ? 3.022  8.125   29.707  1.00 9.42   ? 217 GLN A CG  1 
ATOM   999  C  CD  . GLN A 1 130 ? 2.042  8.336   30.845  1.00 11.08  ? 217 GLN A CD  1 
ATOM   1000 O  OE1 . GLN A 1 130 ? 2.439  8.689   31.975  1.00 7.15   ? 217 GLN A OE1 1 
ATOM   1001 N  NE2 . GLN A 1 130 ? 0.790  7.892   30.633  1.00 18.37  ? 217 GLN A NE2 1 
ATOM   1002 N  N   . LEU A 1 131 ? 4.203  11.694  28.739  1.00 17.39  ? 218 LEU A N   1 
ATOM   1003 C  CA  . LEU A 1 131 ? 5.277  12.593  29.155  1.00 13.38  ? 218 LEU A CA  1 
ATOM   1004 C  C   . LEU A 1 131 ? 4.701  13.868  29.776  1.00 10.86  ? 218 LEU A C   1 
ATOM   1005 O  O   . LEU A 1 131 ? 5.213  14.417  30.765  1.00 8.55   ? 218 LEU A O   1 
ATOM   1006 C  CB  . LEU A 1 131 ? 6.091  12.885  27.871  1.00 12.26  ? 218 LEU A CB  1 
ATOM   1007 C  CG  . LEU A 1 131 ? 7.419  12.121  27.695  1.00 8.69   ? 218 LEU A CG  1 
ATOM   1008 C  CD1 . LEU A 1 131 ? 7.678  11.062  28.761  1.00 10.26  ? 218 LEU A CD1 1 
ATOM   1009 C  CD2 . LEU A 1 131 ? 7.484  11.473  26.318  1.00 1.00   ? 218 LEU A CD2 1 
ATOM   1010 N  N   . GLN A 1 132 ? 3.600  14.326  29.170  1.00 6.54   ? 219 GLN A N   1 
ATOM   1011 C  CA  . GLN A 1 132 ? 2.895  15.510  29.638  1.00 4.11   ? 219 GLN A CA  1 
ATOM   1012 C  C   . GLN A 1 132 ? 2.120  15.299  30.909  1.00 9.07   ? 219 GLN A C   1 
ATOM   1013 O  O   . GLN A 1 132 ? 1.941  16.227  31.660  1.00 16.49  ? 219 GLN A O   1 
ATOM   1014 C  CB  . GLN A 1 132 ? 1.890  16.068  28.651  1.00 3.48   ? 219 GLN A CB  1 
ATOM   1015 C  CG  . GLN A 1 132 ? 2.539  16.200  27.273  1.00 16.29  ? 219 GLN A CG  1 
ATOM   1016 C  CD  . GLN A 1 132 ? 1.607  16.957  26.381  1.00 26.48  ? 219 GLN A CD  1 
ATOM   1017 O  OE1 . GLN A 1 132 ? 1.363  16.627  25.202  1.00 26.78  ? 219 GLN A OE1 1 
ATOM   1018 N  NE2 . GLN A 1 132 ? 1.043  17.979  27.010  1.00 33.49  ? 219 GLN A NE2 1 
ATOM   1019 N  N   . LYS A 1 133 ? 1.603  14.118  31.176  1.00 11.86  ? 220 LYS A N   1 
ATOM   1020 C  CA  . LYS A 1 133 ? 0.857  13.999  32.410  1.00 14.66  ? 220 LYS A CA  1 
ATOM   1021 C  C   . LYS A 1 133 ? 1.793  13.968  33.579  1.00 20.66  ? 220 LYS A C   1 
ATOM   1022 O  O   . LYS A 1 133 ? 1.385  14.241  34.693  1.00 21.83  ? 220 LYS A O   1 
ATOM   1023 C  CB  . LYS A 1 133 ? -0.081 12.797  32.449  1.00 18.34  ? 220 LYS A CB  1 
ATOM   1024 N  N   . VAL A 1 134 ? 3.050  13.611  33.317  1.00 28.98  ? 221 VAL A N   1 
ATOM   1025 C  CA  . VAL A 1 134 ? 4.062  13.537  34.368  1.00 27.64  ? 221 VAL A CA  1 
ATOM   1026 C  C   . VAL A 1 134 ? 4.698  14.872  34.631  1.00 25.97  ? 221 VAL A C   1 
ATOM   1027 O  O   . VAL A 1 134 ? 5.329  15.125  35.670  1.00 25.00  ? 221 VAL A O   1 
ATOM   1028 C  CB  . VAL A 1 134 ? 5.084  12.442  34.139  1.00 24.48  ? 221 VAL A CB  1 
ATOM   1029 C  CG1 . VAL A 1 134 ? 4.420  11.107  34.451  1.00 22.07  ? 221 VAL A CG1 1 
ATOM   1030 C  CG2 . VAL A 1 134 ? 5.538  12.449  32.678  1.00 22.40  ? 221 VAL A CG2 1 
ATOM   1031 N  N   . ARG A 1 135 ? 4.486  15.723  33.644  1.00 27.15  ? 222 ARG A N   1 
ATOM   1032 C  CA  . ARG A 1 135 ? 5.014  17.059  33.712  1.00 35.31  ? 222 ARG A CA  1 
ATOM   1033 C  C   . ARG A 1 135 ? 6.509  17.070  33.389  1.00 28.86  ? 222 ARG A C   1 
ATOM   1034 O  O   . ARG A 1 135 ? 7.395  17.685  34.027  1.00 28.67  ? 222 ARG A O   1 
ATOM   1035 C  CB  . ARG A 1 135 ? 4.520  17.825  34.941  1.00 45.96  ? 222 ARG A CB  1 
ATOM   1036 C  CG  . ARG A 1 135 ? 2.978  17.917  34.959  1.00 54.15  ? 222 ARG A CG  1 
ATOM   1037 C  CD  . ARG A 1 135 ? 2.290  18.350  36.273  1.00 60.19  ? 222 ARG A CD  1 
ATOM   1038 N  NE  . ARG A 1 135 ? 0.863  17.975  36.286  1.00 65.54  ? 222 ARG A NE  1 
ATOM   1039 C  CZ  . ARG A 1 135 ? -0.070 18.297  37.198  1.00 69.78  ? 222 ARG A CZ  1 
ATOM   1040 N  NH1 . ARG A 1 135 ? 0.198  19.058  38.272  1.00 71.76  ? 222 ARG A NH1 1 
ATOM   1041 N  NH2 . ARG A 1 135 ? -1.319 17.836  37.011  1.00 68.21  ? 222 ARG A NH2 1 
ATOM   1042 N  N   . PHE A 1 136 ? 6.747  16.283  32.362  1.00 17.28  ? 223 PHE A N   1 
ATOM   1043 C  CA  . PHE A 1 136 ? 8.053  16.177  31.892  1.00 12.40  ? 223 PHE A CA  1 
ATOM   1044 C  C   . PHE A 1 136 ? 7.948  17.138  30.791  1.00 11.15  ? 223 PHE A C   1 
ATOM   1045 O  O   . PHE A 1 136 ? 8.385  18.256  30.975  1.00 14.50  ? 223 PHE A O   1 
ATOM   1046 C  CB  . PHE A 1 136 ? 8.496  14.781  31.445  1.00 14.03  ? 223 PHE A CB  1 
ATOM   1047 C  CG  . PHE A 1 136 ? 9.914  14.814  30.880  1.00 16.16  ? 223 PHE A CG  1 
ATOM   1048 C  CD1 . PHE A 1 136 ? 11.002 15.122  31.706  1.00 15.88  ? 223 PHE A CD1 1 
ATOM   1049 C  CD2 . PHE A 1 136 ? 10.165 14.534  29.532  1.00 6.22   ? 223 PHE A CD2 1 
ATOM   1050 C  CE1 . PHE A 1 136 ? 12.308 15.148  31.211  1.00 8.74   ? 223 PHE A CE1 1 
ATOM   1051 C  CE2 . PHE A 1 136 ? 11.463 14.549  29.014  1.00 1.49   ? 223 PHE A CE2 1 
ATOM   1052 C  CZ  . PHE A 1 136 ? 12.529 14.860  29.863  1.00 2.96   ? 223 PHE A CZ  1 
ATOM   1053 N  N   . ILE A 1 137 ? 7.340  16.717  29.694  1.00 8.64   ? 224 ILE A N   1 
ATOM   1054 C  CA  . ILE A 1 137 ? 7.196  17.671  28.629  1.00 10.36  ? 224 ILE A CA  1 
ATOM   1055 C  C   . ILE A 1 137 ? 6.345  18.781  29.221  1.00 16.49  ? 224 ILE A C   1 
ATOM   1056 O  O   . ILE A 1 137 ? 5.409  18.461  29.954  1.00 20.06  ? 224 ILE A O   1 
ATOM   1057 C  CB  . ILE A 1 137 ? 6.476  17.036  27.479  1.00 3.42   ? 224 ILE A CB  1 
ATOM   1058 C  CG1 . ILE A 1 137 ? 7.455  16.115  26.811  1.00 1.00   ? 224 ILE A CG1 1 
ATOM   1059 C  CG2 . ILE A 1 137 ? 5.974  18.083  26.499  1.00 2.44   ? 224 ILE A CG2 1 
ATOM   1060 C  CD1 . ILE A 1 137 ? 6.871  15.407  25.604  1.00 1.00   ? 224 ILE A CD1 1 
ATOM   1061 N  N   . THR A 1 138 ? 6.657  20.063  28.995  1.00 10.91  ? 225 THR A N   1 
ATOM   1062 C  CA  . THR A 1 138 ? 5.780  21.018  29.639  1.00 4.57   ? 225 THR A CA  1 
ATOM   1063 C  C   . THR A 1 138 ? 5.157  21.956  28.661  1.00 6.22   ? 225 THR A C   1 
ATOM   1064 O  O   . THR A 1 138 ? 4.255  22.705  29.055  1.00 8.04   ? 225 THR A O   1 
ATOM   1065 C  CB  . THR A 1 138 ? 6.397  21.869  30.690  1.00 1.00   ? 225 THR A CB  1 
ATOM   1066 O  OG1 . THR A 1 138 ? 7.328  22.671  29.997  1.00 8.07   ? 225 THR A OG1 1 
ATOM   1067 C  CG2 . THR A 1 138 ? 7.023  21.017  31.767  1.00 3.50   ? 225 THR A CG2 1 
ATOM   1068 N  N   . ASP A 1 139 ? 5.615  21.912  27.417  1.00 1.00   ? 226 ASP A N   1 
ATOM   1069 C  CA  . ASP A 1 139 ? 4.999  22.773  26.446  1.00 1.00   ? 226 ASP A CA  1 
ATOM   1070 C  C   . ASP A 1 139 ? 5.183  22.063  25.175  1.00 1.00   ? 226 ASP A C   1 
ATOM   1071 O  O   . ASP A 1 139 ? 5.834  21.081  25.299  1.00 6.25   ? 226 ASP A O   1 
ATOM   1072 C  CB  . ASP A 1 139 ? 5.479  24.218  26.346  1.00 5.65   ? 226 ASP A CB  1 
ATOM   1073 C  CG  . ASP A 1 139 ? 5.385  24.950  27.642  1.00 13.32  ? 226 ASP A CG  1 
ATOM   1074 O  OD1 . ASP A 1 139 ? 5.956  24.626  28.664  1.00 20.67  ? 226 ASP A OD1 1 
ATOM   1075 O  OD2 . ASP A 1 139 ? 4.565  25.941  27.581  1.00 11.56  ? 226 ASP A OD2 1 
ATOM   1076 N  N   . THR A 1 140 ? 4.647  22.548  24.059  1.00 1.00   ? 227 THR A N   1 
ATOM   1077 C  CA  . THR A 1 140 ? 4.746  21.957  22.759  1.00 1.00   ? 227 THR A CA  1 
ATOM   1078 C  C   . THR A 1 140 ? 5.030  22.994  21.695  1.00 7.60   ? 227 THR A C   1 
ATOM   1079 O  O   . THR A 1 140 ? 4.470  24.070  21.585  1.00 11.18  ? 227 THR A O   1 
ATOM   1080 C  CB  . THR A 1 140 ? 3.440  21.311  22.316  1.00 2.73   ? 227 THR A CB  1 
ATOM   1081 O  OG1 . THR A 1 140 ? 3.028  20.292  23.208  1.00 5.57   ? 227 THR A OG1 1 
ATOM   1082 C  CG2 . THR A 1 140 ? 3.570  20.843  20.863  1.00 1.00   ? 227 THR A CG2 1 
ATOM   1083 N  N   . LEU A 1 141 ? 5.950  22.669  20.875  1.00 5.19   ? 228 LEU A N   1 
ATOM   1084 C  CA  . LEU A 1 141 ? 6.261  23.588  19.869  1.00 3.71   ? 228 LEU A CA  1 
ATOM   1085 C  C   . LEU A 1 141 ? 5.497  23.121  18.724  1.00 2.70   ? 228 LEU A C   1 
ATOM   1086 O  O   . LEU A 1 141 ? 4.588  23.790  18.380  1.00 13.68  ? 228 LEU A O   1 
ATOM   1087 C  CB  . LEU A 1 141 ? 7.760  23.686  19.535  1.00 11.32  ? 228 LEU A CB  1 
ATOM   1088 C  CG  . LEU A 1 141 ? 8.625  24.673  20.328  1.00 11.06  ? 228 LEU A CG  1 
ATOM   1089 C  CD1 . LEU A 1 141 ? 8.457  24.517  21.837  1.00 10.16  ? 228 LEU A CD1 1 
ATOM   1090 C  CD2 . LEU A 1 141 ? 10.082 24.392  19.978  1.00 7.19   ? 228 LEU A CD2 1 
ATOM   1091 N  N   . SER A 1 142 ? 5.839  21.982  18.161  1.00 8.55   ? 229 SER A N   1 
ATOM   1092 C  CA  . SER A 1 142 ? 5.069  21.497  17.029  1.00 18.45  ? 229 SER A CA  1 
ATOM   1093 C  C   . SER A 1 142 ? 5.004  19.972  16.873  1.00 23.75  ? 229 SER A C   1 
ATOM   1094 O  O   . SER A 1 142 ? 5.906  19.303  16.392  1.00 29.56  ? 229 SER A O   1 
ATOM   1095 C  CB  . SER A 1 142 ? 5.364  22.207  15.748  1.00 20.62  ? 229 SER A CB  1 
ATOM   1096 O  OG  . SER A 1 142 ? 6.545  21.674  15.229  1.00 23.56  ? 229 SER A OG  1 
ATOM   1097 N  N   . LYS A 1 143 ? 3.871  19.449  17.318  1.00 26.50  ? 230 LYS A N   1 
ATOM   1098 C  CA  . LYS A 1 143 ? 3.446  18.056  17.354  1.00 24.91  ? 230 LYS A CA  1 
ATOM   1099 C  C   . LYS A 1 143 ? 2.856  17.550  16.050  1.00 20.47  ? 230 LYS A C   1 
ATOM   1100 O  O   . LYS A 1 143 ? 1.705  17.852  15.750  1.00 21.79  ? 230 LYS A O   1 
ATOM   1101 C  CB  . LYS A 1 143 ? 2.387  18.025  18.436  1.00 21.07  ? 230 LYS A CB  1 
ATOM   1102 C  CG  . LYS A 1 143 ? 1.390  16.898  18.448  1.00 19.69  ? 230 LYS A CG  1 
ATOM   1103 C  CD  . LYS A 1 143 ? 0.529  17.114  19.675  1.00 28.79  ? 230 LYS A CD  1 
ATOM   1104 C  CE  . LYS A 1 143 ? -0.312 15.943  20.145  1.00 36.84  ? 230 LYS A CE  1 
ATOM   1105 N  NZ  . LYS A 1 143 ? -0.876 16.226  21.482  1.00 44.83  ? 230 LYS A NZ  1 
ATOM   1106 N  N   . GLY A 1 144 ? 3.657  16.787  15.299  1.00 17.04  ? 231 GLY A N   1 
ATOM   1107 C  CA  . GLY A 1 144 ? 3.282  16.188  14.018  1.00 17.91  ? 231 GLY A CA  1 
ATOM   1108 C  C   . GLY A 1 144 ? 2.886  14.723  14.207  1.00 22.89  ? 231 GLY A C   1 
ATOM   1109 O  O   . GLY A 1 144 ? 2.707  14.292  15.381  1.00 21.90  ? 231 GLY A O   1 
ATOM   1110 N  N   . GLU A 1 145 ? 2.751  13.957  13.079  1.00 21.38  ? 232 GLU A N   1 
ATOM   1111 C  CA  . GLU A 1 145 ? 2.395  12.541  13.210  1.00 23.01  ? 232 GLU A CA  1 
ATOM   1112 C  C   . GLU A 1 145 ? 3.591  11.668  13.572  1.00 22.07  ? 232 GLU A C   1 
ATOM   1113 O  O   . GLU A 1 145 ? 3.489  10.746  14.367  1.00 25.22  ? 232 GLU A O   1 
ATOM   1114 C  CB  . GLU A 1 145 ? 1.548  11.982  12.088  1.00 29.71  ? 232 GLU A CB  1 
ATOM   1115 C  CG  . GLU A 1 145 ? 2.129  12.346  10.704  1.00 40.88  ? 232 GLU A CG  1 
ATOM   1116 C  CD  . GLU A 1 145 ? 1.171  11.791  9.690   1.00 52.13  ? 232 GLU A CD  1 
ATOM   1117 O  OE1 . GLU A 1 145 ? 0.030  11.596  10.036  1.00 57.15  ? 232 GLU A OE1 1 
ATOM   1118 O  OE2 . GLU A 1 145 ? 1.635  11.552  8.458   1.00 54.00  ? 232 GLU A OE2 1 
ATOM   1119 N  N   . THR A 1 146 ? 4.732  12.007  12.983  1.00 20.71  ? 233 THR A N   1 
ATOM   1120 C  CA  . THR A 1 146 ? 5.997  11.341  13.201  1.00 17.63  ? 233 THR A CA  1 
ATOM   1121 C  C   . THR A 1 146 ? 7.025  12.127  14.010  1.00 16.79  ? 233 THR A C   1 
ATOM   1122 O  O   . THR A 1 146 ? 8.149  11.687  14.230  1.00 19.80  ? 233 THR A O   1 
ATOM   1123 C  CB  . THR A 1 146 ? 6.578  10.808  11.903  1.00 17.29  ? 233 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 146 ? 6.731  11.818  10.930  1.00 14.12  ? 233 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 146 ? 5.583  9.778   11.420  1.00 21.97  ? 233 THR A CG2 1 
ATOM   1126 N  N   . LYS A 1 147 ? 6.682  13.311  14.466  1.00 11.20  ? 234 LYS A N   1 
ATOM   1127 C  CA  . LYS A 1 147 ? 7.701  13.990  15.202  1.00 9.95   ? 234 LYS A CA  1 
ATOM   1128 C  C   . LYS A 1 147 ? 7.126  15.027  16.100  1.00 6.45   ? 234 LYS A C   1 
ATOM   1129 O  O   . LYS A 1 147 ? 6.241  15.742  15.710  1.00 11.51  ? 234 LYS A O   1 
ATOM   1130 C  CB  . LYS A 1 147 ? 8.710  14.656  14.274  1.00 11.71  ? 234 LYS A CB  1 
ATOM   1131 C  CG  . LYS A 1 147 ? 9.539  15.656  15.058  1.00 13.99  ? 234 LYS A CG  1 
ATOM   1132 C  CD  . LYS A 1 147 ? 10.613 16.369  14.271  1.00 18.04  ? 234 LYS A CD  1 
ATOM   1133 C  CE  . LYS A 1 147 ? 10.093 17.373  13.277  1.00 23.27  ? 234 LYS A CE  1 
ATOM   1134 N  NZ  . LYS A 1 147 ? 11.116 18.412  13.074  1.00 27.02  ? 234 LYS A NZ  1 
ATOM   1135 N  N   . PHE A 1 148 ? 7.665  15.149  17.271  1.00 1.00   ? 235 PHE A N   1 
ATOM   1136 C  CA  . PHE A 1 148 ? 7.149  16.127  18.115  1.00 1.00   ? 235 PHE A CA  1 
ATOM   1137 C  C   . PHE A 1 148 ? 8.210  17.060  18.661  1.00 5.54   ? 235 PHE A C   1 
ATOM   1138 O  O   . PHE A 1 148 ? 9.134  16.637  19.333  1.00 10.03  ? 235 PHE A O   1 
ATOM   1139 C  CB  . PHE A 1 148 ? 6.596  15.333  19.252  1.00 1.00   ? 235 PHE A CB  1 
ATOM   1140 C  CG  . PHE A 1 148 ? 6.277  16.183  20.429  1.00 1.00   ? 235 PHE A CG  1 
ATOM   1141 C  CD1 . PHE A 1 148 ? 5.249  17.127  20.381  1.00 1.00   ? 235 PHE A CD1 1 
ATOM   1142 C  CD2 . PHE A 1 148 ? 6.978  16.032  21.625  1.00 1.00   ? 235 PHE A CD2 1 
ATOM   1143 C  CE1 . PHE A 1 148 ? 4.923  17.903  21.499  1.00 1.27   ? 235 PHE A CE1 1 
ATOM   1144 C  CE2 . PHE A 1 148 ? 6.656  16.803  22.747  1.00 7.67   ? 235 PHE A CE2 1 
ATOM   1145 C  CZ  . PHE A 1 148 ? 5.626  17.748  22.696  1.00 1.00   ? 235 PHE A CZ  1 
ATOM   1146 N  N   . MET A 1 149 ? 8.094  18.363  18.408  1.00 5.61   ? 236 MET A N   1 
ATOM   1147 C  CA  . MET A 1 149 ? 9.057  19.305  18.955  1.00 1.00   ? 236 MET A CA  1 
ATOM   1148 C  C   . MET A 1 149 ? 8.461  19.894  20.199  1.00 1.00   ? 236 MET A C   1 
ATOM   1149 O  O   . MET A 1 149 ? 7.399  20.425  20.185  1.00 5.77   ? 236 MET A O   1 
ATOM   1150 C  CB  . MET A 1 149 ? 9.346  20.315  17.912  1.00 1.63   ? 236 MET A CB  1 
ATOM   1151 C  CG  . MET A 1 149 ? 9.440  19.525  16.645  1.00 14.07  ? 236 MET A CG  1 
ATOM   1152 S  SD  . MET A 1 149 ? 10.313 20.487  15.419  1.00 32.92  ? 236 MET A SD  1 
ATOM   1153 C  CE  . MET A 1 149 ? 11.973 20.414  16.133  1.00 33.27  ? 236 MET A CE  1 
ATOM   1154 N  N   . GLY A 1 150 ? 9.089  19.799  21.307  1.00 1.00   ? 237 GLY A N   1 
ATOM   1155 C  CA  . GLY A 1 150 ? 8.453  20.319  22.466  1.00 1.00   ? 237 GLY A CA  1 
ATOM   1156 C  C   . GLY A 1 150 ? 9.486  20.772  23.435  1.00 1.00   ? 237 GLY A C   1 
ATOM   1157 O  O   . GLY A 1 150 ? 10.652 20.918  23.135  1.00 3.28   ? 237 GLY A O   1 
ATOM   1158 N  N   . VAL A 1 151 ? 9.034  20.987  24.617  1.00 1.30   ? 238 VAL A N   1 
ATOM   1159 C  CA  . VAL A 1 151 ? 9.835  21.498  25.682  1.00 4.35   ? 238 VAL A CA  1 
ATOM   1160 C  C   . VAL A 1 151 ? 9.626  20.618  26.874  1.00 6.28   ? 238 VAL A C   1 
ATOM   1161 O  O   . VAL A 1 151 ? 8.542  20.076  26.988  1.00 13.07  ? 238 VAL A O   1 
ATOM   1162 C  CB  . VAL A 1 151 ? 9.148  22.868  25.948  1.00 4.50   ? 238 VAL A CB  1 
ATOM   1163 C  CG1 . VAL A 1 151 ? 9.351  23.479  27.343  1.00 7.00   ? 238 VAL A CG1 1 
ATOM   1164 C  CG2 . VAL A 1 151 ? 9.390  23.871  24.825  1.00 1.00   ? 238 VAL A CG2 1 
ATOM   1165 N  N   . CYS A 1 152 ? 10.625 20.503  27.752  1.00 2.50   ? 239 CYS A N   1 
ATOM   1166 C  CA  . CYS A 1 152 ? 10.474 19.670  28.922  1.00 5.26   ? 239 CYS A CA  1 
ATOM   1167 C  C   . CYS A 1 152 ? 11.186 20.278  30.070  1.00 1.00   ? 239 CYS A C   1 
ATOM   1168 O  O   . CYS A 1 152 ? 11.687 21.356  29.910  1.00 6.78   ? 239 CYS A O   1 
ATOM   1169 C  CB  . CYS A 1 152 ? 10.922 18.216  28.702  1.00 12.81  ? 239 CYS A CB  1 
ATOM   1170 S  SG  . CYS A 1 152 ? 12.657 18.081  28.204  1.00 11.54  ? 239 CYS A SG  1 
ATOM   1171 N  N   . GLN A 1 153 ? 11.217 19.606  31.195  1.00 1.00   ? 240 GLN A N   1 
ATOM   1172 C  CA  . GLN A 1 153 ? 11.861 20.149  32.338  1.00 1.82   ? 240 GLN A CA  1 
ATOM   1173 C  C   . GLN A 1 153 ? 11.832 19.132  33.439  1.00 7.37   ? 240 GLN A C   1 
ATOM   1174 O  O   . GLN A 1 153 ? 10.794 18.543  33.666  1.00 9.89   ? 240 GLN A O   1 
ATOM   1175 C  CB  . GLN A 1 153 ? 11.019 21.340  32.822  1.00 11.04  ? 240 GLN A CB  1 
ATOM   1176 C  CG  . GLN A 1 153 ? 11.469 21.922  34.178  1.00 18.51  ? 240 GLN A CG  1 
ATOM   1177 C  CD  . GLN A 1 153 ? 10.355 22.740  34.855  1.00 33.59  ? 240 GLN A CD  1 
ATOM   1178 O  OE1 . GLN A 1 153 ? 9.274  22.197  35.222  1.00 42.94  ? 240 GLN A OE1 1 
ATOM   1179 N  NE2 . GLN A 1 153 ? 10.533 24.067  34.922  1.00 31.59  ? 240 GLN A NE2 1 
ATOM   1180 N  N   . LEU A 1 154 ? 12.962 18.922  34.118  1.00 13.03  ? 241 LEU A N   1 
ATOM   1181 C  CA  . LEU A 1 154 ? 13.030 17.968  35.207  1.00 14.14  ? 241 LEU A CA  1 
ATOM   1182 C  C   . LEU A 1 154 ? 12.339 18.543  36.408  1.00 20.76  ? 241 LEU A C   1 
ATOM   1183 O  O   . LEU A 1 154 ? 12.241 19.742  36.570  1.00 13.50  ? 241 LEU A O   1 
ATOM   1184 C  CB  . LEU A 1 154 ? 14.448 17.646  35.637  1.00 13.09  ? 241 LEU A CB  1 
ATOM   1185 C  CG  . LEU A 1 154 ? 15.243 16.937  34.572  1.00 25.61  ? 241 LEU A CG  1 
ATOM   1186 C  CD1 . LEU A 1 154 ? 16.723 17.021  34.940  1.00 29.34  ? 241 LEU A CD1 1 
ATOM   1187 C  CD2 . LEU A 1 154 ? 14.868 15.466  34.593  1.00 28.44  ? 241 LEU A CD2 1 
ATOM   1188 N  N   . PRO A 1 155 ? 11.873 17.684  37.269  1.00 33.49  ? 242 PRO A N   1 
ATOM   1189 C  CA  . PRO A 1 155 ? 11.180 18.096  38.473  1.00 39.28  ? 242 PRO A CA  1 
ATOM   1190 C  C   . PRO A 1 155 ? 12.085 18.525  39.611  1.00 46.84  ? 242 PRO A C   1 
ATOM   1191 O  O   . PRO A 1 155 ? 13.212 18.025  39.724  1.00 49.25  ? 242 PRO A O   1 
ATOM   1192 C  CB  . PRO A 1 155 ? 10.429 16.843  38.938  1.00 37.33  ? 242 PRO A CB  1 
ATOM   1193 C  CG  . PRO A 1 155 ? 10.723 15.731  37.944  1.00 34.67  ? 242 PRO A CG  1 
ATOM   1194 C  CD  . PRO A 1 155 ? 11.389 16.387  36.750  1.00 34.35  ? 242 PRO A CD  1 
ATOM   1195 N  N   . SER A 1 156 ? 11.557 19.405  40.477  1.00 49.65  ? 243 SER A N   1 
ATOM   1196 C  CA  . SER A 1 156 ? 12.306 19.883  41.630  1.00 56.60  ? 243 SER A CA  1 
ATOM   1197 C  C   . SER A 1 156 ? 11.481 19.757  42.887  1.00 64.93  ? 243 SER A C   1 
ATOM   1198 O  O   . SER A 1 156 ? 10.328 19.356  42.829  1.00 66.92  ? 243 SER A O   1 
ATOM   1199 C  CB  . SER A 1 156 ? 12.723 21.333  41.496  1.00 57.35  ? 243 SER A CB  1 
ATOM   1200 N  N   . GLU A 1 157 ? 12.077 20.121  44.019  1.00 72.05  ? 244 GLU A N   1 
ATOM   1201 C  CA  . GLU A 1 157 ? 11.402 20.060  45.313  1.00 81.47  ? 244 GLU A CA  1 
ATOM   1202 C  C   . GLU A 1 157 ? 11.443 21.442  45.978  1.00 90.38  ? 244 GLU A C   1 
ATOM   1203 O  O   . GLU A 1 157 ? 10.970 21.653  47.108  1.00 92.17  ? 244 GLU A O   1 
ATOM   1204 C  CB  . GLU A 1 157 ? 11.956 18.954  46.210  1.00 80.80  ? 244 GLU A CB  1 
ATOM   1205 N  N   . ASN A 1 158 ? 12.017 22.369  45.192  1.00 94.42  ? 245 ASN A N   1 
ATOM   1206 C  CA  . ASN A 1 158 ? 12.229 23.784  45.477  1.00 97.32  ? 245 ASN A CA  1 
ATOM   1207 C  C   . ASN A 1 158 ? 12.472 24.520  44.157  1.00 100.00 ? 245 ASN A C   1 
ATOM   1208 O  O   . ASN A 1 158 ? 11.457 24.935  43.521  1.00 100.00 ? 245 ASN A O   1 
ATOM   1209 C  CB  . ASN A 1 158 ? 13.435 23.992  46.392  1.00 96.55  ? 245 ASN A CB  1 
ATOM   1210 N  N   . GLU A 1 162 ? 15.458 25.846  40.410  1.00 35.39  ? 249 GLU A N   1 
ATOM   1211 C  CA  . GLU A 1 162 ? 14.792 24.993  39.445  1.00 37.66  ? 249 GLU A CA  1 
ATOM   1212 C  C   . GLU A 1 162 ? 15.562 24.922  38.088  1.00 36.98  ? 249 GLU A C   1 
ATOM   1213 O  O   . GLU A 1 162 ? 16.556 25.641  37.843  1.00 31.15  ? 249 GLU A O   1 
ATOM   1214 C  CB  . GLU A 1 162 ? 13.272 25.321  39.345  1.00 41.93  ? 249 GLU A CB  1 
ATOM   1215 C  CG  . GLU A 1 162 ? 12.306 24.084  39.534  1.00 46.78  ? 249 GLU A CG  1 
ATOM   1216 C  CD  . GLU A 1 162 ? 12.308 23.013  38.429  1.00 48.40  ? 249 GLU A CD  1 
ATOM   1217 O  OE1 . GLU A 1 162 ? 12.146 23.300  37.265  1.00 51.17  ? 249 GLU A OE1 1 
ATOM   1218 O  OE2 . GLU A 1 162 ? 12.308 21.739  38.811  1.00 45.25  ? 249 GLU A OE2 1 
ATOM   1219 N  N   . TYR A 1 163 ? 15.092 24.003  37.207  1.00 34.31  ? 250 TYR A N   1 
ATOM   1220 C  CA  . TYR A 1 163 ? 15.635 23.668  35.878  1.00 27.21  ? 250 TYR A CA  1 
ATOM   1221 C  C   . TYR A 1 163 ? 15.148 24.479  34.691  1.00 23.08  ? 250 TYR A C   1 
ATOM   1222 O  O   . TYR A 1 163 ? 14.056 25.017  34.675  1.00 28.88  ? 250 TYR A O   1 
ATOM   1223 C  CB  . TYR A 1 163 ? 15.520 22.130  35.592  1.00 24.77  ? 250 TYR A CB  1 
ATOM   1224 C  CG  . TYR A 1 163 ? 16.306 21.251  36.573  1.00 18.63  ? 250 TYR A CG  1 
ATOM   1225 C  CD1 . TYR A 1 163 ? 15.856 21.022  37.866  1.00 19.76  ? 250 TYR A CD1 1 
ATOM   1226 C  CD2 . TYR A 1 163 ? 17.508 20.659  36.197  1.00 25.83  ? 250 TYR A CD2 1 
ATOM   1227 C  CE1 . TYR A 1 163 ? 16.573 20.236  38.766  1.00 26.80  ? 250 TYR A CE1 1 
ATOM   1228 C  CE2 . TYR A 1 163 ? 18.263 19.881  37.074  1.00 27.99  ? 250 TYR A CE2 1 
ATOM   1229 C  CZ  . TYR A 1 163 ? 17.786 19.670  38.368  1.00 29.94  ? 250 TYR A CZ  1 
ATOM   1230 O  OH  . TYR A 1 163 ? 18.520 18.900  39.229  1.00 32.59  ? 250 TYR A OH  1 
ATOM   1231 N  N   . PRO A 1 164 ? 15.966 24.569  33.667  1.00 11.93  ? 251 PRO A N   1 
ATOM   1232 C  CA  . PRO A 1 164 ? 15.571 25.310  32.502  1.00 12.48  ? 251 PRO A CA  1 
ATOM   1233 C  C   . PRO A 1 164 ? 14.729 24.429  31.672  1.00 9.54   ? 251 PRO A C   1 
ATOM   1234 O  O   . PRO A 1 164 ? 14.657 23.256  31.949  1.00 16.14  ? 251 PRO A O   1 
ATOM   1235 C  CB  . PRO A 1 164 ? 16.831 25.576  31.693  1.00 10.26  ? 251 PRO A CB  1 
ATOM   1236 C  CG  . PRO A 1 164 ? 17.954 25.444  32.697  1.00 9.96   ? 251 PRO A CG  1 
ATOM   1237 C  CD  . PRO A 1 164 ? 17.414 24.672  33.895  1.00 8.66   ? 251 PRO A CD  1 
ATOM   1238 N  N   . HIS A 1 165 ? 14.105 24.993  30.676  1.00 2.01   ? 252 HIS A N   1 
ATOM   1239 C  CA  . HIS A 1 165 ? 13.302 24.176  29.825  1.00 5.53   ? 252 HIS A CA  1 
ATOM   1240 C  C   . HIS A 1 165 ? 14.171 23.772  28.691  1.00 8.71   ? 252 HIS A C   1 
ATOM   1241 O  O   . HIS A 1 165 ? 14.636 24.630  27.913  1.00 5.65   ? 252 HIS A O   1 
ATOM   1242 C  CB  . HIS A 1 165 ? 12.022 24.869  29.303  1.00 12.45  ? 252 HIS A CB  1 
ATOM   1243 C  CG  . HIS A 1 165 ? 11.022 24.993  30.388  1.00 14.89  ? 252 HIS A CG  1 
ATOM   1244 N  ND1 . HIS A 1 165 ? 11.173 25.920  31.409  1.00 20.26  ? 252 HIS A ND1 1 
ATOM   1245 C  CD2 . HIS A 1 165 ? 9.906  24.293  30.615  1.00 17.51  ? 252 HIS A CD2 1 
ATOM   1246 C  CE1 . HIS A 1 165 ? 10.151 25.782  32.241  1.00 19.45  ? 252 HIS A CE1 1 
ATOM   1247 N  NE2 . HIS A 1 165 ? 9.377  24.816  31.786  1.00 24.09  ? 252 HIS A NE2 1 
ATOM   1248 N  N   . ARG A 1 166 ? 14.410 22.482  28.587  1.00 7.60   ? 253 ARG A N   1 
ATOM   1249 C  CA  . ARG A 1 166 ? 15.239 22.072  27.487  1.00 6.37   ? 253 ARG A CA  1 
ATOM   1250 C  C   . ARG A 1 166 ? 14.366 21.764  26.328  1.00 1.00   ? 253 ARG A C   1 
ATOM   1251 O  O   . ARG A 1 166 ? 13.170 21.674  26.534  1.00 6.17   ? 253 ARG A O   1 
ATOM   1252 C  CB  . ARG A 1 166 ? 15.931 20.796  27.822  1.00 12.11  ? 253 ARG A CB  1 
ATOM   1253 C  CG  . ARG A 1 166 ? 17.106 20.992  28.733  1.00 15.13  ? 253 ARG A CG  1 
ATOM   1254 C  CD  . ARG A 1 166 ? 16.737 21.440  30.113  1.00 12.49  ? 253 ARG A CD  1 
ATOM   1255 N  NE  . ARG A 1 166 ? 17.994 21.607  30.844  1.00 20.03  ? 253 ARG A NE  1 
ATOM   1256 C  CZ  . ARG A 1 166 ? 18.944 22.518  30.552  1.00 18.37  ? 253 ARG A CZ  1 
ATOM   1257 N  NH1 . ARG A 1 166 ? 18.866 23.381  29.538  1.00 15.56  ? 253 ARG A NH1 1 
ATOM   1258 N  NH2 . ARG A 1 166 ? 20.029 22.563  31.310  1.00 19.55  ? 253 ARG A NH2 1 
ATOM   1259 N  N   . ARG A 1 167 ? 14.947 21.615  25.153  1.00 1.00   ? 254 ARG A N   1 
ATOM   1260 C  CA  . ARG A 1 167 ? 14.178 21.239  23.991  1.00 1.73   ? 254 ARG A CA  1 
ATOM   1261 C  C   . ARG A 1 167 ? 14.174 19.730  24.045  1.00 13.21  ? 254 ARG A C   1 
ATOM   1262 O  O   . ARG A 1 167 ? 15.011 19.078  24.693  1.00 11.18  ? 254 ARG A O   1 
ATOM   1263 C  CB  . ARG A 1 167 ? 14.880 21.496  22.702  1.00 4.07   ? 254 ARG A CB  1 
ATOM   1264 C  CG  . ARG A 1 167 ? 14.930 22.961  22.439  1.00 14.55  ? 254 ARG A CG  1 
ATOM   1265 C  CD  . ARG A 1 167 ? 13.746 23.411  21.624  1.00 15.32  ? 254 ARG A CD  1 
ATOM   1266 N  NE  . ARG A 1 167 ? 13.808 22.938  20.236  1.00 15.23  ? 254 ARG A NE  1 
ATOM   1267 C  CZ  . ARG A 1 167 ? 13.301 21.754  19.923  1.00 12.77  ? 254 ARG A CZ  1 
ATOM   1268 N  NH1 . ARG A 1 167 ? 12.748 20.976  20.865  1.00 14.15  ? 254 ARG A NH1 1 
ATOM   1269 N  NH2 . ARG A 1 167 ? 13.343 21.341  18.661  1.00 7.96   ? 254 ARG A NH2 1 
ATOM   1270 N  N   . ILE A 1 168 ? 13.239 19.152  23.354  1.00 13.74  ? 255 ILE A N   1 
ATOM   1271 C  CA  . ILE A 1 168 ? 13.165 17.729  23.348  1.00 6.70   ? 255 ILE A CA  1 
ATOM   1272 C  C   . ILE A 1 168 ? 12.508 17.406  22.108  1.00 4.50   ? 255 ILE A C   1 
ATOM   1273 O  O   . ILE A 1 168 ? 11.619 18.134  21.762  1.00 8.81   ? 255 ILE A O   1 
ATOM   1274 C  CB  . ILE A 1 168 ? 12.496 17.074  24.541  1.00 4.55   ? 255 ILE A CB  1 
ATOM   1275 C  CG1 . ILE A 1 168 ? 12.155 15.633  24.214  1.00 7.75   ? 255 ILE A CG1 1 
ATOM   1276 C  CG2 . ILE A 1 168 ? 11.273 17.812  24.961  1.00 8.07   ? 255 ILE A CG2 1 
ATOM   1277 C  CD1 . ILE A 1 168 ? 11.910 14.826  25.484  1.00 9.48   ? 255 ILE A CD1 1 
ATOM   1278 N  N   . ASP A 1 169 ? 12.998 16.379  21.462  1.00 2.39   ? 256 ASP A N   1 
ATOM   1279 C  CA  . ASP A 1 169 ? 12.443 15.963  20.224  1.00 3.16   ? 256 ASP A CA  1 
ATOM   1280 C  C   . ASP A 1 169 ? 12.340 14.518  20.377  1.00 11.48  ? 256 ASP A C   1 
ATOM   1281 O  O   . ASP A 1 169 ? 13.246 13.924  20.979  1.00 8.37   ? 256 ASP A O   1 
ATOM   1282 C  CB  . ASP A 1 169 ? 13.260 16.219  18.959  1.00 8.03   ? 256 ASP A CB  1 
ATOM   1283 C  CG  . ASP A 1 169 ? 13.021 17.606  18.502  1.00 7.47   ? 256 ASP A CG  1 
ATOM   1284 O  OD1 . ASP A 1 169 ? 12.764 18.432  19.364  1.00 4.73   ? 256 ASP A OD1 1 
ATOM   1285 O  OD2 . ASP A 1 169 ? 13.191 17.805  17.169  1.00 1.47   ? 256 ASP A OD2 1 
ATOM   1286 N  N   . ILE A 1 170 ? 11.218 14.037  19.832  1.00 12.19  ? 257 ILE A N   1 
ATOM   1287 C  CA  . ILE A 1 170 ? 10.851 12.669  19.861  1.00 1.00   ? 257 ILE A CA  1 
ATOM   1288 C  C   . ILE A 1 170 ? 10.455 12.419  18.492  1.00 1.00   ? 257 ILE A C   1 
ATOM   1289 O  O   . ILE A 1 170 ? 9.700  13.211  17.983  1.00 4.75   ? 257 ILE A O   1 
ATOM   1290 C  CB  . ILE A 1 170 ? 9.661  12.454  20.759  1.00 1.00   ? 257 ILE A CB  1 
ATOM   1291 C  CG1 . ILE A 1 170 ? 9.904  13.196  22.029  1.00 1.00   ? 257 ILE A CG1 1 
ATOM   1292 C  CG2 . ILE A 1 170 ? 9.617  11.012  21.180  1.00 1.00   ? 257 ILE A CG2 1 
ATOM   1293 C  CD1 . ILE A 1 170 ? 9.307  12.508  23.242  1.00 1.89   ? 257 ILE A CD1 1 
ATOM   1294 N  N   . ARG A 1 171 ? 10.978 11.350  17.929  1.00 4.01   ? 258 ARG A N   1 
ATOM   1295 C  CA  . ARG A 1 171 ? 10.662 10.994  16.574  1.00 9.98   ? 258 ARG A CA  1 
ATOM   1296 C  C   . ARG A 1 171 ? 10.169 9.569   16.510  1.00 10.07  ? 258 ARG A C   1 
ATOM   1297 O  O   . ARG A 1 171 ? 10.500 8.665   17.296  1.00 8.47   ? 258 ARG A O   1 
ATOM   1298 C  CB  . ARG A 1 171 ? 11.813 11.107  15.626  1.00 14.05  ? 258 ARG A CB  1 
ATOM   1299 C  CG  . ARG A 1 171 ? 12.322 12.501  15.437  1.00 19.26  ? 258 ARG A CG  1 
ATOM   1300 C  CD  . ARG A 1 171 ? 13.589 12.421  14.613  1.00 26.97  ? 258 ARG A CD  1 
ATOM   1301 N  NE  . ARG A 1 171 ? 14.335 13.660  14.593  1.00 33.27  ? 258 ARG A NE  1 
ATOM   1302 C  CZ  . ARG A 1 171 ? 14.312 14.521  13.577  1.00 40.88  ? 258 ARG A CZ  1 
ATOM   1303 N  NH1 . ARG A 1 171 ? 13.601 14.335  12.450  1.00 39.10  ? 258 ARG A NH1 1 
ATOM   1304 N  NH2 . ARG A 1 171 ? 15.051 15.618  13.701  1.00 47.08  ? 258 ARG A NH2 1 
ATOM   1305 N  N   . LEU A 1 172 ? 9.326  9.382   15.543  1.00 3.86   ? 259 LEU A N   1 
ATOM   1306 C  CA  . LEU A 1 172 ? 8.770  8.087   15.400  1.00 4.87   ? 259 LEU A CA  1 
ATOM   1307 C  C   . LEU A 1 172 ? 9.366  7.503   14.204  1.00 7.28   ? 259 LEU A C   1 
ATOM   1308 O  O   . LEU A 1 172 ? 9.189  8.111   13.166  1.00 4.11   ? 259 LEU A O   1 
ATOM   1309 C  CB  . LEU A 1 172 ? 7.237  8.133   15.231  1.00 1.00   ? 259 LEU A CB  1 
ATOM   1310 C  CG  . LEU A 1 172 ? 6.582  6.765   15.192  1.00 1.00   ? 259 LEU A CG  1 
ATOM   1311 C  CD1 . LEU A 1 172 ? 6.923  5.959   16.451  1.00 1.00   ? 259 LEU A CD1 1 
ATOM   1312 C  CD2 . LEU A 1 172 ? 5.094  6.987   15.104  1.00 4.53   ? 259 LEU A CD2 1 
ATOM   1313 N  N   . ILE A 1 173 ? 10.015 6.346   14.345  1.00 7.30   ? 260 ILE A N   1 
ATOM   1314 C  CA  . ILE A 1 173 ? 10.589 5.793   13.160  1.00 5.24   ? 260 ILE A CA  1 
ATOM   1315 C  C   . ILE A 1 173 ? 10.096 4.388   13.015  1.00 1.00   ? 260 ILE A C   1 
ATOM   1316 O  O   . ILE A 1 173 ? 9.857  3.756   14.025  1.00 1.00   ? 260 ILE A O   1 
ATOM   1317 C  CB  . ILE A 1 173 ? 12.127 5.764   13.340  1.00 9.88   ? 260 ILE A CB  1 
ATOM   1318 C  CG1 . ILE A 1 173 ? 12.704 7.107   13.777  1.00 15.01  ? 260 ILE A CG1 1 
ATOM   1319 C  CG2 . ILE A 1 173 ? 12.835 5.294   12.069  1.00 7.15   ? 260 ILE A CG2 1 
ATOM   1320 C  CD1 . ILE A 1 173 ? 12.602 8.146   12.659  1.00 24.72  ? 260 ILE A CD1 1 
ATOM   1321 N  N   . PRO A 1 174 ? 9.984  3.940   11.772  1.00 1.00   ? 261 PRO A N   1 
ATOM   1322 C  CA  . PRO A 1 174 ? 9.584  2.596   11.478  1.00 7.59   ? 261 PRO A CA  1 
ATOM   1323 C  C   . PRO A 1 174 ? 10.539 1.627   12.169  1.00 8.64   ? 261 PRO A C   1 
ATOM   1324 O  O   . PRO A 1 174 ? 11.643 1.975   12.457  1.00 14.74  ? 261 PRO A O   1 
ATOM   1325 C  CB  . PRO A 1 174 ? 9.736  2.434   9.960   1.00 2.19   ? 261 PRO A CB  1 
ATOM   1326 C  CG  . PRO A 1 174 ? 9.659  3.831   9.372   1.00 1.00   ? 261 PRO A CG  1 
ATOM   1327 C  CD  . PRO A 1 174 ? 9.868  4.773   10.552  1.00 1.00   ? 261 PRO A CD  1 
ATOM   1328 N  N   . LYS A 1 175 ? 10.147 0.407   12.485  1.00 11.83  ? 262 LYS A N   1 
ATOM   1329 C  CA  . LYS A 1 175 ? 11.083 -0.500  13.135  1.00 13.51  ? 262 LYS A CA  1 
ATOM   1330 C  C   . LYS A 1 175 ? 12.028 -0.979  12.062  1.00 7.40   ? 262 LYS A C   1 
ATOM   1331 O  O   . LYS A 1 175 ? 13.109 -1.423  12.348  1.00 5.27   ? 262 LYS A O   1 
ATOM   1332 C  CB  . LYS A 1 175 ? 10.430 -1.717  13.811  1.00 16.76  ? 262 LYS A CB  1 
ATOM   1333 C  CG  . LYS A 1 175 ? 11.370 -2.813  14.342  1.00 19.34  ? 262 LYS A CG  1 
ATOM   1334 C  CD  . LYS A 1 175 ? 11.580 -2.805  15.857  1.00 25.41  ? 262 LYS A CD  1 
ATOM   1335 C  CE  . LYS A 1 175 ? 12.015 -4.182  16.426  1.00 31.74  ? 262 LYS A CE  1 
ATOM   1336 N  NZ  . LYS A 1 175 ? 11.519 -4.563  17.796  1.00 26.67  ? 262 LYS A NZ  1 
ATOM   1337 N  N   . ASP A 1 176 ? 11.630 -0.891  10.804  1.00 5.11   ? 263 ASP A N   1 
ATOM   1338 C  CA  . ASP A 1 176 ? 12.557 -1.363  9.825   1.00 1.67   ? 263 ASP A CA  1 
ATOM   1339 C  C   . ASP A 1 176 ? 13.601 -0.387  9.452   1.00 3.95   ? 263 ASP A C   1 
ATOM   1340 O  O   . ASP A 1 176 ? 14.379 -0.703  8.573   1.00 9.77   ? 263 ASP A O   1 
ATOM   1341 C  CB  . ASP A 1 176 ? 11.999 -2.019  8.554   1.00 1.69   ? 263 ASP A CB  1 
ATOM   1342 C  CG  . ASP A 1 176 ? 11.084 -1.103  7.856   1.00 18.70  ? 263 ASP A CG  1 
ATOM   1343 O  OD1 . ASP A 1 176 ? 10.288 -0.496  8.516   1.00 25.13  ? 263 ASP A OD1 1 
ATOM   1344 O  OD2 . ASP A 1 176 ? 11.191 -1.056  6.526   1.00 25.21  ? 263 ASP A OD2 1 
ATOM   1345 N  N   . GLN A 1 177 ? 13.609 0.763   10.104  1.00 1.00   ? 264 GLN A N   1 
ATOM   1346 C  CA  . GLN A 1 177 ? 14.571 1.800   9.785   1.00 1.00   ? 264 GLN A CA  1 
ATOM   1347 C  C   . GLN A 1 177 ? 15.127 2.487   11.014  1.00 1.00   ? 264 GLN A C   1 
ATOM   1348 O  O   . GLN A 1 177 ? 15.916 3.411   10.910  1.00 1.00   ? 264 GLN A O   1 
ATOM   1349 C  CB  . GLN A 1 177 ? 13.877 2.869   8.905   1.00 2.38   ? 264 GLN A CB  1 
ATOM   1350 C  CG  . GLN A 1 177 ? 13.284 2.325   7.570   1.00 6.73   ? 264 GLN A CG  1 
ATOM   1351 C  CD  . GLN A 1 177 ? 12.640 3.405   6.673   1.00 9.35   ? 264 GLN A CD  1 
ATOM   1352 O  OE1 . GLN A 1 177 ? 12.321 4.509   7.168   1.00 10.41  ? 264 GLN A OE1 1 
ATOM   1353 N  NE2 . GLN A 1 177 ? 12.431 3.104   5.360   1.00 6.24   ? 264 GLN A NE2 1 
ATOM   1354 N  N   . TYR A 1 178 ? 14.706 2.036   12.169  1.00 1.00   ? 265 TYR A N   1 
ATOM   1355 C  CA  . TYR A 1 178 ? 15.142 2.622   13.377  1.00 1.00   ? 265 TYR A CA  1 
ATOM   1356 C  C   . TYR A 1 178 ? 16.604 2.639   13.490  1.00 8.14   ? 265 TYR A C   1 
ATOM   1357 O  O   . TYR A 1 178 ? 17.173 3.701   13.641  1.00 14.06  ? 265 TYR A O   1 
ATOM   1358 C  CB  . TYR A 1 178 ? 14.760 1.722   14.480  1.00 1.00   ? 265 TYR A CB  1 
ATOM   1359 C  CG  . TYR A 1 178 ? 14.865 2.309   15.826  1.00 1.00   ? 265 TYR A CG  1 
ATOM   1360 C  CD1 . TYR A 1 178 ? 14.181 3.457   16.228  1.00 1.00   ? 265 TYR A CD1 1 
ATOM   1361 C  CD2 . TYR A 1 178 ? 15.584 1.602   16.761  1.00 1.00   ? 265 TYR A CD2 1 
ATOM   1362 C  CE1 . TYR A 1 178 ? 14.283 3.934   17.528  1.00 1.00   ? 265 TYR A CE1 1 
ATOM   1363 C  CE2 . TYR A 1 178 ? 15.691 2.058   18.071  1.00 1.00   ? 265 TYR A CE2 1 
ATOM   1364 C  CZ  . TYR A 1 178 ? 15.048 3.225   18.460  1.00 1.97   ? 265 TYR A CZ  1 
ATOM   1365 O  OH  . TYR A 1 178 ? 15.185 3.615   19.790  1.00 1.68   ? 265 TYR A OH  1 
ATOM   1366 N  N   . TYR A 1 179 ? 17.207 1.461   13.412  1.00 16.58  ? 266 TYR A N   1 
ATOM   1367 C  CA  . TYR A 1 179 ? 18.674 1.341   13.545  1.00 15.64  ? 266 TYR A CA  1 
ATOM   1368 C  C   . TYR A 1 179 ? 19.513 2.292   12.702  1.00 10.30  ? 266 TYR A C   1 
ATOM   1369 O  O   . TYR A 1 179 ? 20.399 2.980   13.227  1.00 5.01   ? 266 TYR A O   1 
ATOM   1370 C  CB  . TYR A 1 179 ? 19.258 -0.065  13.879  1.00 8.12   ? 266 TYR A CB  1 
ATOM   1371 C  CG  . TYR A 1 179 ? 18.712 -0.561  15.192  1.00 1.00   ? 266 TYR A CG  1 
ATOM   1372 C  CD1 . TYR A 1 179 ? 19.173 0.007   16.375  1.00 1.00   ? 266 TYR A CD1 1 
ATOM   1373 C  CD2 . TYR A 1 179 ? 17.704 -1.527  15.241  1.00 1.00   ? 266 TYR A CD2 1 
ATOM   1374 C  CE1 . TYR A 1 179 ? 18.670 -0.402  17.613  1.00 3.33   ? 266 TYR A CE1 1 
ATOM   1375 C  CE2 . TYR A 1 179 ? 17.190 -1.957  16.463  1.00 1.00   ? 266 TYR A CE2 1 
ATOM   1376 C  CZ  . TYR A 1 179 ? 17.680 -1.389  17.642  1.00 9.93   ? 266 TYR A CZ  1 
ATOM   1377 O  OH  . TYR A 1 179 ? 17.180 -1.788  18.856  1.00 19.92  ? 266 TYR A OH  1 
ATOM   1378 N  N   . CYS A 1 180 ? 19.194 2.334   11.405  1.00 7.06   ? 267 CYS A N   1 
ATOM   1379 C  CA  . CYS A 1 180 ? 19.899 3.219   10.530  1.00 3.27   ? 267 CYS A CA  1 
ATOM   1380 C  C   . CYS A 1 180 ? 19.797 4.626   11.067  1.00 8.88   ? 267 CYS A C   1 
ATOM   1381 O  O   . CYS A 1 180 ? 20.795 5.320   11.105  1.00 18.90  ? 267 CYS A O   1 
ATOM   1382 C  CB  . CYS A 1 180 ? 19.261 3.278   9.163   1.00 2.28   ? 267 CYS A CB  1 
ATOM   1383 S  SG  . CYS A 1 180 ? 19.996 2.195   7.987   1.00 5.38   ? 267 CYS A SG  1 
ATOM   1384 N  N   . GLY A 1 181 ? 18.590 5.044   11.472  1.00 5.61   ? 268 GLY A N   1 
ATOM   1385 C  CA  . GLY A 1 181 ? 18.379 6.377   12.015  1.00 1.29   ? 268 GLY A CA  1 
ATOM   1386 C  C   . GLY A 1 181 ? 19.059 6.500   13.395  1.00 6.44   ? 268 GLY A C   1 
ATOM   1387 O  O   . GLY A 1 181 ? 19.617 7.549   13.729  1.00 6.99   ? 268 GLY A O   1 
ATOM   1388 N  N   . VAL A 1 182 ? 19.049 5.441   14.227  1.00 2.08   ? 269 VAL A N   1 
ATOM   1389 C  CA  . VAL A 1 182 ? 19.705 5.586   15.519  1.00 6.38   ? 269 VAL A CA  1 
ATOM   1390 C  C   . VAL A 1 182 ? 21.188 5.956   15.390  1.00 9.99   ? 269 VAL A C   1 
ATOM   1391 O  O   . VAL A 1 182 ? 21.851 6.670   16.218  1.00 1.88   ? 269 VAL A O   1 
ATOM   1392 C  CB  . VAL A 1 182 ? 19.566 4.352   16.351  1.00 2.74   ? 269 VAL A CB  1 
ATOM   1393 C  CG1 . VAL A 1 182 ? 20.450 4.593   17.565  1.00 9.51   ? 269 VAL A CG1 1 
ATOM   1394 C  CG2 . VAL A 1 182 ? 18.125 4.280   16.823  1.00 1.43   ? 269 VAL A CG2 1 
ATOM   1395 N  N   . LEU A 1 183 ? 21.671 5.424   14.272  1.00 10.68  ? 270 LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 183 ? 23.044 5.600   13.879  1.00 12.08  ? 270 LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 183 ? 23.261 7.043   13.500  1.00 8.18   ? 270 LEU A C   1 
ATOM   1398 O  O   . LEU A 1 183 ? 24.057 7.765   14.099  1.00 6.92   ? 270 LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 183 ? 23.397 4.610   12.746  1.00 10.65  ? 270 LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 183 ? 24.774 4.810   12.121  1.00 13.35  ? 270 LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 183 ? 25.840 4.633   13.198  1.00 14.53  ? 270 LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 183 ? 25.000 3.856   10.937  1.00 1.00   ? 270 LEU A CD2 1 
ATOM   1403 N  N   . TYR A 1 184 ? 22.479 7.425   12.508  1.00 8.15   ? 271 TYR A N   1 
ATOM   1404 C  CA  . TYR A 1 184 ? 22.493 8.743   11.941  1.00 10.70  ? 271 TYR A CA  1 
ATOM   1405 C  C   . TYR A 1 184 ? 22.237 9.853   12.881  1.00 8.13   ? 271 TYR A C   1 
ATOM   1406 O  O   . TYR A 1 184 ? 22.812 10.884  12.707  1.00 15.16  ? 271 TYR A O   1 
ATOM   1407 C  CB  . TYR A 1 184 ? 21.582 8.847   10.757  1.00 16.68  ? 271 TYR A CB  1 
ATOM   1408 C  CG  . TYR A 1 184 ? 21.461 10.215  10.183  1.00 24.08  ? 271 TYR A CG  1 
ATOM   1409 C  CD1 . TYR A 1 184 ? 22.531 10.827  9.538   1.00 28.44  ? 271 TYR A CD1 1 
ATOM   1410 C  CD2 . TYR A 1 184 ? 20.232 10.874  10.226  1.00 29.76  ? 271 TYR A CD2 1 
ATOM   1411 C  CE1 . TYR A 1 184 ? 22.383 12.090  8.969   1.00 33.49  ? 271 TYR A CE1 1 
ATOM   1412 C  CE2 . TYR A 1 184 ? 20.072 12.136  9.662   1.00 34.85  ? 271 TYR A CE2 1 
ATOM   1413 C  CZ  . TYR A 1 184 ? 21.152 12.743  9.028   1.00 38.51  ? 271 TYR A CZ  1 
ATOM   1414 O  OH  . TYR A 1 184 ? 20.993 13.994  8.460   1.00 44.46  ? 271 TYR A OH  1 
ATOM   1415 N  N   . PHE A 1 185 ? 21.391 9.683   13.849  1.00 1.91   ? 272 PHE A N   1 
ATOM   1416 C  CA  . PHE A 1 185 ? 21.202 10.779  14.745  1.00 5.95   ? 272 PHE A CA  1 
ATOM   1417 C  C   . PHE A 1 185 ? 22.177 10.663  15.878  1.00 10.37  ? 272 PHE A C   1 
ATOM   1418 O  O   . PHE A 1 185 ? 22.137 11.485  16.814  1.00 10.68  ? 272 PHE A O   1 
ATOM   1419 C  CB  . PHE A 1 185 ? 19.799 10.945  15.286  1.00 16.52  ? 272 PHE A CB  1 
ATOM   1420 C  CG  . PHE A 1 185 ? 18.824 11.346  14.238  1.00 20.09  ? 272 PHE A CG  1 
ATOM   1421 C  CD1 . PHE A 1 185 ? 18.376 10.430  13.295  1.00 15.80  ? 272 PHE A CD1 1 
ATOM   1422 C  CD2 . PHE A 1 185 ? 18.342 12.653  14.206  1.00 27.75  ? 272 PHE A CD2 1 
ATOM   1423 C  CE1 . PHE A 1 185 ? 17.457 10.802  12.319  1.00 19.37  ? 272 PHE A CE1 1 
ATOM   1424 C  CE2 . PHE A 1 185 ? 17.416 13.038  13.241  1.00 29.43  ? 272 PHE A CE2 1 
ATOM   1425 C  CZ  . PHE A 1 185 ? 16.974 12.107  12.299  1.00 25.95  ? 272 PHE A CZ  1 
ATOM   1426 N  N   . THR A 1 186 ? 22.990 9.596   15.785  1.00 8.10   ? 273 THR A N   1 
ATOM   1427 C  CA  . THR A 1 186 ? 23.995 9.417   16.757  1.00 8.41   ? 273 THR A CA  1 
ATOM   1428 C  C   . THR A 1 186 ? 25.141 10.325  16.248  1.00 18.62  ? 273 THR A C   1 
ATOM   1429 O  O   . THR A 1 186 ? 25.594 11.204  16.991  1.00 22.81  ? 273 THR A O   1 
ATOM   1430 C  CB  . THR A 1 186 ? 24.352 7.970   17.133  1.00 14.27  ? 273 THR A CB  1 
ATOM   1431 O  OG1 . THR A 1 186 ? 23.676 7.537   18.316  1.00 10.95  ? 273 THR A OG1 1 
ATOM   1432 C  CG2 . THR A 1 186 ? 25.858 7.891   17.328  1.00 19.07  ? 273 THR A CG2 1 
ATOM   1433 N  N   . GLY A 1 187 ? 25.582 10.178  14.963  1.00 20.54  ? 274 GLY A N   1 
ATOM   1434 C  CA  . GLY A 1 187 ? 26.663 11.011  14.418  1.00 13.15  ? 274 GLY A CA  1 
ATOM   1435 C  C   . GLY A 1 187 ? 27.996 10.568  15.003  1.00 13.23  ? 274 GLY A C   1 
ATOM   1436 O  O   . GLY A 1 187 ? 28.188 9.410   15.397  1.00 20.81  ? 274 GLY A O   1 
ATOM   1437 N  N   . SER A 1 188 ? 28.985 11.437  15.102  1.00 12.56  ? 275 SER A N   1 
ATOM   1438 C  CA  . SER A 1 188 ? 29.092 12.822  14.750  1.00 11.63  ? 275 SER A CA  1 
ATOM   1439 C  C   . SER A 1 188 ? 28.893 12.991  13.266  1.00 10.58  ? 275 SER A C   1 
ATOM   1440 O  O   . SER A 1 188 ? 28.817 11.999  12.532  1.00 9.35   ? 275 SER A O   1 
ATOM   1441 C  CB  . SER A 1 188 ? 30.520 13.181  15.107  1.00 15.64  ? 275 SER A CB  1 
ATOM   1442 O  OG  . SER A 1 188 ? 31.434 12.358  14.370  1.00 16.55  ? 275 SER A OG  1 
ATOM   1443 N  N   . ASP A 1 189 ? 28.792 14.227  12.827  1.00 12.68  ? 276 ASP A N   1 
ATOM   1444 C  CA  . ASP A 1 189 ? 28.600 14.444  11.404  1.00 23.33  ? 276 ASP A CA  1 
ATOM   1445 C  C   . ASP A 1 189 ? 29.728 13.771  10.631  1.00 23.00  ? 276 ASP A C   1 
ATOM   1446 O  O   . ASP A 1 189 ? 29.509 13.147  9.592   1.00 24.44  ? 276 ASP A O   1 
ATOM   1447 C  CB  . ASP A 1 189 ? 28.542 15.954  11.052  1.00 34.93  ? 276 ASP A CB  1 
ATOM   1448 C  CG  . ASP A 1 189 ? 27.483 16.743  11.816  1.00 45.70  ? 276 ASP A CG  1 
ATOM   1449 O  OD1 . ASP A 1 189 ? 27.615 17.099  12.996  1.00 46.43  ? 276 ASP A OD1 1 
ATOM   1450 O  OD2 . ASP A 1 189 ? 26.455 17.098  11.056  1.00 48.37  ? 276 ASP A OD2 1 
ATOM   1451 N  N   . ILE A 1 190 ? 30.939 13.890  11.185  1.00 23.37  ? 277 ILE A N   1 
ATOM   1452 C  CA  . ILE A 1 190 ? 32.140 13.313  10.587  1.00 28.07  ? 277 ILE A CA  1 
ATOM   1453 C  C   . ILE A 1 190 ? 32.077 11.805  10.451  1.00 23.71  ? 277 ILE A C   1 
ATOM   1454 O  O   . ILE A 1 190 ? 32.288 11.246  9.368   1.00 16.31  ? 277 ILE A O   1 
ATOM   1455 C  CB  . ILE A 1 190 ? 33.454 13.764  11.237  1.00 34.75  ? 277 ILE A CB  1 
ATOM   1456 C  CG1 . ILE A 1 190 ? 33.287 14.197  12.699  1.00 38.93  ? 277 ILE A CG1 1 
ATOM   1457 C  CG2 . ILE A 1 190 ? 34.036 14.913  10.431  1.00 36.18  ? 277 ILE A CG2 1 
ATOM   1458 C  CD1 . ILE A 1 190 ? 32.950 15.691  12.866  1.00 42.09  ? 277 ILE A CD1 1 
ATOM   1459 N  N   . PHE A 1 191 ? 31.769 11.175  11.582  1.00 22.28  ? 278 PHE A N   1 
ATOM   1460 C  CA  . PHE A 1 191 ? 31.672 9.763   11.601  1.00 13.79  ? 278 PHE A CA  1 
ATOM   1461 C  C   . PHE A 1 191 ? 30.705 9.292   10.554  1.00 11.61  ? 278 PHE A C   1 
ATOM   1462 O  O   . PHE A 1 191 ? 30.925 8.286   9.889   1.00 18.40  ? 278 PHE A O   1 
ATOM   1463 C  CB  . PHE A 1 191 ? 31.332 9.218   12.978  1.00 19.09  ? 278 PHE A CB  1 
ATOM   1464 C  CG  . PHE A 1 191 ? 31.164 7.717   12.863  1.00 30.26  ? 278 PHE A CG  1 
ATOM   1465 C  CD1 . PHE A 1 191 ? 32.262 6.856   12.856  1.00 28.64  ? 278 PHE A CD1 1 
ATOM   1466 C  CD2 . PHE A 1 191 ? 29.887 7.166   12.745  1.00 34.50  ? 278 PHE A CD2 1 
ATOM   1467 C  CE1 . PHE A 1 191 ? 32.085 5.478   12.748  1.00 29.31  ? 278 PHE A CE1 1 
ATOM   1468 C  CE2 . PHE A 1 191 ? 29.682 5.794   12.632  1.00 33.04  ? 278 PHE A CE2 1 
ATOM   1469 C  CZ  . PHE A 1 191 ? 30.797 4.957   12.636  1.00 32.72  ? 278 PHE A CZ  1 
ATOM   1470 N  N   . ASN A 1 192 ? 29.627 10.019  10.369  1.00 5.69   ? 279 ASN A N   1 
ATOM   1471 C  CA  . ASN A 1 192 ? 28.742 9.513   9.355   1.00 7.38   ? 279 ASN A CA  1 
ATOM   1472 C  C   . ASN A 1 192 ? 29.340 9.563   7.987   1.00 7.16   ? 279 ASN A C   1 
ATOM   1473 O  O   . ASN A 1 192 ? 29.100 8.709   7.150   1.00 5.32   ? 279 ASN A O   1 
ATOM   1474 C  CB  . ASN A 1 192 ? 27.421 10.267  9.292   1.00 13.79  ? 279 ASN A CB  1 
ATOM   1475 C  CG  . ASN A 1 192 ? 26.539 9.928   10.441  1.00 21.95  ? 279 ASN A CG  1 
ATOM   1476 O  OD1 . ASN A 1 192 ? 26.114 10.802  11.228  1.00 26.96  ? 279 ASN A OD1 1 
ATOM   1477 N  ND2 . ASN A 1 192 ? 26.270 8.633   10.503  1.00 22.97  ? 279 ASN A ND2 1 
ATOM   1478 N  N   . LYS A 1 193 ? 30.102 10.606  7.775   1.00 15.56  ? 280 LYS A N   1 
ATOM   1479 C  CA  . LYS A 1 193 ? 30.711 10.817  6.488   1.00 21.25  ? 280 LYS A CA  1 
ATOM   1480 C  C   . LYS A 1 193 ? 31.666 9.729   6.124   1.00 11.95  ? 280 LYS A C   1 
ATOM   1481 O  O   . LYS A 1 193 ? 31.687 9.206   5.012   1.00 1.00   ? 280 LYS A O   1 
ATOM   1482 C  CB  . LYS A 1 193 ? 31.396 12.174  6.448   1.00 25.81  ? 280 LYS A CB  1 
ATOM   1483 N  N   . ASN A 1 194 ? 32.442 9.421   7.116   1.00 15.79  ? 281 ASN A N   1 
ATOM   1484 C  CA  . ASN A 1 194 ? 33.453 8.406   6.965   1.00 28.27  ? 281 ASN A CA  1 
ATOM   1485 C  C   . ASN A 1 194 ? 32.845 7.030   6.830   1.00 25.98  ? 281 ASN A C   1 
ATOM   1486 O  O   . ASN A 1 194 ? 33.310 6.198   6.035   1.00 23.79  ? 281 ASN A O   1 
ATOM   1487 C  CB  . ASN A 1 194 ? 34.552 8.487   8.080   1.00 31.46  ? 281 ASN A CB  1 
ATOM   1488 C  CG  . ASN A 1 194 ? 35.275 9.853   8.219   1.00 25.77  ? 281 ASN A CG  1 
ATOM   1489 O  OD1 . ASN A 1 194 ? 35.580 10.309  9.357   1.00 19.61  ? 281 ASN A OD1 1 
ATOM   1490 N  ND2 . ASN A 1 194 ? 35.569 10.485  7.070   1.00 19.28  ? 281 ASN A ND2 1 
ATOM   1491 N  N   . MET A 1 195 ? 31.801 6.806   7.631   1.00 23.62  ? 282 MET A N   1 
ATOM   1492 C  CA  . MET A 1 195 ? 31.168 5.523   7.567   1.00 18.79  ? 282 MET A CA  1 
ATOM   1493 C  C   . MET A 1 195 ? 30.409 5.357   6.283   1.00 17.82  ? 282 MET A C   1 
ATOM   1494 O  O   . MET A 1 195 ? 30.432 4.341   5.613   1.00 17.63  ? 282 MET A O   1 
ATOM   1495 C  CB  . MET A 1 195 ? 30.228 5.250   8.702   1.00 17.44  ? 282 MET A CB  1 
ATOM   1496 C  CG  . MET A 1 195 ? 29.550 3.967   8.305   1.00 20.54  ? 282 MET A CG  1 
ATOM   1497 S  SD  . MET A 1 195 ? 28.635 3.391   9.703   1.00 31.26  ? 282 MET A SD  1 
ATOM   1498 C  CE  . MET A 1 195 ? 27.630 4.886   9.963   1.00 36.25  ? 282 MET A CE  1 
ATOM   1499 N  N   . ARG A 1 196 ? 29.728 6.404   5.945   1.00 20.72  ? 283 ARG A N   1 
ATOM   1500 C  CA  . ARG A 1 196 ? 28.977 6.396   4.747   1.00 24.79  ? 283 ARG A CA  1 
ATOM   1501 C  C   . ARG A 1 196 ? 29.978 6.259   3.628   1.00 21.44  ? 283 ARG A C   1 
ATOM   1502 O  O   . ARG A 1 196 ? 29.694 5.639   2.616   1.00 20.68  ? 283 ARG A O   1 
ATOM   1503 C  CB  . ARG A 1 196 ? 28.257 7.730   4.681   1.00 37.55  ? 283 ARG A CB  1 
ATOM   1504 C  CG  . ARG A 1 196 ? 26.791 7.661   4.264   1.00 49.98  ? 283 ARG A CG  1 
ATOM   1505 C  CD  . ARG A 1 196 ? 26.082 8.937   4.726   1.00 61.05  ? 283 ARG A CD  1 
ATOM   1506 N  NE  . ARG A 1 196 ? 24.622 9.052   4.548   1.00 67.20  ? 283 ARG A NE  1 
ATOM   1507 C  CZ  . ARG A 1 196 ? 23.981 10.192  4.869   1.00 71.90  ? 283 ARG A CZ  1 
ATOM   1508 N  NH1 . ARG A 1 196 ? 24.647 11.253  5.351   1.00 74.90  ? 283 ARG A NH1 1 
ATOM   1509 N  NH2 . ARG A 1 196 ? 22.660 10.297  4.704   1.00 71.19  ? 283 ARG A NH2 1 
ATOM   1510 N  N   . ALA A 1 197 ? 31.167 6.848   3.839   1.00 29.89  ? 284 ALA A N   1 
ATOM   1511 C  CA  . ALA A 1 197 ? 32.282 6.835   2.869   1.00 35.40  ? 284 ALA A CA  1 
ATOM   1512 C  C   . ALA A 1 197 ? 32.933 5.469   2.703   1.00 34.94  ? 284 ALA A C   1 
ATOM   1513 O  O   . ALA A 1 197 ? 33.354 5.058   1.619   1.00 33.40  ? 284 ALA A O   1 
ATOM   1514 C  CB  . ALA A 1 197 ? 33.361 7.833   3.254   1.00 37.85  ? 284 ALA A CB  1 
ATOM   1515 N  N   . HIS A 1 198 ? 33.025 4.764   3.812   1.00 35.89  ? 285 HIS A N   1 
ATOM   1516 C  CA  . HIS A 1 198 ? 33.609 3.457   3.769   1.00 34.76  ? 285 HIS A CA  1 
ATOM   1517 C  C   . HIS A 1 198 ? 32.670 2.534   3.037   1.00 25.21  ? 285 HIS A C   1 
ATOM   1518 O  O   . HIS A 1 198 ? 33.036 1.920   2.057   1.00 22.40  ? 285 HIS A O   1 
ATOM   1519 C  CB  . HIS A 1 198 ? 33.810 2.965   5.194   1.00 40.23  ? 285 HIS A CB  1 
ATOM   1520 C  CG  . HIS A 1 198 ? 34.257 1.555   5.263   1.00 46.80  ? 285 HIS A CG  1 
ATOM   1521 N  ND1 . HIS A 1 198 ? 35.580 1.203   5.066   1.00 50.91  ? 285 HIS A ND1 1 
ATOM   1522 C  CD2 . HIS A 1 198 ? 33.551 0.431   5.540   1.00 50.81  ? 285 HIS A CD2 1 
ATOM   1523 C  CE1 . HIS A 1 198 ? 35.651 -0.119  5.217   1.00 52.41  ? 285 HIS A CE1 1 
ATOM   1524 N  NE2 . HIS A 1 198 ? 34.450 -0.614  5.500   1.00 51.64  ? 285 HIS A NE2 1 
ATOM   1525 N  N   . ALA A 1 199 ? 31.436 2.482   3.522   1.00 22.58  ? 286 ALA A N   1 
ATOM   1526 C  CA  . ALA A 1 199 ? 30.413 1.637   2.960   1.00 17.48  ? 286 ALA A CA  1 
ATOM   1527 C  C   . ALA A 1 199 ? 30.310 1.729   1.498   1.00 11.68  ? 286 ALA A C   1 
ATOM   1528 O  O   . ALA A 1 199 ? 30.050 0.770   0.827   1.00 9.83   ? 286 ALA A O   1 
ATOM   1529 C  CB  . ALA A 1 199 ? 29.054 2.038   3.456   1.00 23.88  ? 286 ALA A CB  1 
ATOM   1530 N  N   . LEU A 1 200 ? 30.494 2.898   1.010   1.00 16.07  ? 287 LEU A N   1 
ATOM   1531 C  CA  . LEU A 1 200 ? 30.373 3.054   -0.416  1.00 27.16  ? 287 LEU A CA  1 
ATOM   1532 C  C   . LEU A 1 200 ? 31.297 2.180   -1.234  1.00 29.99  ? 287 LEU A C   1 
ATOM   1533 O  O   . LEU A 1 200 ? 30.893 1.721   -2.306  1.00 24.39  ? 287 LEU A O   1 
ATOM   1534 C  CB  . LEU A 1 200 ? 30.444 4.551   -0.758  1.00 26.23  ? 287 LEU A CB  1 
ATOM   1535 C  CG  . LEU A 1 200 ? 30.084 4.997   -2.159  1.00 24.26  ? 287 LEU A CG  1 
ATOM   1536 C  CD1 . LEU A 1 200 ? 28.901 4.209   -2.714  1.00 24.51  ? 287 LEU A CD1 1 
ATOM   1537 C  CD2 . LEU A 1 200 ? 29.663 6.448   -1.976  1.00 23.54  ? 287 LEU A CD2 1 
ATOM   1538 N  N   . GLU A 1 201 ? 32.506 1.964   -0.690  1.00 36.58  ? 288 GLU A N   1 
ATOM   1539 C  CA  . GLU A 1 201 ? 33.597 1.180   -1.280  1.00 42.43  ? 288 GLU A CA  1 
ATOM   1540 C  C   . GLU A 1 201 ? 33.349 -0.315  -1.378  1.00 41.52  ? 288 GLU A C   1 
ATOM   1541 O  O   . GLU A 1 201 ? 33.765 -0.961  -2.347  1.00 40.49  ? 288 GLU A O   1 
ATOM   1542 C  CB  . GLU A 1 201 ? 34.792 1.398   -0.379  1.00 51.64  ? 288 GLU A CB  1 
ATOM   1543 C  CG  . GLU A 1 201 ? 36.111 1.674   -1.079  1.00 61.31  ? 288 GLU A CG  1 
ATOM   1544 C  CD  . GLU A 1 201 ? 36.782 2.746   -0.274  1.00 70.81  ? 288 GLU A CD  1 
ATOM   1545 O  OE1 . GLU A 1 201 ? 36.459 3.907   -0.443  1.00 73.22  ? 288 GLU A OE1 1 
ATOM   1546 O  OE2 . GLU A 1 201 ? 37.564 2.312   0.715   1.00 74.32  ? 288 GLU A OE2 1 
ATOM   1547 N  N   . LYS A 1 202 ? 32.679 -0.854  -0.350  1.00 41.40  ? 289 LYS A N   1 
ATOM   1548 C  CA  . LYS A 1 202 ? 32.342 -2.263  -0.271  1.00 36.87  ? 289 LYS A CA  1 
ATOM   1549 C  C   . LYS A 1 202 ? 31.213 -2.652  -1.189  1.00 35.19  ? 289 LYS A C   1 
ATOM   1550 O  O   . LYS A 1 202 ? 31.001 -3.830  -1.468  1.00 35.62  ? 289 LYS A O   1 
ATOM   1551 C  CB  . LYS A 1 202 ? 32.177 -2.762  1.135   1.00 42.34  ? 289 LYS A CB  1 
ATOM   1552 C  CG  . LYS A 1 202 ? 33.468 -2.517  1.909   1.00 50.14  ? 289 LYS A CG  1 
ATOM   1553 C  CD  . LYS A 1 202 ? 33.685 -3.449  3.099   1.00 56.76  ? 289 LYS A CD  1 
ATOM   1554 C  CE  . LYS A 1 202 ? 35.129 -3.466  3.606   1.00 60.02  ? 289 LYS A CE  1 
ATOM   1555 N  NZ  . LYS A 1 202 ? 35.369 -4.327  4.787   1.00 60.91  ? 289 LYS A NZ  1 
ATOM   1556 N  N   . GLY A 1 203 ? 30.537 -1.620  -1.691  1.00 38.28  ? 290 GLY A N   1 
ATOM   1557 C  CA  . GLY A 1 203 ? 29.396 -1.699  -2.612  1.00 40.02  ? 290 GLY A CA  1 
ATOM   1558 C  C   . GLY A 1 203 ? 28.067 -1.457  -1.882  1.00 42.56  ? 290 GLY A C   1 
ATOM   1559 O  O   . GLY A 1 203 ? 27.077 -2.173  -2.090  1.00 42.65  ? 290 GLY A O   1 
ATOM   1560 N  N   . PHE A 1 204 ? 28.079 -0.431  -1.014  1.00 40.00  ? 291 PHE A N   1 
ATOM   1561 C  CA  . PHE A 1 204 ? 26.941 -0.070  -0.205  1.00 37.44  ? 291 PHE A CA  1 
ATOM   1562 C  C   . PHE A 1 204 ? 26.782 1.420   -0.012  1.00 34.73  ? 291 PHE A C   1 
ATOM   1563 O  O   . PHE A 1 204 ? 27.751 2.159   -0.069  1.00 30.43  ? 291 PHE A O   1 
ATOM   1564 C  CB  . PHE A 1 204 ? 27.020 -0.732  1.192   1.00 39.29  ? 291 PHE A CB  1 
ATOM   1565 C  CG  . PHE A 1 204 ? 26.861 -2.238  1.172   1.00 40.66  ? 291 PHE A CG  1 
ATOM   1566 C  CD1 . PHE A 1 204 ? 25.608 -2.849  1.152   1.00 38.89  ? 291 PHE A CD1 1 
ATOM   1567 C  CD2 . PHE A 1 204 ? 27.986 -3.063  1.185   1.00 42.27  ? 291 PHE A CD2 1 
ATOM   1568 C  CE1 . PHE A 1 204 ? 25.498 -4.241  1.138   1.00 38.99  ? 291 PHE A CE1 1 
ATOM   1569 C  CE2 . PHE A 1 204 ? 27.890 -4.453  1.167   1.00 40.67  ? 291 PHE A CE2 1 
ATOM   1570 C  CZ  . PHE A 1 204 ? 26.630 -5.050  1.136   1.00 37.56  ? 291 PHE A CZ  1 
ATOM   1571 N  N   . THR A 1 205 ? 25.508 1.771   0.244   1.00 32.99  ? 292 THR A N   1 
ATOM   1572 C  CA  . THR A 1 205 ? 24.969 3.086   0.462   1.00 21.61  ? 292 THR A CA  1 
ATOM   1573 C  C   . THR A 1 205 ? 24.065 3.065   1.670   1.00 22.51  ? 292 THR A C   1 
ATOM   1574 O  O   . THR A 1 205 ? 23.027 2.424   1.692   1.00 26.82  ? 292 THR A O   1 
ATOM   1575 C  CB  . THR A 1 205 ? 24.178 3.513   -0.797  1.00 15.15  ? 292 THR A CB  1 
ATOM   1576 O  OG1 . THR A 1 205 ? 23.563 4.784   -0.673  1.00 18.48  ? 292 THR A OG1 1 
ATOM   1577 C  CG2 . THR A 1 205 ? 23.182 2.448   -1.178  1.00 12.70  ? 292 THR A CG2 1 
ATOM   1578 N  N   . ILE A 1 206 ? 24.523 3.763   2.689   1.00 19.27  ? 293 ILE A N   1 
ATOM   1579 C  CA  . ILE A 1 206 ? 23.845 3.914   3.935   1.00 11.04  ? 293 ILE A CA  1 
ATOM   1580 C  C   . ILE A 1 206 ? 23.339 5.331   4.011   1.00 17.71  ? 293 ILE A C   1 
ATOM   1581 O  O   . ILE A 1 206 ? 24.121 6.261   3.715   1.00 16.43  ? 293 ILE A O   1 
ATOM   1582 C  CB  . ILE A 1 206 ? 24.863 3.731   5.022   1.00 12.00  ? 293 ILE A CB  1 
ATOM   1583 C  CG1 . ILE A 1 206 ? 25.350 2.295   4.940   1.00 18.67  ? 293 ILE A CG1 1 
ATOM   1584 C  CG2 . ILE A 1 206 ? 24.325 4.131   6.404   1.00 3.24   ? 293 ILE A CG2 1 
ATOM   1585 C  CD1 . ILE A 1 206 ? 26.462 1.993   5.924   1.00 23.45  ? 293 ILE A CD1 1 
ATOM   1586 N  N   . ASN A 1 207 ? 22.053 5.466   4.416   1.00 16.27  ? 294 ASN A N   1 
ATOM   1587 C  CA  . ASN A 1 207 ? 21.388 6.747   4.581   1.00 9.00   ? 294 ASN A CA  1 
ATOM   1588 C  C   . ASN A 1 207 ? 20.731 6.721   5.926   1.00 10.15  ? 294 ASN A C   1 
ATOM   1589 O  O   . ASN A 1 207 ? 21.060 5.851   6.719   1.00 12.42  ? 294 ASN A O   1 
ATOM   1590 C  CB  . ASN A 1 207 ? 20.536 7.287   3.424   1.00 1.84   ? 294 ASN A CB  1 
ATOM   1591 C  CG  . ASN A 1 207 ? 19.374 6.375   3.197   1.00 9.56   ? 294 ASN A CG  1 
ATOM   1592 O  OD1 . ASN A 1 207 ? 19.081 5.992   2.039   1.00 13.27  ? 294 ASN A OD1 1 
ATOM   1593 N  ND2 . ASN A 1 207 ? 18.628 6.134   4.280   1.00 6.67   ? 294 ASN A ND2 1 
ATOM   1594 N  N   . GLU A 1 208 ? 19.826 7.637   6.195   1.00 13.17  ? 295 GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 208 ? 19.223 7.621   7.515   1.00 26.60  ? 295 GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 208 ? 18.114 6.607   7.680   1.00 29.53  ? 295 GLU A C   1 
ATOM   1597 O  O   . GLU A 1 208 ? 17.562 6.391   8.758   1.00 28.89  ? 295 GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 208 ? 18.776 9.015   8.001   1.00 33.68  ? 295 GLU A CB  1 
ATOM   1599 C  CG  . GLU A 1 208 ? 17.941 9.752   6.932   1.00 41.62  ? 295 GLU A CG  1 
ATOM   1600 C  CD  . GLU A 1 208 ? 18.889 10.362  5.935   1.00 53.09  ? 295 GLU A CD  1 
ATOM   1601 O  OE1 . GLU A 1 208 ? 19.665 11.206  6.325   1.00 57.96  ? 295 GLU A OE1 1 
ATOM   1602 O  OE2 . GLU A 1 208 ? 18.841 9.923   4.671   1.00 55.10  ? 295 GLU A OE2 1 
ATOM   1603 N  N   . TYR A 1 209 ? 17.765 5.994   6.585   1.00 30.67  ? 296 TYR A N   1 
ATOM   1604 C  CA  . TYR A 1 209 ? 16.696 5.050   6.646   1.00 30.86  ? 296 TYR A CA  1 
ATOM   1605 C  C   . TYR A 1 209 ? 17.125 3.630   6.465   1.00 21.83  ? 296 TYR A C   1 
ATOM   1606 O  O   . TYR A 1 209 ? 16.763 2.744   7.239   1.00 15.12  ? 296 TYR A O   1 
ATOM   1607 C  CB  . TYR A 1 209 ? 15.751 5.400   5.499   1.00 39.69  ? 296 TYR A CB  1 
ATOM   1608 C  CG  . TYR A 1 209 ? 15.276 6.843   5.490   1.00 44.87  ? 296 TYR A CG  1 
ATOM   1609 C  CD1 . TYR A 1 209 ? 14.835 7.464   6.664   1.00 48.06  ? 296 TYR A CD1 1 
ATOM   1610 C  CD2 . TYR A 1 209 ? 15.237 7.556   4.290   1.00 44.28  ? 296 TYR A CD2 1 
ATOM   1611 C  CE1 . TYR A 1 209 ? 14.374 8.781   6.661   1.00 51.78  ? 296 TYR A CE1 1 
ATOM   1612 C  CE2 . TYR A 1 209 ? 14.773 8.870   4.264   1.00 50.02  ? 296 TYR A CE2 1 
ATOM   1613 C  CZ  . TYR A 1 209 ? 14.347 9.476   5.449   1.00 56.52  ? 296 TYR A CZ  1 
ATOM   1614 O  OH  . TYR A 1 209 ? 13.888 10.773  5.419   1.00 62.05  ? 296 TYR A OH  1 
ATOM   1615 N  N   . THR A 1 210 ? 17.901 3.473   5.412   1.00 18.50  ? 297 THR A N   1 
ATOM   1616 C  CA  . THR A 1 210 ? 18.400 2.190   5.055   1.00 18.11  ? 297 THR A CA  1 
ATOM   1617 C  C   . THR A 1 210 ? 19.865 2.223   4.694   1.00 18.09  ? 297 THR A C   1 
ATOM   1618 O  O   . THR A 1 210 ? 20.505 3.261   4.686   1.00 17.36  ? 297 THR A O   1 
ATOM   1619 C  CB  . THR A 1 210 ? 17.698 1.828   3.753   1.00 16.66  ? 297 THR A CB  1 
ATOM   1620 O  OG1 . THR A 1 210 ? 18.197 2.665   2.735   1.00 18.00  ? 297 THR A OG1 1 
ATOM   1621 C  CG2 . THR A 1 210 ? 16.215 2.056   3.911   1.00 14.19  ? 297 THR A CG2 1 
ATOM   1622 N  N   . ILE A 1 211 ? 20.326 1.021   4.368   1.00 22.33  ? 298 ILE A N   1 
ATOM   1623 C  CA  . ILE A 1 211 ? 21.655 0.626   3.914   1.00 17.52  ? 298 ILE A CA  1 
ATOM   1624 C  C   . ILE A 1 211 ? 21.308 -0.251  2.772   1.00 11.51  ? 298 ILE A C   1 
ATOM   1625 O  O   . ILE A 1 211 ? 20.700 -1.283  2.953   1.00 13.98  ? 298 ILE A O   1 
ATOM   1626 C  CB  . ILE A 1 211 ? 22.516 -0.195  4.879   1.00 15.93  ? 298 ILE A CB  1 
ATOM   1627 C  CG1 . ILE A 1 211 ? 23.668 -0.768  4.083   1.00 15.52  ? 298 ILE A CG1 1 
ATOM   1628 C  CG2 . ILE A 1 211 ? 21.767 -1.329  5.572   1.00 8.36   ? 298 ILE A CG2 1 
ATOM   1629 C  CD1 . ILE A 1 211 ? 24.587 -1.612  4.952   1.00 20.27  ? 298 ILE A CD1 1 
ATOM   1630 N  N   . ARG A 1 212 ? 21.626 0.189   1.602   0.50 12.89  ? 299 ARG A N   1 
ATOM   1631 C  CA  . ARG A 1 212 ? 21.291 -0.582  0.453   0.50 14.18  ? 299 ARG A CA  1 
ATOM   1632 C  C   . ARG A 1 212 ? 22.534 -1.001  -0.239  0.50 17.43  ? 299 ARG A C   1 
ATOM   1633 O  O   . ARG A 1 212 ? 23.554 -0.369  -0.128  0.50 17.57  ? 299 ARG A O   1 
ATOM   1634 C  CB  . ARG A 1 212 ? 20.484 0.290   -0.500  0.50 15.29  ? 299 ARG A CB  1 
ATOM   1635 C  CG  . ARG A 1 212 ? 19.228 0.893   0.125   0.50 14.73  ? 299 ARG A CG  1 
ATOM   1636 C  CD  . ARG A 1 212 ? 18.397 1.651   -0.896  0.50 15.38  ? 299 ARG A CD  1 
ATOM   1637 N  NE  . ARG A 1 212 ? 18.768 3.048   -1.127  0.50 16.11  ? 299 ARG A NE  1 
ATOM   1638 C  CZ  . ARG A 1 212 ? 19.355 3.872   -0.260  0.50 13.93  ? 299 ARG A CZ  1 
ATOM   1639 N  NH1 . ARG A 1 212 ? 19.686 3.508   0.985   0.50 8.67   ? 299 ARG A NH1 1 
ATOM   1640 N  NH2 . ARG A 1 212 ? 19.604 5.120   -0.675  0.50 13.78  ? 299 ARG A NH2 1 
ATOM   1641 N  N   . PRO A 1 213 ? 22.445 -2.065  -0.971  1.00 29.19  ? 300 PRO A N   1 
ATOM   1642 C  CA  . PRO A 1 213 ? 23.585 -2.527  -1.724  1.00 36.37  ? 300 PRO A CA  1 
ATOM   1643 C  C   . PRO A 1 213 ? 23.552 -1.761  -3.026  1.00 43.99  ? 300 PRO A C   1 
ATOM   1644 O  O   . PRO A 1 213 ? 22.497 -1.556  -3.604  1.00 44.11  ? 300 PRO A O   1 
ATOM   1645 C  CB  . PRO A 1 213 ? 23.351 -3.997  -2.069  1.00 31.81  ? 300 PRO A CB  1 
ATOM   1646 C  CG  . PRO A 1 213 ? 21.957 -4.349  -1.571  1.00 31.91  ? 300 PRO A CG  1 
ATOM   1647 C  CD  . PRO A 1 213 ? 21.480 -3.164  -0.726  1.00 33.90  ? 300 PRO A CD  1 
ATOM   1648 N  N   . LEU A 1 214 ? 24.700 -1.342  -3.492  1.00 51.44  ? 301 LEU A N   1 
ATOM   1649 C  CA  . LEU A 1 214 ? 24.771 -0.603  -4.717  1.00 55.47  ? 301 LEU A CA  1 
ATOM   1650 C  C   . LEU A 1 214 ? 24.744 -1.548  -5.903  1.00 63.05  ? 301 LEU A C   1 
ATOM   1651 O  O   . LEU A 1 214 ? 23.997 -2.529  -5.936  1.00 65.94  ? 301 LEU A O   1 
ATOM   1652 C  CB  . LEU A 1 214 ? 26.069 0.195   -4.712  1.00 56.08  ? 301 LEU A CB  1 
ATOM   1653 C  CG  . LEU A 1 214 ? 25.798 1.631   -5.089  1.00 59.45  ? 301 LEU A CG  1 
ATOM   1654 C  CD1 . LEU A 1 214 ? 25.194 2.332   -3.879  1.00 58.71  ? 301 LEU A CD1 1 
ATOM   1655 C  CD2 . LEU A 1 214 ? 27.079 2.315   -5.549  1.00 62.07  ? 301 LEU A CD2 1 
ATOM   1656 N  N   . GLY A 1 215 ? 25.583 -1.241  -6.885  1.00 68.69  ? 302 GLY A N   1 
ATOM   1657 C  CA  . GLY A 1 215 ? 25.699 -2.034  -8.098  1.00 74.22  ? 302 GLY A CA  1 
ATOM   1658 C  C   . GLY A 1 215 ? 26.446 -1.262  -9.182  1.00 78.93  ? 302 GLY A C   1 
ATOM   1659 O  O   . GLY A 1 215 ? 27.380 -0.490  -8.894  1.00 77.69  ? 302 GLY A O   1 
ATOM   1660 N  N   . VAL A 1 216 ? 26.024 -1.503  -10.436 1.00 82.68  ? 303 VAL A N   1 
ATOM   1661 C  CA  . VAL A 1 216 ? 26.593 -0.842  -11.600 1.00 83.33  ? 303 VAL A CA  1 
ATOM   1662 C  C   . VAL A 1 216 ? 25.811 0.432   -11.887 1.00 85.01  ? 303 VAL A C   1 
ATOM   1663 O  O   . VAL A 1 216 ? 24.567 0.457   -11.851 1.00 81.77  ? 303 VAL A O   1 
ATOM   1664 C  CB  . VAL A 1 216 ? 26.681 -1.746  -12.821 1.00 82.05  ? 303 VAL A CB  1 
ATOM   1665 N  N   . THR A 1 217 ? 26.582 1.490   -12.162 1.00 88.86  ? 304 THR A N   1 
ATOM   1666 C  CA  . THR A 1 217 ? 26.055 2.816   -12.458 1.00 90.46  ? 304 THR A CA  1 
ATOM   1667 C  C   . THR A 1 217 ? 25.306 3.401   -11.268 1.00 88.62  ? 304 THR A C   1 
ATOM   1668 O  O   . THR A 1 217 ? 24.440 4.267   -11.411 1.00 87.45  ? 304 THR A O   1 
ATOM   1669 C  CB  . THR A 1 217 ? 25.141 2.787   -13.669 1.00 92.28  ? 304 THR A CB  1 
ATOM   1670 N  N   . GLY A 1 218 ? 25.638 2.895   -10.080 1.00 87.08  ? 305 GLY A N   1 
ATOM   1671 C  CA  . GLY A 1 218 ? 25.028 3.333   -8.835  1.00 85.12  ? 305 GLY A CA  1 
ATOM   1672 C  C   . GLY A 1 218 ? 23.526 3.062   -8.732  1.00 84.66  ? 305 GLY A C   1 
ATOM   1673 O  O   . GLY A 1 218 ? 23.110 2.355   -7.813  1.00 84.84  ? 305 GLY A O   1 
ATOM   1674 N  N   . VAL A 1 219 ? 22.712 3.619   -9.658  1.00 83.44  ? 306 VAL A N   1 
ATOM   1675 C  CA  . VAL A 1 219 ? 21.251 3.416   -9.656  1.00 77.88  ? 306 VAL A CA  1 
ATOM   1676 C  C   . VAL A 1 219 ? 20.921 1.979   -9.277  1.00 72.77  ? 306 VAL A C   1 
ATOM   1677 O  O   . VAL A 1 219 ? 20.787 1.071   -10.083 1.00 73.32  ? 306 VAL A O   1 
ATOM   1678 C  CB  . VAL A 1 219 ? 20.643 3.728   -11.020 1.00 77.24  ? 306 VAL A CB  1 
ATOM   1679 N  N   . ALA A 1 220 ? 20.889 1.808   -7.958  1.00 66.66  ? 307 ALA A N   1 
ATOM   1680 C  CA  . ALA A 1 220 ? 20.647 0.520   -7.397  1.00 61.13  ? 307 ALA A CA  1 
ATOM   1681 C  C   . ALA A 1 220 ? 20.531 0.647   -5.911  1.00 53.58  ? 307 ALA A C   1 
ATOM   1682 O  O   . ALA A 1 220 ? 21.006 1.626   -5.313  1.00 48.11  ? 307 ALA A O   1 
ATOM   1683 C  CB  . ALA A 1 220 ? 21.781 -0.435  -7.749  1.00 63.13  ? 307 ALA A CB  1 
ATOM   1684 N  N   . GLY A 1 221 ? 19.883 -0.369  -5.364  1.00 50.76  ? 308 GLY A N   1 
ATOM   1685 C  CA  . GLY A 1 221 ? 19.652 -0.468  -3.946  1.00 51.86  ? 308 GLY A CA  1 
ATOM   1686 C  C   . GLY A 1 221 ? 18.400 -1.281  -3.693  1.00 54.32  ? 308 GLY A C   1 
ATOM   1687 O  O   . GLY A 1 221 ? 17.501 -1.330  -4.525  1.00 61.97  ? 308 GLY A O   1 
ATOM   1688 N  N   . GLU A 1 222 ? 18.347 -1.925  -2.549  1.00 47.36  ? 309 GLU A N   1 
ATOM   1689 C  CA  . GLU A 1 222 ? 17.219 -2.721  -2.123  1.00 40.86  ? 309 GLU A CA  1 
ATOM   1690 C  C   . GLU A 1 222 ? 17.602 -3.243  -0.777  1.00 35.33  ? 309 GLU A C   1 
ATOM   1691 O  O   . GLU A 1 222 ? 18.277 -4.249  -0.660  1.00 41.95  ? 309 GLU A O   1 
ATOM   1692 C  CB  . GLU A 1 222 ? 16.750 -3.798  -3.087  1.00 47.43  ? 309 GLU A CB  1 
ATOM   1693 C  CG  . GLU A 1 222 ? 15.191 -3.763  -3.094  1.00 50.15  ? 309 GLU A CG  1 
ATOM   1694 C  CD  . GLU A 1 222 ? 14.543 -4.781  -3.998  1.00 50.03  ? 309 GLU A CD  1 
ATOM   1695 O  OE1 . GLU A 1 222 ? 14.783 -4.862  -5.185  1.00 45.94  ? 309 GLU A OE1 1 
ATOM   1696 O  OE2 . GLU A 1 222 ? 13.636 -5.515  -3.388  1.00 55.66  ? 309 GLU A OE2 1 
ATOM   1697 N  N   . PRO A 1 223 ? 17.145 -2.475  0.182   1.00 23.59  ? 310 PRO A N   1 
ATOM   1698 C  CA  . PRO A 1 223 ? 17.305 -2.476  1.598   1.00 27.68  ? 310 PRO A CA  1 
ATOM   1699 C  C   . PRO A 1 223 ? 17.422 -3.715  2.430   1.00 25.38  ? 310 PRO A C   1 
ATOM   1700 O  O   . PRO A 1 223 ? 16.479 -4.435  2.693   1.00 30.39  ? 310 PRO A O   1 
ATOM   1701 C  CB  . PRO A 1 223 ? 16.312 -1.475  2.173   1.00 27.29  ? 310 PRO A CB  1 
ATOM   1702 C  CG  . PRO A 1 223 ? 15.511 -1.015  0.978   1.00 25.03  ? 310 PRO A CG  1 
ATOM   1703 C  CD  . PRO A 1 223 ? 15.827 -1.964  -0.157  1.00 22.62  ? 310 PRO A CD  1 
ATOM   1704 N  N   . LEU A 1 224 ? 18.636 -3.880  2.883   1.00 16.68  ? 311 LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 224 ? 19.006 -4.958  3.714   1.00 18.28  ? 311 LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 224 ? 18.408 -4.791  5.073   1.00 20.06  ? 311 LEU A C   1 
ATOM   1707 O  O   . LEU A 1 224 ? 18.310 -3.698  5.649   1.00 22.47  ? 311 LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 224 ? 20.519 -5.002  3.858   1.00 24.61  ? 311 LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 224 ? 21.233 -5.888  2.870   1.00 29.13  ? 311 LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 224 ? 20.481 -5.990  1.533   1.00 26.68  ? 311 LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 224 ? 22.601 -5.239  2.709   1.00 27.50  ? 311 LEU A CD2 1 
ATOM   1712 N  N   . PRO A 1 225 ? 18.037 -5.932  5.587   1.00 13.14  ? 312 PRO A N   1 
ATOM   1713 C  CA  . PRO A 1 225 ? 17.448 -5.958  6.878   1.00 9.46   ? 312 PRO A CA  1 
ATOM   1714 C  C   . PRO A 1 225 ? 18.442 -5.488  7.896   1.00 8.09   ? 312 PRO A C   1 
ATOM   1715 O  O   . PRO A 1 225 ? 19.593 -5.862  7.770   1.00 8.54   ? 312 PRO A O   1 
ATOM   1716 C  CB  . PRO A 1 225 ? 17.116 -7.420  7.125   1.00 6.62   ? 312 PRO A CB  1 
ATOM   1717 C  CG  . PRO A 1 225 ? 17.240 -8.113  5.791   1.00 5.52   ? 312 PRO A CG  1 
ATOM   1718 C  CD  . PRO A 1 225 ? 18.159 -7.265  4.963   1.00 5.71   ? 312 PRO A CD  1 
ATOM   1719 N  N   . VAL A 1 226 ? 17.973 -4.714  8.891   1.00 7.92   ? 313 VAL A N   1 
ATOM   1720 C  CA  . VAL A 1 226 ? 18.777 -4.176  9.990   1.00 3.98   ? 313 VAL A CA  1 
ATOM   1721 C  C   . VAL A 1 226 ? 18.066 -4.282  11.293  1.00 8.39   ? 313 VAL A C   1 
ATOM   1722 O  O   . VAL A 1 226 ? 16.963 -3.792  11.362  1.00 19.69  ? 313 VAL A O   1 
ATOM   1723 C  CB  . VAL A 1 226 ? 19.744 -3.005  9.746   1.00 1.07   ? 313 VAL A CB  1 
ATOM   1724 C  CG1 . VAL A 1 226 ? 19.539 -2.302  8.405   1.00 1.00   ? 313 VAL A CG1 1 
ATOM   1725 C  CG2 . VAL A 1 226 ? 19.861 -2.078  10.932  1.00 1.00   ? 313 VAL A CG2 1 
ATOM   1726 N  N   . ASP A 1 227 ? 18.685 -4.929  12.295  1.00 11.35  ? 314 ASP A N   1 
ATOM   1727 C  CA  . ASP A 1 227 ? 18.079 -5.169  13.600  1.00 12.42  ? 314 ASP A CA  1 
ATOM   1728 C  C   . ASP A 1 227 ? 18.893 -4.776  14.803  1.00 13.38  ? 314 ASP A C   1 
ATOM   1729 O  O   . ASP A 1 227 ? 18.576 -5.177  15.924  1.00 16.25  ? 314 ASP A O   1 
ATOM   1730 C  CB  . ASP A 1 227 ? 17.720 -6.664  13.768  1.00 22.25  ? 314 ASP A CB  1 
ATOM   1731 C  CG  . ASP A 1 227 ? 16.796 -7.155  12.681  1.00 37.07  ? 314 ASP A CG  1 
ATOM   1732 O  OD1 . ASP A 1 227 ? 15.673 -6.693  12.548  1.00 44.56  ? 314 ASP A OD1 1 
ATOM   1733 O  OD2 . ASP A 1 227 ? 17.278 -8.151  11.942  1.00 41.64  ? 314 ASP A OD2 1 
ATOM   1734 N  N   . SER A 1 228 ? 19.918 -3.986  14.568  1.00 9.08   ? 315 SER A N   1 
ATOM   1735 C  CA  . SER A 1 228 ? 20.798 -3.489  15.595  1.00 6.48   ? 315 SER A CA  1 
ATOM   1736 C  C   . SER A 1 228 ? 21.647 -2.524  14.819  1.00 8.57   ? 315 SER A C   1 
ATOM   1737 O  O   . SER A 1 228 ? 21.550 -2.547  13.594  1.00 12.58  ? 315 SER A O   1 
ATOM   1738 C  CB  . SER A 1 228 ? 21.635 -4.647  16.114  1.00 11.27  ? 315 SER A CB  1 
ATOM   1739 O  OG  . SER A 1 228 ? 22.226 -5.356  15.020  1.00 14.56  ? 315 SER A OG  1 
ATOM   1740 N  N   . GLU A 1 229 ? 22.460 -1.694  15.453  1.00 7.92   ? 316 GLU A N   1 
ATOM   1741 C  CA  . GLU A 1 229 ? 23.293 -0.761  14.683  1.00 11.95  ? 316 GLU A CA  1 
ATOM   1742 C  C   . GLU A 1 229 ? 24.400 -1.604  14.054  1.00 15.95  ? 316 GLU A C   1 
ATOM   1743 O  O   . GLU A 1 229 ? 24.892 -1.332  12.924  1.00 10.97  ? 316 GLU A O   1 
ATOM   1744 C  CB  . GLU A 1 229 ? 23.930 0.258   15.667  1.00 8.17   ? 316 GLU A CB  1 
ATOM   1745 C  CG  . GLU A 1 229 ? 24.034 1.739   15.208  1.00 2.86   ? 316 GLU A CG  1 
ATOM   1746 C  CD  . GLU A 1 229 ? 24.198 2.480   16.494  1.00 2.64   ? 316 GLU A CD  1 
ATOM   1747 O  OE1 . GLU A 1 229 ? 24.111 1.864   17.523  1.00 1.00   ? 316 GLU A OE1 1 
ATOM   1748 O  OE2 . GLU A 1 229 ? 24.320 3.792   16.427  1.00 3.92   ? 316 GLU A OE2 1 
ATOM   1749 N  N   . GLN A 1 230 ? 24.739 -2.637  14.877  1.00 13.02  ? 317 GLN A N   1 
ATOM   1750 C  CA  . GLN A 1 230 ? 25.764 -3.639  14.646  1.00 14.69  ? 317 GLN A CA  1 
ATOM   1751 C  C   . GLN A 1 230 ? 25.723 -4.233  13.272  1.00 12.17  ? 317 GLN A C   1 
ATOM   1752 O  O   . GLN A 1 230 ? 26.747 -4.383  12.605  1.00 16.05  ? 317 GLN A O   1 
ATOM   1753 C  CB  . GLN A 1 230 ? 25.715 -4.779  15.669  1.00 22.28  ? 317 GLN A CB  1 
ATOM   1754 C  CG  . GLN A 1 230 ? 26.100 -4.364  17.107  1.00 35.20  ? 317 GLN A CG  1 
ATOM   1755 C  CD  . GLN A 1 230 ? 25.016 -3.638  17.892  1.00 42.61  ? 317 GLN A CD  1 
ATOM   1756 O  OE1 . GLN A 1 230 ? 25.007 -3.617  19.150  1.00 45.09  ? 317 GLN A OE1 1 
ATOM   1757 N  NE2 . GLN A 1 230 ? 24.069 -3.080  17.143  1.00 45.81  ? 317 GLN A NE2 1 
ATOM   1758 N  N   . ASP A 1 231 ? 24.538 -4.596  12.861  1.00 2.80   ? 318 ASP A N   1 
ATOM   1759 C  CA  . ASP A 1 231 ? 24.493 -5.160  11.558  1.00 5.98   ? 318 ASP A CA  1 
ATOM   1760 C  C   . ASP A 1 231 ? 24.961 -4.157  10.547  1.00 5.37   ? 318 ASP A C   1 
ATOM   1761 O  O   . ASP A 1 231 ? 25.421 -4.563  9.540   1.00 7.64   ? 318 ASP A O   1 
ATOM   1762 C  CB  . ASP A 1 231 ? 23.079 -5.642  11.103  1.00 8.58   ? 318 ASP A CB  1 
ATOM   1763 C  CG  . ASP A 1 231 ? 22.486 -6.568  12.098  1.00 16.29  ? 318 ASP A CG  1 
ATOM   1764 O  OD1 . ASP A 1 231 ? 23.173 -7.333  12.703  1.00 31.24  ? 318 ASP A OD1 1 
ATOM   1765 O  OD2 . ASP A 1 231 ? 21.191 -6.513  12.245  1.00 16.68  ? 318 ASP A OD2 1 
ATOM   1766 N  N   . ILE A 1 232 ? 24.863 -2.854  10.788  1.00 13.50  ? 319 ILE A N   1 
ATOM   1767 C  CA  . ILE A 1 232 ? 25.292 -1.919  9.744   1.00 10.11  ? 319 ILE A CA  1 
ATOM   1768 C  C   . ILE A 1 232 ? 26.733 -2.103  9.434   1.00 3.79   ? 319 ILE A C   1 
ATOM   1769 O  O   . ILE A 1 232 ? 27.136 -2.295  8.280   1.00 1.00   ? 319 ILE A O   1 
ATOM   1770 C  CB  . ILE A 1 232 ? 24.882 -0.469  9.973   1.00 7.58   ? 319 ILE A CB  1 
ATOM   1771 C  CG1 . ILE A 1 232 ? 23.416 -0.438  10.300  1.00 12.73  ? 319 ILE A CG1 1 
ATOM   1772 C  CG2 . ILE A 1 232 ? 24.941 0.307   8.676   1.00 8.57   ? 319 ILE A CG2 1 
ATOM   1773 C  CD1 . ILE A 1 232 ? 23.160 0.719   11.248  1.00 19.09  ? 319 ILE A CD1 1 
ATOM   1774 N  N   . PHE A 1 233 ? 27.438 -2.079  10.542  1.00 1.00   ? 320 PHE A N   1 
ATOM   1775 C  CA  . PHE A 1 233 ? 28.838 -2.251  10.592  1.00 5.55   ? 320 PHE A CA  1 
ATOM   1776 C  C   . PHE A 1 233 ? 29.195 -3.585  9.913   1.00 14.89  ? 320 PHE A C   1 
ATOM   1777 O  O   . PHE A 1 233 ? 30.035 -3.638  9.007   1.00 14.82  ? 320 PHE A O   1 
ATOM   1778 C  CB  . PHE A 1 233 ? 29.218 -2.196  12.078  1.00 15.09  ? 320 PHE A CB  1 
ATOM   1779 C  CG  . PHE A 1 233 ? 29.031 -0.829  12.718  1.00 25.27  ? 320 PHE A CG  1 
ATOM   1780 C  CD1 . PHE A 1 233 ? 27.800 -0.428  13.245  1.00 30.31  ? 320 PHE A CD1 1 
ATOM   1781 C  CD2 . PHE A 1 233 ? 30.097 0.066   12.811  1.00 26.38  ? 320 PHE A CD2 1 
ATOM   1782 C  CE1 . PHE A 1 233 ? 27.630 0.826   13.838  1.00 28.84  ? 320 PHE A CE1 1 
ATOM   1783 C  CE2 . PHE A 1 233 ? 29.958 1.321   13.404  1.00 27.14  ? 320 PHE A CE2 1 
ATOM   1784 C  CZ  . PHE A 1 233 ? 28.716 1.702   13.911  1.00 28.99  ? 320 PHE A CZ  1 
ATOM   1785 N  N   . ASP A 1 234 ? 28.532 -4.681  10.315  1.00 17.87  ? 321 ASP A N   1 
ATOM   1786 C  CA  . ASP A 1 234 ? 28.808 -5.972  9.695   1.00 18.72  ? 321 ASP A CA  1 
ATOM   1787 C  C   . ASP A 1 234 ? 28.651 -5.949  8.180   1.00 11.58  ? 321 ASP A C   1 
ATOM   1788 O  O   . ASP A 1 234 ? 29.427 -6.529  7.444   1.00 14.96  ? 321 ASP A O   1 
ATOM   1789 C  CB  . ASP A 1 234 ? 27.982 -7.137  10.314  1.00 29.69  ? 321 ASP A CB  1 
ATOM   1790 C  CG  . ASP A 1 234 ? 28.541 -7.608  11.659  1.00 38.25  ? 321 ASP A CG  1 
ATOM   1791 O  OD1 . ASP A 1 234 ? 29.747 -7.774  11.786  1.00 39.28  ? 321 ASP A OD1 1 
ATOM   1792 O  OD2 . ASP A 1 234 ? 27.640 -7.982  12.594  1.00 37.45  ? 321 ASP A OD2 1 
ATOM   1793 N  N   . TYR A 1 235 ? 27.643 -5.264  7.698   1.00 9.01   ? 322 TYR A N   1 
ATOM   1794 C  CA  . TYR A 1 235 ? 27.405 -5.202  6.276   1.00 13.81  ? 322 TYR A CA  1 
ATOM   1795 C  C   . TYR A 1 235 ? 28.572 -4.650  5.575   1.00 10.12  ? 322 TYR A C   1 
ATOM   1796 O  O   . TYR A 1 235 ? 28.852 -5.013  4.464   1.00 7.81   ? 322 TYR A O   1 
ATOM   1797 C  CB  . TYR A 1 235 ? 26.138 -4.383  5.856   1.00 23.10  ? 322 TYR A CB  1 
ATOM   1798 C  CG  . TYR A 1 235 ? 24.903 -5.200  6.124   1.00 31.63  ? 322 TYR A CG  1 
ATOM   1799 C  CD1 . TYR A 1 235 ? 24.606 -6.299  5.318   1.00 37.45  ? 322 TYR A CD1 1 
ATOM   1800 C  CD2 . TYR A 1 235 ? 24.039 -4.918  7.184   1.00 32.17  ? 322 TYR A CD2 1 
ATOM   1801 C  CE1 . TYR A 1 235 ? 23.489 -7.106  5.552   1.00 39.00  ? 322 TYR A CE1 1 
ATOM   1802 C  CE2 . TYR A 1 235 ? 22.927 -5.719  7.438   1.00 34.47  ? 322 TYR A CE2 1 
ATOM   1803 C  CZ  . TYR A 1 235 ? 22.646 -6.817  6.623   1.00 36.14  ? 322 TYR A CZ  1 
ATOM   1804 O  OH  . TYR A 1 235 ? 21.542 -7.611  6.871   1.00 34.35  ? 322 TYR A OH  1 
ATOM   1805 N  N   . ILE A 1 236 ? 29.211 -3.736  6.246   1.00 14.65  ? 323 ILE A N   1 
ATOM   1806 C  CA  . ILE A 1 236 ? 30.345 -3.083  5.658   1.00 20.88  ? 323 ILE A CA  1 
ATOM   1807 C  C   . ILE A 1 236 ? 31.649 -3.481  6.313   1.00 21.89  ? 323 ILE A C   1 
ATOM   1808 O  O   . ILE A 1 236 ? 32.692 -2.902  6.080   1.00 26.42  ? 323 ILE A O   1 
ATOM   1809 C  CB  . ILE A 1 236 ? 30.070 -1.570  5.441   1.00 23.89  ? 323 ILE A CB  1 
ATOM   1810 C  CG1 . ILE A 1 236 ? 29.614 -0.842  6.718   1.00 16.80  ? 323 ILE A CG1 1 
ATOM   1811 C  CG2 . ILE A 1 236 ? 28.979 -1.385  4.376   1.00 22.59  ? 323 ILE A CG2 1 
ATOM   1812 C  CD1 . ILE A 1 236 ? 30.717 -0.606  7.732   1.00 13.01  ? 323 ILE A CD1 1 
ATOM   1813 N  N   . GLN A 1 237 ? 31.556 -4.479  7.167   1.00 19.68  ? 324 GLN A N   1 
ATOM   1814 C  CA  . GLN A 1 237 ? 32.688 -5.001  7.895   1.00 14.52  ? 324 GLN A CA  1 
ATOM   1815 C  C   . GLN A 1 237 ? 33.765 -4.040  8.384   1.00 12.70  ? 324 GLN A C   1 
ATOM   1816 O  O   . GLN A 1 237 ? 34.861 -3.848  7.866   1.00 14.25  ? 324 GLN A O   1 
ATOM   1817 C  CB  . GLN A 1 237 ? 33.190 -6.284  7.310   1.00 9.97   ? 324 GLN A CB  1 
ATOM   1818 C  CG  . GLN A 1 237 ? 33.425 -6.043  5.820   1.00 15.33  ? 324 GLN A CG  1 
ATOM   1819 C  CD  . GLN A 1 237 ? 33.230 -7.306  5.005   1.00 17.13  ? 324 GLN A CD  1 
ATOM   1820 O  OE1 . GLN A 1 237 ? 33.704 -7.376  3.844   1.00 11.12  ? 324 GLN A OE1 1 
ATOM   1821 N  NE2 . GLN A 1 237 ? 32.498 -8.277  5.609   1.00 14.97  ? 324 GLN A NE2 1 
ATOM   1822 N  N   . TRP A 1 238 ? 33.382 -3.450  9.459   1.00 9.67   ? 325 TRP A N   1 
ATOM   1823 C  CA  . TRP A 1 238 ? 34.140 -2.520  10.206  1.00 13.99  ? 325 TRP A CA  1 
ATOM   1824 C  C   . TRP A 1 238 ? 33.774 -2.997  11.552  1.00 10.54  ? 325 TRP A C   1 
ATOM   1825 O  O   . TRP A 1 238 ? 32.619 -3.360  11.759  1.00 11.38  ? 325 TRP A O   1 
ATOM   1826 C  CB  . TRP A 1 238 ? 33.569 -1.083  10.146  1.00 18.46  ? 325 TRP A CB  1 
ATOM   1827 C  CG  . TRP A 1 238 ? 34.315 -0.036  9.386   1.00 21.48  ? 325 TRP A CG  1 
ATOM   1828 C  CD1 . TRP A 1 238 ? 35.285 -0.242  8.474   1.00 27.89  ? 325 TRP A CD1 1 
ATOM   1829 C  CD2 . TRP A 1 238 ? 34.181 1.383   9.513   1.00 25.15  ? 325 TRP A CD2 1 
ATOM   1830 N  NE1 . TRP A 1 238 ? 35.749 0.953   7.993   1.00 28.97  ? 325 TRP A NE1 1 
ATOM   1831 C  CE2 . TRP A 1 238 ? 35.082 1.967   8.615   1.00 30.57  ? 325 TRP A CE2 1 
ATOM   1832 C  CE3 . TRP A 1 238 ? 33.349 2.219   10.250  1.00 28.78  ? 325 TRP A CE3 1 
ATOM   1833 C  CZ2 . TRP A 1 238 ? 35.187 3.353   8.468   1.00 36.18  ? 325 TRP A CZ2 1 
ATOM   1834 C  CZ3 . TRP A 1 238 ? 33.449 3.588   10.104  1.00 32.57  ? 325 TRP A CZ3 1 
ATOM   1835 C  CH2 . TRP A 1 238 ? 34.360 4.155   9.217   1.00 35.55  ? 325 TRP A CH2 1 
ATOM   1836 N  N   . ARG A 1 239 ? 34.736 -3.010  12.435  1.00 7.89   ? 326 ARG A N   1 
ATOM   1837 C  CA  . ARG A 1 239 ? 34.431 -3.430  13.766  1.00 12.68  ? 326 ARG A CA  1 
ATOM   1838 C  C   . ARG A 1 239 ? 33.431 -2.396  14.324  1.00 10.22  ? 326 ARG A C   1 
ATOM   1839 O  O   . ARG A 1 239 ? 33.539 -1.189  14.105  1.00 9.67   ? 326 ARG A O   1 
ATOM   1840 C  CB  . ARG A 1 239 ? 35.730 -3.465  14.577  1.00 9.33   ? 326 ARG A CB  1 
ATOM   1841 N  N   . TYR A 1 240 ? 32.447 -2.850  15.041  1.00 4.91   ? 327 TYR A N   1 
ATOM   1842 C  CA  . TYR A 1 240 ? 31.516 -1.909  15.585  1.00 11.09  ? 327 TYR A CA  1 
ATOM   1843 C  C   . TYR A 1 240 ? 32.203 -0.878  16.482  1.00 16.55  ? 327 TYR A C   1 
ATOM   1844 O  O   . TYR A 1 240 ? 32.844 -1.233  17.472  1.00 22.85  ? 327 TYR A O   1 
ATOM   1845 C  CB  . TYR A 1 240 ? 30.449 -2.681  16.414  1.00 13.53  ? 327 TYR A CB  1 
ATOM   1846 C  CG  . TYR A 1 240 ? 29.381 -1.853  17.140  1.00 18.85  ? 327 TYR A CG  1 
ATOM   1847 C  CD1 . TYR A 1 240 ? 28.339 -1.220  16.456  1.00 18.22  ? 327 TYR A CD1 1 
ATOM   1848 C  CD2 . TYR A 1 240 ? 29.403 -1.722  18.533  1.00 19.00  ? 327 TYR A CD2 1 
ATOM   1849 C  CE1 . TYR A 1 240 ? 27.371 -0.467  17.127  1.00 17.15  ? 327 TYR A CE1 1 
ATOM   1850 C  CE2 . TYR A 1 240 ? 28.444 -0.984  19.229  1.00 16.63  ? 327 TYR A CE2 1 
ATOM   1851 C  CZ  . TYR A 1 240 ? 27.422 -0.350  18.520  1.00 16.96  ? 327 TYR A CZ  1 
ATOM   1852 O  OH  . TYR A 1 240 ? 26.465 0.365   19.208  1.00 18.26  ? 327 TYR A OH  1 
ATOM   1853 N  N   . ARG A 1 241 ? 32.095 0.406   16.130  1.00 14.87  ? 328 ARG A N   1 
ATOM   1854 C  CA  . ARG A 1 241 ? 32.691 1.386   17.013  1.00 16.73  ? 328 ARG A CA  1 
ATOM   1855 C  C   . ARG A 1 241 ? 31.581 1.812   17.934  1.00 12.32  ? 328 ARG A C   1 
ATOM   1856 O  O   . ARG A 1 241 ? 30.584 2.367   17.426  1.00 4.40   ? 328 ARG A O   1 
ATOM   1857 C  CB  . ARG A 1 241 ? 33.097 2.716   16.419  1.00 15.91  ? 328 ARG A CB  1 
ATOM   1858 C  CG  . ARG A 1 241 ? 34.475 2.918   15.850  1.00 15.77  ? 328 ARG A CG  1 
ATOM   1859 C  CD  . ARG A 1 241 ? 34.453 4.393   15.563  1.00 17.67  ? 328 ARG A CD  1 
ATOM   1860 N  NE  . ARG A 1 241 ? 35.434 5.016   14.712  1.00 14.06  ? 328 ARG A NE  1 
ATOM   1861 C  CZ  . ARG A 1 241 ? 35.521 4.729   13.428  1.00 18.83  ? 328 ARG A CZ  1 
ATOM   1862 N  NH1 . ARG A 1 241 ? 34.768 3.818   12.850  1.00 11.51  ? 328 ARG A NH1 1 
ATOM   1863 N  NH2 . ARG A 1 241 ? 36.414 5.360   12.690  1.00 30.89  ? 328 ARG A NH2 1 
ATOM   1864 N  N   . GLU A 1 242 ? 31.773 1.624   19.249  1.00 14.28  ? 329 GLU A N   1 
ATOM   1865 C  CA  . GLU A 1 242 ? 30.788 2.031   20.240  1.00 16.15  ? 329 GLU A CA  1 
ATOM   1866 C  C   . GLU A 1 242 ? 30.479 3.485   19.958  1.00 21.24  ? 329 GLU A C   1 
ATOM   1867 O  O   . GLU A 1 242 ? 31.223 4.166   19.271  1.00 25.47  ? 329 GLU A O   1 
ATOM   1868 C  CB  . GLU A 1 242 ? 31.360 2.039   21.663  1.00 15.82  ? 329 GLU A CB  1 
ATOM   1869 C  CG  . GLU A 1 242 ? 31.948 0.726   22.203  1.00 24.76  ? 329 GLU A CG  1 
ATOM   1870 C  CD  . GLU A 1 242 ? 32.191 0.895   23.698  1.00 37.76  ? 329 GLU A CD  1 
ATOM   1871 O  OE1 . GLU A 1 242 ? 31.662 1.788   24.337  1.00 34.04  ? 329 GLU A OE1 1 
ATOM   1872 O  OE2 . GLU A 1 242 ? 32.965 -0.025  24.273  1.00 44.93  ? 329 GLU A OE2 1 
ATOM   1873 N  N   . PRO A 1 243 ? 29.402 4.003   20.479  1.00 23.94  ? 330 PRO A N   1 
ATOM   1874 C  CA  . PRO A 1 243 ? 29.093 5.390   20.222  1.00 25.13  ? 330 PRO A CA  1 
ATOM   1875 C  C   . PRO A 1 243 ? 30.189 6.358   20.647  1.00 24.35  ? 330 PRO A C   1 
ATOM   1876 O  O   . PRO A 1 243 ? 30.485 7.322   19.937  1.00 19.90  ? 330 PRO A O   1 
ATOM   1877 C  CB  . PRO A 1 243 ? 27.794 5.643   20.970  1.00 24.38  ? 330 PRO A CB  1 
ATOM   1878 C  CG  . PRO A 1 243 ? 27.096 4.299   20.983  1.00 23.44  ? 330 PRO A CG  1 
ATOM   1879 C  CD  . PRO A 1 243 ? 28.164 3.244   20.729  1.00 24.46  ? 330 PRO A CD  1 
ATOM   1880 N  N   . LYS A 1 244 ? 30.804 6.072   21.789  1.00 22.82  ? 331 LYS A N   1 
ATOM   1881 C  CA  . LYS A 1 244 ? 31.849 6.928   22.290  1.00 23.33  ? 331 LYS A CA  1 
ATOM   1882 C  C   . LYS A 1 244 ? 33.036 7.100   21.383  1.00 23.22  ? 331 LYS A C   1 
ATOM   1883 O  O   . LYS A 1 244 ? 33.757 8.076   21.509  1.00 27.11  ? 331 LYS A O   1 
ATOM   1884 C  CB  . LYS A 1 244 ? 32.310 6.540   23.661  1.00 24.72  ? 331 LYS A CB  1 
ATOM   1885 C  CG  . LYS A 1 244 ? 33.274 5.382   23.663  1.00 25.30  ? 331 LYS A CG  1 
ATOM   1886 C  CD  . LYS A 1 244 ? 33.218 4.652   24.996  1.00 29.29  ? 331 LYS A CD  1 
ATOM   1887 C  CE  . LYS A 1 244 ? 34.420 3.748   25.245  1.00 32.53  ? 331 LYS A CE  1 
ATOM   1888 N  NZ  . LYS A 1 244 ? 34.930 3.073   24.038  1.00 31.28  ? 331 LYS A NZ  1 
ATOM   1889 N  N   . ASP A 1 245 ? 33.258 6.166   20.484  1.00 20.88  ? 332 ASP A N   1 
ATOM   1890 C  CA  . ASP A 1 245 ? 34.384 6.248   19.569  1.00 16.37  ? 332 ASP A CA  1 
ATOM   1891 C  C   . ASP A 1 245 ? 33.969 6.815   18.225  1.00 13.76  ? 332 ASP A C   1 
ATOM   1892 O  O   . ASP A 1 245 ? 34.600 6.601   17.195  1.00 10.25  ? 332 ASP A O   1 
ATOM   1893 C  CB  . ASP A 1 245 ? 35.061 4.868   19.462  1.00 18.11  ? 332 ASP A CB  1 
ATOM   1894 C  CG  . ASP A 1 245 ? 35.379 4.387   20.851  1.00 22.93  ? 332 ASP A CG  1 
ATOM   1895 O  OD1 . ASP A 1 245 ? 35.975 5.091   21.614  1.00 26.61  ? 332 ASP A OD1 1 
ATOM   1896 O  OD2 . ASP A 1 245 ? 34.914 3.200   21.188  1.00 24.63  ? 332 ASP A OD2 1 
ATOM   1897 N  N   . ARG A 1 246 ? 32.850 7.525   18.203  1.00 18.82  ? 333 ARG A N   1 
ATOM   1898 C  CA  . ARG A 1 246 ? 32.416 8.096   16.920  1.00 23.96  ? 333 ARG A CA  1 
ATOM   1899 C  C   . ARG A 1 246 ? 32.610 9.605   16.953  1.00 35.13  ? 333 ARG A C   1 
ATOM   1900 O  O   . ARG A 1 246 ? 31.667 10.403  16.952  1.00 37.13  ? 333 ARG A O   1 
ATOM   1901 C  CB  . ARG A 1 246 ? 31.053 7.687   16.340  1.00 12.92  ? 333 ARG A CB  1 
ATOM   1902 C  CG  . ARG A 1 246 ? 30.497 6.472   17.055  1.00 12.12  ? 333 ARG A CG  1 
ATOM   1903 C  CD  . ARG A 1 246 ? 29.459 5.717   16.261  1.00 15.49  ? 333 ARG A CD  1 
ATOM   1904 N  NE  . ARG A 1 246 ? 28.954 4.585   17.039  1.00 18.45  ? 333 ARG A NE  1 
ATOM   1905 C  CZ  . ARG A 1 246 ? 27.940 3.780   16.671  1.00 16.74  ? 333 ARG A CZ  1 
ATOM   1906 N  NH1 . ARG A 1 246 ? 27.281 3.930   15.532  1.00 16.43  ? 333 ARG A NH1 1 
ATOM   1907 N  NH2 . ARG A 1 246 ? 27.552 2.781   17.463  1.00 13.65  ? 333 ARG A NH2 1 
ATOM   1908 N  N   . SER A 1 247 ? 33.865 10.016  17.051  1.00 38.97  ? 334 SER A N   1 
ATOM   1909 C  CA  . SER A 1 247 ? 34.140 11.430  17.066  1.00 33.27  ? 334 SER A CA  1 
ATOM   1910 C  C   . SER A 1 247 ? 34.494 11.799  15.654  1.00 22.37  ? 334 SER A C   1 
ATOM   1911 O  O   . SER A 1 247 ? 34.161 12.872  15.200  1.00 19.86  ? 334 SER A O   1 
ATOM   1912 C  CB  . SER A 1 247 ? 35.189 11.809  18.075  1.00 36.19  ? 334 SER A CB  1 
ATOM   1913 O  OG  . SER A 1 247 ? 34.730 11.329  19.319  1.00 40.73  ? 334 SER A OG  1 
ATOM   1914 N  N   . GLU A 1 248 ? 35.139 10.840  14.990  1.00 18.65  ? 335 GLU A N   1 
ATOM   1915 C  CA  . GLU A 1 248 ? 35.579 10.929  13.618  1.00 24.90  ? 335 GLU A CA  1 
ATOM   1916 C  C   . GLU A 1 248 ? 35.757 9.535   13.061  1.00 19.36  ? 335 GLU A C   1 
ATOM   1917 O  O   . GLU A 1 248 ? 35.427 9.321   11.872  1.00 6.69   ? 335 GLU A O   1 
ATOM   1918 C  CB  . GLU A 1 248 ? 36.870 11.778  13.356  1.00 39.13  ? 335 GLU A CB  1 
ATOM   1919 C  CG  . GLU A 1 248 ? 38.270 11.269  13.861  1.00 45.11  ? 335 GLU A CG  1 
ATOM   1920 C  CD  . GLU A 1 248 ? 39.410 11.726  12.936  1.00 50.78  ? 335 GLU A CD  1 
ATOM   1921 O  OE1 . GLU A 1 248 ? 39.405 11.379  11.772  1.00 49.86  ? 335 GLU A OE1 1 
ATOM   1922 O  OE2 . GLU A 1 248 ? 40.454 12.378  13.484  1.00 52.65  ? 335 GLU A OE2 1 
ATOM   1923 O  OXT . GLU A 1 248 ? 36.260 8.684   13.833  1.00 27.72  ? 335 GLU A OXT 1 
HETATM 1924 MN MN  . MN  B 2 .   ? 16.831 18.674  18.169  1.00 100.00 ? 500 MN  A MN  1 
HETATM 1925 O  O   . HOH C 3 .   ? 20.365 14.267  22.821  1.00 3.55   ? 401 HOH A O   1 
HETATM 1926 O  O   . HOH C 3 .   ? 18.366 23.774  27.366  1.00 1.00   ? 402 HOH A O   1 
HETATM 1927 O  O   . HOH C 3 .   ? 22.393 5.854   9.083   1.00 8.03   ? 403 HOH A O   1 
HETATM 1928 O  O   . HOH C 3 .   ? 15.422 20.577  32.859  1.00 1.00   ? 404 HOH A O   1 
HETATM 1929 O  O   . HOH C 3 .   ? 30.979 -5.815  12.980  1.00 7.89   ? 405 HOH A O   1 
HETATM 1930 O  O   . HOH C 3 .   ? 9.889  -0.058  26.136  1.00 25.18  ? 406 HOH A O   1 
HETATM 1931 O  O   . HOH C 3 .   ? 10.452 -4.801  20.393  1.00 13.70  ? 407 HOH A O   1 
HETATM 1932 O  O   . HOH C 3 .   ? 1.441  21.609  15.601  1.00 27.78  ? 408 HOH A O   1 
HETATM 1933 O  O   . HOH C 3 .   ? 25.641 7.267   7.849   1.00 20.05  ? 410 HOH A O   1 
HETATM 1934 O  O   . HOH C 3 .   ? 17.364 23.169  25.169  1.00 7.15   ? 411 HOH A O   1 
HETATM 1935 O  O   . HOH C 3 .   ? 18.422 -1.121  5.474   1.00 16.87  ? 412 HOH A O   1 
HETATM 1936 O  O   . HOH C 3 .   ? 25.098 14.880  27.498  1.00 42.22  ? 413 HOH A O   1 
HETATM 1937 O  O   . HOH C 3 .   ? 26.819 7.274   14.733  1.00 16.86  ? 414 HOH A O   1 
HETATM 1938 O  O   . HOH C 3 .   ? 17.624 19.256  32.047  1.00 28.86  ? 415 HOH A O   1 
HETATM 1939 O  O   . HOH C 3 .   ? 17.471 2.578   24.771  1.00 21.63  ? 416 HOH A O   1 
HETATM 1940 O  O   . HOH C 3 .   ? 1.995  24.518  23.884  1.00 43.04  ? 417 HOH A O   1 
HETATM 1941 O  O   . HOH C 3 .   ? 17.125 -0.089  7.182   1.00 3.18   ? 418 HOH A O   1 
HETATM 1942 O  O   . HOH C 3 .   ? 32.493 -6.073  16.005  1.00 27.41  ? 419 HOH A O   1 
HETATM 1943 O  O   . HOH C 3 .   ? 19.410 35.053  29.409  1.00 48.35  ? 420 HOH A O   1 
HETATM 1944 O  O   . HOH C 3 .   ? 15.426 30.185  14.292  1.00 9.43   ? 421 HOH A O   1 
HETATM 1945 O  O   . HOH C 3 .   ? 21.369 24.621  22.957  1.00 19.82  ? 422 HOH A O   1 
HETATM 1946 O  O   . HOH C 3 .   ? 2.032  19.851  30.877  1.00 17.30  ? 423 HOH A O   1 
HETATM 1947 O  O   . HOH C 3 .   ? 18.607 5.514   24.624  1.00 19.96  ? 424 HOH A O   1 
HETATM 1948 O  O   . HOH C 3 .   ? 25.081 -9.158  11.074  1.00 19.90  ? 425 HOH A O   1 
HETATM 1949 O  O   . HOH C 3 .   ? 2.718  20.430  25.865  1.00 15.39  ? 426 HOH A O   1 
HETATM 1950 O  O   . HOH C 3 .   ? 14.154 1.181   25.996  1.00 26.67  ? 427 HOH A O   1 
HETATM 1951 O  O   . HOH C 3 .   ? 17.862 0.696   9.700   1.00 1.00   ? 428 HOH A O   1 
HETATM 1952 O  O   . HOH C 3 .   ? 29.886 3.938   23.064  1.00 41.88  ? 429 HOH A O   1 
HETATM 1953 O  O   . HOH C 3 .   ? 35.449 0.790   14.285  1.00 14.83  ? 430 HOH A O   1 
HETATM 1954 O  O   . HOH C 3 .   ? 16.123 -1.058  11.264  1.00 22.49  ? 433 HOH A O   1 
HETATM 1955 O  O   . HOH C 3 .   ? 1.990  33.252  19.739  1.00 5.68   ? 434 HOH A O   1 
HETATM 1956 O  O   . HOH C 3 .   ? 14.022 30.579  21.148  1.00 10.39  ? 435 HOH A O   1 
HETATM 1957 O  O   . HOH C 3 .   ? 15.307 -3.334  7.835   1.00 2.47   ? 436 HOH A O   1 
HETATM 1958 O  O   . HOH C 3 .   ? 1.343  27.768  15.042  1.00 49.11  ? 437 HOH A O   1 
HETATM 1959 O  O   . HOH C 3 .   ? -0.869 3.481   20.088  1.00 43.46  ? 438 HOH A O   1 
HETATM 1960 O  O   . HOH C 3 .   ? 14.818 38.776  30.251  1.00 78.62  ? 439 HOH A O   1 
HETATM 1961 O  O   . HOH C 3 .   ? 32.568 16.262  24.840  1.00 13.36  ? 440 HOH A O   1 
HETATM 1962 O  O   . HOH C 3 .   ? -1.112 0.099   17.500  1.00 92.47  ? 441 HOH A O   1 
HETATM 1963 O  O   . HOH C 3 .   ? 0.566  24.175  27.957  1.00 41.68  ? 442 HOH A O   1 
HETATM 1964 O  O   . HOH C 3 .   ? 21.547 6.228   23.926  1.00 35.92  ? 443 HOH A O   1 
HETATM 1965 O  O   . HOH C 3 .   ? 0.680  2.174   22.088  1.00 11.38  ? 444 HOH A O   1 
HETATM 1966 O  O   . HOH C 3 .   ? 3.197  33.167  26.528  1.00 30.77  ? 445 HOH A O   1 
HETATM 1967 O  O   . HOH C 3 .   ? 28.792 22.802  28.079  1.00 43.25  ? 447 HOH A O   1 
HETATM 1968 O  O   . HOH C 3 .   ? -1.331 20.753  14.235  1.00 26.44  ? 448 HOH A O   1 
HETATM 1969 O  O   . HOH C 3 .   ? 14.806 6.796   9.582   1.00 75.33  ? 449 HOH A O   1 
HETATM 1970 O  O   . HOH C 3 .   ? 0.074  34.265  24.286  1.00 47.04  ? 450 HOH A O   1 
HETATM 1971 O  O   . HOH C 3 .   ? 30.140 0.564   26.558  1.00 59.99  ? 451 HOH A O   1 
HETATM 1972 O  O   . HOH C 3 .   ? 26.972 5.531   1.408   1.00 85.52  ? 454 HOH A O   1 
HETATM 1973 O  O   . HOH C 3 .   ? 12.341 27.160  36.641  1.00 43.70  ? 455 HOH A O   1 
HETATM 1974 O  O   . HOH C 3 .   ? 6.505  17.817  13.404  1.00 17.69  ? 456 HOH A O   1 
HETATM 1975 O  O   . HOH C 3 .   ? 13.334 -5.063  1.813   1.00 39.62  ? 457 HOH A O   1 
HETATM 1976 O  O   . HOH C 3 .   ? 23.024 39.520  19.611  1.00 37.17  ? 458 HOH A O   1 
HETATM 1977 O  O   . HOH C 3 .   ? 17.211 3.520   -2.945  1.00 46.75  ? 459 HOH A O   1 
HETATM 1978 O  O   . HOH C 3 .   ? 34.328 1.359   19.259  1.00 46.02  ? 460 HOH A O   1 
HETATM 1979 O  O   . HOH C 3 .   ? 24.221 19.044  21.917  1.00 18.27  ? 461 HOH A O   1 
HETATM 1980 O  O   . HOH C 3 .   ? 39.119 0.107   7.027   1.00 26.05  ? 462 HOH A O   1 
HETATM 1981 O  O   . HOH C 3 .   ? 25.842 8.180   26.851  1.00 29.94  ? 463 HOH A O   1 
HETATM 1982 O  O   . HOH C 3 .   ? -2.617 5.620   30.073  1.00 48.67  ? 464 HOH A O   1 
HETATM 1983 O  O   . HOH C 3 .   ? 16.145 31.011  23.016  1.00 14.96  ? 465 HOH A O   1 
HETATM 1984 O  O   . HOH C 3 .   ? 22.265 -0.415  17.801  1.00 8.98   ? 466 HOH A O   1 
HETATM 1985 O  O   . HOH C 3 .   ? 38.253 7.487   12.419  1.00 70.52  ? 467 HOH A O   1 
HETATM 1986 O  O   . HOH C 3 .   ? -0.094 32.690  20.514  1.00 80.95  ? 468 HOH A O   1 
HETATM 1987 O  O   . HOH C 3 .   ? 24.909 13.069  13.457  1.00 32.96  ? 469 HOH A O   1 
HETATM 1988 O  O   . HOH C 3 .   ? 38.287 5.725   10.344  1.00 76.15  ? 470 HOH A O   1 
HETATM 1989 O  O   . HOH C 3 .   ? 4.480  34.484  13.411  1.00 68.24  ? 471 HOH A O   1 
HETATM 1990 O  O   . HOH C 3 .   ? 6.706  34.418  25.232  1.00 31.19  ? 472 HOH A O   1 
HETATM 1991 O  O   . HOH C 3 .   ? -2.926 6.063   14.478  1.00 19.37  ? 473 HOH A O   1 
HETATM 1992 O  O   . HOH C 3 .   ? 25.064 14.686  16.349  1.00 68.06  ? 474 HOH A O   1 
HETATM 1993 O  O   . HOH C 3 .   ? -3.414 2.168   30.934  1.00 69.15  ? 476 HOH A O   1 
HETATM 1994 O  O   . HOH C 3 .   ? -1.287 0.507   23.104  1.00 82.90  ? 477 HOH A O   1 
HETATM 1995 O  O   . HOH C 3 .   ? 9.406  5.068   4.882   1.00 49.52  ? 478 HOH A O   1 
HETATM 1996 O  O   . HOH C 3 .   ? 37.843 2.506   5.786   1.00 47.78  ? 479 HOH A O   1 
HETATM 1997 O  O   . HOH C 3 .   ? 2.969  -5.586  26.232  1.00 68.52  ? 481 HOH A O   1 
HETATM 1998 O  O   . HOH C 3 .   ? 13.576 -10.666 12.753  1.00 28.92  ? 482 HOH A O   1 
HETATM 1999 O  O   . HOH C 3 .   ? 6.947  25.055  32.751  1.00 19.69  ? 483 HOH A O   1 
HETATM 2000 O  O   . HOH C 3 .   ? -0.908 7.422   27.695  1.00 72.78  ? 484 HOH A O   1 
HETATM 2001 O  O   . HOH C 3 .   ? -2.188 15.953  28.852  1.00 41.88  ? 485 HOH A O   1 
HETATM 2002 O  O   . HOH C 3 .   ? 5.819  -7.396  26.696  1.00 17.40  ? 486 HOH A O   1 
HETATM 2003 O  O   . HOH C 3 .   ? 3.464  -6.990  24.126  1.00 37.67  ? 487 HOH A O   1 
HETATM 2004 O  O   . HOH C 3 .   ? 25.140 -7.826  18.689  1.00 53.16  ? 488 HOH A O   1 
HETATM 2005 O  O   . HOH C 3 .   ? 7.560  27.706  12.874  1.00 42.49  ? 490 HOH A O   1 
HETATM 2006 O  O   . HOH C 3 .   ? 5.326  14.616  38.563  1.00 86.68  ? 491 HOH A O   1 
HETATM 2007 O  O   . HOH C 3 .   ? 24.405 17.362  20.016  1.00 47.68  ? 492 HOH A O   1 
HETATM 2008 O  O   . HOH C 3 .   ? 12.705 -5.097  29.658  1.00 88.48  ? 494 HOH A O   1 
HETATM 2009 O  O   . HOH C 3 .   ? 7.763  19.374  37.399  1.00 66.46  ? 496 HOH A O   1 
HETATM 2010 O  O   . HOH C 3 .   ? 23.451 6.501   25.784  1.00 50.29  ? 497 HOH A O   1 
HETATM 2011 O  O   . HOH C 3 .   ? 15.457 14.967  3.556   1.00 48.54  ? 498 HOH A O   1 
HETATM 2012 O  O   . HOH C 3 .   ? 32.782 12.796  20.241  1.00 63.47  ? 499 HOH A O   1 
HETATM 2013 O  O   . HOH C 3 .   ? 20.723 16.427  18.332  1.00 44.62  ? 501 HOH A O   1 
HETATM 2014 O  O   . HOH C 3 .   ? 7.930  -5.570  13.837  1.00 70.25  ? 502 HOH A O   1 
HETATM 2015 O  O   . HOH C 3 .   ? 9.366  14.499  10.471  1.00 18.64  ? 503 HOH A O   1 
HETATM 2016 O  O   . HOH C 3 .   ? 27.073 -4.436  -3.993  1.00 31.60  ? 504 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   88  ?   ?   ?   A . n 
A 1 2   ARG 2   89  ?   ?   ?   A . n 
A 1 3   GLN 3   90  ?   ?   ?   A . n 
A 1 4   ASP 4   91  91  ASP ASP A . n 
A 1 5   ASP 5   92  92  ASP ASP A . n 
A 1 6   THR 6   93  93  THR THR A . n 
A 1 7   SER 7   94  94  SER SER A . n 
A 1 8   SER 8   95  95  SER SER A . n 
A 1 9   SER 9   96  96  SER SER A . n 
A 1 10  ILE 10  97  97  ILE ILE A . n 
A 1 11  ASN 11  98  98  ASN ASN A . n 
A 1 12  PHE 12  99  99  PHE PHE A . n 
A 1 13  LEU 13  100 100 LEU LEU A . n 
A 1 14  THR 14  101 101 THR THR A . n 
A 1 15  ARG 15  102 102 ARG ARG A . n 
A 1 16  VAL 16  103 103 VAL VAL A . n 
A 1 17  THR 17  104 104 THR THR A . n 
A 1 18  GLY 18  105 105 GLY GLY A . n 
A 1 19  ILE 19  106 106 ILE ILE A . n 
A 1 20  GLY 20  107 107 GLY GLY A . n 
A 1 21  PRO 21  108 108 PRO PRO A . n 
A 1 22  SER 22  109 109 SER SER A . n 
A 1 23  ALA 23  110 110 ALA ALA A . n 
A 1 24  ALA 24  111 111 ALA ALA A . n 
A 1 25  ARG 25  112 112 ARG ARG A . n 
A 1 26  LYS 26  113 113 LYS LYS A . n 
A 1 27  LEU 27  114 114 LEU LEU A . n 
A 1 28  VAL 28  115 115 VAL VAL A . n 
A 1 29  ASP 29  116 116 ASP ASP A . n 
A 1 30  GLU 30  117 117 GLU GLU A . n 
A 1 31  GLY 31  118 118 GLY GLY A . n 
A 1 32  ILE 32  119 119 ILE ILE A . n 
A 1 33  LYS 33  120 120 LYS LYS A . n 
A 1 34  THR 34  121 121 THR THR A . n 
A 1 35  LEU 35  122 122 LEU LEU A . n 
A 1 36  GLU 36  123 123 GLU GLU A . n 
A 1 37  ASP 37  124 124 ASP ASP A . n 
A 1 38  LEU 38  125 125 LEU LEU A . n 
A 1 39  ARG 39  126 126 ARG ARG A . n 
A 1 40  LYS 40  127 127 LYS LYS A . n 
A 1 41  ASN 41  128 128 ASN ASN A . n 
A 1 42  GLU 42  129 129 GLU GLU A . n 
A 1 43  ASP 43  130 130 ASP ASP A . n 
A 1 44  LYS 44  131 131 LYS LYS A . n 
A 1 45  LEU 45  132 132 LEU LEU A . n 
A 1 46  ASN 46  133 133 ASN ASN A . n 
A 1 47  HIS 47  134 134 HIS HIS A . n 
A 1 48  HIS 48  135 135 HIS HIS A . n 
A 1 49  GLN 49  136 136 GLN GLN A . n 
A 1 50  ARG 50  137 137 ARG ARG A . n 
A 1 51  ILE 51  138 138 ILE ILE A . n 
A 1 52  GLY 52  139 139 GLY GLY A . n 
A 1 53  LEU 53  140 140 LEU LEU A . n 
A 1 54  LYS 54  141 141 LYS LYS A . n 
A 1 55  TYR 55  142 142 TYR TYR A . n 
A 1 56  PHE 56  143 143 PHE PHE A . n 
A 1 57  GLU 57  144 144 GLU GLU A . n 
A 1 58  ASP 58  145 145 ASP ASP A . n 
A 1 59  PHE 59  146 146 PHE PHE A . n 
A 1 60  GLU 60  147 147 GLU GLU A . n 
A 1 61  LYS 61  148 148 LYS LYS A . n 
A 1 62  ARG 62  149 149 ARG ARG A . n 
A 1 63  ILE 63  150 150 ILE ILE A . n 
A 1 64  PRO 64  151 151 PRO PRO A . n 
A 1 65  ARG 65  152 152 ARG ARG A . n 
A 1 66  GLU 66  153 153 GLU GLU A . n 
A 1 67  GLU 67  154 154 GLU GLU A . n 
A 1 68  MET 68  155 155 MET MET A . n 
A 1 69  LEU 69  156 156 LEU LEU A . n 
A 1 70  GLN 70  157 157 GLN GLN A . n 
A 1 71  MET 71  158 158 MET MET A . n 
A 1 72  GLN 72  159 159 GLN GLN A . n 
A 1 73  ASP 73  160 160 ASP ASP A . n 
A 1 74  ILE 74  161 161 ILE ILE A . n 
A 1 75  VAL 75  162 162 VAL VAL A . n 
A 1 76  LEU 76  163 163 LEU LEU A . n 
A 1 77  ASN 77  164 164 ASN ASN A . n 
A 1 78  GLU 78  165 165 GLU GLU A . n 
A 1 79  VAL 79  166 166 VAL VAL A . n 
A 1 80  LYS 80  167 167 LYS LYS A . n 
A 1 81  LYS 81  168 168 LYS LYS A . n 
A 1 82  LEU 82  169 169 LEU LEU A . n 
A 1 83  ASP 83  170 170 ASP ASP A . n 
A 1 84  PRO 84  171 171 PRO PRO A . n 
A 1 85  GLU 85  172 172 GLU GLU A . n 
A 1 86  TYR 86  173 173 TYR TYR A . n 
A 1 87  ILE 87  174 174 ILE ILE A . n 
A 1 88  ALA 88  175 175 ALA ALA A . n 
A 1 89  THR 89  176 176 THR THR A . n 
A 1 90  VAL 90  177 177 VAL VAL A . n 
A 1 91  CYS 91  178 178 CYS CYS A . n 
A 1 92  GLY 92  179 179 GLY GLY A . n 
A 1 93  SER 93  180 180 SER SER A . n 
A 1 94  PHE 94  181 181 PHE PHE A . n 
A 1 95  ARG 95  182 182 ARG ARG A . n 
A 1 96  ARG 96  183 183 ARG ARG A . n 
A 1 97  GLY 97  184 184 GLY GLY A . n 
A 1 98  ALA 98  185 185 ALA ALA A . n 
A 1 99  GLU 99  186 186 GLU GLU A . n 
A 1 100 SER 100 187 187 SER SER A . n 
A 1 101 SER 101 188 188 SER SER A . n 
A 1 102 GLY 102 189 189 GLY GLY A . n 
A 1 103 ASP 103 190 190 ASP ASP A . n 
A 1 104 MET 104 191 191 MET MET A . n 
A 1 105 ASP 105 192 192 ASP ASP A . n 
A 1 106 VAL 106 193 193 VAL VAL A . n 
A 1 107 LEU 107 194 194 LEU LEU A . n 
A 1 108 LEU 108 195 195 LEU LEU A . n 
A 1 109 THR 109 196 196 THR THR A . n 
A 1 110 HIS 110 197 197 HIS HIS A . n 
A 1 111 PRO 111 198 198 PRO PRO A . n 
A 1 112 ASN 112 199 199 ASN ASN A . n 
A 1 113 PHE 113 200 200 PHE PHE A . n 
A 1 114 THR 114 201 201 THR THR A . n 
A 1 115 SER 115 202 202 SER SER A . n 
A 1 116 GLU 116 203 203 GLU GLU A . n 
A 1 117 SER 117 204 204 SER SER A . n 
A 1 118 SER 118 205 205 SER SER A . n 
A 1 119 LYS 119 206 206 LYS LYS A . n 
A 1 120 GLN 120 207 207 GLN GLN A . n 
A 1 121 PRO 121 208 208 PRO PRO A . n 
A 1 122 LYS 122 209 209 LYS LYS A . n 
A 1 123 LEU 123 210 210 LEU LEU A . n 
A 1 124 LEU 124 211 211 LEU LEU A . n 
A 1 125 HIS 125 212 212 HIS HIS A . n 
A 1 126 ARG 126 213 213 ARG ARG A . n 
A 1 127 VAL 127 214 214 VAL VAL A . n 
A 1 128 VAL 128 215 215 VAL VAL A . n 
A 1 129 GLU 129 216 216 GLU GLU A . n 
A 1 130 GLN 130 217 217 GLN GLN A . n 
A 1 131 LEU 131 218 218 LEU LEU A . n 
A 1 132 GLN 132 219 219 GLN GLN A . n 
A 1 133 LYS 133 220 220 LYS LYS A . n 
A 1 134 VAL 134 221 221 VAL VAL A . n 
A 1 135 ARG 135 222 222 ARG ARG A . n 
A 1 136 PHE 136 223 223 PHE PHE A . n 
A 1 137 ILE 137 224 224 ILE ILE A . n 
A 1 138 THR 138 225 225 THR THR A . n 
A 1 139 ASP 139 226 226 ASP ASP A . n 
A 1 140 THR 140 227 227 THR THR A . n 
A 1 141 LEU 141 228 228 LEU LEU A . n 
A 1 142 SER 142 229 229 SER SER A . n 
A 1 143 LYS 143 230 230 LYS LYS A . n 
A 1 144 GLY 144 231 231 GLY GLY A . n 
A 1 145 GLU 145 232 232 GLU GLU A . n 
A 1 146 THR 146 233 233 THR THR A . n 
A 1 147 LYS 147 234 234 LYS LYS A . n 
A 1 148 PHE 148 235 235 PHE PHE A . n 
A 1 149 MET 149 236 236 MET MET A . n 
A 1 150 GLY 150 237 237 GLY GLY A . n 
A 1 151 VAL 151 238 238 VAL VAL A . n 
A 1 152 CYS 152 239 239 CYS CYS A . n 
A 1 153 GLN 153 240 240 GLN GLN A . n 
A 1 154 LEU 154 241 241 LEU LEU A . n 
A 1 155 PRO 155 242 242 PRO PRO A . n 
A 1 156 SER 156 243 243 SER SER A . n 
A 1 157 GLU 157 244 244 GLU GLU A . n 
A 1 158 ASN 158 245 245 ASN ASN A . n 
A 1 159 ASP 159 246 ?   ?   ?   A . n 
A 1 160 GLU 160 247 ?   ?   ?   A . n 
A 1 161 ASN 161 248 ?   ?   ?   A . n 
A 1 162 GLU 162 249 249 GLU GLU A . n 
A 1 163 TYR 163 250 250 TYR TYR A . n 
A 1 164 PRO 164 251 251 PRO PRO A . n 
A 1 165 HIS 165 252 252 HIS HIS A . n 
A 1 166 ARG 166 253 253 ARG ARG A . n 
A 1 167 ARG 167 254 254 ARG ARG A . n 
A 1 168 ILE 168 255 255 ILE ILE A . n 
A 1 169 ASP 169 256 256 ASP ASP A . n 
A 1 170 ILE 170 257 257 ILE ILE A . n 
A 1 171 ARG 171 258 258 ARG ARG A . n 
A 1 172 LEU 172 259 259 LEU LEU A . n 
A 1 173 ILE 173 260 260 ILE ILE A . n 
A 1 174 PRO 174 261 261 PRO PRO A . n 
A 1 175 LYS 175 262 262 LYS LYS A . n 
A 1 176 ASP 176 263 263 ASP ASP A . n 
A 1 177 GLN 177 264 264 GLN GLN A . n 
A 1 178 TYR 178 265 265 TYR TYR A . n 
A 1 179 TYR 179 266 266 TYR TYR A . n 
A 1 180 CYS 180 267 267 CYS CYS A . n 
A 1 181 GLY 181 268 268 GLY GLY A . n 
A 1 182 VAL 182 269 269 VAL VAL A . n 
A 1 183 LEU 183 270 270 LEU LEU A . n 
A 1 184 TYR 184 271 271 TYR TYR A . n 
A 1 185 PHE 185 272 272 PHE PHE A . n 
A 1 186 THR 186 273 273 THR THR A . n 
A 1 187 GLY 187 274 274 GLY GLY A . n 
A 1 188 SER 188 275 275 SER SER A . n 
A 1 189 ASP 189 276 276 ASP ASP A . n 
A 1 190 ILE 190 277 277 ILE ILE A . n 
A 1 191 PHE 191 278 278 PHE PHE A . n 
A 1 192 ASN 192 279 279 ASN ASN A . n 
A 1 193 LYS 193 280 280 LYS LYS A . n 
A 1 194 ASN 194 281 281 ASN ASN A . n 
A 1 195 MET 195 282 282 MET MET A . n 
A 1 196 ARG 196 283 283 ARG ARG A . n 
A 1 197 ALA 197 284 284 ALA ALA A . n 
A 1 198 HIS 198 285 285 HIS HIS A . n 
A 1 199 ALA 199 286 286 ALA ALA A . n 
A 1 200 LEU 200 287 287 LEU LEU A . n 
A 1 201 GLU 201 288 288 GLU GLU A . n 
A 1 202 LYS 202 289 289 LYS LYS A . n 
A 1 203 GLY 203 290 290 GLY GLY A . n 
A 1 204 PHE 204 291 291 PHE PHE A . n 
A 1 205 THR 205 292 292 THR THR A . n 
A 1 206 ILE 206 293 293 ILE ILE A . n 
A 1 207 ASN 207 294 294 ASN ASN A . n 
A 1 208 GLU 208 295 295 GLU GLU A . n 
A 1 209 TYR 209 296 296 TYR TYR A . n 
A 1 210 THR 210 297 297 THR THR A . n 
A 1 211 ILE 211 298 298 ILE ILE A . n 
A 1 212 ARG 212 299 299 ARG ARG A . n 
A 1 213 PRO 213 300 300 PRO PRO A . n 
A 1 214 LEU 214 301 301 LEU LEU A . n 
A 1 215 GLY 215 302 302 GLY GLY A . n 
A 1 216 VAL 216 303 303 VAL VAL A . n 
A 1 217 THR 217 304 304 THR THR A . n 
A 1 218 GLY 218 305 305 GLY GLY A . n 
A 1 219 VAL 219 306 306 VAL VAL A . n 
A 1 220 ALA 220 307 307 ALA ALA A . n 
A 1 221 GLY 221 308 308 GLY GLY A . n 
A 1 222 GLU 222 309 309 GLU GLU A . n 
A 1 223 PRO 223 310 310 PRO PRO A . n 
A 1 224 LEU 224 311 311 LEU LEU A . n 
A 1 225 PRO 225 312 312 PRO PRO A . n 
A 1 226 VAL 226 313 313 VAL VAL A . n 
A 1 227 ASP 227 314 314 ASP ASP A . n 
A 1 228 SER 228 315 315 SER SER A . n 
A 1 229 GLU 229 316 316 GLU GLU A . n 
A 1 230 GLN 230 317 317 GLN GLN A . n 
A 1 231 ASP 231 318 318 ASP ASP A . n 
A 1 232 ILE 232 319 319 ILE ILE A . n 
A 1 233 PHE 233 320 320 PHE PHE A . n 
A 1 234 ASP 234 321 321 ASP ASP A . n 
A 1 235 TYR 235 322 322 TYR TYR A . n 
A 1 236 ILE 236 323 323 ILE ILE A . n 
A 1 237 GLN 237 324 324 GLN GLN A . n 
A 1 238 TRP 238 325 325 TRP TRP A . n 
A 1 239 ARG 239 326 326 ARG ARG A . n 
A 1 240 TYR 240 327 327 TYR TYR A . n 
A 1 241 ARG 241 328 328 ARG ARG A . n 
A 1 242 GLU 242 329 329 GLU GLU A . n 
A 1 243 PRO 243 330 330 PRO PRO A . n 
A 1 244 LYS 244 331 331 LYS LYS A . n 
A 1 245 ASP 245 332 332 ASP ASP A . n 
A 1 246 ARG 246 333 333 ARG ARG A . n 
A 1 247 SER 247 334 334 SER SER A . n 
A 1 248 GLU 248 335 335 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MN  1  500 500 MN  MN  A . 
C 3 HOH 1  401 401 HOH HOH A . 
C 3 HOH 2  402 402 HOH HOH A . 
C 3 HOH 3  403 403 HOH HOH A . 
C 3 HOH 4  404 404 HOH HOH A . 
C 3 HOH 5  405 405 HOH HOH A . 
C 3 HOH 6  406 406 HOH HOH A . 
C 3 HOH 7  407 407 HOH HOH A . 
C 3 HOH 8  408 408 HOH HOH A . 
C 3 HOH 9  410 410 HOH HOH A . 
C 3 HOH 10 411 411 HOH HOH A . 
C 3 HOH 11 412 412 HOH HOH A . 
C 3 HOH 12 413 413 HOH HOH A . 
C 3 HOH 13 414 414 HOH HOH A . 
C 3 HOH 14 415 415 HOH HOH A . 
C 3 HOH 15 416 416 HOH HOH A . 
C 3 HOH 16 417 417 HOH HOH A . 
C 3 HOH 17 418 418 HOH HOH A . 
C 3 HOH 18 419 419 HOH HOH A . 
C 3 HOH 19 420 420 HOH HOH A . 
C 3 HOH 20 421 421 HOH HOH A . 
C 3 HOH 21 422 422 HOH HOH A . 
C 3 HOH 22 423 423 HOH HOH A . 
C 3 HOH 23 424 424 HOH HOH A . 
C 3 HOH 24 425 425 HOH HOH A . 
C 3 HOH 25 426 426 HOH HOH A . 
C 3 HOH 26 427 427 HOH HOH A . 
C 3 HOH 27 428 428 HOH HOH A . 
C 3 HOH 28 429 429 HOH HOH A . 
C 3 HOH 29 430 430 HOH HOH A . 
C 3 HOH 30 433 433 HOH HOH A . 
C 3 HOH 31 434 434 HOH HOH A . 
C 3 HOH 32 435 435 HOH HOH A . 
C 3 HOH 33 436 436 HOH HOH A . 
C 3 HOH 34 437 437 HOH HOH A . 
C 3 HOH 35 438 438 HOH HOH A . 
C 3 HOH 36 439 439 HOH HOH A . 
C 3 HOH 37 440 440 HOH HOH A . 
C 3 HOH 38 441 441 HOH HOH A . 
C 3 HOH 39 442 442 HOH HOH A . 
C 3 HOH 40 443 443 HOH HOH A . 
C 3 HOH 41 444 444 HOH HOH A . 
C 3 HOH 42 445 445 HOH HOH A . 
C 3 HOH 43 447 447 HOH HOH A . 
C 3 HOH 44 448 448 HOH HOH A . 
C 3 HOH 45 449 449 HOH HOH A . 
C 3 HOH 46 450 450 HOH HOH A . 
C 3 HOH 47 451 451 HOH HOH A . 
C 3 HOH 48 454 454 HOH HOH A . 
C 3 HOH 49 455 455 HOH HOH A . 
C 3 HOH 50 456 456 HOH HOH A . 
C 3 HOH 51 457 457 HOH HOH A . 
C 3 HOH 52 458 458 HOH HOH A . 
C 3 HOH 53 459 459 HOH HOH A . 
C 3 HOH 54 460 460 HOH HOH A . 
C 3 HOH 55 461 461 HOH HOH A . 
C 3 HOH 56 462 462 HOH HOH A . 
C 3 HOH 57 463 463 HOH HOH A . 
C 3 HOH 58 464 464 HOH HOH A . 
C 3 HOH 59 465 465 HOH HOH A . 
C 3 HOH 60 466 466 HOH HOH A . 
C 3 HOH 61 467 467 HOH HOH A . 
C 3 HOH 62 468 468 HOH HOH A . 
C 3 HOH 63 469 469 HOH HOH A . 
C 3 HOH 64 470 470 HOH HOH A . 
C 3 HOH 65 471 471 HOH HOH A . 
C 3 HOH 66 472 472 HOH HOH A . 
C 3 HOH 67 473 473 HOH HOH A . 
C 3 HOH 68 474 474 HOH HOH A . 
C 3 HOH 69 476 476 HOH HOH A . 
C 3 HOH 70 477 477 HOH HOH A . 
C 3 HOH 71 478 478 HOH HOH A . 
C 3 HOH 72 479 479 HOH HOH A . 
C 3 HOH 73 481 481 HOH HOH A . 
C 3 HOH 74 482 482 HOH HOH A . 
C 3 HOH 75 483 483 HOH HOH A . 
C 3 HOH 76 484 484 HOH HOH A . 
C 3 HOH 77 485 485 HOH HOH A . 
C 3 HOH 78 486 486 HOH HOH A . 
C 3 HOH 79 487 487 HOH HOH A . 
C 3 HOH 80 488 488 HOH HOH A . 
C 3 HOH 81 490 490 HOH HOH A . 
C 3 HOH 82 491 491 HOH HOH A . 
C 3 HOH 83 492 492 HOH HOH A . 
C 3 HOH 84 494 494 HOH HOH A . 
C 3 HOH 85 496 496 HOH HOH A . 
C 3 HOH 86 497 497 HOH HOH A . 
C 3 HOH 87 498 498 HOH HOH A . 
C 3 HOH 88 499 499 HOH HOH A . 
C 3 HOH 89 501 501 HOH HOH A . 
C 3 HOH 90 502 502 HOH HOH A . 
C 3 HOH 91 503 503 HOH HOH A . 
C 3 HOH 92 504 504 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-08-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_entry_details.entry_id             2BPC 
_pdbx_entry_details.compound_details     
;DNA POLYMERASE BETA POSSESSES A PROTEOLYTICALLY SENSITIVE
REGION IN ITS AMINO ACID SEQUENCE (RESIDUES 80 - 90), AND
THE PRECISE CLEAVAGE SITE VARIES DEPENDING ON THE PROTEASE
OR THE CHEMICAL REAGENT USED IN THE CLEAVAGE REACTION (SEE
A. KUMAR ET AL., J. BIOL. CHEM. 265, 2124 (1990)).  THE
AUTHORS SUSPECT THAT A BACTERIAL PROTEASE OF UNKNOWN ORIGIN
UNEXPECTEDLY CLEAVED THEIR INTACT ENZYME DURING THE
CRYSTALLIZATION PROCESS, RESULTING IN CRYSTALS OF THE
PROTEIN STRUCTURE REPORTED IN THIS ENTRY - THE 31-KD
COOH-TERMINAL DOMAIN (RESIDUES 88 - 335) OF DNA POLYMERASE
BETA.  BECAUSE THE AUTHORS HAVE NOT DONE AN N-TERMINAL
ANALYSIS ON THE PROTEIN IN THEIR CRYSTALS, THEIR CHOICE OF
THE CLEAVAGE SITE (BETWEEN RESIDUES 87 AND 88) IS RATHER
ARBITRARY, AND IN FACT, THERE MAY EVEN BE VARIABLE
N-TERMINAL RESIDUES WITHIN ANY GIVEN CRYSTAL OF THIS
CLEAVED PROTEIN.

PLEASE NOTE THAT THE STRUCTURE PRESENTED IN THIS ENTRY IS
ONLY THE 31 KD DOMAIN AND THE FIRST 8 KD DOMAIN IS NOT
PRESENT IN THIS STRUCTURE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;THE POSITION OF MN2+ IN THIS STRUCTURE, ALTHOUGH WEAKLY
OCCUPIED, CORRESPONDS TO THE MG2+ SITE B IN THE TERNARY
TEMPLATE-PRIMER-DDCTP COMPLEX, 2BPF.
;
_pdbx_entry_details.sequence_details     
;SEQUENCE ADVISORY NOTICE:
     DIFFERENCE BETWEEN SWISS-PROT AND PDB SEQUENCE.

     SWISS-PROT ENTRY NAME: DPOB_RAT

     SWISS-PROT RESIDUE      PDB SEQRES
       NAME   NUMBER         NAME  CHAIN  SEQ/INSERT CODE
       ARG    227            LEU          228

     THE PAPER BY KUMAR, ET AL., J.BIOL.CHEM., 265, 2124,
     (1990) REPORTS A CORRECTION TO THE SEQUENCE GIVEN IN
     SWISS-PROT (SEE REFERENCE 3 ABOVE).
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CD A GLU 117 ? ? OE2 A GLU 117 ? ? 1.335 1.252 0.083 0.011 N 
2  1 CD A GLU 129 ? ? OE2 A GLU 129 ? ? 1.338 1.252 0.086 0.011 N 
3  1 CD A GLU 144 ? ? OE2 A GLU 144 ? ? 1.349 1.252 0.097 0.011 N 
4  1 CD A GLU 147 ? ? OE2 A GLU 147 ? ? 1.334 1.252 0.082 0.011 N 
5  1 CD A GLU 153 ? ? OE2 A GLU 153 ? ? 1.340 1.252 0.088 0.011 N 
6  1 CD A GLU 154 ? ? OE2 A GLU 154 ? ? 1.345 1.252 0.093 0.011 N 
7  1 CD A GLU 165 ? ? OE2 A GLU 165 ? ? 1.333 1.252 0.081 0.011 N 
8  1 CD A GLU 172 ? ? OE2 A GLU 172 ? ? 1.336 1.252 0.084 0.011 N 
9  1 CD A GLU 186 ? ? OE2 A GLU 186 ? ? 1.330 1.252 0.078 0.011 N 
10 1 CD A GLU 203 ? ? OE2 A GLU 203 ? ? 1.335 1.252 0.083 0.011 N 
11 1 CD A GLU 216 ? ? OE2 A GLU 216 ? ? 1.341 1.252 0.089 0.011 N 
12 1 CD A GLU 232 ? ? OE2 A GLU 232 ? ? 1.338 1.252 0.086 0.011 N 
13 1 CD A GLU 249 ? ? OE2 A GLU 249 ? ? 1.330 1.252 0.078 0.011 N 
14 1 CD A GLU 288 ? ? OE2 A GLU 288 ? ? 1.333 1.252 0.081 0.011 N 
15 1 CD A GLU 295 ? ? OE2 A GLU 295 ? ? 1.339 1.252 0.087 0.011 N 
16 1 CD A GLU 316 ? ? OE2 A GLU 316 ? ? 1.319 1.252 0.067 0.011 N 
17 1 CD A GLU 329 ? ? OE2 A GLU 329 ? ? 1.333 1.252 0.081 0.011 N 
18 1 CD A GLU 335 ? ? OE2 A GLU 335 ? ? 1.347 1.252 0.095 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 182 ? ? CZ A ARG 182 ? ? NH1 A ARG 182 ? ? 125.19 120.30 4.89   0.50 N 
2  1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD1 A ASP 190 ? ? 124.70 118.30 6.40   0.90 N 
3  1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD2 A ASP 190 ? ? 110.18 118.30 -8.12  0.90 N 
4  1 N  A ASP 192 ? ? CA A ASP 192 ? ? CB  A ASP 192 ? ? 127.89 110.60 17.29  1.80 N 
5  1 C  A GLN 207 ? ? N  A PRO 208 ? ? CD  A PRO 208 ? ? 114.24 128.40 -14.16 2.10 Y 
6  1 CB A ASP 226 ? ? CG A ASP 226 ? ? OD1 A ASP 226 ? ? 124.79 118.30 6.49   0.90 N 
7  1 CB A ASP 226 ? ? CG A ASP 226 ? ? OD2 A ASP 226 ? ? 112.13 118.30 -6.17  0.90 N 
8  1 NE A ARG 253 ? ? CZ A ARG 253 ? ? NH1 A ARG 253 ? ? 124.10 120.30 3.80   0.50 N 
9  1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH1 A ARG 258 ? ? 123.97 120.30 3.67   0.50 N 
10 1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH2 A ARG 258 ? ? 116.93 120.30 -3.37  0.50 N 
11 1 CB A TYR 265 ? ? CG A TYR 265 ? ? CD2 A TYR 265 ? ? 117.00 121.00 -4.00  0.60 N 
12 1 NE A ARG 299 ? ? CZ A ARG 299 ? ? NH2 A ARG 299 ? ? 117.18 120.30 -3.12  0.50 N 
13 1 C  A GLU 309 ? ? N  A PRO 310 ? ? CA  A PRO 310 ? ? 133.42 119.30 14.12  1.50 Y 
14 1 C  A GLU 309 ? ? N  A PRO 310 ? ? CD  A PRO 310 ? ? 110.57 128.40 -17.83 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 92  ? ? -50.98  44.20   
2  1 THR A 93  ? ? -138.84 -34.99  
3  1 ARG A 126 ? ? -38.25  -38.23  
4  1 ASN A 128 ? ? -144.76 40.74   
5  1 PHE A 143 ? ? -29.76  -65.59  
6  1 ASP A 170 ? ? -175.54 110.69  
7  1 CYS A 178 ? ? -91.16  -144.06 
8  1 ARG A 183 ? ? -73.12  22.02   
9  1 ALA A 185 ? ? -35.74  136.20  
10 1 ASP A 192 ? ? -163.17 104.54  
11 1 SER A 202 ? ? -67.33  18.55   
12 1 SER A 205 ? ? 62.91   -12.00  
13 1 LYS A 206 ? ? -108.60 58.59   
14 1 ARG A 222 ? ? 77.56   42.74   
15 1 PHE A 223 ? ? -97.66  -77.75  
16 1 LEU A 228 ? ? -96.67  -68.13  
17 1 GLN A 240 ? ? -175.83 134.09  
18 1 LEU A 301 ? ? -81.82  -138.50 
19 1 VAL A 306 ? ? -39.05  84.34   
20 1 GLU A 309 ? ? -179.61 94.52   
21 1 PRO A 310 ? ? -35.11  108.29  
22 1 GLN A 324 ? ? 36.75   79.63   
23 1 ARG A 333 ? ? -108.78 64.63   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 91  ? CG  ? A ASP 4   CG  
2  1 Y 1 A ASP 91  ? OD1 ? A ASP 4   OD1 
3  1 Y 1 A ASP 91  ? OD2 ? A ASP 4   OD2 
4  1 Y 1 A ASP 92  ? CG  ? A ASP 5   CG  
5  1 Y 1 A ASP 92  ? OD1 ? A ASP 5   OD1 
6  1 Y 1 A ASP 92  ? OD2 ? A ASP 5   OD2 
7  1 Y 1 A SER 109 ? OG  ? A SER 22  OG  
8  1 Y 1 A ILE 119 ? CG1 ? A ILE 32  CG1 
9  1 Y 1 A ILE 119 ? CG2 ? A ILE 32  CG2 
10 1 Y 1 A ILE 119 ? CD1 ? A ILE 32  CD1 
11 1 Y 1 A GLU 123 ? CG  ? A GLU 36  CG  
12 1 Y 1 A GLU 123 ? CD  ? A GLU 36  CD  
13 1 Y 1 A GLU 123 ? OE1 ? A GLU 36  OE1 
14 1 Y 1 A GLU 123 ? OE2 ? A GLU 36  OE2 
15 1 Y 1 A LYS 131 ? CG  ? A LYS 44  CG  
16 1 Y 1 A LYS 131 ? CD  ? A LYS 44  CD  
17 1 Y 1 A LYS 131 ? CE  ? A LYS 44  CE  
18 1 Y 1 A LYS 131 ? NZ  ? A LYS 44  NZ  
19 1 Y 1 A LYS 220 ? CG  ? A LYS 133 CG  
20 1 Y 1 A LYS 220 ? CD  ? A LYS 133 CD  
21 1 Y 1 A LYS 220 ? CE  ? A LYS 133 CE  
22 1 Y 1 A LYS 220 ? NZ  ? A LYS 133 NZ  
23 1 Y 1 A SER 243 ? OG  ? A SER 156 OG  
24 1 Y 1 A GLU 244 ? CG  ? A GLU 157 CG  
25 1 Y 1 A GLU 244 ? CD  ? A GLU 157 CD  
26 1 Y 1 A GLU 244 ? OE1 ? A GLU 157 OE1 
27 1 Y 1 A GLU 244 ? OE2 ? A GLU 157 OE2 
28 1 Y 1 A ASN 245 ? CG  ? A ASN 158 CG  
29 1 Y 1 A ASN 245 ? OD1 ? A ASN 158 OD1 
30 1 Y 1 A ASN 245 ? ND2 ? A ASN 158 ND2 
31 1 Y 1 A LYS 280 ? CG  ? A LYS 193 CG  
32 1 Y 1 A LYS 280 ? CD  ? A LYS 193 CD  
33 1 Y 1 A LYS 280 ? CE  ? A LYS 193 CE  
34 1 Y 1 A LYS 280 ? NZ  ? A LYS 193 NZ  
35 1 Y 1 A VAL 303 ? CG1 ? A VAL 216 CG1 
36 1 Y 1 A VAL 303 ? CG2 ? A VAL 216 CG2 
37 1 Y 1 A THR 304 ? OG1 ? A THR 217 OG1 
38 1 Y 1 A THR 304 ? CG2 ? A THR 217 CG2 
39 1 Y 1 A VAL 306 ? CG1 ? A VAL 219 CG1 
40 1 Y 1 A VAL 306 ? CG2 ? A VAL 219 CG2 
41 1 Y 1 A ARG 326 ? CG  ? A ARG 239 CG  
42 1 Y 1 A ARG 326 ? CD  ? A ARG 239 CD  
43 1 Y 1 A ARG 326 ? NE  ? A ARG 239 NE  
44 1 Y 1 A ARG 326 ? CZ  ? A ARG 239 CZ  
45 1 Y 1 A ARG 326 ? NH1 ? A ARG 239 NH1 
46 1 Y 1 A ARG 326 ? NH2 ? A ARG 239 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ILE 88  ? A ILE 1   
2 1 Y 1 A ARG 89  ? A ARG 2   
3 1 Y 1 A GLN 90  ? A GLN 3   
4 1 Y 1 A ASP 246 ? A ASP 159 
5 1 Y 1 A GLU 247 ? A GLU 160 
6 1 Y 1 A ASN 248 ? A ASN 161 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
#