data_2BPF
# 
_entry.id   2BPF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BPF         
RCSB  PDE011       
WWPDB D_1000177850 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2BPG 
_pdbx_database_related.details        
;2BPF STRUCTURE IS VERY SIMILAR TO THE STRUCTURE IN PDB
ENTRY 2BPG WITH THE FOLLOWING DIFFERENCES:
 (1) THE STRUCTURE IN THIS ENTRY CRYSTALLIZED IN SPACE
     GROUP P 61, WHEREAS THE STRUCTURE IN ENTRY 2BPG
     CRYSTALLIZED IN SPACE GROUP P 21.
 (2) THE STRUCTURE IN THIS ENTRY WAS DETERMINED AT 2.9
     ANGSTROMS RESOLUTION, WHEREAS THE STRUCTURE IN ENTRY
     2BPG WAS DETERMINED AT 3.6 ANGSTROMS RESOLUTION.
 (3) THE STRUCTURE IN THIS ENTRY HAS ONE MOLECULE IN THE
     ASYMMETRIC UNIT, WHEREAS THE STRUCTURE IN ENTRY 2BPG
     HAS TWO MOLECULES IN THE ASYMMETRIC UNIT.
 (4) THE POSITION OF THE 8 KD DOMAIN DIFFERS IN THE TWO
     ENTRIES.
 (5) THE STRUCTURE IN THIS ENTRY INCLUDES TWO CATALYTICALLY
     IMPORTANT MG++ IONS, WHEREAS THE STRUCTURE IN ENTRY
     2BPG WAS NOT DETERMINED AT A HIGH ENOUGH RESOLUTION TO
     SEE EVIDENCE OF THE MG++ IONS IN THE ELECTRON DENSITY
     MAPS OF THE ACTIVE SITE, SO THEY ARE NOT INCLUDED IN
     THAT ENTRY.
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BPF 
_pdbx_database_status.recvd_initial_deposition_date   1994-05-19 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pelletier, H.' 1 
'Sawaya, M.R.'  2 
'Kumar, A.'     3 
'Wilson, S.H.'  4 
'Kraut, J.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of ternary complexes of rat DNA polymerase beta, a DNA template-primer, and ddCTP.' Science 264 1891 1903 1994 
SCIEAS US 0036-8075 0038 ? 7516580 ? 
1       'Crystal Structure of Rat DNA Polymerase Beta: Evidence for a Common Polymerase Mechanism'      Science 264 1930 ?    1994 
SCIEAS US 0036-8075 0038 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pelletier, H.' 1  
primary 'Sawaya, M.R.'  2  
primary 'Kumar, A.'     3  
primary 'Wilson, S.H.'  4  
primary 'Kraut, J.'     5  
1       'Sawaya, M.R.'  6  
1       'Pelletier, H.' 7  
1       'Kumar, A.'     8  
1       'Wilson, S.H.'  9  
1       'Kraut, J.'     10 
# 
_cell.entry_id           2BPF 
_cell.length_a           94.900 
_cell.length_b           94.900 
_cell.length_c           117.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BPF 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*GP*GP*CP*GP*CP*CP*G)-3')
;
2468.617  1  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*GP*CP*C)-3')
;
2099.387  1  ? ? ? ? 
3 polymer     man 'PROTEIN (DNA POLYMERASE BETA (E.C.2.7.7.7))' 38388.762 1  ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                               24.305    2  ? ? ? ? 
5 non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   1  ? ? ? ? 
6 water       nat water                                         18.015    31 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DG)' GGGCGCCG T ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DG)(DC)(DC)' CGGCGCC P ? 
3 'polypeptide(L)'        no no 
;MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATG
KLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQD
IVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSENDENEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIF
DYIQWRYREPKDRSE
;
;MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATG
KLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQD
IVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSENDENEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIF
DYIQWRYREPKDRSE
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DC  n 
1 7   DC  n 
1 8   DG  n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DG  n 
2 6   DC  n 
2 7   DC  n 
3 1   MET n 
3 2   SER n 
3 3   LYS n 
3 4   ARG n 
3 5   LYS n 
3 6   ALA n 
3 7   PRO n 
3 8   GLN n 
3 9   GLU n 
3 10  THR n 
3 11  LEU n 
3 12  ASN n 
3 13  GLY n 
3 14  GLY n 
3 15  ILE n 
3 16  THR n 
3 17  ASP n 
3 18  MET n 
3 19  LEU n 
3 20  VAL n 
3 21  GLU n 
3 22  LEU n 
3 23  ALA n 
3 24  ASN n 
3 25  PHE n 
3 26  GLU n 
3 27  LYS n 
3 28  ASN n 
3 29  VAL n 
3 30  SER n 
3 31  GLN n 
3 32  ALA n 
3 33  ILE n 
3 34  HIS n 
3 35  LYS n 
3 36  TYR n 
3 37  ASN n 
3 38  ALA n 
3 39  TYR n 
3 40  ARG n 
3 41  LYS n 
3 42  ALA n 
3 43  ALA n 
3 44  SER n 
3 45  VAL n 
3 46  ILE n 
3 47  ALA n 
3 48  LYS n 
3 49  TYR n 
3 50  PRO n 
3 51  HIS n 
3 52  LYS n 
3 53  ILE n 
3 54  LYS n 
3 55  SER n 
3 56  GLY n 
3 57  ALA n 
3 58  GLU n 
3 59  ALA n 
3 60  LYS n 
3 61  LYS n 
3 62  LEU n 
3 63  PRO n 
3 64  GLY n 
3 65  VAL n 
3 66  GLY n 
3 67  THR n 
3 68  LYS n 
3 69  ILE n 
3 70  ALA n 
3 71  GLU n 
3 72  LYS n 
3 73  ILE n 
3 74  ASP n 
3 75  GLU n 
3 76  PHE n 
3 77  LEU n 
3 78  ALA n 
3 79  THR n 
3 80  GLY n 
3 81  LYS n 
3 82  LEU n 
3 83  ARG n 
3 84  LYS n 
3 85  LEU n 
3 86  GLU n 
3 87  LYS n 
3 88  ILE n 
3 89  ARG n 
3 90  GLN n 
3 91  ASP n 
3 92  ASP n 
3 93  THR n 
3 94  SER n 
3 95  SER n 
3 96  SER n 
3 97  ILE n 
3 98  ASN n 
3 99  PHE n 
3 100 LEU n 
3 101 THR n 
3 102 ARG n 
3 103 VAL n 
3 104 THR n 
3 105 GLY n 
3 106 ILE n 
3 107 GLY n 
3 108 PRO n 
3 109 SER n 
3 110 ALA n 
3 111 ALA n 
3 112 ARG n 
3 113 LYS n 
3 114 LEU n 
3 115 VAL n 
3 116 ASP n 
3 117 GLU n 
3 118 GLY n 
3 119 ILE n 
3 120 LYS n 
3 121 THR n 
3 122 LEU n 
3 123 GLU n 
3 124 ASP n 
3 125 LEU n 
3 126 ARG n 
3 127 LYS n 
3 128 ASN n 
3 129 GLU n 
3 130 ASP n 
3 131 LYS n 
3 132 LEU n 
3 133 ASN n 
3 134 HIS n 
3 135 HIS n 
3 136 GLN n 
3 137 ARG n 
3 138 ILE n 
3 139 GLY n 
3 140 LEU n 
3 141 LYS n 
3 142 TYR n 
3 143 PHE n 
3 144 GLU n 
3 145 ASP n 
3 146 PHE n 
3 147 GLU n 
3 148 LYS n 
3 149 ARG n 
3 150 ILE n 
3 151 PRO n 
3 152 ARG n 
3 153 GLU n 
3 154 GLU n 
3 155 MET n 
3 156 LEU n 
3 157 GLN n 
3 158 MET n 
3 159 GLN n 
3 160 ASP n 
3 161 ILE n 
3 162 VAL n 
3 163 LEU n 
3 164 ASN n 
3 165 GLU n 
3 166 VAL n 
3 167 LYS n 
3 168 LYS n 
3 169 LEU n 
3 170 ASP n 
3 171 PRO n 
3 172 GLU n 
3 173 TYR n 
3 174 ILE n 
3 175 ALA n 
3 176 THR n 
3 177 VAL n 
3 178 CYS n 
3 179 GLY n 
3 180 SER n 
3 181 PHE n 
3 182 ARG n 
3 183 ARG n 
3 184 GLY n 
3 185 ALA n 
3 186 GLU n 
3 187 SER n 
3 188 SER n 
3 189 GLY n 
3 190 ASP n 
3 191 MET n 
3 192 ASP n 
3 193 VAL n 
3 194 LEU n 
3 195 LEU n 
3 196 THR n 
3 197 HIS n 
3 198 PRO n 
3 199 ASN n 
3 200 PHE n 
3 201 THR n 
3 202 SER n 
3 203 GLU n 
3 204 SER n 
3 205 SER n 
3 206 LYS n 
3 207 GLN n 
3 208 PRO n 
3 209 LYS n 
3 210 LEU n 
3 211 LEU n 
3 212 HIS n 
3 213 ARG n 
3 214 VAL n 
3 215 VAL n 
3 216 GLU n 
3 217 GLN n 
3 218 LEU n 
3 219 GLN n 
3 220 LYS n 
3 221 VAL n 
3 222 ARG n 
3 223 PHE n 
3 224 ILE n 
3 225 THR n 
3 226 ASP n 
3 227 THR n 
3 228 LEU n 
3 229 SER n 
3 230 LYS n 
3 231 GLY n 
3 232 GLU n 
3 233 THR n 
3 234 LYS n 
3 235 PHE n 
3 236 MET n 
3 237 GLY n 
3 238 VAL n 
3 239 CYS n 
3 240 GLN n 
3 241 LEU n 
3 242 PRO n 
3 243 SER n 
3 244 GLU n 
3 245 ASN n 
3 246 ASP n 
3 247 GLU n 
3 248 ASN n 
3 249 GLU n 
3 250 TYR n 
3 251 PRO n 
3 252 HIS n 
3 253 ARG n 
3 254 ARG n 
3 255 ILE n 
3 256 ASP n 
3 257 ILE n 
3 258 ARG n 
3 259 LEU n 
3 260 ILE n 
3 261 PRO n 
3 262 LYS n 
3 263 ASP n 
3 264 GLN n 
3 265 TYR n 
3 266 TYR n 
3 267 CYS n 
3 268 GLY n 
3 269 VAL n 
3 270 LEU n 
3 271 TYR n 
3 272 PHE n 
3 273 THR n 
3 274 GLY n 
3 275 SER n 
3 276 ASP n 
3 277 ILE n 
3 278 PHE n 
3 279 ASN n 
3 280 LYS n 
3 281 ASN n 
3 282 MET n 
3 283 ARG n 
3 284 ALA n 
3 285 HIS n 
3 286 ALA n 
3 287 LEU n 
3 288 GLU n 
3 289 LYS n 
3 290 GLY n 
3 291 PHE n 
3 292 THR n 
3 293 ILE n 
3 294 ASN n 
3 295 GLU n 
3 296 TYR n 
3 297 THR n 
3 298 ILE n 
3 299 ARG n 
3 300 PRO n 
3 301 LEU n 
3 302 GLY n 
3 303 VAL n 
3 304 THR n 
3 305 GLY n 
3 306 VAL n 
3 307 ALA n 
3 308 GLY n 
3 309 GLU n 
3 310 PRO n 
3 311 LEU n 
3 312 PRO n 
3 313 VAL n 
3 314 ASP n 
3 315 SER n 
3 316 GLU n 
3 317 GLN n 
3 318 ASP n 
3 319 ILE n 
3 320 PHE n 
3 321 ASP n 
3 322 TYR n 
3 323 ILE n 
3 324 GLN n 
3 325 TRP n 
3 326 ARG n 
3 327 TYR n 
3 328 ARG n 
3 329 GLU n 
3 330 PRO n 
3 331 LYS n 
3 332 ASP n 
3 333 ARG n 
3 334 SER n 
3 335 GLU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP DPOB_RAT P06766 3 1 ? ? 
2 PDB 2BPF     2BPF   1 ? ? ? 
3 PDB 2BPF     2BPF   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BPF A 2 ? 335 ? P06766 1 ? 334 ? 2 335 
2 2 2BPF T 1 ? 8   ? 2BPF   4 ? 11  ? 4 11  
3 3 2BPF P 1 ? 7   ? 2BPF   1 ? 7   ? 1 7   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'     121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"     ? 'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'       n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
? 'C9 H16 N3 O12 P3' 451.158 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"    ? 'C10 H14 N5 O7 P'  347.221 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                         ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2BPF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.54 
_exptl_crystal.density_percent_sol   65.23 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    'pH 6.50' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 WATER        ? ? ? 
1 2 1 MES          ? ? ? 
1 3 1 MGCL2        ? ? ? 
1 4 1 'LI SULFATE' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2BPF 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            2.900 
_reflns.number_obs                   13281 
_reflns.number_all                   53583 
_reflns.percent_possible_obs         99.000 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2BPF 
_refine.ls_number_reflns_obs                     13281 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.000 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1930000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2543 
_refine_hist.pdbx_number_atoms_nucleic_acid   305 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               2908 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 23.56 ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2BPF 
_struct.title                     'STRUCTURES OF TERNARY COMPLEXES OF RAT DNA POLYMERASE BETA, A DNA TEMPLATE-PRIMER, AND DDCTP' 
_struct.pdbx_descriptor           
;DNA POLYMERASE BETA (E.C.2.7.7.7)/DNA COMPLEX + 2'-DIDEOXYCYTIDINE-5'- TRIPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BPF 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN C 12  ? VAL C 29  ? ASN A 12  VAL A 29  1 ? 18 
HELX_P HELX_P2  2  ALA C 32  ? TYR C 49  ? ALA A 32  TYR A 49  1 ? 18 
HELX_P HELX_P3  3  SER C 55  ? LEU C 62  ? SER A 55  LEU A 62  1 ? 8  
HELX_P HELX_P4  4  GLY C 66  ? THR C 79  ? GLY A 66  THR A 79  1 ? 14 
HELX_P HELX_P5  5  LEU C 82  ? ILE C 88  ? LEU A 82  ILE A 88  1 ? 7  
HELX_P HELX_P6  6  ARG C 89  ? ASP C 91  ? ARG A 89  ASP A 91  5 ? 3  
HELX_P HELX_P7  7  ASP C 92  ? ARG C 102 ? ASP A 92  ARG A 102 1 ? 11 
HELX_P HELX_P8  8  GLY C 107 ? GLU C 117 ? GLY A 107 GLU A 117 1 ? 11 
HELX_P HELX_P9  9  THR C 121 ? ASN C 128 ? THR A 121 ASN A 128 1 ? 8  
HELX_P HELX_P10 10 GLU C 129 ? LEU C 132 ? GLU A 129 LEU A 132 5 ? 4  
HELX_P HELX_P11 11 ASN C 133 ? TYR C 142 ? ASN A 133 TYR A 142 1 ? 10 
HELX_P HELX_P12 12 TYR C 142 ? GLU C 147 ? TYR A 142 GLU A 147 1 ? 6  
HELX_P HELX_P13 13 ARG C 152 ? ASP C 170 ? ARG A 152 ASP A 170 1 ? 19 
HELX_P HELX_P14 14 CYS C 178 ? ARG C 183 ? CYS A 178 ARG A 183 1 ? 6  
HELX_P HELX_P15 15 PRO C 208 ? LYS C 220 ? PRO A 208 LYS A 220 1 ? 13 
HELX_P HELX_P16 16 PRO C 261 ? ASP C 263 ? PRO A 261 ASP A 263 5 ? 3  
HELX_P HELX_P17 17 GLN C 264 ? GLY C 274 ? GLN A 264 GLY A 274 1 ? 11 
HELX_P HELX_P18 18 SER C 275 ? LYS C 289 ? SER A 275 LYS A 289 1 ? 15 
HELX_P HELX_P19 19 SER C 315 ? ILE C 323 ? SER A 315 ILE A 323 1 ? 9  
HELX_P HELX_P20 20 GLU C 329 ? ARG C 333 ? GLU A 329 ARG A 333 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F DCT . O2B ? ? ? 1_555 D MG  .   MG  ? ? A DCT 338 A MG  339 1_555 ? ? ? ? ? ? ?            1.715 ? 
metalc2  metalc ? ? D MG  . MG  ? ? ? 1_555 F DCT .   O1A ? ? A MG  339 A DCT 338 1_555 ? ? ? ? ? ? ?            2.950 ? 
metalc3  metalc ? ? D MG  . MG  ? ? ? 1_555 F DCT .   O1G ? ? A MG  339 A DCT 338 1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc4  metalc ? ? D MG  . MG  ? ? ? 1_555 C ASP 192 OD2 ? ? A MG  339 A ASP 192 1_555 ? ? ? ? ? ? ?            2.538 ? 
metalc5  metalc ? ? D MG  . MG  ? ? ? 1_555 I HOH .   O   ? ? A MG  339 A HOH 419 1_555 ? ? ? ? ? ? ?            2.542 ? 
metalc6  metalc ? ? D MG  . MG  ? ? ? 1_555 C ASP 190 O   ? ? A MG  339 A ASP 190 1_555 ? ? ? ? ? ? ?            3.085 ? 
metalc7  metalc ? ? D MG  . MG  ? ? ? 1_555 C ASP 190 OD1 ? ? A MG  339 A ASP 190 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc8  metalc ? ? E MG  . MG  ? ? ? 1_555 C ASP 192 OD1 ? ? A MG  340 A ASP 192 1_555 ? ? ? ? ? ? ?            2.460 ? 
metalc9  metalc ? ? E MG  . MG  ? ? ? 1_555 F DCT .   O1A ? ? A MG  340 A DCT 338 1_555 ? ? ? ? ? ? ?            2.630 ? 
metalc10 metalc ? ? E MG  . MG  ? ? ? 1_555 C ASP 190 OD2 ? ? A MG  340 A ASP 190 1_555 ? ? ? ? ? ? ?            2.033 ? 
hydrog1  hydrog ? ? A DG  2 N1  ? ? ? 1_555 B DC  7   N3  ? ? T DG  5   P DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  2 N2  ? ? ? 1_555 B DC  7   O2  ? ? T DG  5   P DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  2 O6  ? ? ? 1_555 B DC  7   N4  ? ? T DG  5   P DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  3 N1  ? ? ? 1_555 B DC  6   N3  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  3 N2  ? ? ? 1_555 B DC  6   O2  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  3 O6  ? ? ? 1_555 B DC  6   N4  ? ? T DG  6   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  4 N3  ? ? ? 1_555 B DG  5   N1  ? ? T DC  7   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  4 N4  ? ? ? 1_555 B DG  5   O6  ? ? T DC  7   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  4 O2  ? ? ? 1_555 B DG  5   N2  ? ? T DC  7   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  5 N1  ? ? ? 1_555 B DC  4   N3  ? ? T DG  8   P DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5 N2  ? ? ? 1_555 B DC  4   O2  ? ? T DG  8   P DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  5 O6  ? ? ? 1_555 B DC  4   N4  ? ? T DG  8   P DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC  6 N3  ? ? ? 1_555 B DG  3   N1  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  6 N4  ? ? ? 1_555 B DG  3   O6  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  6 O2  ? ? ? 1_555 B DG  3   N2  ? ? T DC  9   P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  7 N3  ? ? ? 1_555 B DG  2   N1  ? ? T DC  10  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  7 N4  ? ? ? 1_555 B DG  2   O6  ? ? T DC  10  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  7 O2  ? ? ? 1_555 B DG  2   N2  ? ? T DC  10  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  8 N1  ? ? ? 1_555 B DC  1   N3  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  8 N2  ? ? ? 1_555 B DC  1   O2  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  8 O6  ? ? ? 1_555 B DC  1   N4  ? ? T DG  11  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           274 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            274 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    275 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     275 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 150 ? PRO C 151 ? ILE A 150 PRO A 151 
A 2 SER C 187 ? SER C 188 ? SER A 187 SER A 188 
B 1 ILE C 174 ? VAL C 177 ? ILE A 174 VAL A 177 
B 2 MET C 191 ? THR C 196 ? MET A 191 THR A 196 
B 3 ARG C 253 ? LEU C 259 ? ARG A 253 LEU A 259 
B 4 LYS C 234 ? CYS C 239 ? LYS A 234 CYS A 239 
B 5 ILE C 224 ? LYS C 230 ? ILE A 224 LYS A 230 
C 1 PHE C 291 ? ILE C 293 ? PHE A 291 ILE A 293 
C 2 ILE C 298 ? PRO C 300 ? ILE A 298 PRO A 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE C 150 ? N ILE A 150 O SER C 188 ? O SER A 188 
B 1 2 O THR C 176 ? O THR A 176 N LEU C 194 ? N LEU A 194 
B 2 3 N MET C 191 ? N MET A 191 O ARG C 254 ? O ARG A 254 
B 3 4 N ILE C 257 ? N ILE A 257 O PHE C 235 ? O PHE A 235 
B 4 5 O VAL C 238 ? O VAL A 238 N THR C 225 ? N THR A 225 
C 1 2 N THR C 292 ? N THR A 292 O ARG C 299 ? O ARG A 299 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 339'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 340'  
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DCT A 338' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  SER C 180 ? SER A 180 . ? 1_555 ? 
2  AC1 6  SER C 188 ? SER A 188 . ? 1_555 ? 
3  AC1 6  ASP C 190 ? ASP A 190 . ? 1_555 ? 
4  AC1 6  ASP C 192 ? ASP A 192 . ? 1_555 ? 
5  AC1 6  DCT F .   ? DCT A 338 . ? 1_555 ? 
6  AC1 6  HOH I .   ? HOH A 419 . ? 1_555 ? 
7  AC2 4  ASP C 190 ? ASP A 190 . ? 1_555 ? 
8  AC2 4  ASP C 192 ? ASP A 192 . ? 1_555 ? 
9  AC2 4  ASP C 256 ? ASP A 256 . ? 1_555 ? 
10 AC2 4  DCT F .   ? DCT A 338 . ? 1_555 ? 
11 AC3 17 ARG C 149 ? ARG A 149 . ? 1_555 ? 
12 AC3 17 GLY C 179 ? GLY A 179 . ? 1_555 ? 
13 AC3 17 SER C 180 ? SER A 180 . ? 1_555 ? 
14 AC3 17 ARG C 183 ? ARG A 183 . ? 1_555 ? 
15 AC3 17 GLY C 189 ? GLY A 189 . ? 1_555 ? 
16 AC3 17 ASP C 190 ? ASP A 190 . ? 1_555 ? 
17 AC3 17 ASP C 192 ? ASP A 192 . ? 1_555 ? 
18 AC3 17 TYR C 271 ? TYR A 271 . ? 1_555 ? 
19 AC3 17 PHE C 272 ? PHE A 272 . ? 1_555 ? 
20 AC3 17 GLY C 274 ? GLY A 274 . ? 1_555 ? 
21 AC3 17 ASP C 276 ? ASP A 276 . ? 1_555 ? 
22 AC3 17 ASN C 279 ? ASN A 279 . ? 1_555 ? 
23 AC3 17 MG  D .   ? MG  A 339 . ? 1_555 ? 
24 AC3 17 MG  E .   ? MG  A 340 . ? 1_555 ? 
25 AC3 17 HOH I .   ? HOH A 408 . ? 1_555 ? 
26 AC3 17 DC  B 7   ? DC  P 7   . ? 1_555 ? 
27 AC3 17 DG  A 1   ? DG  T 4   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2BPF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BPF 
_atom_sites.fract_transf_matrix[1][1]   0.010537 
_atom_sites.fract_transf_matrix[1][2]   0.006084 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012168 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008503 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'GLY A 274 - SER A 275 OMEGA = 359.63 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATIO' 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DG  A 1 1   ? -3.097  62.548 25.937 1.00 53.29  ? 4   DG  T P     1 
ATOM   2    O  OP1   . DG  A 1 1   ? -2.550  61.807 27.102 1.00 55.27  ? 4   DG  T OP1   1 
ATOM   3    O  OP2   . DG  A 1 1   ? -4.516  63.020 25.945 1.00 56.70  ? 4   DG  T OP2   1 
ATOM   4    O  "O5'" . DG  A 1 1   ? -2.225  63.868 25.740 1.00 45.89  ? 4   DG  T "O5'" 1 
ATOM   5    C  "C5'" . DG  A 1 1   ? -2.877  65.142 25.746 1.00 35.66  ? 4   DG  T "C5'" 1 
ATOM   6    C  "C4'" . DG  A 1 1   ? -2.302  66.067 24.694 1.00 20.57  ? 4   DG  T "C4'" 1 
ATOM   7    O  "O4'" . DG  A 1 1   ? -1.062  65.534 24.242 1.00 16.16  ? 4   DG  T "O4'" 1 
ATOM   8    C  "C3'" . DG  A 1 1   ? -3.138  66.306 23.461 1.00 6.85   ? 4   DG  T "C3'" 1 
ATOM   9    O  "O3'" . DG  A 1 1   ? -3.215  67.576 23.441 1.00 5.62   ? 4   DG  T "O3'" 1 
ATOM   10   C  "C2'" . DG  A 1 1   ? -2.250  65.936 22.291 1.00 7.72   ? 4   DG  T "C2'" 1 
ATOM   11   C  "C1'" . DG  A 1 1   ? -0.873  65.760 22.899 1.00 9.95   ? 4   DG  T "C1'" 1 
ATOM   12   N  N9    . DG  A 1 1   ? -0.056  64.619 22.456 1.00 13.84  ? 4   DG  T N9    1 
ATOM   13   C  C8    . DG  A 1 1   ? 0.032   63.255 22.691 1.00 14.23  ? 4   DG  T C8    1 
ATOM   14   N  N7    . DG  A 1 1   ? 1.206   62.710 22.384 1.00 11.28  ? 4   DG  T N7    1 
ATOM   15   C  C5    . DG  A 1 1   ? 1.925   63.775 21.890 1.00 11.98  ? 4   DG  T C5    1 
ATOM   16   C  C6    . DG  A 1 1   ? 3.227   63.792 21.404 1.00 14.54  ? 4   DG  T C6    1 
ATOM   17   O  O6    . DG  A 1 1   ? 4.007   62.825 21.326 1.00 13.55  ? 4   DG  T O6    1 
ATOM   18   N  N1    . DG  A 1 1   ? 3.612   65.083 20.978 1.00 17.49  ? 4   DG  T N1    1 
ATOM   19   C  C2    . DG  A 1 1   ? 2.801   66.205 21.035 1.00 18.91  ? 4   DG  T C2    1 
ATOM   20   N  N2    . DG  A 1 1   ? 3.307   67.351 20.590 1.00 23.80  ? 4   DG  T N2    1 
ATOM   21   N  N3    . DG  A 1 1   ? 1.571   66.211 21.503 1.00 17.73  ? 4   DG  T N3    1 
ATOM   22   C  C4    . DG  A 1 1   ? 1.187   64.958 21.912 1.00 16.79  ? 4   DG  T C4    1 
ATOM   23   P  P     . DG  A 1 2   ? -4.290  68.219 22.550 1.00 16.41  ? 5   DG  T P     1 
ATOM   24   O  OP1   . DG  A 1 2   ? -4.468  69.595 23.059 1.00 20.21  ? 5   DG  T OP1   1 
ATOM   25   O  OP2   . DG  A 1 2   ? -5.430  67.307 22.448 1.00 21.00  ? 5   DG  T OP2   1 
ATOM   26   O  "O5'" . DG  A 1 2   ? -3.569  68.253 21.153 1.00 18.32  ? 5   DG  T "O5'" 1 
ATOM   27   C  "C5'" . DG  A 1 2   ? -2.731  69.279 20.803 1.00 17.88  ? 5   DG  T "C5'" 1 
ATOM   28   C  "C4'" . DG  A 1 2   ? -2.187  68.880 19.468 1.00 18.95  ? 5   DG  T "C4'" 1 
ATOM   29   O  "O4'" . DG  A 1 2   ? -1.420  67.669 19.648 1.00 21.28  ? 5   DG  T "O4'" 1 
ATOM   30   C  "C3'" . DG  A 1 2   ? -3.248  68.482 18.435 1.00 22.60  ? 5   DG  T "C3'" 1 
ATOM   31   O  "O3'" . DG  A 1 2   ? -3.169  69.365 17.306 1.00 30.16  ? 5   DG  T "O3'" 1 
ATOM   32   C  "C2'" . DG  A 1 2   ? -2.869  67.054 18.032 1.00 23.57  ? 5   DG  T "C2'" 1 
ATOM   33   C  "C1'" . DG  A 1 2   ? -1.402  67.108 18.360 1.00 23.34  ? 5   DG  T "C1'" 1 
ATOM   34   N  N9    . DG  A 1 2   ? -0.708  65.841 18.388 1.00 22.85  ? 5   DG  T N9    1 
ATOM   35   C  C8    . DG  A 1 2   ? -1.254  64.792 19.059 1.00 19.19  ? 5   DG  T C8    1 
ATOM   36   N  N7    . DG  A 1 2   ? -0.457  63.758 19.150 1.00 17.74  ? 5   DG  T N7    1 
ATOM   37   C  C5    . DG  A 1 2   ? 0.674   64.159 18.500 1.00 21.28  ? 5   DG  T C5    1 
ATOM   38   C  C6    . DG  A 1 2   ? 1.838   63.459 18.295 1.00 26.10  ? 5   DG  T C6    1 
ATOM   39   O  O6    . DG  A 1 2   ? 2.088   62.319 18.666 1.00 34.09  ? 5   DG  T O6    1 
ATOM   40   N  N1    . DG  A 1 2   ? 2.771   64.181 17.583 1.00 25.86  ? 5   DG  T N1    1 
ATOM   41   C  C2    . DG  A 1 2   ? 2.592   65.455 17.125 1.00 28.82  ? 5   DG  T C2    1 
ATOM   42   N  N2    . DG  A 1 2   ? 3.639   65.975 16.453 1.00 34.48  ? 5   DG  T N2    1 
ATOM   43   N  N3    . DG  A 1 2   ? 1.489   66.168 17.321 1.00 25.77  ? 5   DG  T N3    1 
ATOM   44   C  C4    . DG  A 1 2   ? 0.563   65.436 18.015 1.00 24.89  ? 5   DG  T C4    1 
ATOM   45   P  P     . DG  A 1 3   ? -3.840  69.108 15.856 1.00 27.21  ? 6   DG  T P     1 
ATOM   46   O  OP1   . DG  A 1 3   ? -4.058  70.402 15.199 1.00 22.74  ? 6   DG  T OP1   1 
ATOM   47   O  OP2   . DG  A 1 3   ? -4.925  68.127 16.058 1.00 31.72  ? 6   DG  T OP2   1 
ATOM   48   O  "O5'" . DG  A 1 3   ? -2.611  68.442 15.084 1.00 27.67  ? 6   DG  T "O5'" 1 
ATOM   49   C  "C5'" . DG  A 1 3   ? -1.518  69.315 14.813 1.00 26.76  ? 6   DG  T "C5'" 1 
ATOM   50   C  "C4'" . DG  A 1 3   ? -0.536  68.719 13.810 1.00 24.07  ? 6   DG  T "C4'" 1 
ATOM   51   O  "O4'" . DG  A 1 3   ? 0.140   67.531 14.325 1.00 24.95  ? 6   DG  T "O4'" 1 
ATOM   52   C  "C3'" . DG  A 1 3   ? -1.117  68.301 12.480 1.00 18.58  ? 6   DG  T "C3'" 1 
ATOM   53   O  "O3'" . DG  A 1 3   ? -0.085  68.434 11.554 1.00 14.02  ? 6   DG  T "O3'" 1 
ATOM   54   C  "C2'" . DG  A 1 3   ? -1.429  66.823 12.706 1.00 21.43  ? 6   DG  T "C2'" 1 
ATOM   55   C  "C1'" . DG  A 1 3   ? -0.185  66.416 13.508 1.00 20.79  ? 6   DG  T "C1'" 1 
ATOM   56   N  N9    . DG  A 1 3   ? -0.362  65.222 14.327 1.00 15.99  ? 6   DG  T N9    1 
ATOM   57   C  C8    . DG  A 1 3   ? -1.329  64.563 15.009 1.00 20.83  ? 6   DG  T C8    1 
ATOM   58   N  N7    . DG  A 1 3   ? -1.006  63.326 15.342 1.00 20.35  ? 6   DG  T N7    1 
ATOM   59   C  C5    . DG  A 1 3   ? 0.255   63.173 14.829 1.00 15.38  ? 6   DG  T C5    1 
ATOM   60   C  C6    . DG  A 1 3   ? 1.104   62.071 14.863 1.00 14.71  ? 6   DG  T C6    1 
ATOM   61   O  O6    . DG  A 1 3   ? 0.914   60.967 15.367 1.00 16.68  ? 6   DG  T O6    1 
ATOM   62   N  N1    . DG  A 1 3   ? 2.279   62.306 14.239 1.00 15.66  ? 6   DG  T N1    1 
ATOM   63   C  C2    . DG  A 1 3   ? 2.611   63.475 13.658 1.00 23.00  ? 6   DG  T C2    1 
ATOM   64   N  N2    . DG  A 1 3   ? 3.841   63.525 13.093 1.00 32.86  ? 6   DG  T N2    1 
ATOM   65   N  N3    . DG  A 1 3   ? 1.824   64.530 13.621 1.00 18.27  ? 6   DG  T N3    1 
ATOM   66   C  C4    . DG  A 1 3   ? 0.662   64.309 14.216 1.00 14.38  ? 6   DG  T C4    1 
ATOM   67   P  P     . DC  A 1 4   ? -0.499  68.697 10.031 1.00 17.95  ? 7   DC  T P     1 
ATOM   68   O  OP1   . DC  A 1 4   ? -0.239  70.128 9.676  1.00 13.65  ? 7   DC  T OP1   1 
ATOM   69   O  OP2   . DC  A 1 4   ? -1.873  68.096 9.855  1.00 20.77  ? 7   DC  T OP2   1 
ATOM   70   O  "O5'" . DC  A 1 4   ? 0.604   67.829 9.310  1.00 9.72   ? 7   DC  T "O5'" 1 
ATOM   71   C  "C5'" . DC  A 1 4   ? 1.852   68.058 9.795  1.00 5.37   ? 7   DC  T "C5'" 1 
ATOM   72   C  "C4'" . DC  A 1 4   ? 2.786   67.289 8.906  1.00 6.59   ? 7   DC  T "C4'" 1 
ATOM   73   O  "O4'" . DC  A 1 4   ? 2.949   65.983 9.430  1.00 8.96   ? 7   DC  T "O4'" 1 
ATOM   74   C  "C3'" . DC  A 1 4   ? 2.301   67.122 7.491  1.00 5.71   ? 7   DC  T "C3'" 1 
ATOM   75   O  "O3'" . DC  A 1 4   ? 3.416   67.215 6.720  1.00 13.95  ? 7   DC  T "O3'" 1 
ATOM   76   C  "C2'" . DC  A 1 4   ? 1.764   65.718 7.436  1.00 5.66   ? 7   DC  T "C2'" 1 
ATOM   77   C  "C1'" . DC  A 1 4   ? 2.512   65.012 8.526  1.00 5.23   ? 7   DC  T "C1'" 1 
ATOM   78   N  N1    . DC  A 1 4   ? 1.686   64.155 9.312  1.00 1.89   ? 7   DC  T N1    1 
ATOM   79   C  C2    . DC  A 1 4   ? 2.443   63.013 9.585  1.00 9.94   ? 7   DC  T C2    1 
ATOM   80   O  O2    . DC  A 1 4   ? 3.579   62.913 9.083  1.00 15.29  ? 7   DC  T O2    1 
ATOM   81   N  N3    . DC  A 1 4   ? 1.913   62.047 10.383 1.00 10.03  ? 7   DC  T N3    1 
ATOM   82   C  C4    . DC  A 1 4   ? 0.700   62.237 10.887 1.00 10.53  ? 7   DC  T C4    1 
ATOM   83   N  N4    . DC  A 1 4   ? 0.200   61.297 11.660 1.00 14.20  ? 7   DC  T N4    1 
ATOM   84   C  C5    . DC  A 1 4   ? -0.077  63.404 10.609 1.00 5.66   ? 7   DC  T C5    1 
ATOM   85   C  C6    . DC  A 1 4   ? 0.460   64.335 9.817  1.00 1.00   ? 7   DC  T C6    1 
ATOM   86   P  P     . DG  A 1 5   ? 3.346   67.239 5.135  1.00 17.58  ? 8   DG  T P     1 
ATOM   87   O  OP1   . DG  A 1 5   ? 4.718   67.750 4.679  1.00 5.81   ? 8   DG  T OP1   1 
ATOM   88   O  OP2   . DG  A 1 5   ? 2.075   67.936 4.669  1.00 20.22  ? 8   DG  T OP2   1 
ATOM   89   O  "O5'" . DG  A 1 5   ? 3.242   65.654 4.882  1.00 10.42  ? 8   DG  T "O5'" 1 
ATOM   90   C  "C5'" . DG  A 1 5   ? 4.534   65.201 4.540  1.00 17.87  ? 8   DG  T "C5'" 1 
ATOM   91   C  "C4'" . DG  A 1 5   ? 4.726   63.704 4.381  1.00 20.69  ? 8   DG  T "C4'" 1 
ATOM   92   O  "O4'" . DG  A 1 5   ? 4.074   62.935 5.412  1.00 25.65  ? 8   DG  T "O4'" 1 
ATOM   93   C  "C3'" . DG  A 1 5   ? 4.318   63.175 3.073  1.00 12.01  ? 8   DG  T "C3'" 1 
ATOM   94   O  "O3'" . DG  A 1 5   ? 5.485   62.658 2.537  1.00 24.71  ? 8   DG  T "O3'" 1 
ATOM   95   C  "C2'" . DG  A 1 5   ? 3.252   62.133 3.342  1.00 8.30   ? 8   DG  T "C2'" 1 
ATOM   96   C  "C1'" . DG  A 1 5   ? 3.252   61.947 4.850  1.00 14.56  ? 8   DG  T "C1'" 1 
ATOM   97   N  N9    . DG  A 1 5   ? 1.951   62.097 5.489  1.00 15.44  ? 8   DG  T N9    1 
ATOM   98   C  C8    . DG  A 1 5   ? 0.826   62.774 5.897  1.00 21.28  ? 8   DG  T C8    1 
ATOM   99   N  N7    . DG  A 1 5   ? 0.065   62.101 6.735  1.00 22.18  ? 8   DG  T N7    1 
ATOM   100  C  C5    . DG  A 1 5   ? 0.752   60.910 6.889  1.00 18.47  ? 8   DG  T C5    1 
ATOM   101  C  C6    . DG  A 1 5   ? 0.425   59.797 7.653  1.00 16.29  ? 8   DG  T C6    1 
ATOM   102  O  O6    . DG  A 1 5   ? -0.567  59.667 8.348  1.00 25.61  ? 8   DG  T O6    1 
ATOM   103  N  N1    . DG  A 1 5   ? 1.343   58.787 7.553  1.00 10.01  ? 8   DG  T N1    1 
ATOM   104  C  C2    . DG  A 1 5   ? 2.463   58.878 6.790  1.00 17.59  ? 8   DG  T C2    1 
ATOM   105  N  N2    . DG  A 1 5   ? 3.287   57.833 6.786  1.00 25.22  ? 8   DG  T N2    1 
ATOM   106  N  N3    . DG  A 1 5   ? 2.797   59.920 6.060  1.00 18.41  ? 8   DG  T N3    1 
ATOM   107  C  C4    . DG  A 1 5   ? 1.897   60.899 6.148  1.00 17.49  ? 8   DG  T C4    1 
ATOM   108  P  P     . DC  A 1 6   ? 5.424   62.047 1.017  1.00 29.58  ? 9   DC  T P     1 
ATOM   109  O  OP1   . DC  A 1 6   ? 6.761   62.185 0.378  1.00 15.40  ? 9   DC  T OP1   1 
ATOM   110  O  OP2   . DC  A 1 6   ? 4.184   62.477 0.313  1.00 29.60  ? 9   DC  T OP2   1 
ATOM   111  O  "O5'" . DC  A 1 6   ? 5.087   60.507 1.425  1.00 25.95  ? 9   DC  T "O5'" 1 
ATOM   112  C  "C5'" . DC  A 1 6   ? 6.022   59.562 1.919  1.00 19.14  ? 9   DC  T "C5'" 1 
ATOM   113  C  "C4'" . DC  A 1 6   ? 5.232   58.296 2.135  1.00 20.49  ? 9   DC  T "C4'" 1 
ATOM   114  O  "O4'" . DC  A 1 6   ? 3.982   58.724 2.594  1.00 22.72  ? 9   DC  T "O4'" 1 
ATOM   115  C  "C3'" . DC  A 1 6   ? 4.808   57.519 0.888  1.00 25.32  ? 9   DC  T "C3'" 1 
ATOM   116  O  "O3'" . DC  A 1 6   ? 5.606   56.376 0.870  1.00 36.98  ? 9   DC  T "O3'" 1 
ATOM   117  C  "C2'" . DC  A 1 6   ? 3.346   57.128 1.158  1.00 21.59  ? 9   DC  T "C2'" 1 
ATOM   118  C  "C1'" . DC  A 1 6   ? 3.196   57.602 2.590  1.00 18.23  ? 9   DC  T "C1'" 1 
ATOM   119  N  N1    . DC  A 1 6   ? 1.902   58.092 2.901  1.00 10.13  ? 9   DC  T N1    1 
ATOM   120  C  C2    . DC  A 1 6   ? 1.507   57.237 3.899  1.00 16.05  ? 9   DC  T C2    1 
ATOM   121  O  O2    . DC  A 1 6   ? 2.158   56.199 4.091  1.00 23.37  ? 9   DC  T O2    1 
ATOM   122  N  N3    . DC  A 1 6   ? 0.427   57.557 4.624  1.00 11.78  ? 9   DC  T N3    1 
ATOM   123  C  C4    . DC  A 1 6   ? -0.211  58.660 4.384  1.00 9.02   ? 9   DC  T C4    1 
ATOM   124  N  N4    . DC  A 1 6   ? -1.259  58.927 5.132  1.00 18.02  ? 9   DC  T N4    1 
ATOM   125  C  C5    . DC  A 1 6   ? 0.190   59.551 3.391  1.00 4.98   ? 9   DC  T C5    1 
ATOM   126  C  C6    . DC  A 1 6   ? 1.262   59.224 2.673  1.00 3.07   ? 9   DC  T C6    1 
ATOM   127  P  P     . DC  A 1 7   ? 5.628   55.274 -0.273 1.00 36.18  ? 10  DC  T P     1 
ATOM   128  O  OP1   . DC  A 1 7   ? 6.888   54.506 -0.034 1.00 28.72  ? 10  DC  T OP1   1 
ATOM   129  O  OP2   . DC  A 1 7   ? 5.317   55.966 -1.552 1.00 41.55  ? 10  DC  T OP2   1 
ATOM   130  O  "O5'" . DC  A 1 7   ? 4.409   54.274 0.093  1.00 31.52  ? 10  DC  T "O5'" 1 
ATOM   131  C  "C5'" . DC  A 1 7   ? 4.834   53.192 0.886  1.00 29.38  ? 10  DC  T "C5'" 1 
ATOM   132  C  "C4'" . DC  A 1 7   ? 3.674   52.664 1.663  1.00 38.26  ? 10  DC  T "C4'" 1 
ATOM   133  O  "O4'" . DC  A 1 7   ? 2.687   53.694 1.695  1.00 35.20  ? 10  DC  T "O4'" 1 
ATOM   134  C  "C3'" . DC  A 1 7   ? 2.936   51.548 0.957  1.00 50.08  ? 10  DC  T "C3'" 1 
ATOM   135  O  "O3'" . DC  A 1 7   ? 3.471   50.278 1.346  1.00 60.81  ? 10  DC  T "O3'" 1 
ATOM   136  C  "C2'" . DC  A 1 7   ? 1.486   51.718 1.408  1.00 44.45  ? 10  DC  T "C2'" 1 
ATOM   137  C  "C1'" . DC  A 1 7   ? 1.476   53.105 2.034  1.00 35.22  ? 10  DC  T "C1'" 1 
ATOM   138  N  N1    . DC  A 1 7   ? 0.544   53.924 1.406  1.00 28.74  ? 10  DC  T N1    1 
ATOM   139  C  C2    . DC  A 1 7   ? -0.443  53.896 2.369  1.00 22.36  ? 10  DC  T C2    1 
ATOM   140  O  O2    . DC  A 1 7   ? -0.543  52.868 3.059  1.00 21.47  ? 10  DC  T O2    1 
ATOM   141  N  N3    . DC  A 1 7   ? -1.253  54.980 2.504  1.00 19.12  ? 10  DC  T N3    1 
ATOM   142  C  C4    . DC  A 1 7   ? -1.054  56.029 1.710  1.00 23.22  ? 10  DC  T C4    1 
ATOM   143  N  N4    . DC  A 1 7   ? -1.840  57.093 1.841  1.00 19.19  ? 10  DC  T N4    1 
ATOM   144  C  C5    . DC  A 1 7   ? -0.020  56.047 0.722  1.00 30.68  ? 10  DC  T C5    1 
ATOM   145  C  C6    . DC  A 1 7   ? 0.764   54.978 0.607  1.00 29.68  ? 10  DC  T C6    1 
ATOM   146  P  P     . DG  A 1 8   ? 3.613   49.289 0.110  1.00 65.30  ? 11  DG  T P     1 
ATOM   147  O  OP1   . DG  A 1 8   ? 4.389   48.091 0.523  1.00 64.13  ? 11  DG  T OP1   1 
ATOM   148  O  OP2   . DG  A 1 8   ? 4.028   50.090 -1.069 1.00 64.71  ? 11  DG  T OP2   1 
ATOM   149  O  "O5'" . DG  A 1 8   ? 2.086   48.885 -0.091 1.00 69.16  ? 11  DG  T "O5'" 1 
ATOM   150  C  "C5'" . DG  A 1 8   ? 1.384   48.263 0.968  1.00 69.08  ? 11  DG  T "C5'" 1 
ATOM   151  C  "C4'" . DG  A 1 8   ? -0.065  48.042 0.561  1.00 66.84  ? 11  DG  T "C4'" 1 
ATOM   152  O  "O4'" . DG  A 1 8   ? -0.782  49.286 0.657  1.00 63.38  ? 11  DG  T "O4'" 1 
ATOM   153  C  "C3'" . DG  A 1 8   ? -0.281  47.601 -0.879 1.00 66.71  ? 11  DG  T "C3'" 1 
ATOM   154  O  "O3'" . DG  A 1 8   ? -1.445  46.768 -0.905 1.00 71.81  ? 11  DG  T "O3'" 1 
ATOM   155  C  "C2'" . DG  A 1 8   ? -0.524  48.932 -1.590 1.00 60.08  ? 11  DG  T "C2'" 1 
ATOM   156  C  "C1'" . DG  A 1 8   ? -1.437  49.533 -0.547 1.00 58.39  ? 11  DG  T "C1'" 1 
ATOM   157  N  N9    . DG  A 1 8   ? -1.686  50.953 -0.626 1.00 53.32  ? 11  DG  T N9    1 
ATOM   158  C  C8    . DG  A 1 8   ? -0.966  51.772 -1.439 1.00 55.30  ? 11  DG  T C8    1 
ATOM   159  N  N7    . DG  A 1 8   ? -1.427  52.995 -1.464 1.00 53.74  ? 11  DG  T N7    1 
ATOM   160  C  C5    . DG  A 1 8   ? -2.512  52.986 -0.617 1.00 48.76  ? 11  DG  T C5    1 
ATOM   161  C  C6    . DG  A 1 8   ? -3.398  54.034 -0.262 1.00 46.41  ? 11  DG  T C6    1 
ATOM   162  O  O6    . DG  A 1 8   ? -3.379  55.196 -0.635 1.00 48.88  ? 11  DG  T O6    1 
ATOM   163  N  N1    . DG  A 1 8   ? -4.383  53.626 0.613  1.00 42.74  ? 11  DG  T N1    1 
ATOM   164  C  C2    . DG  A 1 8   ? -4.471  52.342 1.075  1.00 46.63  ? 11  DG  T C2    1 
ATOM   165  N  N2    . DG  A 1 8   ? -5.478  52.123 1.924  1.00 57.28  ? 11  DG  T N2    1 
ATOM   166  N  N3    . DG  A 1 8   ? -3.655  51.336 0.758  1.00 41.56  ? 11  DG  T N3    1 
ATOM   167  C  C4    . DG  A 1 8   ? -2.696  51.732 -0.094 1.00 47.40  ? 11  DG  T C4    1 
ATOM   168  O  "O5'" . DC  B 2 1   ? -11.785 58.667 1.258  1.00 57.18  ? 1   DC  P "O5'" 1 
ATOM   169  C  "C5'" . DC  B 2 1   ? -11.693 58.483 2.684  1.00 51.11  ? 1   DC  P "C5'" 1 
ATOM   170  C  "C4'" . DC  B 2 1   ? -10.899 57.243 2.950  1.00 45.46  ? 1   DC  P "C4'" 1 
ATOM   171  O  "O4'" . DC  B 2 1   ? -10.168 56.947 1.721  1.00 42.79  ? 1   DC  P "O4'" 1 
ATOM   172  C  "C3'" . DC  B 2 1   ? -9.843  57.433 4.029  1.00 45.49  ? 1   DC  P "C3'" 1 
ATOM   173  O  "O3'" . DC  B 2 1   ? -10.173 56.815 5.231  1.00 35.45  ? 1   DC  P "O3'" 1 
ATOM   174  C  "C2'" . DC  B 2 1   ? -8.558  56.828 3.420  1.00 50.66  ? 1   DC  P "C2'" 1 
ATOM   175  C  "C1'" . DC  B 2 1   ? -8.985  56.267 2.065  1.00 43.46  ? 1   DC  P "C1'" 1 
ATOM   176  N  N1    . DC  B 2 1   ? -7.982  56.456 1.032  1.00 35.02  ? 1   DC  P N1    1 
ATOM   177  C  C2    . DC  B 2 1   ? -6.836  55.654 1.223  1.00 31.89  ? 1   DC  P C2    1 
ATOM   178  O  O2    . DC  B 2 1   ? -6.934  54.599 1.846  1.00 26.94  ? 1   DC  P O2    1 
ATOM   179  N  N3    . DC  B 2 1   ? -5.657  56.071 0.715  1.00 33.47  ? 1   DC  P N3    1 
ATOM   180  C  C4    . DC  B 2 1   ? -5.624  57.241 0.050  1.00 36.52  ? 1   DC  P C4    1 
ATOM   181  N  N4    . DC  B 2 1   ? -4.453  57.648 -0.445 1.00 38.07  ? 1   DC  P N4    1 
ATOM   182  C  C5    . DC  B 2 1   ? -6.785  58.053 -0.145 1.00 35.86  ? 1   DC  P C5    1 
ATOM   183  C  C6    . DC  B 2 1   ? -7.939  57.629 0.360  1.00 32.77  ? 1   DC  P C6    1 
ATOM   184  P  P     . DG  B 2 2   ? -11.286 57.496 6.078  1.00 38.97  ? 2   DG  P P     1 
ATOM   185  O  OP1   . DG  B 2 2   ? -12.469 57.631 5.228  1.00 38.14  ? 2   DG  P OP1   1 
ATOM   186  O  OP2   . DG  B 2 2   ? -10.739 58.705 6.734  1.00 41.22  ? 2   DG  P OP2   1 
ATOM   187  O  "O5'" . DG  B 2 2   ? -11.564 56.344 7.156  1.00 33.79  ? 2   DG  P "O5'" 1 
ATOM   188  C  "C5'" . DG  B 2 2   ? -10.545 55.943 7.992  1.00 27.78  ? 2   DG  P "C5'" 1 
ATOM   189  C  "C4'" . DG  B 2 2   ? -9.837  54.740 7.520  1.00 24.23  ? 2   DG  P "C4'" 1 
ATOM   190  O  "O4'" . DG  B 2 2   ? -9.076  55.217 6.440  1.00 32.59  ? 2   DG  P "O4'" 1 
ATOM   191  C  "C3'" . DG  B 2 2   ? -8.784  54.313 8.504  1.00 21.44  ? 2   DG  P "C3'" 1 
ATOM   192  O  "O3'" . DG  B 2 2   ? -9.264  53.292 9.277  1.00 28.40  ? 2   DG  P "O3'" 1 
ATOM   193  C  "C2'" . DG  B 2 2   ? -7.737  53.704 7.635  1.00 25.92  ? 2   DG  P "C2'" 1 
ATOM   194  C  "C1'" . DG  B 2 2   ? -7.818  54.537 6.413  1.00 31.22  ? 2   DG  P "C1'" 1 
ATOM   195  N  N9    . DG  B 2 2   ? -6.703  55.461 6.368  1.00 24.04  ? 2   DG  P N9    1 
ATOM   196  C  C8    . DG  B 2 2   ? -7.083  56.774 6.152  1.00 24.09  ? 2   DG  P C8    1 
ATOM   197  N  N7    . DG  B 2 2   ? -6.333  57.395 5.282  1.00 19.63  ? 2   DG  P N7    1 
ATOM   198  C  C5    . DG  B 2 2   ? -5.403  56.415 4.902  1.00 17.14  ? 2   DG  P C5    1 
ATOM   199  C  C6    . DG  B 2 2   ? -4.324  56.502 3.986  1.00 14.96  ? 2   DG  P C6    1 
ATOM   200  O  O6    . DG  B 2 2   ? -4.000  57.480 3.326  1.00 20.62  ? 2   DG  P O6    1 
ATOM   201  N  N1    . DG  B 2 2   ? -3.615  55.321 3.849  1.00 9.08   ? 2   DG  P N1    1 
ATOM   202  C  C2    . DG  B 2 2   ? -3.910  54.181 4.540  1.00 11.87  ? 2   DG  P C2    1 
ATOM   203  N  N2    . DG  B 2 2   ? -3.102  53.148 4.286  1.00 4.80   ? 2   DG  P N2    1 
ATOM   204  N  N3    . DG  B 2 2   ? -4.935  54.059 5.431  1.00 18.79  ? 2   DG  P N3    1 
ATOM   205  C  C4    . DG  B 2 2   ? -5.629  55.221 5.555  1.00 18.35  ? 2   DG  P C4    1 
ATOM   206  P  P     . DG  B 2 3   ? -8.489  52.996 10.642 1.00 33.21  ? 3   DG  P P     1 
ATOM   207  O  OP1   . DG  B 2 3   ? -8.735  51.621 11.154 1.00 31.16  ? 3   DG  P OP1   1 
ATOM   208  O  OP2   . DG  B 2 3   ? -8.808  54.180 11.483 1.00 41.05  ? 3   DG  P OP2   1 
ATOM   209  O  "O5'" . DG  B 2 3   ? -6.961  52.957 10.206 1.00 26.94  ? 3   DG  P "O5'" 1 
ATOM   210  C  "C5'" . DG  B 2 3   ? -6.724  51.728 9.621  1.00 29.41  ? 3   DG  P "C5'" 1 
ATOM   211  C  "C4'" . DG  B 2 3   ? -5.258  51.429 9.582  1.00 39.74  ? 3   DG  P "C4'" 1 
ATOM   212  O  "O4'" . DG  B 2 3   ? -4.507  52.134 8.565  1.00 40.68  ? 3   DG  P "O4'" 1 
ATOM   213  C  "C3'" . DG  B 2 3   ? -4.505  51.649 10.852 1.00 45.72  ? 3   DG  P "C3'" 1 
ATOM   214  O  "O3'" . DG  B 2 3   ? -3.487  50.738 10.730 1.00 51.48  ? 3   DG  P "O3'" 1 
ATOM   215  C  "C2'" . DG  B 2 3   ? -3.991  53.071 10.670 1.00 41.56  ? 3   DG  P "C2'" 1 
ATOM   216  C  "C1'" . DG  B 2 3   ? -3.658  53.072 9.178  1.00 38.67  ? 3   DG  P "C1'" 1 
ATOM   217  N  N9    . DG  B 2 3   ? -3.975  54.334 8.532  1.00 34.72  ? 3   DG  P N9    1 
ATOM   218  C  C8    . DG  B 2 3   ? -4.869  55.197 9.095  1.00 33.08  ? 3   DG  P C8    1 
ATOM   219  N  N7    . DG  B 2 3   ? -4.672  56.449 8.754  1.00 30.75  ? 3   DG  P N7    1 
ATOM   220  C  C5    . DG  B 2 3   ? -3.582  56.406 7.915  1.00 31.19  ? 3   DG  P C5    1 
ATOM   221  C  C6    . DG  B 2 3   ? -2.932  57.461 7.238  1.00 28.39  ? 3   DG  P C6    1 
ATOM   222  O  O6    . DG  B 2 3   ? -3.235  58.673 7.284  1.00 25.40  ? 3   DG  P O6    1 
ATOM   223  N  N1    . DG  B 2 3   ? -1.853  56.971 6.467  1.00 24.93  ? 3   DG  P N1    1 
ATOM   224  C  C2    . DG  B 2 3   ? -1.493  55.619 6.386  1.00 23.40  ? 3   DG  P C2    1 
ATOM   225  N  N2    . DG  B 2 3   ? -0.446  55.281 5.614  1.00 22.65  ? 3   DG  P N2    1 
ATOM   226  N  N3    . DG  B 2 3   ? -2.097  54.639 7.022  1.00 24.80  ? 3   DG  P N3    1 
ATOM   227  C  C4    . DG  B 2 3   ? -3.134  55.103 7.763  1.00 31.77  ? 3   DG  P C4    1 
ATOM   228  P  P     . DC  B 2 4   ? -2.719  50.179 11.978 1.00 54.86  ? 4   DC  P P     1 
ATOM   229  O  OP1   . DC  B 2 4   ? -2.631  48.687 11.813 1.00 53.11  ? 4   DC  P OP1   1 
ATOM   230  O  OP2   . DC  B 2 4   ? -3.270  50.828 13.197 1.00 56.67  ? 4   DC  P OP2   1 
ATOM   231  O  "O5'" . DC  B 2 4   ? -1.294  50.815 11.660 1.00 51.17  ? 4   DC  P "O5'" 1 
ATOM   232  C  "C5'" . DC  B 2 4   ? -0.537  50.108 10.695 1.00 43.43  ? 4   DC  P "C5'" 1 
ATOM   233  C  "C4'" . DC  B 2 4   ? 0.527   50.998 10.160 1.00 36.65  ? 4   DC  P "C4'" 1 
ATOM   234  O  "O4'" . DC  B 2 4   ? -0.061  52.290 9.909  1.00 43.95  ? 4   DC  P "O4'" 1 
ATOM   235  C  "C3'" . DC  B 2 4   ? 1.617   51.265 11.153 1.00 31.05  ? 4   DC  P "C3'" 1 
ATOM   236  O  "O3'" . DC  B 2 4   ? 2.550   50.296 10.901 1.00 27.51  ? 4   DC  P "O3'" 1 
ATOM   237  C  "C2'" . DC  B 2 4   ? 2.098   52.691 10.792 1.00 38.84  ? 4   DC  P "C2'" 1 
ATOM   238  C  "C1'" . DC  B 2 4   ? 0.998   53.229 9.834  1.00 43.00  ? 4   DC  P "C1'" 1 
ATOM   239  N  N1    . DC  B 2 4   ? 0.437   54.665 10.085 1.00 40.20  ? 4   DC  P N1    1 
ATOM   240  C  C2    . DC  B 2 4   ? 1.028   55.707 9.362  1.00 39.08  ? 4   DC  P C2    1 
ATOM   241  O  O2    . DC  B 2 4   ? 2.026   55.447 8.671  1.00 40.14  ? 4   DC  P O2    1 
ATOM   242  N  N3    . DC  B 2 4   ? 0.500   56.957 9.438  1.00 37.91  ? 4   DC  P N3    1 
ATOM   243  C  C4    . DC  B 2 4   ? -0.580  57.183 10.206 1.00 37.43  ? 4   DC  P C4    1 
ATOM   244  N  N4    . DC  B 2 4   ? -1.081  58.424 10.274 1.00 36.93  ? 4   DC  P N4    1 
ATOM   245  C  C5    . DC  B 2 4   ? -1.197  56.150 10.940 1.00 35.47  ? 4   DC  P C5    1 
ATOM   246  C  C6    . DC  B 2 4   ? -0.660  54.927 10.845 1.00 38.22  ? 4   DC  P C6    1 
ATOM   247  P  P     . DG  B 2 5   ? 3.877   50.124 11.752 1.00 29.68  ? 5   DG  P P     1 
ATOM   248  O  OP1   . DG  B 2 5   ? 4.903   49.308 11.036 1.00 27.40  ? 5   DG  P OP1   1 
ATOM   249  O  OP2   . DG  B 2 5   ? 3.518   49.752 13.139 1.00 21.77  ? 5   DG  P OP2   1 
ATOM   250  O  "O5'" . DG  B 2 5   ? 4.523   51.575 11.647 1.00 27.15  ? 5   DG  P "O5'" 1 
ATOM   251  C  "C5'" . DG  B 2 5   ? 5.436   51.657 10.542 1.00 19.38  ? 5   DG  P "C5'" 1 
ATOM   252  C  "C4'" . DG  B 2 5   ? 6.155   52.985 10.593 1.00 18.53  ? 5   DG  P "C4'" 1 
ATOM   253  O  "O4'" . DG  B 2 5   ? 5.155   54.046 10.691 1.00 18.12  ? 5   DG  P "O4'" 1 
ATOM   254  C  "C3'" . DG  B 2 5   ? 6.945   53.144 11.866 1.00 19.65  ? 5   DG  P "C3'" 1 
ATOM   255  O  "O3'" . DG  B 2 5   ? 8.213   53.669 11.559 1.00 21.91  ? 5   DG  P "O3'" 1 
ATOM   256  C  "C2'" . DG  B 2 5   ? 6.107   54.125 12.683 1.00 19.98  ? 5   DG  P "C2'" 1 
ATOM   257  C  "C1'" . DG  B 2 5   ? 5.627   55.029 11.550 1.00 17.56  ? 5   DG  P "C1'" 1 
ATOM   258  N  N9    . DG  B 2 5   ? 4.565   56.039 11.863 1.00 20.31  ? 5   DG  P N9    1 
ATOM   259  C  C8    . DG  B 2 5   ? 3.546   55.622 12.692 1.00 16.37  ? 5   DG  P C8    1 
ATOM   260  N  N7    . DG  B 2 5   ? 2.515   56.430 12.718 1.00 13.87  ? 5   DG  P N7    1 
ATOM   261  C  C5    . DG  B 2 5   ? 2.848   57.473 11.869 1.00 12.37  ? 5   DG  P C5    1 
ATOM   262  C  C6    . DG  B 2 5   ? 2.105   58.602 11.506 1.00 6.01   ? 5   DG  P C6    1 
ATOM   263  O  O6    . DG  B 2 5   ? 0.964   58.910 11.879 1.00 3.93   ? 5   DG  P O6    1 
ATOM   264  N  N1    . DG  B 2 5   ? 2.779   59.397 10.610 1.00 8.26   ? 5   DG  P N1    1 
ATOM   265  C  C2    . DG  B 2 5   ? 4.031   59.131 10.109 1.00 11.92  ? 5   DG  P C2    1 
ATOM   266  N  N2    . DG  B 2 5   ? 4.567   60.013 9.245  1.00 7.12   ? 5   DG  P N2    1 
ATOM   267  N  N3    . DG  B 2 5   ? 4.745   58.071 10.433 1.00 19.44  ? 5   DG  P N3    1 
ATOM   268  C  C4    . DG  B 2 5   ? 4.097   57.270 11.325 1.00 20.22  ? 5   DG  P C4    1 
ATOM   269  P  P     . DC  B 2 6   ? 9.176   54.067 12.798 1.00 27.05  ? 6   DC  P P     1 
ATOM   270  O  OP1   . DC  B 2 6   ? 10.629  53.915 12.480 1.00 28.97  ? 6   DC  P OP1   1 
ATOM   271  O  OP2   . DC  B 2 6   ? 8.658   53.366 14.003 1.00 36.44  ? 6   DC  P OP2   1 
ATOM   272  O  "O5'" . DC  B 2 6   ? 8.833   55.621 12.867 1.00 15.01  ? 6   DC  P "O5'" 1 
ATOM   273  C  "C5'" . DC  B 2 6   ? 9.187   56.356 11.745 1.00 10.40  ? 6   DC  P "C5'" 1 
ATOM   274  C  "C4'" . DC  B 2 6   ? 8.811   57.813 11.872 1.00 12.36  ? 6   DC  P "C4'" 1 
ATOM   275  O  "O4'" . DC  B 2 6   ? 7.381   57.953 12.058 1.00 10.82  ? 6   DC  P "O4'" 1 
ATOM   276  C  "C3'" . DC  B 2 6   ? 9.492   58.512 13.044 1.00 17.84  ? 6   DC  P "C3'" 1 
ATOM   277  O  "O3'" . DC  B 2 6   ? 10.543  59.373 12.651 1.00 15.19  ? 6   DC  P "O3'" 1 
ATOM   278  C  "C2'" . DC  B 2 6   ? 8.373   59.269 13.738 1.00 21.75  ? 6   DC  P "C2'" 1 
ATOM   279  C  "C1'" . DC  B 2 6   ? 7.167   59.102 12.826 1.00 15.00  ? 6   DC  P "C1'" 1 
ATOM   280  N  N1    . DC  B 2 6   ? 6.022   58.943 13.643 1.00 13.49  ? 6   DC  P N1    1 
ATOM   281  C  C2    . DC  B 2 6   ? 5.184   59.974 13.399 1.00 19.63  ? 6   DC  P C2    1 
ATOM   282  O  O2    . DC  B 2 6   ? 5.573   60.883 12.657 1.00 29.10  ? 6   DC  P O2    1 
ATOM   283  N  N3    . DC  B 2 6   ? 3.986   59.962 13.955 1.00 14.87  ? 6   DC  P N3    1 
ATOM   284  C  C4    . DC  B 2 6   ? 3.639   58.977 14.730 1.00 11.99  ? 6   DC  P C4    1 
ATOM   285  N  N4    . DC  B 2 6   ? 2.426   58.982 15.284 1.00 14.58  ? 6   DC  P N4    1 
ATOM   286  C  C5    . DC  B 2 6   ? 4.492   57.928 14.997 1.00 12.03  ? 6   DC  P C5    1 
ATOM   287  C  C6    . DC  B 2 6   ? 5.676   57.958 14.434 1.00 13.12  ? 6   DC  P C6    1 
ATOM   288  P  P     . DC  B 2 7   ? 11.504  60.098 13.717 1.00 18.62  ? 7   DC  P P     1 
ATOM   289  O  OP1   . DC  B 2 7   ? 12.778  60.420 13.015 1.00 20.20  ? 7   DC  P OP1   1 
ATOM   290  O  OP2   . DC  B 2 7   ? 11.516  59.329 14.976 1.00 23.50  ? 7   DC  P OP2   1 
ATOM   291  O  "O5'" . DC  B 2 7   ? 10.722  61.456 13.936 1.00 21.43  ? 7   DC  P "O5'" 1 
ATOM   292  C  "C5'" . DC  B 2 7   ? 10.243  62.152 12.722 1.00 22.25  ? 7   DC  P "C5'" 1 
ATOM   293  C  "C4'" . DC  B 2 7   ? 9.645   63.409 13.247 1.00 20.19  ? 7   DC  P "C4'" 1 
ATOM   294  O  "O4'" . DC  B 2 7   ? 8.210   63.341 13.323 1.00 17.70  ? 7   DC  P "O4'" 1 
ATOM   295  C  "C3'" . DC  B 2 7   ? 10.009  63.614 14.719 1.00 18.24  ? 7   DC  P "C3'" 1 
ATOM   296  C  "C2'" . DC  B 2 7   ? 9.037   64.732 15.017 1.00 17.19  ? 7   DC  P "C2'" 1 
ATOM   297  C  "C1'" . DC  B 2 7   ? 7.813   64.038 14.498 1.00 13.55  ? 7   DC  P "C1'" 1 
ATOM   298  N  N1    . DC  B 2 7   ? 7.494   63.071 15.485 1.00 8.98   ? 7   DC  P N1    1 
ATOM   299  C  C2    . DC  B 2 7   ? 6.346   63.757 15.905 1.00 12.04  ? 7   DC  P C2    1 
ATOM   300  O  O2    . DC  B 2 7   ? 6.192   64.975 15.718 1.00 11.65  ? 7   DC  P O2    1 
ATOM   301  N  N3    . DC  B 2 7   ? 5.396   63.075 16.521 1.00 12.50  ? 7   DC  P N3    1 
ATOM   302  C  C4    . DC  B 2 7   ? 5.547   61.809 16.729 1.00 10.72  ? 7   DC  P C4    1 
ATOM   303  N  N4    . DC  B 2 7   ? 4.565   61.245 17.357 1.00 8.21   ? 7   DC  P N4    1 
ATOM   304  C  C5    . DC  B 2 7   ? 6.692   61.085 16.323 1.00 11.85  ? 7   DC  P C5    1 
ATOM   305  C  C6    . DC  B 2 7   ? 7.656   61.762 15.700 1.00 7.72   ? 7   DC  P C6    1 
ATOM   306  N  N     . GLU C 3 9   ? 23.181  25.638 48.290 1.00 91.10  ? 9   GLU A N     1 
ATOM   307  C  CA    . GLU C 3 9   ? 23.044  26.204 49.616 1.00 90.53  ? 9   GLU A CA    1 
ATOM   308  C  C     . GLU C 3 9   ? 21.933  27.260 49.703 1.00 90.30  ? 9   GLU A C     1 
ATOM   309  O  O     . GLU C 3 9   ? 20.804  26.893 50.067 1.00 89.55  ? 9   GLU A O     1 
ATOM   310  C  CB    . GLU C 3 9   ? 24.402  26.703 50.127 1.00 89.31  ? 9   GLU A CB    1 
ATOM   311  C  CG    . GLU C 3 9   ? 25.545  25.789 49.625 1.00 87.94  ? 9   GLU A CG    1 
ATOM   312  C  CD    . GLU C 3 9   ? 26.931  26.271 49.987 1.00 86.71  ? 9   GLU A CD    1 
ATOM   313  O  OE1   . GLU C 3 9   ? 27.003  26.859 51.173 1.00 85.78  ? 9   GLU A OE1   1 
ATOM   314  O  OE2   . GLU C 3 9   ? 27.896  26.065 49.271 1.00 85.37  ? 9   GLU A OE2   1 
ATOM   315  N  N     . THR C 3 10  ? 22.285  28.527 49.356 1.00 90.08  ? 10  THR A N     1 
ATOM   316  C  CA    . THR C 3 10  ? 21.435  29.751 49.345 1.00 87.29  ? 10  THR A CA    1 
ATOM   317  C  C     . THR C 3 10  ? 19.946  29.479 49.562 1.00 77.68  ? 10  THR A C     1 
ATOM   318  O  O     . THR C 3 10  ? 19.260  28.928 48.696 1.00 79.03  ? 10  THR A O     1 
ATOM   319  C  CB    . THR C 3 10  ? 21.707  30.713 48.133 1.00 89.52  ? 10  THR A CB    1 
ATOM   320  O  OG1   . THR C 3 10  ? 21.464  32.080 48.458 1.00 88.32  ? 10  THR A OG1   1 
ATOM   321  C  CG2   . THR C 3 10  ? 20.882  30.318 46.901 1.00 89.51  ? 10  THR A CG2   1 
ATOM   322  N  N     . LEU C 3 11  ? 19.476  29.871 50.746 1.00 65.74  ? 11  LEU A N     1 
ATOM   323  C  CA    . LEU C 3 11  ? 18.111  29.686 51.159 1.00 59.96  ? 11  LEU A CA    1 
ATOM   324  C  C     . LEU C 3 11  ? 17.033  30.013 50.147 1.00 61.86  ? 11  LEU A C     1 
ATOM   325  O  O     . LEU C 3 11  ? 16.341  29.119 49.622 1.00 67.59  ? 11  LEU A O     1 
ATOM   326  C  CB    . LEU C 3 11  ? 17.744  30.512 52.396 1.00 57.26  ? 11  LEU A CB    1 
ATOM   327  C  CG    . LEU C 3 11  ? 18.915  31.002 53.206 1.00 60.95  ? 11  LEU A CG    1 
ATOM   328  C  CD1   . LEU C 3 11  ? 19.836  29.851 53.514 1.00 64.55  ? 11  LEU A CD1   1 
ATOM   329  C  CD2   . LEU C 3 11  ? 19.667  32.086 52.451 1.00 64.53  ? 11  LEU A CD2   1 
ATOM   330  N  N     . ASN C 3 12  ? 16.884  31.320 49.900 1.00 51.65  ? 12  ASN A N     1 
ATOM   331  C  CA    . ASN C 3 12  ? 15.874  31.814 49.009 1.00 40.93  ? 12  ASN A CA    1 
ATOM   332  C  C     . ASN C 3 12  ? 16.091  31.758 47.526 1.00 37.76  ? 12  ASN A C     1 
ATOM   333  O  O     . ASN C 3 12  ? 15.312  32.398 46.760 1.00 35.05  ? 12  ASN A O     1 
ATOM   334  C  CB    . ASN C 3 12  ? 15.443  33.149 49.540 1.00 39.99  ? 12  ASN A CB    1 
ATOM   335  C  CG    . ASN C 3 12  ? 15.487  33.059 51.044 1.00 40.71  ? 12  ASN A CG    1 
ATOM   336  O  OD1   . ASN C 3 12  ? 16.099  33.890 51.723 1.00 42.22  ? 12  ASN A OD1   1 
ATOM   337  N  ND2   . ASN C 3 12  ? 14.888  32.000 51.570 1.00 42.68  ? 12  ASN A ND2   1 
ATOM   338  N  N     . GLY C 3 13  ? 17.145  30.988 47.179 1.00 31.71  ? 13  GLY A N     1 
ATOM   339  C  CA    . GLY C 3 13  ? 17.565  30.771 45.828 1.00 24.38  ? 13  GLY A CA    1 
ATOM   340  C  C     . GLY C 3 13  ? 16.342  30.559 44.996 1.00 24.19  ? 13  GLY A C     1 
ATOM   341  O  O     . GLY C 3 13  ? 15.928  31.486 44.262 1.00 21.80  ? 13  GLY A O     1 
ATOM   342  N  N     . GLY C 3 14  ? 15.807  29.365 45.197 1.00 26.86  ? 14  GLY A N     1 
ATOM   343  C  CA    . GLY C 3 14  ? 14.627  28.872 44.542 1.00 33.11  ? 14  GLY A CA    1 
ATOM   344  C  C     . GLY C 3 14  ? 13.655  29.979 44.205 1.00 40.18  ? 14  GLY A C     1 
ATOM   345  O  O     . GLY C 3 14  ? 13.339  30.131 43.020 1.00 43.40  ? 14  GLY A O     1 
ATOM   346  N  N     . ILE C 3 15  ? 13.244  30.763 45.239 1.00 41.06  ? 15  ILE A N     1 
ATOM   347  C  CA    . ILE C 3 15  ? 12.316  31.869 44.991 1.00 46.14  ? 15  ILE A CA    1 
ATOM   348  C  C     . ILE C 3 15  ? 12.862  32.904 44.037 1.00 43.86  ? 15  ILE A C     1 
ATOM   349  O  O     . ILE C 3 15  ? 12.335  32.959 42.910 1.00 45.00  ? 15  ILE A O     1 
ATOM   350  C  CB    . ILE C 3 15  ? 11.600  32.573 46.173 1.00 54.50  ? 15  ILE A CB    1 
ATOM   351  C  CG1   . ILE C 3 15  ? 11.560  34.083 45.947 1.00 56.38  ? 15  ILE A CG1   1 
ATOM   352  C  CG2   . ILE C 3 15  ? 12.163  32.299 47.566 1.00 57.15  ? 15  ILE A CG2   1 
ATOM   353  C  CD1   . ILE C 3 15  ? 11.725  34.827 47.278 1.00 58.03  ? 15  ILE A CD1   1 
ATOM   354  N  N     . THR C 3 16  ? 13.911  33.675 44.486 1.00 36.48  ? 16  THR A N     1 
ATOM   355  C  CA    . THR C 3 16  ? 14.545  34.716 43.677 1.00 29.07  ? 16  THR A CA    1 
ATOM   356  C  C     . THR C 3 16  ? 14.660  34.291 42.258 1.00 27.16  ? 16  THR A C     1 
ATOM   357  O  O     . THR C 3 16  ? 14.611  35.108 41.357 1.00 27.78  ? 16  THR A O     1 
ATOM   358  C  CB    . THR C 3 16  ? 15.960  35.155 44.082 1.00 24.60  ? 16  THR A CB    1 
ATOM   359  O  OG1   . THR C 3 16  ? 16.718  34.145 44.691 1.00 24.09  ? 16  THR A OG1   1 
ATOM   360  C  CG2   . THR C 3 16  ? 15.945  36.441 44.846 1.00 21.64  ? 16  THR A CG2   1 
ATOM   361  N  N     . ASP C 3 17  ? 14.822  33.002 42.068 1.00 27.66  ? 17  ASP A N     1 
ATOM   362  C  CA    . ASP C 3 17  ? 14.916  32.582 40.718 1.00 36.94  ? 17  ASP A CA    1 
ATOM   363  C  C     . ASP C 3 17  ? 13.617  32.874 40.004 1.00 40.11  ? 17  ASP A C     1 
ATOM   364  O  O     . ASP C 3 17  ? 13.558  33.567 38.985 1.00 43.29  ? 17  ASP A O     1 
ATOM   365  C  CB    . ASP C 3 17  ? 15.314  31.124 40.614 1.00 39.53  ? 17  ASP A CB    1 
ATOM   366  C  CG    . ASP C 3 17  ? 16.743  31.057 40.979 1.00 42.96  ? 17  ASP A CG    1 
ATOM   367  O  OD1   . ASP C 3 17  ? 17.287  32.268 41.036 1.00 42.10  ? 17  ASP A OD1   1 
ATOM   368  O  OD2   . ASP C 3 17  ? 17.301  30.009 41.235 1.00 44.09  ? 17  ASP A OD2   1 
ATOM   369  N  N     . MET C 3 18  ? 12.560  32.354 40.565 1.00 39.29  ? 18  MET A N     1 
ATOM   370  C  CA    . MET C 3 18  ? 11.252  32.549 39.973 1.00 44.11  ? 18  MET A CA    1 
ATOM   371  C  C     . MET C 3 18  ? 10.890  33.986 39.685 1.00 40.93  ? 18  MET A C     1 
ATOM   372  O  O     . MET C 3 18  ? 10.450  34.416 38.591 1.00 36.33  ? 18  MET A O     1 
ATOM   373  C  CB    . MET C 3 18  ? 10.218  31.945 40.907 1.00 51.05  ? 18  MET A CB    1 
ATOM   374  C  CG    . MET C 3 18  ? 8.823   32.448 40.631 1.00 56.23  ? 18  MET A CG    1 
ATOM   375  S  SD    . MET C 3 18  ? 8.271   33.637 41.867 1.00 58.53  ? 18  MET A SD    1 
ATOM   376  C  CE    . MET C 3 18  ? 8.252   32.605 43.348 1.00 58.12  ? 18  MET A CE    1 
ATOM   377  N  N     . LEU C 3 19  ? 11.111  34.700 40.750 1.00 41.58  ? 19  LEU A N     1 
ATOM   378  C  CA    . LEU C 3 19  ? 10.877  36.092 40.842 1.00 43.44  ? 19  LEU A CA    1 
ATOM   379  C  C     . LEU C 3 19  ? 11.537  36.836 39.684 1.00 48.64  ? 19  LEU A C     1 
ATOM   380  O  O     . LEU C 3 19  ? 10.933  37.669 38.996 1.00 47.46  ? 19  LEU A O     1 
ATOM   381  C  CB    . LEU C 3 19  ? 11.441  36.499 42.199 1.00 43.26  ? 19  LEU A CB    1 
ATOM   382  C  CG    . LEU C 3 19  ? 10.559  37.524 42.856 1.00 47.04  ? 19  LEU A CG    1 
ATOM   383  C  CD1   . LEU C 3 19  ? 9.155   37.377 42.282 1.00 46.17  ? 19  LEU A CD1   1 
ATOM   384  C  CD2   . LEU C 3 19  ? 10.537  37.189 44.335 1.00 50.12  ? 19  LEU A CD2   1 
ATOM   385  N  N     . VAL C 3 20  ? 12.804  36.526 39.465 1.00 52.98  ? 20  VAL A N     1 
ATOM   386  C  CA    . VAL C 3 20  ? 13.522  37.160 38.392 1.00 57.45  ? 20  VAL A CA    1 
ATOM   387  C  C     . VAL C 3 20  ? 12.985  36.713 37.034 1.00 61.24  ? 20  VAL A C     1 
ATOM   388  O  O     . VAL C 3 20  ? 12.885  37.496 36.091 1.00 61.82  ? 20  VAL A O     1 
ATOM   389  C  CB    . VAL C 3 20  ? 15.019  36.998 38.545 1.00 57.79  ? 20  VAL A CB    1 
ATOM   390  C  CG1   . VAL C 3 20  ? 15.395  35.557 38.283 1.00 63.51  ? 20  VAL A CG1   1 
ATOM   391  C  CG2   . VAL C 3 20  ? 15.767  37.901 37.595 1.00 55.00  ? 20  VAL A CG2   1 
ATOM   392  N  N     . GLU C 3 21  ? 12.632  35.438 36.920 1.00 62.72  ? 21  GLU A N     1 
ATOM   393  C  CA    . GLU C 3 21  ? 12.107  34.980 35.649 1.00 68.75  ? 21  GLU A CA    1 
ATOM   394  C  C     . GLU C 3 21  ? 10.852  35.734 35.340 1.00 60.74  ? 21  GLU A C     1 
ATOM   395  O  O     . GLU C 3 21  ? 10.580  36.180 34.216 1.00 58.93  ? 21  GLU A O     1 
ATOM   396  C  CB    . GLU C 3 21  ? 11.790  33.495 35.649 1.00 79.80  ? 21  GLU A CB    1 
ATOM   397  C  CG    . GLU C 3 21  ? 12.958  32.677 35.120 1.00 89.64  ? 21  GLU A CG    1 
ATOM   398  C  CD    . GLU C 3 21  ? 13.040  31.374 35.837 1.00 98.14  ? 21  GLU A CD    1 
ATOM   399  O  OE1   . GLU C 3 21  ? 11.900  31.049 36.417 1.00 100.00 ? 21  GLU A OE1   1 
ATOM   400  O  OE2   . GLU C 3 21  ? 14.068  30.711 35.897 1.00 100.00 ? 21  GLU A OE2   1 
ATOM   401  N  N     . LEU C 3 22  ? 10.101  35.849 36.406 1.00 52.44  ? 22  LEU A N     1 
ATOM   402  C  CA    . LEU C 3 22  ? 8.864   36.537 36.331 1.00 48.00  ? 22  LEU A CA    1 
ATOM   403  C  C     . LEU C 3 22  ? 9.096   37.956 35.796 1.00 42.35  ? 22  LEU A C     1 
ATOM   404  O  O     . LEU C 3 22  ? 8.498   38.346 34.797 1.00 39.36  ? 22  LEU A O     1 
ATOM   405  C  CB    . LEU C 3 22  ? 8.300   36.548 37.746 1.00 49.25  ? 22  LEU A CB    1 
ATOM   406  C  CG    . LEU C 3 22  ? 6.794   36.477 37.846 1.00 50.74  ? 22  LEU A CG    1 
ATOM   407  C  CD1   . LEU C 3 22  ? 6.264   35.237 37.146 1.00 47.32  ? 22  LEU A CD1   1 
ATOM   408  C  CD2   . LEU C 3 22  ? 6.468   36.360 39.329 1.00 57.09  ? 22  LEU A CD2   1 
ATOM   409  N  N     . ALA C 3 23  ? 9.975   38.729 36.449 1.00 39.08  ? 23  ALA A N     1 
ATOM   410  C  CA    . ALA C 3 23  ? 10.206  40.063 35.963 1.00 41.07  ? 23  ALA A CA    1 
ATOM   411  C  C     . ALA C 3 23  ? 10.646  40.095 34.529 1.00 49.60  ? 23  ALA A C     1 
ATOM   412  O  O     . ALA C 3 23  ? 10.292  41.019 33.803 1.00 52.59  ? 23  ALA A O     1 
ATOM   413  C  CB    . ALA C 3 23  ? 10.998  41.008 36.845 1.00 36.67  ? 23  ALA A CB    1 
ATOM   414  N  N     . ASN C 3 24  ? 11.417  39.105 34.106 1.00 54.51  ? 24  ASN A N     1 
ATOM   415  C  CA    . ASN C 3 24  ? 11.659  39.383 32.719 1.00 62.93  ? 24  ASN A CA    1 
ATOM   416  C  C     . ASN C 3 24  ? 10.660  39.192 31.731 1.00 64.90  ? 24  ASN A C     1 
ATOM   417  O  O     . ASN C 3 24  ? 10.607  39.970 30.774 1.00 60.28  ? 24  ASN A O     1 
ATOM   418  C  CB    . ASN C 3 24  ? 13.251  39.421 32.250 1.00 66.48  ? 24  ASN A CB    1 
ATOM   419  C  CG    . ASN C 3 24  ? 14.008  38.119 32.290 1.00 70.81  ? 24  ASN A CG    1 
ATOM   420  O  OD1   . ASN C 3 24  ? 14.609  37.754 33.332 1.00 72.86  ? 24  ASN A OD1   1 
ATOM   421  N  ND2   . ASN C 3 24  ? 13.775  37.320 31.245 1.00 71.72  ? 24  ASN A ND2   1 
ATOM   422  N  N     . PHE C 3 25  ? 9.719   38.299 32.048 1.00 69.00  ? 25  PHE A N     1 
ATOM   423  C  CA    . PHE C 3 25  ? 8.519   38.161 31.278 1.00 69.31  ? 25  PHE A CA    1 
ATOM   424  C  C     . PHE C 3 25  ? 7.801   39.510 31.284 1.00 72.60  ? 25  PHE A C     1 
ATOM   425  O  O     . PHE C 3 25  ? 7.609   40.105 30.229 1.00 77.45  ? 25  PHE A O     1 
ATOM   426  C  CB    . PHE C 3 25  ? 7.623   37.075 31.856 1.00 66.58  ? 25  PHE A CB    1 
ATOM   427  N  N     . GLU C 3 26  ? 7.428   39.992 32.486 1.00 67.02  ? 26  GLU A N     1 
ATOM   428  C  CA    . GLU C 3 26  ? 6.737   41.251 32.645 1.00 59.88  ? 26  GLU A CA    1 
ATOM   429  C  C     . GLU C 3 26  ? 7.392   42.350 31.839 1.00 59.67  ? 26  GLU A C     1 
ATOM   430  O  O     . GLU C 3 26  ? 6.736   43.161 31.218 1.00 59.62  ? 26  GLU A O     1 
ATOM   431  C  CB    . GLU C 3 26  ? 6.633   41.626 34.122 1.00 58.08  ? 26  GLU A CB    1 
ATOM   432  C  CG    . GLU C 3 26  ? 5.194   42.004 34.532 1.00 59.83  ? 26  GLU A CG    1 
ATOM   433  C  CD    . GLU C 3 26  ? 4.183   40.908 34.239 1.00 58.90  ? 26  GLU A CD    1 
ATOM   434  O  OE1   . GLU C 3 26  ? 3.715   40.983 33.023 1.00 58.04  ? 26  GLU A OE1   1 
ATOM   435  O  OE2   . GLU C 3 26  ? 3.809   40.064 35.056 1.00 57.91  ? 26  GLU A OE2   1 
ATOM   436  N  N     . LYS C 3 27  ? 8.705   42.328 31.849 1.00 64.43  ? 27  LYS A N     1 
ATOM   437  C  CA    . LYS C 3 27  ? 9.565   43.265 31.158 1.00 70.75  ? 27  LYS A CA    1 
ATOM   438  C  C     . LYS C 3 27  ? 9.401   43.306 29.639 1.00 77.78  ? 27  LYS A C     1 
ATOM   439  O  O     . LYS C 3 27  ? 9.288   44.405 29.070 1.00 77.18  ? 27  LYS A O     1 
ATOM   440  C  CB    . LYS C 3 27  ? 11.017  43.012 31.588 1.00 71.07  ? 27  LYS A CB    1 
ATOM   441  C  CG    . LYS C 3 27  ? 12.110  43.433 30.618 1.00 70.26  ? 27  LYS A CG    1 
ATOM   442  C  CD    . LYS C 3 27  ? 12.072  44.912 30.308 1.00 72.50  ? 27  LYS A CD    1 
ATOM   443  C  CE    . LYS C 3 27  ? 13.175  45.320 29.357 1.00 74.99  ? 27  LYS A CE    1 
ATOM   444  N  NZ    . LYS C 3 27  ? 13.438  46.765 29.392 1.00 76.48  ? 27  LYS A NZ    1 
ATOM   445  N  N     . ASN C 3 28  ? 9.400   42.097 29.021 1.00 85.27  ? 28  ASN A N     1 
ATOM   446  C  CA    . ASN C 3 28  ? 9.280   41.818 27.566 1.00 89.31  ? 28  ASN A CA    1 
ATOM   447  C  C     . ASN C 3 28  ? 7.880   41.520 26.975 1.00 90.99  ? 28  ASN A C     1 
ATOM   448  O  O     . ASN C 3 28  ? 7.394   42.273 26.119 1.00 91.82  ? 28  ASN A O     1 
ATOM   449  C  CB    . ASN C 3 28  ? 10.233  40.691 27.211 1.00 89.78  ? 28  ASN A CB    1 
ATOM   450  N  N     . VAL C 3 29  ? 7.244   40.410 27.423 1.00 89.18  ? 29  VAL A N     1 
ATOM   451  C  CA    . VAL C 3 29  ? 5.902   39.964 26.988 1.00 82.79  ? 29  VAL A CA    1 
ATOM   452  C  C     . VAL C 3 29  ? 4.889   41.115 27.128 1.00 83.06  ? 29  VAL A C     1 
ATOM   453  O  O     . VAL C 3 29  ? 3.774   41.071 26.575 1.00 86.09  ? 29  VAL A O     1 
ATOM   454  C  CB    . VAL C 3 29  ? 5.430   38.739 27.822 1.00 75.18  ? 29  VAL A CB    1 
ATOM   455  C  CG1   . VAL C 3 29  ? 3.921   38.696 28.026 1.00 73.76  ? 29  VAL A CG1   1 
ATOM   456  C  CG2   . VAL C 3 29  ? 5.859   37.424 27.193 1.00 72.43  ? 29  VAL A CG2   1 
ATOM   457  N  N     . SER C 3 30  ? 5.310   42.159 27.880 1.00 76.23  ? 30  SER A N     1 
ATOM   458  C  CA    . SER C 3 30  ? 4.510   43.345 28.165 1.00 65.44  ? 30  SER A CA    1 
ATOM   459  C  C     . SER C 3 30  ? 5.308   44.627 28.101 1.00 62.92  ? 30  SER A C     1 
ATOM   460  O  O     . SER C 3 30  ? 6.313   44.764 27.428 1.00 63.06  ? 30  SER A O     1 
ATOM   461  C  CB    . SER C 3 30  ? 4.048   43.220 29.612 1.00 58.02  ? 30  SER A CB    1 
ATOM   462  O  OG    . SER C 3 30  ? 3.571   41.901 29.878 1.00 54.57  ? 30  SER A OG    1 
ATOM   463  N  N     . GLN C 3 31  ? 4.820   45.600 28.814 1.00 63.88  ? 31  GLN A N     1 
ATOM   464  C  CA    . GLN C 3 31  ? 5.502   46.865 28.876 1.00 70.54  ? 31  GLN A CA    1 
ATOM   465  C  C     . GLN C 3 31  ? 5.827   46.916 30.370 1.00 70.79  ? 31  GLN A C     1 
ATOM   466  O  O     . GLN C 3 31  ? 6.903   47.313 30.807 1.00 76.42  ? 31  GLN A O     1 
ATOM   467  C  CB    . GLN C 3 31  ? 4.657   48.084 28.507 1.00 79.15  ? 31  GLN A CB    1 
ATOM   468  C  CG    . GLN C 3 31  ? 4.406   49.016 29.727 1.00 87.99  ? 31  GLN A CG    1 
ATOM   469  C  CD    . GLN C 3 31  ? 5.575   49.963 30.059 1.00 91.90  ? 31  GLN A CD    1 
ATOM   470  O  OE1   . GLN C 3 31  ? 5.416   51.010 30.730 1.00 91.10  ? 31  GLN A OE1   1 
ATOM   471  N  NE2   . GLN C 3 31  ? 6.750   49.622 29.546 1.00 93.99  ? 31  GLN A NE2   1 
ATOM   472  N  N     . ALA C 3 32  ? 4.815   46.450 31.116 1.00 61.74  ? 32  ALA A N     1 
ATOM   473  C  CA    . ALA C 3 32  ? 4.699   46.309 32.560 1.00 50.95  ? 32  ALA A CA    1 
ATOM   474  C  C     . ALA C 3 32  ? 5.949   46.646 33.379 1.00 42.30  ? 32  ALA A C     1 
ATOM   475  O  O     . ALA C 3 32  ? 6.325   45.934 34.312 1.00 42.60  ? 32  ALA A O     1 
ATOM   476  C  CB    . ALA C 3 32  ? 4.195   44.887 32.845 1.00 48.20  ? 32  ALA A CB    1 
ATOM   477  N  N     . ILE C 3 33  ? 6.575   47.724 33.027 1.00 37.80  ? 33  ILE A N     1 
ATOM   478  C  CA    . ILE C 3 33  ? 7.769   48.185 33.679 1.00 42.82  ? 33  ILE A CA    1 
ATOM   479  C  C     . ILE C 3 33  ? 7.566   48.238 35.193 1.00 43.59  ? 33  ILE A C     1 
ATOM   480  O  O     . ILE C 3 33  ? 8.366   47.720 35.990 1.00 45.14  ? 33  ILE A O     1 
ATOM   481  C  CB    . ILE C 3 33  ? 8.133   49.550 33.056 1.00 50.40  ? 33  ILE A CB    1 
ATOM   482  C  CG1   . ILE C 3 33  ? 9.406   50.202 33.590 1.00 57.88  ? 33  ILE A CG1   1 
ATOM   483  C  CG2   . ILE C 3 33  ? 6.964   50.503 33.261 1.00 51.46  ? 33  ILE A CG2   1 
ATOM   484  C  CD1   . ILE C 3 33  ? 10.644  49.299 33.667 1.00 62.28  ? 33  ILE A CD1   1 
ATOM   485  N  N     . HIS C 3 34  ? 6.466   48.843 35.578 1.00 42.80  ? 34  HIS A N     1 
ATOM   486  C  CA    . HIS C 3 34  ? 6.142   48.966 36.966 1.00 43.76  ? 34  HIS A CA    1 
ATOM   487  C  C     . HIS C 3 34  ? 6.109   47.633 37.609 1.00 40.76  ? 34  HIS A C     1 
ATOM   488  O  O     . HIS C 3 34  ? 6.572   47.470 38.746 1.00 43.12  ? 34  HIS A O     1 
ATOM   489  C  CB    . HIS C 3 34  ? 4.826   49.695 37.172 1.00 49.32  ? 34  HIS A CB    1 
ATOM   490  C  CG    . HIS C 3 34  ? 4.949   51.013 36.526 1.00 58.79  ? 34  HIS A CG    1 
ATOM   491  N  ND1   . HIS C 3 34  ? 4.237   51.329 35.377 1.00 62.31  ? 34  HIS A ND1   1 
ATOM   492  C  CD2   . HIS C 3 34  ? 5.732   52.082 36.870 1.00 63.45  ? 34  HIS A CD2   1 
ATOM   493  C  CE1   . HIS C 3 34  ? 4.586   52.578 35.054 1.00 65.12  ? 34  HIS A CE1   1 
ATOM   494  N  NE2   . HIS C 3 34  ? 5.480   53.059 35.924 1.00 66.19  ? 34  HIS A NE2   1 
ATOM   495  N  N     . LYS C 3 35  ? 5.557   46.688 36.890 1.00 35.69  ? 35  LYS A N     1 
ATOM   496  C  CA    . LYS C 3 35  ? 5.515   45.395 37.506 1.00 40.61  ? 35  LYS A CA    1 
ATOM   497  C  C     . LYS C 3 35  ? 6.922   44.835 37.755 1.00 36.97  ? 35  LYS A C     1 
ATOM   498  O  O     . LYS C 3 35  ? 7.411   44.595 38.885 1.00 34.05  ? 35  LYS A O     1 
ATOM   499  C  CB    . LYS C 3 35  ? 4.628   44.442 36.734 1.00 47.72  ? 35  LYS A CB    1 
ATOM   500  C  CG    . LYS C 3 35  ? 3.178   44.873 36.778 1.00 56.37  ? 35  LYS A CG    1 
ATOM   501  C  CD    . LYS C 3 35  ? 2.226   43.686 36.762 1.00 65.36  ? 35  LYS A CD    1 
ATOM   502  C  CE    . LYS C 3 35  ? 0.796   44.076 36.425 1.00 72.83  ? 35  LYS A CE    1 
ATOM   503  N  NZ    . LYS C 3 35  ? -0.113  42.916 36.351 1.00 77.52  ? 35  LYS A NZ    1 
ATOM   504  N  N     . TYR C 3 36  ? 7.550   44.652 36.629 1.00 32.15  ? 36  TYR A N     1 
ATOM   505  C  CA    . TYR C 3 36  ? 8.872   44.145 36.502 1.00 24.82  ? 36  TYR A CA    1 
ATOM   506  C  C     . TYR C 3 36  ? 9.792   44.848 37.480 1.00 17.52  ? 36  TYR A C     1 
ATOM   507  O  O     . TYR C 3 36  ? 10.638  44.288 38.159 1.00 17.16  ? 36  TYR A O     1 
ATOM   508  C  CB    . TYR C 3 36  ? 9.226   44.507 35.061 1.00 27.78  ? 36  TYR A CB    1 
ATOM   509  C  CG    . TYR C 3 36  ? 10.680  44.625 34.899 1.00 29.81  ? 36  TYR A CG    1 
ATOM   510  C  CD1   . TYR C 3 36  ? 11.408  43.449 34.761 1.00 33.54  ? 36  TYR A CD1   1 
ATOM   511  C  CD2   . TYR C 3 36  ? 11.321  45.863 34.906 1.00 25.01  ? 36  TYR A CD2   1 
ATOM   512  C  CE1   . TYR C 3 36  ? 12.793  43.514 34.613 1.00 35.35  ? 36  TYR A CE1   1 
ATOM   513  C  CE2   . TYR C 3 36  ? 12.701  45.942 34.755 1.00 23.21  ? 36  TYR A CE2   1 
ATOM   514  C  CZ    . TYR C 3 36  ? 13.429  44.759 34.611 1.00 30.83  ? 36  TYR A CZ    1 
ATOM   515  O  OH    . TYR C 3 36  ? 14.801  44.775 34.465 1.00 36.67  ? 36  TYR A OH    1 
ATOM   516  N  N     . ASN C 3 37  ? 9.610   46.117 37.568 1.00 15.33  ? 37  ASN A N     1 
ATOM   517  C  CA    . ASN C 3 37  ? 10.431  46.859 38.474 1.00 23.32  ? 37  ASN A CA    1 
ATOM   518  C  C     . ASN C 3 37  ? 10.342  46.411 39.939 1.00 20.30  ? 37  ASN A C     1 
ATOM   519  O  O     . ASN C 3 37  ? 11.344  46.299 40.671 1.00 15.87  ? 37  ASN A O     1 
ATOM   520  C  CB    . ASN C 3 37  ? 10.063  48.343 38.335 1.00 37.38  ? 37  ASN A CB    1 
ATOM   521  C  CG    . ASN C 3 37  ? 10.996  49.162 37.457 1.00 45.21  ? 37  ASN A CG    1 
ATOM   522  O  OD1   . ASN C 3 37  ? 10.552  50.095 36.731 1.00 47.73  ? 37  ASN A OD1   1 
ATOM   523  N  ND2   . ASN C 3 37  ? 12.293  48.887 37.626 1.00 45.14  ? 37  ASN A ND2   1 
ATOM   524  N  N     . ALA C 3 38  ? 9.111   46.169 40.391 1.00 22.16  ? 38  ALA A N     1 
ATOM   525  C  CA    . ALA C 3 38  ? 8.931   45.751 41.765 1.00 26.28  ? 38  ALA A CA    1 
ATOM   526  C  C     . ALA C 3 38  ? 9.430   44.387 41.871 1.00 30.25  ? 38  ALA A C     1 
ATOM   527  O  O     . ALA C 3 38  ? 9.915   43.909 42.893 1.00 35.91  ? 38  ALA A O     1 
ATOM   528  C  CB    . ALA C 3 38  ? 7.498   45.759 42.226 1.00 28.69  ? 38  ALA A CB    1 
ATOM   529  N  N     . TYR C 3 39  ? 9.267   43.771 40.754 1.00 29.24  ? 39  TYR A N     1 
ATOM   530  C  CA    . TYR C 3 39  ? 9.690   42.441 40.672 1.00 33.59  ? 39  TYR A CA    1 
ATOM   531  C  C     . TYR C 3 39  ? 11.110  42.221 41.019 1.00 36.84  ? 39  TYR A C     1 
ATOM   532  O  O     . TYR C 3 39  ? 11.423  41.457 41.949 1.00 42.72  ? 39  TYR A O     1 
ATOM   533  C  CB    . TYR C 3 39  ? 9.529   41.971 39.259 1.00 36.33  ? 39  TYR A CB    1 
ATOM   534  C  CG    . TYR C 3 39  ? 8.228   41.349 39.288 1.00 38.76  ? 39  TYR A CG    1 
ATOM   535  C  CD1   . TYR C 3 39  ? 7.947   40.586 40.425 1.00 36.02  ? 39  TYR A CD1   1 
ATOM   536  C  CD2   . TYR C 3 39  ? 7.300   41.533 38.264 1.00 38.94  ? 39  TYR A CD2   1 
ATOM   537  C  CE1   . TYR C 3 39  ? 6.724   39.949 40.561 1.00 33.97  ? 39  TYR A CE1   1 
ATOM   538  C  CE2   . TYR C 3 39  ? 6.067   40.897 38.396 1.00 39.05  ? 39  TYR A CE2   1 
ATOM   539  C  CZ    . TYR C 3 39  ? 5.809   40.126 39.535 1.00 39.40  ? 39  TYR A CZ    1 
ATOM   540  O  OH    . TYR C 3 39  ? 4.613   39.517 39.657 1.00 47.45  ? 39  TYR A OH    1 
ATOM   541  N  N     . ARG C 3 40  ? 11.962  42.881 40.253 1.00 31.84  ? 40  ARG A N     1 
ATOM   542  C  CA    . ARG C 3 40  ? 13.315  42.651 40.562 1.00 34.97  ? 40  ARG A CA    1 
ATOM   543  C  C     . ARG C 3 40  ? 13.653  43.098 41.910 1.00 29.94  ? 40  ARG A C     1 
ATOM   544  O  O     . ARG C 3 40  ? 14.297  42.339 42.681 1.00 25.51  ? 40  ARG A O     1 
ATOM   545  C  CB    . ARG C 3 40  ? 14.358  42.896 39.496 1.00 43.09  ? 40  ARG A CB    1 
ATOM   546  C  CG    . ARG C 3 40  ? 14.379  44.291 38.916 1.00 50.46  ? 40  ARG A CG    1 
ATOM   547  C  CD    . ARG C 3 40  ? 15.492  44.476 37.868 1.00 51.18  ? 40  ARG A CD    1 
ATOM   548  N  NE    . ARG C 3 40  ? 16.694  45.063 38.412 1.00 52.44  ? 40  ARG A NE    1 
ATOM   549  C  CZ    . ARG C 3 40  ? 17.702  45.420 37.660 1.00 58.18  ? 40  ARG A CZ    1 
ATOM   550  N  NH1   . ARG C 3 40  ? 17.647  45.238 36.337 1.00 63.18  ? 40  ARG A NH1   1 
ATOM   551  N  NH2   . ARG C 3 40  ? 18.790  45.955 38.231 1.00 58.69  ? 40  ARG A NH2   1 
ATOM   552  N  N     . LYS C 3 41  ? 13.148  44.308 42.108 1.00 25.69  ? 41  LYS A N     1 
ATOM   553  C  CA    . LYS C 3 41  ? 13.339  44.984 43.335 1.00 23.84  ? 41  LYS A CA    1 
ATOM   554  C  C     . LYS C 3 41  ? 13.179  44.060 44.470 1.00 16.95  ? 41  LYS A C     1 
ATOM   555  O  O     . LYS C 3 41  ? 14.051  43.928 45.287 1.00 23.37  ? 41  LYS A O     1 
ATOM   556  C  CB    . LYS C 3 41  ? 12.346  46.051 43.548 1.00 28.57  ? 41  LYS A CB    1 
ATOM   557  C  CG    . LYS C 3 41  ? 12.692  46.692 44.859 1.00 39.17  ? 41  LYS A CG    1 
ATOM   558  C  CD    . LYS C 3 41  ? 11.468  46.825 45.718 1.00 55.83  ? 41  LYS A CD    1 
ATOM   559  C  CE    . LYS C 3 41  ? 10.162  46.896 44.915 1.00 63.34  ? 41  LYS A CE    1 
ATOM   560  N  NZ    . LYS C 3 41  ? 9.638   45.571 44.529 1.00 64.71  ? 41  LYS A NZ    1 
ATOM   561  N  N     . ALA C 3 42  ? 12.086  43.369 44.453 1.00 9.42   ? 42  ALA A N     1 
ATOM   562  C  CA    . ALA C 3 42  ? 11.802  42.439 45.490 1.00 8.83   ? 42  ALA A CA    1 
ATOM   563  C  C     . ALA C 3 42  ? 12.823  41.326 45.671 1.00 14.42  ? 42  ALA A C     1 
ATOM   564  O  O     . ALA C 3 42  ? 13.413  41.086 46.804 1.00 2.64   ? 42  ALA A O     1 
ATOM   565  C  CB    . ALA C 3 42  ? 10.449  41.856 45.224 1.00 5.10   ? 42  ALA A CB    1 
ATOM   566  N  N     . ALA C 3 43  ? 13.022  40.648 44.515 1.00 14.90  ? 43  ALA A N     1 
ATOM   567  C  CA    . ALA C 3 43  ? 13.938  39.534 44.461 1.00 6.34   ? 43  ALA A CA    1 
ATOM   568  C  C     . ALA C 3 43  ? 15.215  39.986 45.039 1.00 7.04   ? 43  ALA A C     1 
ATOM   569  O  O     . ALA C 3 43  ? 15.946  39.283 45.693 1.00 11.84  ? 43  ALA A O     1 
ATOM   570  C  CB    . ALA C 3 43  ? 14.095  39.047 43.063 1.00 8.92   ? 43  ALA A CB    1 
ATOM   571  N  N     . SER C 3 44  ? 15.468  41.237 44.809 1.00 8.75   ? 44  SER A N     1 
ATOM   572  C  CA    . SER C 3 44  ? 16.661  41.775 45.354 1.00 8.54   ? 44  SER A CA    1 
ATOM   573  C  C     . SER C 3 44  ? 16.543  41.735 46.871 1.00 15.16  ? 44  SER A C     1 
ATOM   574  O  O     . SER C 3 44  ? 17.262  41.009 47.563 1.00 11.96  ? 44  SER A O     1 
ATOM   575  C  CB    . SER C 3 44  ? 16.750  43.201 44.961 1.00 4.87   ? 44  SER A CB    1 
ATOM   576  O  OG    . SER C 3 44  ? 17.848  43.657 45.674 1.00 7.68   ? 44  SER A OG    1 
ATOM   577  N  N     . VAL C 3 45  ? 15.583  42.511 47.395 1.00 18.09  ? 45  VAL A N     1 
ATOM   578  C  CA    . VAL C 3 45  ? 15.408  42.512 48.832 1.00 20.12  ? 45  VAL A CA    1 
ATOM   579  C  C     . VAL C 3 45  ? 15.240  41.113 49.470 1.00 12.53  ? 45  VAL A C     1 
ATOM   580  O  O     . VAL C 3 45  ? 15.904  40.909 50.448 1.00 7.97   ? 45  VAL A O     1 
ATOM   581  C  CB    . VAL C 3 45  ? 14.423  43.572 49.315 1.00 25.34  ? 45  VAL A CB    1 
ATOM   582  C  CG1   . VAL C 3 45  ? 13.365  43.720 48.244 1.00 27.57  ? 45  VAL A CG1   1 
ATOM   583  C  CG2   . VAL C 3 45  ? 13.748  43.117 50.617 1.00 22.74  ? 45  VAL A CG2   1 
ATOM   584  N  N     . ILE C 3 46  ? 14.387  40.170 48.938 1.00 9.03   ? 46  ILE A N     1 
ATOM   585  C  CA    . ILE C 3 46  ? 14.311  38.894 49.598 1.00 11.05  ? 46  ILE A CA    1 
ATOM   586  C  C     . ILE C 3 46  ? 15.667  38.290 49.547 1.00 11.79  ? 46  ILE A C     1 
ATOM   587  O  O     . ILE C 3 46  ? 16.063  37.492 50.393 1.00 13.57  ? 46  ILE A O     1 
ATOM   588  C  CB    . ILE C 3 46  ? 13.468  37.826 48.905 1.00 19.94  ? 46  ILE A CB    1 
ATOM   589  C  CG1   . ILE C 3 46  ? 14.090  37.297 47.602 1.00 26.75  ? 46  ILE A CG1   1 
ATOM   590  C  CG2   . ILE C 3 46  ? 12.084  38.322 48.623 1.00 22.49  ? 46  ILE A CG2   1 
ATOM   591  C  CD1   . ILE C 3 46  ? 15.070  36.091 47.680 1.00 27.76  ? 46  ILE A CD1   1 
ATOM   592  N  N     . ALA C 3 47  ? 16.365  38.626 48.483 1.00 8.02   ? 47  ALA A N     1 
ATOM   593  C  CA    . ALA C 3 47  ? 17.681  38.037 48.377 1.00 21.20  ? 47  ALA A CA    1 
ATOM   594  C  C     . ALA C 3 47  ? 18.759  38.425 49.425 1.00 21.55  ? 47  ALA A C     1 
ATOM   595  O  O     . ALA C 3 47  ? 19.588  37.612 49.803 1.00 16.67  ? 47  ALA A O     1 
ATOM   596  C  CB    . ALA C 3 47  ? 18.153  37.648 46.985 1.00 23.73  ? 47  ALA A CB    1 
ATOM   597  N  N     . LYS C 3 48  ? 18.727  39.682 49.861 1.00 21.63  ? 48  LYS A N     1 
ATOM   598  C  CA    . LYS C 3 48  ? 19.653  40.185 50.825 1.00 27.89  ? 48  LYS A CA    1 
ATOM   599  C  C     . LYS C 3 48  ? 19.366  39.616 52.199 1.00 41.33  ? 48  LYS A C     1 
ATOM   600  O  O     . LYS C 3 48  ? 20.269  39.596 53.041 1.00 46.22  ? 48  LYS A O     1 
ATOM   601  C  CB    . LYS C 3 48  ? 19.768  41.705 50.802 1.00 28.60  ? 48  LYS A CB    1 
ATOM   602  C  CG    . LYS C 3 48  ? 20.306  42.310 49.480 1.00 33.28  ? 48  LYS A CG    1 
ATOM   603  C  CD    . LYS C 3 48  ? 20.272  43.860 49.405 1.00 37.43  ? 48  LYS A CD    1 
ATOM   604  C  CE    . LYS C 3 48  ? 21.332  44.519 48.499 1.00 38.87  ? 48  LYS A CE    1 
ATOM   605  N  NZ    . LYS C 3 48  ? 21.270  46.005 48.412 1.00 36.43  ? 48  LYS A NZ    1 
ATOM   606  N  N     . TYR C 3 49  ? 18.104  39.147 52.399 1.00 46.16  ? 49  TYR A N     1 
ATOM   607  C  CA    . TYR C 3 49  ? 17.587  38.541 53.654 1.00 49.54  ? 49  TYR A CA    1 
ATOM   608  C  C     . TYR C 3 49  ? 18.398  37.319 54.102 1.00 46.09  ? 49  TYR A C     1 
ATOM   609  O  O     . TYR C 3 49  ? 18.662  36.427 53.284 1.00 43.07  ? 49  TYR A O     1 
ATOM   610  C  CB    . TYR C 3 49  ? 16.127  38.101 53.444 1.00 57.09  ? 49  TYR A CB    1 
ATOM   611  C  CG    . TYR C 3 49  ? 15.357  37.936 54.725 1.00 62.08  ? 49  TYR A CG    1 
ATOM   612  C  CD1   . TYR C 3 49  ? 15.702  38.730 55.818 1.00 66.98  ? 49  TYR A CD1   1 
ATOM   613  C  CD2   . TYR C 3 49  ? 14.290  37.044 54.851 1.00 61.37  ? 49  TYR A CD2   1 
ATOM   614  C  CE1   . TYR C 3 49  ? 15.016  38.632 57.029 1.00 68.77  ? 49  TYR A CE1   1 
ATOM   615  C  CE2   . TYR C 3 49  ? 13.592  36.932 56.052 1.00 62.97  ? 49  TYR A CE2   1 
ATOM   616  C  CZ    . TYR C 3 49  ? 13.960  37.728 57.139 1.00 69.33  ? 49  TYR A CZ    1 
ATOM   617  O  OH    . TYR C 3 49  ? 13.294  37.646 58.339 1.00 74.59  ? 49  TYR A OH    1 
ATOM   618  N  N     . PRO C 3 50  ? 18.795  37.252 55.401 1.00 47.00  ? 50  PRO A N     1 
ATOM   619  C  CA    . PRO C 3 50  ? 19.594  36.118 55.893 1.00 48.77  ? 50  PRO A CA    1 
ATOM   620  C  C     . PRO C 3 50  ? 18.902  34.961 56.609 1.00 60.14  ? 50  PRO A C     1 
ATOM   621  O  O     . PRO C 3 50  ? 19.515  34.282 57.430 1.00 65.06  ? 50  PRO A O     1 
ATOM   622  C  CB    . PRO C 3 50  ? 20.728  36.677 56.738 1.00 39.59  ? 50  PRO A CB    1 
ATOM   623  C  CG    . PRO C 3 50  ? 20.358  38.135 56.985 1.00 40.14  ? 50  PRO A CG    1 
ATOM   624  C  CD    . PRO C 3 50  ? 19.104  38.479 56.178 1.00 42.29  ? 50  PRO A CD    1 
ATOM   625  N  N     . HIS C 3 51  ? 17.639  34.705 56.311 1.00 63.83  ? 51  HIS A N     1 
ATOM   626  C  CA    . HIS C 3 51  ? 16.926  33.615 56.941 1.00 64.61  ? 51  HIS A CA    1 
ATOM   627  C  C     . HIS C 3 51  ? 16.226  32.885 55.844 1.00 59.28  ? 51  HIS A C     1 
ATOM   628  O  O     . HIS C 3 51  ? 15.981  33.461 54.789 1.00 55.39  ? 51  HIS A O     1 
ATOM   629  C  CB    . HIS C 3 51  ? 15.867  34.102 57.962 1.00 71.46  ? 51  HIS A CB    1 
ATOM   630  C  CG    . HIS C 3 51  ? 16.452  34.993 58.996 1.00 78.12  ? 51  HIS A CG    1 
ATOM   631  N  ND1   . HIS C 3 51  ? 17.370  34.514 59.913 1.00 82.05  ? 51  HIS A ND1   1 
ATOM   632  C  CD2   . HIS C 3 51  ? 16.250  36.312 59.234 1.00 81.19  ? 51  HIS A CD2   1 
ATOM   633  C  CE1   . HIS C 3 51  ? 17.705  35.536 60.679 1.00 84.37  ? 51  HIS A CE1   1 
ATOM   634  N  NE2   . HIS C 3 51  ? 17.048  36.633 60.296 1.00 83.96  ? 51  HIS A NE2   1 
ATOM   635  N  N     . LYS C 3 52  ? 15.900  31.629 56.071 1.00 61.15  ? 52  LYS A N     1 
ATOM   636  C  CA    . LYS C 3 52  ? 15.210  30.930 55.010 1.00 63.26  ? 52  LYS A CA    1 
ATOM   637  C  C     . LYS C 3 52  ? 13.801  31.499 54.903 1.00 67.26  ? 52  LYS A C     1 
ATOM   638  O  O     . LYS C 3 52  ? 13.138  31.745 55.916 1.00 69.79  ? 52  LYS A O     1 
ATOM   639  C  CB    . LYS C 3 52  ? 15.141  29.432 55.273 1.00 59.88  ? 52  LYS A CB    1 
ATOM   640  N  N     . ILE C 3 53  ? 13.311  31.740 53.706 1.00 67.21  ? 53  ILE A N     1 
ATOM   641  C  CA    . ILE C 3 53  ? 11.971  32.257 53.711 1.00 67.52  ? 53  ILE A CA    1 
ATOM   642  C  C     . ILE C 3 53  ? 11.080  31.053 53.761 1.00 68.23  ? 53  ILE A C     1 
ATOM   643  O  O     . ILE C 3 53  ? 11.227  30.155 52.940 1.00 63.39  ? 53  ILE A O     1 
ATOM   644  C  CB    . ILE C 3 53  ? 11.575  33.244 52.600 1.00 64.15  ? 53  ILE A CB    1 
ATOM   645  C  CG1   . ILE C 3 53  ? 12.031  34.662 52.961 1.00 66.36  ? 53  ILE A CG1   1 
ATOM   646  C  CG2   . ILE C 3 53  ? 10.068  33.249 52.434 1.00 57.54  ? 53  ILE A CG2   1 
ATOM   647  C  CD1   . ILE C 3 53  ? 11.590  35.730 51.961 1.00 65.05  ? 53  ILE A CD1   1 
ATOM   648  N  N     . LYS C 3 54  ? 10.187  31.043 54.740 1.00 74.59  ? 54  LYS A N     1 
ATOM   649  C  CA    . LYS C 3 54  ? 9.267   29.937 54.884 1.00 80.90  ? 54  LYS A CA    1 
ATOM   650  C  C     . LYS C 3 54  ? 7.888   30.318 54.352 1.00 78.47  ? 54  LYS A C     1 
ATOM   651  O  O     . LYS C 3 54  ? 7.467   29.831 53.300 1.00 79.42  ? 54  LYS A O     1 
ATOM   652  C  CB    . LYS C 3 54  ? 9.213   29.361 56.300 1.00 87.81  ? 54  LYS A CB    1 
ATOM   653  C  CG    . LYS C 3 54  ? 10.551  28.861 56.853 1.00 89.26  ? 54  LYS A CG    1 
ATOM   654  C  CD    . LYS C 3 54  ? 11.117  27.611 56.188 1.00 90.54  ? 54  LYS A CD    1 
ATOM   655  C  CE    . LYS C 3 54  ? 10.616  26.305 56.792 1.00 93.19  ? 54  LYS A CE    1 
ATOM   656  N  NZ    . LYS C 3 54  ? 11.673  25.281 56.935 1.00 93.89  ? 54  LYS A NZ    1 
ATOM   657  N  N     . SER C 3 55  ? 7.197   31.207 55.084 1.00 74.11  ? 55  SER A N     1 
ATOM   658  C  CA    . SER C 3 55  ? 5.870   31.666 54.702 1.00 71.19  ? 55  SER A CA    1 
ATOM   659  C  C     . SER C 3 55  ? 5.850   32.936 53.895 1.00 68.15  ? 55  SER A C     1 
ATOM   660  O  O     . SER C 3 55  ? 6.577   33.879 54.210 1.00 66.45  ? 55  SER A O     1 
ATOM   661  C  CB    . SER C 3 55  ? 5.033   31.941 55.940 1.00 70.99  ? 55  SER A CB    1 
ATOM   662  N  N     . GLY C 3 56  ? 4.989   32.954 52.872 1.00 66.18  ? 56  GLY A N     1 
ATOM   663  C  CA    . GLY C 3 56  ? 4.847   34.126 52.024 1.00 63.82  ? 56  GLY A CA    1 
ATOM   664  C  C     . GLY C 3 56  ? 4.413   35.280 52.928 1.00 62.69  ? 56  GLY A C     1 
ATOM   665  O  O     . GLY C 3 56  ? 4.709   36.456 52.695 1.00 62.09  ? 56  GLY A O     1 
ATOM   666  N  N     . ALA C 3 57  ? 3.693   34.906 53.986 1.00 62.08  ? 57  ALA A N     1 
ATOM   667  C  CA    . ALA C 3 57  ? 3.202   35.861 54.963 1.00 62.89  ? 57  ALA A CA    1 
ATOM   668  C  C     . ALA C 3 57  ? 4.385   36.489 55.681 1.00 64.23  ? 57  ALA A C     1 
ATOM   669  O  O     . ALA C 3 57  ? 4.351   37.577 56.246 1.00 60.66  ? 57  ALA A O     1 
ATOM   670  C  CB    . ALA C 3 57  ? 2.203   35.233 55.926 1.00 62.47  ? 57  ALA A CB    1 
ATOM   671  N  N     . GLU C 3 58  ? 5.476   35.761 55.686 1.00 70.63  ? 58  GLU A N     1 
ATOM   672  C  CA    . GLU C 3 58  ? 6.631   36.311 56.339 1.00 76.20  ? 58  GLU A CA    1 
ATOM   673  C  C     . GLU C 3 58  ? 7.220   37.387 55.438 1.00 70.16  ? 58  GLU A C     1 
ATOM   674  O  O     . GLU C 3 58  ? 7.531   38.503 55.864 1.00 67.07  ? 58  GLU A O     1 
ATOM   675  C  CB    . GLU C 3 58  ? 7.683   35.254 56.664 1.00 84.34  ? 58  GLU A CB    1 
ATOM   676  C  CG    . GLU C 3 58  ? 8.968   35.903 57.203 1.00 91.84  ? 58  GLU A CG    1 
ATOM   677  C  CD    . GLU C 3 58  ? 9.898   34.888 57.806 1.00 98.71  ? 58  GLU A CD    1 
ATOM   678  O  OE1   . GLU C 3 58  ? 9.390   33.662 57.794 1.00 100.00 ? 58  GLU A OE1   1 
ATOM   679  O  OE2   . GLU C 3 58  ? 10.992  35.179 58.275 1.00 100.00 ? 58  GLU A OE2   1 
ATOM   680  N  N     . ALA C 3 59  ? 7.337   36.977 54.163 1.00 63.73  ? 59  ALA A N     1 
ATOM   681  C  CA    . ALA C 3 59  ? 7.866   37.765 53.079 1.00 52.69  ? 59  ALA A CA    1 
ATOM   682  C  C     . ALA C 3 59  ? 7.330   39.174 53.118 1.00 51.32  ? 59  ALA A C     1 
ATOM   683  O  O     . ALA C 3 59  ? 8.111   40.126 53.198 1.00 51.93  ? 59  ALA A O     1 
ATOM   684  C  CB    . ALA C 3 59  ? 7.429   37.132 51.781 1.00 43.20  ? 59  ALA A CB    1 
ATOM   685  N  N     . LYS C 3 60  ? 6.000   39.244 53.074 1.00 48.19  ? 60  LYS A N     1 
ATOM   686  C  CA    . LYS C 3 60  ? 5.219   40.456 53.093 1.00 48.03  ? 60  LYS A CA    1 
ATOM   687  C  C     . LYS C 3 60  ? 5.842   41.526 53.982 1.00 50.38  ? 60  LYS A C     1 
ATOM   688  O  O     . LYS C 3 60  ? 5.944   42.703 53.610 1.00 48.21  ? 60  LYS A O     1 
ATOM   689  C  CB    . LYS C 3 60  ? 3.810   40.112 53.569 1.00 44.98  ? 60  LYS A CB    1 
ATOM   690  N  N     . LYS C 3 61  ? 6.272   41.072 55.151 1.00 54.58  ? 61  LYS A N     1 
ATOM   691  C  CA    . LYS C 3 61  ? 6.900   41.893 56.173 1.00 59.77  ? 61  LYS A CA    1 
ATOM   692  C  C     . LYS C 3 61  ? 7.958   42.801 55.624 1.00 57.93  ? 61  LYS A C     1 
ATOM   693  O  O     . LYS C 3 61  ? 7.943   44.029 55.843 1.00 62.65  ? 61  LYS A O     1 
ATOM   694  C  CB    . LYS C 3 61  ? 7.575   40.976 57.176 1.00 68.94  ? 61  LYS A CB    1 
ATOM   695  C  CG    . LYS C 3 61  ? 7.789   41.639 58.528 1.00 77.12  ? 61  LYS A CG    1 
ATOM   696  C  CD    . LYS C 3 61  ? 7.516   40.672 59.681 1.00 81.15  ? 61  LYS A CD    1 
ATOM   697  C  CE    . LYS C 3 61  ? 6.699   41.307 60.799 1.00 82.35  ? 61  LYS A CE    1 
ATOM   698  N  NZ    . LYS C 3 61  ? 7.294   42.559 61.292 1.00 83.43  ? 61  LYS A NZ    1 
ATOM   699  N  N     . LEU C 3 62  ? 8.872   42.129 54.914 1.00 49.08  ? 62  LEU A N     1 
ATOM   700  C  CA    . LEU C 3 62  ? 10.030  42.687 54.246 1.00 36.67  ? 62  LEU A CA    1 
ATOM   701  C  C     . LEU C 3 62  ? 9.563   43.806 53.348 1.00 36.68  ? 62  LEU A C     1 
ATOM   702  O  O     . LEU C 3 62  ? 8.524   43.682 52.719 1.00 39.75  ? 62  LEU A O     1 
ATOM   703  C  CB    . LEU C 3 62  ? 10.510  41.541 53.364 1.00 27.45  ? 62  LEU A CB    1 
ATOM   704  C  CG    . LEU C 3 62  ? 11.994  41.255 53.389 1.00 26.61  ? 62  LEU A CG    1 
ATOM   705  C  CD1   . LEU C 3 62  ? 12.472  41.050 54.816 1.00 25.70  ? 62  LEU A CD1   1 
ATOM   706  C  CD2   . LEU C 3 62  ? 12.245  39.959 52.605 1.00 27.39  ? 62  LEU A CD2   1 
ATOM   707  N  N     . PRO C 3 63  ? 10.280  44.903 53.260 1.00 34.50  ? 63  PRO A N     1 
ATOM   708  C  CA    . PRO C 3 63  ? 9.808   45.950 52.391 1.00 32.39  ? 63  PRO A CA    1 
ATOM   709  C  C     . PRO C 3 63  ? 10.084  45.543 50.990 1.00 30.83  ? 63  PRO A C     1 
ATOM   710  O  O     . PRO C 3 63  ? 11.037  44.830 50.770 1.00 33.12  ? 63  PRO A O     1 
ATOM   711  C  CB    . PRO C 3 63  ? 10.712  47.166 52.610 1.00 29.86  ? 63  PRO A CB    1 
ATOM   712  C  CG    . PRO C 3 63  ? 11.976  46.623 53.217 1.00 29.43  ? 63  PRO A CG    1 
ATOM   713  C  CD    . PRO C 3 63  ? 11.592  45.273 53.829 1.00 33.72  ? 63  PRO A CD    1 
ATOM   714  N  N     . GLY C 3 64  ? 9.264   46.016 50.073 1.00 32.03  ? 64  GLY A N     1 
ATOM   715  C  CA    . GLY C 3 64  ? 9.416   45.723 48.665 1.00 35.50  ? 64  GLY A CA    1 
ATOM   716  C  C     . GLY C 3 64  ? 8.403   44.739 48.169 1.00 37.40  ? 64  GLY A C     1 
ATOM   717  O  O     . GLY C 3 64  ? 7.812   44.875 47.068 1.00 40.46  ? 64  GLY A O     1 
ATOM   718  N  N     . VAL C 3 65  ? 8.224   43.748 49.001 1.00 35.20  ? 65  VAL A N     1 
ATOM   719  C  CA    . VAL C 3 65  ? 7.274   42.713 48.712 1.00 40.18  ? 65  VAL A CA    1 
ATOM   720  C  C     . VAL C 3 65  ? 5.900   43.115 49.270 1.00 45.39  ? 65  VAL A C     1 
ATOM   721  O  O     . VAL C 3 65  ? 5.767   43.856 50.243 1.00 53.72  ? 65  VAL A O     1 
ATOM   722  C  CB    . VAL C 3 65  ? 7.780   41.488 49.408 1.00 40.10  ? 65  VAL A CB    1 
ATOM   723  C  CG1   . VAL C 3 65  ? 8.880   42.007 50.326 1.00 38.14  ? 65  VAL A CG1   1 
ATOM   724  C  CG2   . VAL C 3 65  ? 6.663   40.857 50.250 1.00 40.93  ? 65  VAL A CG2   1 
ATOM   725  N  N     . GLY C 3 66  ? 4.854   42.643 48.676 1.00 40.43  ? 66  GLY A N     1 
ATOM   726  C  CA    . GLY C 3 66  ? 3.574   42.992 49.194 1.00 37.83  ? 66  GLY A CA    1 
ATOM   727  C  C     . GLY C 3 66  ? 2.727   41.926 48.651 1.00 47.32  ? 66  GLY A C     1 
ATOM   728  O  O     . GLY C 3 66  ? 3.248   41.095 47.857 1.00 53.37  ? 66  GLY A O     1 
ATOM   729  N  N     . THR C 3 67  ? 1.488   42.007 49.110 1.00 47.84  ? 67  THR A N     1 
ATOM   730  C  CA    . THR C 3 67  ? 0.367   41.146 48.806 1.00 45.18  ? 67  THR A CA    1 
ATOM   731  C  C     . THR C 3 67  ? 0.602   40.323 47.547 1.00 35.74  ? 67  THR A C     1 
ATOM   732  O  O     . THR C 3 67  ? 0.943   39.130 47.626 1.00 24.23  ? 67  THR A O     1 
ATOM   733  C  CB    . THR C 3 67  ? -0.833  42.100 48.679 1.00 51.52  ? 67  THR A CB    1 
ATOM   734  O  OG1   . THR C 3 67  ? -1.919  41.510 48.013 1.00 52.84  ? 67  THR A OG1   1 
ATOM   735  C  CG2   . THR C 3 67  ? -0.371  43.354 47.940 1.00 56.43  ? 67  THR A CG2   1 
ATOM   736  N  N     . LYS C 3 68  ? 0.454   40.993 46.387 1.00 39.98  ? 68  LYS A N     1 
ATOM   737  C  CA    . LYS C 3 68  ? 0.644   40.359 45.082 1.00 40.32  ? 68  LYS A CA    1 
ATOM   738  C  C     . LYS C 3 68  ? 1.921   39.533 45.017 1.00 41.65  ? 68  LYS A C     1 
ATOM   739  O  O     . LYS C 3 68  ? 1.941   38.418 44.463 1.00 43.15  ? 68  LYS A O     1 
ATOM   740  C  CB    . LYS C 3 68  ? 0.597   41.372 43.956 1.00 38.33  ? 68  LYS A CB    1 
ATOM   741  N  N     . ILE C 3 69  ? 3.013   40.063 45.586 1.00 36.96  ? 69  ILE A N     1 
ATOM   742  C  CA    . ILE C 3 69  ? 4.164   39.239 45.488 1.00 30.25  ? 69  ILE A CA    1 
ATOM   743  C  C     . ILE C 3 69  ? 4.029   38.080 46.367 1.00 23.40  ? 69  ILE A C     1 
ATOM   744  O  O     . ILE C 3 69  ? 4.192   36.965 45.897 1.00 27.21  ? 69  ILE A O     1 
ATOM   745  C  CB    . ILE C 3 69  ? 5.512   39.916 45.563 1.00 30.46  ? 69  ILE A CB    1 
ATOM   746  C  CG1   . ILE C 3 69  ? 5.762   40.633 44.253 1.00 27.23  ? 69  ILE A CG1   1 
ATOM   747  C  CG2   . ILE C 3 69  ? 6.611   38.878 45.719 1.00 24.08  ? 69  ILE A CG2   1 
ATOM   748  C  CD1   . ILE C 3 69  ? 6.500   41.933 44.511 1.00 28.89  ? 69  ILE A CD1   1 
ATOM   749  N  N     . ALA C 3 70  ? 3.719   38.360 47.608 1.00 20.33  ? 70  ALA A N     1 
ATOM   750  C  CA    . ALA C 3 70  ? 3.570   37.275 48.572 1.00 27.76  ? 70  ALA A CA    1 
ATOM   751  C  C     . ALA C 3 70  ? 2.720   36.115 48.087 1.00 30.64  ? 70  ALA A C     1 
ATOM   752  O  O     . ALA C 3 70  ? 2.977   34.956 48.430 1.00 27.34  ? 70  ALA A O     1 
ATOM   753  C  CB    . ALA C 3 70  ? 3.249   37.741 49.975 1.00 30.27  ? 70  ALA A CB    1 
ATOM   754  N  N     . GLU C 3 71  ? 1.709   36.456 47.263 1.00 34.56  ? 71  GLU A N     1 
ATOM   755  C  CA    . GLU C 3 71  ? 0.822   35.431 46.711 1.00 37.05  ? 71  GLU A CA    1 
ATOM   756  C  C     . GLU C 3 71  ? 1.629   34.530 45.821 1.00 41.19  ? 71  GLU A C     1 
ATOM   757  O  O     . GLU C 3 71  ? 1.766   33.321 46.101 1.00 44.70  ? 71  GLU A O     1 
ATOM   758  C  CB    . GLU C 3 71  ? -0.373  35.976 45.927 1.00 33.80  ? 71  GLU A CB    1 
ATOM   759  N  N     . LYS C 3 72  ? 2.184   35.177 44.764 1.00 36.88  ? 72  LYS A N     1 
ATOM   760  C  CA    . LYS C 3 72  ? 3.012   34.524 43.761 1.00 28.48  ? 72  LYS A CA    1 
ATOM   761  C  C     . LYS C 3 72  ? 4.001   33.656 44.502 1.00 31.59  ? 72  LYS A C     1 
ATOM   762  O  O     . LYS C 3 72  ? 4.387   32.563 44.066 1.00 33.67  ? 72  LYS A O     1 
ATOM   763  C  CB    . LYS C 3 72  ? 3.610   35.518 42.775 1.00 19.17  ? 72  LYS A CB    1 
ATOM   764  N  N     . ILE C 3 73  ? 4.377   34.153 45.686 1.00 31.03  ? 73  ILE A N     1 
ATOM   765  C  CA    . ILE C 3 73  ? 5.279   33.409 46.485 1.00 35.08  ? 73  ILE A CA    1 
ATOM   766  C  C     . ILE C 3 73  ? 4.619   32.117 46.940 1.00 42.23  ? 73  ILE A C     1 
ATOM   767  O  O     . ILE C 3 73  ? 5.158   30.997 46.766 1.00 37.78  ? 73  ILE A O     1 
ATOM   768  C  CB    . ILE C 3 73  ? 5.752   34.232 47.656 1.00 33.47  ? 73  ILE A CB    1 
ATOM   769  C  CG1   . ILE C 3 73  ? 6.857   35.153 47.169 1.00 31.66  ? 73  ILE A CG1   1 
ATOM   770  C  CG2   . ILE C 3 73  ? 6.260   33.320 48.776 1.00 32.58  ? 73  ILE A CG2   1 
ATOM   771  C  CD1   . ILE C 3 73  ? 7.357   36.192 48.179 1.00 25.40  ? 73  ILE A CD1   1 
ATOM   772  N  N     . ASP C 3 74  ? 3.423   32.274 47.523 1.00 49.71  ? 74  ASP A N     1 
ATOM   773  C  CA    . ASP C 3 74  ? 2.722   31.097 48.003 1.00 57.82  ? 74  ASP A CA    1 
ATOM   774  C  C     . ASP C 3 74  ? 2.572   29.935 47.004 1.00 63.46  ? 74  ASP A C     1 
ATOM   775  O  O     . ASP C 3 74  ? 2.993   28.775 47.262 1.00 60.21  ? 74  ASP A O     1 
ATOM   776  C  CB    . ASP C 3 74  ? 1.585   31.370 49.017 1.00 58.09  ? 74  ASP A CB    1 
ATOM   777  C  CG    . ASP C 3 74  ? 2.202   32.019 50.239 1.00 61.51  ? 74  ASP A CG    1 
ATOM   778  O  OD1   . ASP C 3 74  ? 3.516   31.941 50.166 1.00 62.79  ? 74  ASP A OD1   1 
ATOM   779  O  OD2   . ASP C 3 74  ? 1.585   32.613 51.142 1.00 60.10  ? 74  ASP A OD2   1 
ATOM   780  N  N     . GLU C 3 75  ? 1.986   30.276 45.849 1.00 66.83  ? 75  GLU A N     1 
ATOM   781  C  CA    . GLU C 3 75  ? 1.746   29.351 44.762 1.00 68.37  ? 75  GLU A CA    1 
ATOM   782  C  C     . GLU C 3 75  ? 3.000   28.604 44.367 1.00 74.59  ? 75  GLU A C     1 
ATOM   783  O  O     . GLU C 3 75  ? 2.910   27.490 43.828 1.00 77.04  ? 75  GLU A O     1 
ATOM   784  C  CB    . GLU C 3 75  ? 1.124   30.030 43.550 1.00 67.47  ? 75  GLU A CB    1 
ATOM   785  C  CG    . GLU C 3 75  ? 0.987   29.058 42.380 1.00 71.95  ? 75  GLU A CG    1 
ATOM   786  C  CD    . GLU C 3 75  ? 0.617   29.810 41.140 1.00 78.68  ? 75  GLU A CD    1 
ATOM   787  O  OE1   . GLU C 3 75  ? 0.473   31.096 41.407 1.00 81.08  ? 75  GLU A OE1   1 
ATOM   788  O  OE2   . GLU C 3 75  ? 0.488   29.283 40.026 1.00 79.60  ? 75  GLU A OE2   1 
ATOM   789  N  N     . PHE C 3 76  ? 4.163   29.247 44.611 1.00 76.26  ? 76  PHE A N     1 
ATOM   790  C  CA    . PHE C 3 76  ? 5.456   28.657 44.311 1.00 76.82  ? 76  PHE A CA    1 
ATOM   791  C  C     . PHE C 3 76  ? 5.818   27.751 45.450 1.00 67.23  ? 76  PHE A C     1 
ATOM   792  O  O     . PHE C 3 76  ? 6.373   26.681 45.262 1.00 63.52  ? 76  PHE A O     1 
ATOM   793  C  CB    . PHE C 3 76  ? 6.622   29.667 44.112 1.00 87.29  ? 76  PHE A CB    1 
ATOM   794  C  CG    . PHE C 3 76  ? 8.027   29.035 44.064 1.00 95.09  ? 76  PHE A CG    1 
ATOM   795  C  CD1   . PHE C 3 76  ? 8.676   28.573 45.210 1.00 98.01  ? 76  PHE A CD1   1 
ATOM   796  C  CD2   . PHE C 3 76  ? 8.720   28.906 42.860 1.00 99.38  ? 76  PHE A CD2   1 
ATOM   797  C  CE1   . PHE C 3 76  ? 9.947   27.998 45.176 1.00 99.60  ? 76  PHE A CE1   1 
ATOM   798  C  CE2   . PHE C 3 76  ? 9.994   28.335 42.797 1.00 100.00 ? 76  PHE A CE2   1 
ATOM   799  C  CZ    . PHE C 3 76  ? 10.616  27.876 43.959 1.00 100.00 ? 76  PHE A CZ    1 
ATOM   800  N  N     . LEU C 3 77  ? 5.512   28.226 46.643 1.00 66.13  ? 77  LEU A N     1 
ATOM   801  C  CA    . LEU C 3 77  ? 5.825   27.465 47.813 1.00 72.63  ? 77  LEU A CA    1 
ATOM   802  C  C     . LEU C 3 77  ? 5.259   26.095 47.859 1.00 86.64  ? 77  LEU A C     1 
ATOM   803  O  O     . LEU C 3 77  ? 6.011   25.133 47.970 1.00 93.06  ? 77  LEU A O     1 
ATOM   804  C  CB    . LEU C 3 77  ? 5.577   28.204 49.105 1.00 69.77  ? 77  LEU A CB    1 
ATOM   805  C  CG    . LEU C 3 77  ? 6.851   28.887 49.473 1.00 67.09  ? 77  LEU A CG    1 
ATOM   806  C  CD1   . LEU C 3 77  ? 7.731   28.738 48.255 1.00 64.59  ? 77  LEU A CD1   1 
ATOM   807  C  CD2   . LEU C 3 77  ? 6.536   30.355 49.669 1.00 69.72  ? 77  LEU A CD2   1 
ATOM   808  N  N     . ALA C 3 78  ? 3.945   26.002 47.794 1.00 93.25  ? 78  ALA A N     1 
ATOM   809  C  CA    . ALA C 3 78  ? 3.337   24.687 47.840 1.00 98.74  ? 78  ALA A CA    1 
ATOM   810  C  C     . ALA C 3 78  ? 3.869   23.804 46.720 1.00 99.96  ? 78  ALA A C     1 
ATOM   811  O  O     . ALA C 3 78  ? 4.418   22.715 46.891 1.00 100.00 ? 78  ALA A O     1 
ATOM   812  C  CB    . ALA C 3 78  ? 1.828   24.806 47.694 1.00 100.00 ? 78  ALA A CB    1 
ATOM   813  N  N     . THR C 3 79  ? 3.694   24.322 45.545 1.00 100.00 ? 79  THR A N     1 
ATOM   814  C  CA    . THR C 3 79  ? 4.107   23.646 44.369 1.00 100.00 ? 79  THR A CA    1 
ATOM   815  C  C     . THR C 3 79  ? 5.045   24.514 43.579 1.00 100.00 ? 79  THR A C     1 
ATOM   816  O  O     . THR C 3 79  ? 4.736   25.689 43.363 1.00 100.00 ? 79  THR A O     1 
ATOM   817  C  CB    . THR C 3 79  ? 2.816   23.506 43.556 1.00 100.00 ? 79  THR A CB    1 
ATOM   818  O  OG1   . THR C 3 79  ? 3.112   23.470 42.173 1.00 100.00 ? 79  THR A OG1   1 
ATOM   819  C  CG2   . THR C 3 79  ? 1.909   24.699 43.869 1.00 97.69  ? 79  THR A CG2   1 
ATOM   820  N  N     . GLY C 3 80  ? 6.169   23.931 43.132 1.00 100.00 ? 80  GLY A N     1 
ATOM   821  C  CA    . GLY C 3 80  ? 7.164   24.633 42.342 1.00 99.06  ? 80  GLY A CA    1 
ATOM   822  C  C     . GLY C 3 80  ? 6.469   25.364 41.210 1.00 99.31  ? 80  GLY A C     1 
ATOM   823  O  O     . GLY C 3 80  ? 6.959   26.369 40.705 1.00 100.00 ? 80  GLY A O     1 
ATOM   824  N  N     . LYS C 3 81  ? 5.295   24.834 40.837 1.00 98.83  ? 81  LYS A N     1 
ATOM   825  C  CA    . LYS C 3 81  ? 4.465   25.385 39.793 1.00 95.38  ? 81  LYS A CA    1 
ATOM   826  C  C     . LYS C 3 81  ? 4.181   26.882 40.009 1.00 92.58  ? 81  LYS A C     1 
ATOM   827  O  O     . LYS C 3 81  ? 4.493   27.520 41.024 1.00 89.39  ? 81  LYS A O     1 
ATOM   828  C  CB    . LYS C 3 81  ? 3.185   24.565 39.581 1.00 93.14  ? 81  LYS A CB    1 
ATOM   829  N  N     . LEU C 3 82  ? 3.576   27.404 38.979 1.00 91.06  ? 82  LEU A N     1 
ATOM   830  C  CA    . LEU C 3 82  ? 3.165   28.760 38.820 1.00 88.32  ? 82  LEU A CA    1 
ATOM   831  C  C     . LEU C 3 82  ? 2.571   28.698 37.442 1.00 90.14  ? 82  LEU A C     1 
ATOM   832  O  O     . LEU C 3 82  ? 3.245   29.116 36.494 1.00 87.80  ? 82  LEU A O     1 
ATOM   833  C  CB    . LEU C 3 82  ? 4.404   29.649 38.810 1.00 83.11  ? 82  LEU A CB    1 
ATOM   834  N  N     . ARG C 3 83  ? 1.334   28.144 37.381 1.00 95.73  ? 83  ARG A N     1 
ATOM   835  C  CA    . ARG C 3 83  ? 0.605   27.981 36.121 1.00 100.00 ? 83  ARG A CA    1 
ATOM   836  C  C     . ARG C 3 83  ? 0.799   29.175 35.203 1.00 100.00 ? 83  ARG A C     1 
ATOM   837  O  O     . ARG C 3 83  ? 1.069   29.037 34.000 1.00 100.00 ? 83  ARG A O     1 
ATOM   838  C  CB    . ARG C 3 83  ? -0.858  27.521 36.229 1.00 100.00 ? 83  ARG A CB    1 
ATOM   839  C  CG    . ARG C 3 83  ? -1.642  27.792 34.935 1.00 100.00 ? 83  ARG A CG    1 
ATOM   840  C  CD    . ARG C 3 83  ? -3.071  27.236 34.902 1.00 100.00 ? 83  ARG A CD    1 
ATOM   841  N  NE    . ARG C 3 83  ? -3.946  27.953 33.953 1.00 100.00 ? 83  ARG A NE    1 
ATOM   842  C  CZ    . ARG C 3 83  ? -5.266  27.745 33.754 1.00 100.00 ? 83  ARG A CZ    1 
ATOM   843  N  NH1   . ARG C 3 83  ? -5.954  26.812 34.431 1.00 100.00 ? 83  ARG A NH1   1 
ATOM   844  N  NH2   . ARG C 3 83  ? -5.912  28.501 32.846 1.00 100.00 ? 83  ARG A NH2   1 
ATOM   845  N  N     . LYS C 3 84  ? 0.678   30.349 35.813 1.00 100.00 ? 84  LYS A N     1 
ATOM   846  C  CA    . LYS C 3 84  ? 0.857   31.583 35.093 1.00 98.56  ? 84  LYS A CA    1 
ATOM   847  C  C     . LYS C 3 84  ? 2.233   31.522 34.518 1.00 92.92  ? 84  LYS A C     1 
ATOM   848  O  O     . LYS C 3 84  ? 2.494   31.650 33.325 1.00 90.49  ? 84  LYS A O     1 
ATOM   849  C  CB    . LYS C 3 84  ? 0.884   32.738 36.074 1.00 100.00 ? 84  LYS A CB    1 
ATOM   850  C  CG    . LYS C 3 84  ? 1.564   33.949 35.465 1.00 100.00 ? 84  LYS A CG    1 
ATOM   851  C  CD    . LYS C 3 84  ? 1.093   35.242 36.103 1.00 100.00 ? 84  LYS A CD    1 
ATOM   852  C  CE    . LYS C 3 84  ? 1.141   36.414 35.131 1.00 100.00 ? 84  LYS A CE    1 
ATOM   853  N  NZ    . LYS C 3 84  ? 0.909   37.715 35.781 1.00 100.00 ? 84  LYS A NZ    1 
ATOM   854  N  N     . LEU C 3 85  ? 3.117   31.313 35.450 1.00 92.20  ? 85  LEU A N     1 
ATOM   855  C  CA    . LEU C 3 85  ? 4.478   31.217 35.090 1.00 95.85  ? 85  LEU A CA    1 
ATOM   856  C  C     . LEU C 3 85  ? 4.662   30.068 34.114 1.00 94.19  ? 85  LEU A C     1 
ATOM   857  O  O     . LEU C 3 85  ? 5.389   30.237 33.151 1.00 93.66  ? 85  LEU A O     1 
ATOM   858  C  CB    . LEU C 3 85  ? 5.406   31.138 36.305 1.00 100.00 ? 85  LEU A CB    1 
ATOM   859  C  CG    . LEU C 3 85  ? 6.846   30.867 35.872 1.00 100.00 ? 85  LEU A CG    1 
ATOM   860  C  CD1   . LEU C 3 85  ? 7.745   32.103 36.019 1.00 99.97  ? 85  LEU A CD1   1 
ATOM   861  C  CD2   . LEU C 3 85  ? 7.378   29.615 36.579 1.00 100.00 ? 85  LEU A CD2   1 
ATOM   862  N  N     . GLU C 3 86  ? 4.009   28.910 34.341 1.00 93.42  ? 86  GLU A N     1 
ATOM   863  C  CA    . GLU C 3 86  ? 4.167   27.795 33.399 1.00 94.13  ? 86  GLU A CA    1 
ATOM   864  C  C     . GLU C 3 86  ? 3.840   28.234 31.966 1.00 96.75  ? 86  GLU A C     1 
ATOM   865  O  O     . GLU C 3 86  ? 4.534   27.848 31.015 1.00 97.84  ? 86  GLU A O     1 
ATOM   866  C  CB    . GLU C 3 86  ? 3.501   26.431 33.772 1.00 92.40  ? 86  GLU A CB    1 
ATOM   867  C  CG    . GLU C 3 86  ? 4.320   25.522 34.728 1.00 92.86  ? 86  GLU A CG    1 
ATOM   868  C  CD    . GLU C 3 86  ? 5.681   25.087 34.209 1.00 96.40  ? 86  GLU A CD    1 
ATOM   869  O  OE1   . GLU C 3 86  ? 6.248   25.948 33.387 1.00 98.38  ? 86  GLU A OE1   1 
ATOM   870  O  OE2   . GLU C 3 86  ? 6.251   24.073 34.595 1.00 96.74  ? 86  GLU A OE2   1 
ATOM   871  N  N     . LYS C 3 87  ? 2.777   29.055 31.840 1.00 97.15  ? 87  LYS A N     1 
ATOM   872  C  CA    . LYS C 3 87  ? 2.277   29.617 30.584 1.00 97.28  ? 87  LYS A CA    1 
ATOM   873  C  C     . LYS C 3 87  ? 3.427   30.051 29.662 1.00 99.42  ? 87  LYS A C     1 
ATOM   874  O  O     . LYS C 3 87  ? 3.411   29.782 28.463 1.00 100.00 ? 87  LYS A O     1 
ATOM   875  C  CB    . LYS C 3 87  ? 1.329   30.806 30.881 1.00 97.95  ? 87  LYS A CB    1 
ATOM   876  C  CG    . LYS C 3 87  ? 0.648   31.441 29.661 1.00 98.75  ? 87  LYS A CG    1 
ATOM   877  C  CD    . LYS C 3 87  ? -0.271  32.654 29.923 1.00 99.35  ? 87  LYS A CD    1 
ATOM   878  C  CE    . LYS C 3 87  ? -1.019  33.110 28.649 1.00 99.46  ? 87  LYS A CE    1 
ATOM   879  N  NZ    . LYS C 3 87  ? -1.600  34.474 28.661 1.00 97.54  ? 87  LYS A NZ    1 
ATOM   880  N  N     . ILE C 3 88  ? 4.431   30.697 30.240 1.00 100.00 ? 88  ILE A N     1 
ATOM   881  C  CA    . ILE C 3 88  ? 5.653   31.249 29.607 1.00 100.00 ? 88  ILE A CA    1 
ATOM   882  C  C     . ILE C 3 88  ? 6.088   30.676 28.257 1.00 100.00 ? 88  ILE A C     1 
ATOM   883  O  O     . ILE C 3 88  ? 6.224   31.433 27.295 1.00 100.00 ? 88  ILE A O     1 
ATOM   884  C  CB    . ILE C 3 88  ? 6.862   31.190 30.575 1.00 100.00 ? 88  ILE A CB    1 
ATOM   885  C  CG1   . ILE C 3 88  ? 8.134   31.691 29.885 1.00 100.00 ? 88  ILE A CG1   1 
ATOM   886  C  CG2   . ILE C 3 88  ? 7.135   29.748 31.027 1.00 100.00 ? 88  ILE A CG2   1 
ATOM   887  C  CD1   . ILE C 3 88  ? 9.019   30.552 29.355 1.00 97.85  ? 88  ILE A CD1   1 
ATOM   888  N  N     . ARG C 3 89  ? 6.314   29.357 28.185 1.00 100.00 ? 89  ARG A N     1 
ATOM   889  C  CA    . ARG C 3 89  ? 6.766   28.622 26.995 1.00 100.00 ? 89  ARG A CA    1 
ATOM   890  C  C     . ARG C 3 89  ? 6.196   29.048 25.629 1.00 100.00 ? 89  ARG A C     1 
ATOM   891  O  O     . ARG C 3 89  ? 6.487   28.420 24.597 1.00 100.00 ? 89  ARG A O     1 
ATOM   892  C  CB    . ARG C 3 89  ? 6.586   27.119 27.177 1.00 100.00 ? 89  ARG A CB    1 
ATOM   893  C  CG    . ARG C 3 89  ? 5.122   26.718 27.220 1.00 99.48  ? 89  ARG A CG    1 
ATOM   894  C  CD    . ARG C 3 89  ? 4.965   25.212 27.160 1.00 100.00 ? 89  ARG A CD    1 
ATOM   895  N  NE    . ARG C 3 89  ? 3.569   24.775 27.189 1.00 100.00 ? 89  ARG A NE    1 
ATOM   896  C  CZ    . ARG C 3 89  ? 3.170   23.521 27.484 1.00 100.00 ? 89  ARG A CZ    1 
ATOM   897  N  NH1   . ARG C 3 89  ? 4.043   22.534 27.783 1.00 100.00 ? 89  ARG A NH1   1 
ATOM   898  N  NH2   . ARG C 3 89  ? 1.858   23.241 27.477 1.00 100.00 ? 89  ARG A NH2   1 
ATOM   899  N  N     . GLN C 3 90  ? 5.410   30.121 25.622 1.00 100.00 ? 90  GLN A N     1 
ATOM   900  C  CA    . GLN C 3 90  ? 4.793   30.680 24.425 1.00 100.00 ? 90  GLN A CA    1 
ATOM   901  C  C     . GLN C 3 90  ? 5.847   31.206 23.420 1.00 100.00 ? 90  GLN A C     1 
ATOM   902  O  O     . GLN C 3 90  ? 5.685   31.097 22.192 1.00 100.00 ? 90  GLN A O     1 
ATOM   903  C  CB    . GLN C 3 90  ? 3.811   31.767 24.840 1.00 100.00 ? 90  GLN A CB    1 
ATOM   904  N  N     . ASP C 3 91  ? 6.912   31.783 24.021 1.00 100.00 ? 91  ASP A N     1 
ATOM   905  C  CA    . ASP C 3 91  ? 8.162   32.387 23.521 1.00 100.00 ? 91  ASP A CA    1 
ATOM   906  C  C     . ASP C 3 91  ? 8.470   32.580 22.003 1.00 100.00 ? 91  ASP A C     1 
ATOM   907  O  O     . ASP C 3 91  ? 7.806   32.119 21.056 1.00 100.00 ? 91  ASP A O     1 
ATOM   908  C  CB    . ASP C 3 91  ? 9.288   31.531 24.202 1.00 100.00 ? 91  ASP A CB    1 
ATOM   909  C  CG    . ASP C 3 91  ? 10.738  31.821 23.849 1.00 100.00 ? 91  ASP A CG    1 
ATOM   910  O  OD1   . ASP C 3 91  ? 11.104  31.294 22.698 1.00 100.00 ? 91  ASP A OD1   1 
ATOM   911  O  OD2   . ASP C 3 91  ? 11.494  32.482 24.571 1.00 100.00 ? 91  ASP A OD2   1 
ATOM   912  N  N     . ASP C 3 92  ? 9.570   33.317 21.833 1.00 99.90  ? 92  ASP A N     1 
ATOM   913  C  CA    . ASP C 3 92  ? 10.252  33.689 20.619 1.00 100.00 ? 92  ASP A CA    1 
ATOM   914  C  C     . ASP C 3 92  ? 9.729   34.712 19.648 1.00 100.00 ? 92  ASP A C     1 
ATOM   915  O  O     . ASP C 3 92  ? 10.548  35.430 19.044 1.00 100.00 ? 92  ASP A O     1 
ATOM   916  C  CB    . ASP C 3 92  ? 10.822  32.455 19.899 1.00 100.00 ? 92  ASP A CB    1 
ATOM   917  C  CG    . ASP C 3 92  ? 12.275  32.639 19.513 1.00 100.00 ? 92  ASP A CG    1 
ATOM   918  O  OD1   . ASP C 3 92  ? 12.870  33.608 20.200 1.00 100.00 ? 92  ASP A OD1   1 
ATOM   919  O  OD2   . ASP C 3 92  ? 12.857  31.895 18.697 1.00 100.00 ? 92  ASP A OD2   1 
ATOM   920  N  N     . THR C 3 93  ? 8.415   34.792 19.464 1.00 99.04  ? 93  THR A N     1 
ATOM   921  C  CA    . THR C 3 93  ? 7.933   35.790 18.531 1.00 96.09  ? 93  THR A CA    1 
ATOM   922  C  C     . THR C 3 93  ? 8.404   37.166 18.998 1.00 91.96  ? 93  THR A C     1 
ATOM   923  O  O     . THR C 3 93  ? 9.077   37.903 18.286 1.00 90.42  ? 93  THR A O     1 
ATOM   924  C  CB    . THR C 3 93  ? 6.391   35.696 18.361 1.00 97.31  ? 93  THR A CB    1 
ATOM   925  O  OG1   . THR C 3 93  ? 5.896   36.637 17.434 1.00 100.00 ? 93  THR A OG1   1 
ATOM   926  C  CG2   . THR C 3 93  ? 5.665   35.849 19.685 1.00 96.27  ? 93  THR A CG2   1 
ATOM   927  N  N     . SER C 3 94  ? 8.078   37.431 20.252 1.00 91.27  ? 94  SER A N     1 
ATOM   928  C  CA    . SER C 3 94  ? 8.373   38.637 21.005 1.00 87.71  ? 94  SER A CA    1 
ATOM   929  C  C     . SER C 3 94  ? 9.826   39.053 21.009 1.00 80.32  ? 94  SER A C     1 
ATOM   930  O  O     . SER C 3 94  ? 10.131  40.238 20.926 1.00 77.33  ? 94  SER A O     1 
ATOM   931  C  CB    . SER C 3 94  ? 7.797   38.534 22.403 1.00 91.74  ? 94  SER A CB    1 
ATOM   932  O  OG    . SER C 3 94  ? 6.441   38.084 22.345 1.00 94.05  ? 94  SER A OG    1 
ATOM   933  N  N     . SER C 3 95  ? 10.741  38.096 21.110 1.00 76.91  ? 95  SER A N     1 
ATOM   934  C  CA    . SER C 3 95  ? 12.128  38.495 21.105 1.00 73.48  ? 95  SER A CA    1 
ATOM   935  C  C     . SER C 3 95  ? 12.465  39.192 19.812 1.00 65.81  ? 95  SER A C     1 
ATOM   936  O  O     . SER C 3 95  ? 12.846  40.346 19.782 1.00 62.29  ? 95  SER A O     1 
ATOM   937  C  CB    . SER C 3 95  ? 13.056  37.304 21.182 1.00 79.49  ? 95  SER A CB    1 
ATOM   938  O  OG    . SER C 3 95  ? 14.321  37.682 20.633 1.00 84.45  ? 95  SER A OG    1 
ATOM   939  N  N     . SER C 3 96  ? 12.292  38.426 18.747 1.00 64.95  ? 96  SER A N     1 
ATOM   940  C  CA    . SER C 3 96  ? 12.552  38.826 17.389 1.00 64.42  ? 96  SER A CA    1 
ATOM   941  C  C     . SER C 3 96  ? 11.793  40.015 16.858 1.00 64.46  ? 96  SER A C     1 
ATOM   942  O  O     . SER C 3 96  ? 12.362  40.835 16.130 1.00 69.92  ? 96  SER A O     1 
ATOM   943  C  CB    . SER C 3 96  ? 12.592  37.656 16.435 1.00 65.80  ? 96  SER A CB    1 
ATOM   944  O  OG    . SER C 3 96  ? 13.758  36.903 16.739 1.00 67.11  ? 96  SER A OG    1 
ATOM   945  N  N     . ILE C 3 97  ? 10.524  40.114 17.204 1.00 57.23  ? 97  ILE A N     1 
ATOM   946  C  CA    . ILE C 3 97  ? 9.736   41.212 16.738 1.00 55.20  ? 97  ILE A CA    1 
ATOM   947  C  C     . ILE C 3 97  ? 10.366  42.560 17.024 1.00 56.49  ? 97  ILE A C     1 
ATOM   948  O  O     . ILE C 3 97  ? 10.742  43.299 16.127 1.00 57.97  ? 97  ILE A O     1 
ATOM   949  C  CB    . ILE C 3 97  ? 8.378   41.141 17.400 1.00 56.07  ? 97  ILE A CB    1 
ATOM   950  C  CG1   . ILE C 3 97  ? 7.449   40.351 16.522 1.00 61.51  ? 97  ILE A CG1   1 
ATOM   951  C  CG2   . ILE C 3 97  ? 7.783   42.518 17.653 1.00 54.48  ? 97  ILE A CG2   1 
ATOM   952  C  CD1   . ILE C 3 97  ? 6.182   40.003 17.279 1.00 67.56  ? 97  ILE A CD1   1 
ATOM   953  N  N     . ASN C 3 98  ? 10.480  42.842 18.294 1.00 58.63  ? 98  ASN A N     1 
ATOM   954  C  CA    . ASN C 3 98  ? 11.032  44.063 18.805 1.00 63.15  ? 98  ASN A CA    1 
ATOM   955  C  C     . ASN C 3 98  ? 12.289  44.434 18.139 1.00 51.26  ? 98  ASN A C     1 
ATOM   956  O  O     . ASN C 3 98  ? 12.539  45.616 17.845 1.00 48.74  ? 98  ASN A O     1 
ATOM   957  C  CB    . ASN C 3 98  ? 11.388  43.908 20.286 1.00 78.83  ? 98  ASN A CB    1 
ATOM   958  C  CG    . ASN C 3 98  ? 10.174  43.841 21.185 1.00 90.86  ? 98  ASN A CG    1 
ATOM   959  O  OD1   . ASN C 3 98  ? 9.301   44.735 21.168 1.00 93.85  ? 98  ASN A OD1   1 
ATOM   960  N  ND2   . ASN C 3 98  ? 10.094  42.741 21.936 1.00 96.19  ? 98  ASN A ND2   1 
ATOM   961  N  N     . PHE C 3 99  ? 13.053  43.389 17.937 1.00 44.63  ? 99  PHE A N     1 
ATOM   962  C  CA    . PHE C 3 99  ? 14.314  43.573 17.308 1.00 44.84  ? 99  PHE A CA    1 
ATOM   963  C  C     . PHE C 3 99  ? 14.164  44.329 15.993 1.00 44.43  ? 99  PHE A C     1 
ATOM   964  O  O     . PHE C 3 99  ? 14.780  45.399 15.738 1.00 46.26  ? 99  PHE A O     1 
ATOM   965  C  CB    . PHE C 3 99  ? 14.925  42.234 17.000 1.00 45.03  ? 99  PHE A CB    1 
ATOM   966  C  CG    . PHE C 3 99  ? 15.984  42.496 15.976 1.00 50.53  ? 99  PHE A CG    1 
ATOM   967  C  CD1   . PHE C 3 99  ? 17.204  43.020 16.392 1.00 52.18  ? 99  PHE A CD1   1 
ATOM   968  C  CD2   . PHE C 3 99  ? 15.777  42.242 14.616 1.00 54.23  ? 99  PHE A CD2   1 
ATOM   969  C  CE1   . PHE C 3 99  ? 18.213  43.277 15.465 1.00 55.55  ? 99  PHE A CE1   1 
ATOM   970  C  CE2   . PHE C 3 99  ? 16.773  42.506 13.677 1.00 57.00  ? 99  PHE A CE2   1 
ATOM   971  C  CZ    . PHE C 3 99  ? 17.997  43.020 14.110 1.00 57.33  ? 99  PHE A CZ    1 
ATOM   972  N  N     . LEU C 3 100 ? 13.319  43.706 15.168 1.00 34.48  ? 100 LEU A N     1 
ATOM   973  C  CA    . LEU C 3 100 ? 12.979  44.188 13.859 1.00 21.50  ? 100 LEU A CA    1 
ATOM   974  C  C     . LEU C 3 100 ? 12.554  45.649 13.952 1.00 8.41   ? 100 LEU A C     1 
ATOM   975  O  O     . LEU C 3 100 ? 12.832  46.478 13.097 1.00 5.58   ? 100 LEU A O     1 
ATOM   976  C  CB    . LEU C 3 100 ? 11.827  43.299 13.403 1.00 24.39  ? 100 LEU A CB    1 
ATOM   977  C  CG    . LEU C 3 100 ? 11.843  42.991 11.934 1.00 27.40  ? 100 LEU A CG    1 
ATOM   978  C  CD1   . LEU C 3 100 ? 13.264  42.700 11.475 1.00 26.52  ? 100 LEU A CD1   1 
ATOM   979  C  CD2   . LEU C 3 100 ? 11.017  41.743 11.766 1.00 32.82  ? 100 LEU A CD2   1 
ATOM   980  N  N     . THR C 3 101 ? 11.858  45.965 15.018 1.00 6.30   ? 101 THR A N     1 
ATOM   981  C  CA    . THR C 3 101 ? 11.391  47.313 15.250 1.00 11.83  ? 101 THR A CA    1 
ATOM   982  C  C     . THR C 3 101 ? 12.494  48.345 15.274 1.00 14.57  ? 101 THR A C     1 
ATOM   983  O  O     . THR C 3 101 ? 12.282  49.503 14.905 1.00 20.24  ? 101 THR A O     1 
ATOM   984  C  CB    . THR C 3 101 ? 10.648  47.343 16.528 1.00 20.37  ? 101 THR A CB    1 
ATOM   985  O  OG1   . THR C 3 101 ? 9.311   47.100 16.172 1.00 26.01  ? 101 THR A OG1   1 
ATOM   986  C  CG2   . THR C 3 101 ? 10.885  48.693 17.177 1.00 23.60  ? 101 THR A CG2   1 
ATOM   987  N  N     . ARG C 3 102 ? 13.673  47.915 15.701 1.00 13.66  ? 102 ARG A N     1 
ATOM   988  C  CA    . ARG C 3 102 ? 14.803  48.801 15.740 1.00 20.07  ? 102 ARG A CA    1 
ATOM   989  C  C     . ARG C 3 102 ? 15.023  49.399 14.377 1.00 21.60  ? 102 ARG A C     1 
ATOM   990  O  O     . ARG C 3 102 ? 15.602  50.458 14.250 1.00 25.45  ? 102 ARG A O     1 
ATOM   991  C  CB    . ARG C 3 102 ? 16.069  48.132 16.246 1.00 26.00  ? 102 ARG A CB    1 
ATOM   992  C  CG    . ARG C 3 102 ? 16.040  48.106 17.773 1.00 34.58  ? 102 ARG A CG    1 
ATOM   993  C  CD    . ARG C 3 102 ? 17.009  47.132 18.393 1.00 44.98  ? 102 ARG A CD    1 
ATOM   994  N  NE    . ARG C 3 102 ? 18.393  47.447 18.061 1.00 58.18  ? 102 ARG A NE    1 
ATOM   995  C  CZ    . ARG C 3 102 ? 19.444  46.672 18.394 1.00 69.47  ? 102 ARG A CZ    1 
ATOM   996  N  NH1   . ARG C 3 102 ? 19.275  45.522 19.064 1.00 75.40  ? 102 ARG A NH1   1 
ATOM   997  N  NH2   . ARG C 3 102 ? 20.694  47.033 18.044 1.00 70.12  ? 102 ARG A NH2   1 
ATOM   998  N  N     . VAL C 3 103 ? 14.536  48.701 13.358 1.00 24.30  ? 103 VAL A N     1 
ATOM   999  C  CA    . VAL C 3 103 ? 14.660  49.147 11.982 1.00 25.17  ? 103 VAL A CA    1 
ATOM   1000 C  C     . VAL C 3 103 ? 13.784  50.332 11.704 1.00 27.92  ? 103 VAL A C     1 
ATOM   1001 O  O     . VAL C 3 103 ? 12.553  50.237 11.847 1.00 27.29  ? 103 VAL A O     1 
ATOM   1002 C  CB    . VAL C 3 103 ? 14.198  48.109 10.967 1.00 22.35  ? 103 VAL A CB    1 
ATOM   1003 C  CG1   . VAL C 3 103 ? 14.566  48.573 9.562  1.00 21.53  ? 103 VAL A CG1   1 
ATOM   1004 C  CG2   . VAL C 3 103 ? 14.853  46.787 11.203 1.00 25.09  ? 103 VAL A CG2   1 
ATOM   1005 N  N     . THR C 3 104 ? 14.418  51.424 11.275 1.00 26.79  ? 104 THR A N     1 
ATOM   1006 C  CA    . THR C 3 104 ? 13.627  52.596 10.974 1.00 26.24  ? 104 THR A CA    1 
ATOM   1007 C  C     . THR C 3 104 ? 12.696  52.333 9.830  1.00 21.00  ? 104 THR A C     1 
ATOM   1008 O  O     . THR C 3 104 ? 13.133  52.080 8.715  1.00 27.86  ? 104 THR A O     1 
ATOM   1009 C  CB    . THR C 3 104 ? 14.416  53.904 10.713 1.00 31.63  ? 104 THR A CB    1 
ATOM   1010 O  OG1   . THR C 3 104 ? 13.514  54.981 10.758 1.00 37.41  ? 104 THR A OG1   1 
ATOM   1011 C  CG2   . THR C 3 104 ? 15.116  53.929 9.369  1.00 26.25  ? 104 THR A CG2   1 
ATOM   1012 N  N     . GLY C 3 105 ? 11.419  52.400 10.124 1.00 10.93  ? 105 GLY A N     1 
ATOM   1013 C  CA    . GLY C 3 105 ? 10.372  52.186 9.161  1.00 8.19   ? 105 GLY A CA    1 
ATOM   1014 C  C     . GLY C 3 105 ? 9.479   51.068 9.645  1.00 14.96  ? 105 GLY A C     1 
ATOM   1015 O  O     . GLY C 3 105 ? 8.260   50.996 9.328  1.00 12.42  ? 105 GLY A O     1 
ATOM   1016 N  N     . ILE C 3 106 ? 10.145  50.190 10.424 1.00 19.78  ? 106 ILE A N     1 
ATOM   1017 C  CA    . ILE C 3 106 ? 9.487   49.027 10.990 1.00 22.84  ? 106 ILE A CA    1 
ATOM   1018 C  C     . ILE C 3 106 ? 8.737   49.261 12.296 1.00 23.53  ? 106 ILE A C     1 
ATOM   1019 O  O     . ILE C 3 106 ? 9.316   49.450 13.404 1.00 21.52  ? 106 ILE A O     1 
ATOM   1020 C  CB    . ILE C 3 106 ? 10.391  47.808 11.040 1.00 21.68  ? 106 ILE A CB    1 
ATOM   1021 C  CG1   . ILE C 3 106 ? 10.750  47.371 9.614  1.00 18.80  ? 106 ILE A CG1   1 
ATOM   1022 C  CG2   . ILE C 3 106 ? 9.694   46.690 11.822 1.00 21.13  ? 106 ILE A CG2   1 
ATOM   1023 C  CD1   . ILE C 3 106 ? 11.927  46.384 9.550  1.00 14.79  ? 106 ILE A CD1   1 
ATOM   1024 N  N     . GLY C 3 107 ? 7.417   49.255 12.137 1.00 22.46  ? 107 GLY A N     1 
ATOM   1025 C  CA    . GLY C 3 107 ? 6.624   49.450 13.295 1.00 25.96  ? 107 GLY A CA    1 
ATOM   1026 C  C     . GLY C 3 107 ? 6.189   48.104 13.788 1.00 28.12  ? 107 GLY A C     1 
ATOM   1027 O  O     . GLY C 3 107 ? 6.541   47.094 13.167 1.00 31.85  ? 107 GLY A O     1 
ATOM   1028 N  N     . PRO C 3 108 ? 5.447   48.082 14.890 1.00 24.48  ? 108 PRO A N     1 
ATOM   1029 C  CA    . PRO C 3 108 ? 5.032   46.818 15.395 1.00 24.45  ? 108 PRO A CA    1 
ATOM   1030 C  C     . PRO C 3 108 ? 4.230   46.085 14.346 1.00 21.28  ? 108 PRO A C     1 
ATOM   1031 O  O     . PRO C 3 108 ? 4.444   44.903 14.132 1.00 19.21  ? 108 PRO A O     1 
ATOM   1032 C  CB    . PRO C 3 108 ? 4.299   47.063 16.709 1.00 23.01  ? 108 PRO A CB    1 
ATOM   1033 C  CG    . PRO C 3 108 ? 4.001   48.543 16.781 1.00 19.20  ? 108 PRO A CG    1 
ATOM   1034 C  CD    . PRO C 3 108 ? 4.696   49.154 15.582 1.00 22.82  ? 108 PRO A CD    1 
ATOM   1035 N  N     . SER C 3 109 ? 3.337   46.789 13.670 1.00 21.47  ? 109 SER A N     1 
ATOM   1036 C  CA    . SER C 3 109 ? 2.575   46.102 12.643 1.00 27.46  ? 109 SER A CA    1 
ATOM   1037 C  C     . SER C 3 109 ? 3.453   45.494 11.487 1.00 32.99  ? 109 SER A C     1 
ATOM   1038 O  O     . SER C 3 109 ? 3.402   44.294 11.176 1.00 34.89  ? 109 SER A O     1 
ATOM   1039 C  CB    . SER C 3 109 ? 1.274   46.792 12.245 1.00 25.72  ? 109 SER A CB    1 
ATOM   1040 N  N     . ALA C 3 110 ? 4.289   46.256 10.825 1.00 33.42  ? 110 ALA A N     1 
ATOM   1041 C  CA    . ALA C 3 110 ? 5.075   45.604 9.792  1.00 38.41  ? 110 ALA A CA    1 
ATOM   1042 C  C     . ALA C 3 110 ? 6.042   44.562 10.396 1.00 39.69  ? 110 ALA A C     1 
ATOM   1043 O  O     . ALA C 3 110 ? 6.472   43.611 9.729  1.00 44.02  ? 110 ALA A O     1 
ATOM   1044 C  CB    . ALA C 3 110 ? 5.737   46.557 8.797  1.00 40.48  ? 110 ALA A CB    1 
ATOM   1045 N  N     . ALA C 3 111 ? 6.382   44.736 11.671 1.00 32.81  ? 111 ALA A N     1 
ATOM   1046 C  CA    . ALA C 3 111 ? 7.280   43.790 12.280 1.00 29.93  ? 111 ALA A CA    1 
ATOM   1047 C  C     . ALA C 3 111 ? 6.658   42.413 12.470 1.00 32.64  ? 111 ALA A C     1 
ATOM   1048 O  O     . ALA C 3 111 ? 7.270   41.342 12.313 1.00 26.82  ? 111 ALA A O     1 
ATOM   1049 C  CB    . ALA C 3 111 ? 7.993   44.358 13.496 1.00 28.22  ? 111 ALA A CB    1 
ATOM   1050 N  N     . ARG C 3 112 ? 5.404   42.442 12.828 1.00 46.29  ? 112 ARG A N     1 
ATOM   1051 C  CA    . ARG C 3 112 ? 4.679   41.201 13.049 1.00 57.26  ? 112 ARG A CA    1 
ATOM   1052 C  C     . ARG C 3 112 ? 4.698   40.390 11.783 1.00 53.85  ? 112 ARG A C     1 
ATOM   1053 O  O     . ARG C 3 112 ? 5.304   39.316 11.704 1.00 52.24  ? 112 ARG A O     1 
ATOM   1054 C  CB    . ARG C 3 112 ? 3.238   41.532 13.393 1.00 68.91  ? 112 ARG A CB    1 
ATOM   1055 C  CG    . ARG C 3 112 ? 2.668   40.734 14.556 1.00 83.44  ? 112 ARG A CG    1 
ATOM   1056 C  CD    . ARG C 3 112 ? 1.763   41.603 15.460 1.00 95.30  ? 112 ARG A CD    1 
ATOM   1057 N  NE    . ARG C 3 112 ? 2.496   42.684 16.162 1.00 100.00 ? 112 ARG A NE    1 
ATOM   1058 C  CZ    . ARG C 3 112 ? 1.969   43.816 16.645 1.00 100.00 ? 112 ARG A CZ    1 
ATOM   1059 N  NH1   . ARG C 3 112 ? 0.669   44.091 16.531 1.00 100.00 ? 112 ARG A NH1   1 
ATOM   1060 N  NH2   . ARG C 3 112 ? 2.775   44.688 17.257 1.00 100.00 ? 112 ARG A NH2   1 
ATOM   1061 N  N     . LYS C 3 113 ? 4.032   40.984 10.803 1.00 52.34  ? 113 LYS A N     1 
ATOM   1062 C  CA    . LYS C 3 113 ? 3.880   40.451 9.479  1.00 51.68  ? 113 LYS A CA    1 
ATOM   1063 C  C     . LYS C 3 113 ? 5.196   39.917 8.999  1.00 42.05  ? 113 LYS A C     1 
ATOM   1064 O  O     . LYS C 3 113 ? 5.245   38.865 8.433  1.00 42.18  ? 113 LYS A O     1 
ATOM   1065 C  CB    . LYS C 3 113 ? 3.359   41.503 8.524  1.00 61.63  ? 113 LYS A CB    1 
ATOM   1066 C  CG    . LYS C 3 113 ? 1.983   42.021 8.883  1.00 70.05  ? 113 LYS A CG    1 
ATOM   1067 C  CD    . LYS C 3 113 ? 1.439   43.000 7.844  1.00 79.83  ? 113 LYS A CD    1 
ATOM   1068 C  CE    . LYS C 3 113 ? -0.017  43.393 8.093  1.00 86.26  ? 113 LYS A CE    1 
ATOM   1069 N  NZ    . LYS C 3 113 ? -0.768  43.709 6.864  1.00 88.19  ? 113 LYS A NZ    1 
ATOM   1070 N  N     . LEU C 3 114 ? 6.264   40.659 9.252  1.00 35.43  ? 114 LEU A N     1 
ATOM   1071 C  CA    . LEU C 3 114 ? 7.583   40.229 8.852  1.00 29.13  ? 114 LEU A CA    1 
ATOM   1072 C  C     . LEU C 3 114 ? 7.997   38.973 9.574  1.00 33.61  ? 114 LEU A C     1 
ATOM   1073 O  O     . LEU C 3 114 ? 8.640   38.082 9.009  1.00 34.97  ? 114 LEU A O     1 
ATOM   1074 C  CB    . LEU C 3 114 ? 8.626   41.278 9.137  1.00 20.49  ? 114 LEU A CB    1 
ATOM   1075 C  CG    . LEU C 3 114 ? 8.683   42.243 8.015  1.00 21.96  ? 114 LEU A CG    1 
ATOM   1076 C  CD1   . LEU C 3 114 ? 10.084  42.791 7.932  1.00 23.91  ? 114 LEU A CD1   1 
ATOM   1077 C  CD2   . LEU C 3 114 ? 8.397   41.489 6.739  1.00 25.58  ? 114 LEU A CD2   1 
ATOM   1078 N  N     . VAL C 3 115 ? 7.650   38.922 10.849 1.00 34.38  ? 115 VAL A N     1 
ATOM   1079 C  CA    . VAL C 3 115 ? 7.997   37.762 11.597 1.00 38.77  ? 115 VAL A CA    1 
ATOM   1080 C  C     . VAL C 3 115 ? 7.180   36.534 11.092 1.00 46.81  ? 115 VAL A C     1 
ATOM   1081 O  O     . VAL C 3 115 ? 7.746   35.452 10.847 1.00 43.56  ? 115 VAL A O     1 
ATOM   1082 C  CB    . VAL C 3 115 ? 8.048   38.064 13.095 1.00 37.04  ? 115 VAL A CB    1 
ATOM   1083 C  CG1   . VAL C 3 115 ? 7.140   37.130 13.895 1.00 37.75  ? 115 VAL A CG1   1 
ATOM   1084 C  CG2   . VAL C 3 115 ? 9.474   37.924 13.601 1.00 35.51  ? 115 VAL A CG2   1 
ATOM   1085 N  N     . ASP C 3 116 ? 5.836   36.711 10.900 1.00 54.35  ? 116 ASP A N     1 
ATOM   1086 C  CA    . ASP C 3 116 ? 4.922   35.638 10.417 1.00 59.58  ? 116 ASP A CA    1 
ATOM   1087 C  C     . ASP C 3 116 ? 5.367   34.918 9.141  1.00 58.61  ? 116 ASP A C     1 
ATOM   1088 O  O     . ASP C 3 116 ? 5.107   33.737 8.926  1.00 53.57  ? 116 ASP A O     1 
ATOM   1089 C  CB    . ASP C 3 116 ? 3.466   36.104 10.209 1.00 64.21  ? 116 ASP A CB    1 
ATOM   1090 C  CG    . ASP C 3 116 ? 2.644   36.134 11.467 1.00 68.81  ? 116 ASP A CG    1 
ATOM   1091 O  OD1   . ASP C 3 116 ? 3.381   36.047 12.560 1.00 71.32  ? 116 ASP A OD1   1 
ATOM   1092 O  OD2   . ASP C 3 116 ? 1.423   36.252 11.459 1.00 68.41  ? 116 ASP A OD2   1 
ATOM   1093 N  N     . GLU C 3 117 ? 6.031   35.674 8.289  1.00 65.00  ? 117 GLU A N     1 
ATOM   1094 C  CA    . GLU C 3 117 ? 6.549   35.206 7.024  1.00 67.53  ? 117 GLU A CA    1 
ATOM   1095 C  C     . GLU C 3 117 ? 7.960   34.716 7.213  1.00 62.80  ? 117 GLU A C     1 
ATOM   1096 O  O     . GLU C 3 117 ? 8.718   34.558 6.246  1.00 62.49  ? 117 GLU A O     1 
ATOM   1097 C  CB    . GLU C 3 117 ? 6.412   36.241 5.887  1.00 72.74  ? 117 GLU A CB    1 
ATOM   1098 C  CG    . GLU C 3 117 ? 4.963   36.759 5.818  1.00 79.54  ? 117 GLU A CG    1 
ATOM   1099 C  CD    . GLU C 3 117 ? 4.557   37.380 4.514  1.00 85.72  ? 117 GLU A CD    1 
ATOM   1100 O  OE1   . GLU C 3 117 ? 5.486   37.286 3.602  1.00 88.65  ? 117 GLU A OE1   1 
ATOM   1101 O  OE2   . GLU C 3 117 ? 3.458   37.878 4.318  1.00 87.68  ? 117 GLU A OE2   1 
ATOM   1102 N  N     . GLY C 3 118 ? 8.281   34.486 8.495  1.00 57.68  ? 118 GLY A N     1 
ATOM   1103 C  CA    . GLY C 3 118 ? 9.596   33.997 8.876  1.00 57.19  ? 118 GLY A CA    1 
ATOM   1104 C  C     . GLY C 3 118 ? 10.784  34.972 8.839  1.00 55.03  ? 118 GLY A C     1 
ATOM   1105 O  O     . GLY C 3 118 ? 11.871  34.563 9.263  1.00 51.18  ? 118 GLY A O     1 
ATOM   1106 N  N     . ILE C 3 119 ? 10.609  36.232 8.342  1.00 54.12  ? 119 ILE A N     1 
ATOM   1107 C  CA    . ILE C 3 119 ? 11.733  37.185 8.313  1.00 50.18  ? 119 ILE A CA    1 
ATOM   1108 C  C     . ILE C 3 119 ? 11.906  37.633 9.747  1.00 50.33  ? 119 ILE A C     1 
ATOM   1109 O  O     . ILE C 3 119 ? 11.019  38.343 10.256 1.00 48.43  ? 119 ILE A O     1 
ATOM   1110 C  CB    . ILE C 3 119 ? 11.485  38.396 7.412  1.00 44.24  ? 119 ILE A CB    1 
ATOM   1111 N  N     . LYS C 3 120 ? 13.008  37.214 10.414 1.00 48.67  ? 120 LYS A N     1 
ATOM   1112 C  CA    . LYS C 3 120 ? 13.126  37.652 11.785 1.00 49.60  ? 120 LYS A CA    1 
ATOM   1113 C  C     . LYS C 3 120 ? 14.516  37.716 12.330 1.00 48.00  ? 120 LYS A C     1 
ATOM   1114 O  O     . LYS C 3 120 ? 14.801  37.281 13.433 1.00 45.11  ? 120 LYS A O     1 
ATOM   1115 C  CB    . LYS C 3 120 ? 12.170  36.965 12.712 1.00 54.33  ? 120 LYS A CB    1 
ATOM   1116 C  CG    . LYS C 3 120 ? 12.395  35.475 12.752 1.00 61.48  ? 120 LYS A CG    1 
ATOM   1117 C  CD    . LYS C 3 120 ? 11.203  34.706 13.318 1.00 68.16  ? 120 LYS A CD    1 
ATOM   1118 C  CE    . LYS C 3 120 ? 11.414  33.189 13.309 1.00 72.90  ? 120 LYS A CE    1 
ATOM   1119 N  NZ    . LYS C 3 120 ? 10.189  32.384 13.499 1.00 72.85  ? 120 LYS A NZ    1 
ATOM   1120 N  N     . THR C 3 121 ? 15.367  38.280 11.517 1.00 48.99  ? 121 THR A N     1 
ATOM   1121 C  CA    . THR C 3 121 ? 16.758  38.474 11.818 1.00 51.82  ? 121 THR A CA    1 
ATOM   1122 C  C     . THR C 3 121 ? 17.141  39.715 11.045 1.00 51.46  ? 121 THR A C     1 
ATOM   1123 O  O     . THR C 3 121 ? 16.306  40.295 10.355 1.00 57.82  ? 121 THR A O     1 
ATOM   1124 C  CB    . THR C 3 121 ? 17.640  37.324 11.297 1.00 53.40  ? 121 THR A CB    1 
ATOM   1125 O  OG1   . THR C 3 121 ? 18.006  37.605 9.962  1.00 55.00  ? 121 THR A OG1   1 
ATOM   1126 C  CG2   . THR C 3 121 ? 16.833  36.049 11.271 1.00 53.87  ? 121 THR A CG2   1 
ATOM   1127 N  N     . LEU C 3 122 ? 18.388  40.110 11.161 1.00 40.63  ? 122 LEU A N     1 
ATOM   1128 C  CA    . LEU C 3 122 ? 18.893  41.259 10.473 1.00 35.26  ? 122 LEU A CA    1 
ATOM   1129 C  C     . LEU C 3 122 ? 19.331  40.697 9.147  1.00 37.86  ? 122 LEU A C     1 
ATOM   1130 O  O     . LEU C 3 122 ? 19.113  41.218 8.047  1.00 35.35  ? 122 LEU A O     1 
ATOM   1131 C  CB    . LEU C 3 122 ? 20.094  41.685 11.312 1.00 36.61  ? 122 LEU A CB    1 
ATOM   1132 C  CG    . LEU C 3 122 ? 20.902  42.856 10.840 1.00 35.73  ? 122 LEU A CG    1 
ATOM   1133 C  CD1   . LEU C 3 122 ? 21.672  42.497 9.593  1.00 33.02  ? 122 LEU A CD1   1 
ATOM   1134 C  CD2   . LEU C 3 122 ? 19.953  44.003 10.579 1.00 41.81  ? 122 LEU A CD2   1 
ATOM   1135 N  N     . GLU C 3 123 ? 19.973  39.557 9.299  1.00 44.23  ? 123 GLU A N     1 
ATOM   1136 C  CA    . GLU C 3 123 ? 20.479  38.824 8.176  1.00 47.51  ? 123 GLU A CA    1 
ATOM   1137 C  C     . GLU C 3 123 ? 19.336  38.555 7.189  1.00 50.48  ? 123 GLU A C     1 
ATOM   1138 O  O     . GLU C 3 123 ? 19.441  38.816 5.999  1.00 52.99  ? 123 GLU A O     1 
ATOM   1139 C  CB    . GLU C 3 123 ? 21.139  37.546 8.691  1.00 44.52  ? 123 GLU A CB    1 
ATOM   1140 N  N     . ASP C 3 124 ? 18.229  38.041 7.720  1.00 47.67  ? 124 ASP A N     1 
ATOM   1141 C  CA    . ASP C 3 124 ? 17.058  37.720 6.958  1.00 43.18  ? 124 ASP A CA    1 
ATOM   1142 C  C     . ASP C 3 124 ? 16.492  38.874 6.210  1.00 37.33  ? 124 ASP A C     1 
ATOM   1143 O  O     . ASP C 3 124 ? 16.104  38.695 5.066  1.00 32.85  ? 124 ASP A O     1 
ATOM   1144 C  CB    . ASP C 3 124 ? 15.965  37.121 7.838  1.00 46.83  ? 124 ASP A CB    1 
ATOM   1145 C  CG    . ASP C 3 124 ? 16.257  35.711 8.254  1.00 46.63  ? 124 ASP A CG    1 
ATOM   1146 O  OD1   . ASP C 3 124 ? 17.529  35.394 8.134  1.00 41.01  ? 124 ASP A OD1   1 
ATOM   1147 O  OD2   . ASP C 3 124 ? 15.379  34.953 8.643  1.00 49.44  ? 124 ASP A OD2   1 
ATOM   1148 N  N     . LEU C 3 125 ? 16.433  40.037 6.874  1.00 38.56  ? 125 LEU A N     1 
ATOM   1149 C  CA    . LEU C 3 125 ? 15.885  41.236 6.224  1.00 37.15  ? 125 LEU A CA    1 
ATOM   1150 C  C     . LEU C 3 125 ? 16.574  41.443 4.915  1.00 29.85  ? 125 LEU A C     1 
ATOM   1151 O  O     . LEU C 3 125 ? 15.933  41.356 3.884  1.00 22.97  ? 125 LEU A O     1 
ATOM   1152 C  CB    . LEU C 3 125 ? 15.862  42.524 7.094  1.00 37.91  ? 125 LEU A CB    1 
ATOM   1153 C  CG    . LEU C 3 125 ? 14.454  42.846 7.624  1.00 40.30  ? 125 LEU A CG    1 
ATOM   1154 C  CD1   . LEU C 3 125 ? 13.671  41.570 7.883  1.00 42.50  ? 125 LEU A CD1   1 
ATOM   1155 C  CD2   . LEU C 3 125 ? 14.521  43.628 8.920  1.00 39.83  ? 125 LEU A CD2   1 
ATOM   1156 N  N     . ARG C 3 126 ? 17.881  41.665 5.026  1.00 33.66  ? 126 ARG A N     1 
ATOM   1157 C  CA    . ARG C 3 126 ? 18.785  41.883 3.932  1.00 41.76  ? 126 ARG A CA    1 
ATOM   1158 C  C     . ARG C 3 126 ? 18.469  40.914 2.825  1.00 45.89  ? 126 ARG A C     1 
ATOM   1159 O  O     . ARG C 3 126 ? 18.575  41.175 1.618  1.00 50.49  ? 126 ARG A O     1 
ATOM   1160 C  CB    . ARG C 3 126 ? 20.181  41.709 4.443  1.00 50.03  ? 126 ARG A CB    1 
ATOM   1161 C  CG    . ARG C 3 126 ? 20.501  42.770 5.489  1.00 58.66  ? 126 ARG A CG    1 
ATOM   1162 C  CD    . ARG C 3 126 ? 20.830  44.102 4.831  1.00 66.76  ? 126 ARG A CD    1 
ATOM   1163 N  NE    . ARG C 3 126 ? 21.591  44.990 5.701  1.00 71.74  ? 126 ARG A NE    1 
ATOM   1164 C  CZ    . ARG C 3 126 ? 22.782  44.664 6.190  1.00 73.93  ? 126 ARG A CZ    1 
ATOM   1165 N  NH1   . ARG C 3 126 ? 23.351  43.479 5.905  1.00 72.75  ? 126 ARG A NH1   1 
ATOM   1166 N  NH2   . ARG C 3 126 ? 23.405  45.550 6.982  1.00 73.98  ? 126 ARG A NH2   1 
ATOM   1167 N  N     . LYS C 3 127 ? 18.064  39.765 3.251  1.00 46.61  ? 127 LYS A N     1 
ATOM   1168 C  CA    . LYS C 3 127 ? 17.712  38.793 2.271  1.00 51.70  ? 127 LYS A CA    1 
ATOM   1169 C  C     . LYS C 3 127 ? 16.303  39.050 1.723  1.00 42.93  ? 127 LYS A C     1 
ATOM   1170 O  O     . LYS C 3 127 ? 16.021  38.772 0.575  1.00 42.63  ? 127 LYS A O     1 
ATOM   1171 C  CB    . LYS C 3 127 ? 17.958  37.364 2.724  1.00 64.19  ? 127 LYS A CB    1 
ATOM   1172 C  CG    . LYS C 3 127 ? 19.393  36.909 2.447  1.00 73.70  ? 127 LYS A CG    1 
ATOM   1173 C  CD    . LYS C 3 127 ? 19.564  36.325 1.047  1.00 81.50  ? 127 LYS A CD    1 
ATOM   1174 C  CE    . LYS C 3 127 ? 18.522  35.242 0.703  1.00 85.02  ? 127 LYS A CE    1 
ATOM   1175 N  NZ    . LYS C 3 127 ? 18.910  33.847 1.019  1.00 85.75  ? 127 LYS A NZ    1 
ATOM   1176 N  N     . ASN C 3 128 ? 15.384  39.584 2.521  1.00 36.67  ? 128 ASN A N     1 
ATOM   1177 C  CA    . ASN C 3 128 ? 14.048  39.804 1.981  1.00 35.47  ? 128 ASN A CA    1 
ATOM   1178 C  C     . ASN C 3 128 ? 13.701  41.242 1.611  1.00 40.34  ? 128 ASN A C     1 
ATOM   1179 O  O     . ASN C 3 128 ? 12.568  41.666 1.726  1.00 43.70  ? 128 ASN A O     1 
ATOM   1180 C  CB    . ASN C 3 128 ? 12.981  39.019 2.757  1.00 33.21  ? 128 ASN A CB    1 
ATOM   1181 C  CG    . ASN C 3 128 ? 13.707  37.923 3.543  1.00 37.26  ? 128 ASN A CG    1 
ATOM   1182 O  OD1   . ASN C 3 128 ? 13.636  37.871 4.805  1.00 41.70  ? 128 ASN A OD1   1 
ATOM   1183 N  ND2   . ASN C 3 128 ? 14.566  37.171 2.832  1.00 32.84  ? 128 ASN A ND2   1 
ATOM   1184 N  N     . GLU C 3 129 ? 14.705  41.989 1.147  1.00 40.24  ? 129 GLU A N     1 
ATOM   1185 C  CA    . GLU C 3 129 ? 14.586  43.382 0.743  1.00 37.33  ? 129 GLU A CA    1 
ATOM   1186 C  C     . GLU C 3 129 ? 13.352  43.693 -0.017 1.00 32.69  ? 129 GLU A C     1 
ATOM   1187 O  O     . GLU C 3 129 ? 12.686  44.669 0.198  1.00 34.42  ? 129 GLU A O     1 
ATOM   1188 C  CB    . GLU C 3 129 ? 15.740  43.739 -0.197 1.00 37.83  ? 129 GLU A CB    1 
ATOM   1189 C  CG    . GLU C 3 129 ? 15.923  45.235 -0.471 1.00 41.13  ? 129 GLU A CG    1 
ATOM   1190 C  CD    . GLU C 3 129 ? 17.412  45.518 -0.593 1.00 54.81  ? 129 GLU A CD    1 
ATOM   1191 O  OE1   . GLU C 3 129 ? 18.170  44.812 -1.216 1.00 58.69  ? 129 GLU A OE1   1 
ATOM   1192 O  OE2   . GLU C 3 129 ? 17.870  46.484 0.174  1.00 60.82  ? 129 GLU A OE2   1 
ATOM   1193 N  N     . ASP C 3 130 ? 13.078  42.834 -0.928 1.00 32.89  ? 130 ASP A N     1 
ATOM   1194 C  CA    . ASP C 3 130 ? 11.947  42.997 -1.757 1.00 35.71  ? 130 ASP A CA    1 
ATOM   1195 C  C     . ASP C 3 130 ? 10.641  43.165 -1.027 1.00 35.51  ? 130 ASP A C     1 
ATOM   1196 O  O     . ASP C 3 130 ? 9.655   43.630 -1.604 1.00 40.65  ? 130 ASP A O     1 
ATOM   1197 C  CB    . ASP C 3 130 ? 11.890  41.956 -2.845 1.00 41.24  ? 130 ASP A CB    1 
ATOM   1198 C  CG    . ASP C 3 130 ? 11.172  40.722 -2.390 1.00 47.91  ? 130 ASP A CG    1 
ATOM   1199 O  OD1   . ASP C 3 130 ? 11.981  39.841 -1.843 1.00 47.63  ? 130 ASP A OD1   1 
ATOM   1200 O  OD2   . ASP C 3 130 ? 9.965   40.545 -2.578 1.00 53.37  ? 130 ASP A OD2   1 
ATOM   1201 N  N     . LYS C 3 131 ? 10.599  42.767 0.217  1.00 30.84  ? 131 LYS A N     1 
ATOM   1202 C  CA    . LYS C 3 131 ? 9.361   42.923 0.970  1.00 38.42  ? 131 LYS A CA    1 
ATOM   1203 C  C     . LYS C 3 131 ? 9.185   44.314 1.643  1.00 36.08  ? 131 LYS A C     1 
ATOM   1204 O  O     . LYS C 3 131 ? 8.081   44.772 2.034  1.00 41.04  ? 131 LYS A O     1 
ATOM   1205 C  CB    . LYS C 3 131 ? 9.211   41.829 1.985  1.00 47.02  ? 131 LYS A CB    1 
ATOM   1206 C  CG    . LYS C 3 131 ? 9.210   40.506 1.287  1.00 59.01  ? 131 LYS A CG    1 
ATOM   1207 C  CD    . LYS C 3 131 ? 8.542   39.427 2.108  1.00 71.28  ? 131 LYS A CD    1 
ATOM   1208 C  CE    . LYS C 3 131 ? 8.108   38.234 1.272  1.00 79.33  ? 131 LYS A CE    1 
ATOM   1209 N  NZ    . LYS C 3 131 ? 7.354   37.244 2.057  1.00 83.66  ? 131 LYS A NZ    1 
ATOM   1210 N  N     . LEU C 3 132 ? 10.303  44.975 1.773  1.00 21.29  ? 132 LEU A N     1 
ATOM   1211 C  CA    . LEU C 3 132 ? 10.383  46.250 2.374  1.00 21.35  ? 132 LEU A CA    1 
ATOM   1212 C  C     . LEU C 3 132 ? 9.971   47.425 1.587  1.00 24.33  ? 132 LEU A C     1 
ATOM   1213 O  O     . LEU C 3 132 ? 10.271  47.532 0.407  1.00 27.89  ? 132 LEU A O     1 
ATOM   1214 C  CB    . LEU C 3 132 ? 11.864  46.471 2.660  1.00 20.53  ? 132 LEU A CB    1 
ATOM   1215 C  CG    . LEU C 3 132 ? 12.257  45.247 3.450  1.00 18.29  ? 132 LEU A CG    1 
ATOM   1216 C  CD1   . LEU C 3 132 ? 13.765  45.196 3.715  1.00 14.91  ? 132 LEU A CD1   1 
ATOM   1217 C  CD2   . LEU C 3 132 ? 11.395  45.277 4.710  1.00 11.53  ? 132 LEU A CD2   1 
ATOM   1218 N  N     . ASN C 3 133 ? 9.302   48.339 2.270  1.00 22.86  ? 133 ASN A N     1 
ATOM   1219 C  CA    . ASN C 3 133 ? 8.942   49.534 1.554  1.00 22.59  ? 133 ASN A CA    1 
ATOM   1220 C  C     . ASN C 3 133 ? 10.239  50.382 1.506  1.00 20.51  ? 133 ASN A C     1 
ATOM   1221 O  O     . ASN C 3 133 ? 11.269  50.093 2.197  1.00 17.30  ? 133 ASN A O     1 
ATOM   1222 C  CB    . ASN C 3 133 ? 7.758   50.317 2.106  1.00 21.55  ? 133 ASN A CB    1 
ATOM   1223 C  CG    . ASN C 3 133 ? 7.983   50.837 3.497  1.00 25.39  ? 133 ASN A CG    1 
ATOM   1224 O  OD1   . ASN C 3 133 ? 7.007   50.996 4.196  1.00 34.59  ? 133 ASN A OD1   1 
ATOM   1225 N  ND2   . ASN C 3 133 ? 9.209   51.150 3.914  1.00 22.62  ? 133 ASN A ND2   1 
ATOM   1226 N  N     . HIS C 3 134 ? 10.154  51.430 0.739  1.00 15.81  ? 134 HIS A N     1 
ATOM   1227 C  CA    . HIS C 3 134 ? 11.293  52.261 0.590  1.00 16.98  ? 134 HIS A CA    1 
ATOM   1228 C  C     . HIS C 3 134 ? 11.977  52.716 1.833  1.00 19.66  ? 134 HIS A C     1 
ATOM   1229 O  O     . HIS C 3 134 ? 13.174  52.510 1.959  1.00 19.51  ? 134 HIS A O     1 
ATOM   1230 C  CB    . HIS C 3 134 ? 11.055  53.333 -0.450 1.00 16.50  ? 134 HIS A CB    1 
ATOM   1231 C  CG    . HIS C 3 134 ? 12.014  54.476 -0.373 1.00 22.34  ? 134 HIS A CG    1 
ATOM   1232 N  ND1   . HIS C 3 134 ? 13.277  54.435 -0.965 1.00 25.34  ? 134 HIS A ND1   1 
ATOM   1233 C  CD2   . HIS C 3 134 ? 11.868  55.704 0.201  1.00 28.28  ? 134 HIS A CD2   1 
ATOM   1234 C  CE1   . HIS C 3 134 ? 13.875  55.587 -0.755 1.00 27.12  ? 134 HIS A CE1   1 
ATOM   1235 N  NE2   . HIS C 3 134 ? 13.052  56.373 -0.050 1.00 31.83  ? 134 HIS A NE2   1 
ATOM   1236 N  N     . HIS C 3 135 ? 11.188  53.281 2.750  1.00 18.34  ? 135 HIS A N     1 
ATOM   1237 C  CA    . HIS C 3 135 ? 11.709  53.772 3.992  1.00 13.08  ? 135 HIS A CA    1 
ATOM   1238 C  C     . HIS C 3 135 ? 12.503  52.672 4.706  1.00 12.78  ? 135 HIS A C     1 
ATOM   1239 O  O     . HIS C 3 135 ? 13.671  52.812 5.104  1.00 11.61  ? 135 HIS A O     1 
ATOM   1240 C  CB    . HIS C 3 135 ? 10.516  54.304 4.742  1.00 24.05  ? 135 HIS A CB    1 
ATOM   1241 C  CG    . HIS C 3 135 ? 10.855  54.972 6.018  1.00 43.45  ? 135 HIS A CG    1 
ATOM   1242 N  ND1   . HIS C 3 135 ? 11.925  54.537 6.797  1.00 51.33  ? 135 HIS A ND1   1 
ATOM   1243 C  CD2   . HIS C 3 135 ? 10.252  56.016 6.655  1.00 46.15  ? 135 HIS A CD2   1 
ATOM   1244 C  CE1   . HIS C 3 135 ? 11.961  55.324 7.871  1.00 51.29  ? 135 HIS A CE1   1 
ATOM   1245 N  NE2   . HIS C 3 135 ? 10.971  56.216 7.811  1.00 48.44  ? 135 HIS A NE2   1 
ATOM   1246 N  N     . GLN C 3 136 ? 11.846  51.536 4.829  1.00 9.84   ? 136 GLN A N     1 
ATOM   1247 C  CA    . GLN C 3 136 ? 12.402  50.373 5.446  1.00 3.62   ? 136 GLN A CA    1 
ATOM   1248 C  C     . GLN C 3 136 ? 13.710  50.052 4.764  1.00 7.43   ? 136 GLN A C     1 
ATOM   1249 O  O     . GLN C 3 136 ? 14.749  49.743 5.398  1.00 7.52   ? 136 GLN A O     1 
ATOM   1250 C  CB    . GLN C 3 136 ? 11.391  49.230 5.364  1.00 4.14   ? 136 GLN A CB    1 
ATOM   1251 C  CG    . GLN C 3 136 ? 10.110  49.620 6.157  1.00 5.36   ? 136 GLN A CG    1 
ATOM   1252 C  CD    . GLN C 3 136 ? 8.819   48.856 5.911  1.00 10.40  ? 136 GLN A CD    1 
ATOM   1253 O  OE1   . GLN C 3 136 ? 7.811   49.074 6.620  1.00 13.91  ? 136 GLN A OE1   1 
ATOM   1254 N  NE2   . GLN C 3 136 ? 8.825   47.936 4.940  1.00 11.24  ? 136 GLN A NE2   1 
ATOM   1255 N  N     . ARG C 3 137 ? 13.661  50.157 3.453  1.00 15.05  ? 137 ARG A N     1 
ATOM   1256 C  CA    . ARG C 3 137 ? 14.855  49.886 2.694  1.00 21.88  ? 137 ARG A CA    1 
ATOM   1257 C  C     . ARG C 3 137 ? 15.978  50.744 3.142  1.00 18.12  ? 137 ARG A C     1 
ATOM   1258 O  O     . ARG C 3 137 ? 17.114  50.272 3.362  1.00 20.75  ? 137 ARG A O     1 
ATOM   1259 C  CB    . ARG C 3 137 ? 14.660  49.944 1.212  1.00 31.73  ? 137 ARG A CB    1 
ATOM   1260 C  CG    . ARG C 3 137 ? 13.695  48.852 0.797  1.00 41.73  ? 137 ARG A CG    1 
ATOM   1261 C  CD    . ARG C 3 137 ? 13.739  48.622 -0.697 1.00 46.90  ? 137 ARG A CD    1 
ATOM   1262 N  NE    . ARG C 3 137 ? 12.407  48.512 -1.247 1.00 47.15  ? 137 ARG A NE    1 
ATOM   1263 C  CZ    . ARG C 3 137 ? 11.808  49.502 -1.890 1.00 49.27  ? 137 ARG A CZ    1 
ATOM   1264 N  NH1   . ARG C 3 137 ? 12.395  50.692 -2.092 1.00 43.13  ? 137 ARG A NH1   1 
ATOM   1265 N  NH2   . ARG C 3 137 ? 10.574  49.273 -2.354 1.00 55.77  ? 137 ARG A NH2   1 
ATOM   1266 N  N     . ILE C 3 138 ? 15.647  51.998 3.319  1.00 13.11  ? 138 ILE A N     1 
ATOM   1267 C  CA    . ILE C 3 138 ? 16.729  52.834 3.780  1.00 21.60  ? 138 ILE A CA    1 
ATOM   1268 C  C     . ILE C 3 138 ? 17.217  52.492 5.183  1.00 20.27  ? 138 ILE A C     1 
ATOM   1269 O  O     . ILE C 3 138 ? 18.435  52.333 5.348  1.00 19.85  ? 138 ILE A O     1 
ATOM   1270 C  CB    . ILE C 3 138 ? 16.487  54.303 3.766  1.00 23.33  ? 138 ILE A CB    1 
ATOM   1271 C  CG1   . ILE C 3 138 ? 16.120  54.772 2.361  1.00 20.65  ? 138 ILE A CG1   1 
ATOM   1272 C  CG2   . ILE C 3 138 ? 17.785  54.896 4.288  1.00 18.93  ? 138 ILE A CG2   1 
ATOM   1273 C  CD1   . ILE C 3 138 ? 16.942  54.062 1.319  1.00 20.26  ? 138 ILE A CD1   1 
ATOM   1274 N  N     . GLY C 3 139 ? 16.250  52.416 6.135  1.00 10.52  ? 139 GLY A N     1 
ATOM   1275 C  CA    . GLY C 3 139 ? 16.553  52.103 7.489  1.00 14.75  ? 139 GLY A CA    1 
ATOM   1276 C  C     . GLY C 3 139 ? 17.453  50.888 7.465  1.00 21.88  ? 139 GLY A C     1 
ATOM   1277 O  O     . GLY C 3 139 ? 18.493  50.770 8.146  1.00 19.69  ? 139 GLY A O     1 
ATOM   1278 N  N     . LEU C 3 140 ? 17.042  49.986 6.613  1.00 23.61  ? 140 LEU A N     1 
ATOM   1279 C  CA    . LEU C 3 140 ? 17.848  48.799 6.498  1.00 23.38  ? 140 LEU A CA    1 
ATOM   1280 C  C     . LEU C 3 140 ? 19.224  49.125 5.919  1.00 17.45  ? 140 LEU A C     1 
ATOM   1281 O  O     . LEU C 3 140 ? 20.229  48.768 6.503  1.00 14.38  ? 140 LEU A O     1 
ATOM   1282 C  CB    . LEU C 3 140 ? 17.146  47.616 5.780  1.00 21.71  ? 140 LEU A CB    1 
ATOM   1283 C  CG    . LEU C 3 140 ? 18.080  46.430 5.578  1.00 14.32  ? 140 LEU A CG    1 
ATOM   1284 C  CD1   . LEU C 3 140 ? 18.951  46.261 6.807  1.00 7.06   ? 140 LEU A CD1   1 
ATOM   1285 C  CD2   . LEU C 3 140 ? 17.288  45.161 5.335  1.00 16.22  ? 140 LEU A CD2   1 
ATOM   1286 N  N     . LYS C 3 141 ? 19.254  49.811 4.781  1.00 18.77  ? 141 LYS A N     1 
ATOM   1287 C  CA    . LYS C 3 141 ? 20.539  50.171 4.143  1.00 24.58  ? 141 LYS A CA    1 
ATOM   1288 C  C     . LYS C 3 141 ? 21.603  50.737 5.092  1.00 23.86  ? 141 LYS A C     1 
ATOM   1289 O  O     . LYS C 3 141 ? 22.701  50.273 5.133  1.00 26.19  ? 141 LYS A O     1 
ATOM   1290 C  CB    . LYS C 3 141 ? 20.332  51.173 2.999  1.00 26.08  ? 141 LYS A CB    1 
ATOM   1291 C  CG    . LYS C 3 141 ? 21.602  51.607 2.278  1.00 27.90  ? 141 LYS A CG    1 
ATOM   1292 C  CD    . LYS C 3 141 ? 21.342  52.788 1.341  1.00 33.63  ? 141 LYS A CD    1 
ATOM   1293 C  CE    . LYS C 3 141 ? 22.011  52.680 -0.034 1.00 37.69  ? 141 LYS A CE    1 
ATOM   1294 N  NZ    . LYS C 3 141 ? 23.280  53.412 -0.165 1.00 38.38  ? 141 LYS A NZ    1 
ATOM   1295 N  N     . TYR C 3 142 ? 21.241  51.752 5.841  1.00 25.02  ? 142 TYR A N     1 
ATOM   1296 C  CA    . TYR C 3 142 ? 22.051  52.458 6.789  1.00 27.83  ? 142 TYR A CA    1 
ATOM   1297 C  C     . TYR C 3 142 ? 21.871  52.038 8.199  1.00 37.82  ? 142 TYR A C     1 
ATOM   1298 O  O     . TYR C 3 142 ? 22.138  52.865 9.076  1.00 41.03  ? 142 TYR A O     1 
ATOM   1299 C  CB    . TYR C 3 142 ? 21.516  53.880 6.818  1.00 27.37  ? 142 TYR A CB    1 
ATOM   1300 C  CG    . TYR C 3 142 ? 21.805  54.515 5.522  1.00 30.11  ? 142 TYR A CG    1 
ATOM   1301 C  CD1   . TYR C 3 142 ? 23.127  54.559 5.085  1.00 33.59  ? 142 TYR A CD1   1 
ATOM   1302 C  CD2   . TYR C 3 142 ? 20.813  55.082 4.732  1.00 28.50  ? 142 TYR A CD2   1 
ATOM   1303 C  CE1   . TYR C 3 142 ? 23.448  55.163 3.868  1.00 34.70  ? 142 TYR A CE1   1 
ATOM   1304 C  CE2   . TYR C 3 142 ? 21.125  55.686 3.519  1.00 27.81  ? 142 TYR A CE2   1 
ATOM   1305 C  CZ    . TYR C 3 142 ? 22.446  55.730 3.075  1.00 31.36  ? 142 TYR A CZ    1 
ATOM   1306 O  OH    . TYR C 3 142 ? 22.800  56.311 1.866  1.00 33.57  ? 142 TYR A OH    1 
ATOM   1307 N  N     . PHE C 3 143 ? 21.426  50.825 8.418  1.00 44.19  ? 143 PHE A N     1 
ATOM   1308 C  CA    . PHE C 3 143 ? 21.198  50.309 9.768  1.00 55.24  ? 143 PHE A CA    1 
ATOM   1309 C  C     . PHE C 3 143 ? 22.228  50.578 10.881 1.00 58.54  ? 143 PHE A C     1 
ATOM   1310 O  O     . PHE C 3 143 ? 21.911  51.167 11.907 1.00 57.28  ? 143 PHE A O     1 
ATOM   1311 C  CB    . PHE C 3 143 ? 21.077  48.805 9.705  1.00 62.07  ? 143 PHE A CB    1 
ATOM   1312 C  CG    . PHE C 3 143 ? 20.711  48.224 11.038 1.00 69.18  ? 143 PHE A CG    1 
ATOM   1313 C  CD1   . PHE C 3 143 ? 19.436  48.415 11.565 1.00 72.20  ? 143 PHE A CD1   1 
ATOM   1314 C  CD2   . PHE C 3 143 ? 21.623  47.466 11.770 1.00 74.04  ? 143 PHE A CD2   1 
ATOM   1315 C  CE1   . PHE C 3 143 ? 19.067  47.871 12.795 1.00 74.41  ? 143 PHE A CE1   1 
ATOM   1316 C  CE2   . PHE C 3 143 ? 21.277  46.916 13.003 1.00 75.35  ? 143 PHE A CE2   1 
ATOM   1317 C  CZ    . PHE C 3 143 ? 19.997  47.123 13.515 1.00 75.38  ? 143 PHE A CZ    1 
ATOM   1318 N  N     . GLU C 3 144 ? 23.462  50.116 10.686 1.00 63.15  ? 144 GLU A N     1 
ATOM   1319 C  CA    . GLU C 3 144 ? 24.511  50.300 11.670 1.00 68.66  ? 144 GLU A CA    1 
ATOM   1320 C  C     . GLU C 3 144 ? 24.764  51.740 11.935 1.00 60.12  ? 144 GLU A C     1 
ATOM   1321 O  O     . GLU C 3 144 ? 25.147  52.096 13.043 1.00 57.75  ? 144 GLU A O     1 
ATOM   1322 C  CB    . GLU C 3 144 ? 25.847  49.602 11.367 1.00 82.90  ? 144 GLU A CB    1 
ATOM   1323 C  CG    . GLU C 3 144 ? 25.704  48.107 11.043 1.00 93.26  ? 144 GLU A CG    1 
ATOM   1324 C  CD    . GLU C 3 144 ? 25.615  47.866 9.561  1.00 99.46  ? 144 GLU A CD    1 
ATOM   1325 O  OE1   . GLU C 3 144 ? 26.331  48.454 8.750  1.00 100.00 ? 144 GLU A OE1   1 
ATOM   1326 O  OE2   . GLU C 3 144 ? 24.652  47.018 9.238  1.00 100.00 ? 144 GLU A OE2   1 
ATOM   1327 N  N     . ASP C 3 145 ? 24.559  52.517 10.878 1.00 56.08  ? 145 ASP A N     1 
ATOM   1328 C  CA    . ASP C 3 145 ? 24.731  53.952 10.888 1.00 54.08  ? 145 ASP A CA    1 
ATOM   1329 C  C     . ASP C 3 145 ? 23.708  54.632 11.772 1.00 54.95  ? 145 ASP A C     1 
ATOM   1330 O  O     . ASP C 3 145 ? 24.018  55.502 12.601 1.00 59.22  ? 145 ASP A O     1 
ATOM   1331 C  CB    . ASP C 3 145 ? 24.641  54.523 9.475  1.00 51.95  ? 145 ASP A CB    1 
ATOM   1332 C  CG    . ASP C 3 145 ? 25.988  54.571 8.869  1.00 52.85  ? 145 ASP A CG    1 
ATOM   1333 O  OD1   . ASP C 3 145 ? 26.928  54.283 9.737  1.00 53.11  ? 145 ASP A OD1   1 
ATOM   1334 O  OD2   . ASP C 3 145 ? 26.184  54.838 7.703  1.00 55.61  ? 145 ASP A OD2   1 
ATOM   1335 N  N     . PHE C 3 146 ? 22.471  54.218 11.582 1.00 48.66  ? 146 PHE A N     1 
ATOM   1336 C  CA    . PHE C 3 146 ? 21.414  54.784 12.358 1.00 44.92  ? 146 PHE A CA    1 
ATOM   1337 C  C     . PHE C 3 146 ? 21.508  54.571 13.881 1.00 46.26  ? 146 PHE A C     1 
ATOM   1338 O  O     . PHE C 3 146 ? 20.872  55.316 14.648 1.00 49.86  ? 146 PHE A O     1 
ATOM   1339 C  CB    . PHE C 3 146 ? 20.019  54.590 11.737 1.00 37.19  ? 146 PHE A CB    1 
ATOM   1340 C  CG    . PHE C 3 146 ? 19.912  55.338 10.437 1.00 27.31  ? 146 PHE A CG    1 
ATOM   1341 C  CD1   . PHE C 3 146 ? 20.924  56.212 10.050 1.00 29.92  ? 146 PHE A CD1   1 
ATOM   1342 C  CD2   . PHE C 3 146 ? 18.812  55.190 9.597  1.00 22.34  ? 146 PHE A CD2   1 
ATOM   1343 C  CE1   . PHE C 3 146 ? 20.862  56.929 8.850  1.00 31.01  ? 146 PHE A CE1   1 
ATOM   1344 C  CE2   . PHE C 3 146 ? 18.730  55.893 8.399  1.00 22.16  ? 146 PHE A CE2   1 
ATOM   1345 C  CZ    . PHE C 3 146 ? 19.751  56.763 8.021  1.00 24.96  ? 146 PHE A CZ    1 
ATOM   1346 N  N     . GLU C 3 147 ? 22.297  53.574 14.320 1.00 40.27  ? 147 GLU A N     1 
ATOM   1347 C  CA    . GLU C 3 147 ? 22.439  53.293 15.743 1.00 40.38  ? 147 GLU A CA    1 
ATOM   1348 C  C     . GLU C 3 147 ? 23.407  54.161 16.526 1.00 34.41  ? 147 GLU A C     1 
ATOM   1349 O  O     . GLU C 3 147 ? 23.442  54.076 17.734 1.00 34.99  ? 147 GLU A O     1 
ATOM   1350 C  CB    . GLU C 3 147 ? 22.535  51.802 16.122 1.00 51.04  ? 147 GLU A CB    1 
ATOM   1351 C  CG    . GLU C 3 147 ? 21.185  51.204 16.622 1.00 58.22  ? 147 GLU A CG    1 
ATOM   1352 C  CD    . GLU C 3 147 ? 21.254  49.812 17.231 1.00 62.09  ? 147 GLU A CD    1 
ATOM   1353 O  OE1   . GLU C 3 147 ? 22.272  49.066 16.801 1.00 65.21  ? 147 GLU A OE1   1 
ATOM   1354 O  OE2   . GLU C 3 147 ? 20.431  49.427 18.046 1.00 60.43  ? 147 GLU A OE2   1 
ATOM   1355 N  N     . LYS C 3 148 ? 24.191  54.981 15.844 1.00 31.85  ? 148 LYS A N     1 
ATOM   1356 C  CA    . LYS C 3 148 ? 25.152  55.852 16.481 1.00 32.04  ? 148 LYS A CA    1 
ATOM   1357 C  C     . LYS C 3 148 ? 24.682  57.273 16.696 1.00 33.05  ? 148 LYS A C     1 
ATOM   1358 O  O     . LYS C 3 148 ? 24.235  57.929 15.759 1.00 36.81  ? 148 LYS A O     1 
ATOM   1359 C  CB    . LYS C 3 148 ? 26.453  55.915 15.691 1.00 36.59  ? 148 LYS A CB    1 
ATOM   1360 C  CG    . LYS C 3 148 ? 27.264  54.631 15.761 1.00 41.50  ? 148 LYS A CG    1 
ATOM   1361 C  CD    . LYS C 3 148 ? 28.476  54.619 14.835 1.00 46.23  ? 148 LYS A CD    1 
ATOM   1362 C  CE    . LYS C 3 148 ? 28.904  53.201 14.432 1.00 47.56  ? 148 LYS A CE    1 
ATOM   1363 N  NZ    . LYS C 3 148 ? 29.284  53.067 13.004 1.00 47.96  ? 148 LYS A NZ    1 
ATOM   1364 N  N     . ARG C 3 149 ? 24.809  57.753 17.934 1.00 30.41  ? 149 ARG A N     1 
ATOM   1365 C  CA    . ARG C 3 149 ? 24.408  59.103 18.275 1.00 27.35  ? 149 ARG A CA    1 
ATOM   1366 C  C     . ARG C 3 149 ? 25.342  60.108 17.684 1.00 24.45  ? 149 ARG A C     1 
ATOM   1367 O  O     . ARG C 3 149 ? 26.536  59.861 17.620 1.00 30.65  ? 149 ARG A O     1 
ATOM   1368 C  CB    . ARG C 3 149 ? 24.301  59.331 19.760 1.00 35.12  ? 149 ARG A CB    1 
ATOM   1369 C  CG    . ARG C 3 149 ? 23.092  58.643 20.371 1.00 43.23  ? 149 ARG A CG    1 
ATOM   1370 C  CD    . ARG C 3 149 ? 22.775  59.250 21.722 1.00 52.73  ? 149 ARG A CD    1 
ATOM   1371 N  NE    . ARG C 3 149 ? 21.925  60.427 21.621 1.00 61.32  ? 149 ARG A NE    1 
ATOM   1372 C  CZ    . ARG C 3 149 ? 20.668  60.440 22.071 1.00 70.14  ? 149 ARG A CZ    1 
ATOM   1373 N  NH1   . ARG C 3 149 ? 20.124  59.367 22.648 1.00 71.37  ? 149 ARG A NH1   1 
ATOM   1374 N  NH2   . ARG C 3 149 ? 19.931  61.556 21.954 1.00 74.29  ? 149 ARG A NH2   1 
ATOM   1375 N  N     . ILE C 3 150 ? 24.813  61.235 17.246 1.00 20.89  ? 150 ILE A N     1 
ATOM   1376 C  CA    . ILE C 3 150 ? 25.660  62.256 16.655 1.00 19.17  ? 150 ILE A CA    1 
ATOM   1377 C  C     . ILE C 3 150 ? 26.398  63.023 17.726 1.00 23.91  ? 150 ILE A C     1 
ATOM   1378 O  O     . ILE C 3 150 ? 25.848  63.435 18.744 1.00 29.55  ? 150 ILE A O     1 
ATOM   1379 C  CB    . ILE C 3 150 ? 24.842  63.198 15.794 1.00 16.77  ? 150 ILE A CB    1 
ATOM   1380 C  CG1   . ILE C 3 150 ? 24.190  62.469 14.647 1.00 16.29  ? 150 ILE A CG1   1 
ATOM   1381 C  CG2   . ILE C 3 150 ? 25.714  64.306 15.259 1.00 16.63  ? 150 ILE A CG2   1 
ATOM   1382 C  CD1   . ILE C 3 150 ? 23.070  63.319 14.070 1.00 18.45  ? 150 ILE A CD1   1 
ATOM   1383 N  N     . PRO C 3 151 ? 27.658  63.250 17.576 1.00 27.90  ? 151 PRO A N     1 
ATOM   1384 C  CA    . PRO C 3 151 ? 28.240  63.985 18.674 1.00 32.60  ? 151 PRO A CA    1 
ATOM   1385 C  C     . PRO C 3 151 ? 28.183  65.473 18.445 1.00 44.51  ? 151 PRO A C     1 
ATOM   1386 O  O     . PRO C 3 151 ? 28.203  65.922 17.262 1.00 44.34  ? 151 PRO A O     1 
ATOM   1387 C  CB    . PRO C 3 151 ? 29.631  63.444 18.915 1.00 27.85  ? 151 PRO A CB    1 
ATOM   1388 C  CG    . PRO C 3 151 ? 29.751  62.189 18.047 1.00 28.19  ? 151 PRO A CG    1 
ATOM   1389 C  CD    . PRO C 3 151 ? 28.433  62.010 17.297 1.00 28.70  ? 151 PRO A CD    1 
ATOM   1390 N  N     . ARG C 3 152 ? 28.119  66.212 19.587 1.00 51.61  ? 152 ARG A N     1 
ATOM   1391 C  CA    . ARG C 3 152 ? 28.051  67.684 19.585 1.00 55.80  ? 152 ARG A CA    1 
ATOM   1392 C  C     . ARG C 3 152 ? 28.844  68.431 18.530 1.00 57.63  ? 152 ARG A C     1 
ATOM   1393 O  O     . ARG C 3 152 ? 28.342  69.304 17.829 1.00 56.40  ? 152 ARG A O     1 
ATOM   1394 C  CB    . ARG C 3 152 ? 27.726  68.464 20.863 1.00 57.54  ? 152 ARG A CB    1 
ATOM   1395 C  CG    . ARG C 3 152 ? 27.722  69.972 20.558 1.00 58.48  ? 152 ARG A CG    1 
ATOM   1396 C  CD    . ARG C 3 152 ? 27.022  70.913 21.547 1.00 55.00  ? 152 ARG A CD    1 
ATOM   1397 N  NE    . ARG C 3 152 ? 25.630  70.579 21.787 1.00 55.30  ? 152 ARG A NE    1 
ATOM   1398 C  CZ    . ARG C 3 152 ? 24.636  71.459 21.925 1.00 59.66  ? 152 ARG A CZ    1 
ATOM   1399 N  NH1   . ARG C 3 152 ? 24.796  72.790 21.841 1.00 58.98  ? 152 ARG A NH1   1 
ATOM   1400 N  NH2   . ARG C 3 152 ? 23.422  70.969 22.149 1.00 62.28  ? 152 ARG A NH2   1 
ATOM   1401 N  N     . GLU C 3 153 ? 30.101  68.080 18.399 1.00 59.14  ? 153 GLU A N     1 
ATOM   1402 C  CA    . GLU C 3 153 ? 30.910  68.729 17.420 1.00 58.23  ? 153 GLU A CA    1 
ATOM   1403 C  C     . GLU C 3 153 ? 30.394  68.458 16.007 1.00 48.44  ? 153 GLU A C     1 
ATOM   1404 O  O     . GLU C 3 153 ? 30.484  69.302 15.101 1.00 50.10  ? 153 GLU A O     1 
ATOM   1405 C  CB    . GLU C 3 153 ? 32.379  68.377 17.651 1.00 70.38  ? 153 GLU A CB    1 
ATOM   1406 C  CG    . GLU C 3 153 ? 32.833  68.779 19.071 1.00 84.06  ? 153 GLU A CG    1 
ATOM   1407 C  CD    . GLU C 3 153 ? 33.162  70.256 19.190 1.00 96.69  ? 153 GLU A CD    1 
ATOM   1408 O  OE1   . GLU C 3 153 ? 33.955  70.806 18.422 1.00 100.00 ? 153 GLU A OE1   1 
ATOM   1409 O  OE2   . GLU C 3 153 ? 32.498  70.890 20.164 1.00 100.00 ? 153 GLU A OE2   1 
ATOM   1410 N  N     . GLU C 3 154 ? 29.841  67.270 15.780 1.00 38.07  ? 154 GLU A N     1 
ATOM   1411 C  CA    . GLU C 3 154 ? 29.362  67.013 14.442 1.00 33.67  ? 154 GLU A CA    1 
ATOM   1412 C  C     . GLU C 3 154 ? 28.224  67.903 13.984 1.00 30.74  ? 154 GLU A C     1 
ATOM   1413 O  O     . GLU C 3 154 ? 28.273  68.515 12.903 1.00 30.39  ? 154 GLU A O     1 
ATOM   1414 C  CB    . GLU C 3 154 ? 29.095  65.527 14.139 1.00 31.52  ? 154 GLU A CB    1 
ATOM   1415 C  CG    . GLU C 3 154 ? 30.361  64.788 13.672 1.00 32.67  ? 154 GLU A CG    1 
ATOM   1416 C  CD    . GLU C 3 154 ? 30.209  63.287 13.649 1.00 32.44  ? 154 GLU A CD    1 
ATOM   1417 O  OE1   . GLU C 3 154 ? 29.081  62.951 13.021 1.00 31.59  ? 154 GLU A OE1   1 
ATOM   1418 O  OE2   . GLU C 3 154 ? 31.031  62.496 14.177 1.00 24.53  ? 154 GLU A OE2   1 
ATOM   1419 N  N     . MET C 3 155 ? 27.220  67.924 14.843 1.00 26.79  ? 155 MET A N     1 
ATOM   1420 C  CA    . MET C 3 155 ? 26.016  68.659 14.670 1.00 26.04  ? 155 MET A CA    1 
ATOM   1421 C  C     . MET C 3 155 ? 26.427  70.007 14.307 1.00 28.60  ? 155 MET A C     1 
ATOM   1422 O  O     . MET C 3 155 ? 25.890  70.617 13.368 1.00 29.61  ? 155 MET A O     1 
ATOM   1423 C  CB    . MET C 3 155 ? 25.330  68.712 16.015 1.00 32.60  ? 155 MET A CB    1 
ATOM   1424 C  CG    . MET C 3 155 ? 24.862  67.341 16.448 1.00 32.22  ? 155 MET A CG    1 
ATOM   1425 S  SD    . MET C 3 155 ? 23.475  66.840 15.425 1.00 34.64  ? 155 MET A SD    1 
ATOM   1426 C  CE    . MET C 3 155 ? 22.174  67.951 15.994 1.00 28.79  ? 155 MET A CE    1 
ATOM   1427 N  N     . LEU C 3 156 ? 27.437  70.403 15.074 1.00 31.76  ? 156 LEU A N     1 
ATOM   1428 C  CA    . LEU C 3 156 ? 28.050  71.702 14.907 1.00 37.47  ? 156 LEU A CA    1 
ATOM   1429 C  C     . LEU C 3 156 ? 28.311  71.984 13.458 1.00 35.46  ? 156 LEU A C     1 
ATOM   1430 O  O     . LEU C 3 156 ? 27.731  72.924 12.894 1.00 32.14  ? 156 LEU A O     1 
ATOM   1431 C  CB    . LEU C 3 156 ? 29.378  71.853 15.652 1.00 44.09  ? 156 LEU A CB    1 
ATOM   1432 C  CG    . LEU C 3 156 ? 29.189  72.771 16.847 1.00 54.18  ? 156 LEU A CG    1 
ATOM   1433 C  CD1   . LEU C 3 156 ? 27.880  73.513 16.647 1.00 57.59  ? 156 LEU A CD1   1 
ATOM   1434 C  CD2   . LEU C 3 156 ? 29.204  72.044 18.190 1.00 57.59  ? 156 LEU A CD2   1 
ATOM   1435 N  N     . GLN C 3 157 ? 29.164  71.141 12.863 1.00 35.01  ? 157 GLN A N     1 
ATOM   1436 C  CA    . GLN C 3 157 ? 29.442  71.348 11.471 1.00 37.53  ? 157 GLN A CA    1 
ATOM   1437 C  C     . GLN C 3 157 ? 28.161  71.341 10.640 1.00 40.74  ? 157 GLN A C     1 
ATOM   1438 O  O     . GLN C 3 157 ? 27.940  72.267 9.768  1.00 44.01  ? 157 GLN A O     1 
ATOM   1439 C  CB    . GLN C 3 157 ? 30.477  70.390 10.957 1.00 37.87  ? 157 GLN A CB    1 
ATOM   1440 C  CG    . GLN C 3 157 ? 31.777  70.684 11.680 1.00 48.33  ? 157 GLN A CG    1 
ATOM   1441 C  CD    . GLN C 3 157 ? 32.579  69.413 11.931 1.00 60.96  ? 157 GLN A CD    1 
ATOM   1442 O  OE1   . GLN C 3 157 ? 32.990  68.664 10.988 1.00 65.28  ? 157 GLN A OE1   1 
ATOM   1443 N  NE2   . GLN C 3 157 ? 32.713  69.115 13.221 1.00 62.56  ? 157 GLN A NE2   1 
ATOM   1444 N  N     . MET C 3 158 ? 27.316  70.307 10.917 1.00 29.17  ? 158 MET A N     1 
ATOM   1445 C  CA    . MET C 3 158 ? 26.085  70.245 10.175 1.00 22.87  ? 158 MET A CA    1 
ATOM   1446 C  C     . MET C 3 158 ? 25.291  71.596 10.330 1.00 27.96  ? 158 MET A C     1 
ATOM   1447 O  O     . MET C 3 158 ? 24.790  72.191 9.325  1.00 23.14  ? 158 MET A O     1 
ATOM   1448 C  CB    . MET C 3 158 ? 25.315  68.982 10.532 1.00 15.33  ? 158 MET A CB    1 
ATOM   1449 C  CG    . MET C 3 158 ? 26.260  67.920 11.049 1.00 20.00  ? 158 MET A CG    1 
ATOM   1450 S  SD    . MET C 3 158 ? 25.449  66.480 11.881 1.00 24.90  ? 158 MET A SD    1 
ATOM   1451 C  CE    . MET C 3 158 ? 24.230  65.967 10.653 1.00 21.21  ? 158 MET A CE    1 
ATOM   1452 N  N     . GLN C 3 159 ? 25.208  72.084 11.600 1.00 27.41  ? 159 GLN A N     1 
ATOM   1453 C  CA    . GLN C 3 159 ? 24.511  73.330 11.886 1.00 26.19  ? 159 GLN A CA    1 
ATOM   1454 C  C     . GLN C 3 159 ? 25.026  74.364 10.946 1.00 25.40  ? 159 GLN A C     1 
ATOM   1455 O  O     . GLN C 3 159 ? 24.287  75.111 10.332 1.00 24.42  ? 159 GLN A O     1 
ATOM   1456 C  CB    . GLN C 3 159 ? 24.678  73.852 13.311 1.00 21.52  ? 159 GLN A CB    1 
ATOM   1457 C  CG    . GLN C 3 159 ? 23.720  75.016 13.521 1.00 25.04  ? 159 GLN A CG    1 
ATOM   1458 C  CD    . GLN C 3 159 ? 23.803  75.708 14.876 1.00 37.94  ? 159 GLN A CD    1 
ATOM   1459 O  OE1   . GLN C 3 159 ? 22.775  76.036 15.536 1.00 40.02  ? 159 GLN A OE1   1 
ATOM   1460 N  NE2   . GLN C 3 159 ? 25.029  76.088 15.233 1.00 46.10  ? 159 GLN A NE2   1 
ATOM   1461 N  N     . ASP C 3 160 ? 26.329  74.314 10.817 1.00 27.35  ? 160 ASP A N     1 
ATOM   1462 C  CA    . ASP C 3 160 ? 27.003  75.207 9.942  1.00 29.72  ? 160 ASP A CA    1 
ATOM   1463 C  C     . ASP C 3 160 ? 26.589  75.127 8.483  1.00 21.98  ? 160 ASP A C     1 
ATOM   1464 O  O     . ASP C 3 160 ? 26.015  76.086 7.884  1.00 17.42  ? 160 ASP A O     1 
ATOM   1465 C  CB    . ASP C 3 160 ? 28.498  75.162 10.161 1.00 36.89  ? 160 ASP A CB    1 
ATOM   1466 C  CG    . ASP C 3 160 ? 28.800  76.344 11.024 1.00 45.92  ? 160 ASP A CG    1 
ATOM   1467 O  OD1   . ASP C 3 160 ? 28.227  77.449 10.561 1.00 47.39  ? 160 ASP A OD1   1 
ATOM   1468 O  OD2   . ASP C 3 160 ? 29.377  76.258 12.089 1.00 50.28  ? 160 ASP A OD2   1 
ATOM   1469 N  N     . ILE C 3 161 ? 26.869  73.981 7.930  1.00 16.20  ? 161 ILE A N     1 
ATOM   1470 C  CA    . ILE C 3 161 ? 26.524  73.780 6.542  1.00 14.86  ? 161 ILE A CA    1 
ATOM   1471 C  C     . ILE C 3 161 ? 25.057  74.086 6.234  1.00 20.28  ? 161 ILE A C     1 
ATOM   1472 O  O     . ILE C 3 161 ? 24.698  74.633 5.200  1.00 21.98  ? 161 ILE A O     1 
ATOM   1473 C  CB    . ILE C 3 161 ? 26.808  72.364 6.219  1.00 13.54  ? 161 ILE A CB    1 
ATOM   1474 C  CG1   . ILE C 3 161 ? 28.227  72.039 6.626  1.00 19.98  ? 161 ILE A CG1   1 
ATOM   1475 C  CG2   . ILE C 3 161 ? 26.560  72.066 4.773  1.00 9.67   ? 161 ILE A CG2   1 
ATOM   1476 C  CD1   . ILE C 3 161 ? 28.463  70.533 6.697  1.00 19.76  ? 161 ILE A CD1   1 
ATOM   1477 N  N     . VAL C 3 162 ? 24.172  73.744 7.144  1.00 22.05  ? 162 VAL A N     1 
ATOM   1478 C  CA    . VAL C 3 162 ? 22.793  74.037 6.838  1.00 22.59  ? 162 VAL A CA    1 
ATOM   1479 C  C     . VAL C 3 162 ? 22.511  75.499 6.831  1.00 26.69  ? 162 VAL A C     1 
ATOM   1480 O  O     . VAL C 3 162 ? 21.791  76.100 5.943  1.00 21.11  ? 162 VAL A O     1 
ATOM   1481 C  CB    . VAL C 3 162 ? 21.834  73.337 7.759  1.00 18.37  ? 162 VAL A CB    1 
ATOM   1482 C  CG1   . VAL C 3 162 ? 20.572  74.145 7.807  1.00 11.63  ? 162 VAL A CG1   1 
ATOM   1483 C  CG2   . VAL C 3 162 ? 21.506  71.970 7.164  1.00 22.64  ? 162 VAL A CG2   1 
ATOM   1484 N  N     . LEU C 3 163 ? 23.124  76.026 7.887  1.00 28.98  ? 163 LEU A N     1 
ATOM   1485 C  CA    . LEU C 3 163 ? 23.008  77.409 8.126  1.00 31.63  ? 163 LEU A CA    1 
ATOM   1486 C  C     . LEU C 3 163 ? 23.374  78.208 6.938  1.00 26.52  ? 163 LEU A C     1 
ATOM   1487 O  O     . LEU C 3 163 ? 22.558  79.008 6.441  1.00 20.10  ? 163 LEU A O     1 
ATOM   1488 C  CB    . LEU C 3 163 ? 23.587  77.833 9.464  1.00 36.37  ? 163 LEU A CB    1 
ATOM   1489 C  CG    . LEU C 3 163 ? 22.560  77.312 10.456 1.00 42.62  ? 163 LEU A CG    1 
ATOM   1490 C  CD1   . LEU C 3 163 ? 22.476  78.147 11.747 1.00 44.65  ? 163 LEU A CD1   1 
ATOM   1491 C  CD2   . LEU C 3 163 ? 21.213  77.313 9.727  1.00 43.42  ? 163 LEU A CD2   1 
ATOM   1492 N  N     . ASN C 3 164 ? 24.586  77.915 6.501  1.00 26.86  ? 164 ASN A N     1 
ATOM   1493 C  CA    . ASN C 3 164 ? 25.132  78.582 5.368  1.00 34.69  ? 164 ASN A CA    1 
ATOM   1494 C  C     . ASN C 3 164 ? 24.255  78.529 4.135  1.00 33.10  ? 164 ASN A C     1 
ATOM   1495 O  O     . ASN C 3 164 ? 23.543  79.516 3.842  1.00 33.39  ? 164 ASN A O     1 
ATOM   1496 C  CB    . ASN C 3 164 ? 26.559  78.081 5.113  1.00 46.65  ? 164 ASN A CB    1 
ATOM   1497 C  CG    . ASN C 3 164 ? 27.400  78.259 6.369  1.00 56.96  ? 164 ASN A CG    1 
ATOM   1498 O  OD1   . ASN C 3 164 ? 27.568  79.384 6.858  1.00 60.74  ? 164 ASN A OD1   1 
ATOM   1499 N  ND2   . ASN C 3 164 ? 27.835  77.148 6.974  1.00 60.26  ? 164 ASN A ND2   1 
ATOM   1500 N  N     . GLU C 3 165 ? 24.305  77.383 3.448  1.00 30.15  ? 165 GLU A N     1 
ATOM   1501 C  CA    . GLU C 3 165 ? 23.525  77.182 2.242  1.00 32.67  ? 165 GLU A CA    1 
ATOM   1502 C  C     . GLU C 3 165 ? 22.093  77.701 2.377  1.00 35.66  ? 165 GLU A C     1 
ATOM   1503 O  O     . GLU C 3 165 ? 21.441  78.020 1.387  1.00 36.64  ? 165 GLU A O     1 
ATOM   1504 C  CB    . GLU C 3 165 ? 23.580  75.745 1.718  1.00 34.73  ? 165 GLU A CB    1 
ATOM   1505 C  CG    . GLU C 3 165 ? 25.010  75.171 1.692  1.00 45.90  ? 165 GLU A CG    1 
ATOM   1506 C  CD    . GLU C 3 165 ? 25.848  75.559 0.478  1.00 55.34  ? 165 GLU A CD    1 
ATOM   1507 O  OE1   . GLU C 3 165 ? 25.100  75.700 -0.610 1.00 57.94  ? 165 GLU A OE1   1 
ATOM   1508 O  OE2   . GLU C 3 165 ? 27.096  75.688 0.503  1.00 54.85  ? 165 GLU A OE2   1 
ATOM   1509 N  N     . VAL C 3 166 ? 21.605  77.794 3.628  1.00 34.63  ? 166 VAL A N     1 
ATOM   1510 C  CA    . VAL C 3 166 ? 20.273  78.296 3.717  1.00 37.87  ? 166 VAL A CA    1 
ATOM   1511 C  C     . VAL C 3 166 ? 20.259  79.700 3.286  1.00 43.67  ? 166 VAL A C     1 
ATOM   1512 O  O     . VAL C 3 166 ? 19.349  80.133 2.588  1.00 42.67  ? 166 VAL A O     1 
ATOM   1513 C  CB    . VAL C 3 166 ? 19.474  78.079 4.969  1.00 35.34  ? 166 VAL A CB    1 
ATOM   1514 C  CG1   . VAL C 3 166 ? 18.449  79.199 5.065  1.00 32.41  ? 166 VAL A CG1   1 
ATOM   1515 C  CG2   . VAL C 3 166 ? 18.691  76.800 4.759  1.00 34.78  ? 166 VAL A CG2   1 
ATOM   1516 N  N     . LYS C 3 167 ? 21.297  80.383 3.715  1.00 53.31  ? 167 LYS A N     1 
ATOM   1517 C  CA    . LYS C 3 167 ? 21.458  81.785 3.383  1.00 65.30  ? 167 LYS A CA    1 
ATOM   1518 C  C     . LYS C 3 167 ? 21.584  82.044 1.870  1.00 65.90  ? 167 LYS A C     1 
ATOM   1519 O  O     . LYS C 3 167 ? 20.903  82.893 1.297  1.00 63.19  ? 167 LYS A O     1 
ATOM   1520 C  CB    . LYS C 3 167 ? 22.662  82.359 4.089  1.00 74.00  ? 167 LYS A CB    1 
ATOM   1521 C  CG    . LYS C 3 167 ? 22.426  82.882 5.492  1.00 83.18  ? 167 LYS A CG    1 
ATOM   1522 C  CD    . LYS C 3 167 ? 23.782  83.155 6.137  1.00 92.83  ? 167 LYS A CD    1 
ATOM   1523 C  CE    . LYS C 3 167 ? 23.958  84.563 6.697  1.00 99.31  ? 167 LYS A CE    1 
ATOM   1524 N  NZ    . LYS C 3 167 ? 25.330  85.086 6.489  1.00 100.00 ? 167 LYS A NZ    1 
ATOM   1525 N  N     . LYS C 3 168 ? 22.472  81.303 1.218  1.00 65.71  ? 168 LYS A N     1 
ATOM   1526 C  CA    . LYS C 3 168 ? 22.692  81.460 -0.208 1.00 66.18  ? 168 LYS A CA    1 
ATOM   1527 C  C     . LYS C 3 168 ? 21.427  81.587 -1.082 1.00 61.36  ? 168 LYS A C     1 
ATOM   1528 O  O     . LYS C 3 168 ? 21.351  82.420 -1.983 1.00 57.06  ? 168 LYS A O     1 
ATOM   1529 C  CB    . LYS C 3 168 ? 23.718  80.454 -0.738 1.00 71.83  ? 168 LYS A CB    1 
ATOM   1530 C  CG    . LYS C 3 168 ? 25.147  80.771 -0.290 1.00 76.18  ? 168 LYS A CG    1 
ATOM   1531 C  CD    . LYS C 3 168 ? 26.258  79.866 -0.853 1.00 79.31  ? 168 LYS A CD    1 
ATOM   1532 C  CE    . LYS C 3 168 ? 26.657  78.717 0.071  1.00 81.03  ? 168 LYS A CE    1 
ATOM   1533 N  NZ    . LYS C 3 168 ? 28.025  78.199 -0.153 1.00 80.35  ? 168 LYS A NZ    1 
ATOM   1534 N  N     . LEU C 3 169 ? 20.416  80.777 -0.813 1.00 63.17  ? 169 LEU A N     1 
ATOM   1535 C  CA    . LEU C 3 169 ? 19.177  80.845 -1.601 1.00 64.56  ? 169 LEU A CA    1 
ATOM   1536 C  C     . LEU C 3 169 ? 18.355  82.053 -1.206 1.00 59.03  ? 169 LEU A C     1 
ATOM   1537 O  O     . LEU C 3 169 ? 17.549  82.620 -1.957 1.00 57.10  ? 169 LEU A O     1 
ATOM   1538 C  CB    . LEU C 3 169 ? 18.251  79.593 -1.478 1.00 67.75  ? 169 LEU A CB    1 
ATOM   1539 C  CG    . LEU C 3 169 ? 18.901  78.262 -1.088 1.00 72.63  ? 169 LEU A CG    1 
ATOM   1540 C  CD1   . LEU C 3 169 ? 18.037  77.087 -1.552 1.00 73.67  ? 169 LEU A CD1   1 
ATOM   1541 C  CD2   . LEU C 3 169 ? 20.318  78.108 -1.633 1.00 73.95  ? 169 LEU A CD2   1 
ATOM   1542 N  N     . ASP C 3 170 ? 18.570  82.442 0.023  1.00 53.43  ? 170 ASP A N     1 
ATOM   1543 C  CA    . ASP C 3 170 ? 17.833  83.555 0.507  1.00 46.23  ? 170 ASP A CA    1 
ATOM   1544 C  C     . ASP C 3 170 ? 18.373  83.862 1.874  1.00 45.73  ? 170 ASP A C     1 
ATOM   1545 O  O     . ASP C 3 170 ? 18.662  82.971 2.668  1.00 46.96  ? 170 ASP A O     1 
ATOM   1546 C  CB    . ASP C 3 170 ? 16.366  83.111 0.523  1.00 41.45  ? 170 ASP A CB    1 
ATOM   1547 C  CG    . ASP C 3 170 ? 15.512  84.295 0.432  1.00 41.22  ? 170 ASP A CG    1 
ATOM   1548 O  OD1   . ASP C 3 170 ? 16.218  85.338 0.793  1.00 42.19  ? 170 ASP A OD1   1 
ATOM   1549 O  OD2   . ASP C 3 170 ? 14.360  84.285 0.007  1.00 39.08  ? 170 ASP A OD2   1 
ATOM   1550 N  N     . PRO C 3 171 ? 18.587  85.087 2.207  1.00 46.08  ? 171 PRO A N     1 
ATOM   1551 C  CA    . PRO C 3 171 ? 19.131  85.192 3.531  1.00 49.55  ? 171 PRO A CA    1 
ATOM   1552 C  C     . PRO C 3 171 ? 18.019  85.566 4.464  1.00 50.74  ? 171 PRO A C     1 
ATOM   1553 O  O     . PRO C 3 171 ? 18.239  85.845 5.653  1.00 52.04  ? 171 PRO A O     1 
ATOM   1554 C  CB    . PRO C 3 171 ? 20.219  86.264 3.468  1.00 48.85  ? 171 PRO A CB    1 
ATOM   1555 C  CG    . PRO C 3 171 ? 19.890  87.088 2.216  1.00 47.51  ? 171 PRO A CG    1 
ATOM   1556 C  CD    . PRO C 3 171 ? 18.731  86.387 1.508  1.00 46.42  ? 171 PRO A CD    1 
ATOM   1557 N  N     . GLU C 3 172 ? 16.824  85.573 3.879  1.00 48.34  ? 172 GLU A N     1 
ATOM   1558 C  CA    . GLU C 3 172 ? 15.649  85.903 4.642  1.00 53.00  ? 172 GLU A CA    1 
ATOM   1559 C  C     . GLU C 3 172 ? 15.110  84.646 5.379  1.00 47.12  ? 172 GLU A C     1 
ATOM   1560 O  O     . GLU C 3 172 ? 14.280  84.702 6.313  1.00 48.71  ? 172 GLU A O     1 
ATOM   1561 C  CB    . GLU C 3 172 ? 14.646  86.728 3.814  1.00 64.32  ? 172 GLU A CB    1 
ATOM   1562 C  CG    . GLU C 3 172 ? 13.690  87.576 4.680  1.00 76.40  ? 172 GLU A CG    1 
ATOM   1563 C  CD    . GLU C 3 172 ? 13.553  89.039 4.276  1.00 84.09  ? 172 GLU A CD    1 
ATOM   1564 O  OE1   . GLU C 3 172 ? 12.583  89.273 3.388  1.00 84.23  ? 172 GLU A OE1   1 
ATOM   1565 O  OE2   . GLU C 3 172 ? 14.259  89.919 4.769  1.00 86.89  ? 172 GLU A OE2   1 
ATOM   1566 N  N     . TYR C 3 173 ? 15.636  83.497 4.930  1.00 33.79  ? 173 TYR A N     1 
ATOM   1567 C  CA    . TYR C 3 173 ? 15.327  82.207 5.447  1.00 22.87  ? 173 TYR A CA    1 
ATOM   1568 C  C     . TYR C 3 173 ? 15.871  82.082 6.780  1.00 21.61  ? 173 TYR A C     1 
ATOM   1569 O  O     . TYR C 3 173 ? 17.029  82.422 6.909  1.00 24.85  ? 173 TYR A O     1 
ATOM   1570 C  CB    . TYR C 3 173 ? 16.218  81.181 4.770  1.00 21.65  ? 173 TYR A CB    1 
ATOM   1571 C  CG    . TYR C 3 173 ? 15.397  80.488 3.772  1.00 25.53  ? 173 TYR A CG    1 
ATOM   1572 C  CD1   . TYR C 3 173 ? 14.057  80.226 4.043  1.00 30.63  ? 173 TYR A CD1   1 
ATOM   1573 C  CD2   . TYR C 3 173 ? 15.913  80.123 2.539  1.00 24.45  ? 173 TYR A CD2   1 
ATOM   1574 C  CE1   . TYR C 3 173 ? 13.267  79.591 3.087  1.00 30.31  ? 173 TYR A CE1   1 
ATOM   1575 C  CE2   . TYR C 3 173 ? 15.132  79.479 1.583  1.00 22.60  ? 173 TYR A CE2   1 
ATOM   1576 C  CZ    . TYR C 3 173 ? 13.797  79.207 1.854  1.00 22.67  ? 173 TYR A CZ    1 
ATOM   1577 O  OH    . TYR C 3 173 ? 13.020  78.563 0.927  1.00 23.50  ? 173 TYR A OH    1 
ATOM   1578 N  N     . ILE C 3 174 ? 15.082  81.581 7.711  1.00 19.92  ? 174 ILE A N     1 
ATOM   1579 C  CA    . ILE C 3 174 ? 15.535  81.385 9.076  1.00 21.83  ? 174 ILE A CA    1 
ATOM   1580 C  C     . ILE C 3 174 ? 15.656  79.921 9.395  1.00 14.17  ? 174 ILE A C     1 
ATOM   1581 O  O     . ILE C 3 174 ? 14.723  79.154 9.162  1.00 14.72  ? 174 ILE A O     1 
ATOM   1582 C  CB    . ILE C 3 174 ? 14.592  81.954 10.109 1.00 28.88  ? 174 ILE A CB    1 
ATOM   1583 C  CG1   . ILE C 3 174 ? 14.497  83.451 9.976  1.00 32.24  ? 174 ILE A CG1   1 
ATOM   1584 C  CG2   . ILE C 3 174 ? 15.121  81.594 11.480 1.00 30.48  ? 174 ILE A CG2   1 
ATOM   1585 C  CD1   . ILE C 3 174 ? 13.634  84.027 11.074 1.00 35.45  ? 174 ILE A CD1   1 
ATOM   1586 N  N     . ALA C 3 175 ? 16.775  79.514 9.945  1.00 9.61   ? 175 ALA A N     1 
ATOM   1587 C  CA    . ALA C 3 175 ? 16.849  78.081 10.257 1.00 10.04  ? 175 ALA A CA    1 
ATOM   1588 C  C     . ALA C 3 175 ? 17.269  77.834 11.679 1.00 14.63  ? 175 ALA A C     1 
ATOM   1589 O  O     . ALA C 3 175 ? 18.340  78.286 12.117 1.00 18.80  ? 175 ALA A O     1 
ATOM   1590 C  CB    . ALA C 3 175 ? 17.748  77.261 9.316  1.00 1.00   ? 175 ALA A CB    1 
ATOM   1591 N  N     . THR C 3 176 ? 16.431  77.129 12.407 1.00 9.69   ? 176 THR A N     1 
ATOM   1592 C  CA    . THR C 3 176 ? 16.790  76.839 13.781 1.00 6.97   ? 176 THR A CA    1 
ATOM   1593 C  C     . THR C 3 176 ? 16.884  75.376 13.988 1.00 8.98   ? 176 THR A C     1 
ATOM   1594 O  O     . THR C 3 176 ? 16.059  74.637 13.440 1.00 14.84  ? 176 THR A O     1 
ATOM   1595 C  CB    . THR C 3 176 ? 15.877  77.455 14.797 1.00 7.26   ? 176 THR A CB    1 
ATOM   1596 O  OG1   . THR C 3 176 ? 15.393  78.658 14.253 1.00 5.39   ? 176 THR A OG1   1 
ATOM   1597 C  CG2   . THR C 3 176 ? 16.809  77.818 15.922 1.00 12.43  ? 176 THR A CG2   1 
ATOM   1598 N  N     . VAL C 3 177 ? 17.876  74.940 14.753 1.00 10.36  ? 177 VAL A N     1 
ATOM   1599 C  CA    . VAL C 3 177 ? 18.006  73.480 14.987 1.00 7.64   ? 177 VAL A CA    1 
ATOM   1600 C  C     . VAL C 3 177 ? 17.646  73.224 16.408 1.00 11.71  ? 177 VAL A C     1 
ATOM   1601 O  O     . VAL C 3 177 ? 18.321  73.712 17.332 1.00 13.48  ? 177 VAL A O     1 
ATOM   1602 C  CB    . VAL C 3 177 ? 19.363  72.988 14.548 1.00 4.31   ? 177 VAL A CB    1 
ATOM   1603 C  CG1   . VAL C 3 177 ? 20.197  74.247 14.575 1.00 5.94   ? 177 VAL A CG1   1 
ATOM   1604 C  CG2   . VAL C 3 177 ? 19.967  71.982 15.480 1.00 3.70   ? 177 VAL A CG2   1 
ATOM   1605 N  N     . CYS C 3 178 ? 16.558  72.481 16.546 1.00 16.24  ? 178 CYS A N     1 
ATOM   1606 C  CA    . CYS C 3 178 ? 15.936  72.082 17.830 1.00 19.06  ? 178 CYS A CA    1 
ATOM   1607 C  C     . CYS C 3 178 ? 16.280  70.727 18.416 1.00 14.73  ? 178 CYS A C     1 
ATOM   1608 O  O     . CYS C 3 178 ? 17.443  70.289 18.431 1.00 13.29  ? 178 CYS A O     1 
ATOM   1609 C  CB    . CYS C 3 178 ? 14.422  72.188 17.608 1.00 20.80  ? 178 CYS A CB    1 
ATOM   1610 S  SG    . CYS C 3 178 ? 14.266  73.734 16.694 1.00 20.31  ? 178 CYS A SG    1 
ATOM   1611 N  N     . GLY C 3 179 ? 15.196  70.084 18.903 1.00 12.32  ? 179 GLY A N     1 
ATOM   1612 C  CA    . GLY C 3 179 ? 15.318  68.772 19.504 1.00 7.75   ? 179 GLY A CA    1 
ATOM   1613 C  C     . GLY C 3 179 ? 16.446  68.740 20.546 1.00 4.26   ? 179 GLY A C     1 
ATOM   1614 O  O     . GLY C 3 179 ? 16.675  69.695 21.305 1.00 1.00   ? 179 GLY A O     1 
ATOM   1615 N  N     . SER C 3 180 ? 17.138  67.629 20.569 1.00 5.84   ? 180 SER A N     1 
ATOM   1616 C  CA    . SER C 3 180 ? 18.210  67.462 21.520 1.00 12.34  ? 180 SER A CA    1 
ATOM   1617 C  C     . SER C 3 180 ? 19.180  68.535 21.519 1.00 12.64  ? 180 SER A C     1 
ATOM   1618 O  O     . SER C 3 180 ? 19.440  69.077 22.591 1.00 14.06  ? 180 SER A O     1 
ATOM   1619 C  CB    . SER C 3 180 ? 19.032  66.212 21.361 1.00 13.26  ? 180 SER A CB    1 
ATOM   1620 O  OG    . SER C 3 180 ? 18.191  65.162 20.996 1.00 13.00  ? 180 SER A OG    1 
ATOM   1621 N  N     . PHE C 3 181 ? 19.663  68.782 20.307 1.00 7.62   ? 181 PHE A N     1 
ATOM   1622 C  CA    . PHE C 3 181 ? 20.647  69.781 20.138 1.00 7.59   ? 181 PHE A CA    1 
ATOM   1623 C  C     . PHE C 3 181 ? 20.324  71.030 20.868 1.00 11.44  ? 181 PHE A C     1 
ATOM   1624 O  O     . PHE C 3 181 ? 21.063  71.479 21.726 1.00 17.71  ? 181 PHE A O     1 
ATOM   1625 C  CB    . PHE C 3 181 ? 20.904  70.048 18.704 1.00 15.62  ? 181 PHE A CB    1 
ATOM   1626 C  CG    . PHE C 3 181 ? 21.970  71.086 18.613 1.00 17.02  ? 181 PHE A CG    1 
ATOM   1627 C  CD1   . PHE C 3 181 ? 23.288  70.730 18.887 1.00 17.49  ? 181 PHE A CD1   1 
ATOM   1628 C  CD2   . PHE C 3 181 ? 21.644  72.393 18.246 1.00 14.35  ? 181 PHE A CD2   1 
ATOM   1629 C  CE1   . PHE C 3 181 ? 24.282  71.702 18.801 1.00 21.82  ? 181 PHE A CE1   1 
ATOM   1630 C  CE2   . PHE C 3 181 ? 22.625  73.373 18.158 1.00 16.24  ? 181 PHE A CE2   1 
ATOM   1631 C  CZ    . PHE C 3 181 ? 23.943  73.013 18.447 1.00 20.88  ? 181 PHE A CZ    1 
ATOM   1632 N  N     . ARG C 3 182 ? 19.188  71.583 20.579 1.00 13.19  ? 182 ARG A N     1 
ATOM   1633 C  CA    . ARG C 3 182 ? 18.837  72.777 21.288 1.00 12.48  ? 182 ARG A CA    1 
ATOM   1634 C  C     . ARG C 3 182 ? 18.718  72.565 22.801 1.00 11.37  ? 182 ARG A C     1 
ATOM   1635 O  O     . ARG C 3 182 ? 18.964  73.426 23.564 1.00 13.20  ? 182 ARG A O     1 
ATOM   1636 C  CB    . ARG C 3 182 ? 17.623  73.410 20.674 1.00 11.47  ? 182 ARG A CB    1 
ATOM   1637 C  CG    . ARG C 3 182 ? 16.900  74.333 21.631 1.00 11.88  ? 182 ARG A CG    1 
ATOM   1638 C  CD    . ARG C 3 182 ? 16.137  75.387 20.857 1.00 17.54  ? 182 ARG A CD    1 
ATOM   1639 N  NE    . ARG C 3 182 ? 16.092  76.666 21.536 1.00 22.45  ? 182 ARG A NE    1 
ATOM   1640 C  CZ    . ARG C 3 182 ? 14.998  77.208 22.062 1.00 25.86  ? 182 ARG A CZ    1 
ATOM   1641 N  NH1   . ARG C 3 182 ? 13.807  76.640 22.005 1.00 27.67  ? 182 ARG A NH1   1 
ATOM   1642 N  NH2   . ARG C 3 182 ? 15.114  78.377 22.659 1.00 30.03  ? 182 ARG A NH2   1 
ATOM   1643 N  N     . ARG C 3 183 ? 18.310  71.409 23.262 1.00 11.41  ? 183 ARG A N     1 
ATOM   1644 C  CA    . ARG C 3 183 ? 18.196  71.199 24.662 1.00 9.51   ? 183 ARG A CA    1 
ATOM   1645 C  C     . ARG C 3 183 ? 19.560  70.958 25.203 1.00 22.77  ? 183 ARG A C     1 
ATOM   1646 O  O     . ARG C 3 183 ? 19.689  70.416 26.302 1.00 31.17  ? 183 ARG A O     1 
ATOM   1647 C  CB    . ARG C 3 183 ? 17.405  69.962 25.014 1.00 6.73   ? 183 ARG A CB    1 
ATOM   1648 C  CG    . ARG C 3 183 ? 15.927  70.093 24.832 1.00 15.17  ? 183 ARG A CG    1 
ATOM   1649 C  CD    . ARG C 3 183 ? 15.169  69.111 25.745 1.00 23.56  ? 183 ARG A CD    1 
ATOM   1650 N  NE    . ARG C 3 183 ? 14.758  67.802 25.194 1.00 23.77  ? 183 ARG A NE    1 
ATOM   1651 C  CZ    . ARG C 3 183 ? 15.265  67.149 24.168 1.00 14.15  ? 183 ARG A CZ    1 
ATOM   1652 N  NH1   . ARG C 3 183 ? 16.253  67.643 23.520 1.00 16.70  ? 183 ARG A NH1   1 
ATOM   1653 N  NH2   . ARG C 3 183 ? 14.781  65.969 23.791 1.00 10.79  ? 183 ARG A NH2   1 
ATOM   1654 N  N     . GLY C 3 184 ? 20.587  71.312 24.448 1.00 24.84  ? 184 GLY A N     1 
ATOM   1655 C  CA    . GLY C 3 184 ? 21.980  71.104 24.913 1.00 31.81  ? 184 GLY A CA    1 
ATOM   1656 C  C     . GLY C 3 184 ? 22.612  69.673 25.119 1.00 31.74  ? 184 GLY A C     1 
ATOM   1657 O  O     . GLY C 3 184 ? 23.688  69.545 25.709 1.00 35.14  ? 184 GLY A O     1 
ATOM   1658 N  N     . ALA C 3 185 ? 22.032  68.570 24.678 1.00 25.46  ? 185 ALA A N     1 
ATOM   1659 C  CA    . ALA C 3 185 ? 22.723  67.331 24.946 1.00 23.68  ? 185 ALA A CA    1 
ATOM   1660 C  C     . ALA C 3 185 ? 24.049  67.211 24.228 1.00 31.41  ? 185 ALA A C     1 
ATOM   1661 O  O     . ALA C 3 185 ? 24.252  67.874 23.222 1.00 33.41  ? 185 ALA A O     1 
ATOM   1662 C  CB    . ALA C 3 185 ? 21.828  66.154 24.722 1.00 23.31  ? 185 ALA A CB    1 
ATOM   1663 N  N     . GLU C 3 186 ? 24.917  66.366 24.781 1.00 40.72  ? 186 GLU A N     1 
ATOM   1664 C  CA    . GLU C 3 186 ? 26.268  66.053 24.333 1.00 53.80  ? 186 GLU A CA    1 
ATOM   1665 C  C     . GLU C 3 186 ? 26.351  65.157 23.091 1.00 52.69  ? 186 GLU A C     1 
ATOM   1666 O  O     . GLU C 3 186 ? 27.370  65.094 22.397 1.00 53.33  ? 186 GLU A O     1 
ATOM   1667 C  CB    . GLU C 3 186 ? 27.068  65.465 25.542 1.00 69.99  ? 186 GLU A CB    1 
ATOM   1668 C  CG    . GLU C 3 186 ? 28.570  65.108 25.286 1.00 83.98  ? 186 GLU A CG    1 
ATOM   1669 C  CD    . GLU C 3 186 ? 29.615  66.189 25.567 1.00 91.72  ? 186 GLU A CD    1 
ATOM   1670 O  OE1   . GLU C 3 186 ? 29.721  66.470 26.853 1.00 92.66  ? 186 GLU A OE1   1 
ATOM   1671 O  OE2   . GLU C 3 186 ? 30.367  66.657 24.698 1.00 94.23  ? 186 GLU A OE2   1 
ATOM   1672 N  N     . SER C 3 187 ? 25.258  64.467 22.813 1.00 50.79  ? 187 SER A N     1 
ATOM   1673 C  CA    . SER C 3 187 ? 25.092  63.557 21.680 1.00 47.70  ? 187 SER A CA    1 
ATOM   1674 C  C     . SER C 3 187 ? 23.641  63.691 21.255 1.00 50.79  ? 187 SER A C     1 
ATOM   1675 O  O     . SER C 3 187 ? 22.760  63.850 22.107 1.00 52.22  ? 187 SER A O     1 
ATOM   1676 C  CB    . SER C 3 187 ? 25.431  62.095 21.995 1.00 44.35  ? 187 SER A CB    1 
ATOM   1677 O  OG    . SER C 3 187 ? 24.689  61.560 23.091 1.00 40.39  ? 187 SER A OG    1 
ATOM   1678 N  N     . SER C 3 188 ? 23.370  63.642 19.954 1.00 45.64  ? 188 SER A N     1 
ATOM   1679 C  CA    . SER C 3 188 ? 22.011  63.793 19.516 1.00 33.19  ? 188 SER A CA    1 
ATOM   1680 C  C     . SER C 3 188 ? 21.654  62.721 18.524 1.00 23.41  ? 188 SER A C     1 
ATOM   1681 O  O     . SER C 3 188 ? 22.440  62.400 17.656 1.00 19.22  ? 188 SER A O     1 
ATOM   1682 C  CB    . SER C 3 188 ? 21.805  65.204 18.985 1.00 32.85  ? 188 SER A CB    1 
ATOM   1683 O  OG    . SER C 3 188 ? 20.441  65.586 19.049 1.00 35.85  ? 188 SER A OG    1 
ATOM   1684 N  N     . GLY C 3 189 ? 20.450  62.183 18.699 1.00 20.57  ? 189 GLY A N     1 
ATOM   1685 C  CA    . GLY C 3 189 ? 19.917  61.139 17.878 1.00 21.35  ? 189 GLY A CA    1 
ATOM   1686 C  C     . GLY C 3 189 ? 19.989  61.510 16.427 1.00 24.45  ? 189 GLY A C     1 
ATOM   1687 O  O     . GLY C 3 189 ? 20.498  60.712 15.614 1.00 23.65  ? 189 GLY A O     1 
ATOM   1688 N  N     . ASP C 3 190 ? 19.463  62.726 16.125 1.00 17.90  ? 190 ASP A N     1 
ATOM   1689 C  CA    . ASP C 3 190 ? 19.463  63.207 14.772 1.00 9.46   ? 190 ASP A CA    1 
ATOM   1690 C  C     . ASP C 3 190 ? 19.560  64.667 14.768 1.00 8.41   ? 190 ASP A C     1 
ATOM   1691 O  O     . ASP C 3 190 ? 19.787  65.250 15.843 1.00 4.48   ? 190 ASP A O     1 
ATOM   1692 C  CB    . ASP C 3 190 ? 18.126  62.910 14.172 1.00 11.26  ? 190 ASP A CB    1 
ATOM   1693 C  CG    . ASP C 3 190 ? 16.995  63.607 14.856 1.00 14.97  ? 190 ASP A CG    1 
ATOM   1694 O  OD1   . ASP C 3 190 ? 17.035  64.403 15.770 1.00 14.95  ? 190 ASP A OD1   1 
ATOM   1695 O  OD2   . ASP C 3 190 ? 15.888  63.161 14.384 1.00 22.73  ? 190 ASP A OD2   1 
ATOM   1696 N  N     . MET C 3 191 ? 19.335  65.209 13.565 1.00 10.96  ? 191 MET A N     1 
ATOM   1697 C  CA    . MET C 3 191 ? 19.372  66.636 13.388 1.00 14.32  ? 191 MET A CA    1 
ATOM   1698 C  C     . MET C 3 191 ? 18.017  67.031 13.104 1.00 17.90  ? 191 MET A C     1 
ATOM   1699 O  O     . MET C 3 191 ? 17.472  66.518 12.151 1.00 23.61  ? 191 MET A O     1 
ATOM   1700 C  CB    . MET C 3 191 ? 20.210  67.169 12.236 1.00 16.60  ? 191 MET A CB    1 
ATOM   1701 C  CG    . MET C 3 191 ? 20.491  68.630 12.440 1.00 22.77  ? 191 MET A CG    1 
ATOM   1702 S  SD    . MET C 3 191 ? 21.720  69.249 11.262 1.00 37.31  ? 191 MET A SD    1 
ATOM   1703 C  CE    . MET C 3 191 ? 22.770  70.225 12.390 1.00 33.11  ? 191 MET A CE    1 
ATOM   1704 N  N     . ASP C 3 192 ? 17.496  67.910 13.929 1.00 18.70  ? 192 ASP A N     1 
ATOM   1705 C  CA    . ASP C 3 192 ? 16.144  68.398 13.780 1.00 16.43  ? 192 ASP A CA    1 
ATOM   1706 C  C     . ASP C 3 192 ? 16.211  69.874 13.480 1.00 14.26  ? 192 ASP A C     1 
ATOM   1707 O  O     . ASP C 3 192 ? 16.803  70.638 14.266 1.00 17.46  ? 192 ASP A O     1 
ATOM   1708 C  CB    . ASP C 3 192 ? 15.239  67.980 15.011 1.00 14.43  ? 192 ASP A CB    1 
ATOM   1709 C  CG    . ASP C 3 192 ? 15.104  66.468 15.178 1.00 16.54  ? 192 ASP A CG    1 
ATOM   1710 O  OD1   . ASP C 3 192 ? 15.048  65.701 14.218 1.00 16.80  ? 192 ASP A OD1   1 
ATOM   1711 O  OD2   . ASP C 3 192 ? 15.152  66.039 16.428 1.00 15.78  ? 192 ASP A OD2   1 
ATOM   1712 N  N     . VAL C 3 193 ? 15.628  70.308 12.358 1.00 11.10  ? 193 VAL A N     1 
ATOM   1713 C  CA    . VAL C 3 193 ? 15.696  71.733 12.048 1.00 6.52   ? 193 VAL A CA    1 
ATOM   1714 C  C     . VAL C 3 193 ? 14.488  72.384 11.532 1.00 6.88   ? 193 VAL A C     1 
ATOM   1715 O  O     . VAL C 3 193 ? 13.944  71.908 10.519 1.00 6.87   ? 193 VAL A O     1 
ATOM   1716 C  CB    . VAL C 3 193 ? 16.845  72.185 11.212 1.00 1.20   ? 193 VAL A CB    1 
ATOM   1717 C  CG1   . VAL C 3 193 ? 17.287  71.049 10.335 1.00 2.08   ? 193 VAL A CG1   1 
ATOM   1718 C  CG2   . VAL C 3 193 ? 16.334  73.308 10.334 1.00 1.00   ? 193 VAL A CG2   1 
ATOM   1719 N  N     . LEU C 3 194 ? 14.153  73.487 12.273 1.00 3.77   ? 194 LEU A N     1 
ATOM   1720 C  CA    . LEU C 3 194 ? 13.013  74.400 12.061 1.00 5.34   ? 194 LEU A CA    1 
ATOM   1721 C  C     . LEU C 3 194 ? 13.350  75.352 10.953 1.00 5.96   ? 194 LEU A C     1 
ATOM   1722 O  O     . LEU C 3 194 ? 14.432  75.913 10.926 1.00 7.20   ? 194 LEU A O     1 
ATOM   1723 C  CB    . LEU C 3 194 ? 12.735  75.201 13.325 1.00 13.22  ? 194 LEU A CB    1 
ATOM   1724 C  CG    . LEU C 3 194 ? 11.255  75.468 13.479 1.00 23.93  ? 194 LEU A CG    1 
ATOM   1725 C  CD1   . LEU C 3 194 ? 10.839  76.510 12.480 1.00 27.74  ? 194 LEU A CD1   1 
ATOM   1726 C  CD2   . LEU C 3 194 ? 10.555  74.193 13.061 1.00 31.83  ? 194 LEU A CD2   1 
ATOM   1727 N  N     . LEU C 3 195 ? 12.460  75.566 10.015 1.00 6.47   ? 195 LEU A N     1 
ATOM   1728 C  CA    . LEU C 3 195 ? 12.835  76.477 8.958  1.00 1.26   ? 195 LEU A CA    1 
ATOM   1729 C  C     . LEU C 3 195 ? 11.802  77.521 8.741  1.00 6.24   ? 195 LEU A C     1 
ATOM   1730 O  O     . LEU C 3 195 ? 10.627  77.202 8.489  1.00 7.51   ? 195 LEU A O     1 
ATOM   1731 C  CB    . LEU C 3 195 ? 13.067  75.673 7.705  1.00 4.50   ? 195 LEU A CB    1 
ATOM   1732 C  CG    . LEU C 3 195 ? 13.698  76.532 6.640  1.00 8.93   ? 195 LEU A CG    1 
ATOM   1733 C  CD1   . LEU C 3 195 ? 14.956  77.159 7.224  1.00 9.53   ? 195 LEU A CD1   1 
ATOM   1734 C  CD2   . LEU C 3 195 ? 14.036  75.661 5.432  1.00 3.38   ? 195 LEU A CD2   1 
ATOM   1735 N  N     . THR C 3 196 ? 12.313  78.780 8.883  1.00 8.05   ? 196 THR A N     1 
ATOM   1736 C  CA    . THR C 3 196 ? 11.298  79.725 8.483  1.00 9.37   ? 196 THR A CA    1 
ATOM   1737 C  C     . THR C 3 196 ? 11.717  80.917 7.504  1.00 18.43  ? 196 THR A C     1 
ATOM   1738 O  O     . THR C 3 196 ? 12.740  81.047 6.864  1.00 25.51  ? 196 THR A O     1 
ATOM   1739 C  CB    . THR C 3 196 ? 10.316  80.155 9.537  1.00 14.11  ? 196 THR A CB    1 
ATOM   1740 O  OG1   . THR C 3 196 ? 9.172   80.097 8.685  1.00 19.12  ? 196 THR A OG1   1 
ATOM   1741 C  CG2   . THR C 3 196 ? 10.372  81.417 10.340 1.00 11.93  ? 196 THR A CG2   1 
ATOM   1742 N  N     . HIS C 3 197 ? 10.604  81.514 7.126  1.00 24.53  ? 197 HIS A N     1 
ATOM   1743 C  CA    . HIS C 3 197 ? 10.505  82.376 5.957  1.00 29.49  ? 197 HIS A CA    1 
ATOM   1744 C  C     . HIS C 3 197 ? 9.266   83.222 6.112  1.00 31.63  ? 197 HIS A C     1 
ATOM   1745 O  O     . HIS C 3 197 ? 8.161   82.672 6.315  1.00 22.91  ? 197 HIS A O     1 
ATOM   1746 C  CB    . HIS C 3 197 ? 10.629  81.725 4.585  1.00 41.23  ? 197 HIS A CB    1 
ATOM   1747 C  CG    . HIS C 3 197 ? 11.210  82.746 3.659  1.00 52.41  ? 197 HIS A CG    1 
ATOM   1748 N  ND1   . HIS C 3 197 ? 10.418  83.500 2.811  1.00 53.99  ? 197 HIS A ND1   1 
ATOM   1749 C  CD2   . HIS C 3 197 ? 12.511  83.157 3.499  1.00 56.63  ? 197 HIS A CD2   1 
ATOM   1750 C  CE1   . HIS C 3 197 ? 11.240  84.323 2.154  1.00 55.80  ? 197 HIS A CE1   1 
ATOM   1751 N  NE2   . HIS C 3 197 ? 12.505  84.147 2.539  1.00 56.11  ? 197 HIS A NE2   1 
ATOM   1752 N  N     . PRO C 3 198 ? 9.494   84.574 6.030  1.00 40.38  ? 198 PRO A N     1 
ATOM   1753 C  CA    . PRO C 3 198 ? 8.457   85.584 6.212  1.00 40.71  ? 198 PRO A CA    1 
ATOM   1754 C  C     . PRO C 3 198 ? 7.538   85.706 5.055  1.00 40.82  ? 198 PRO A C     1 
ATOM   1755 O  O     . PRO C 3 198 ? 6.442   86.227 5.217  1.00 44.95  ? 198 PRO A O     1 
ATOM   1756 C  CB    . PRO C 3 198 ? 9.192   86.905 6.348  1.00 34.31  ? 198 PRO A CB    1 
ATOM   1757 C  CG    . PRO C 3 198 ? 10.336  86.713 5.370  1.00 33.36  ? 198 PRO A CG    1 
ATOM   1758 C  CD    . PRO C 3 198 ? 10.512  85.226 5.143  1.00 32.43  ? 198 PRO A CD    1 
ATOM   1759 N  N     . ASN C 3 199 ? 7.960   85.258 3.910  1.00 40.64  ? 199 ASN A N     1 
ATOM   1760 C  CA    . ASN C 3 199 ? 7.026   85.392 2.824  1.00 51.85  ? 199 ASN A CA    1 
ATOM   1761 C  C     . ASN C 3 199 ? 5.821   84.508 3.122  1.00 55.15  ? 199 ASN A C     1 
ATOM   1762 O  O     . ASN C 3 199 ? 4.665   84.744 2.682  1.00 59.54  ? 199 ASN A O     1 
ATOM   1763 C  CB    . ASN C 3 199 ? 7.650   85.108 1.438  1.00 56.86  ? 199 ASN A CB    1 
ATOM   1764 C  CG    . ASN C 3 199 ? 8.490   86.269 0.892  1.00 59.54  ? 199 ASN A CG    1 
ATOM   1765 O  OD1   . ASN C 3 199 ? 9.140   86.133 -0.154 1.00 62.94  ? 199 ASN A OD1   1 
ATOM   1766 N  ND2   . ASN C 3 199 ? 8.476   87.413 1.583  1.00 57.97  ? 199 ASN A ND2   1 
ATOM   1767 N  N     . PHE C 3 200 ? 6.180   83.489 3.912  1.00 48.97  ? 200 PHE A N     1 
ATOM   1768 C  CA    . PHE C 3 200 ? 5.321   82.432 4.408  1.00 37.33  ? 200 PHE A CA    1 
ATOM   1769 C  C     . PHE C 3 200 ? 4.753   82.741 5.755  1.00 31.20  ? 200 PHE A C     1 
ATOM   1770 O  O     . PHE C 3 200 ? 5.497   83.005 6.675  1.00 35.31  ? 200 PHE A O     1 
ATOM   1771 C  CB    . PHE C 3 200 ? 6.212   81.228 4.562  1.00 31.88  ? 200 PHE A CB    1 
ATOM   1772 C  CG    . PHE C 3 200 ? 5.413   80.016 4.787  1.00 34.03  ? 200 PHE A CG    1 
ATOM   1773 C  CD1   . PHE C 3 200 ? 4.080   79.991 4.381  1.00 35.77  ? 200 PHE A CD1   1 
ATOM   1774 C  CD2   . PHE C 3 200 ? 5.986   78.884 5.368  1.00 36.22  ? 200 PHE A CD2   1 
ATOM   1775 C  CE1   . PHE C 3 200 ? 3.310   78.846 4.566  1.00 36.17  ? 200 PHE A CE1   1 
ATOM   1776 C  CE2   . PHE C 3 200 ? 5.225   77.733 5.557  1.00 37.23  ? 200 PHE A CE2   1 
ATOM   1777 C  CZ    . PHE C 3 200 ? 3.890   77.721 5.156  1.00 36.94  ? 200 PHE A CZ    1 
ATOM   1778 N  N     . THR C 3 201 ? 3.463   82.699 5.889  1.00 26.29  ? 201 THR A N     1 
ATOM   1779 C  CA    . THR C 3 201 ? 2.881   83.000 7.180  1.00 28.25  ? 201 THR A CA    1 
ATOM   1780 C  C     . THR C 3 201 ? 1.490   82.441 7.235  1.00 29.62  ? 201 THR A C     1 
ATOM   1781 O  O     . THR C 3 201 ? 1.013   81.936 6.236  1.00 25.54  ? 201 THR A O     1 
ATOM   1782 C  CB    . THR C 3 201 ? 2.655   84.488 7.335  1.00 30.25  ? 201 THR A CB    1 
ATOM   1783 O  OG1   . THR C 3 201 ? 1.722   84.843 6.339  1.00 31.53  ? 201 THR A OG1   1 
ATOM   1784 C  CG2   . THR C 3 201 ? 3.935   85.269 7.141  1.00 33.98  ? 201 THR A CG2   1 
ATOM   1785 N  N     . SER C 3 202 ? 0.849   82.556 8.393  1.00 34.25  ? 202 SER A N     1 
ATOM   1786 C  CA    . SER C 3 202 ? -0.486  82.034 8.527  1.00 45.49  ? 202 SER A CA    1 
ATOM   1787 C  C     . SER C 3 202 ? -1.521  82.453 7.491  1.00 55.62  ? 202 SER A C     1 
ATOM   1788 O  O     . SER C 3 202 ? -2.683  82.024 7.520  1.00 55.01  ? 202 SER A O     1 
ATOM   1789 C  CB    . SER C 3 202 ? -1.004  81.886 9.938  1.00 47.30  ? 202 SER A CB    1 
ATOM   1790 O  OG    . SER C 3 202 ? -0.993  83.141 10.556 1.00 50.12  ? 202 SER A OG    1 
ATOM   1791 N  N     . GLU C 3 203 ? -1.109  83.291 6.564  1.00 66.17  ? 203 GLU A N     1 
ATOM   1792 C  CA    . GLU C 3 203 ? -2.025  83.723 5.526  1.00 75.61  ? 203 GLU A CA    1 
ATOM   1793 C  C     . GLU C 3 203 ? -1.313  83.503 4.211  1.00 73.76  ? 203 GLU A C     1 
ATOM   1794 O  O     . GLU C 3 203 ? -0.539  84.336 3.751  1.00 71.57  ? 203 GLU A O     1 
ATOM   1795 C  CB    . GLU C 3 203 ? -2.499  85.163 5.694  1.00 83.66  ? 203 GLU A CB    1 
ATOM   1796 C  CG    . GLU C 3 203 ? -2.845  85.476 7.151  1.00 90.73  ? 203 GLU A CG    1 
ATOM   1797 C  CD    . GLU C 3 203 ? -2.643  86.932 7.429  1.00 98.21  ? 203 GLU A CD    1 
ATOM   1798 O  OE1   . GLU C 3 203 ? -1.566  87.431 7.764  1.00 100.00 ? 203 GLU A OE1   1 
ATOM   1799 O  OE2   . GLU C 3 203 ? -3.719  87.615 7.120  1.00 100.00 ? 203 GLU A OE2   1 
ATOM   1800 N  N     . SER C 3 204 ? -1.606  82.336 3.672  1.00 74.56  ? 204 SER A N     1 
ATOM   1801 C  CA    . SER C 3 204 ? -1.093  81.811 2.441  1.00 81.76  ? 204 SER A CA    1 
ATOM   1802 C  C     . SER C 3 204 ? -1.146  80.311 2.528  1.00 92.94  ? 204 SER A C     1 
ATOM   1803 O  O     . SER C 3 204 ? -1.568  79.643 1.584  1.00 95.13  ? 204 SER A O     1 
ATOM   1804 C  CB    . SER C 3 204 ? 0.311   82.290 2.055  1.00 78.84  ? 204 SER A CB    1 
ATOM   1805 O  OG    . SER C 3 204 ? 1.157   82.472 3.174  1.00 76.63  ? 204 SER A OG    1 
ATOM   1806 N  N     . SER C 3 205 ? -0.711  79.816 3.703  1.00 99.27  ? 205 SER A N     1 
ATOM   1807 C  CA    . SER C 3 205 ? -0.653  78.389 4.040  1.00 100.00 ? 205 SER A CA    1 
ATOM   1808 C  C     . SER C 3 205 ? -0.276  77.501 2.848  1.00 100.00 ? 205 SER A C     1 
ATOM   1809 O  O     . SER C 3 205 ? -0.683  76.334 2.740  1.00 100.00 ? 205 SER A O     1 
ATOM   1810 C  CB    . SER C 3 205 ? -1.789  77.843 4.928  1.00 100.00 ? 205 SER A CB    1 
ATOM   1811 O  OG    . SER C 3 205 ? -1.414  77.804 6.307  1.00 100.00 ? 205 SER A OG    1 
ATOM   1812 N  N     . LYS C 3 206 ? 0.513   78.084 1.937  1.00 99.95  ? 206 LYS A N     1 
ATOM   1813 C  CA    . LYS C 3 206 ? 0.969   77.401 0.734  1.00 95.42  ? 206 LYS A CA    1 
ATOM   1814 C  C     . LYS C 3 206 ? 2.451   77.073 0.692  1.00 91.53  ? 206 LYS A C     1 
ATOM   1815 O  O     . LYS C 3 206 ? 3.015   76.324 1.492  1.00 91.17  ? 206 LYS A O     1 
ATOM   1816 C  CB    . LYS C 3 206 ? 0.601   78.261 -0.454 1.00 93.18  ? 206 LYS A CB    1 
ATOM   1817 C  CG    . LYS C 3 206 ? 0.616   79.752 -0.144 1.00 89.03  ? 206 LYS A CG    1 
ATOM   1818 C  CD    . LYS C 3 206 ? -0.519  80.432 -0.880 1.00 88.06  ? 206 LYS A CD    1 
ATOM   1819 C  CE    . LYS C 3 206 ? -0.429  81.943 -0.892 1.00 91.10  ? 206 LYS A CE    1 
ATOM   1820 N  NZ    . LYS C 3 206 ? -1.457  82.572 -1.740 1.00 93.38  ? 206 LYS A NZ    1 
ATOM   1821 N  N     . GLN C 3 207 ? 3.030   77.685 -0.323 1.00 88.53  ? 207 GLN A N     1 
ATOM   1822 C  CA    . GLN C 3 207 ? 4.423   77.666 -0.720 1.00 83.17  ? 207 GLN A CA    1 
ATOM   1823 C  C     . GLN C 3 207 ? 5.269   76.472 -0.312 1.00 77.88  ? 207 GLN A C     1 
ATOM   1824 O  O     . GLN C 3 207 ? 6.289   76.672 0.349  1.00 77.25  ? 207 GLN A O     1 
ATOM   1825 C  CB    . GLN C 3 207 ? 5.066   78.969 -0.257 1.00 80.86  ? 207 GLN A CB    1 
ATOM   1826 C  CG    . GLN C 3 207 ? 4.021   80.073 -0.027 1.00 78.28  ? 207 GLN A CG    1 
ATOM   1827 C  CD    . GLN C 3 207 ? 4.712   81.389 0.234  1.00 80.06  ? 207 GLN A CD    1 
ATOM   1828 O  OE1   . GLN C 3 207 ? 5.703   81.712 -0.448 1.00 81.37  ? 207 GLN A OE1   1 
ATOM   1829 N  NE2   . GLN C 3 207 ? 4.258   82.114 1.264  1.00 79.14  ? 207 GLN A NE2   1 
ATOM   1830 N  N     . PRO C 3 208 ? 4.851   75.262 -0.702 1.00 74.56  ? 208 PRO A N     1 
ATOM   1831 C  CA    . PRO C 3 208 ? 5.579   74.031 -0.392 1.00 72.14  ? 208 PRO A CA    1 
ATOM   1832 C  C     . PRO C 3 208 ? 6.998   74.263 -0.854 1.00 66.53  ? 208 PRO A C     1 
ATOM   1833 O  O     . PRO C 3 208 ? 7.991   73.848 -0.237 1.00 66.69  ? 208 PRO A O     1 
ATOM   1834 C  CB    . PRO C 3 208 ? 5.041   72.990 -1.379 1.00 74.81  ? 208 PRO A CB    1 
ATOM   1835 C  CG    . PRO C 3 208 ? 4.547   73.796 -2.571 1.00 75.91  ? 208 PRO A CG    1 
ATOM   1836 C  CD    . PRO C 3 208 ? 4.229   75.196 -2.046 1.00 74.74  ? 208 PRO A CD    1 
ATOM   1837 N  N     . LYS C 3 209 ? 7.021   74.972 -1.989 1.00 59.17  ? 209 LYS A N     1 
ATOM   1838 C  CA    . LYS C 3 209 ? 8.213   75.362 -2.688 1.00 48.28  ? 209 LYS A CA    1 
ATOM   1839 C  C     . LYS C 3 209 ? 9.350   75.827 -1.787 1.00 34.96  ? 209 LYS A C     1 
ATOM   1840 O  O     . LYS C 3 209 ? 10.455  75.371 -2.007 1.00 39.03  ? 209 LYS A O     1 
ATOM   1841 C  CB    . LYS C 3 209 ? 7.931   76.256 -3.886 1.00 54.81  ? 209 LYS A CB    1 
ATOM   1842 C  CG    . LYS C 3 209 ? 7.363   75.511 -5.109 1.00 63.10  ? 209 LYS A CG    1 
ATOM   1843 C  CD    . LYS C 3 209 ? 8.370   75.219 -6.237 1.00 68.84  ? 209 LYS A CD    1 
ATOM   1844 C  CE    . LYS C 3 209 ? 9.192   73.932 -6.098 1.00 70.39  ? 209 LYS A CE    1 
ATOM   1845 N  NZ    . LYS C 3 209 ? 10.258  73.795 -7.112 1.00 69.21  ? 209 LYS A NZ    1 
ATOM   1846 N  N     . LEU C 3 210 ? 9.141   76.682 -0.779 1.00 22.37  ? 210 LEU A N     1 
ATOM   1847 C  CA    . LEU C 3 210 ? 10.303  77.072 0.044  1.00 24.30  ? 210 LEU A CA    1 
ATOM   1848 C  C     . LEU C 3 210 ? 11.157  75.934 0.627  1.00 21.76  ? 210 LEU A C     1 
ATOM   1849 O  O     . LEU C 3 210 ? 12.409  75.955 0.630  1.00 21.44  ? 210 LEU A O     1 
ATOM   1850 C  CB    . LEU C 3 210 ? 9.905   77.994 1.170  1.00 27.59  ? 210 LEU A CB    1 
ATOM   1851 C  CG    . LEU C 3 210 ? 9.430   79.301 0.609  1.00 32.42  ? 210 LEU A CG    1 
ATOM   1852 C  CD1   . LEU C 3 210 ? 8.242   79.794 1.440  1.00 32.70  ? 210 LEU A CD1   1 
ATOM   1853 C  CD2   . LEU C 3 210 ? 10.617  80.283 0.642  1.00 29.50  ? 210 LEU A CD2   1 
ATOM   1854 N  N     . LEU C 3 211 ? 10.455  74.943 1.135  1.00 13.81  ? 211 LEU A N     1 
ATOM   1855 C  CA    . LEU C 3 211 ? 11.094  73.839 1.703  1.00 15.59  ? 211 LEU A CA    1 
ATOM   1856 C  C     . LEU C 3 211 ? 11.790  73.165 0.591  1.00 21.81  ? 211 LEU A C     1 
ATOM   1857 O  O     . LEU C 3 211 ? 12.999  72.840 0.613  1.00 26.93  ? 211 LEU A O     1 
ATOM   1858 C  CB    . LEU C 3 211 ? 9.994   72.927 2.227  1.00 21.04  ? 211 LEU A CB    1 
ATOM   1859 C  CG    . LEU C 3 211 ? 10.548  71.628 2.812  1.00 26.35  ? 211 LEU A CG    1 
ATOM   1860 C  CD1   . LEU C 3 211 ? 11.757  71.908 3.705  1.00 16.87  ? 211 LEU A CD1   1 
ATOM   1861 C  CD2   . LEU C 3 211 ? 9.425   70.950 3.608  1.00 31.43  ? 211 LEU A CD2   1 
ATOM   1862 N  N     . HIS C 3 212 ? 10.939  72.985 -0.394 1.00 22.67  ? 212 HIS A N     1 
ATOM   1863 C  CA    . HIS C 3 212 ? 11.309  72.345 -1.604 1.00 32.16  ? 212 HIS A CA    1 
ATOM   1864 C  C     . HIS C 3 212 ? 12.630  72.740 -2.167 1.00 28.91  ? 212 HIS A C     1 
ATOM   1865 O  O     . HIS C 3 212 ? 13.474  71.871 -2.416 1.00 30.71  ? 212 HIS A O     1 
ATOM   1866 C  CB    . HIS C 3 212 ? 10.186  72.176 -2.616 1.00 44.59  ? 212 HIS A CB    1 
ATOM   1867 C  CG    . HIS C 3 212 ? 9.278   71.159 -2.034 1.00 56.03  ? 212 HIS A CG    1 
ATOM   1868 N  ND1   . HIS C 3 212 ? 7.924   71.395 -1.815 1.00 62.23  ? 212 HIS A ND1   1 
ATOM   1869 C  CD2   . HIS C 3 212 ? 9.574   69.904 -1.613 1.00 59.01  ? 212 HIS A CD2   1 
ATOM   1870 C  CE1   . HIS C 3 212 ? 7.437   70.276 -1.282 1.00 63.95  ? 212 HIS A CE1   1 
ATOM   1871 N  NE2   . HIS C 3 212 ? 8.402   69.366 -1.144 1.00 62.30  ? 212 HIS A NE2   1 
ATOM   1872 N  N     . ARG C 3 213 ? 12.794  74.012 -2.352 1.00 27.64  ? 213 ARG A N     1 
ATOM   1873 C  CA    . ARG C 3 213 ? 14.027  74.465 -2.870 1.00 35.88  ? 213 ARG A CA    1 
ATOM   1874 C  C     . ARG C 3 213 ? 15.111  74.024 -1.944 1.00 30.89  ? 213 ARG A C     1 
ATOM   1875 O  O     . ARG C 3 213 ? 15.952  73.252 -2.349 1.00 33.24  ? 213 ARG A O     1 
ATOM   1876 C  CB    . ARG C 3 213 ? 14.070  75.964 -3.048 1.00 53.51  ? 213 ARG A CB    1 
ATOM   1877 C  CG    . ARG C 3 213 ? 13.267  76.464 -4.247 1.00 72.99  ? 213 ARG A CG    1 
ATOM   1878 C  CD    . ARG C 3 213 ? 13.480  77.963 -4.506 1.00 88.46  ? 213 ARG A CD    1 
ATOM   1879 N  NE    . ARG C 3 213 ? 14.894  78.352 -4.411 1.00 97.72  ? 213 ARG A NE    1 
ATOM   1880 C  CZ    . ARG C 3 213 ? 15.323  79.566 -4.039 1.00 100.00 ? 213 ARG A CZ    1 
ATOM   1881 N  NH1   . ARG C 3 213 ? 14.456  80.547 -3.712 1.00 100.00 ? 213 ARG A NH1   1 
ATOM   1882 N  NH2   . ARG C 3 213 ? 16.653  79.785 -3.986 1.00 100.00 ? 213 ARG A NH2   1 
ATOM   1883 N  N     . VAL C 3 214 ? 15.032  74.464 -0.718 1.00 31.17  ? 214 VAL A N     1 
ATOM   1884 C  CA    . VAL C 3 214 ? 16.027  74.097 0.245  1.00 33.87  ? 214 VAL A CA    1 
ATOM   1885 C  C     . VAL C 3 214 ? 16.484  72.663 0.286  1.00 33.26  ? 214 VAL A C     1 
ATOM   1886 O  O     . VAL C 3 214 ? 17.721  72.465 0.245  1.00 33.28  ? 214 VAL A O     1 
ATOM   1887 C  CB    . VAL C 3 214 ? 15.986  74.792 1.560  1.00 31.68  ? 214 VAL A CB    1 
ATOM   1888 C  CG1   . VAL C 3 214 ? 14.602  74.529 2.132  1.00 34.37  ? 214 VAL A CG1   1 
ATOM   1889 C  CG2   . VAL C 3 214 ? 17.123  74.198 2.399  1.00 21.34  ? 214 VAL A CG2   1 
ATOM   1890 N  N     . VAL C 3 215 ? 15.555  71.685 0.320  1.00 29.73  ? 215 VAL A N     1 
ATOM   1891 C  CA    . VAL C 3 215 ? 16.113  70.312 0.319  1.00 31.45  ? 215 VAL A CA    1 
ATOM   1892 C  C     . VAL C 3 215 ? 16.922  70.088 -0.950 1.00 29.95  ? 215 VAL A C     1 
ATOM   1893 O  O     . VAL C 3 215 ? 18.010  69.545 -0.898 1.00 34.53  ? 215 VAL A O     1 
ATOM   1894 C  CB    . VAL C 3 215 ? 15.225  69.112 0.540  1.00 31.12  ? 215 VAL A CB    1 
ATOM   1895 C  CG1   . VAL C 3 215 ? 14.168  69.380 1.601  1.00 32.29  ? 215 VAL A CG1   1 
ATOM   1896 C  CG2   . VAL C 3 215 ? 14.624  68.723 -0.795 1.00 33.57  ? 215 VAL A CG2   1 
ATOM   1897 N  N     . GLU C 3 216 ? 16.404  70.530 -2.076 1.00 29.98  ? 216 GLU A N     1 
ATOM   1898 C  CA    . GLU C 3 216 ? 17.136  70.364 -3.321 1.00 43.15  ? 216 GLU A CA    1 
ATOM   1899 C  C     . GLU C 3 216 ? 18.512  70.962 -3.249 1.00 37.23  ? 216 GLU A C     1 
ATOM   1900 O  O     . GLU C 3 216 ? 19.496  70.501 -3.826 1.00 40.32  ? 216 GLU A O     1 
ATOM   1901 C  CB    . GLU C 3 216 ? 16.431  71.002 -4.518 1.00 59.02  ? 216 GLU A CB    1 
ATOM   1902 C  CG    . GLU C 3 216 ? 15.210  70.187 -4.960 1.00 73.23  ? 216 GLU A CG    1 
ATOM   1903 C  CD    . GLU C 3 216 ? 14.313  70.923 -5.904 1.00 81.56  ? 216 GLU A CD    1 
ATOM   1904 O  OE1   . GLU C 3 216 ? 14.992  71.670 -6.757 1.00 82.00  ? 216 GLU A OE1   1 
ATOM   1905 O  OE2   . GLU C 3 216 ? 13.084  70.789 -5.874 1.00 84.78  ? 216 GLU A OE2   1 
ATOM   1906 N  N     . GLN C 3 217 ? 18.567  72.017 -2.539 1.00 27.79  ? 217 GLN A N     1 
ATOM   1907 C  CA    . GLN C 3 217 ? 19.825  72.607 -2.460 1.00 33.90  ? 217 GLN A CA    1 
ATOM   1908 C  C     . GLN C 3 217 ? 20.807  71.772 -1.727 1.00 30.44  ? 217 GLN A C     1 
ATOM   1909 O  O     . GLN C 3 217 ? 21.879  71.488 -2.242 1.00 28.30  ? 217 GLN A O     1 
ATOM   1910 C  CB    . GLN C 3 217 ? 19.763  73.896 -1.685 1.00 48.20  ? 217 GLN A CB    1 
ATOM   1911 C  CG    . GLN C 3 217 ? 21.191  74.327 -1.321 1.00 53.61  ? 217 GLN A CG    1 
ATOM   1912 C  CD    . GLN C 3 217 ? 21.840  75.006 -2.487 1.00 55.62  ? 217 GLN A CD    1 
ATOM   1913 O  OE1   . GLN C 3 217 ? 21.407  74.789 -3.648 1.00 57.83  ? 217 GLN A OE1   1 
ATOM   1914 N  NE2   . GLN C 3 217 ? 22.763  75.919 -2.156 1.00 53.90  ? 217 GLN A NE2   1 
ATOM   1915 N  N     . LEU C 3 218 ? 20.424  71.417 -0.515 1.00 30.29  ? 218 LEU A N     1 
ATOM   1916 C  CA    . LEU C 3 218 ? 21.333  70.629 0.236  1.00 32.98  ? 218 LEU A CA    1 
ATOM   1917 C  C     . LEU C 3 218 ? 21.601  69.352 -0.501 1.00 36.89  ? 218 LEU A C     1 
ATOM   1918 O  O     . LEU C 3 218 ? 22.726  68.786 -0.446 1.00 39.05  ? 218 LEU A O     1 
ATOM   1919 C  CB    . LEU C 3 218 ? 20.977  70.445 1.710  1.00 31.19  ? 218 LEU A CB    1 
ATOM   1920 C  CG    . LEU C 3 218 ? 20.811  71.780 2.367  1.00 28.65  ? 218 LEU A CG    1 
ATOM   1921 C  CD1   . LEU C 3 218 ? 19.317  72.047 2.484  1.00 29.37  ? 218 LEU A CD1   1 
ATOM   1922 C  CD2   . LEU C 3 218 ? 21.539  71.854 3.712  1.00 22.61  ? 218 LEU A CD2   1 
ATOM   1923 N  N     . GLN C 3 219 ? 20.533  68.958 -1.192 1.00 33.70  ? 219 GLN A N     1 
ATOM   1924 C  CA    . GLN C 3 219 ? 20.597  67.768 -1.972 1.00 39.46  ? 219 GLN A CA    1 
ATOM   1925 C  C     . GLN C 3 219 ? 21.735  67.937 -2.982 1.00 42.16  ? 219 GLN A C     1 
ATOM   1926 O  O     . GLN C 3 219 ? 22.721  67.166 -3.087 1.00 39.04  ? 219 GLN A O     1 
ATOM   1927 C  CB    . GLN C 3 219 ? 19.268  67.546 -2.711 1.00 40.60  ? 219 GLN A CB    1 
ATOM   1928 C  CG    . GLN C 3 219 ? 19.188  66.113 -3.251 1.00 45.62  ? 219 GLN A CG    1 
ATOM   1929 C  CD    . GLN C 3 219 ? 17.777  65.567 -3.341 1.00 54.30  ? 219 GLN A CD    1 
ATOM   1930 O  OE1   . GLN C 3 219 ? 16.828  66.227 -3.843 1.00 57.23  ? 219 GLN A OE1   1 
ATOM   1931 N  NE2   . GLN C 3 219 ? 17.631  64.345 -2.824 1.00 56.84  ? 219 GLN A NE2   1 
ATOM   1932 N  N     . LYS C 3 220 ? 21.582  69.004 -3.738 1.00 43.24  ? 220 LYS A N     1 
ATOM   1933 C  CA    . LYS C 3 220 ? 22.563  69.315 -4.745 1.00 43.99  ? 220 LYS A CA    1 
ATOM   1934 C  C     . LYS C 3 220 ? 23.950  69.635 -4.172 1.00 42.11  ? 220 LYS A C     1 
ATOM   1935 O  O     . LYS C 3 220 ? 24.738  70.331 -4.792 1.00 41.06  ? 220 LYS A O     1 
ATOM   1936 C  CB    . LYS C 3 220 ? 22.040  70.410 -5.669 1.00 42.91  ? 220 LYS A CB    1 
ATOM   1937 N  N     . VAL C 3 221 ? 24.289  69.148 -2.997 1.00 40.22  ? 221 VAL A N     1 
ATOM   1938 C  CA    . VAL C 3 221 ? 25.599  69.504 -2.525 1.00 45.21  ? 221 VAL A CA    1 
ATOM   1939 C  C     . VAL C 3 221 ? 26.182  68.331 -1.812 1.00 48.01  ? 221 VAL A C     1 
ATOM   1940 O  O     . VAL C 3 221 ? 27.296  68.377 -1.224 1.00 46.71  ? 221 VAL A O     1 
ATOM   1941 C  CB    . VAL C 3 221 ? 25.532  70.736 -1.617 1.00 49.32  ? 221 VAL A CB    1 
ATOM   1942 C  CG1   . VAL C 3 221 ? 26.924  71.139 -1.146 1.00 52.23  ? 221 VAL A CG1   1 
ATOM   1943 C  CG2   . VAL C 3 221 ? 24.882  71.897 -2.352 1.00 50.36  ? 221 VAL A CG2   1 
ATOM   1944 N  N     . ARG C 3 222 ? 25.376  67.269 -1.881 1.00 51.74  ? 222 ARG A N     1 
ATOM   1945 C  CA    . ARG C 3 222 ? 25.749  66.029 -1.242 1.00 58.39  ? 222 ARG A CA    1 
ATOM   1946 C  C     . ARG C 3 222 ? 25.695  66.147 0.258  1.00 51.62  ? 222 ARG A C     1 
ATOM   1947 O  O     . ARG C 3 222 ? 26.685  65.997 1.020  1.00 54.71  ? 222 ARG A O     1 
ATOM   1948 C  CB    . ARG C 3 222 ? 27.090  65.499 -1.659 1.00 72.46  ? 222 ARG A CB    1 
ATOM   1949 C  CG    . ARG C 3 222 ? 26.955  64.474 -2.764 1.00 85.17  ? 222 ARG A CG    1 
ATOM   1950 C  CD    . ARG C 3 222 ? 26.421  65.053 -4.067 1.00 93.84  ? 222 ARG A CD    1 
ATOM   1951 N  NE    . ARG C 3 222 ? 26.691  64.142 -5.176 1.00 99.67  ? 222 ARG A NE    1 
ATOM   1952 C  CZ    . ARG C 3 222 ? 27.728  64.248 -6.002 1.00 100.00 ? 222 ARG A CZ    1 
ATOM   1953 N  NH1   . ARG C 3 222 ? 28.639  65.226 -5.898 1.00 100.00 ? 222 ARG A NH1   1 
ATOM   1954 N  NH2   . ARG C 3 222 ? 27.850  63.345 -6.970 1.00 100.00 ? 222 ARG A NH2   1 
ATOM   1955 N  N     . PHE C 3 223 ? 24.508  66.445 0.693  1.00 38.81  ? 223 PHE A N     1 
ATOM   1956 C  CA    . PHE C 3 223 ? 24.382  66.561 2.079  1.00 31.81  ? 223 PHE A CA    1 
ATOM   1957 C  C     . PHE C 3 223 ? 23.274  65.635 2.369  1.00 29.92  ? 223 PHE A C     1 
ATOM   1958 O  O     . PHE C 3 223 ? 23.435  64.629 3.048  1.00 38.89  ? 223 PHE A O     1 
ATOM   1959 C  CB    . PHE C 3 223 ? 24.142  67.971 2.559  1.00 26.36  ? 223 PHE A CB    1 
ATOM   1960 C  CG    . PHE C 3 223 ? 24.215  67.909 4.045  1.00 21.51  ? 223 PHE A CG    1 
ATOM   1961 C  CD1   . PHE C 3 223 ? 25.364  67.455 4.676  1.00 20.40  ? 223 PHE A CD1   1 
ATOM   1962 C  CD2   . PHE C 3 223 ? 23.135  68.291 4.837  1.00 21.20  ? 223 PHE A CD2   1 
ATOM   1963 C  CE1   . PHE C 3 223 ? 25.427  67.403 6.068  1.00 19.89  ? 223 PHE A CE1   1 
ATOM   1964 C  CE2   . PHE C 3 223 ? 23.173  68.244 6.229  1.00 15.44  ? 223 PHE A CE2   1 
ATOM   1965 C  CZ    . PHE C 3 223 ? 24.336  67.793 6.843  1.00 18.23  ? 223 PHE A CZ    1 
ATOM   1966 N  N     . ILE C 3 224 ? 22.152  65.964 1.820  1.00 23.45  ? 224 ILE A N     1 
ATOM   1967 C  CA    . ILE C 3 224 ? 21.089  65.078 2.040  1.00 30.62  ? 224 ILE A CA    1 
ATOM   1968 C  C     . ILE C 3 224 ? 21.522  64.024 1.080  1.00 38.40  ? 224 ILE A C     1 
ATOM   1969 O  O     . ILE C 3 224 ? 22.220  64.349 0.128  1.00 42.79  ? 224 ILE A O     1 
ATOM   1970 C  CB    . ILE C 3 224 ? 19.775  65.655 1.562  1.00 31.98  ? 224 ILE A CB    1 
ATOM   1971 C  CG1   . ILE C 3 224 ? 19.371  66.739 2.546  1.00 32.52  ? 224 ILE A CG1   1 
ATOM   1972 C  CG2   . ILE C 3 224 ? 18.726  64.537 1.434  1.00 29.04  ? 224 ILE A CG2   1 
ATOM   1973 C  CD1   . ILE C 3 224 ? 17.866  67.012 2.572  1.00 33.20  ? 224 ILE A CD1   1 
ATOM   1974 N  N     . THR C 3 225 ? 21.134  62.798 1.281  1.00 38.12  ? 225 THR A N     1 
ATOM   1975 C  CA    . THR C 3 225 ? 21.556  61.785 0.351  1.00 32.24  ? 225 THR A CA    1 
ATOM   1976 C  C     . THR C 3 225 ? 20.375  60.854 0.100  1.00 25.45  ? 225 THR A C     1 
ATOM   1977 O  O     . THR C 3 225 ? 20.383  59.991 -0.788 1.00 27.69  ? 225 THR A O     1 
ATOM   1978 C  CB    . THR C 3 225 ? 22.791  61.045 0.918  1.00 33.21  ? 225 THR A CB    1 
ATOM   1979 O  OG1   . THR C 3 225 ? 22.353  60.143 1.902  1.00 37.74  ? 225 THR A OG1   1 
ATOM   1980 C  CG2   . THR C 3 225 ? 23.708  62.031 1.627  1.00 29.08  ? 225 THR A CG2   1 
ATOM   1981 N  N     . ASP C 3 226 ? 19.333  61.020 0.900  1.00 12.27  ? 226 ASP A N     1 
ATOM   1982 C  CA    . ASP C 3 226 ? 18.272  60.158 0.647  1.00 13.39  ? 226 ASP A CA    1 
ATOM   1983 C  C     . ASP C 3 226 ? 17.049  60.824 1.040  1.00 9.23   ? 226 ASP A C     1 
ATOM   1984 O  O     . ASP C 3 226 ? 17.071  61.838 1.677  1.00 7.44   ? 226 ASP A O     1 
ATOM   1985 C  CB    . ASP C 3 226 ? 18.364  58.713 1.153  1.00 26.58  ? 226 ASP A CB    1 
ATOM   1986 C  CG    . ASP C 3 226 ? 19.728  58.064 1.124  1.00 35.14  ? 226 ASP A CG    1 
ATOM   1987 O  OD1   . ASP C 3 226 ? 20.703  58.574 1.658  1.00 34.55  ? 226 ASP A OD1   1 
ATOM   1988 O  OD2   . ASP C 3 226 ? 19.727  56.844 0.594  1.00 39.45  ? 226 ASP A OD2   1 
ATOM   1989 N  N     . THR C 3 227 ? 15.964  60.248 0.630  1.00 12.13  ? 227 THR A N     1 
ATOM   1990 C  CA    . THR C 3 227 ? 14.796  60.936 0.979  1.00 15.55  ? 227 THR A CA    1 
ATOM   1991 C  C     . THR C 3 227 ? 13.729  60.088 1.536  1.00 14.87  ? 227 THR A C     1 
ATOM   1992 O  O     . THR C 3 227 ? 13.219  59.223 0.857  1.00 14.60  ? 227 THR A O     1 
ATOM   1993 C  CB    . THR C 3 227 ? 14.244  61.513 -0.334 1.00 14.87  ? 227 THR A CB    1 
ATOM   1994 O  OG1   . THR C 3 227 ? 15.208  62.338 -0.975 1.00 17.78  ? 227 THR A OG1   1 
ATOM   1995 C  CG2   . THR C 3 227 ? 13.005  62.312 -0.003 1.00 9.64   ? 227 THR A CG2   1 
ATOM   1996 N  N     . LEU C 3 228 ? 13.346  60.318 2.773  1.00 15.36  ? 228 LEU A N     1 
ATOM   1997 C  CA    . LEU C 3 228 ? 12.278  59.449 3.227  1.00 16.96  ? 228 LEU A CA    1 
ATOM   1998 C  C     . LEU C 3 228 ? 10.857  59.932 2.955  1.00 9.44   ? 228 LEU A C     1 
ATOM   1999 O  O     . LEU C 3 228 ? 9.977   59.097 2.885  1.00 9.24   ? 228 LEU A O     1 
ATOM   2000 C  CB    . LEU C 3 228 ? 12.436  58.762 4.590  1.00 21.05  ? 228 LEU A CB    1 
ATOM   2001 C  CG    . LEU C 3 228 ? 13.863  58.669 5.045  1.00 22.33  ? 228 LEU A CG    1 
ATOM   2002 C  CD1   . LEU C 3 228 ? 13.896  57.729 6.233  1.00 22.21  ? 228 LEU A CD1   1 
ATOM   2003 C  CD2   . LEU C 3 228 ? 14.787  58.219 3.906  1.00 21.30  ? 228 LEU A CD2   1 
ATOM   2004 N  N     . SER C 3 229 ? 10.673  61.246 2.825  1.00 4.41   ? 229 SER A N     1 
ATOM   2005 C  CA    . SER C 3 229 ? 9.412   61.909 2.547  1.00 10.91  ? 229 SER A CA    1 
ATOM   2006 C  C     . SER C 3 229 ? 9.662   63.388 2.272  1.00 16.61  ? 229 SER A C     1 
ATOM   2007 O  O     . SER C 3 229 ? 10.704  63.942 2.672  1.00 16.61  ? 229 SER A O     1 
ATOM   2008 C  CB    . SER C 3 229 ? 8.357   61.691 3.577  1.00 14.47  ? 229 SER A CB    1 
ATOM   2009 O  OG    . SER C 3 229 ? 9.065   61.791 4.765  1.00 18.44  ? 229 SER A OG    1 
ATOM   2010 N  N     . LYS C 3 230 ? 8.696   64.000 1.593  1.00 19.07  ? 230 LYS A N     1 
ATOM   2011 C  CA    . LYS C 3 230 ? 8.764   65.395 1.211  1.00 24.88  ? 230 LYS A CA    1 
ATOM   2012 C  C     . LYS C 3 230 ? 7.346   65.885 1.066  1.00 27.61  ? 230 LYS A C     1 
ATOM   2013 O  O     . LYS C 3 230 ? 6.641   65.622 0.074  1.00 30.66  ? 230 LYS A O     1 
ATOM   2014 C  CB    . LYS C 3 230 ? 9.438   65.460 -0.158 1.00 28.56  ? 230 LYS A CB    1 
ATOM   2015 C  CG    . LYS C 3 230 ? 10.279  66.677 -0.489 1.00 39.17  ? 230 LYS A CG    1 
ATOM   2016 C  CD    . LYS C 3 230 ? 10.589  66.690 -1.988 1.00 51.01  ? 230 LYS A CD    1 
ATOM   2017 C  CE    . LYS C 3 230 ? 11.724  67.603 -2.449 1.00 60.66  ? 230 LYS A CE    1 
ATOM   2018 N  NZ    . LYS C 3 230 ? 12.183  67.325 -3.836 1.00 63.34  ? 230 LYS A NZ    1 
ATOM   2019 N  N     . GLY C 3 231 ? 6.917   66.580 2.078  1.00 26.47  ? 231 GLY A N     1 
ATOM   2020 C  CA    . GLY C 3 231 ? 5.589   67.118 2.083  1.00 27.67  ? 231 GLY A CA    1 
ATOM   2021 C  C     . GLY C 3 231 ? 5.810   68.528 1.703  1.00 27.86  ? 231 GLY A C     1 
ATOM   2022 O  O     . GLY C 3 231 ? 6.907   68.821 1.199  1.00 19.82  ? 231 GLY A O     1 
ATOM   2023 N  N     . GLU C 3 232 ? 4.804   69.351 1.956  1.00 33.27  ? 232 GLU A N     1 
ATOM   2024 C  CA    . GLU C 3 232 ? 4.881   70.766 1.656  1.00 43.58  ? 232 GLU A CA    1 
ATOM   2025 C  C     . GLU C 3 232 ? 5.283   71.506 2.929  1.00 38.13  ? 232 GLU A C     1 
ATOM   2026 O  O     . GLU C 3 232 ? 5.380   72.723 2.986  1.00 36.70  ? 232 GLU A O     1 
ATOM   2027 C  CB    . GLU C 3 232 ? 3.534   71.244 1.103  1.00 63.90  ? 232 GLU A CB    1 
ATOM   2028 C  CG    . GLU C 3 232 ? 2.385   70.540 1.872  1.00 80.01  ? 232 GLU A CG    1 
ATOM   2029 C  CD    . GLU C 3 232 ? 0.985   70.758 1.346  1.00 89.80  ? 232 GLU A CD    1 
ATOM   2030 O  OE1   . GLU C 3 232 ? 0.745   71.183 0.213  1.00 92.72  ? 232 GLU A OE1   1 
ATOM   2031 O  OE2   . GLU C 3 232 ? 0.057   70.419 2.241  1.00 92.04  ? 232 GLU A OE2   1 
ATOM   2032 N  N     . THR C 3 233 ? 5.516   70.708 3.975  1.00 36.75  ? 233 THR A N     1 
ATOM   2033 C  CA    . THR C 3 233 ? 5.916   71.158 5.298  1.00 26.31  ? 233 THR A CA    1 
ATOM   2034 C  C     . THR C 3 233 ? 6.994   70.294 5.893  1.00 30.07  ? 233 THR A C     1 
ATOM   2035 O  O     . THR C 3 233 ? 8.043   70.801 6.310  1.00 31.64  ? 233 THR A O     1 
ATOM   2036 C  CB    . THR C 3 233 ? 4.825   71.021 6.325  1.00 15.72  ? 233 THR A CB    1 
ATOM   2037 O  OG1   . THR C 3 233 ? 3.773   71.872 6.007  1.00 14.28  ? 233 THR A OG1   1 
ATOM   2038 C  CG2   . THR C 3 233 ? 5.451   71.435 7.646  1.00 14.69  ? 233 THR A CG2   1 
ATOM   2039 N  N     . LYS C 3 234 ? 6.721   68.972 5.970  1.00 29.57  ? 234 LYS A N     1 
ATOM   2040 C  CA    . LYS C 3 234 ? 7.751   68.134 6.552  1.00 25.87  ? 234 LYS A CA    1 
ATOM   2041 C  C     . LYS C 3 234 ? 8.812   67.575 5.661  1.00 20.55  ? 234 LYS A C     1 
ATOM   2042 O  O     . LYS C 3 234 ? 8.734   67.641 4.462  1.00 16.79  ? 234 LYS A O     1 
ATOM   2043 C  CB    . LYS C 3 234 ? 7.585   67.481 7.904  1.00 25.19  ? 234 LYS A CB    1 
ATOM   2044 C  CG    . LYS C 3 234 ? 6.698   66.257 7.874  1.00 25.95  ? 234 LYS A CG    1 
ATOM   2045 C  CD    . LYS C 3 234 ? 7.022   65.262 8.986  1.00 23.28  ? 234 LYS A CD    1 
ATOM   2046 C  CE    . LYS C 3 234 ? 6.545   63.868 8.616  1.00 21.33  ? 234 LYS A CE    1 
ATOM   2047 N  NZ    . LYS C 3 234 ? 6.443   62.989 9.784  1.00 22.40  ? 234 LYS A NZ    1 
ATOM   2048 N  N     . PHE C 3 235 ? 9.820   67.026 6.263  1.00 20.41  ? 235 PHE A N     1 
ATOM   2049 C  CA    . PHE C 3 235 ? 10.863  66.466 5.465  1.00 20.20  ? 235 PHE A CA    1 
ATOM   2050 C  C     . PHE C 3 235 ? 11.827  65.652 6.283  1.00 23.61  ? 235 PHE A C     1 
ATOM   2051 O  O     . PHE C 3 235 ? 12.467  66.183 7.198  1.00 22.53  ? 235 PHE A O     1 
ATOM   2052 C  CB    . PHE C 3 235 ? 11.674  67.503 4.721  1.00 16.91  ? 235 PHE A CB    1 
ATOM   2053 C  CG    . PHE C 3 235 ? 12.860  66.871 3.997  1.00 18.40  ? 235 PHE A CG    1 
ATOM   2054 C  CD1   . PHE C 3 235 ? 14.085  66.662 4.631  1.00 20.06  ? 235 PHE A CD1   1 
ATOM   2055 C  CD2   . PHE C 3 235 ? 12.760  66.497 2.661  1.00 19.12  ? 235 PHE A CD2   1 
ATOM   2056 C  CE1   . PHE C 3 235 ? 15.181  66.093 3.982  1.00 21.83  ? 235 PHE A CE1   1 
ATOM   2057 C  CE2   . PHE C 3 235 ? 13.837  65.926 1.986  1.00 23.19  ? 235 PHE A CE2   1 
ATOM   2058 C  CZ    . PHE C 3 235 ? 15.051  65.721 2.644  1.00 24.99  ? 235 PHE A CZ    1 
ATOM   2059 N  N     . MET C 3 236 ? 11.938  64.370 5.922  1.00 22.01  ? 236 MET A N     1 
ATOM   2060 C  CA    . MET C 3 236 ? 12.851  63.543 6.646  1.00 21.25  ? 236 MET A CA    1 
ATOM   2061 C  C     . MET C 3 236 ? 13.724  62.937 5.617  1.00 19.01  ? 236 MET A C     1 
ATOM   2062 O  O     . MET C 3 236 ? 13.198  62.653 4.544  1.00 24.32  ? 236 MET A O     1 
ATOM   2063 C  CB    . MET C 3 236 ? 12.095  62.460 7.400  1.00 21.29  ? 236 MET A CB    1 
ATOM   2064 C  CG    . MET C 3 236 ? 10.719  62.939 7.791  1.00 28.84  ? 236 MET A CG    1 
ATOM   2065 S  SD    . MET C 3 236 ? 9.893   61.573 8.619  1.00 39.38  ? 236 MET A SD    1 
ATOM   2066 C  CE    . MET C 3 236 ? 11.388  60.856 9.332  1.00 38.38  ? 236 MET A CE    1 
ATOM   2067 N  N     . GLY C 3 237 ? 15.002  62.756 5.919  1.00 10.78  ? 237 GLY A N     1 
ATOM   2068 C  CA    . GLY C 3 237 ? 15.885  62.162 4.927  1.00 8.60   ? 237 GLY A CA    1 
ATOM   2069 C  C     . GLY C 3 237 ? 17.203  61.851 5.537  1.00 10.03  ? 237 GLY A C     1 
ATOM   2070 O  O     . GLY C 3 237 ? 17.431  62.067 6.744  1.00 17.76  ? 237 GLY A O     1 
ATOM   2071 N  N     . VAL C 3 238 ? 18.079  61.330 4.730  1.00 6.50   ? 238 VAL A N     1 
ATOM   2072 C  CA    . VAL C 3 238 ? 19.392  61.024 5.266  1.00 6.70   ? 238 VAL A CA    1 
ATOM   2073 C  C     . VAL C 3 238 ? 20.294  62.067 4.782  1.00 10.77  ? 238 VAL A C     1 
ATOM   2074 O  O     . VAL C 3 238 ? 19.988  62.708 3.747  1.00 10.18  ? 238 VAL A O     1 
ATOM   2075 C  CB    . VAL C 3 238 ? 19.960  59.699 4.861  1.00 7.05   ? 238 VAL A CB    1 
ATOM   2076 C  CG1   . VAL C 3 238 ? 21.361  59.490 5.458  1.00 4.64   ? 238 VAL A CG1   1 
ATOM   2077 C  CG2   . VAL C 3 238 ? 18.981  58.639 5.344  1.00 6.75   ? 238 VAL A CG2   1 
ATOM   2078 N  N     . CYS C 3 239 ? 21.363  62.227 5.530  1.00 14.47  ? 239 CYS A N     1 
ATOM   2079 C  CA    . CYS C 3 239 ? 22.343  63.205 5.191  1.00 27.24  ? 239 CYS A CA    1 
ATOM   2080 C  C     . CYS C 3 239 ? 23.655  62.745 5.678  1.00 38.00  ? 239 CYS A C     1 
ATOM   2081 O  O     . CYS C 3 239 ? 23.696  61.710 6.387  1.00 44.49  ? 239 CYS A O     1 
ATOM   2082 C  CB    . CYS C 3 239 ? 22.031  64.573 5.764  1.00 28.03  ? 239 CYS A CB    1 
ATOM   2083 S  SG    . CYS C 3 239 ? 22.391  64.667 7.500  1.00 24.15  ? 239 CYS A SG    1 
ATOM   2084 N  N     . GLN C 3 240 ? 24.692  63.490 5.301  1.00 37.81  ? 240 GLN A N     1 
ATOM   2085 C  CA    . GLN C 3 240 ? 25.995  63.062 5.729  1.00 41.37  ? 240 GLN A CA    1 
ATOM   2086 C  C     . GLN C 3 240 ? 27.097  64.094 5.589  1.00 41.06  ? 240 GLN A C     1 
ATOM   2087 O  O     . GLN C 3 240 ? 27.110  64.902 4.653  1.00 37.20  ? 240 GLN A O     1 
ATOM   2088 C  CB    . GLN C 3 240 ? 26.348  61.849 4.829  1.00 44.13  ? 240 GLN A CB    1 
ATOM   2089 C  CG    . GLN C 3 240 ? 27.676  61.154 5.159  1.00 49.34  ? 240 GLN A CG    1 
ATOM   2090 C  CD    . GLN C 3 240 ? 28.396  60.626 3.925  1.00 57.45  ? 240 GLN A CD    1 
ATOM   2091 O  OE1   . GLN C 3 240 ? 27.786  60.166 2.945  1.00 59.50  ? 240 GLN A OE1   1 
ATOM   2092 N  NE2   . GLN C 3 240 ? 29.716  60.759 3.929  1.00 62.08  ? 240 GLN A NE2   1 
ATOM   2093 N  N     . LEU C 3 241 ? 28.022  64.033 6.546  1.00 45.81  ? 241 LEU A N     1 
ATOM   2094 C  CA    . LEU C 3 241 ? 29.151  64.922 6.550  1.00 54.44  ? 241 LEU A CA    1 
ATOM   2095 C  C     . LEU C 3 241 ? 30.149  64.457 5.508  1.00 61.25  ? 241 LEU A C     1 
ATOM   2096 O  O     . LEU C 3 241 ? 30.147  63.306 5.108  1.00 61.70  ? 241 LEU A O     1 
ATOM   2097 C  CB    . LEU C 3 241 ? 29.814  65.044 7.924  1.00 56.32  ? 241 LEU A CB    1 
ATOM   2098 C  CG    . LEU C 3 241 ? 29.498  66.404 8.521  1.00 61.37  ? 241 LEU A CG    1 
ATOM   2099 C  CD1   . LEU C 3 241 ? 28.017  66.476 8.795  1.00 66.82  ? 241 LEU A CD1   1 
ATOM   2100 C  CD2   . LEU C 3 241 ? 30.291  66.673 9.791  1.00 61.28  ? 241 LEU A CD2   1 
ATOM   2101 N  N     . PRO C 3 242 ? 31.004  65.342 5.053  1.00 67.96  ? 242 PRO A N     1 
ATOM   2102 C  CA    . PRO C 3 242 ? 31.985  64.959 4.059  1.00 75.37  ? 242 PRO A CA    1 
ATOM   2103 C  C     . PRO C 3 242 ? 33.407  64.776 4.604  1.00 87.23  ? 242 PRO A C     1 
ATOM   2104 O  O     . PRO C 3 242 ? 33.649  64.992 5.797  1.00 88.56  ? 242 PRO A O     1 
ATOM   2105 C  CB    . PRO C 3 242 ? 31.820  65.943 2.912  1.00 70.33  ? 242 PRO A CB    1 
ATOM   2106 C  CG    . PRO C 3 242 ? 30.366  66.405 3.015  1.00 67.23  ? 242 PRO A CG    1 
ATOM   2107 C  CD    . PRO C 3 242 ? 29.888  66.083 4.420  1.00 66.66  ? 242 PRO A CD    1 
ATOM   2108 N  N     . SER C 3 243 ? 34.348  64.365 3.734  1.00 95.73  ? 243 SER A N     1 
ATOM   2109 C  CA    . SER C 3 243 ? 35.756  64.137 4.138  1.00 100.00 ? 243 SER A CA    1 
ATOM   2110 C  C     . SER C 3 243 ? 36.727  63.738 2.981  1.00 100.00 ? 243 SER A C     1 
ATOM   2111 O  O     . SER C 3 243 ? 36.363  63.780 1.786  1.00 100.00 ? 243 SER A O     1 
ATOM   2112 C  CB    . SER C 3 243 ? 35.793  63.089 5.254  1.00 100.00 ? 243 SER A CB    1 
ATOM   2113 N  N     . GLU C 3 244 ? 37.980  63.346 3.350  1.00 100.00 ? 244 GLU A N     1 
ATOM   2114 C  CA    . GLU C 3 244 ? 39.044  62.911 2.417  1.00 100.00 ? 244 GLU A CA    1 
ATOM   2115 C  C     . GLU C 3 244 ? 39.490  61.548 2.898  1.00 100.00 ? 244 GLU A C     1 
ATOM   2116 O  O     . GLU C 3 244 ? 40.309  61.438 3.832  1.00 99.73  ? 244 GLU A O     1 
ATOM   2117 C  CB    . GLU C 3 244 ? 40.230  63.854 2.390  1.00 100.00 ? 244 GLU A CB    1 
ATOM   2118 N  N     . ASN C 3 245 ? 38.907  60.536 2.233  1.00 100.00 ? 245 ASN A N     1 
ATOM   2119 C  CA    . ASN C 3 245 ? 39.108  59.107 2.491  1.00 100.00 ? 245 ASN A CA    1 
ATOM   2120 C  C     . ASN C 3 245 ? 37.996  58.630 3.429  1.00 100.00 ? 245 ASN A C     1 
ATOM   2121 O  O     . ASN C 3 245 ? 36.818  58.621 2.965  1.00 100.00 ? 245 ASN A O     1 
ATOM   2122 C  CB    . ASN C 3 245 ? 40.480  58.760 3.076  1.00 100.00 ? 245 ASN A CB    1 
ATOM   2123 N  N     . GLU C 3 249 ? 34.773  57.184 5.865  1.00 86.55  ? 249 GLU A N     1 
ATOM   2124 C  CA    . GLU C 3 249 ? 33.940  58.367 5.791  1.00 86.05  ? 249 GLU A CA    1 
ATOM   2125 C  C     . GLU C 3 249 ? 32.891  58.451 6.925  1.00 81.60  ? 249 GLU A C     1 
ATOM   2126 O  O     . GLU C 3 249 ? 32.601  57.467 7.632  1.00 79.57  ? 249 GLU A O     1 
ATOM   2127 C  CB    . GLU C 3 249 ? 33.306  58.506 4.395  1.00 89.00  ? 249 GLU A CB    1 
ATOM   2128 C  CG    . GLU C 3 249 ? 32.778  57.140 3.923  1.00 95.04  ? 249 GLU A CG    1 
ATOM   2129 C  CD    . GLU C 3 249 ? 31.682  57.219 2.886  1.00 100.00 ? 249 GLU A CD    1 
ATOM   2130 O  OE1   . GLU C 3 249 ? 31.007  58.224 2.672  1.00 100.00 ? 249 GLU A OE1   1 
ATOM   2131 O  OE2   . GLU C 3 249 ? 31.499  56.069 2.257  1.00 100.00 ? 249 GLU A OE2   1 
ATOM   2132 N  N     . TYR C 3 250 ? 32.345  59.673 7.077  1.00 75.28  ? 250 TYR A N     1 
ATOM   2133 C  CA    . TYR C 3 250 ? 31.351  60.031 8.061  1.00 69.39  ? 250 TYR A CA    1 
ATOM   2134 C  C     . TYR C 3 250 ? 30.039  59.234 7.960  1.00 62.98  ? 250 TYR A C     1 
ATOM   2135 O  O     . TYR C 3 250 ? 29.539  58.994 6.851  1.00 67.55  ? 250 TYR A O     1 
ATOM   2136 C  CB    . TYR C 3 250 ? 31.162  61.534 7.991  1.00 74.26  ? 250 TYR A CB    1 
ATOM   2137 C  CG    . TYR C 3 250 ? 32.112  62.212 8.925  1.00 83.64  ? 250 TYR A CG    1 
ATOM   2138 C  CD1   . TYR C 3 250 ? 31.747  62.387 10.258 1.00 89.89  ? 250 TYR A CD1   1 
ATOM   2139 C  CD2   . TYR C 3 250 ? 33.363  62.668 8.513  1.00 88.60  ? 250 TYR A CD2   1 
ATOM   2140 C  CE1   . TYR C 3 250 ? 32.586  63.008 11.178 1.00 94.21  ? 250 TYR A CE1   1 
ATOM   2141 C  CE2   . TYR C 3 250 ? 34.223  63.294 9.419  1.00 93.43  ? 250 TYR A CE2   1 
ATOM   2142 C  CZ    . TYR C 3 250 ? 33.833  63.462 10.752 1.00 97.05  ? 250 TYR A CZ    1 
ATOM   2143 O  OH    . TYR C 3 250 ? 34.662  64.076 11.667 1.00 100.00 ? 250 TYR A OH    1 
ATOM   2144 N  N     . PRO C 3 251 ? 29.469  58.818 9.122  1.00 47.21  ? 251 PRO A N     1 
ATOM   2145 C  CA    . PRO C 3 251 ? 28.232  58.032 9.167  1.00 38.19  ? 251 PRO A CA    1 
ATOM   2146 C  C     . PRO C 3 251 ? 26.970  58.751 8.726  1.00 36.50  ? 251 PRO A C     1 
ATOM   2147 O  O     . PRO C 3 251 ? 26.778  59.948 8.992  1.00 41.57  ? 251 PRO A O     1 
ATOM   2148 C  CB    . PRO C 3 251 ? 28.059  57.611 10.608 1.00 35.65  ? 251 PRO A CB    1 
ATOM   2149 C  CG    . PRO C 3 251 ? 28.996  58.451 11.441 1.00 35.93  ? 251 PRO A CG    1 
ATOM   2150 C  CD    . PRO C 3 251 ? 29.972  59.111 10.483 1.00 39.67  ? 251 PRO A CD    1 
ATOM   2151 N  N     . HIS C 3 252 ? 26.097  58.023 8.060  1.00 27.04  ? 252 HIS A N     1 
ATOM   2152 C  CA    . HIS C 3 252 ? 24.875  58.638 7.615  1.00 27.22  ? 252 HIS A CA    1 
ATOM   2153 C  C     . HIS C 3 252 ? 23.970  59.037 8.739  1.00 24.87  ? 252 HIS A C     1 
ATOM   2154 O  O     . HIS C 3 252 ? 23.697  58.287 9.674  1.00 16.69  ? 252 HIS A O     1 
ATOM   2155 C  CB    . HIS C 3 252 ? 24.098  57.795 6.618  1.00 34.57  ? 252 HIS A CB    1 
ATOM   2156 C  CG    . HIS C 3 252 ? 24.742  57.837 5.273  1.00 42.15  ? 252 HIS A CG    1 
ATOM   2157 N  ND1   . HIS C 3 252 ? 26.069  57.456 5.098  1.00 42.33  ? 252 HIS A ND1   1 
ATOM   2158 C  CD2   . HIS C 3 252 ? 24.229  58.204 4.063  1.00 43.96  ? 252 HIS A CD2   1 
ATOM   2159 C  CE1   . HIS C 3 252 ? 26.321  57.607 3.802  1.00 43.98  ? 252 HIS A CE1   1 
ATOM   2160 N  NE2   . HIS C 3 252 ? 25.242  58.049 3.146  1.00 44.74  ? 252 HIS A NE2   1 
ATOM   2161 N  N     . ARG C 3 253 ? 23.485  60.261 8.633  1.00 27.96  ? 253 ARG A N     1 
ATOM   2162 C  CA    . ARG C 3 253 ? 22.621  60.699 9.669  1.00 27.87  ? 253 ARG A CA    1 
ATOM   2163 C  C     . ARG C 3 253 ? 21.230  60.987 9.246  1.00 28.21  ? 253 ARG A C     1 
ATOM   2164 O  O     . ARG C 3 253 ? 20.962  61.270 8.060  1.00 32.95  ? 253 ARG A O     1 
ATOM   2165 C  CB    . ARG C 3 253 ? 23.222  61.852 10.407 1.00 25.86  ? 253 ARG A CB    1 
ATOM   2166 C  CG    . ARG C 3 253 ? 24.705  61.603 10.509 1.00 29.65  ? 253 ARG A CG    1 
ATOM   2167 C  CD    . ARG C 3 253 ? 25.088  60.456 11.430 1.00 31.31  ? 253 ARG A CD    1 
ATOM   2168 N  NE    . ARG C 3 253 ? 26.333  60.874 12.056 1.00 35.09  ? 253 ARG A NE    1 
ATOM   2169 C  CZ    . ARG C 3 253 ? 26.746  60.575 13.271 1.00 34.98  ? 253 ARG A CZ    1 
ATOM   2170 N  NH1   . ARG C 3 253 ? 26.030  59.809 14.094 1.00 38.15  ? 253 ARG A NH1   1 
ATOM   2171 N  NH2   . ARG C 3 253 ? 27.921  61.071 13.663 1.00 31.01  ? 253 ARG A NH2   1 
ATOM   2172 N  N     . ARG C 3 254 ? 20.372  60.911 10.266 1.00 22.11  ? 254 ARG A N     1 
ATOM   2173 C  CA    . ARG C 3 254 ? 18.997  61.177 10.068 1.00 23.47  ? 254 ARG A CA    1 
ATOM   2174 C  C     . ARG C 3 254 ? 18.758  62.639 10.210 1.00 24.65  ? 254 ARG A C     1 
ATOM   2175 O  O     . ARG C 3 254 ? 19.230  63.266 11.207 1.00 14.49  ? 254 ARG A O     1 
ATOM   2176 C  CB    . ARG C 3 254 ? 18.131  60.459 11.036 1.00 25.95  ? 254 ARG A CB    1 
ATOM   2177 C  CG    . ARG C 3 254 ? 17.911  59.054 10.572 1.00 31.37  ? 254 ARG A CG    1 
ATOM   2178 C  CD    . ARG C 3 254 ? 16.461  58.710 10.649 1.00 41.65  ? 254 ARG A CD    1 
ATOM   2179 N  NE    . ARG C 3 254 ? 15.810  59.268 11.844 1.00 55.18  ? 254 ARG A NE    1 
ATOM   2180 C  CZ    . ARG C 3 254 ? 15.960  58.838 13.114 1.00 59.00  ? 254 ARG A CZ    1 
ATOM   2181 N  NH1   . ARG C 3 254 ? 16.777  57.812 13.427 1.00 59.35  ? 254 ARG A NH1   1 
ATOM   2182 N  NH2   . ARG C 3 254 ? 15.280  59.468 14.092 1.00 58.52  ? 254 ARG A NH2   1 
ATOM   2183 N  N     . ILE C 3 255 ? 18.004  63.157 9.196  1.00 27.88  ? 255 ILE A N     1 
ATOM   2184 C  CA    . ILE C 3 255 ? 17.662  64.588 9.166  1.00 21.19  ? 255 ILE A CA    1 
ATOM   2185 C  C     . ILE C 3 255 ? 16.201  64.883 8.968  1.00 11.66  ? 255 ILE A C     1 
ATOM   2186 O  O     . ILE C 3 255 ? 15.523  64.186 8.208  1.00 6.51   ? 255 ILE A O     1 
ATOM   2187 C  CB    . ILE C 3 255 ? 18.534  65.401 8.253  1.00 19.85  ? 255 ILE A CB    1 
ATOM   2188 C  CG1   . ILE C 3 255 ? 18.109  66.826 8.473  1.00 20.30  ? 255 ILE A CG1   1 
ATOM   2189 C  CG2   . ILE C 3 255 ? 18.243  65.019 6.819  1.00 18.78  ? 255 ILE A CG2   1 
ATOM   2190 C  CD1   . ILE C 3 255 ? 19.213  67.822 8.172  1.00 19.98  ? 255 ILE A CD1   1 
ATOM   2191 N  N     . ASP C 3 256 ? 15.757  65.928 9.676  1.00 13.04  ? 256 ASP A N     1 
ATOM   2192 C  CA    . ASP C 3 256 ? 14.372  66.392 9.666  1.00 14.79  ? 256 ASP A CA    1 
ATOM   2193 C  C     . ASP C 3 256 ? 14.224  67.842 9.499  1.00 16.57  ? 256 ASP A C     1 
ATOM   2194 O  O     . ASP C 3 256 ? 14.827  68.583 10.215 1.00 26.38  ? 256 ASP A O     1 
ATOM   2195 C  CB    . ASP C 3 256 ? 13.662  66.076 10.983 1.00 16.68  ? 256 ASP A CB    1 
ATOM   2196 C  CG    . ASP C 3 256 ? 13.178  64.672 10.872 1.00 35.44  ? 256 ASP A CG    1 
ATOM   2197 O  OD1   . ASP C 3 256 ? 13.096  64.367 9.617  1.00 42.84  ? 256 ASP A OD1   1 
ATOM   2198 O  OD2   . ASP C 3 256 ? 12.948  63.876 11.796 1.00 42.97  ? 256 ASP A OD2   1 
ATOM   2199 N  N     . ILE C 3 257 ? 13.409  68.264 8.568  1.00 11.69  ? 257 ILE A N     1 
ATOM   2200 C  CA    . ILE C 3 257 ? 13.220  69.673 8.392  1.00 7.24   ? 257 ILE A CA    1 
ATOM   2201 C  C     . ILE C 3 257 ? 11.755  69.839 8.508  1.00 9.20   ? 257 ILE A C     1 
ATOM   2202 O  O     . ILE C 3 257 ? 11.001  69.003 8.100  1.00 12.42  ? 257 ILE A O     1 
ATOM   2203 C  CB    . ILE C 3 257 ? 13.533  70.343 7.018  1.00 4.91   ? 257 ILE A CB    1 
ATOM   2204 C  CG1   . ILE C 3 257 ? 14.744  69.863 6.221  1.00 1.00   ? 257 ILE A CG1   1 
ATOM   2205 C  CG2   . ILE C 3 257 ? 13.637  71.855 7.184  1.00 1.84   ? 257 ILE A CG2   1 
ATOM   2206 C  CD1   . ILE C 3 257 ? 16.022  70.533 6.649  1.00 1.00   ? 257 ILE A CD1   1 
ATOM   2207 N  N     . ARG C 3 258 ? 11.371  70.948 9.048  1.00 14.21  ? 258 ARG A N     1 
ATOM   2208 C  CA    . ARG C 3 258 ? 9.996   71.265 9.199  1.00 11.27  ? 258 ARG A CA    1 
ATOM   2209 C  C     . ARG C 3 258 ? 9.918   72.741 8.948  1.00 10.65  ? 258 ARG A C     1 
ATOM   2210 O  O     . ARG C 3 258 ? 10.702  73.523 9.510  1.00 14.62  ? 258 ARG A O     1 
ATOM   2211 C  CB    . ARG C 3 258 ? 9.537   71.009 10.604 1.00 9.85   ? 258 ARG A CB    1 
ATOM   2212 C  CG    . ARG C 3 258 ? 8.080   71.390 10.709 1.00 11.26  ? 258 ARG A CG    1 
ATOM   2213 C  CD    . ARG C 3 258 ? 7.156   70.302 10.150 1.00 15.60  ? 258 ARG A CD    1 
ATOM   2214 N  NE    . ARG C 3 258 ? 6.107   70.037 11.126 1.00 19.07  ? 258 ARG A NE    1 
ATOM   2215 C  CZ    . ARG C 3 258 ? 4.913   70.663 11.166 1.00 22.72  ? 258 ARG A CZ    1 
ATOM   2216 N  NH1   . ARG C 3 258 ? 4.557   71.597 10.283 1.00 22.33  ? 258 ARG A NH1   1 
ATOM   2217 N  NH2   . ARG C 3 258 ? 4.047   70.334 12.130 1.00 23.57  ? 258 ARG A NH2   1 
ATOM   2218 N  N     . LEU C 3 259 ? 8.995   73.108 8.106  1.00 7.25   ? 259 LEU A N     1 
ATOM   2219 C  CA    . LEU C 3 259 ? 8.794   74.495 7.766  1.00 10.99  ? 259 LEU A CA    1 
ATOM   2220 C  C     . LEU C 3 259 ? 7.562   75.057 8.480  1.00 18.64  ? 259 LEU A C     1 
ATOM   2221 O  O     . LEU C 3 259 ? 6.427   74.629 8.212  1.00 18.54  ? 259 LEU A O     1 
ATOM   2222 C  CB    . LEU C 3 259 ? 8.573   74.587 6.258  1.00 10.91  ? 259 LEU A CB    1 
ATOM   2223 C  CG    . LEU C 3 259 ? 8.312   75.989 5.760  1.00 8.50   ? 259 LEU A CG    1 
ATOM   2224 C  CD1   . LEU C 3 259 ? 9.641   76.733 5.828  1.00 13.45  ? 259 LEU A CD1   1 
ATOM   2225 C  CD2   . LEU C 3 259 ? 7.792   75.901 4.334  1.00 2.09   ? 259 LEU A CD2   1 
ATOM   2226 N  N     . ILE C 3 260 ? 7.790   76.008 9.401  1.00 23.05  ? 260 ILE A N     1 
ATOM   2227 C  CA    . ILE C 3 260 ? 6.715   76.634 10.169 1.00 24.07  ? 260 ILE A CA    1 
ATOM   2228 C  C     . ILE C 3 260 ? 6.521   78.040 9.664  1.00 19.76  ? 260 ILE A C     1 
ATOM   2229 O  O     . ILE C 3 260 ? 7.514   78.744 9.465  1.00 20.15  ? 260 ILE A O     1 
ATOM   2230 C  CB    . ILE C 3 260 ? 7.058   76.553 11.667 1.00 32.84  ? 260 ILE A CB    1 
ATOM   2231 C  CG1   . ILE C 3 260 ? 6.506   75.267 12.180 1.00 39.37  ? 260 ILE A CG1   1 
ATOM   2232 C  CG2   . ILE C 3 260 ? 6.463   77.680 12.515 1.00 32.30  ? 260 ILE A CG2   1 
ATOM   2233 C  CD1   . ILE C 3 260 ? 4.990   75.299 12.007 1.00 44.09  ? 260 ILE A CD1   1 
ATOM   2234 N  N     . PRO C 3 261 ? 5.276   78.438 9.445  1.00 18.11  ? 261 PRO A N     1 
ATOM   2235 C  CA    . PRO C 3 261 ? 4.992   79.777 8.953  1.00 19.83  ? 261 PRO A CA    1 
ATOM   2236 C  C     . PRO C 3 261 ? 5.627   80.750 9.903  1.00 24.38  ? 261 PRO A C     1 
ATOM   2237 O  O     . PRO C 3 261 ? 5.292   80.729 11.074 1.00 23.35  ? 261 PRO A O     1 
ATOM   2238 C  CB    . PRO C 3 261 ? 3.481   79.966 9.024  1.00 19.18  ? 261 PRO A CB    1 
ATOM   2239 C  CG    . PRO C 3 261 ? 2.930   78.806 9.841  1.00 18.47  ? 261 PRO A CG    1 
ATOM   2240 C  CD    . PRO C 3 261 ? 4.087   77.818 10.064 1.00 17.45  ? 261 PRO A CD    1 
ATOM   2241 N  N     . LYS C 3 262 ? 6.542   81.561 9.375  1.00 29.77  ? 262 LYS A N     1 
ATOM   2242 C  CA    . LYS C 3 262 ? 7.277   82.554 10.110 1.00 32.40  ? 262 LYS A CA    1 
ATOM   2243 C  C     . LYS C 3 262 ? 6.478   83.223 11.199 1.00 28.18  ? 262 LYS A C     1 
ATOM   2244 O  O     . LYS C 3 262 ? 7.004   83.635 12.212 1.00 29.63  ? 262 LYS A O     1 
ATOM   2245 C  CB    . LYS C 3 262 ? 7.823   83.628 9.195  1.00 41.75  ? 262 LYS A CB    1 
ATOM   2246 C  CG    . LYS C 3 262 ? 8.608   84.670 9.975  1.00 51.38  ? 262 LYS A CG    1 
ATOM   2247 C  CD    . LYS C 3 262 ? 9.631   85.417 9.130  1.00 63.07  ? 262 LYS A CD    1 
ATOM   2248 C  CE    . LYS C 3 262 ? 10.701  86.081 9.999  1.00 75.56  ? 262 LYS A CE    1 
ATOM   2249 N  NZ    . LYS C 3 262 ? 11.295  87.318 9.428  1.00 81.31  ? 262 LYS A NZ    1 
ATOM   2250 N  N     . ASP C 3 263 ? 5.196   83.326 11.014 1.00 23.08  ? 263 ASP A N     1 
ATOM   2251 C  CA    . ASP C 3 263 ? 4.458   83.973 12.060 1.00 22.50  ? 263 ASP A CA    1 
ATOM   2252 C  C     . ASP C 3 263 ? 4.142   83.169 13.296 1.00 22.85  ? 263 ASP A C     1 
ATOM   2253 O  O     . ASP C 3 263 ? 3.798   83.735 14.330 1.00 25.62  ? 263 ASP A O     1 
ATOM   2254 C  CB    . ASP C 3 263 ? 3.300   84.840 11.584 1.00 24.08  ? 263 ASP A CB    1 
ATOM   2255 C  CG    . ASP C 3 263 ? 2.153   84.070 11.034 1.00 28.15  ? 263 ASP A CG    1 
ATOM   2256 O  OD1   . ASP C 3 263 ? 2.435   83.325 9.972  1.00 30.46  ? 263 ASP A OD1   1 
ATOM   2257 O  OD2   . ASP C 3 263 ? 1.051   84.215 11.486 1.00 29.94  ? 263 ASP A OD2   1 
ATOM   2258 N  N     . GLN C 3 264 ? 4.247   81.850 13.174 1.00 20.66  ? 264 GLN A N     1 
ATOM   2259 C  CA    . GLN C 3 264 ? 3.978   80.901 14.257 1.00 8.91   ? 264 GLN A CA    1 
ATOM   2260 C  C     . GLN C 3 264 ? 5.226   80.197 14.630 1.00 9.34   ? 264 GLN A C     1 
ATOM   2261 O  O     . GLN C 3 264 ? 5.196   78.991 14.905 1.00 14.36  ? 264 GLN A O     1 
ATOM   2262 C  CB    . GLN C 3 264 ? 2.988   79.832 13.830 1.00 3.81   ? 264 GLN A CB    1 
ATOM   2263 C  CG    . GLN C 3 264 ? 1.909   80.406 12.910 1.00 7.32   ? 264 GLN A CG    1 
ATOM   2264 C  CD    . GLN C 3 264 ? 0.740   79.497 12.645 1.00 11.32  ? 264 GLN A CD    1 
ATOM   2265 O  OE1   . GLN C 3 264 ? -0.291  79.940 12.149 1.00 13.02  ? 264 GLN A OE1   1 
ATOM   2266 N  NE2   . GLN C 3 264 ? 0.881   78.222 12.951 1.00 14.74  ? 264 GLN A NE2   1 
ATOM   2267 N  N     . TYR C 3 265 ? 6.326   80.947 14.607 1.00 5.04   ? 265 TYR A N     1 
ATOM   2268 C  CA    . TYR C 3 265 ? 7.590   80.385 14.931 1.00 1.00   ? 265 TYR A CA    1 
ATOM   2269 C  C     . TYR C 3 265 ? 7.644   79.868 16.345 1.00 4.24   ? 265 TYR A C     1 
ATOM   2270 O  O     . TYR C 3 265 ? 8.055   78.736 16.594 1.00 4.63   ? 265 TYR A O     1 
ATOM   2271 C  CB    . TYR C 3 265 ? 8.585   81.437 14.717 1.00 6.11   ? 265 TYR A CB    1 
ATOM   2272 C  CG    . TYR C 3 265 ? 9.969   81.080 15.093 1.00 15.51  ? 265 TYR A CG    1 
ATOM   2273 C  CD1   . TYR C 3 265 ? 10.798  80.483 14.150 1.00 15.55  ? 265 TYR A CD1   1 
ATOM   2274 C  CD2   . TYR C 3 265 ? 10.463  81.380 16.363 1.00 22.77  ? 265 TYR A CD2   1 
ATOM   2275 C  CE1   . TYR C 3 265 ? 12.110  80.168 14.475 1.00 19.22  ? 265 TYR A CE1   1 
ATOM   2276 C  CE2   . TYR C 3 265 ? 11.782  81.059 16.694 1.00 25.28  ? 265 TYR A CE2   1 
ATOM   2277 C  CZ    . TYR C 3 265 ? 12.603  80.451 15.744 1.00 24.81  ? 265 TYR A CZ    1 
ATOM   2278 O  OH    . TYR C 3 265 ? 13.904  80.131 16.041 1.00 31.24  ? 265 TYR A OH    1 
ATOM   2279 N  N     . TYR C 3 266 ? 7.208   80.637 17.320 1.00 12.58  ? 266 TYR A N     1 
ATOM   2280 C  CA    . TYR C 3 266 ? 7.289   80.057 18.669 1.00 16.94  ? 266 TYR A CA    1 
ATOM   2281 C  C     . TYR C 3 266 ? 6.605   78.731 18.974 1.00 8.71   ? 266 TYR A C     1 
ATOM   2282 O  O     . TYR C 3 266 ? 7.171   77.915 19.722 1.00 1.00   ? 266 TYR A O     1 
ATOM   2283 C  CB    . TYR C 3 266 ? 7.446   80.979 19.867 1.00 22.42  ? 266 TYR A CB    1 
ATOM   2284 C  CG    . TYR C 3 266 ? 8.286   82.182 19.598 1.00 32.18  ? 266 TYR A CG    1 
ATOM   2285 C  CD1   . TYR C 3 266 ? 7.707   83.269 18.952 1.00 35.40  ? 266 TYR A CD1   1 
ATOM   2286 C  CD2   . TYR C 3 266 ? 9.622   82.270 19.995 1.00 35.79  ? 266 TYR A CD2   1 
ATOM   2287 C  CE1   . TYR C 3 266 ? 8.449   84.421 18.700 1.00 38.71  ? 266 TYR A CE1   1 
ATOM   2288 C  CE2   . TYR C 3 266 ? 10.380  83.414 19.754 1.00 36.27  ? 266 TYR A CE2   1 
ATOM   2289 C  CZ    . TYR C 3 266 ? 9.781   84.488 19.100 1.00 39.11  ? 266 TYR A CZ    1 
ATOM   2290 O  OH    . TYR C 3 266 ? 10.491  85.634 18.844 1.00 43.40  ? 266 TYR A OH    1 
ATOM   2291 N  N     . CYS C 3 267 ? 5.406   78.517 18.423 1.00 4.01   ? 267 CYS A N     1 
ATOM   2292 C  CA    . CYS C 3 267 ? 4.842   77.232 18.752 1.00 5.79   ? 267 CYS A CA    1 
ATOM   2293 C  C     . CYS C 3 267 ? 5.695   76.144 18.206 1.00 3.67   ? 267 CYS A C     1 
ATOM   2294 O  O     . CYS C 3 267 ? 5.915   75.110 18.812 1.00 1.00   ? 267 CYS A O     1 
ATOM   2295 C  CB    . CYS C 3 267 ? 3.423   77.123 18.355 1.00 10.48  ? 267 CYS A CB    1 
ATOM   2296 S  SG    . CYS C 3 267 ? 2.699   78.387 19.393 1.00 15.58  ? 267 CYS A SG    1 
ATOM   2297 N  N     . GLY C 3 268 ? 6.198   76.457 17.044 1.00 7.54   ? 268 GLY A N     1 
ATOM   2298 C  CA    . GLY C 3 268 ? 7.053   75.535 16.387 1.00 7.72   ? 268 GLY A CA    1 
ATOM   2299 C  C     . GLY C 3 268 ? 8.215   75.256 17.261 1.00 2.83   ? 268 GLY A C     1 
ATOM   2300 O  O     . GLY C 3 268 ? 8.336   74.136 17.722 1.00 5.21   ? 268 GLY A O     1 
ATOM   2301 N  N     . VAL C 3 269 ? 9.013   76.281 17.509 1.00 3.01   ? 269 VAL A N     1 
ATOM   2302 C  CA    . VAL C 3 269 ? 10.180  76.100 18.362 1.00 7.70   ? 269 VAL A CA    1 
ATOM   2303 C  C     . VAL C 3 269 ? 9.966   75.346 19.616 1.00 18.37  ? 269 VAL A C     1 
ATOM   2304 O  O     . VAL C 3 269 ? 10.821  74.527 19.962 1.00 29.68  ? 269 VAL A O     1 
ATOM   2305 C  CB    . VAL C 3 269 ? 10.888  77.317 18.814 1.00 1.85   ? 269 VAL A CB    1 
ATOM   2306 C  CG1   . VAL C 3 269 ? 12.175  77.384 18.085 1.00 1.00   ? 269 VAL A CG1   1 
ATOM   2307 C  CG2   . VAL C 3 269 ? 10.018  78.541 18.573 1.00 6.81   ? 269 VAL A CG2   1 
ATOM   2308 N  N     . LEU C 3 270 ? 8.880   75.619 20.294 1.00 16.52  ? 270 LEU A N     1 
ATOM   2309 C  CA    . LEU C 3 270 ? 8.699   74.870 21.502 1.00 18.79  ? 270 LEU A CA    1 
ATOM   2310 C  C     . LEU C 3 270 ? 8.622   73.390 21.143 1.00 13.62  ? 270 LEU A C     1 
ATOM   2311 O  O     . LEU C 3 270 ? 9.489   72.555 21.573 1.00 10.23  ? 270 LEU A O     1 
ATOM   2312 C  CB    . LEU C 3 270 ? 7.427   75.312 22.182 1.00 22.21  ? 270 LEU A CB    1 
ATOM   2313 C  CG    . LEU C 3 270 ? 7.226   74.686 23.527 1.00 23.52  ? 270 LEU A CG    1 
ATOM   2314 C  CD1   . LEU C 3 270 ? 8.549   74.814 24.274 1.00 27.88  ? 270 LEU A CD1   1 
ATOM   2315 C  CD2   . LEU C 3 270 ? 6.164   75.527 24.223 1.00 20.09  ? 270 LEU A CD2   1 
ATOM   2316 N  N     . TYR C 3 271 ? 7.609   73.133 20.306 1.00 4.99   ? 271 TYR A N     1 
ATOM   2317 C  CA    . TYR C 3 271 ? 7.357   71.810 19.836 1.00 1.00   ? 271 TYR A CA    1 
ATOM   2318 C  C     . TYR C 3 271 ? 8.592   71.114 19.290 1.00 7.91   ? 271 TYR A C     1 
ATOM   2319 O  O     . TYR C 3 271 ? 8.959   70.050 19.722 1.00 15.92  ? 271 TYR A O     1 
ATOM   2320 C  CB    . TYR C 3 271 ? 6.214   71.822 18.890 1.00 1.00   ? 271 TYR A CB    1 
ATOM   2321 C  CG    . TYR C 3 271 ? 6.340   70.720 17.987 1.00 1.00   ? 271 TYR A CG    1 
ATOM   2322 C  CD1   . TYR C 3 271 ? 5.897   69.438 18.295 1.00 4.10   ? 271 TYR A CD1   1 
ATOM   2323 C  CD2   . TYR C 3 271 ? 6.948   70.973 16.770 1.00 1.00   ? 271 TYR A CD2   1 
ATOM   2324 C  CE1   . TYR C 3 271 ? 6.062   68.396 17.388 1.00 5.53   ? 271 TYR A CE1   1 
ATOM   2325 C  CE2   . TYR C 3 271 ? 7.107   69.939 15.846 1.00 7.51   ? 271 TYR A CE2   1 
ATOM   2326 C  CZ    . TYR C 3 271 ? 6.665   68.655 16.158 1.00 10.70  ? 271 TYR A CZ    1 
ATOM   2327 O  OH    . TYR C 3 271 ? 6.849   67.676 15.220 1.00 16.82  ? 271 TYR A OH    1 
ATOM   2328 N  N     . PHE C 3 272 ? 9.306   71.671 18.367 1.00 5.00   ? 272 PHE A N     1 
ATOM   2329 C  CA    . PHE C 3 272 ? 10.483  71.011 17.863 1.00 5.46   ? 272 PHE A CA    1 
ATOM   2330 C  C     . PHE C 3 272 ? 11.602  70.874 18.867 1.00 11.00  ? 272 PHE A C     1 
ATOM   2331 O  O     . PHE C 3 272 ? 12.566  70.168 18.662 1.00 11.27  ? 272 PHE A O     1 
ATOM   2332 C  CB    . PHE C 3 272 ? 10.961  71.727 16.630 1.00 14.03  ? 272 PHE A CB    1 
ATOM   2333 C  CG    . PHE C 3 272 ? 11.185  70.744 15.520 1.00 16.73  ? 272 PHE A CG    1 
ATOM   2334 C  CD1   . PHE C 3 272 ? 10.505  69.535 15.517 1.00 11.96  ? 272 PHE A CD1   1 
ATOM   2335 C  CD2   . PHE C 3 272 ? 12.091  70.988 14.481 1.00 20.86  ? 272 PHE A CD2   1 
ATOM   2336 C  CE1   . PHE C 3 272 ? 10.727  68.614 14.493 1.00 13.55  ? 272 PHE A CE1   1 
ATOM   2337 C  CE2   . PHE C 3 272 ? 12.320  70.074 13.445 1.00 14.67  ? 272 PHE A CE2   1 
ATOM   2338 C  CZ    . PHE C 3 272 ? 11.625  68.870 13.456 1.00 11.55  ? 272 PHE A CZ    1 
ATOM   2339 N  N     . THR C 3 273 ? 11.549  71.584 19.987 1.00 14.38  ? 273 THR A N     1 
ATOM   2340 C  CA    . THR C 3 273 ? 12.630  71.431 20.930 1.00 12.79  ? 273 THR A CA    1 
ATOM   2341 C  C     . THR C 3 273 ? 12.392  70.185 21.777 1.00 16.62  ? 273 THR A C     1 
ATOM   2342 O  O     . THR C 3 273 ? 13.278  69.407 22.237 1.00 14.15  ? 273 THR A O     1 
ATOM   2343 C  CB    . THR C 3 273 ? 12.716  72.668 21.809 1.00 16.54  ? 273 THR A CB    1 
ATOM   2344 O  OG1   . THR C 3 273 ? 13.226  73.725 21.035 1.00 15.78  ? 273 THR A OG1   1 
ATOM   2345 C  CG2   . THR C 3 273 ? 13.705  72.428 22.932 1.00 19.93  ? 273 THR A CG2   1 
ATOM   2346 N  N     . GLY C 3 274 ? 11.129  69.962 22.008 1.00 20.33  ? 274 GLY A N     1 
ATOM   2347 C  CA    . GLY C 3 274 ? 10.843  68.821 22.807 1.00 17.62  ? 274 GLY A CA    1 
ATOM   2348 C  C     . GLY C 3 274 ? 11.306  69.214 24.175 1.00 16.34  ? 274 GLY A C     1 
ATOM   2349 O  O     . GLY C 3 274 ? 11.407  70.412 24.445 1.00 13.88  ? 274 GLY A O     1 
ATOM   2350 N  N     . SER C 3 275 ? 11.597  68.224 25.005 1.00 20.98  ? 275 SER A N     1 
ATOM   2351 C  CA    . SER C 3 275 ? 11.482  66.809 24.658 1.00 19.18  ? 275 SER A CA    1 
ATOM   2352 C  C     . SER C 3 275 ? 10.053  66.371 24.377 1.00 24.07  ? 275 SER A C     1 
ATOM   2353 O  O     . SER C 3 275 ? 9.071   67.102 24.575 1.00 23.90  ? 275 SER A O     1 
ATOM   2354 C  CB    . SER C 3 275 ? 11.987  65.972 25.786 1.00 10.97  ? 275 SER A CB    1 
ATOM   2355 O  OG    . SER C 3 275 ? 10.933  65.955 26.714 1.00 10.95  ? 275 SER A OG    1 
ATOM   2356 N  N     . ASP C 3 276 ? 9.935   65.135 23.906 1.00 23.31  ? 276 ASP A N     1 
ATOM   2357 C  CA    . ASP C 3 276 ? 8.622   64.630 23.614 1.00 23.37  ? 276 ASP A CA    1 
ATOM   2358 C  C     . ASP C 3 276 ? 7.791   64.506 24.879 1.00 21.87  ? 276 ASP A C     1 
ATOM   2359 O  O     . ASP C 3 276 ? 6.606   64.860 24.947 1.00 20.02  ? 276 ASP A O     1 
ATOM   2360 C  CB    . ASP C 3 276 ? 8.706   63.296 22.884 1.00 32.38  ? 276 ASP A CB    1 
ATOM   2361 C  CG    . ASP C 3 276 ? 9.629   62.365 23.580 1.00 41.15  ? 276 ASP A CG    1 
ATOM   2362 O  OD1   . ASP C 3 276 ? 10.731  62.720 23.963 1.00 46.12  ? 276 ASP A OD1   1 
ATOM   2363 O  OD2   . ASP C 3 276 ? 9.105   61.171 23.771 1.00 41.60  ? 276 ASP A OD2   1 
ATOM   2364 N  N     . ILE C 3 277 ? 8.426   63.989 25.909 1.00 19.73  ? 277 ILE A N     1 
ATOM   2365 C  CA    . ILE C 3 277 ? 7.710   63.837 27.138 1.00 22.29  ? 277 ILE A CA    1 
ATOM   2366 C  C     . ILE C 3 277 ? 7.254   65.189 27.645 1.00 16.58  ? 277 ILE A C     1 
ATOM   2367 O  O     . ILE C 3 277 ? 6.126   65.364 28.163 1.00 20.52  ? 277 ILE A O     1 
ATOM   2368 C  CB    . ILE C 3 277 ? 8.592   63.270 28.223 1.00 32.16  ? 277 ILE A CB    1 
ATOM   2369 C  CG1   . ILE C 3 277 ? 9.414   62.053 27.763 1.00 38.05  ? 277 ILE A CG1   1 
ATOM   2370 C  CG2   . ILE C 3 277 ? 7.735   62.995 29.464 1.00 30.46  ? 277 ILE A CG2   1 
ATOM   2371 C  CD1   . ILE C 3 277 ? 8.572   60.812 27.506 1.00 40.60  ? 277 ILE A CD1   1 
ATOM   2372 N  N     . PHE C 3 278 ? 8.163   66.130 27.503 1.00 5.39   ? 278 PHE A N     1 
ATOM   2373 C  CA    . PHE C 3 278 ? 7.896   67.458 27.942 1.00 3.18   ? 278 PHE A CA    1 
ATOM   2374 C  C     . PHE C 3 278 ? 6.645   67.939 27.286 1.00 2.35   ? 278 PHE A C     1 
ATOM   2375 O  O     . PHE C 3 278 ? 5.689   68.276 27.982 1.00 1.00   ? 278 PHE A O     1 
ATOM   2376 C  CB    . PHE C 3 278 ? 9.107   68.358 27.671 1.00 3.67   ? 278 PHE A CB    1 
ATOM   2377 C  CG    . PHE C 3 278 ? 8.864   69.803 27.969 1.00 1.59   ? 278 PHE A CG    1 
ATOM   2378 C  CD1   . PHE C 3 278 ? 8.704   70.255 29.275 1.00 7.65   ? 278 PHE A CD1   1 
ATOM   2379 C  CD2   . PHE C 3 278 ? 8.797   70.749 26.955 1.00 4.57   ? 278 PHE A CD2   1 
ATOM   2380 C  CE1   . PHE C 3 278 ? 8.483   71.609 29.537 1.00 13.17  ? 278 PHE A CE1   1 
ATOM   2381 C  CE2   . PHE C 3 278 ? 8.567   72.102 27.192 1.00 11.22  ? 278 PHE A CE2   1 
ATOM   2382 C  CZ    . PHE C 3 278 ? 8.412   72.545 28.500 1.00 13.34  ? 278 PHE A CZ    1 
ATOM   2383 N  N     . ASN C 3 279 ? 6.658   67.906 25.951 1.00 1.00   ? 279 ASN A N     1 
ATOM   2384 C  CA    . ASN C 3 279 ? 5.511   68.325 25.164 1.00 2.69   ? 279 ASN A CA    1 
ATOM   2385 C  C     . ASN C 3 279 ? 4.254   67.645 25.665 1.00 6.44   ? 279 ASN A C     1 
ATOM   2386 O  O     . ASN C 3 279 ? 3.180   68.251 25.839 1.00 7.66   ? 279 ASN A O     1 
ATOM   2387 C  CB    . ASN C 3 279 ? 5.688   67.996 23.673 1.00 1.26   ? 279 ASN A CB    1 
ATOM   2388 C  CG    . ASN C 3 279 ? 6.716   68.894 23.031 1.00 10.40  ? 279 ASN A CG    1 
ATOM   2389 O  OD1   . ASN C 3 279 ? 7.533   68.518 22.194 1.00 1.00   ? 279 ASN A OD1   1 
ATOM   2390 N  ND2   . ASN C 3 279 ? 6.638   70.164 23.391 1.00 22.69  ? 279 ASN A ND2   1 
ATOM   2391 N  N     . LYS C 3 280 ? 4.393   66.351 25.901 1.00 9.65   ? 280 LYS A N     1 
ATOM   2392 C  CA    . LYS C 3 280 ? 3.229   65.626 26.364 1.00 19.72  ? 280 LYS A CA    1 
ATOM   2393 C  C     . LYS C 3 280 ? 2.686   66.166 27.637 1.00 16.15  ? 280 LYS A C     1 
ATOM   2394 O  O     . LYS C 3 280 ? 1.504   66.409 27.734 1.00 17.13  ? 280 LYS A O     1 
ATOM   2395 C  CB    . LYS C 3 280 ? 3.330   64.100 26.322 1.00 28.26  ? 280 LYS A CB    1 
ATOM   2396 N  N     . ASN C 3 281 ? 3.566   66.357 28.601 1.00 14.42  ? 281 ASN A N     1 
ATOM   2397 C  CA    . ASN C 3 281 ? 3.079   66.886 29.831 1.00 13.93  ? 281 ASN A CA    1 
ATOM   2398 C  C     . ASN C 3 281 ? 2.469   68.258 29.575 1.00 15.38  ? 281 ASN A C     1 
ATOM   2399 O  O     . ASN C 3 281 ? 1.300   68.503 29.860 1.00 18.38  ? 281 ASN A O     1 
ATOM   2400 C  CB    . ASN C 3 281 ? 4.209   66.909 30.846 1.00 10.77  ? 281 ASN A CB    1 
ATOM   2401 C  CG    . ASN C 3 281 ? 4.548   65.495 31.209 1.00 14.70  ? 281 ASN A CG    1 
ATOM   2402 O  OD1   . ASN C 3 281 ? 5.541   65.202 31.910 1.00 15.81  ? 281 ASN A OD1   1 
ATOM   2403 N  ND2   . ASN C 3 281 ? 3.651   64.610 30.804 1.00 18.72  ? 281 ASN A ND2   1 
ATOM   2404 N  N     . MET C 3 282 ? 3.283   69.120 29.001 1.00 10.07  ? 282 MET A N     1 
ATOM   2405 C  CA    . MET C 3 282 ? 2.844   70.420 28.707 1.00 6.66   ? 282 MET A CA    1 
ATOM   2406 C  C     . MET C 3 282 ? 1.549   70.486 27.956 1.00 11.04  ? 282 MET A C     1 
ATOM   2407 O  O     . MET C 3 282 ? 0.632   71.110 28.487 1.00 12.43  ? 282 MET A O     1 
ATOM   2408 C  CB    . MET C 3 282 ? 3.816   71.174 27.837 1.00 9.87   ? 282 MET A CB    1 
ATOM   2409 C  CG    . MET C 3 282 ? 3.356   72.620 27.778 1.00 15.67  ? 282 MET A CG    1 
ATOM   2410 S  SD    . MET C 3 282 ? 4.609   73.863 27.363 1.00 17.91  ? 282 MET A SD    1 
ATOM   2411 C  CE    . MET C 3 282 ? 4.607   73.405 25.622 1.00 13.69  ? 282 MET A CE    1 
ATOM   2412 N  N     . ARG C 3 283 ? 1.456   69.855 26.759 1.00 10.41  ? 283 ARG A N     1 
ATOM   2413 C  CA    . ARG C 3 283 ? 0.191   69.947 26.020 1.00 8.40   ? 283 ARG A CA    1 
ATOM   2414 C  C     . ARG C 3 283 ? -0.967  69.512 26.819 1.00 12.82  ? 283 ARG A C     1 
ATOM   2415 O  O     . ARG C 3 283 ? -2.046  70.137 26.797 1.00 13.95  ? 283 ARG A O     1 
ATOM   2416 C  CB    . ARG C 3 283 ? 0.099   69.361 24.643 1.00 7.33   ? 283 ARG A CB    1 
ATOM   2417 C  CG    . ARG C 3 283 ? 1.404   69.302 23.868 1.00 8.46   ? 283 ARG A CG    1 
ATOM   2418 C  CD    . ARG C 3 283 ? 1.168   68.855 22.433 1.00 6.29   ? 283 ARG A CD    1 
ATOM   2419 N  NE    . ARG C 3 283 ? 1.885   69.702 21.554 1.00 6.71   ? 283 ARG A NE    1 
ATOM   2420 C  CZ    . ARG C 3 283 ? 1.815   69.673 20.245 1.00 11.14  ? 283 ARG A CZ    1 
ATOM   2421 N  NH1   . ARG C 3 283 ? 1.033   68.803 19.615 1.00 14.32  ? 283 ARG A NH1   1 
ATOM   2422 N  NH2   . ARG C 3 283 ? 2.578   70.549 19.571 1.00 12.33  ? 283 ARG A NH2   1 
ATOM   2423 N  N     . ALA C 3 284 ? -0.682  68.419 27.511 1.00 16.83  ? 284 ALA A N     1 
ATOM   2424 C  CA    . ALA C 3 284 ? -1.630  67.772 28.383 1.00 22.24  ? 284 ALA A CA    1 
ATOM   2425 C  C     . ALA C 3 284 ? -2.178  68.761 29.399 1.00 24.97  ? 284 ALA A C     1 
ATOM   2426 O  O     . ALA C 3 284 ? -3.361  68.791 29.749 1.00 23.68  ? 284 ALA A O     1 
ATOM   2427 C  CB    . ALA C 3 284 ? -0.903  66.711 29.159 1.00 21.65  ? 284 ALA A CB    1 
ATOM   2428 N  N     . HIS C 3 285 ? -1.262  69.566 29.871 1.00 25.64  ? 285 HIS A N     1 
ATOM   2429 C  CA    . HIS C 3 285 ? -1.579  70.560 30.842 1.00 29.78  ? 285 HIS A CA    1 
ATOM   2430 C  C     . HIS C 3 285 ? -2.437  71.710 30.366 1.00 19.43  ? 285 HIS A C     1 
ATOM   2431 O  O     . HIS C 3 285 ? -3.339  72.136 31.075 1.00 22.66  ? 285 HIS A O     1 
ATOM   2432 C  CB    . HIS C 3 285 ? -0.322  71.026 31.593 1.00 42.54  ? 285 HIS A CB    1 
ATOM   2433 C  CG    . HIS C 3 285 ? -0.607  71.920 32.766 1.00 54.31  ? 285 HIS A CG    1 
ATOM   2434 N  ND1   . HIS C 3 285 ? -1.740  71.781 33.547 1.00 58.06  ? 285 HIS A ND1   1 
ATOM   2435 C  CD2   . HIS C 3 285 ? 0.121   72.947 33.281 1.00 59.42  ? 285 HIS A CD2   1 
ATOM   2436 C  CE1   . HIS C 3 285 ? -1.674  72.719 34.493 1.00 60.36  ? 285 HIS A CE1   1 
ATOM   2437 N  NE2   . HIS C 3 285 ? -0.565  73.439 34.367 1.00 60.23  ? 285 HIS A NE2   1 
ATOM   2438 N  N     . ALA C 3 286 ? -2.142  72.187 29.199 1.00 10.80  ? 286 ALA A N     1 
ATOM   2439 C  CA    . ALA C 3 286 ? -2.862  73.297 28.643 1.00 16.79  ? 286 ALA A CA    1 
ATOM   2440 C  C     . ALA C 3 286 ? -4.321  73.116 28.724 1.00 21.20  ? 286 ALA A C     1 
ATOM   2441 O  O     . ALA C 3 286 ? -5.104  74.042 28.837 1.00 21.44  ? 286 ALA A O     1 
ATOM   2442 C  CB    . ALA C 3 286 ? -2.519  73.384 27.187 1.00 22.37  ? 286 ALA A CB    1 
ATOM   2443 N  N     . LEU C 3 287 ? -4.634  71.853 28.622 1.00 26.43  ? 287 LEU A N     1 
ATOM   2444 C  CA    . LEU C 3 287 ? -5.982  71.389 28.657 1.00 29.34  ? 287 LEU A CA    1 
ATOM   2445 C  C     . LEU C 3 287 ? -6.596  71.529 30.046 1.00 32.69  ? 287 LEU A C     1 
ATOM   2446 O  O     . LEU C 3 287 ? -7.726  72.010 30.221 1.00 34.54  ? 287 LEU A O     1 
ATOM   2447 C  CB    . LEU C 3 287 ? -6.052  69.951 28.126 1.00 29.89  ? 287 LEU A CB    1 
ATOM   2448 C  CG    . LEU C 3 287 ? -6.045  69.839 26.613 1.00 37.54  ? 287 LEU A CG    1 
ATOM   2449 C  CD1   . LEU C 3 287 ? -4.915  70.653 25.965 1.00 40.56  ? 287 LEU A CD1   1 
ATOM   2450 C  CD2   . LEU C 3 287 ? -5.846  68.375 26.273 1.00 39.76  ? 287 LEU A CD2   1 
ATOM   2451 N  N     . GLU C 3 288 ? -5.823  71.102 31.033 1.00 33.03  ? 288 GLU A N     1 
ATOM   2452 C  CA    . GLU C 3 288 ? -6.233  71.148 32.388 1.00 35.53  ? 288 GLU A CA    1 
ATOM   2453 C  C     . GLU C 3 288 ? -6.598  72.533 32.685 1.00 38.90  ? 288 GLU A C     1 
ATOM   2454 O  O     . GLU C 3 288 ? -7.471  72.765 33.504 1.00 44.44  ? 288 GLU A O     1 
ATOM   2455 C  CB    . GLU C 3 288 ? -5.146  70.698 33.330 1.00 41.23  ? 288 GLU A CB    1 
ATOM   2456 C  CG    . GLU C 3 288 ? -5.730  70.391 34.699 1.00 50.11  ? 288 GLU A CG    1 
ATOM   2457 C  CD    . GLU C 3 288 ? -4.934  69.327 35.381 1.00 60.60  ? 288 GLU A CD    1 
ATOM   2458 O  OE1   . GLU C 3 288 ? -3.643  69.547 35.343 1.00 63.70  ? 288 GLU A OE1   1 
ATOM   2459 O  OE2   . GLU C 3 288 ? -5.440  68.343 35.875 1.00 65.10  ? 288 GLU A OE2   1 
ATOM   2460 N  N     . LYS C 3 289 ? -5.914  73.417 31.963 1.00 36.91  ? 289 LYS A N     1 
ATOM   2461 C  CA    . LYS C 3 289 ? -6.110  74.846 32.058 1.00 36.69  ? 289 LYS A CA    1 
ATOM   2462 C  C     . LYS C 3 289 ? -7.137  75.401 31.052 1.00 32.16  ? 289 LYS A C     1 
ATOM   2463 O  O     . LYS C 3 289 ? -7.546  76.550 31.153 1.00 38.57  ? 289 LYS A O     1 
ATOM   2464 C  CB    . LYS C 3 289 ? -4.811  75.657 32.082 1.00 35.12  ? 289 LYS A CB    1 
ATOM   2465 C  CG    . LYS C 3 289 ? -3.952  75.370 33.311 1.00 36.86  ? 289 LYS A CG    1 
ATOM   2466 C  CD    . LYS C 3 289 ? -4.447  76.056 34.575 1.00 41.74  ? 289 LYS A CD    1 
ATOM   2467 C  CE    . LYS C 3 289 ? -3.900  75.526 35.908 1.00 41.56  ? 289 LYS A CE    1 
ATOM   2468 N  NZ    . LYS C 3 289 ? -2.431  75.480 36.002 1.00 40.62  ? 289 LYS A NZ    1 
ATOM   2469 N  N     . GLY C 3 290 ? -7.585  74.639 30.073 1.00 21.02  ? 290 GLY A N     1 
ATOM   2470 C  CA    . GLY C 3 290 ? -8.557  75.224 29.157 1.00 17.98  ? 290 GLY A CA    1 
ATOM   2471 C  C     . GLY C 3 290 ? -8.047  75.660 27.772 1.00 20.99  ? 290 GLY A C     1 
ATOM   2472 O  O     . GLY C 3 290 ? -8.792  76.276 26.985 1.00 22.69  ? 290 GLY A O     1 
ATOM   2473 N  N     . PHE C 3 291 ? -6.805  75.360 27.428 1.00 21.43  ? 291 PHE A N     1 
ATOM   2474 C  CA    . PHE C 3 291 ? -6.326  75.751 26.105 1.00 23.43  ? 291 PHE A CA    1 
ATOM   2475 C  C     . PHE C 3 291 ? -5.735  74.531 25.501 1.00 17.74  ? 291 PHE A C     1 
ATOM   2476 O  O     . PHE C 3 291 ? -5.411  73.636 26.260 1.00 3.73   ? 291 PHE A O     1 
ATOM   2477 C  CB    . PHE C 3 291 ? -5.159  76.726 26.091 1.00 26.02  ? 291 PHE A CB    1 
ATOM   2478 C  CG    . PHE C 3 291 ? -5.257  77.860 27.050 1.00 30.21  ? 291 PHE A CG    1 
ATOM   2479 C  CD1   . PHE C 3 291 ? -4.981  77.655 28.406 1.00 31.94  ? 291 PHE A CD1   1 
ATOM   2480 C  CD2   . PHE C 3 291 ? -5.591  79.134 26.590 1.00 28.75  ? 291 PHE A CD2   1 
ATOM   2481 C  CE1   . PHE C 3 291 ? -5.040  78.702 29.323 1.00 32.86  ? 291 PHE A CE1   1 
ATOM   2482 C  CE2   . PHE C 3 291 ? -5.664  80.191 27.492 1.00 32.20  ? 291 PHE A CE2   1 
ATOM   2483 C  CZ    . PHE C 3 291 ? -5.390  79.969 28.847 1.00 35.63  ? 291 PHE A CZ    1 
ATOM   2484 N  N     . THR C 3 292 ? -5.592  74.527 24.164 1.00 18.55  ? 292 THR A N     1 
ATOM   2485 C  CA    . THR C 3 292 ? -5.014  73.393 23.447 1.00 20.34  ? 292 THR A CA    1 
ATOM   2486 C  C     . THR C 3 292 ? -3.859  73.865 22.578 1.00 17.51  ? 292 THR A C     1 
ATOM   2487 O  O     . THR C 3 292 ? -4.088  74.766 21.773 1.00 15.42  ? 292 THR A O     1 
ATOM   2488 C  CB    . THR C 3 292 ? -6.060  72.620 22.612 1.00 23.26  ? 292 THR A CB    1 
ATOM   2489 O  OG1   . THR C 3 292 ? -5.427  71.717 21.736 1.00 30.08  ? 292 THR A OG1   1 
ATOM   2490 C  CG2   . THR C 3 292 ? -6.795  73.590 21.741 1.00 25.74  ? 292 THR A CG2   1 
ATOM   2491 N  N     . ILE C 3 293 ? -2.646  73.257 22.766 1.00 15.28  ? 293 ILE A N     1 
ATOM   2492 C  CA    . ILE C 3 293 ? -1.424  73.605 22.010 1.00 16.69  ? 293 ILE A CA    1 
ATOM   2493 C  C     . ILE C 3 293 ? -0.884  72.621 20.963 1.00 13.58  ? 293 ILE A C     1 
ATOM   2494 O  O     . ILE C 3 293 ? -0.693  71.448 21.273 1.00 18.92  ? 293 ILE A O     1 
ATOM   2495 C  CB    . ILE C 3 293 ? -0.247  73.759 22.929 1.00 17.18  ? 293 ILE A CB    1 
ATOM   2496 C  CG1   . ILE C 3 293 ? -0.372  74.952 23.844 1.00 16.35  ? 293 ILE A CG1   1 
ATOM   2497 C  CG2   . ILE C 3 293 ? 1.038   73.838 22.120 1.00 12.42  ? 293 ILE A CG2   1 
ATOM   2498 C  CD1   . ILE C 3 293 ? 0.722   74.876 24.901 1.00 15.19  ? 293 ILE A CD1   1 
ATOM   2499 N  N     . ASN C 3 294 ? -0.601  73.146 19.752 1.00 6.11   ? 294 ASN A N     1 
ATOM   2500 C  CA    . ASN C 3 294 ? -0.051  72.432 18.603 1.00 8.32   ? 294 ASN A CA    1 
ATOM   2501 C  C     . ASN C 3 294 ? 1.171   73.210 18.073 1.00 6.75   ? 294 ASN A C     1 
ATOM   2502 O  O     . ASN C 3 294 ? 1.454   74.306 18.481 1.00 11.29  ? 294 ASN A O     1 
ATOM   2503 C  CB    . ASN C 3 294 ? -1.063  72.052 17.504 1.00 11.35  ? 294 ASN A CB    1 
ATOM   2504 C  CG    . ASN C 3 294 ? -1.730  73.290 17.040 1.00 16.44  ? 294 ASN A CG    1 
ATOM   2505 O  OD1   . ASN C 3 294 ? -1.135  74.098 16.308 1.00 20.73  ? 294 ASN A OD1   1 
ATOM   2506 N  ND2   . ASN C 3 294 ? -2.798  73.584 17.741 1.00 17.47  ? 294 ASN A ND2   1 
ATOM   2507 N  N     . GLU C 3 295 ? 1.914   72.656 17.164 1.00 2.51   ? 295 GLU A N     1 
ATOM   2508 C  CA    . GLU C 3 295 ? 3.075   73.294 16.645 1.00 4.14   ? 295 GLU A CA    1 
ATOM   2509 C  C     . GLU C 3 295 ? 2.815   74.656 16.052 1.00 5.51   ? 295 GLU A C     1 
ATOM   2510 O  O     . GLU C 3 295 ? 3.715   75.439 15.688 1.00 1.00   ? 295 GLU A O     1 
ATOM   2511 C  CB    . GLU C 3 295 ? 3.648   72.353 15.575 1.00 6.08   ? 295 GLU A CB    1 
ATOM   2512 C  CG    . GLU C 3 295 ? 2.569   71.777 14.638 1.00 8.80   ? 295 GLU A CG    1 
ATOM   2513 C  CD    . GLU C 3 295 ? 2.135   70.401 15.075 1.00 25.87  ? 295 GLU A CD    1 
ATOM   2514 O  OE1   . GLU C 3 295 ? 1.554   70.148 16.132 1.00 29.85  ? 295 GLU A OE1   1 
ATOM   2515 O  OE2   . GLU C 3 295 ? 2.511   69.443 14.239 1.00 35.26  ? 295 GLU A OE2   1 
ATOM   2516 N  N     . TYR C 3 296 ? 1.559   74.953 15.920 1.00 3.59   ? 296 TYR A N     1 
ATOM   2517 C  CA    . TYR C 3 296 ? 1.290   76.215 15.329 1.00 5.29   ? 296 TYR A CA    1 
ATOM   2518 C  C     . TYR C 3 296 ? 0.777   77.246 16.241 1.00 16.45  ? 296 TYR A C     1 
ATOM   2519 O  O     . TYR C 3 296 ? 1.212   78.394 16.187 1.00 25.18  ? 296 TYR A O     1 
ATOM   2520 C  CB    . TYR C 3 296 ? 0.146   75.957 14.384 1.00 8.81   ? 296 TYR A CB    1 
ATOM   2521 C  CG    . TYR C 3 296 ? 0.482   74.943 13.307 1.00 13.41  ? 296 TYR A CG    1 
ATOM   2522 C  CD1   . TYR C 3 296 ? 1.586   75.094 12.474 1.00 14.74  ? 296 TYR A CD1   1 
ATOM   2523 C  CD2   . TYR C 3 296 ? -0.300  73.814 13.097 1.00 16.72  ? 296 TYR A CD2   1 
ATOM   2524 C  CE1   . TYR C 3 296 ? 1.890   74.166 11.476 1.00 16.05  ? 296 TYR A CE1   1 
ATOM   2525 C  CE2   . TYR C 3 296 ? -0.011  72.874 12.102 1.00 17.50  ? 296 TYR A CE2   1 
ATOM   2526 C  CZ    . TYR C 3 296 ? 1.094   73.040 11.274 1.00 16.15  ? 296 TYR A CZ    1 
ATOM   2527 O  OH    . TYR C 3 296 ? 1.389   72.112 10.287 1.00 15.62  ? 296 TYR A OH    1 
ATOM   2528 N  N     . THR C 3 297 ? -0.175  76.844 17.089 1.00 19.86  ? 297 THR A N     1 
ATOM   2529 C  CA    . THR C 3 297 ? -0.789  77.781 18.009 1.00 22.12  ? 297 THR A CA    1 
ATOM   2530 C  C     . THR C 3 297 ? -1.219  77.264 19.366 1.00 22.81  ? 297 THR A C     1 
ATOM   2531 O  O     . THR C 3 297 ? -1.111  76.077 19.691 1.00 28.79  ? 297 THR A O     1 
ATOM   2532 C  CB    . THR C 3 297 ? -2.175  78.012 17.361 1.00 24.83  ? 297 THR A CB    1 
ATOM   2533 O  OG1   . THR C 3 297 ? -2.993  76.858 17.635 1.00 25.55  ? 297 THR A OG1   1 
ATOM   2534 C  CG2   . THR C 3 297 ? -2.039  78.191 15.849 1.00 22.28  ? 297 THR A CG2   1 
ATOM   2535 N  N     . ILE C 3 298 ? -1.758  78.231 20.135 1.00 13.88  ? 298 ILE A N     1 
ATOM   2536 C  CA    . ILE C 3 298 ? -2.298  77.999 21.452 1.00 9.80   ? 298 ILE A CA    1 
ATOM   2537 C  C     . ILE C 3 298 ? -3.531  78.777 21.425 1.00 15.66  ? 298 ILE A C     1 
ATOM   2538 O  O     . ILE C 3 298 ? -3.460  79.981 21.339 1.00 22.37  ? 298 ILE A O     1 
ATOM   2539 C  CB    . ILE C 3 298 ? -1.466  78.270 22.666 1.00 8.39   ? 298 ILE A CB    1 
ATOM   2540 C  CG1   . ILE C 3 298 ? -2.344  78.529 23.839 1.00 1.00   ? 298 ILE A CG1   1 
ATOM   2541 C  CG2   . ILE C 3 298 ? -0.418  79.358 22.481 1.00 15.38  ? 298 ILE A CG2   1 
ATOM   2542 C  CD1   . ILE C 3 298 ? -1.636  78.111 25.096 1.00 1.00   ? 298 ILE A CD1   1 
ATOM   2543 N  N     . ARG C 3 299 ? -4.659  78.088 21.445 1.00 14.62  ? 299 ARG A N     1 
ATOM   2544 C  CA    . ARG C 3 299 ? -5.880  78.798 21.383 1.00 17.77  ? 299 ARG A CA    1 
ATOM   2545 C  C     . ARG C 3 299 ? -6.788  78.243 22.378 1.00 24.65  ? 299 ARG A C     1 
ATOM   2546 O  O     . ARG C 3 299 ? -6.857  77.057 22.529 1.00 23.69  ? 299 ARG A O     1 
ATOM   2547 C  CB    . ARG C 3 299 ? -6.465  78.758 20.014 1.00 20.33  ? 299 ARG A CB    1 
ATOM   2548 C  CG    . ARG C 3 299 ? -6.804  77.367 19.607 1.00 33.41  ? 299 ARG A CG    1 
ATOM   2549 C  CD    . ARG C 3 299 ? -7.041  77.343 18.107 1.00 44.79  ? 299 ARG A CD    1 
ATOM   2550 N  NE    . ARG C 3 299 ? -7.089  76.009 17.521 1.00 49.24  ? 299 ARG A NE    1 
ATOM   2551 C  CZ    . ARG C 3 299 ? -6.182  75.073 17.775 1.00 52.22  ? 299 ARG A CZ    1 
ATOM   2552 N  NH1   . ARG C 3 299 ? -5.156  75.301 18.615 1.00 51.80  ? 299 ARG A NH1   1 
ATOM   2553 N  NH2   . ARG C 3 299 ? -6.312  73.874 17.168 1.00 53.72  ? 299 ARG A NH2   1 
ATOM   2554 N  N     . PRO C 3 300 ? -7.444  79.159 23.054 1.00 34.46  ? 300 PRO A N     1 
ATOM   2555 C  CA    . PRO C 3 300 ? -8.342  78.850 24.083 1.00 38.30  ? 300 PRO A CA    1 
ATOM   2556 C  C     . PRO C 3 300 ? -9.292  77.826 23.622 1.00 41.63  ? 300 PRO A C     1 
ATOM   2557 O  O     . PRO C 3 300 ? -9.831  77.842 22.502 1.00 42.13  ? 300 PRO A O     1 
ATOM   2558 C  CB    . PRO C 3 300 ? -9.132  80.104 24.327 1.00 37.98  ? 300 PRO A CB    1 
ATOM   2559 C  CG    . PRO C 3 300 ? -9.311  80.630 22.914 1.00 40.91  ? 300 PRO A CG    1 
ATOM   2560 C  CD    . PRO C 3 300 ? -8.161  80.047 22.119 1.00 38.31  ? 300 PRO A CD    1 
ATOM   2561 N  N     . LEU C 3 301 ? -9.441  76.928 24.550 1.00 45.92  ? 301 LEU A N     1 
ATOM   2562 C  CA    . LEU C 3 301 ? -10.320 76.007 24.175 1.00 51.16  ? 301 LEU A CA    1 
ATOM   2563 C  C     . LEU C 3 301 ? -11.698 76.046 24.917 1.00 63.76  ? 301 LEU A C     1 
ATOM   2564 O  O     . LEU C 3 301 ? -11.900 75.913 26.134 1.00 60.43  ? 301 LEU A O     1 
ATOM   2565 C  CB    . LEU C 3 301 ? -10.076 74.633 23.484 1.00 41.24  ? 301 LEU A CB    1 
ATOM   2566 C  CG    . LEU C 3 301 ? -10.486 73.446 24.316 1.00 30.40  ? 301 LEU A CG    1 
ATOM   2567 C  CD1   . LEU C 3 301 ? -9.888  72.169 23.753 1.00 26.55  ? 301 LEU A CD1   1 
ATOM   2568 C  CD2   . LEU C 3 301 ? -10.069 73.686 25.771 1.00 27.47  ? 301 LEU A CD2   1 
ATOM   2569 N  N     . GLY C 3 302 ? -12.580 76.383 23.960 1.00 77.62  ? 302 GLY A N     1 
ATOM   2570 C  CA    . GLY C 3 302 ? -13.992 76.664 24.168 1.00 88.10  ? 302 GLY A CA    1 
ATOM   2571 C  C     . GLY C 3 302 ? -14.723 75.666 25.054 1.00 97.35  ? 302 GLY A C     1 
ATOM   2572 O  O     . GLY C 3 302 ? -14.422 74.468 25.087 1.00 100.00 ? 302 GLY A O     1 
ATOM   2573 N  N     . VAL C 3 303 ? -15.704 76.235 25.767 1.00 100.00 ? 303 VAL A N     1 
ATOM   2574 C  CA    . VAL C 3 303 ? -16.604 75.580 26.717 1.00 100.00 ? 303 VAL A CA    1 
ATOM   2575 C  C     . VAL C 3 303 ? -17.266 74.328 26.139 1.00 100.00 ? 303 VAL A C     1 
ATOM   2576 O  O     . VAL C 3 303 ? -17.330 73.279 26.799 1.00 99.63  ? 303 VAL A O     1 
ATOM   2577 C  CB    . VAL C 3 303 ? -17.593 76.615 27.268 1.00 100.00 ? 303 VAL A CB    1 
ATOM   2578 C  CG1   . VAL C 3 303 ? -18.379 77.284 26.129 1.00 100.00 ? 303 VAL A CG1   1 
ATOM   2579 C  CG2   . VAL C 3 303 ? -18.505 75.995 28.327 1.00 100.00 ? 303 VAL A CG2   1 
ATOM   2580 N  N     . THR C 3 304 ? -17.750 74.466 24.891 1.00 100.00 ? 304 THR A N     1 
ATOM   2581 C  CA    . THR C 3 304 ? -18.395 73.397 24.159 1.00 99.77  ? 304 THR A CA    1 
ATOM   2582 C  C     . THR C 3 304 ? -17.375 72.284 23.948 1.00 99.02  ? 304 THR A C     1 
ATOM   2583 O  O     . THR C 3 304 ? -17.692 71.099 24.029 1.00 99.23  ? 304 THR A O     1 
ATOM   2584 C  CB    . THR C 3 304 ? -18.865 73.929 22.794 1.00 99.49  ? 304 THR A CB    1 
ATOM   2585 O  OG1   . THR C 3 304 ? -19.337 72.881 21.979 1.00 98.58  ? 304 THR A OG1   1 
ATOM   2586 C  CG2   . THR C 3 304 ? -17.707 74.633 22.101 1.00 100.00 ? 304 THR A CG2   1 
ATOM   2587 N  N     . GLY C 3 305 ? -16.131 72.721 23.689 1.00 97.00  ? 305 GLY A N     1 
ATOM   2588 C  CA    . GLY C 3 305 ? -14.960 71.875 23.448 1.00 90.68  ? 305 GLY A CA    1 
ATOM   2589 C  C     . GLY C 3 305 ? -14.345 72.057 22.055 1.00 82.29  ? 305 GLY A C     1 
ATOM   2590 O  O     . GLY C 3 305 ? -13.754 71.118 21.534 1.00 84.52  ? 305 GLY A O     1 
ATOM   2591 N  N     . VAL C 3 306 ? -14.509 73.266 21.477 1.00 71.74  ? 306 VAL A N     1 
ATOM   2592 C  CA    . VAL C 3 306 ? -14.030 73.713 20.155 1.00 64.36  ? 306 VAL A CA    1 
ATOM   2593 C  C     . VAL C 3 306 ? -12.979 74.811 20.277 1.00 51.12  ? 306 VAL A C     1 
ATOM   2594 O  O     . VAL C 3 306 ? -13.062 75.655 21.148 1.00 54.48  ? 306 VAL A O     1 
ATOM   2595 C  CB    . VAL C 3 306 ? -15.185 74.323 19.394 1.00 74.53  ? 306 VAL A CB    1 
ATOM   2596 C  CG1   . VAL C 3 306 ? -14.655 75.390 18.458 1.00 77.87  ? 306 VAL A CG1   1 
ATOM   2597 C  CG2   . VAL C 3 306 ? -15.924 73.269 18.593 1.00 79.14  ? 306 VAL A CG2   1 
ATOM   2598 N  N     . ALA C 3 307 ? -11.991 74.841 19.401 1.00 38.44  ? 307 ALA A N     1 
ATOM   2599 C  CA    . ALA C 3 307 ? -10.945 75.866 19.497 1.00 35.22  ? 307 ALA A CA    1 
ATOM   2600 C  C     . ALA C 3 307 ? -11.227 77.303 19.230 1.00 29.16  ? 307 ALA A C     1 
ATOM   2601 O  O     . ALA C 3 307 ? -11.532 77.672 18.112 1.00 29.44  ? 307 ALA A O     1 
ATOM   2602 C  CB    . ALA C 3 307 ? -9.828  75.538 18.558 1.00 43.55  ? 307 ALA A CB    1 
ATOM   2603 N  N     . GLY C 3 308 ? -11.075 78.137 20.234 1.00 23.52  ? 308 GLY A N     1 
ATOM   2604 C  CA    . GLY C 3 308 ? -11.324 79.569 20.026 1.00 21.49  ? 308 GLY A CA    1 
ATOM   2605 C  C     . GLY C 3 308 ? -10.225 80.179 19.182 1.00 26.21  ? 308 GLY A C     1 
ATOM   2606 O  O     . GLY C 3 308 ? -9.333  79.470 18.703 1.00 26.08  ? 308 GLY A O     1 
ATOM   2607 N  N     . GLU C 3 309 ? -10.285 81.498 18.978 1.00 28.94  ? 309 GLU A N     1 
ATOM   2608 C  CA    . GLU C 3 309 ? -9.264  82.175 18.173 1.00 29.95  ? 309 GLU A CA    1 
ATOM   2609 C  C     . GLU C 3 309 ? -7.899  81.997 18.852 1.00 28.53  ? 309 GLU A C     1 
ATOM   2610 O  O     . GLU C 3 309 ? -7.821  81.903 20.082 1.00 31.48  ? 309 GLU A O     1 
ATOM   2611 C  CB    . GLU C 3 309 ? -9.621  83.656 17.990 1.00 36.32  ? 309 GLU A CB    1 
ATOM   2612 C  CG    . GLU C 3 309 ? -10.875 83.855 17.114 1.00 46.40  ? 309 GLU A CG    1 
ATOM   2613 C  CD    . GLU C 3 309 ? -10.606 83.623 15.638 1.00 55.02  ? 309 GLU A CD    1 
ATOM   2614 O  OE1   . GLU C 3 309 ? -9.471  84.168 15.212 1.00 58.03  ? 309 GLU A OE1   1 
ATOM   2615 O  OE2   . GLU C 3 309 ? -11.353 82.970 14.910 1.00 59.34  ? 309 GLU A OE2   1 
ATOM   2616 N  N     . PRO C 3 310 ? -6.812  81.958 18.083 1.00 21.75  ? 310 PRO A N     1 
ATOM   2617 C  CA    . PRO C 3 310 ? -5.486  81.765 18.641 1.00 16.71  ? 310 PRO A CA    1 
ATOM   2618 C  C     . PRO C 3 310 ? -4.811  82.932 19.257 1.00 19.57  ? 310 PRO A C     1 
ATOM   2619 O  O     . PRO C 3 310 ? -4.540  83.923 18.588 1.00 27.28  ? 310 PRO A O     1 
ATOM   2620 C  CB    . PRO C 3 310 ? -4.612  81.390 17.454 1.00 15.71  ? 310 PRO A CB    1 
ATOM   2621 C  CG    . PRO C 3 310 ? -5.302  81.910 16.212 1.00 13.45  ? 310 PRO A CG    1 
ATOM   2622 C  CD    . PRO C 3 310 ? -6.745  82.154 16.608 1.00 18.47  ? 310 PRO A CD    1 
ATOM   2623 N  N     . LEU C 3 311 ? -4.504  82.794 20.526 1.00 19.14  ? 311 LEU A N     1 
ATOM   2624 C  CA    . LEU C 3 311 ? -3.821  83.838 21.272 1.00 13.87  ? 311 LEU A CA    1 
ATOM   2625 C  C     . LEU C 3 311 ? -2.485  84.087 20.700 1.00 11.86  ? 311 LEU A C     1 
ATOM   2626 O  O     . LEU C 3 311 ? -1.709  83.179 20.405 1.00 18.71  ? 311 LEU A O     1 
ATOM   2627 C  CB    . LEU C 3 311 ? -3.417  83.296 22.606 1.00 16.99  ? 311 LEU A CB    1 
ATOM   2628 C  CG    . LEU C 3 311 ? -4.450  83.427 23.670 1.00 19.31  ? 311 LEU A CG    1 
ATOM   2629 C  CD1   . LEU C 3 311 ? -5.800  83.674 23.057 1.00 19.58  ? 311 LEU A CD1   1 
ATOM   2630 C  CD2   . LEU C 3 311 ? -4.378  82.124 24.447 1.00 22.46  ? 311 LEU A CD2   1 
ATOM   2631 N  N     . PRO C 3 312 ? -2.221  85.316 20.565 1.00 12.82  ? 312 PRO A N     1 
ATOM   2632 C  CA    . PRO C 3 312 ? -0.959  85.803 20.030 1.00 19.73  ? 312 PRO A CA    1 
ATOM   2633 C  C     . PRO C 3 312 ? 0.232   85.296 20.852 1.00 18.20  ? 312 PRO A C     1 
ATOM   2634 O  O     . PRO C 3 312 ? 0.085   85.116 22.068 1.00 17.63  ? 312 PRO A O     1 
ATOM   2635 C  CB    . PRO C 3 312 ? -1.067  87.323 20.353 1.00 20.88  ? 312 PRO A CB    1 
ATOM   2636 C  CG    . PRO C 3 312 ? -1.956  87.445 21.593 1.00 17.39  ? 312 PRO A CG    1 
ATOM   2637 C  CD    . PRO C 3 312 ? -2.642  86.074 21.754 1.00 13.92  ? 312 PRO A CD    1 
ATOM   2638 N  N     . VAL C 3 313 ? 1.386   85.084 20.205 1.00 16.96  ? 313 VAL A N     1 
ATOM   2639 C  CA    . VAL C 3 313 ? 2.603   84.628 20.915 1.00 18.71  ? 313 VAL A CA    1 
ATOM   2640 C  C     . VAL C 3 313 ? 3.855   85.334 20.418 1.00 24.55  ? 313 VAL A C     1 
ATOM   2641 O  O     . VAL C 3 313 ? 4.147   85.356 19.207 1.00 29.24  ? 313 VAL A O     1 
ATOM   2642 C  CB    . VAL C 3 313 ? 2.794   83.163 21.335 1.00 11.80  ? 313 VAL A CB    1 
ATOM   2643 C  CG1   . VAL C 3 313 ? 1.502   82.342 21.352 1.00 14.74  ? 313 VAL A CG1   1 
ATOM   2644 C  CG2   . VAL C 3 313 ? 3.898   82.450 20.631 1.00 8.70   ? 313 VAL A CG2   1 
ATOM   2645 N  N     . ASP C 3 314 ? 4.582   85.931 21.358 1.00 22.71  ? 314 ASP A N     1 
ATOM   2646 C  CA    . ASP C 3 314 ? 5.775   86.656 21.011 1.00 24.48  ? 314 ASP A CA    1 
ATOM   2647 C  C     . ASP C 3 314 ? 7.082   86.057 21.460 1.00 29.42  ? 314 ASP A C     1 
ATOM   2648 O  O     . ASP C 3 314 ? 8.165   86.602 21.221 1.00 36.53  ? 314 ASP A O     1 
ATOM   2649 C  CB    . ASP C 3 314 ? 5.640   88.145 21.344 1.00 26.50  ? 314 ASP A CB    1 
ATOM   2650 C  CG    . ASP C 3 314 ? 4.426   88.792 20.672 1.00 31.52  ? 314 ASP A CG    1 
ATOM   2651 O  OD1   . ASP C 3 314 ? 4.093   88.605 19.507 1.00 25.93  ? 314 ASP A OD1   1 
ATOM   2652 O  OD2   . ASP C 3 314 ? 3.746   89.582 21.500 1.00 38.37  ? 314 ASP A OD2   1 
ATOM   2653 N  N     . SER C 3 315 ? 6.985   84.925 22.105 1.00 25.77  ? 315 SER A N     1 
ATOM   2654 C  CA    . SER C 3 315 ? 8.140   84.233 22.600 1.00 20.83  ? 315 SER A CA    1 
ATOM   2655 C  C     . SER C 3 315 ? 7.680   83.071 23.415 1.00 19.49  ? 315 SER A C     1 
ATOM   2656 O  O     . SER C 3 315 ? 6.590   83.112 23.985 1.00 24.22  ? 315 SER A O     1 
ATOM   2657 C  CB    . SER C 3 315 ? 8.888   85.155 23.524 1.00 29.79  ? 315 SER A CB    1 
ATOM   2658 O  OG    . SER C 3 315 ? 8.033   85.600 24.591 1.00 34.41  ? 315 SER A OG    1 
ATOM   2659 N  N     . GLU C 3 316 ? 8.504   82.055 23.473 1.00 16.18  ? 316 GLU A N     1 
ATOM   2660 C  CA    . GLU C 3 316 ? 8.199   80.859 24.235 1.00 15.36  ? 316 GLU A CA    1 
ATOM   2661 C  C     . GLU C 3 316 ? 7.625   81.163 25.666 1.00 22.14  ? 316 GLU A C     1 
ATOM   2662 O  O     . GLU C 3 316 ? 6.746   80.454 26.175 1.00 23.71  ? 316 GLU A O     1 
ATOM   2663 C  CB    . GLU C 3 316 ? 9.524   80.077 24.390 1.00 11.63  ? 316 GLU A CB    1 
ATOM   2664 C  CG    . GLU C 3 316 ? 9.927   79.152 23.240 1.00 11.23  ? 316 GLU A CG    1 
ATOM   2665 C  CD    . GLU C 3 316 ? 11.177  78.342 23.559 1.00 20.18  ? 316 GLU A CD    1 
ATOM   2666 O  OE1   . GLU C 3 316 ? 11.222  77.315 24.239 1.00 23.42  ? 316 GLU A OE1   1 
ATOM   2667 O  OE2   . GLU C 3 316 ? 12.230  78.778 22.948 1.00 25.28  ? 316 GLU A OE2   1 
ATOM   2668 N  N     . GLN C 3 317 ? 8.128   82.243 26.313 1.00 18.37  ? 317 GLN A N     1 
ATOM   2669 C  CA    . GLN C 3 317 ? 7.686   82.601 27.621 1.00 17.99  ? 317 GLN A CA    1 
ATOM   2670 C  C     . GLN C 3 317 ? 6.237   82.730 27.712 1.00 8.14   ? 317 GLN A C     1 
ATOM   2671 O  O     . GLN C 3 317 ? 5.663   82.244 28.683 1.00 4.07   ? 317 GLN A O     1 
ATOM   2672 C  CB    . GLN C 3 317 ? 8.274   83.884 28.197 1.00 35.23  ? 317 GLN A CB    1 
ATOM   2673 C  CG    . GLN C 3 317 ? 9.797   83.813 28.470 1.00 54.50  ? 317 GLN A CG    1 
ATOM   2674 C  CD    . GLN C 3 317 ? 10.711  84.120 27.254 1.00 66.37  ? 317 GLN A CD    1 
ATOM   2675 O  OE1   . GLN C 3 317 ? 10.671  83.437 26.201 1.00 70.38  ? 317 GLN A OE1   1 
ATOM   2676 N  NE2   . GLN C 3 317 ? 11.508  85.193 27.374 1.00 68.75  ? 317 GLN A NE2   1 
ATOM   2677 N  N     . ASP C 3 318 ? 5.671   83.398 26.713 1.00 7.14   ? 318 ASP A N     1 
ATOM   2678 C  CA    . ASP C 3 318 ? 4.243   83.606 26.700 1.00 8.78   ? 318 ASP A CA    1 
ATOM   2679 C  C     . ASP C 3 318 ? 3.496   82.307 26.731 1.00 9.18   ? 318 ASP A C     1 
ATOM   2680 O  O     . ASP C 3 318 ? 2.504   82.265 27.398 1.00 15.19  ? 318 ASP A O     1 
ATOM   2681 C  CB    . ASP C 3 318 ? 3.618   84.496 25.611 1.00 16.39  ? 318 ASP A CB    1 
ATOM   2682 C  CG    . ASP C 3 318 ? 4.335   85.759 25.214 1.00 27.56  ? 318 ASP A CG    1 
ATOM   2683 O  OD1   . ASP C 3 318 ? 5.632   85.649 25.190 1.00 31.26  ? 318 ASP A OD1   1 
ATOM   2684 O  OD2   . ASP C 3 318 ? 3.757   86.736 24.764 1.00 32.86  ? 318 ASP A OD2   1 
ATOM   2685 N  N     . ILE C 3 319 ? 3.916   81.255 26.028 1.00 9.12   ? 319 ILE A N     1 
ATOM   2686 C  CA    . ILE C 3 319 ? 3.155   80.011 26.094 1.00 11.41  ? 319 ILE A CA    1 
ATOM   2687 C  C     . ILE C 3 319 ? 3.043   79.547 27.542 1.00 16.87  ? 319 ILE A C     1 
ATOM   2688 O  O     . ILE C 3 319 ? 1.984   79.266 28.090 1.00 19.13  ? 319 ILE A O     1 
ATOM   2689 C  CB    . ILE C 3 319 ? 3.571   78.979 25.070 1.00 3.50   ? 319 ILE A CB    1 
ATOM   2690 C  CG1   . ILE C 3 319 ? 3.773   79.816 23.804 1.00 4.44   ? 319 ILE A CG1   1 
ATOM   2691 C  CG2   . ILE C 3 319 ? 2.430   77.972 24.885 1.00 1.00   ? 319 ILE A CG2   1 
ATOM   2692 C  CD1   . ILE C 3 319 ? 4.344   79.055 22.620 1.00 5.03   ? 319 ILE A CD1   1 
ATOM   2693 N  N     . PHE C 3 320 ? 4.158   79.523 28.183 1.00 14.85  ? 320 PHE A N     1 
ATOM   2694 C  CA    . PHE C 3 320 ? 4.181   79.148 29.543 1.00 15.14  ? 320 PHE A CA    1 
ATOM   2695 C  C     . PHE C 3 320 ? 3.338   80.049 30.406 1.00 24.22  ? 320 PHE A C     1 
ATOM   2696 O  O     . PHE C 3 320 ? 2.739   79.623 31.384 1.00 29.40  ? 320 PHE A O     1 
ATOM   2697 C  CB    . PHE C 3 320 ? 5.558   79.462 29.992 1.00 12.78  ? 320 PHE A CB    1 
ATOM   2698 C  CG    . PHE C 3 320 ? 6.412   78.326 29.639 1.00 13.84  ? 320 PHE A CG    1 
ATOM   2699 C  CD1   . PHE C 3 320 ? 6.990   78.257 28.375 1.00 12.07  ? 320 PHE A CD1   1 
ATOM   2700 C  CD2   . PHE C 3 320 ? 6.618   77.315 30.579 1.00 12.73  ? 320 PHE A CD2   1 
ATOM   2701 C  CE1   . PHE C 3 320 ? 7.795   77.170 28.050 1.00 10.54  ? 320 PHE A CE1   1 
ATOM   2702 C  CE2   . PHE C 3 320 ? 7.425   76.230 30.272 1.00 10.29  ? 320 PHE A CE2   1 
ATOM   2703 C  CZ    . PHE C 3 320 ? 8.008   76.175 29.003 1.00 11.80  ? 320 PHE A CZ    1 
ATOM   2704 N  N     . ASP C 3 321 ? 3.323   81.322 30.069 1.00 27.16  ? 321 ASP A N     1 
ATOM   2705 C  CA    . ASP C 3 321 ? 2.554   82.232 30.868 1.00 27.33  ? 321 ASP A CA    1 
ATOM   2706 C  C     . ASP C 3 321 ? 1.109   81.823 30.906 1.00 30.55  ? 321 ASP A C     1 
ATOM   2707 O  O     . ASP C 3 321 ? 0.453   81.882 31.939 1.00 38.37  ? 321 ASP A O     1 
ATOM   2708 C  CB    . ASP C 3 321 ? 2.837   83.739 30.636 1.00 22.36  ? 321 ASP A CB    1 
ATOM   2709 C  CG    . ASP C 3 321 ? 4.264   84.126 30.969 1.00 22.59  ? 321 ASP A CG    1 
ATOM   2710 O  OD1   . ASP C 3 321 ? 4.868   83.310 31.807 1.00 23.34  ? 321 ASP A OD1   1 
ATOM   2711 O  OD2   . ASP C 3 321 ? 4.814   85.083 30.478 1.00 24.76  ? 321 ASP A OD2   1 
ATOM   2712 N  N     . TYR C 3 322 ? 0.640   81.380 29.768 1.00 25.74  ? 322 TYR A N     1 
ATOM   2713 C  CA    . TYR C 3 322 ? -0.715  80.950 29.633 1.00 25.08  ? 322 TYR A CA    1 
ATOM   2714 C  C     . TYR C 3 322 ? -1.131  79.753 30.488 1.00 29.24  ? 322 TYR A C     1 
ATOM   2715 O  O     . TYR C 3 322 ? -2.177  79.726 31.162 1.00 32.17  ? 322 TYR A O     1 
ATOM   2716 C  CB    . TYR C 3 322 ? -0.950  80.610 28.190 1.00 25.93  ? 322 TYR A CB    1 
ATOM   2717 C  CG    . TYR C 3 322 ? -0.886  81.794 27.289 1.00 28.41  ? 322 TYR A CG    1 
ATOM   2718 C  CD1   . TYR C 3 322 ? -1.577  82.962 27.623 1.00 33.53  ? 322 TYR A CD1   1 
ATOM   2719 C  CD2   . TYR C 3 322 ? -0.176  81.749 26.094 1.00 26.22  ? 322 TYR A CD2   1 
ATOM   2720 C  CE1   . TYR C 3 322 ? -1.565  84.090 26.800 1.00 30.51  ? 322 TYR A CE1   1 
ATOM   2721 C  CE2   . TYR C 3 322 ? -0.149  82.863 25.264 1.00 29.93  ? 322 TYR A CE2   1 
ATOM   2722 C  CZ    . TYR C 3 322 ? -0.835  84.021 25.619 1.00 31.37  ? 322 TYR A CZ    1 
ATOM   2723 O  OH    . TYR C 3 322 ? -0.800  85.104 24.799 1.00 36.71  ? 322 TYR A OH    1 
ATOM   2724 N  N     . ILE C 3 323 ? -0.326  78.722 30.469 1.00 26.47  ? 323 ILE A N     1 
ATOM   2725 C  CA    . ILE C 3 323 ? -0.713  77.590 31.266 1.00 21.79  ? 323 ILE A CA    1 
ATOM   2726 C  C     . ILE C 3 323 ? -0.311  77.713 32.717 1.00 24.06  ? 323 ILE A C     1 
ATOM   2727 O  O     . ILE C 3 323 ? -0.329  76.724 33.436 1.00 22.60  ? 323 ILE A O     1 
ATOM   2728 C  CB    . ILE C 3 323 ? -0.255  76.267 30.681 1.00 13.28  ? 323 ILE A CB    1 
ATOM   2729 C  CG1   . ILE C 3 323 ? 1.263   76.163 30.591 1.00 3.81   ? 323 ILE A CG1   1 
ATOM   2730 C  CG2   . ILE C 3 323 ? -0.893  75.983 29.335 1.00 9.55   ? 323 ILE A CG2   1 
ATOM   2731 C  CD1   . ILE C 3 323 ? 1.678   74.749 30.166 1.00 1.00   ? 323 ILE A CD1   1 
ATOM   2732 N  N     . GLN C 3 324 ? 0.068   78.917 33.155 1.00 24.38  ? 324 GLN A N     1 
ATOM   2733 C  CA    . GLN C 3 324 ? 0.459   79.056 34.538 1.00 24.46  ? 324 GLN A CA    1 
ATOM   2734 C  C     . GLN C 3 324 ? 1.623   78.144 34.862 1.00 28.96  ? 324 GLN A C     1 
ATOM   2735 O  O     . GLN C 3 324 ? 1.571   77.308 35.763 1.00 32.92  ? 324 GLN A O     1 
ATOM   2736 C  CB    . GLN C 3 324 ? -0.722  78.660 35.408 1.00 27.76  ? 324 GLN A CB    1 
ATOM   2737 C  CG    . GLN C 3 324 ? -2.046  79.320 34.976 1.00 38.10  ? 324 GLN A CG    1 
ATOM   2738 C  CD    . GLN C 3 324 ? -2.013  80.817 35.181 1.00 48.41  ? 324 GLN A CD    1 
ATOM   2739 O  OE1   . GLN C 3 324 ? -2.748  81.545 34.516 1.00 54.54  ? 324 GLN A OE1   1 
ATOM   2740 N  NE2   . GLN C 3 324 ? -1.142  81.301 36.075 1.00 50.37  ? 324 GLN A NE2   1 
ATOM   2741 N  N     . TRP C 3 325 ? 2.695   78.277 34.128 1.00 30.17  ? 325 TRP A N     1 
ATOM   2742 C  CA    . TRP C 3 325 ? 3.860   77.435 34.362 1.00 30.67  ? 325 TRP A CA    1 
ATOM   2743 C  C     . TRP C 3 325 ? 5.166   78.216 34.296 1.00 26.06  ? 325 TRP A C     1 
ATOM   2744 O  O     . TRP C 3 325 ? 5.322   79.184 33.525 1.00 21.46  ? 325 TRP A O     1 
ATOM   2745 C  CB    . TRP C 3 325 ? 3.871   76.417 33.252 1.00 35.10  ? 325 TRP A CB    1 
ATOM   2746 C  CG    . TRP C 3 325 ? 3.431   75.072 33.635 1.00 39.22  ? 325 TRP A CG    1 
ATOM   2747 C  CD1   . TRP C 3 325 ? 2.648   74.692 34.665 1.00 43.93  ? 325 TRP A CD1   1 
ATOM   2748 C  CD2   . TRP C 3 325 ? 3.800   73.905 32.954 1.00 38.93  ? 325 TRP A CD2   1 
ATOM   2749 N  NE1   . TRP C 3 325 ? 2.506   73.314 34.663 1.00 42.17  ? 325 TRP A NE1   1 
ATOM   2750 C  CE2   . TRP C 3 325 ? 3.203   72.826 33.610 1.00 39.72  ? 325 TRP A CE2   1 
ATOM   2751 C  CE3   . TRP C 3 325 ? 4.579   73.698 31.838 1.00 40.99  ? 325 TRP A CE3   1 
ATOM   2752 C  CZ2   . TRP C 3 325 ? 3.383   71.543 33.164 1.00 44.31  ? 325 TRP A CZ2   1 
ATOM   2753 C  CZ3   . TRP C 3 325 ? 4.761   72.422 31.392 1.00 44.62  ? 325 TRP A CZ3   1 
ATOM   2754 C  CH2   . TRP C 3 325 ? 4.168   71.352 32.044 1.00 45.91  ? 325 TRP A CH2   1 
ATOM   2755 N  N     . ARG C 3 326 ? 6.123   77.812 35.108 1.00 25.88  ? 326 ARG A N     1 
ATOM   2756 C  CA    . ARG C 3 326 ? 7.357   78.557 35.059 1.00 28.47  ? 326 ARG A CA    1 
ATOM   2757 C  C     . ARG C 3 326 ? 8.121   78.214 33.836 1.00 23.58  ? 326 ARG A C     1 
ATOM   2758 O  O     . ARG C 3 326 ? 8.206   77.038 33.511 1.00 24.49  ? 326 ARG A O     1 
ATOM   2759 C  CB    . ARG C 3 326 ? 8.215   78.466 36.312 1.00 36.93  ? 326 ARG A CB    1 
ATOM   2760 C  CG    . ARG C 3 326 ? 8.245   77.070 36.904 1.00 49.94  ? 326 ARG A CG    1 
ATOM   2761 C  CD    . ARG C 3 326 ? 9.315   76.873 37.982 1.00 61.16  ? 326 ARG A CD    1 
ATOM   2762 N  NE    . ARG C 3 326 ? 10.657  76.685 37.438 1.00 68.30  ? 326 ARG A NE    1 
ATOM   2763 C  CZ    . ARG C 3 326 ? 11.096  75.517 36.971 1.00 72.97  ? 326 ARG A CZ    1 
ATOM   2764 N  NH1   . ARG C 3 326 ? 10.330  74.415 36.952 1.00 73.18  ? 326 ARG A NH1   1 
ATOM   2765 N  NH2   . ARG C 3 326 ? 12.340  75.451 36.496 1.00 75.70  ? 326 ARG A NH2   1 
ATOM   2766 N  N     . TYR C 3 327 ? 8.655   79.235 33.165 1.00 21.52  ? 327 TYR A N     1 
ATOM   2767 C  CA    . TYR C 3 327 ? 9.427   79.007 31.968 1.00 25.85  ? 327 TYR A CA    1 
ATOM   2768 C  C     . TYR C 3 327 ? 10.580  78.047 32.347 1.00 30.87  ? 327 TYR A C     1 
ATOM   2769 O  O     . TYR C 3 327 ? 11.076  78.026 33.477 1.00 32.24  ? 327 TYR A O     1 
ATOM   2770 C  CB    . TYR C 3 327 ? 9.860   80.337 31.322 1.00 31.23  ? 327 TYR A CB    1 
ATOM   2771 C  CG    . TYR C 3 327 ? 10.764  80.238 30.121 1.00 43.24  ? 327 TYR A CG    1 
ATOM   2772 C  CD1   . TYR C 3 327 ? 12.075  79.800 30.270 1.00 48.26  ? 327 TYR A CD1   1 
ATOM   2773 C  CD2   . TYR C 3 327 ? 10.334  80.585 28.836 1.00 52.38  ? 327 TYR A CD2   1 
ATOM   2774 C  CE1   . TYR C 3 327 ? 12.930  79.693 29.178 1.00 54.78  ? 327 TYR A CE1   1 
ATOM   2775 C  CE2   . TYR C 3 327 ? 11.182  80.487 27.723 1.00 57.03  ? 327 TYR A CE2   1 
ATOM   2776 C  CZ    . TYR C 3 327 ? 12.494  80.036 27.901 1.00 57.73  ? 327 TYR A CZ    1 
ATOM   2777 O  OH    . TYR C 3 327 ? 13.370  79.923 26.839 1.00 57.89  ? 327 TYR A OH    1 
ATOM   2778 N  N     . ARG C 3 328 ? 11.010  77.217 31.413 1.00 28.91  ? 328 ARG A N     1 
ATOM   2779 C  CA    . ARG C 3 328 ? 12.056  76.280 31.666 1.00 26.14  ? 328 ARG A CA    1 
ATOM   2780 C  C     . ARG C 3 328 ? 12.973  76.296 30.480 1.00 31.67  ? 328 ARG A C     1 
ATOM   2781 O  O     . ARG C 3 328 ? 12.541  76.205 29.320 1.00 37.12  ? 328 ARG A O     1 
ATOM   2782 C  CB    . ARG C 3 328 ? 11.435  74.921 31.958 1.00 28.67  ? 328 ARG A CB    1 
ATOM   2783 C  CG    . ARG C 3 328 ? 10.826  74.925 33.386 1.00 30.49  ? 328 ARG A CG    1 
ATOM   2784 C  CD    . ARG C 3 328 ? 9.408   74.308 33.618 1.00 25.70  ? 328 ARG A CD    1 
ATOM   2785 N  NE    . ARG C 3 328 ? 9.185   72.876 33.392 1.00 16.29  ? 328 ARG A NE    1 
ATOM   2786 C  CZ    . ARG C 3 328 ? 10.116  71.986 33.061 1.00 14.66  ? 328 ARG A CZ    1 
ATOM   2787 N  NH1   . ARG C 3 328 ? 11.435  72.261 32.897 1.00 14.05  ? 328 ARG A NH1   1 
ATOM   2788 N  NH2   . ARG C 3 328 ? 9.699   70.744 32.892 1.00 15.96  ? 328 ARG A NH2   1 
ATOM   2789 N  N     . GLU C 3 329 ? 14.241  76.452 30.764 1.00 30.74  ? 329 GLU A N     1 
ATOM   2790 C  CA    . GLU C 3 329 ? 15.120  76.481 29.659 1.00 33.38  ? 329 GLU A CA    1 
ATOM   2791 C  C     . GLU C 3 329 ? 15.085  75.252 28.830 1.00 23.13  ? 329 GLU A C     1 
ATOM   2792 O  O     . GLU C 3 329 ? 14.571  74.268 29.294 1.00 26.34  ? 329 GLU A O     1 
ATOM   2793 C  CB    . GLU C 3 329 ? 16.460  77.146 29.882 1.00 50.49  ? 329 GLU A CB    1 
ATOM   2794 C  CG    . GLU C 3 329 ? 16.188  78.653 29.824 1.00 67.06  ? 329 GLU A CG    1 
ATOM   2795 C  CD    . GLU C 3 329 ? 17.394  79.512 29.670 1.00 82.36  ? 329 GLU A CD    1 
ATOM   2796 O  OE1   . GLU C 3 329 ? 18.459  78.839 29.278 1.00 87.94  ? 329 GLU A OE1   1 
ATOM   2797 O  OE2   . GLU C 3 329 ? 17.361  80.718 29.879 1.00 88.35  ? 329 GLU A OE2   1 
ATOM   2798 N  N     . PRO C 3 330 ? 15.582  75.344 27.627 1.00 17.07  ? 330 PRO A N     1 
ATOM   2799 C  CA    . PRO C 3 330 ? 15.569  74.205 26.788 1.00 11.22  ? 330 PRO A CA    1 
ATOM   2800 C  C     . PRO C 3 330 ? 16.222  73.075 27.447 1.00 13.89  ? 330 PRO A C     1 
ATOM   2801 O  O     . PRO C 3 330 ? 15.633  72.015 27.518 1.00 16.54  ? 330 PRO A O     1 
ATOM   2802 C  CB    . PRO C 3 330 ? 16.256  74.640 25.479 1.00 1.25   ? 330 PRO A CB    1 
ATOM   2803 C  CG    . PRO C 3 330 ? 15.822  76.086 25.320 1.00 1.00   ? 330 PRO A CG    1 
ATOM   2804 C  CD    . PRO C 3 330 ? 15.553  76.569 26.743 1.00 12.79  ? 330 PRO A CD    1 
ATOM   2805 N  N     . LYS C 3 331 ? 17.401  73.344 27.954 1.00 20.77  ? 331 LYS A N     1 
ATOM   2806 C  CA    . LYS C 3 331 ? 18.160  72.321 28.635 1.00 29.17  ? 331 LYS A CA    1 
ATOM   2807 C  C     . LYS C 3 331 ? 17.369  71.684 29.757 1.00 23.32  ? 331 LYS A C     1 
ATOM   2808 O  O     . LYS C 3 331 ? 17.750  70.618 30.254 1.00 24.87  ? 331 LYS A O     1 
ATOM   2809 C  CB    . LYS C 3 331 ? 19.413  72.918 29.174 1.00 45.85  ? 331 LYS A CB    1 
ATOM   2810 C  CG    . LYS C 3 331 ? 19.080  74.114 30.031 1.00 61.34  ? 331 LYS A CG    1 
ATOM   2811 C  CD    . LYS C 3 331 ? 20.145  74.437 31.068 1.00 73.86  ? 331 LYS A CD    1 
ATOM   2812 C  CE    . LYS C 3 331 ? 19.595  75.218 32.268 1.00 82.19  ? 331 LYS A CE    1 
ATOM   2813 N  NZ    . LYS C 3 331 ? 18.885  76.476 31.922 1.00 84.41  ? 331 LYS A NZ    1 
ATOM   2814 N  N     . ASP C 3 332 ? 16.271  72.336 30.142 1.00 12.79  ? 332 ASP A N     1 
ATOM   2815 C  CA    . ASP C 3 332 ? 15.459  71.799 31.204 1.00 21.03  ? 332 ASP A CA    1 
ATOM   2816 C  C     . ASP C 3 332 ? 14.215  71.054 30.808 1.00 19.11  ? 332 ASP A C     1 
ATOM   2817 O  O     . ASP C 3 332 ? 13.540  70.485 31.675 1.00 19.40  ? 332 ASP A O     1 
ATOM   2818 C  CB    . ASP C 3 332 ? 14.959  72.911 32.106 1.00 36.43  ? 332 ASP A CB    1 
ATOM   2819 C  CG    . ASP C 3 332 ? 16.009  73.209 33.099 1.00 49.33  ? 332 ASP A CG    1 
ATOM   2820 O  OD1   . ASP C 3 332 ? 16.840  72.177 33.206 1.00 51.80  ? 332 ASP A OD1   1 
ATOM   2821 O  OD2   . ASP C 3 332 ? 16.075  74.281 33.713 1.00 55.22  ? 332 ASP A OD2   1 
ATOM   2822 N  N     . ARG C 3 333 ? 13.899  71.087 29.541 1.00 17.83  ? 333 ARG A N     1 
ATOM   2823 C  CA    . ARG C 3 333 ? 12.726  70.434 29.055 1.00 17.70  ? 333 ARG A CA    1 
ATOM   2824 C  C     . ARG C 3 333 ? 12.730  68.924 28.898 1.00 26.87  ? 333 ARG A C     1 
ATOM   2825 O  O     . ARG C 3 333 ? 11.856  68.359 28.215 1.00 24.41  ? 333 ARG A O     1 
ATOM   2826 C  CB    . ARG C 3 333 ? 12.163  71.152 27.907 1.00 7.00   ? 333 ARG A CB    1 
ATOM   2827 C  CG    . ARG C 3 333 ? 11.723  72.496 28.368 1.00 2.47   ? 333 ARG A CG    1 
ATOM   2828 C  CD    . ARG C 3 333 ? 11.310  73.222 27.125 1.00 6.43   ? 333 ARG A CD    1 
ATOM   2829 N  NE    . ARG C 3 333 ? 12.289  74.121 26.598 1.00 7.92   ? 333 ARG A NE    1 
ATOM   2830 C  CZ    . ARG C 3 333 ? 11.918  75.377 26.560 1.00 16.47  ? 333 ARG A CZ    1 
ATOM   2831 N  NH1   . ARG C 3 333 ? 10.717  75.734 26.985 1.00 17.64  ? 333 ARG A NH1   1 
ATOM   2832 N  NH2   . ARG C 3 333 ? 12.717  76.308 26.098 1.00 23.13  ? 333 ARG A NH2   1 
ATOM   2833 N  N     . SER C 3 334 ? 13.711  68.296 29.554 1.00 32.75  ? 334 SER A N     1 
ATOM   2834 C  CA    . SER C 3 334 ? 13.868  66.856 29.553 1.00 39.50  ? 334 SER A CA    1 
ATOM   2835 C  C     . SER C 3 334 ? 12.547  66.125 29.736 1.00 34.40  ? 334 SER A C     1 
ATOM   2836 O  O     . SER C 3 334 ? 12.334  65.106 29.115 1.00 27.89  ? 334 SER A O     1 
ATOM   2837 C  CB    . SER C 3 334 ? 14.837  66.408 30.630 1.00 49.92  ? 334 SER A CB    1 
ATOM   2838 O  OG    . SER C 3 334 ? 16.159  66.482 30.107 1.00 60.07  ? 334 SER A OG    1 
ATOM   2839 N  N     . GLU C 3 335 ? 11.665  66.659 30.575 1.00 42.36  ? 335 GLU A N     1 
ATOM   2840 C  CA    . GLU C 3 335 ? 10.353  66.070 30.843 1.00 53.42  ? 335 GLU A CA    1 
ATOM   2841 C  C     . GLU C 3 335 ? 9.378   66.985 31.594 1.00 54.27  ? 335 GLU A C     1 
ATOM   2842 O  O     . GLU C 3 335 ? 8.151   66.740 31.606 1.00 51.27  ? 335 GLU A O     1 
ATOM   2843 C  CB    . GLU C 3 335 ? 10.465  64.729 31.563 1.00 65.41  ? 335 GLU A CB    1 
ATOM   2844 C  CG    . GLU C 3 335 ? 10.801  64.874 33.056 1.00 75.81  ? 335 GLU A CG    1 
ATOM   2845 C  CD    . GLU C 3 335 ? 10.702  63.575 33.805 1.00 81.41  ? 335 GLU A CD    1 
ATOM   2846 O  OE1   . GLU C 3 335 ? 11.201  62.579 33.119 1.00 82.97  ? 335 GLU A OE1   1 
ATOM   2847 O  OE2   . GLU C 3 335 ? 10.222  63.477 34.928 1.00 84.29  ? 335 GLU A OE2   1 
ATOM   2848 O  OXT   . GLU C 3 335 ? 9.814   67.983 32.185 1.00 58.53  ? 335 GLU A OXT   1 
HETATM 2849 MG MG    . MG  D 4 .   ? 17.268  65.308 17.623 1.00 5.98   ? 339 MG  A MG    1 
HETATM 2850 MG MG    . MG  E 4 .   ? 13.937  63.578 14.776 1.00 79.12  ? 340 MG  A MG    1 
HETATM 2851 N  N1    . DCT F 5 .   ? 7.981   65.909 19.596 1.00 12.76  ? 338 DCT A N1    1 
HETATM 2852 C  C2    . DCT F 5 .   ? 6.672   65.691 20.113 1.00 19.61  ? 338 DCT A C2    1 
HETATM 2853 N  N3    . DCT F 5 .   ? 6.228   64.397 20.177 1.00 13.84  ? 338 DCT A N3    1 
HETATM 2854 C  C4    . DCT F 5 .   ? 7.010   63.394 19.752 1.00 4.02   ? 338 DCT A C4    1 
HETATM 2855 C  C5    . DCT F 5 .   ? 8.282   63.624 19.222 1.00 1.00   ? 338 DCT A C5    1 
HETATM 2856 C  C6    . DCT F 5 .   ? 8.725   64.862 19.164 1.00 1.04   ? 338 DCT A C6    1 
HETATM 2857 O  O2    . DCT F 5 .   ? 5.963   66.650 20.518 1.00 21.98  ? 338 DCT A O2    1 
HETATM 2858 N  N4    . DCT F 5 .   ? 6.527   62.151 19.820 1.00 3.36   ? 338 DCT A N4    1 
HETATM 2859 C  "C1'" . DCT F 5 .   ? 9.206   66.742 19.326 1.00 13.61  ? 338 DCT A "C1'" 1 
HETATM 2860 C  "C2'" . DCT F 5 .   ? 10.338  66.714 20.353 1.00 1.00   ? 338 DCT A "C2'" 1 
HETATM 2861 C  "C3'" . DCT F 5 .   ? 11.447  67.276 19.457 1.00 5.39   ? 338 DCT A "C3'" 1 
HETATM 2862 C  "C4'" . DCT F 5 .   ? 11.219  66.506 18.158 1.00 11.78  ? 338 DCT A "C4'" 1 
HETATM 2863 O  "O4'" . DCT F 5 .   ? 9.772   66.437 18.036 1.00 17.82  ? 338 DCT A "O4'" 1 
HETATM 2864 C  "C5'" . DCT F 5 .   ? 11.650  65.071 18.243 1.00 14.86  ? 338 DCT A "C5'" 1 
HETATM 2865 O  "O5'" . DCT F 5 .   ? 12.915  64.969 17.801 1.00 19.89  ? 338 DCT A "O5'" 1 
HETATM 2866 P  PA    . DCT F 5 .   ? 13.617  63.613 18.171 1.00 18.62  ? 338 DCT A PA    1 
HETATM 2867 O  O1A   . DCT F 5 .   ? 14.847  63.666 17.242 1.00 1.00   ? 338 DCT A O1A   1 
HETATM 2868 O  O2A   . DCT F 5 .   ? 12.518  62.466 18.200 1.00 19.21  ? 338 DCT A O2A   1 
HETATM 2869 O  O3A   . DCT F 5 .   ? 14.052  63.897 19.666 1.00 20.21  ? 338 DCT A O3A   1 
HETATM 2870 P  PB    . DCT F 5 .   ? 15.315  64.577 20.055 1.00 16.96  ? 338 DCT A PB    1 
HETATM 2871 O  O1B   . DCT F 5 .   ? 15.121  65.508 21.165 1.00 6.45   ? 338 DCT A O1B   1 
HETATM 2872 O  O2B   . DCT F 5 .   ? 15.932  65.097 18.678 1.00 10.01  ? 338 DCT A O2B   1 
HETATM 2873 O  O3B   . DCT F 5 .   ? 16.053  63.336 20.467 1.00 20.10  ? 338 DCT A O3B   1 
HETATM 2874 P  PG    . DCT F 5 .   ? 17.289  62.589 19.674 1.00 22.72  ? 338 DCT A PG    1 
HETATM 2875 O  O1G   . DCT F 5 .   ? 17.329  63.113 18.206 1.00 21.66  ? 338 DCT A O1G   1 
HETATM 2876 O  O2G   . DCT F 5 .   ? 18.450  62.804 20.495 1.00 17.57  ? 338 DCT A O2G   1 
HETATM 2877 O  O3G   . DCT F 5 .   ? 16.878  61.167 19.700 1.00 27.66  ? 338 DCT A O3G   1 
HETATM 2878 O  O     . HOH G 6 .   ? 1.862   63.779 0.634  1.00 47.64  ? 410 HOH T O     1 
HETATM 2879 O  O     . HOH G 6 .   ? 2.799   53.723 4.581  1.00 35.64  ? 417 HOH T O     1 
HETATM 2880 O  O     . HOH H 6 .   ? -0.505  52.573 6.170  1.00 19.39  ? 401 HOH P O     1 
HETATM 2881 O  O     . HOH H 6 .   ? 6.554   61.254 7.090  1.00 39.69  ? 411 HOH P O     1 
HETATM 2882 O  O     . HOH I 6 .   ? 11.221  51.871 14.203 1.00 3.96   ? 400 HOH A O     1 
HETATM 2883 O  O     . HOH I 6 .   ? 14.240  60.786 9.760  1.00 16.00  ? 402 HOH A O     1 
HETATM 2884 O  O     . HOH I 6 .   ? 14.805  60.347 16.503 1.00 41.71  ? 403 HOH A O     1 
HETATM 2885 O  O     . HOH I 6 .   ? 0.156   81.123 18.185 1.00 47.53  ? 404 HOH A O     1 
HETATM 2886 O  O     . HOH I 6 .   ? 10.207  72.582 24.630 1.00 25.37  ? 405 HOH A O     1 
HETATM 2887 O  O     . HOH I 6 .   ? -5.137  81.189 32.092 1.00 17.36  ? 406 HOH A O     1 
HETATM 2888 O  O     . HOH I 6 .   ? 15.538  62.594 -4.158 1.00 30.69  ? 407 HOH A O     1 
HETATM 2889 O  O     . HOH I 6 .   ? 12.656  64.356 21.603 1.00 29.27  ? 408 HOH A O     1 
HETATM 2890 O  O     . HOH I 6 .   ? 17.411  61.890 -1.838 1.00 53.92  ? 409 HOH A O     1 
HETATM 2891 O  O     . HOH I 6 .   ? 2.033   89.437 24.191 1.00 51.26  ? 412 HOH A O     1 
HETATM 2892 O  O     . HOH I 6 .   ? 27.303  63.377 10.939 1.00 39.46  ? 413 HOH A O     1 
HETATM 2893 O  O     . HOH I 6 .   ? -0.802  39.756 37.603 1.00 25.03  ? 414 HOH A O     1 
HETATM 2894 O  O     . HOH I 6 .   ? 7.984   54.711 7.806  1.00 100.00 ? 415 HOH A O     1 
HETATM 2895 O  O     . HOH I 6 .   ? 14.149  33.437 11.027 1.00 61.43  ? 416 HOH A O     1 
HETATM 2896 O  O     . HOH I 6 .   ? 9.272   54.809 1.834  1.00 40.95  ? 418 HOH A O     1 
HETATM 2897 O  O     . HOH I 6 .   ? 17.890  67.558 16.617 1.00 31.83  ? 419 HOH A O     1 
HETATM 2898 O  O     . HOH I 6 .   ? 18.147  33.971 46.955 1.00 26.25  ? 420 HOH A O     1 
HETATM 2899 O  O     . HOH I 6 .   ? 31.628  59.383 14.447 1.00 55.46  ? 421 HOH A O     1 
HETATM 2900 O  O     . HOH I 6 .   ? 29.865  76.524 4.824  1.00 63.98  ? 422 HOH A O     1 
HETATM 2901 O  O     . HOH I 6 .   ? 9.888   48.882 20.323 1.00 66.62  ? 423 HOH A O     1 
HETATM 2902 O  O     . HOH I 6 .   ? 36.804  56.495 7.566  1.00 72.07  ? 424 HOH A O     1 
HETATM 2903 O  O     . HOH I 6 .   ? 9.036   45.395 25.333 1.00 66.00  ? 425 HOH A O     1 
HETATM 2904 O  O     . HOH I 6 .   ? 4.606   70.887 24.235 1.00 61.54  ? 426 HOH A O     1 
HETATM 2905 O  O     . HOH I 6 .   ? 18.631  48.461 35.390 1.00 70.43  ? 427 HOH A O     1 
HETATM 2906 O  O     . HOH I 6 .   ? 18.818  28.314 41.514 1.00 66.93  ? 428 HOH A O     1 
HETATM 2907 O  O     . HOH I 6 .   ? 19.255  34.712 50.190 1.00 66.12  ? 429 HOH A O     1 
HETATM 2908 O  O     . HOH I 6 .   ? 7.218   24.833 30.976 1.00 49.95  ? 430 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   4   4   DG  G   T . n 
A 1 2   DG  2   5   5   DG  G   T . n 
A 1 3   DG  3   6   6   DG  G   T . n 
A 1 4   DC  4   7   7   DC  C   T . n 
A 1 5   DG  5   8   8   DG  G   T . n 
A 1 6   DC  6   9   9   DC  C   T . n 
A 1 7   DC  7   10  10  DC  C   T . n 
A 1 8   DG  8   11  11  DG  G   T . n 
B 2 1   DC  1   1   1   DC  C   P . n 
B 2 2   DG  2   2   2   DG  G   P . n 
B 2 3   DG  3   3   3   DG  G   P . n 
B 2 4   DC  4   4   4   DC  C   P . n 
B 2 5   DG  5   5   5   DG  G   P . n 
B 2 6   DC  6   6   6   DC  C   P . n 
B 2 7   DC  7   7   7   DC  C   P . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   SER 2   2   ?   ?   ?   A . n 
C 3 3   LYS 3   3   ?   ?   ?   A . n 
C 3 4   ARG 4   4   ?   ?   ?   A . n 
C 3 5   LYS 5   5   ?   ?   ?   A . n 
C 3 6   ALA 6   6   ?   ?   ?   A . n 
C 3 7   PRO 7   7   ?   ?   ?   A . n 
C 3 8   GLN 8   8   ?   ?   ?   A . n 
C 3 9   GLU 9   9   9   GLU GLU A . n 
C 3 10  THR 10  10  10  THR THR A . n 
C 3 11  LEU 11  11  11  LEU LEU A . n 
C 3 12  ASN 12  12  12  ASN ASN A . n 
C 3 13  GLY 13  13  13  GLY GLY A . n 
C 3 14  GLY 14  14  14  GLY GLY A . n 
C 3 15  ILE 15  15  15  ILE ILE A . n 
C 3 16  THR 16  16  16  THR THR A . n 
C 3 17  ASP 17  17  17  ASP ASP A . n 
C 3 18  MET 18  18  18  MET MET A . n 
C 3 19  LEU 19  19  19  LEU LEU A . n 
C 3 20  VAL 20  20  20  VAL VAL A . n 
C 3 21  GLU 21  21  21  GLU GLU A . n 
C 3 22  LEU 22  22  22  LEU LEU A . n 
C 3 23  ALA 23  23  23  ALA ALA A . n 
C 3 24  ASN 24  24  24  ASN ASN A . n 
C 3 25  PHE 25  25  25  PHE PHE A . n 
C 3 26  GLU 26  26  26  GLU GLU A . n 
C 3 27  LYS 27  27  27  LYS LYS A . n 
C 3 28  ASN 28  28  28  ASN ASN A . n 
C 3 29  VAL 29  29  29  VAL VAL A . n 
C 3 30  SER 30  30  30  SER SER A . n 
C 3 31  GLN 31  31  31  GLN GLN A . n 
C 3 32  ALA 32  32  32  ALA ALA A . n 
C 3 33  ILE 33  33  33  ILE ILE A . n 
C 3 34  HIS 34  34  34  HIS HIS A . n 
C 3 35  LYS 35  35  35  LYS LYS A . n 
C 3 36  TYR 36  36  36  TYR TYR A . n 
C 3 37  ASN 37  37  37  ASN ASN A . n 
C 3 38  ALA 38  38  38  ALA ALA A . n 
C 3 39  TYR 39  39  39  TYR TYR A . n 
C 3 40  ARG 40  40  40  ARG ARG A . n 
C 3 41  LYS 41  41  41  LYS LYS A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  ALA 43  43  43  ALA ALA A . n 
C 3 44  SER 44  44  44  SER SER A . n 
C 3 45  VAL 45  45  45  VAL VAL A . n 
C 3 46  ILE 46  46  46  ILE ILE A . n 
C 3 47  ALA 47  47  47  ALA ALA A . n 
C 3 48  LYS 48  48  48  LYS LYS A . n 
C 3 49  TYR 49  49  49  TYR TYR A . n 
C 3 50  PRO 50  50  50  PRO PRO A . n 
C 3 51  HIS 51  51  51  HIS HIS A . n 
C 3 52  LYS 52  52  52  LYS LYS A . n 
C 3 53  ILE 53  53  53  ILE ILE A . n 
C 3 54  LYS 54  54  54  LYS LYS A . n 
C 3 55  SER 55  55  55  SER SER A . n 
C 3 56  GLY 56  56  56  GLY GLY A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLU 58  58  58  GLU GLU A . n 
C 3 59  ALA 59  59  59  ALA ALA A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  LYS 61  61  61  LYS LYS A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  PRO 63  63  63  PRO PRO A . n 
C 3 64  GLY 64  64  64  GLY GLY A . n 
C 3 65  VAL 65  65  65  VAL VAL A . n 
C 3 66  GLY 66  66  66  GLY GLY A . n 
C 3 67  THR 67  67  67  THR THR A . n 
C 3 68  LYS 68  68  68  LYS LYS A . n 
C 3 69  ILE 69  69  69  ILE ILE A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  GLU 71  71  71  GLU GLU A . n 
C 3 72  LYS 72  72  72  LYS LYS A . n 
C 3 73  ILE 73  73  73  ILE ILE A . n 
C 3 74  ASP 74  74  74  ASP ASP A . n 
C 3 75  GLU 75  75  75  GLU GLU A . n 
C 3 76  PHE 76  76  76  PHE PHE A . n 
C 3 77  LEU 77  77  77  LEU LEU A . n 
C 3 78  ALA 78  78  78  ALA ALA A . n 
C 3 79  THR 79  79  79  THR THR A . n 
C 3 80  GLY 80  80  80  GLY GLY A . n 
C 3 81  LYS 81  81  81  LYS LYS A . n 
C 3 82  LEU 82  82  82  LEU LEU A . n 
C 3 83  ARG 83  83  83  ARG ARG A . n 
C 3 84  LYS 84  84  84  LYS LYS A . n 
C 3 85  LEU 85  85  85  LEU LEU A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  LYS 87  87  87  LYS LYS A . n 
C 3 88  ILE 88  88  88  ILE ILE A . n 
C 3 89  ARG 89  89  89  ARG ARG A . n 
C 3 90  GLN 90  90  90  GLN GLN A . n 
C 3 91  ASP 91  91  91  ASP ASP A . n 
C 3 92  ASP 92  92  92  ASP ASP A . n 
C 3 93  THR 93  93  93  THR THR A . n 
C 3 94  SER 94  94  94  SER SER A . n 
C 3 95  SER 95  95  95  SER SER A . n 
C 3 96  SER 96  96  96  SER SER A . n 
C 3 97  ILE 97  97  97  ILE ILE A . n 
C 3 98  ASN 98  98  98  ASN ASN A . n 
C 3 99  PHE 99  99  99  PHE PHE A . n 
C 3 100 LEU 100 100 100 LEU LEU A . n 
C 3 101 THR 101 101 101 THR THR A . n 
C 3 102 ARG 102 102 102 ARG ARG A . n 
C 3 103 VAL 103 103 103 VAL VAL A . n 
C 3 104 THR 104 104 104 THR THR A . n 
C 3 105 GLY 105 105 105 GLY GLY A . n 
C 3 106 ILE 106 106 106 ILE ILE A . n 
C 3 107 GLY 107 107 107 GLY GLY A . n 
C 3 108 PRO 108 108 108 PRO PRO A . n 
C 3 109 SER 109 109 109 SER SER A . n 
C 3 110 ALA 110 110 110 ALA ALA A . n 
C 3 111 ALA 111 111 111 ALA ALA A . n 
C 3 112 ARG 112 112 112 ARG ARG A . n 
C 3 113 LYS 113 113 113 LYS LYS A . n 
C 3 114 LEU 114 114 114 LEU LEU A . n 
C 3 115 VAL 115 115 115 VAL VAL A . n 
C 3 116 ASP 116 116 116 ASP ASP A . n 
C 3 117 GLU 117 117 117 GLU GLU A . n 
C 3 118 GLY 118 118 118 GLY GLY A . n 
C 3 119 ILE 119 119 119 ILE ILE A . n 
C 3 120 LYS 120 120 120 LYS LYS A . n 
C 3 121 THR 121 121 121 THR THR A . n 
C 3 122 LEU 122 122 122 LEU LEU A . n 
C 3 123 GLU 123 123 123 GLU GLU A . n 
C 3 124 ASP 124 124 124 ASP ASP A . n 
C 3 125 LEU 125 125 125 LEU LEU A . n 
C 3 126 ARG 126 126 126 ARG ARG A . n 
C 3 127 LYS 127 127 127 LYS LYS A . n 
C 3 128 ASN 128 128 128 ASN ASN A . n 
C 3 129 GLU 129 129 129 GLU GLU A . n 
C 3 130 ASP 130 130 130 ASP ASP A . n 
C 3 131 LYS 131 131 131 LYS LYS A . n 
C 3 132 LEU 132 132 132 LEU LEU A . n 
C 3 133 ASN 133 133 133 ASN ASN A . n 
C 3 134 HIS 134 134 134 HIS HIS A . n 
C 3 135 HIS 135 135 135 HIS HIS A . n 
C 3 136 GLN 136 136 136 GLN GLN A . n 
C 3 137 ARG 137 137 137 ARG ARG A . n 
C 3 138 ILE 138 138 138 ILE ILE A . n 
C 3 139 GLY 139 139 139 GLY GLY A . n 
C 3 140 LEU 140 140 140 LEU LEU A . n 
C 3 141 LYS 141 141 141 LYS LYS A . n 
C 3 142 TYR 142 142 142 TYR TYR A . n 
C 3 143 PHE 143 143 143 PHE PHE A . n 
C 3 144 GLU 144 144 144 GLU GLU A . n 
C 3 145 ASP 145 145 145 ASP ASP A . n 
C 3 146 PHE 146 146 146 PHE PHE A . n 
C 3 147 GLU 147 147 147 GLU GLU A . n 
C 3 148 LYS 148 148 148 LYS LYS A . n 
C 3 149 ARG 149 149 149 ARG ARG A . n 
C 3 150 ILE 150 150 150 ILE ILE A . n 
C 3 151 PRO 151 151 151 PRO PRO A . n 
C 3 152 ARG 152 152 152 ARG ARG A . n 
C 3 153 GLU 153 153 153 GLU GLU A . n 
C 3 154 GLU 154 154 154 GLU GLU A . n 
C 3 155 MET 155 155 155 MET MET A . n 
C 3 156 LEU 156 156 156 LEU LEU A . n 
C 3 157 GLN 157 157 157 GLN GLN A . n 
C 3 158 MET 158 158 158 MET MET A . n 
C 3 159 GLN 159 159 159 GLN GLN A . n 
C 3 160 ASP 160 160 160 ASP ASP A . n 
C 3 161 ILE 161 161 161 ILE ILE A . n 
C 3 162 VAL 162 162 162 VAL VAL A . n 
C 3 163 LEU 163 163 163 LEU LEU A . n 
C 3 164 ASN 164 164 164 ASN ASN A . n 
C 3 165 GLU 165 165 165 GLU GLU A . n 
C 3 166 VAL 166 166 166 VAL VAL A . n 
C 3 167 LYS 167 167 167 LYS LYS A . n 
C 3 168 LYS 168 168 168 LYS LYS A . n 
C 3 169 LEU 169 169 169 LEU LEU A . n 
C 3 170 ASP 170 170 170 ASP ASP A . n 
C 3 171 PRO 171 171 171 PRO PRO A . n 
C 3 172 GLU 172 172 172 GLU GLU A . n 
C 3 173 TYR 173 173 173 TYR TYR A . n 
C 3 174 ILE 174 174 174 ILE ILE A . n 
C 3 175 ALA 175 175 175 ALA ALA A . n 
C 3 176 THR 176 176 176 THR THR A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 CYS 178 178 178 CYS CYS A . n 
C 3 179 GLY 179 179 179 GLY GLY A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 PHE 181 181 181 PHE PHE A . n 
C 3 182 ARG 182 182 182 ARG ARG A . n 
C 3 183 ARG 183 183 183 ARG ARG A . n 
C 3 184 GLY 184 184 184 GLY GLY A . n 
C 3 185 ALA 185 185 185 ALA ALA A . n 
C 3 186 GLU 186 186 186 GLU GLU A . n 
C 3 187 SER 187 187 187 SER SER A . n 
C 3 188 SER 188 188 188 SER SER A . n 
C 3 189 GLY 189 189 189 GLY GLY A . n 
C 3 190 ASP 190 190 190 ASP ASP A . n 
C 3 191 MET 191 191 191 MET MET A . n 
C 3 192 ASP 192 192 192 ASP ASP A . n 
C 3 193 VAL 193 193 193 VAL VAL A . n 
C 3 194 LEU 194 194 194 LEU LEU A . n 
C 3 195 LEU 195 195 195 LEU LEU A . n 
C 3 196 THR 196 196 196 THR THR A . n 
C 3 197 HIS 197 197 197 HIS HIS A . n 
C 3 198 PRO 198 198 198 PRO PRO A . n 
C 3 199 ASN 199 199 199 ASN ASN A . n 
C 3 200 PHE 200 200 200 PHE PHE A . n 
C 3 201 THR 201 201 201 THR THR A . n 
C 3 202 SER 202 202 202 SER SER A . n 
C 3 203 GLU 203 203 203 GLU GLU A . n 
C 3 204 SER 204 204 204 SER SER A . n 
C 3 205 SER 205 205 205 SER SER A . n 
C 3 206 LYS 206 206 206 LYS LYS A . n 
C 3 207 GLN 207 207 207 GLN GLN A . n 
C 3 208 PRO 208 208 208 PRO PRO A . n 
C 3 209 LYS 209 209 209 LYS LYS A . n 
C 3 210 LEU 210 210 210 LEU LEU A . n 
C 3 211 LEU 211 211 211 LEU LEU A . n 
C 3 212 HIS 212 212 212 HIS HIS A . n 
C 3 213 ARG 213 213 213 ARG ARG A . n 
C 3 214 VAL 214 214 214 VAL VAL A . n 
C 3 215 VAL 215 215 215 VAL VAL A . n 
C 3 216 GLU 216 216 216 GLU GLU A . n 
C 3 217 GLN 217 217 217 GLN GLN A . n 
C 3 218 LEU 218 218 218 LEU LEU A . n 
C 3 219 GLN 219 219 219 GLN GLN A . n 
C 3 220 LYS 220 220 220 LYS LYS A . n 
C 3 221 VAL 221 221 221 VAL VAL A . n 
C 3 222 ARG 222 222 222 ARG ARG A . n 
C 3 223 PHE 223 223 223 PHE PHE A . n 
C 3 224 ILE 224 224 224 ILE ILE A . n 
C 3 225 THR 225 225 225 THR THR A . n 
C 3 226 ASP 226 226 226 ASP ASP A . n 
C 3 227 THR 227 227 227 THR THR A . n 
C 3 228 LEU 228 228 228 LEU LEU A . n 
C 3 229 SER 229 229 229 SER SER A . n 
C 3 230 LYS 230 230 230 LYS LYS A . n 
C 3 231 GLY 231 231 231 GLY GLY A . n 
C 3 232 GLU 232 232 232 GLU GLU A . n 
C 3 233 THR 233 233 233 THR THR A . n 
C 3 234 LYS 234 234 234 LYS LYS A . n 
C 3 235 PHE 235 235 235 PHE PHE A . n 
C 3 236 MET 236 236 236 MET MET A . n 
C 3 237 GLY 237 237 237 GLY GLY A . n 
C 3 238 VAL 238 238 238 VAL VAL A . n 
C 3 239 CYS 239 239 239 CYS CYS A . n 
C 3 240 GLN 240 240 240 GLN GLN A . n 
C 3 241 LEU 241 241 241 LEU LEU A . n 
C 3 242 PRO 242 242 242 PRO PRO A . n 
C 3 243 SER 243 243 243 SER SER A . n 
C 3 244 GLU 244 244 244 GLU GLU A . n 
C 3 245 ASN 245 245 245 ASN ASN A . n 
C 3 246 ASP 246 246 ?   ?   ?   A . n 
C 3 247 GLU 247 247 ?   ?   ?   A . n 
C 3 248 ASN 248 248 ?   ?   ?   A . n 
C 3 249 GLU 249 249 249 GLU GLU A . n 
C 3 250 TYR 250 250 250 TYR TYR A . n 
C 3 251 PRO 251 251 251 PRO PRO A . n 
C 3 252 HIS 252 252 252 HIS HIS A . n 
C 3 253 ARG 253 253 253 ARG ARG A . n 
C 3 254 ARG 254 254 254 ARG ARG A . n 
C 3 255 ILE 255 255 255 ILE ILE A . n 
C 3 256 ASP 256 256 256 ASP ASP A . n 
C 3 257 ILE 257 257 257 ILE ILE A . n 
C 3 258 ARG 258 258 258 ARG ARG A . n 
C 3 259 LEU 259 259 259 LEU LEU A . n 
C 3 260 ILE 260 260 260 ILE ILE A . n 
C 3 261 PRO 261 261 261 PRO PRO A . n 
C 3 262 LYS 262 262 262 LYS LYS A . n 
C 3 263 ASP 263 263 263 ASP ASP A . n 
C 3 264 GLN 264 264 264 GLN GLN A . n 
C 3 265 TYR 265 265 265 TYR TYR A . n 
C 3 266 TYR 266 266 266 TYR TYR A . n 
C 3 267 CYS 267 267 267 CYS CYS A . n 
C 3 268 GLY 268 268 268 GLY GLY A . n 
C 3 269 VAL 269 269 269 VAL VAL A . n 
C 3 270 LEU 270 270 270 LEU LEU A . n 
C 3 271 TYR 271 271 271 TYR TYR A . n 
C 3 272 PHE 272 272 272 PHE PHE A . n 
C 3 273 THR 273 273 273 THR THR A . n 
C 3 274 GLY 274 274 274 GLY GLY A . n 
C 3 275 SER 275 275 275 SER SER A . n 
C 3 276 ASP 276 276 276 ASP ASP A . n 
C 3 277 ILE 277 277 277 ILE ILE A . n 
C 3 278 PHE 278 278 278 PHE PHE A . n 
C 3 279 ASN 279 279 279 ASN ASN A . n 
C 3 280 LYS 280 280 280 LYS LYS A . n 
C 3 281 ASN 281 281 281 ASN ASN A . n 
C 3 282 MET 282 282 282 MET MET A . n 
C 3 283 ARG 283 283 283 ARG ARG A . n 
C 3 284 ALA 284 284 284 ALA ALA A . n 
C 3 285 HIS 285 285 285 HIS HIS A . n 
C 3 286 ALA 286 286 286 ALA ALA A . n 
C 3 287 LEU 287 287 287 LEU LEU A . n 
C 3 288 GLU 288 288 288 GLU GLU A . n 
C 3 289 LYS 289 289 289 LYS LYS A . n 
C 3 290 GLY 290 290 290 GLY GLY A . n 
C 3 291 PHE 291 291 291 PHE PHE A . n 
C 3 292 THR 292 292 292 THR THR A . n 
C 3 293 ILE 293 293 293 ILE ILE A . n 
C 3 294 ASN 294 294 294 ASN ASN A . n 
C 3 295 GLU 295 295 295 GLU GLU A . n 
C 3 296 TYR 296 296 296 TYR TYR A . n 
C 3 297 THR 297 297 297 THR THR A . n 
C 3 298 ILE 298 298 298 ILE ILE A . n 
C 3 299 ARG 299 299 299 ARG ARG A . n 
C 3 300 PRO 300 300 300 PRO PRO A . n 
C 3 301 LEU 301 301 301 LEU LEU A . n 
C 3 302 GLY 302 302 302 GLY GLY A . n 
C 3 303 VAL 303 303 303 VAL VAL A . n 
C 3 304 THR 304 304 304 THR THR A . n 
C 3 305 GLY 305 305 305 GLY GLY A . n 
C 3 306 VAL 306 306 306 VAL VAL A . n 
C 3 307 ALA 307 307 307 ALA ALA A . n 
C 3 308 GLY 308 308 308 GLY GLY A . n 
C 3 309 GLU 309 309 309 GLU GLU A . n 
C 3 310 PRO 310 310 310 PRO PRO A . n 
C 3 311 LEU 311 311 311 LEU LEU A . n 
C 3 312 PRO 312 312 312 PRO PRO A . n 
C 3 313 VAL 313 313 313 VAL VAL A . n 
C 3 314 ASP 314 314 314 ASP ASP A . n 
C 3 315 SER 315 315 315 SER SER A . n 
C 3 316 GLU 316 316 316 GLU GLU A . n 
C 3 317 GLN 317 317 317 GLN GLN A . n 
C 3 318 ASP 318 318 318 ASP ASP A . n 
C 3 319 ILE 319 319 319 ILE ILE A . n 
C 3 320 PHE 320 320 320 PHE PHE A . n 
C 3 321 ASP 321 321 321 ASP ASP A . n 
C 3 322 TYR 322 322 322 TYR TYR A . n 
C 3 323 ILE 323 323 323 ILE ILE A . n 
C 3 324 GLN 324 324 324 GLN GLN A . n 
C 3 325 TRP 325 325 325 TRP TRP A . n 
C 3 326 ARG 326 326 326 ARG ARG A . n 
C 3 327 TYR 327 327 327 TYR TYR A . n 
C 3 328 ARG 328 328 328 ARG ARG A . n 
C 3 329 GLU 329 329 329 GLU GLU A . n 
C 3 330 PRO 330 330 330 PRO PRO A . n 
C 3 331 LYS 331 331 331 LYS LYS A . n 
C 3 332 ASP 332 332 332 ASP ASP A . n 
C 3 333 ARG 333 333 333 ARG ARG A . n 
C 3 334 SER 334 334 334 SER SER A . n 
C 3 335 GLU 335 335 335 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1  339 339 MG  MG  A . 
E 4 MG  1  340 340 MG  MG  A . 
F 5 DCT 1  338 338 DCT DCT A . 
G 6 HOH 1  410 410 HOH HOH T . 
G 6 HOH 2  417 417 HOH HOH T . 
H 6 HOH 1  401 401 HOH HOH P . 
H 6 HOH 2  411 411 HOH HOH P . 
I 6 HOH 1  400 400 HOH HOH A . 
I 6 HOH 2  402 402 HOH HOH A . 
I 6 HOH 3  403 403 HOH HOH A . 
I 6 HOH 4  404 404 HOH HOH A . 
I 6 HOH 5  405 405 HOH HOH A . 
I 6 HOH 6  406 406 HOH HOH A . 
I 6 HOH 7  407 407 HOH HOH A . 
I 6 HOH 8  408 408 HOH HOH A . 
I 6 HOH 9  409 409 HOH HOH A . 
I 6 HOH 10 412 412 HOH HOH A . 
I 6 HOH 11 413 413 HOH HOH A . 
I 6 HOH 12 414 414 HOH HOH A . 
I 6 HOH 13 415 415 HOH HOH A . 
I 6 HOH 14 416 416 HOH HOH A . 
I 6 HOH 15 418 418 HOH HOH A . 
I 6 HOH 16 419 419 HOH HOH A . 
I 6 HOH 17 420 420 HOH HOH A . 
I 6 HOH 18 421 421 HOH HOH A . 
I 6 HOH 19 422 422 HOH HOH A . 
I 6 HOH 20 423 423 HOH HOH A . 
I 6 HOH 21 424 424 HOH HOH A . 
I 6 HOH 22 425 425 HOH HOH A . 
I 6 HOH 23 426 426 HOH HOH A . 
I 6 HOH 24 427 427 HOH HOH A . 
I 6 HOH 25 428 428 HOH HOH A . 
I 6 HOH 26 429 429 HOH HOH A . 
I 6 HOH 27 430 430 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O1A ? F DCT .   ? A DCT 338 ? 1_555 51.1  ? 
2  O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O1G ? F DCT .   ? A DCT 338 ? 1_555 75.2  ? 
3  O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O1G ? F DCT .   ? A DCT 338 ? 1_555 61.1  ? 
4  O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 71.1  ? 
5  O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 54.2  ? 
6  O1G ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 114.9 ? 
7  O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? I HOH .   ? A HOH 419 ? 1_555 122.9 ? 
8  O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? I HOH .   ? A HOH 419 ? 1_555 130.0 ? 
9  O1G ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? I HOH .   ? A HOH 419 ? 1_555 161.8 ? 
10 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? I HOH .   ? A HOH 419 ? 1_555 76.3  ? 
11 O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? C ASP 190 ? A ASP 190 ? 1_555 171.3 ? 
12 O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? C ASP 190 ? A ASP 190 ? 1_555 125.8 ? 
13 O1G ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? C ASP 190 ? A ASP 190 ? 1_555 96.2  ? 
14 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? C ASP 190 ? A ASP 190 ? 1_555 114.5 ? 
15 O   ? I HOH .   ? A HOH 419 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 O   ? C ASP 190 ? A ASP 190 ? 1_555 65.7  ? 
16 O2B ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 114.1 ? 
17 O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 63.2  ? 
18 O1G ? F DCT .   ? A DCT 338 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 79.1  ? 
19 OD2 ? C ASP 192 ? A ASP 192 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 67.1  ? 
20 O   ? I HOH .   ? A HOH 419 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 93.4  ? 
21 O   ? C ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 339 ? 1_555 OD1 ? C ASP 190 ? A ASP 190 ? 1_555 64.4  ? 
22 OD1 ? C ASP 192 ? A ASP 192 ? 1_555 MG ? E MG . ? A MG 340 ? 1_555 O1A ? F DCT .   ? A DCT 338 ? 1_555 91.6  ? 
23 OD1 ? C ASP 192 ? A ASP 192 ? 1_555 MG ? E MG . ? A MG 340 ? 1_555 OD2 ? C ASP 190 ? A ASP 190 ? 1_555 72.5  ? 
24 O1A ? F DCT .   ? A DCT 338 ? 1_555 MG ? E MG . ? A MG 340 ? 1_555 OD2 ? C ASP 190 ? A ASP 190 ? 1_555 81.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-12-14 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_entry_details.entry_id             2BPF 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;SEQUENCE ADVISORY NOTICE:
     DIFFERENCE BETWEEN SWISS-PROT AND PDB SEQUENCE.

     SWISS-PROT ENTRY NAME: DPOB_RAT

     SWISS-PROT RESIDUE      PDB SEQRES
       NAME   NUMBER         NAME  CHAIN  SEQ/INSERT CODE
       ARG    227            LEU          228

THE N-TERMINAL METHIONINE IS INCLUDED IN THE GENE SEQUENCE
EVEN THOUGH IT IS REMOVED AFTER TRANSLATION IN THE CELL;
SEE MATSUKAGE ET AL., J. BIOL. CHEM. 262, 8960, (1987).
FOR THE AMINO ACID SEQUENCE, SEE A. KUMAR ET AL., J. BIOL.
CHEM. 265, 2124, (1990).
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "O3'" T DG  4   ? ? "C3'" T DG  4   ? ? 1.272 1.419 -0.147 0.006 N 
2  1 "O3'" T DC  7   ? ? "C3'" T DC  7   ? ? 1.359 1.419 -0.060 0.006 N 
3  1 N1    T DC  9   ? ? C6    T DC  9   ? ? 1.320 1.367 -0.047 0.006 N 
4  1 "O3'" P DG  2   ? ? "C3'" P DG  2   ? ? 1.368 1.419 -0.051 0.006 N 
5  1 "O3'" P DG  3   ? ? "C3'" P DG  3   ? ? 1.372 1.419 -0.047 0.006 N 
6  1 "O3'" P DC  4   ? ? "C3'" P DC  4   ? ? 1.369 1.419 -0.050 0.006 N 
7  1 N1    P DC  6   ? ? C6    P DC  6   ? ? 1.310 1.367 -0.057 0.006 N 
8  1 N3    P DC  7   ? ? C4    P DC  7   ? ? 1.292 1.335 -0.043 0.007 N 
9  1 CD    A GLU 9   ? ? OE1   A GLU 9   ? ? 1.326 1.252 0.074  0.011 N 
10 1 CD    A GLU 21  ? ? OE1   A GLU 21  ? ? 1.320 1.252 0.068  0.011 N 
11 1 CD    A GLU 58  ? ? OE1   A GLU 58  ? ? 1.327 1.252 0.075  0.011 N 
12 1 CD    A GLU 75  ? ? OE1   A GLU 75  ? ? 1.321 1.252 0.069  0.011 N 
13 1 CD    A GLU 86  ? ? OE1   A GLU 86  ? ? 1.319 1.252 0.067  0.011 N 
14 1 CD    A GLU 144 ? ? OE2   A GLU 144 ? ? 1.323 1.252 0.071  0.011 N 
15 1 CD    A GLU 147 ? ? OE1   A GLU 147 ? ? 1.333 1.252 0.081  0.011 N 
16 1 CD    A GLU 153 ? ? OE2   A GLU 153 ? ? 1.338 1.252 0.086  0.011 N 
17 1 CD    A GLU 154 ? ? OE1   A GLU 154 ? ? 1.334 1.252 0.082  0.011 N 
18 1 CD    A GLU 165 ? ? OE1   A GLU 165 ? ? 1.328 1.252 0.076  0.011 N 
19 1 CD    A GLU 172 ? ? OE1   A GLU 172 ? ? 1.336 1.252 0.084  0.011 N 
20 1 CD    A GLU 186 ? ? OE1   A GLU 186 ? ? 1.321 1.252 0.069  0.011 N 
21 1 CD    A GLU 216 ? ? OE1   A GLU 216 ? ? 1.322 1.252 0.070  0.011 N 
22 1 CD    A GLU 232 ? ? OE2   A GLU 232 ? ? 1.333 1.252 0.081  0.011 N 
23 1 CD    A GLU 249 ? ? OE2   A GLU 249 ? ? 1.323 1.252 0.071  0.011 N 
24 1 CD    A GLU 295 ? ? OE2   A GLU 295 ? ? 1.326 1.252 0.074  0.011 N 
25 1 N     A LEU 301 ? ? CA    A LEU 301 ? ? 1.327 1.459 -0.132 0.020 N 
26 1 CD    A GLU 309 ? ? OE1   A GLU 309 ? ? 1.329 1.252 0.077  0.011 N 
27 1 CD    A GLU 329 ? ? OE1   A GLU 329 ? ? 1.319 1.252 0.067  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C8    T DG  4   ? ? N9    T DG  4   ? ? "C1'" T DG  4   ? ? 138.31 127.00 11.31  1.30 N 
2  1 C4    T DG  4   ? ? N9    T DG  4   ? ? "C1'" T DG  4   ? ? 115.00 126.50 -11.50 1.30 N 
3  1 "O5'" T DG  5   ? ? "C5'" T DG  5   ? ? "C4'" T DG  5   ? ? 104.52 109.40 -4.88  0.80 N 
4  1 "C1'" T DG  5   ? ? "O4'" T DG  5   ? ? "C4'" T DG  5   ? ? 103.14 110.10 -6.96  1.00 N 
5  1 "O4'" T DG  6   ? ? "C1'" T DG  6   ? ? N9    T DG  6   ? ? 110.33 108.30 2.03   0.30 N 
6  1 C8    T DG  6   ? ? N9    T DG  6   ? ? "C1'" T DG  6   ? ? 140.14 127.00 13.14  1.30 N 
7  1 C4    T DG  6   ? ? N9    T DG  6   ? ? "C1'" T DG  6   ? ? 114.04 126.50 -12.46 1.30 N 
8  1 C6    T DC  7   ? ? N1    T DC  7   ? ? "C1'" T DC  7   ? ? 131.13 120.80 10.33  1.20 N 
9  1 C2    T DC  7   ? ? N1    T DC  7   ? ? "C1'" T DC  7   ? ? 106.56 118.80 -12.24 1.10 N 
10 1 P     T DG  8   ? ? "O5'" T DG  8   ? ? "C5'" T DG  8   ? ? 107.17 120.90 -13.73 1.60 N 
11 1 C8    T DG  8   ? ? N9    T DG  8   ? ? "C1'" T DG  8   ? ? 155.69 127.00 28.69  1.30 N 
12 1 C4    T DG  8   ? ? N9    T DG  8   ? ? "C1'" T DG  8   ? ? 98.99  126.50 -27.51 1.30 N 
13 1 "O4'" T DC  9   ? ? "C4'" T DC  9   ? ? "C3'" T DC  9   ? ? 100.10 104.50 -4.40  0.40 N 
14 1 C6    T DC  9   ? ? N1    T DC  9   ? ? "C1'" T DC  9   ? ? 134.48 120.80 13.68  1.20 N 
15 1 C2    T DC  9   ? ? N1    T DC  9   ? ? "C1'" T DC  9   ? ? 101.94 118.80 -16.86 1.10 N 
16 1 "O4'" T DC  10  ? ? "C4'" T DC  10  ? ? "C3'" T DC  10  ? ? 101.86 104.50 -2.64  0.40 N 
17 1 "O4'" T DC  10  ? ? "C1'" T DC  10  ? ? N1    T DC  10  ? ? 102.97 108.00 -5.03  0.70 N 
18 1 C6    T DC  10  ? ? N1    T DC  10  ? ? C2    T DC  10  ? ? 123.33 120.30 3.03   0.40 N 
19 1 C6    T DC  10  ? ? N1    T DC  10  ? ? "C1'" T DC  10  ? ? 128.47 120.80 7.67   1.20 N 
20 1 C2    T DC  10  ? ? N1    T DC  10  ? ? "C1'" T DC  10  ? ? 98.76  118.80 -20.04 1.10 N 
21 1 "C3'" T DC  10  ? ? "O3'" T DC  10  ? ? P     T DG  11  ? ? 111.96 119.70 -7.74  1.20 Y 
22 1 "C3'" T DG  11  ? ? "C2'" T DG  11  ? ? "C1'" T DG  11  ? ? 96.97  102.40 -5.43  0.80 N 
23 1 "O4'" P DC  1   ? ? "C1'" P DC  1   ? ? N1    P DC  1   ? ? 110.11 108.30 1.81   0.30 N 
24 1 "O4'" P DG  2   ? ? "C1'" P DG  2   ? ? N9    P DG  2   ? ? 111.98 108.30 3.68   0.30 N 
25 1 C8    P DG  2   ? ? N9    P DG  2   ? ? "C1'" P DG  2   ? ? 113.49 127.00 -13.51 1.30 N 
26 1 P     P DG  3   ? ? "O5'" P DG  3   ? ? "C5'" P DG  3   ? ? 107.63 120.90 -13.27 1.60 N 
27 1 P     P DG  5   ? ? "O5'" P DG  5   ? ? "C5'" P DG  5   ? ? 111.16 120.90 -9.74  1.60 N 
28 1 "O4'" P DG  5   ? ? "C1'" P DG  5   ? ? "C2'" P DG  5   ? ? 98.44  105.90 -7.46  0.80 N 
29 1 "O4'" P DG  5   ? ? "C1'" P DG  5   ? ? N9    P DG  5   ? ? 111.44 108.30 3.14   0.30 N 
30 1 C8    P DG  5   ? ? N9    P DG  5   ? ? "C1'" P DG  5   ? ? 116.47 127.00 -10.53 1.30 N 
31 1 C4    P DG  5   ? ? N9    P DG  5   ? ? "C1'" P DG  5   ? ? 137.50 126.50 11.00  1.30 N 
32 1 "O4'" P DC  6   ? ? "C1'" P DC  6   ? ? N1    P DC  6   ? ? 110.39 108.30 2.09   0.30 N 
33 1 C6    P DC  6   ? ? N1    P DC  6   ? ? "C1'" P DC  6   ? ? 130.29 120.80 9.49   1.20 N 
34 1 C2    P DC  6   ? ? N1    P DC  6   ? ? "C1'" P DC  6   ? ? 108.17 118.80 -10.63 1.10 N 
35 1 "O5'" P DC  7   ? ? "C5'" P DC  7   ? ? "C4'" P DC  7   ? ? 103.78 109.40 -5.62  0.80 N 
36 1 "O4'" P DC  7   ? ? "C4'" P DC  7   ? ? "C3'" P DC  7   ? ? 101.12 104.50 -3.38  0.40 N 
37 1 "C4'" P DC  7   ? ? "C3'" P DC  7   ? ? "C2'" P DC  7   ? ? 97.81  102.20 -4.39  0.70 N 
38 1 "C3'" P DC  7   ? ? "C2'" P DC  7   ? ? "C1'" P DC  7   ? ? 96.57  102.40 -5.83  0.80 N 
39 1 C6    P DC  7   ? ? N1    P DC  7   ? ? "C1'" P DC  7   ? ? 138.82 120.80 18.02  1.20 N 
40 1 C2    P DC  7   ? ? N1    P DC  7   ? ? "C1'" P DC  7   ? ? 93.39  118.80 -25.41 1.10 N 
41 1 CB    A ASP 17  ? ? CG    A ASP 17  ? ? OD1   A ASP 17  ? ? 111.44 118.30 -6.86  0.90 N 
42 1 C     A ALA 23  ? ? N     A ASN 24  ? ? CA    A ASN 24  ? ? 105.19 121.70 -16.51 2.50 Y 
43 1 CB    A TYR 39  ? ? CG    A TYR 39  ? ? CD1   A TYR 39  ? ? 115.66 121.00 -5.34  0.60 N 
44 1 CB    A ASP 74  ? ? CG    A ASP 74  ? ? OD1   A ASP 74  ? ? 109.63 118.30 -8.67  0.90 N 
45 1 CB    A ASP 74  ? ? CG    A ASP 74  ? ? OD2   A ASP 74  ? ? 126.00 118.30 7.70   0.90 N 
46 1 CB    A ASP 92  ? ? CG    A ASP 92  ? ? OD1   A ASP 92  ? ? 112.73 118.30 -5.57  0.90 N 
47 1 CB    A ASP 116 ? ? CG    A ASP 116 ? ? OD1   A ASP 116 ? ? 112.71 118.30 -5.59  0.90 N 
48 1 CB    A ASP 130 ? ? CG    A ASP 130 ? ? OD1   A ASP 130 ? ? 112.53 118.30 -5.77  0.90 N 
49 1 NE    A ARG 137 ? ? CZ    A ARG 137 ? ? NH2   A ARG 137 ? ? 117.24 120.30 -3.06  0.50 N 
50 1 CB    A ASP 145 ? ? CG    A ASP 145 ? ? OD1   A ASP 145 ? ? 112.01 118.30 -6.29  0.90 N 
51 1 C     A ILE 150 ? ? N     A PRO 151 ? ? CD    A PRO 151 ? ? 112.58 128.40 -15.82 2.10 Y 
52 1 NE    A ARG 152 ? ? CZ    A ARG 152 ? ? NH1   A ARG 152 ? ? 123.93 120.30 3.63   0.50 N 
53 1 NE    A ARG 152 ? ? CZ    A ARG 152 ? ? NH2   A ARG 152 ? ? 117.06 120.30 -3.24  0.50 N 
54 1 CB    A ASP 160 ? ? CG    A ASP 160 ? ? OD1   A ASP 160 ? ? 111.69 118.30 -6.61  0.90 N 
55 1 CB    A ASP 170 ? ? CG    A ASP 170 ? ? OD1   A ASP 170 ? ? 108.22 118.30 -10.08 0.90 N 
56 1 CB    A ASP 170 ? ? CG    A ASP 170 ? ? OD2   A ASP 170 ? ? 124.24 118.30 5.94   0.90 N 
57 1 CB    A TYR 173 ? ? CA    A TYR 173 ? ? C     A TYR 173 ? ? 97.58  110.40 -12.82 2.00 N 
58 1 CA    A THR 176 ? ? CB    A THR 176 ? ? CG2   A THR 176 ? ? 103.22 112.40 -9.18  1.40 N 
59 1 CA    A CYS 178 ? ? CB    A CYS 178 ? ? SG    A CYS 178 ? ? 102.60 114.00 -11.40 1.80 N 
60 1 NE    A ARG 182 ? ? CZ    A ARG 182 ? ? NH1   A ARG 182 ? ? 123.35 120.30 3.05   0.50 N 
61 1 CB    A ASP 190 ? ? CG    A ASP 190 ? ? OD1   A ASP 190 ? ? 128.77 118.30 10.47  0.90 N 
62 1 CB    A ASP 190 ? ? CG    A ASP 190 ? ? OD2   A ASP 190 ? ? 108.81 118.30 -9.49  0.90 N 
63 1 CA    A THR 196 ? ? CB    A THR 196 ? ? OG1   A THR 196 ? ? 95.36  109.00 -13.64 2.10 N 
64 1 CA    A THR 196 ? ? CB    A THR 196 ? ? CG2   A THR 196 ? ? 126.36 112.40 13.96  1.40 N 
65 1 N     A LYS 234 ? ? CA    A LYS 234 ? ? CB    A LYS 234 ? ? 122.08 110.60 11.48  1.80 N 
66 1 C     A LEU 241 ? ? N     A PRO 242 ? ? CD    A PRO 242 ? ? 89.69  128.40 -38.71 2.10 Y 
67 1 CB    A ASP 256 ? ? CG    A ASP 256 ? ? OD1   A ASP 256 ? ? 108.36 118.30 -9.94  0.90 N 
68 1 CB    A ASP 256 ? ? CG    A ASP 256 ? ? OD2   A ASP 256 ? ? 127.55 118.30 9.25   0.90 N 
69 1 CA    A CYS 267 ? ? CB    A CYS 267 ? ? SG    A CYS 267 ? ? 100.41 114.00 -13.59 1.80 N 
70 1 CB    A TYR 271 ? ? CG    A TYR 271 ? ? CD2   A TYR 271 ? ? 116.94 121.00 -4.06  0.60 N 
71 1 CB    A ASP 276 ? ? CG    A ASP 276 ? ? OD2   A ASP 276 ? ? 112.89 118.30 -5.41  0.90 N 
72 1 NE    A ARG 283 ? ? CZ    A ARG 283 ? ? NH2   A ARG 283 ? ? 117.15 120.30 -3.15  0.50 N 
73 1 C     A ARG 299 ? ? N     A PRO 300 ? ? CD    A PRO 300 ? ? 109.64 128.40 -18.76 2.10 Y 
74 1 N     A LEU 301 ? ? CA    A LEU 301 ? ? CB    A LEU 301 ? ? 129.34 110.40 18.94  2.00 N 
75 1 C     A LEU 311 ? ? N     A PRO 312 ? ? CD    A PRO 312 ? ? 110.78 128.40 -17.62 2.10 Y 
76 1 CB    A ASP 314 ? ? CG    A ASP 314 ? ? OD1   A ASP 314 ? ? 124.61 118.30 6.31   0.90 N 
77 1 CB    A ASP 314 ? ? CG    A ASP 314 ? ? OD2   A ASP 314 ? ? 112.51 118.30 -5.79  0.90 N 
78 1 NE    A ARG 328 ? ? CZ    A ARG 328 ? ? NH1   A ARG 328 ? ? 125.09 120.30 4.79   0.50 N 
79 1 NE    A ARG 328 ? ? CZ    A ARG 328 ? ? NH2   A ARG 328 ? ? 116.11 120.30 -4.19  0.50 N 
80 1 CB    A ASP 332 ? ? CG    A ASP 332 ? ? OD1   A ASP 332 ? ? 110.01 118.30 -8.29  0.90 N 
81 1 CD    A ARG 333 ? ? NE    A ARG 333 ? ? CZ    A ARG 333 ? ? 114.81 123.60 -8.79  1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 10  ? ? -9.48   108.69  
2  1 LEU A 11  ? ? -44.33  -71.18  
3  1 THR A 16  ? ? -38.75  -31.58  
4  1 ASN A 28  ? ? -94.14  -63.17  
5  1 SER A 30  ? ? -139.06 -154.91 
6  1 ALA A 32  ? ? -4.87   44.06   
7  1 LYS A 54  ? ? -102.30 -70.68  
8  1 THR A 67  ? ? -17.43  -76.89  
9  1 LYS A 81  ? ? -52.45  171.96  
10 1 LEU A 82  ? ? 179.11  77.42   
11 1 ILE A 88  ? ? -21.63  -57.18  
12 1 ARG A 89  ? ? -38.46  4.92    
13 1 ASP A 91  ? ? 5.04    171.08  
14 1 ASP A 92  ? ? 73.31   -35.22  
15 1 LYS A 120 ? ? -154.80 45.38   
16 1 ASN A 164 ? ? -53.76  -79.30  
17 1 ASP A 170 ? ? -174.46 136.73  
18 1 CYS A 178 ? ? -95.94  -137.10 
19 1 SER A 202 ? ? -51.90  -1.41   
20 1 SER A 204 ? ? 153.80  -44.43  
21 1 SER A 205 ? ? 35.99   29.85   
22 1 LYS A 206 ? ? -110.60 -118.62 
23 1 GLN A 207 ? ? 24.91   57.14   
24 1 LYS A 220 ? ? -63.94  25.08   
25 1 ARG A 222 ? ? 69.93   60.38   
26 1 PHE A 223 ? ? -126.00 -62.72  
27 1 THR A 233 ? ? -137.67 -55.30  
28 1 SER A 243 ? ? -176.76 -171.33 
29 1 LYS A 262 ? ? -35.65  -29.73  
30 1 GLU A 295 ? ? -56.65  -9.92   
31 1 SER A 315 ? ? 173.59  152.64  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG T 4  ? ? 0.081 'SIDE CHAIN' 
2 1 DG T 6  ? ? 0.056 'SIDE CHAIN' 
3 1 DC T 9  ? ? 0.077 'SIDE CHAIN' 
4 1 DC T 10 ? ? 0.178 'SIDE CHAIN' 
5 1 DC P 1  ? ? 0.148 'SIDE CHAIN' 
6 1 DG P 2  ? ? 0.204 'SIDE CHAIN' 
7 1 DG P 3  ? ? 0.121 'SIDE CHAIN' 
8 1 DG P 5  ? ? 0.072 'SIDE CHAIN' 
9 1 DC P 7  ? ? 0.139 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 P DC  7   ? "O3'" ? B DC  7   "O3'" 
2  1 Y 1 A PHE 25  ? CG    ? C PHE 25  CG    
3  1 Y 1 A PHE 25  ? CD1   ? C PHE 25  CD1   
4  1 Y 1 A PHE 25  ? CD2   ? C PHE 25  CD2   
5  1 Y 1 A PHE 25  ? CE1   ? C PHE 25  CE1   
6  1 Y 1 A PHE 25  ? CE2   ? C PHE 25  CE2   
7  1 Y 1 A PHE 25  ? CZ    ? C PHE 25  CZ    
8  1 Y 1 A ASN 28  ? CG    ? C ASN 28  CG    
9  1 Y 1 A ASN 28  ? OD1   ? C ASN 28  OD1   
10 1 Y 1 A ASN 28  ? ND2   ? C ASN 28  ND2   
11 1 Y 1 A LYS 52  ? CG    ? C LYS 52  CG    
12 1 Y 1 A LYS 52  ? CD    ? C LYS 52  CD    
13 1 Y 1 A LYS 52  ? CE    ? C LYS 52  CE    
14 1 Y 1 A LYS 52  ? NZ    ? C LYS 52  NZ    
15 1 Y 1 A SER 55  ? OG    ? C SER 55  OG    
16 1 Y 1 A LYS 60  ? CG    ? C LYS 60  CG    
17 1 Y 1 A LYS 60  ? CD    ? C LYS 60  CD    
18 1 Y 1 A LYS 60  ? CE    ? C LYS 60  CE    
19 1 Y 1 A LYS 60  ? NZ    ? C LYS 60  NZ    
20 1 Y 1 A LYS 68  ? CG    ? C LYS 68  CG    
21 1 Y 1 A LYS 68  ? CD    ? C LYS 68  CD    
22 1 Y 1 A LYS 68  ? CE    ? C LYS 68  CE    
23 1 Y 1 A LYS 68  ? NZ    ? C LYS 68  NZ    
24 1 Y 1 A GLU 71  ? CG    ? C GLU 71  CG    
25 1 Y 1 A GLU 71  ? CD    ? C GLU 71  CD    
26 1 Y 1 A GLU 71  ? OE1   ? C GLU 71  OE1   
27 1 Y 1 A GLU 71  ? OE2   ? C GLU 71  OE2   
28 1 Y 1 A LYS 72  ? CG    ? C LYS 72  CG    
29 1 Y 1 A LYS 72  ? CD    ? C LYS 72  CD    
30 1 Y 1 A LYS 72  ? CE    ? C LYS 72  CE    
31 1 Y 1 A LYS 72  ? NZ    ? C LYS 72  NZ    
32 1 Y 1 A LYS 81  ? CG    ? C LYS 81  CG    
33 1 Y 1 A LYS 81  ? CD    ? C LYS 81  CD    
34 1 Y 1 A LYS 81  ? CE    ? C LYS 81  CE    
35 1 Y 1 A LYS 81  ? NZ    ? C LYS 81  NZ    
36 1 Y 1 A LEU 82  ? CG    ? C LEU 82  CG    
37 1 Y 1 A LEU 82  ? CD1   ? C LEU 82  CD1   
38 1 Y 1 A LEU 82  ? CD2   ? C LEU 82  CD2   
39 1 Y 1 A GLN 90  ? CG    ? C GLN 90  CG    
40 1 Y 1 A GLN 90  ? CD    ? C GLN 90  CD    
41 1 Y 1 A GLN 90  ? OE1   ? C GLN 90  OE1   
42 1 Y 1 A GLN 90  ? NE2   ? C GLN 90  NE2   
43 1 Y 1 A SER 109 ? OG    ? C SER 109 OG    
44 1 Y 1 A ILE 119 ? CG1   ? C ILE 119 CG1   
45 1 Y 1 A ILE 119 ? CG2   ? C ILE 119 CG2   
46 1 Y 1 A ILE 119 ? CD1   ? C ILE 119 CD1   
47 1 Y 1 A GLU 123 ? CG    ? C GLU 123 CG    
48 1 Y 1 A GLU 123 ? CD    ? C GLU 123 CD    
49 1 Y 1 A GLU 123 ? OE1   ? C GLU 123 OE1   
50 1 Y 1 A GLU 123 ? OE2   ? C GLU 123 OE2   
51 1 Y 1 A LYS 220 ? CG    ? C LYS 220 CG    
52 1 Y 1 A LYS 220 ? CD    ? C LYS 220 CD    
53 1 Y 1 A LYS 220 ? CE    ? C LYS 220 CE    
54 1 Y 1 A LYS 220 ? NZ    ? C LYS 220 NZ    
55 1 Y 1 A SER 243 ? OG    ? C SER 243 OG    
56 1 Y 1 A GLU 244 ? CG    ? C GLU 244 CG    
57 1 Y 1 A GLU 244 ? CD    ? C GLU 244 CD    
58 1 Y 1 A GLU 244 ? OE1   ? C GLU 244 OE1   
59 1 Y 1 A GLU 244 ? OE2   ? C GLU 244 OE2   
60 1 Y 1 A ASN 245 ? CG    ? C ASN 245 CG    
61 1 Y 1 A ASN 245 ? OD1   ? C ASN 245 OD1   
62 1 Y 1 A ASN 245 ? ND2   ? C ASN 245 ND2   
63 1 Y 1 A LYS 280 ? CG    ? C LYS 280 CG    
64 1 Y 1 A LYS 280 ? CD    ? C LYS 280 CD    
65 1 Y 1 A LYS 280 ? CE    ? C LYS 280 CE    
66 1 Y 1 A LYS 280 ? NZ    ? C LYS 280 NZ    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? C MET 1   
2  1 Y 1 A SER 2   ? C SER 2   
3  1 Y 1 A LYS 3   ? C LYS 3   
4  1 Y 1 A ARG 4   ? C ARG 4   
5  1 Y 1 A LYS 5   ? C LYS 5   
6  1 Y 1 A ALA 6   ? C ALA 6   
7  1 Y 1 A PRO 7   ? C PRO 7   
8  1 Y 1 A GLN 8   ? C GLN 8   
9  1 Y 1 A ASP 246 ? C ASP 246 
10 1 Y 1 A GLU 247 ? C GLU 247 
11 1 Y 1 A ASN 248 ? C ASN 248 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2BPF 'double helix'        
2BPF 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2 1_555 B DC 7 1_555 0.263  -0.010 -0.160 6.039  8.118   -2.711  1 T_DG5:DC7_P  T 5  ? P 7 ? 19 1 
1 A DG 3 1_555 B DC 6 1_555 0.109  -0.282 -0.617 -7.448 -7.673  -9.552  2 T_DG6:DC6_P  T 6  ? P 6 ? 19 1 
1 A DC 4 1_555 B DG 5 1_555 -0.226 -0.354 -0.676 -2.999 -2.384  -8.532  3 T_DC7:DG5_P  T 7  ? P 5 ? 19 1 
1 A DG 5 1_555 B DC 4 1_555 -0.222 -0.500 0.626  8.552  -8.276  -16.180 4 T_DG8:DC4_P  T 8  ? P 4 ? 19 1 
1 A DC 6 1_555 B DG 3 1_555 -1.619 -0.315 -0.323 15.392 -15.482 -5.156  5 T_DC9:DG3_P  T 9  ? P 3 ? 19 1 
1 A DC 7 1_555 B DG 2 1_555 -0.442 -0.282 -0.391 2.528  -6.454  -4.248  6 T_DC10:DG2_P T 10 ? P 2 ? 19 1 
1 A DG 8 1_555 B DC 1 1_555 -0.971 -0.549 0.874  27.338 -0.219  -5.899  7 T_DG11:DC1_P T 11 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2 1_555 B DC 7 1_555 A DG 3 1_555 B DC 6 1_555 0.370  -0.799 3.978 4.817   6.652  27.676 -3.382 0.544  3.700 13.533 -9.800 
28.846 1 TT_DG5DG6:DC6DC7_PP   T 5  ? P 7 ? T 6  ? P 6 ? 
1 A DG 3 1_555 B DC 6 1_555 A DC 4 1_555 B DG 5 1_555 -1.304 -0.676 3.264 2.615   4.194  30.992 -2.014 2.887  3.031 7.787  -4.855 
31.374 2 TT_DG6DC7:DG5DC6_PP   T 6  ? P 6 ? T 7  ? P 5 ? 
1 A DC 4 1_555 B DG 5 1_555 A DG 5 1_555 B DC 4 1_555 -0.152 0.094  3.219 -10.245 8.559  31.438 -1.198 -1.366 3.043 14.979 17.929 
34.089 3 TT_DC7DG8:DC4DG5_PP   T 7  ? P 5 ? T 8  ? P 4 ? 
1 A DG 5 1_555 B DC 4 1_555 A DC 6 1_555 B DG 3 1_555 0.026  -0.773 3.204 3.101   3.141  28.686 -2.212 0.610  3.089 6.291  -6.212 
29.017 4 TT_DG8DC9:DG3DC4_PP   T 8  ? P 4 ? T 9  ? P 3 ? 
1 A DC 6 1_555 B DG 3 1_555 A DC 7 1_555 B DG 2 1_555 -0.431 0.354  3.613 2.008   -1.682 44.083 0.644  0.780  3.576 -2.239 -2.672 
44.157 5 TT_DC9DC10:DG2DG3_PP  T 9  ? P 3 ? T 10 ? P 2 ? 
1 A DC 7 1_555 B DG 2 1_555 A DG 8 1_555 B DC 1 1_555 0.600  0.735  3.081 -14.298 3.587  30.882 0.729  -3.104 2.625 6.305  25.134 
34.143 6 TT_DC10DG11:DC1DG2_PP T 10 ? P 2 ? T 11 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                         MG  
5 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
DCT 
6 water                                   HOH 
#